5GS0H

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 3
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 116
sequence length 116
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0H00
1ORQA 2WW8A 4XI5C 2CUIA 4LLDA 1EK3A 4YEFA 4BSJA 2HVJA 5DD5L 3MRRB 3KPSA 3I75B 1T66D 3CDFA 2HVKB 1TZIB 1ZXQA 3IFNL 4NKMA 3O3EA 4YIQA 4Z7WF 2HFEA 2OJEA 1J9CT 3IU4L 5FYJU 3W11C 4UTAH 3G5VB 1H3XA 2EDJA 5T3XH 1D5IL 3W0WA 1JFQH 4EDWL 4EDXA 2OXHA 3V5KB 3SDCD 3AS0A 1TVHA 1XF5B 1MCOL 1MQ8A 4X5WB 2Q7YA 1MPAH 3K81A 1ZLSL 3IDIB 4I9WD 4S1QH 1AR1D 2NXZC 1CCZA 3QO1B 4HCRL 4R90L 4X99B 2WQRA 5AZEH 4LKXA 4FZ8H 1YY8A 3C60B 4WTXA 5K9OB 5I76A 4JFDB 1UB6A 4QWWD 1TQBC 4PJCA 5GGTH 4DAGL 5IG7B 1C08A 3AXLB 1YYML 1LK3H 5GRVL 1EEZB 2QR0B 2CDEB 5CAYB 3L3DB 1BP3B 4YLQT 5B39G 5I1JL 4Y19D 5GJTL 1W2KT 5H94B 4XBEH 1HYRC 3HC0A 4POZC 5HPMA 1NGPH 4HHAA 2BVQB 2OI9C 2F8VA 1B6DA 1U8LA 3E6FA 1IQWH 1QSEB 5F71A 1G7MB 1U8JB 2FGWL 2CJUL 2HG5A 1CDUA 2R4RL 4K7PX 1Z2KA 3H42H 5JPNA 4RAHA 4OLVL 1GAFL 3IDXH 3DJ9A 4FQXC 1WZKA 3WYRA 1MIEL 5CD3A 2HT4C 1FZOA 3ARBC 4GQ9H 5FV2A 2ZP0T 3UPAA 1A7OL 4PRIE 2W92A 4Q9QH 1Z9SA 3ZLQC 4OFPA 4P2QB 1NDMB 1RHHA 5TFSL 2G9HA 4OF3A 3QIWD 5HVWA 1BQUA 4G8FB 1C1EH 4H8WL 1OOAA 3MUGA 3FCTB 4PB0H 5MENB 3KAAA 1UCBH 1WSST 4ELME 3DX9B 4LCYB 3RVXD 4RGMC 3BP4B 3CZFB 4ODTH 1GSMA 2DM7A 4M1DH 3PG2A 4HGWB 4PJEA 3MROB 3DX7A 1MHEA 4HMEA 3QUYD 1BHGA 1I75A 2F8OA 3RVTD 2AJYH 3V7MA 4NUJA 5EPMA 4FMKA 5EO0B 2J5LC 3DIFB 3RPIB 3I02A 5IV2B 4MD0A 2CSPA 3QDME 4MAYC 1MCQA 5IFJA 5ALBL 2B5IB 3D1MC 3N1PC 5CFHA 1BM3L 5IMMA 4OKVB 4X4ME 5IVZB 5L6YH 3M45A 3LQMA 3OAYH 4DTGH 2JB6A 3P4OB 3BGMB 5DS8B 4Y8DC 1WK0A 3CSBA 2P43B 4GKOA 5HHOA 3CVIL 1VACA 2HT2D 5I66A 1G9EA 2AV7B 5DJAB 1MCSA 3P4NA 5LCVL 3KPLA 3CUPB 3RWDB 1ZEAL 3MLXH 5DI8B 3SY0A 1FRGH 1MFDL 1JYWA 3ARDB 3MCLL 4JM4L 4AENB 3HC4L 4P57B 5HHQB 1EIBA 2F53D 1GGIH 4Y2DD 2H32H 1Q1JL 4OJFH 4XPFH 5CILL 3RHWK 1J86A 1MVFA 1NCDL 3F7YB 3VFUB 3ULUE 1CZ8L 3KWWB 4XCYA 2XZCH 5INDB 4HC1A 3MV11 2DLGA 3STZB 1M6OA 3D2UA 4R7NA 5DHVA 4ONGH 3UJJL 1MHPH 4ODUB 2X89D 5L2JA 2BDNL 4WUKH 3DETD 4JG0L 1KPRB 1RZKL 1U58A 3FFCD 3QDAA 2DQUL 3GSRB 4CVXA 4YX2L 1MJ8L 2R0KH 5IBLC 1M05A 4I5BA 5BRZA 1F3DH 1AGEB 4PR5B 2E7LC 4MA1B 3Q1SL 2FB4H 2A9NL 3LKPA 4EEEA 1ZVSB 4APQB 4Z7NF 5HVHB 3EYQC 5B38A 3CK0L 2BJML 5BS0B 3GI8L 4G6ML 2EE6A 2ZKHL 5D7LB 1DUZB 1WFOA 3BQUA 5I15L 3LCYA 5SWZA 3KYMA 5HHMB 3U0WL 3HZVA 5DC9B 3ARFD 1J1OL 2EE2A 3UJIH 3GIZL 1J10A 4O5LH 1ZT4A 2X4RB 3OKLA 5CLTA 4TVPL 1W72B 3EO9L 3QI9A 3PWPB 4IRSB 1F6AB 3ARED 3D0LB 3CXHK 3REVB 1FNHA 2OK0H 3IFOB 3IRZA 5D2LF 1H8OA 5E56A 1ITCA 2GK0B 5JNYB 5GJSH 4K8RH 3V9FA 5GS0L 1K6QL 1NBYA 2BNUA 5HI4C 3O11B 4HBCH 2NY2B 3RTQD 1YEKH 5KTEL 4XPBL 2Y6SC 2DJUA 4DJMA 1ZHNA 2PTTB 2P1YA 2RGSA 4XPAL 5GRUL 4BZ2H 2D2OA 4JO4L 2YKLH 3PP4H 4Z18A 4P48A 5EZOL 1A6AB 3KPQB 3UYRH 3C6LD 2DQFA 4DGYH 2YN3A 3G6JA 1KIRA 5DJDB 2HLFD 2VKXA 2VNCA 4OZGE 3MRHA 5JZ7D 3LIZL 4JPVH 1DE4A 4C4KT 3FHQA 2CO6B 2X4QB 1FJ1B 2ZOLA 4JB9H 5D96B 1IT9H 1KJMB 3PL6D 3IETB 3T0EB 1UZ6E 2UYLB 4L8DA 1YEDA 4JFEE 3KNBA 5MHSE 3P77A 3SEPA 4IDLA 4OCXL 4G6JL 4DFIA 1RIUH 4MHHI 3LKSA 4UQ3B 4ELKB 2BNRD 4M1GL 2DLIA 4UINL 5D72L 3P4MB 5I17B 2BSSA 4ZDHB 5E5UB 2D31B 5T5NF 4OLWH 1MCPL 4KUZH 4JFZL 4MNGA 5K9JH 1OTUD 2H2PD 1P84K 2EDLA 6FABH 1TVDA 2O26U 2Q7NA 4NBZB 3MRIB 1C5BH 3OR7B 4WNQA 2GUOA 2CQVA 4HFUL 5DSCB 4HGMA 4HS3B 3IDJB 4NDMA 3MXWH 1JTPA 4E41A 3BW9A 3W9EA 3SE8H 4JKPL 3CFCL 1D6EA 4FFZH 3UCRA 5F9JB 1JPTH 2R0WL 3IVKB 3CVHB 3TO2B 3E8UH 3KR3H 3KYOA 2NXZB 1IM9D 3KGRA 3SGKC 4PJDF 3RP1A 1OT1A 4ZO7A 4JAMA 1YJDC 1JZ8A 1RFDH 3PIQA 3IAPA 4MLIA 3NAAH 2B4CH 4JFFE 5F1NB 1T4KB 5LG1A 1TQBB 3VGDA 3M8OL 1IAIH 4KTEL 4E0RA 2ICWJ 5FHBL 4ZPTB 1ZHBB 2LU7A 4FXKA 1H3PL 4OCRL 4QYOB 3GNML 4GLRH 3O3BB 4U0QB 3JV4B 4OZFG 4U6TA 2OI9B 5KSVA 4TSAH 4HT1L 4XRCA 1MCBA 3BDYH 2IGFH 5IWLA 1FAIL 4UUJB 5F96L 5TE6L 5EUOA 4H25B 3SDDA 4M7ZB 5DR5L 4LPYA 1CT8A 2GY7B 3L3HA 1ZGLM 1V7NH 5KG9B 3HUJF 1CIUA 2L7UA 2JK5B 4OFVA 5GRZA 3QFJB 4XHQA 3FB7B 2QQKH 3QG6A 3VXME 4FQCH 4KKAD 4LL9A 1DUYA 2ED9A 2NY5C 2Y1VA 2XA8H 2EEAA 3MMEA 3LS4L 4N0UA 1FVEA 4RFEA 3BQUC 1TVBB 4WWKB 1D5ZA 3S34H 2CRIA 4JFOB 1IGFL 2D7TH 1J87A 1JBJA 1CLCA 4YFEA 1IMHC 4BKLB 5I1DA 1AGDA 3QI9C 1QOKA 5HYSA 4JLRB 1LMKA 1YYLL 4WHTA 4BZ1L 3JV0A 3BXNB 5EU4A 4KZDH 3JVGA 4LSRH 5DRZB 2X4UB 3MLYH 1IM3B 4IRZL 4UQ2B 4YHML 5GS3A 3SDCA 4MAYB 2ADIA 5J6GA 1LQSR 1T83C 5C0AB 4HZAA 3LN5A 5D6DA 2AGJL 5I1LB 1TTGA 2ZCKL 3GBLA 2NW2B 1PBYA 1QFPA 5B22A 3BT2H 1N5YH 4LIQL 3ZDYE 2OTWA 5C0AE 3BX7C 3EDDA 2ADGA 3CDGB 5EN2B 1XR9B 3OPZH 2AEWA 4CJ0A 1QSFE 1MNUH 5SX4I 4K23L 4KMTL 2EDOA 1FLTX 2EXYC 2QSQA 4GOSA 1MRCH 3FTGA 1C12B 4K7PY 4Y19A 5L9DH 5J57B 3CPLB 4KAQL 1LVEA 3L7EB 1HHKA 1CBVL 1ZT1A 5IEKB 1II4E 1RIVL 1N6QH 2Z0BA 5CBAB 3K8LA 4WI7A 3BP7A 3UYOD 1LD9A 2CRMA 1CU4H 3ULUH 5JORB 5CEYB 1QSVA 1OSZB 5DUMH 4MJ4A 5AAMA 5B3JF 5HYEA 2VXQL 4LLDB 1SHMA 2HVJB 4DN3H 1KACB 5F9OH 3ILPA 3KPSB 1DQMH 2FD6H 2R2BA 4L8SA 4L4VD 4NNYA 3TBVA 2CDFA 3BAEH 1Y6MR 4NKMB 25C8H 2R29H 3QQ9D 1WGOA 3O3EB 3O8XD 4P0DA 4YIQB 2HFEB 2OJEB 4GAGH 1R3HA 3QIWA 1JPSH 5B4MD 3I85A 3VMOA 4L8CA 1FH5L 3W0WB 4EDXB 3WIHL 1TVHB 4ERSL 2Q7YB 2IMNA 1IC7L 3UTSE 5JHLL 5DC4B 5SX5H 2ZG1A 3VFTA 2YOCA 3B2VH 1B90A 3UDWA 3IFLL 1MWAA 3QUYA 4CGTA 4CAGA 3LSOB 4I77L 3SHSA 4QEGA 4LKXB 4S1RH 1JWUA 1YY8B 4HEPG 2V17L 3VA6A 3TBYA 4PG2A 5I76B 1UB6B 1CGWA 3MV7E 3VWJD 4PJCB 3STLA 1C08B 4I13B 4X8JA 4HBQA 2QSCH 1QFUH 4OBSA 1MFNA 1R3JA 3DNKA 4ODBD 2VH5H 5C2UB 1AI1H 4PJFF 1QKZH 4BH8A 3HC0B 4ORZC 4PJ7F 2ICCA 5HPMB 4D2NA 5I1KH 1G0YR 4HHAB 5IUSA 1AC6A 1W8NA 1F42A 1U8LB 3E6FB 4U05A 4NPYA 3O41A 1FDLH 2HG5B 2YMXH 4BYHA 1G9NL 4RRPA 5JPNB 4LSTH 1NAML 3NOIA 2X09A 1VERA 5CD3B 2GKIA 4TPRL 3NTCL 1NAKL 2F5AH 1FZOB 2AQ3A 5KZCB 5IGXH 3MXVH 2QQLL 2PR4H 3WXVH 1QHPA 1CIDA 2F53A 4OLZL 3ZTJH 1RHHB 4Y2DA 1W0VA 2G9HB 3V7AG 1IC5H 1ZTXL 2DKSA 4ZS6D 5FYJL 3MUGB 2NY6D 3H6JA 4KRNA 2IBBA 1UXWA 3LPFA 2ZJSL 3UEZA 1O7VA 2X89A 4X7EC 3AY4A 1FG2A 5BO1H 2B1AL 1VGKA 1Y6KR 2JF1A 3FFCA 4PJEB 2NW3A 3DX7B 5KBNC 4OD3L 1MHEB 4F7TA 4LAJH 1Q0YL 4UB0L 1A47A 1A3RL 2R4SH 3JV5A 1OAKH 3IXTA 4QTIH 5EPMB 1RJCA 3JVGC 3R1GL 3WHXA 5I1IL 4PJEE 3SE3C 3I02B 4MD0B 3OAYK 1IAMA 3IDYB 1C5DA 1F8TH 3SDCC 1J0HA 2CH8A 1TNNA 5C0BE 3BWAA 1AXTL 1UGNA 4ZUTA 2XV6B 5IMMB 5D6DC 3O9WD 2KUTA 4Q74A 1AR1C 3MC0A 2JB6B 1UZ8A 4ZTOH 5JIIA 1F4WL 3RUGF 5HHOB 1HQRA 4QWWC 3AREA 1UH3A 2AVGA 5I66B 3P4NB 2VXVL 3KPLB 3CVHH 3SY0B 5EOCJ 3HR5A 4PJ9C 3QDJD 4MJ6A 1OLZA 2YUVA 4AYFA 5ERWA 2HFGL 1VEOA 1NGWA 5KOVC 5L8KB 2DI7A 3QHZH 3T0WA 1I9JH 3RTQA 2YHGA 1M7IA 2C7UA 3WSQH 1D5MA 2G75A 4L3EE 3BJLA 2AI0H 3PGFH 1HXYA 2EO1A 4XCYB 3C5JA 2BHYA 4XP6H 4BK4A 1BBJA 4NO0D 3RAJL 1M6OB 3D2UB 4R7NB 5DHVB 2YPLE 3C6LA 4G80A 4CRPA 4R8WL 1AD9A 3J7HA 5L2JB 2FHFA 2NY1D 4L8SC 1U58B 3C09B 4CVXB 5A3ID 1T89A 4HJ0C 1M05B 4I5BB 2H1PL 4OFYD 4LF3B 5BRZB 3QIWC 2XRAL 1DQDL 3PL6A 2OL3H 4WEUD 3LKPB 4I3GA 3T8XA 3V6ZA 5B38B 1U41A 1GC1L 2I60L 5A2LH 1ORSB 3MRJA 4F8TA 5DMGC 1JZ6A 3BQUB 4WGVB 4DN4H 4MVBC 4L4TE 1MCKA 5SWZB 3HNSL 3KYMB 3F65A 2BNRA 3QEGL 4N0YH 3QCTL 3RKDC 1ZT4B 4JJHA 3QUYC 3OKLB 4GMTL 3QI9B 4PG2C 2WV3A 5C0GA 3BN9D 1DFBL 2JB5L 1LEKA 3S3JA 1AJ7H 3MLSL 1T0NB 2W0FA 3GMNA 3V79C 1Y6NR 2A6DA 2XZAL 3M17A 3VFRA 2VJXA 1GGCH 2E27H 4ELMF 2IFGA 4K3HA 4LQ1A 3VXUE 1NBYB 2BNUB 1H3WM 1GPOH 3EJZD 4LGPB 4XZUA 3WUWA 3STBA 1MCIA 5I1AA 1ZHNB 4G5ZH 4GKNA 5CCKL 2HFFA 4MMZC 3NN8A 1IM9A 1YEEL 1T1WA 2HT2C 3FT2A 3NCYP 5FM5O 4X8XA 2EH7H 1Q72H 1IL1A 3CFBA 2DQFB 2YZ1A 3MUY1 3U0TA 3P9LA 4XNQA 3G6JB 3KYKH 2Q20A 4GMSH 5EC1A 1DBJH 5MEOA 3PWNA 3MRHB 5CGYD 5DHYA 3GKZA 3K8MA 1DE4B 4YZFE 5DTFA 3MTRA 5L7XH 1ITBB 1FYHB 2W65A 2XA3A 1OSPH 5F7UA 5HDQL 2ZOLB 3DMMD 5DZNA 4HWBL 4L8DB 1FNLA 1YEDB 2R1YA 3F7VB 1P6FA 3KNBB 3OXSA 4O2CA 3P77B 5FUCE 2FBJL 1NLBH 1YEGH 1NMCC 3K3QA 5AWNH 5IMKA 3GM8A 3LKSB 3SKJL 2QSTA 2I5YH 3DETC 4G7YH 3KPPA 2X44D 4ODSH 4A6YA 1VFBA 2CLVA 1RJZA 4X6FA 2BSSB 1YNKH 1MI5E 4S0SD 2VC2H 4MNGB 2AXHA 5JHDE 2RIKA 1E4XH 3NCEB 2VLME 3ULUF 2IPKA 3V8CA 4JVPA 1DTUA 4WNQB 3MLZH 2GUOB 3OKNA 3U7YH 2NY7H 4IOFD 4NDMB 2EDBA 1RIHH 4O2FA 4MWFA 4E41B 3BW9B 3W9EB 5EZIL 1D6EB 4KMQA 3X3FL 3GSXA 4QRRD 1LEIA 5IB3A 3O3AA 4XMKL 1NGQL 3KYOB 4XCNA 3AREC 2FLBT 5IW6A 1KPUA 1O7SA 4JAMB 5I0ZA 2PXYD 3PIQB 3WFDL 5EIQA 4TTGA 3VXRE 4ZSOA 3TBSA 4E0RB 4O2EA 3RZCC 5T1MA 1MREH 1VKXA 3KPOA 3RTQC 4FXKB 1EAPA 1H8SA 4FP8L 3RKPA 2ADJA 2HWZL 3SOBL 4XX1G 1SBSH 1BFSA 2A1WL 5L8JB 2BFVH 3MRPA 5KSVB 5D2NA 4XRCB 4FFWD 3QQ4A 3BKCH 3GO1H 5FV1L 5C6PB 4HUNB 3WS6A 1R3IL 5EUOB 4MNQD 3SDDB 4TNWF 5JZ7C 3QXUA 1YNTA 2N4IA 1T2JA 2PTVA 5IMOA 1CT8B 3L3HB 2A73A 1T89C 4X7SL 1RUQL 2H8PA 1P69B 3BZFA 4I48A 3QCUH 3PL6C 1AO7B 1RUPL 1T1YA 3QG6B 1RZFL 3HA0A 4NN5C 4TSBL 1DUYB 4RFOH 2L4OA 3DV4A 4KUCF 3UJTH 4N0UB 1FVEB 5I8KH 4RFEB 1AO7E 1D5ZB 2IMMA 2Q8AH 5C08E 1VEPA 1ZA6A 5KSBE 4KZEL 1RURL 1HSBA 4F9PC 5MP6H 4XMLL 2YD5A 5I1DB 1AGDB 2B2XL 3BGFC 4OZGF 3O3DA 4L4VA 4OLYL 1SM3H 4RFNC 1Z3GL 1OAQH 1MJ7H 5HYSB 4F37K 2VO5A 3O8XA 4WHTB 4YHKL 1HINL 3NGBC 3X17A 1T7XA 1OTUC 3U7WL 1P4IH 4F7MA 2H2PC 3BEWA 4OLXL 5EU4B 1UZ6F 3D3VD 3MNZA 1DQTA 2I07A 3DGCR 1FPTL 3UX9B 3ZT5A 1EZVX 3QT2A 1MCHA 2X6MA 3SDCB 2ADIB 5BMFH 5J6GB 3G6AA 4P5TC 4RDQG 3LN5B 1DQLH 2P44B 1KC5L 1CE1L 1UA6H 3D39D 3ZL4L 3DGGA 4LHUD 4PJAA 2CK0H 2OTWB 4TUOA 1RY7B 2ADGB 1ZT7A 5GGVY 1TMCB 3VWJA 1U3HD 4KROD 4OI8A 3OJVC 1L9NA 2J88L 4PJGA 3DSFH 4EUPA 4K2UL 4I18C 4QXGH 4NNPH 4Y19B 3FTGB 2NY0C 4ONFL 1HHKB 1WWBX 1ZT1B 1P9MC 2UVFA 5TPWL 4MXQC 4JO3H 4PUBL 4QHNA 4LLAA 4HF5L 5T1LD 5KS9A 3BP7B 1LD9B 1RUAL 5L8LB 4ODHH 1CD8A 5AYUH 2J8UE 1MIML 1ZS8A 1B4RA 4RMSA 4JFYA 5AUMA 3ILPB 4XNUL 4HGKC 1E4JA 2R2BB 1J11A 3DI3B 4HC1H 4B50A 4L8SB 4NNYB 3TBVB 1KFAL 2N7BA 2CDFB 4P2CG 2AQ2A 5DHVH 5LQBL 4UIMA 5AEAA 3DYMA 4KKAC 1R3HB 3QIWB 2O5ZL 4MZ2A 3B4NA 1R5WA 1FFOA 3EDFA 4L8CB 3DUUA 3CDCA 4MS8D 1MAML 3KJ4C 1EFXD 3I2CH 4LBEA 4JY4A 3G5YA 2Z8RA 1FNSL 3VRIA 1A64A 5I1GH 2PN5A 3GBNL 1AGCA 1YPZE 4UT7L 5CKAA 3VFTB 1I1FB 4Y4FD 3QUYB 1MWAB 4M6AA 2QADD 2FDBP 5B21A 2H45A 3QFDA 4X9FA 1AQKH 1IKNA 1JWUB 4Z7VB 5GGRB 3TBYB 3LH2H 5F72S 3CLEL 4O9HH 3STLB 3ECBA 1BEYH 4X8JB 3GIVA 4ZYKA 1TJGL 4OLUL 5I74C 1R3JB 2VZ1A 4Z7VE 5BJTA 4JCLA 1OAUL 4BH8B 1MCCA 3O9WA 5T1KD 1BFTA 1DCLA 4WU5A 4ACPA 1YNLL 3T4AA 4NPYB 3O41B 5HXMA 1J1PH 1WJ3A 1KCSH 2A38A 5D71H 2DQCH 3WS6C 4JCMA 1CLYH 3GSWA 5FM8A 1GVIA 2ATPA 1N2RB 3QDJA 3Q6FA 2V2WA 3QA3A 4E5XA 4PS4L 1CF8L 3TNMA 1IILE 5L2KE 4HSQA 4U1JA 5IMLA 2F53B 4Y2DB 1W0VB 1KJ3L 2K7PA 3W5NA 4WW2F 5TF1H 3ZDYF 4LSVL 4NO0A 1UXWB 2H41A 3C2AH 2MQ0A 5D1QC 1IBGH 1MFAL 1NMCB 2HJLA 5GGQH 3VGHA 4XNXL 2OMNA 1FG2B 4HH9A 1MY5A 3WFEL 1PW3A 1VGKB 4Z76A 1OD7A 3FFCB 2NW3B 1QVOA 3QQ9C 3O8XC 3T2OA 3LEVL 4F7TB 5F9AC 4KKNA 4OFYA 3S37H 4Q9CA 3S4SG 3IXTB 2AP2A 3WHXB 4XP4L 2APFA 5EUKA 1RZKC 4MA3A 2BNQD 1T21A 4KY1H 1C5DB 3ZKND 3BWAB 4ZUTB 3GMOA 4AG4H 4POUB 3ARFB 4G3YH 4TSCL 4WI3A 1RZ8A 1UZ8B 1PLGH 1HQRB 3EYVA 3VWJC 4Y4KD 3AREB 2OZ4L 1QPPA 3QHTC 4B7LA 3JXAA 2PETA 3RIFF 4ZUVB 1B2WL 1I9IH 5DT1L 3HR5B 4Y5XC 15C8H 5SWSD 4MJ6B 4G7VL 5DJ8A 5ERWB 1XGPA 3F58L 5CIPA 1IEHA 1NGWB 1ADQL 5JOPD 1J8HD 5C71A 3EOYG 1QBLH 5DQDH 3RTQB 1M7DA 5C7XH 4Z7QE 3R8QA 1O5DT 2W0LA 1I3UA 1M7IB 5JW4N 2C7UB 4OZHA 5FDYA 1D5MB 2G75B 4RWHA 1HXYB 1I8LC 3C5JB 1BBJB 1FFQA 5GS0C 2YUZA 1UWEH 1INQA 3O2VH 3C6LB 4G80B 3HRZA 1UCTA 4UTAL 1HEZA 1AD9B 1LDPH 4NWUH 3AROA 1JFQL 5CJQH 2F54D 5D70L 3ZYJA 1MPAL 1L7TH 3V2AR 3DMMA 3PL6B 4XTRD 4ZS6C 4M6NH 3UAJD 1X5IA 4YXLH 4AT6A 4S1QL 3T8XB 1IGIL 4TTDC 3ZT7A 3V6ZB 3MRJB 3I84A 4QXWA 1U3JA 2XTLA 3ZDXE 5GGTL 4GG8A 3OL2A 1CD9B 2BNRB 2VXUH 4ONHA 4NZUH 2WP3O 3PUCA 3BGFB 2RHEA 4QRUA 1IKNC 4XBEL 3KLHD 4RFNB 1EX0A 2YR3A 5ID1A 3LPGA 3DVNB 5C0GB 5HYJD 3TO4D 5HBBA 1NGPL 2YWZA 4HX1A 4YUEL 1FN4A 2W0FB 3GMNB 4LGSB 1IQWL 3F8UB 3SKNA 2A6DB 3M17B 3VFRB 5D6CA 1J88A 4F8QA 3H42L 3O9WC 1RVFL 1KCVH 4NQED 1H3TA 4XZUB 3WUWB 1N4XL 4IIQC 4WTZG 5I1AB 4FG6D 1Y18A 4QRRA 1K2DA 4GQ9L 4GKNB 2DM4A 2HFFB 5J89A 3NN8B 1IM9B 4Q9QL 1T1WB 3FT2B 3H9SD 4UNVA 2VITA 2PXYA 1IL1B 3CFBB 3O6ML 1P7HL 5DD3H 4YPJA 3U0TB 3P9LB 4XNQB 2ICES 2ILLA 4JPIA 5EC1B 5MEOB 2LU4A 3PWNB 5FYLD 2WAHA 5DHYB 1QNZH 1UCBL 4XT1C 5J13C 5KJRH 1EPFA 5DTFB 1AH1A 3HE6D 2R23A 5I18H 2W65B 3WL9A 4WI6A 4ODTL 1HYSC 1ZOXA 4M1DL 1RPQA 2C4XA 2IQ9H 2R1YB 3OXSB 4O2CB 2CMRL 3EFFA 1H3UA 1FZKA 4FQ2H 2AJYL 3O4LD 4LFHG 4U1MA 5IMKB 3MJ9H 5E8NA 2CUMA 4ZS7H 4MNQA 2B20A 4X7TA 2NY1C 1DANU 4IHOA 3KPPB 1CXLA 4A6YB 1VFBB 1OARH 5A3IC 2AJZA 1GGUA 2CLVB 1RJZB 4ZFZA 1FGNH 4P3DA 3T2NH 5L6YL 2VDKH 3BRDA 3MRBA 4DTGL 1SVCP 3WFCH 2IPKB 4HWZA 2VLJD 2BSED 4PB9L 3QJHA 5F1KC 2FWOA 3OKNB 1NCTA 4L5FH 4RMUA 2PYEE 1H8NA 4O2FB 3KJ4B 4MWFB 3QQ3A 4JHZA 3MRCA 4XVSH 5KANI 2R2EA 4MXVE 5EIIA 1EZVY 3GSXB 5BZDA 1LEIB 4GUPA 5IB3B 2ED8A 3O3AB 4WHCA 3U7AA 4YDIL 4PRAA 2ESVE 4XCNB 2VN7A 3BN9C 1W8OA 2DD8H 5EO1A 5IW6B 1KPUB 4IRJC 3HZKA 1GGIL 4D3CL 3D3VA 4OT1H 4OJFL 4JDTL 1YN6A 4U6HB 4JZNA 4ZSOB 3TBSB 4O2EB 1QTYT 5T1MB 4NM4L 2B7DT 4J23A 3BZDA 1VKXB 1YDPA 3MPCA 1CLZH 4ONGL 5F7NC 3KPOB 2LVCA 1MHPL 3RY4A 1EAPB 1L6ZA 2ADJB 4P2OC 1WVZA 4WUKL 2NX5E 5DYOA 3D39A 3MRPB 5T5FL 4X4ZA 2CRYA 4LHUA 5D2NB 3W2DH 3QQ4B 4BQ8A 4GW1A 3GJEA 5KVFH 3MBED 1U3HA 1KULA 4LLUA 4NJ9H 5E1AA 4YHOL 1AC0A 2FB4L 5IB4A 4MLSA 4NJAL 5CGYC 1YNTB 5IMOB 2A73B 1FYTD 3ISWA 4ODVH 3HI5L 3TZVD 2H8PB 3NFSH 2EDTA 2WIIA 3BZFB 4I48B 4UV4L 3DMMC 3EZJB 5AYQA 4KKCC 1J8KA 1EO8H 1T1YB 4O5LL 2IG2H 2H6PA 5T1LA 3DV4B 4MDIA 2W9DH 4I3RH 4KDVA 2I9TA 1CR9L 1NANI 1ZA6B 3HN3A 1S9WA 2VLKD 2OK0L 3T1FB 4Z8FH 1U95A 4OV6F 1HSBB 3X12A 1KF9B 2FJGB 3O3DB 4L4VB 1BF8A 1YEHL 5GJSL 3EYSH 4K8RL 4YZFF 3O8XB 1NDGA 4HBCL 1MFBL 4LLVA 4F7MB 3BEWB 4L9LC 3JSSA 1T22A 3QZWA 4BZ2L 3UZQA 1OWWA 2I07B 3LQAH 4IOFC 2UWEE 3PP4L 3QPXL 4X0KA 5HI5D 1EFXA 4QRPE 3G6AB 1P2CA 4DGYL 1JJUA 2NNAA 5CGTA 4GQPH 1CD1A 5DZOA 3HMXA 4HLJA 4Y4FA 3DGGB 3BFOA 4O51A 4P4RA 5CP7A 4PJAB 5DC0A 5E8DL 4KVCH 4TUOB 1ZHKA 4JPVL 4ZXBD 2PXYC 4XC3L 1ZT7B 3ETBF 4WY7H 3VWJB 3Q2CA 4JB9L 1IT9L 2EDRA 3R4DA 5FCUH 4PJGB 3NCJL 4NO5A 4EUPB 4PP1C 2V9QA 3QDGD 3EHBD 1QQDA 2NXYC 2V5YA 3INUL 5T1KA 4EBQH 1RIUL 4NIKB 4PJGE 5FGBC 4ODWB 4LEOA 1J0IA 4S1DC 2YN5A 4QHNB 4FFWC 5KS9B 3A6CH 1R5VA 1T0MA 3CLFH 4MJIE 4OLWL 4KUZL 2P47B 1HKLL 5K9JL 3TYGH 1ZS8B 6FABL 3AFLA 4JFYB 4UU9A 1C5BL 4MCYA 1ERNA 2G60H 3HS0A 5AZ2L 2ZCLL 3QDHA 3MXWL 2F74A 4UIMB 3SE8L 2HFTA 4P59H 4WHDA 4I0CC 1RK0A 4FFZL 4GW5A 1JPTL 1PKQA 5EOQL 1R5WB 5K33A 1QHOA 1FFOB 1CGSL 5T3XD 5FHAH 3DUUB 1E6JH 2NY6B 1OGAE 3VWKD 5A1AA 3U36A 5FYKE 4LBEB 1RFDL 3G5YB 4JY4B 4LARL 4RCAA 3NAAL 2B4CL 1A8JH 3VRIB 1T6WA 2D4FA 1AGCB 1IAIL 1EJOH 3GSNA 3MACL 1CN4A 2ZUXA 5ISZD 1NFIA 3QFDB 3VG0H 4WHYG 1L0YA 4WV1C 1UENA 5EH1A 3SJVD 5DFTA 5FO7A 3ECBB 3GIVB 2P5WE 4ZYKB 2BNQA 1MQKH 3BDYL 5D7IE 1H3VA 5BJTB 2DRUA 5HHNA 2IGFL 2BVYA 5KSBF 3O9WB 1JVKA 2I25N 4WU5B 5DRXA 3T4AB 1NFDE 4WI8A 1WTLA 2V9TA 1F6FB 2E8YA 1WQVT 2IJ0C 1BFVH 1YEJH 1YZZA 1RUMH 2XPGA 5IVXA 1HDMA 3BMVA 4JQVA 1J0KA 4Y4KA 1U3HC 4K3DH 2QQKL 4BSVA 4FQCL 2VWEC 1BJ8A 2PNDA 3GSWB 5F89A 4PP2A 1OW0A 5SWSA 2ATPB 2OSLA 3KPRD 3QDJB 1KXTB 2GJ6D 3Q6FB 1JZ3A 2V2WB 3QA3B 3X3GH 3S34L 4E5XB 2O93L 3TNMB 3ZTNL 3GHEH 1J8HA 3C9NA 4U1JB 2FSEA 2D7TL 3EDEA 1VA9A 5IMLB 2JCCE 2DMBA 4Z7WA 5J1SC 1G9MH 4HK3N 3L5HA 3FZUD 1N0XL 1V8HA 3VU2A 3ZE1E 4NO0B 1CYGA 1U8MA 1CXIA 5D1ZD 4G9DB 1DEEA 2HJLB 1Q9LA 2VXSH 3P9MA 4HH9B 1A7QH 3MLYL 3MJ7A 4Z76B 2F54A 1QVOB 4OIIH 3NA4A 4OSUL 3B9KC 3QUMH 2FHCA 4M43L 5JUEH 5FM5M 1VFAA 1ACZA 2X4PA 1MRFH 3RPKA 3VFNA 3GBMH 2VL5A 5EUKB 2D0HA 3S97C 4MA3B 3WFBL 4MS8C 3BT2L 1T21B 4NO2A 3MRDA 4HIIA 3GMOB 2J8UF 1CDHA 3OPZL 4JFXA 3S88H 2D9QB 5C8JA 4I0PD 4K9EL 1MNUL 4Y4FC 2IAND 3L5XH 3T04D 1RZ8B 4PRNB 2QADC 2VUYA 5C0CD 4JRXD 1KJ2H 4Y5VC 4LSQH 5IHLB 2HKFH 1J18A 3EYVB 5HYJA 1JV5A 3TO4A 1E27A 1N6QL 4FQIH 1TQCC 2F9BT 3AVEA 2O5XH 3OXRA 3P0YH 4PJ5D 5EBGA 4P9HH 1ZLWK 3S5LG 5DJ8B 1XGPB 5CIPB 5DUML 1SMAA 1UKTA 4NQEA 3GRWL 1M7DB 4DN3L 1YPZF 3TA3D 4OZHB 4ZTPH 2FD6L 1XH3A 3BAEL 1FLRH 3VGGA 4OAWA 25C8L 3H9SA 1INQB 5JQ6H 5JMRA 1CFVH 1WIOA 4FQPA 4GAGL 1EFQA 1FO0H 5CP3H 3HRZB 1HEZB 3BUYA 1HK6A 3TN0D 1LO2L 4MCZB 4MGXA 3DARA 4Z7VF 4QTHA 4M1CC 3E2HB 5BXFA 1JGEB 2CKBH 3HE6A 2Q87A 1EDQA 3VFGH 4GKSA 3CSYA 3G5XA 2RAMA 3DMMB 4AT6B 1DBMH 3B2VL 1CG9A 3EW3B 4YO0A 2AJUH 1G7LA 4XAKD 1R0AH 3O4LA 2Y5TA 3DRTA 1TDQA 2DTMH 2NR6D 1JP5A 4GG8B 1NUDA 3KHOA 4TULH 4K94H 1QFUL 4ONHB 3V6BR 1W72L 3FT4A 4M48H 2IPUK 4QRUB 1SBBA 1UKQA 3ILQD 1L7IL 1QKZL 4EN3D 5ID1B 2C1PA 1YMMD 1J1XH 5I1KL 4HX1B 4QKXB 1FN4B 2F19H 1OCWH 3SKNB 4NZRH 5EA0H 3AC0A 4GH7B 4TNVF 3FQXA 4OFDA 5D6CB 2ENSA 2HN7A 4HWUA 5ANMB 2NY4D 3S8WA 1TXKA 5D7KE 3F6LA 1F90L 4KPHH 2D9CA 4M7JL 2IWGA 4U3CA 1Y18B 3SCMD 4QRRB 3MYZA 1K2DB 3H3KA 5ANME 1VSCA 3KHQA 3D18A 3O0RH 4LVHC 1QBAA 2E9JA 2PR4L 3WXVL 1SEBA 2VITB 4JRYD 2PXYB 5C07D 4FN0A 1CXFA 1OW0C 3FQTA 1DQJA 1IC5L 5BVJA 3WV0A 1HWGB 4JPIB 3JWDC 4W70A 3T0DA 1Q9KA 5I30L 3E1F1 3OKDA 2AW2A 2FECL 3UC0H 3VD5A 3WL9B 1OHQA 5T3ZL 3QXWA 4XNYL 4O58H 1FQ9C 2EXWC 5F7EH 3SO5A 2B0SH 1GZPA 3WMSA 2ZWLT 2J8OA 1WWWX 4LSUH 3EFFB 3EFDH 1S7RA 1FZKB 4U1MB 5DHXB 3V4VH 1NCBL 2R4SL 4P3CH 3MBEA 4Q97A 1OAKL 3MODL 1KGCD 4YH6A 5E8NB 1TZGH 2X40A 3T08A 4F15B 5E0QA 4MNQB 4X7TB 3SGJC 4IHOB 1E6OL 3V6OA 2PF6A 3NZ8B 5CGMA 3FQNA 4Z7OE 1CFQA 3RWHA 5D7SH 2AJZB 1FYTA 4ZFZB 1AXSA 2E7MA 3TZVA 5HGDA 5CMAA 5E6ZA 1DANT 2PO6C 4JDZA 4P3DB 4PRHE 5CINL 4Z7QF 3UAJC 2N1KA 3A67L 3BEVA 3MRBB 4MAUL 4HWZB 4LVNB 4ZG1A 5D2LA 3N1GC 5JLZA 2FWOB 5DJYA 5E2TH 2X4SA 1XGQA 2HRPH 3QQ3B 4HJJH 2VLKA 3MRCB 5SV3A 5FYKH 5FUZL 1E4XI 2Z91A 2R2EB 3CVHL 4LPTA 4XXCA 2BSRA 1LK2A 5EIIB 5BZDB 4CNIA 4GUPB 3KLHC 4NZJA 1ZA3A 4PRAB 5LJYH 4NKOA 5MERA 2RJMA 5EO1B 3HZKB 4NQDE 1T0PB 3D3VB 4F37F 1YN6B 4LASL 4JZNB 2AI0L 3PGFL 4XP6L 3CDYA 1YDPB 43CAA 2K1MA 3ZDXF 3LN4A 4U1LA 4P46D 4HXBL 1I7TA 4XB8A 5DYOB 3D39B 3MOBH 4LHUB 4OCWL 2XKNA 2BOBA 2D7NA 1K4DA 4LVOB 1F3JA 4ZXBA 5CKGA 4GW1B 3GJEB 1VGEH 1WFTA 4MDJA 1U3HB 4I2XE 4KROB 4LLUB 5E1AB 5GZND 4PRPE 2R56H 4LVEA 5IB4B 5A16A 3VDBA 5C3TA 3TNNA 4PJ8D 5BW7A 4AIZA 3VW3L 1FC1A 3HE6C 5CZVL 3IFPB 2WIIB 4PRID 1Q9WA 4NZTL 1KEMH 4NWTL 5IB2A 4N0YL 1I7ZA 2H6PB 3CXHJ 3MLVH 4EOWH 5T1LB 1JGVH 2BSTA 3QWOA 1AHWA 3N9GH 3MRLA 2I9TB 5FGCE 1S9WB 2VDOH 5JIPA 5K9KA 3K74B 1AJ7L 4OF6A 3GMQA 1U95B 2APWA 3X12B 1H9VA 4LOUD 3SDYH 5TE4L 1D5XA 2DJ4A 3QXVA 1GGCL 4NC1C 2GJZA 1NDGB 1GPOL 5IB5A 4LLVB 4PJDA 2VDLH 1T22B 4UZGA 1FC2D 1MCFA 4U3HA 3QZWB 4G5ZL 3PHQA 4KRLB 4IEFB 4X0KB 1DBAH 2RBLA 1ZGLP 1EFXB 3VWKA 4DOHE 2XTJE 3QDMD 1Q72L 3IXAA 1P2CB 2PYFA 1MCLA 4PPTA 2NNAB 3DTXA 3WJLA 4XC1H 3KYKL 3HI1A 4PJBE 1CD1B 3HPJA 4Y4FB 4O51B 4OD2A 4P4RB 5ISZA 1NBZA 5CP7B 2QADB 1ZHKB 2E3VA 2HTKD 1VEMA 3LOWA 5L7XL 2C3XA 3SJVA 2XY1A 4PV8A 2YS4A 3CU1A 4OCSH 5I1CH 3K2UH 4LEXH 1QQDB 2CLZA 4JO2H 5AWNL 4KJYA 5T1KB 4KDWA 5EZLA 2PW2A 4X80L 4YK4C 2I5YL 5DXWA 3HUJA 4G7YL 4MXVF 4LEOB 1WCBA 4N8PA 4ODSL 4PFEA 3RWJA 1R5VB 1T0MB 2LU3A 3GK8H 3ULUD 1YNKL 3MBEC 3KPNA 2VC2L 4P5KB 5IR1A 2Z31D 1BQSA 4UU9B 1DVFD 3KPRA 2GJ6A 3RVWC 1KIPA 5EU7C 4MCYB 2GJJA 3HS0B 1GOFA 5E2WH 1FL5A 2NY7L 5LWYL 1RIHL 3SE4A 3W82A 2F74B 4XWOC 1B0RA 4NYLA 1RK0B 3CFEA 4GW5B 1PKQB 5HGHA 2DI8A 4BQCA 4NSKA 3VG9C 5IQ7L 1F4HA 4AEIH 5A40E 4LCIL 2YXFA 5D1ZA 2ATKA 3U36B 2LFGA 5D93B 3WLWD 1DBBH 4KKBC 4KI1A 4ETYA 5EU3A 1CL7H 2GAZA 1MREL 2DQTH 1BVLA 3GSNB 2J3SA 4OBRA 5HGAA 1NFIB 3U4EA 1KTRL 3KS0J 3CMOL 3ARZA 4KJQC 2DL2A 5FO7B 4CDHA 1SBSL 4GT7A 5CD5D 3EYUH 3IDGA 3T3PE 1UXSA 2BNQB 2YXMA 2W91A 5HI5C 3OAZK 3BKCL 4P23D 3GJFH 3HNVL 5HHNB 3GO1L 3GEWB 1PD6A 2F58H 5DRXB 4I0PA 1FIEA 3FB6A 2IANA 4LKCA 4PBWD 2X70A 4Q6IA 5C0CA 2E7CA 4JRXA 4ZXBC 2XPGB 4NN6C 1NBVH 1HDMB 5IVXB 3N1QC 1UKSA 4KUCD 1S7VA 2UV3A 4Y4KB 3HI6H 4LVHB 3QCUL 2C1OB 2OP4H 4BSVB 4X7CC 4LU5H 5F89B 1JTTA 4PP2B 4PJ5A 4LNVA 5SWSB 5BW7C 2OSLB 2UWEF 4QY8A 3UJTL 3FO0L 1NGZA 2Q8AL 2AJXL 2VL4A 1J8HB 4JFHE 3C9NB 2FSEB 3MUZ1 1NMBL 2H32A 4Z7WB 3TA3A 4PTTA 5ALCH 2YA0A 1AHWC 4NQSA 1I4FA 1SM3L 2IBZY 5GRVK 4JFED 1U8MB 5MHSD 3L6FA 2X9WA 3VE0A 1MUJA 1DEEB 2P49B 3TN0A 4WU7A 1Q9LB 1TETH 2MPAL 3MJ7B 3OZ9H 3K1KC 2F54B 1OF2A 4YC2C 3OB8A 5I1HH 3CX5J 5BMFL 4U7KA 4HPOH 1DQLL 1VFAB 2FIKA 2X4PB 1EAJA 2LTQC 4D9LH 3VFNB 1Z9OA 2VL5B 2Z8VC 4PREA 3QNYA 4NO2B 2CK0L 3MRDB 1Q8MA 2G2RA 3VWKC 4MA7L 5TGBA 2DIBA 2BVUA 2EIZB 1ZLUH 4JJ5A 3U1SH 1VENA 5JIHA 4JFXB 2V7NA 3WJLC 4KVNL 4PJFA 3KVQA 5EWIH 2DQIH 5C8JB 2WUBH 5KAQG 3OJMB 4PJ7A 1RU9L 3W5MA 3DSFL 3RWIA 4LFHD 1RAMA 4QXGL 4Z0BH 1B4JH 2CXGA 4EN3A 4TYUA 5HYJB 1JV5B 3TO4B 1E27B 3WN5A 4R2GC 4KK8D 3U9UA 4QRTA 4JHWL 1U8OA 3OXRB 3FO1A 4JFFD 3BPOB 2BMKA 1CTNA 5AYUL 4CVZA 4XP9L 3TVMD 4NQEB 1H0DA 4D8PA 1HH6A 1CFTA 4XHJC 3SCMA 4HC1L 4NRZA 4PIRF 1CGXA 1XH3B 4OAWB 1T1ZA 3H9SB 1QFWM 4JRYA 4AEEA 5C07A 4BH7A 3BUYB 4Y5YA 3FQUA 4FQHA 2AXFB 1CDGA 5D7IF 1UWXK 4QTHB 4M4PA 5BXFB 5IVNA 3RIAK 3I2CL 3HE6B 5BCAA 1NFDF 4GKSB 2EDXA 3CSYB 3T2PA 3G5XB 5I1GL 5FYLE 2NY5L 3FZUC 1CG9B 4HPYH 3HAEA 3VXMD 3TCXA 4YO0B 4WEBH 5CUSH 1G7LB 3DUSA 5GQBA 2V2XB 3O4LB 1AQKL 2Y5TB 1BZ7A 3DRTB 1NKRA 1MH5A 4O9HL 3RU8L 1BEYL 3UTZA 2R15A 1G7IA 1EO7A 3FT4B 4PGDA 2C1PB 4JY5H 1UC6A 3RUGA 2JCCF 2WUCH 3QEQE 1A4KA 2VLJB 4PGEA 2DLFH 1J12A 1J1PL 3FQXB 5GS1C 1I1CA 1KCSL 3BZ4B 5DJXB 3ZE1F 1LGVA 2HN7B 3CSPA 1FZMA 3FB5A 4I0PC 2VLJE 4BA8A 3H7BA 3I9GH 3PGDA 5IJVA 4L3CA 1NCWH 4Q6IC 5C1MB 3BKYH 3BP6A 1IEBA 1QBBA 2R2HA 1B0GA 2IH1A 5DVMA 3D18B 3PWUA 1SEBB 4KK6D 2GW5A 2ZOKA 1JGLL 1KEGL 2W07A 3FQTB 1DQJB 4XVTL 5BVJB 3HMXH 2OR7A 5HI3D 1QSFD 1IEAA 4WUUE 3LN9A 3GMMA 2KZ1B 1Q9KB 2VN4A 3OKDB 1IBGL 4P46A 1P6AB 4CW1A 3TA3C 5IBUB 2C5DC 1ZKAA 1GZPB 3PGCA 3HZYA 4NQXA 4HUMB 5FGSA 1OP5H 3BESR 1JGUL 1S7RB 1A6PA 4WFEE 4MQTB 1WICA 3S37L 3MBEB 4MB3A 1OT2A 4H88H 5JW4Q 1NEUA 5EU6E 3MBXH 4NM8H 2AJVH 3FQNB 1CFQB 3RWHB 4PJ8A 3BUTA 1FYTB 1AXSB 3TZVB 5HGDB 1QR1A 2MCPH 5CMAB 1UYWL 4JDZB 4PRIA 4JANA 2XN9E 3V52L 3TJHD 2XICA 1I9RL 3BEVB 4N9OB 4PY8I 3D6GA 2GT9A 1A6UH 1U3ZA 5D2LB 3VG9B 5JLZB 1WZ1H 3PDOA 5DJYB 3RVUD 5EOCH 1BGXL 2X4SB 3F62A 1XGQB 2BXYA 1D5BA 4I1NB 2VLKB 5DF0A 4ELMA 3AAZA 4H20H 1IGMH 1Z9LA 3NIDE 2Z91B 3UTSD 2BSRB 2F8XC 15C8L 1LK2B 4C56D 3ILQC 1MRDH 4CNIB 5CZXD 4EN3C 1ZA3B 1SJEA 2VLKE 4LRIA 4NKOB 5MERB 4G6KH 2WBJD 3WN5C 1FL3A 1J0JA 4OGYH 5DQDL 4M7KH 5C7XL 3O6FD 1P1ZA 3FRPA 4JN1H 4P9MH 1NCAH 5BOZG 5ICXA 2FBOJ 3MV7D 4AK1A 3S36H 2VYRE 1F3DJ 4GRLC 4K8RC 4AZ8A 5IKCA 3QDMA 43CAB 1VADA 1WWCA 4F80A 5F3BA 3LN4B 4U1LB 1HI6A 4XPGH 4F3FA 4W81A 3ZYZA 2NLJB 1LDPL 4X4MA 3QPQD 3UTTE 3SCMC 4NWUL 5IOPA 2D7QA 3V7AE 2XKNB 2BOBB 5GGVH 1K4DB 1F3JB 4ZXBB 4NN6B 3ROOB 2VQ1B 5GRJL 1L7TL 4MDJB 4PJXE 1UWGL 4M6NL 4YXLL 1L0QA 3SDAC 5DD6A 1KG0A 2JJTA 5IW1A 3FQWA 5F3HA 3TNNB 3TF7C 4AIZB 2P24A 3QDGB 4ALAH 5EC2A 4GBXD 4LDEB 4H0IA 3MLRH 3TFKD 1KCLA 4WFGE 3EOAA 1Q9WB 3NPSC 2DI9A 5HYQA 2VXUL 5IB2B 4G8IA 1I7ZB 1TNMA 5EFIA 3OKKA 5DK0A 3QDGE 1NJ9A 2BSTB 3QWOB 2OMBA 1I1AD 1AHWB 1EMTH 5KVDH 5F7LB 3MRLB 1TIUA 4XH2A 5K9KB 3GMQB 4XP1H 2Z31A 1CDYA 1XGRA 1CGVA 2RQ8A 1DVFA 5FYKU 1PDKA 1D5XB 5CEZD 1VPOH 4X9IA 2GJZB 1KCVL 4LCCA 5IB5B 2MTPA 4PJDB 4GS7B 2VDNH 4U1KA 5DK3A 1LO0L 2LTQB 4NHCH 1CFNA 2GSGB 3PHQB 3LB6D 2D03H 1ZK9A 3VWKB 1H5BA 1IRAY 1PG7H 3IXAB 1E4WH 2PYFB 1XF3A 5C0BD 1I3GH 5DD3L 4PR5A 4WI9A 1NMAH 3DTXB 3FOLA 3JWOH 1GGBL 5E8PA 3HI1B 4Z7OF 1KIQA 3HPJB 2DMKA 5JO5A 4JO1H 4OD2B 5E2JA 4TOYL 5ISZB 1B6UA 1QNZL 4O02H 1GHFL 2A6JA 3P3YA 4KTYA 5KJRL 1LE5A 4FOMA 2CLRA 5I18L 2F15A 2B4CC 4TQEH 3SJVB 5E6ID 3B8YA 1T3FA 2A0LC 4PV8B 1I1YA 5I19H 2IQAA 3V5DA 1S9KC 2EC9U 4P23A 1MFCH 1AFVL 2CLZB 4P46C 1Q0XL 4KJYB 4X83A 5EU5B 3QXAA 4NT6A 4ZS7L 1B88A 4LSPH 2PW2B 5EZLB 3HUJB 4ESKA 3DBXA 1WCBB 1EJ6A 3RWJB 1O0VA 3RI5K 1KN4H 4U6XA 4L3ED 5TDOA 1TPXC 1U92A 1AXIB 3T2NL 3KPNB 3VDCA 5JXAH 5GZNC 2YPLD 1PQZA 5IR1B 5HJ3A 3WFCL 4MA8L 3JBG7 3KPRB 4CKVX 2GJ6B 1KIPB 1FL5B 4FHBD 4LPVA 4OZGA 1QO3A 4JKWA 1B0RB 4NYLB 3EJJX 3CFEB 4XWGH 1F45A 4CBPA 1N6UA 5HGHB 3THMH 2AS5M 5FYLH 3BKJH 4NSKB 1JRHL 1G6RA 5E03A 1QYGH 4JFEA 2DD8L 5DGRA 5D1ZB 2ATKB 1NUNB 2WLYA 4L4TD 2GAZB 3H3PH 2AABH 1MWAL 5DVOA 1BVLB 4LRIC 5HGAB 2OXGA 5ILTH 1LP9E 3U4EB 4LPWA 4LCWE 2KL6A 4AM0B 1KLGA 2OX5A 3N50A 3B5HA 1PGRB 4HIXL 5E2VL 3IDGB 1UXSB 1Q38A 2J6EH 4JREB 2AEQL 3UO1H 5KVFL 3I6GA 2HT3C 4NJ9L 3VXUD 4I0PB 2IANB 2APTA 2M8XA 4TVPE 2DYPD 2YPKA 3ARTA 4LKCB 1HHJA 2X70B 4Q6IB 2HTKC 5C0CB 4JRXB 4ODVL 1OTSD 3WKNA 5KW9H 5LGHL 1HHIA 1IQDA 3MOQA 3NFSL 1S7VB 5CJXC 2CRZA 5IFHH 5JW4M 12E8L 2UVEA 5E2UL 2IG2L 4PJ5B 4JFFA 4QY8B 4HH8A 4QHKJ 3VFWA 1NGZB 2YA2A 4X7DC 3BHBA 3TVMA 4I3RL 3LRSA 3ELAT 1DLHA 4Z77A 4Z8FL 4PJBF 2H32B 5DMIL 3TA3B 3U4BH 3H0TA 3QCVH 4RQQA 3ULUC 4NQSB 5DEGB 1I4FB 1S5HA 5CJ5A 3EYSL 3GUTB 4J7RA 5F7FA 1MAJA 5DGQA 5GGUA 3L6FB 2Z31C 3VE0B 1MUJB 1QRNE 3PXJA 3TN0B 2HJFA 3EOTL 4WU7B 2GTZA 2N7AA 2XG4A 1KCRH 1OF2B 2GEEA 1YEFH 3OTTA 2ADFL 2YD7A 5F6HJ 2FIKB 1MI5D 1ZLUK 5J0BA 2OL3A 3Q5OA 3VXMA 5JHDD 2R1XA 3G9AB 4J6RH 3QNYB 2A77L 4PREB 2VLMD 1OL0A 2G2RB 4KVCL 2D7MA 1H5BC 4RSVA 5TGBB 2DF3A 3WLWC 5BV7B 4JJ5B 4WY7L 2V7NB 4AEHH 4PJFB 4P99A 5DD5H 9CGTA 1IKFL 3N1MC 3NH7L 5FCUL 1CQYA 4PJ7B 4HG4J 3RWIB 3KG5A 1TITA 5FGRA 4XX1E 3G04A 2A6KA 3O2DA 3IFNH 1FIGH 4EN3B 2OBGA 1ZVYA 1YMMB 4EBQL 4ZFFA 3WN5B 5CD5C 1RULH 5F7KC 4Y16D 1K8DA 3U9UB 4QRTB 2HA1A 1D5IH 3FO1B 3A6CL 3U4AA 4XXDA 4L9DA 3VXRD 4PLOB 3VXTA 1Z0MA 2ZUWA 4U6VH 1YMME 4JLRA 3CLFL 2BMKB 2NY4B 5J3HD 4CVZB 2MMXA 4HFWA 2XIDA 1ZLSH 1D9KD 1SY6H 1H0DB 4D8PB 1HH6B 1UM6H 1CFTB 4PY7A 3SCMB 4PJIE 2VSDA 2HTLD 3C8DA 4NRZB 1ZMYA 1T1ZB 4WW2A 5FA3A 2HP4A 5GGSA 5C0AA 2LE9A 4JRYB 4P59L 4BFGA 5C07B 4DAGH 4BH7B 3Q5YA 3G08A 1YYMH 3MREA 3T3PF 4J3WA 4Y5YB 3FQUB 4FQHB 1QSFA 3TH2T 3N85H 5FHAL 1E6JL 5CJBA 1S7XA 2B1HL 3QSKB 2VDRL 4OCYH 2BVOA 1S5IL 1V7MH 1EHXA 1F02I 3VA2C 1CQKA 2H3NA 1F11A 3HAEB 1EJOL 1MELA 2IALA 5KSUA 2R4RH 5HHVH 1JNHA 3DUSB 4Q9RH 3VG0L 3QWRD 2APBA 2ZZUT 4OLVH 4LSSH 1BZ7B 4K71B 1AO7D 1MH5B 2VDML 3N1FC 2DWDA 4JFPA 2R8SL 1TZHA 5C08D 1M1SA 5DJ2A 1LO4H 1MQKL 4U6YA 1HZHL 2OR9H 1G7IB 4GFTB 1OSZA 4PGDB 1K3IA 4PTUA 1INDH 3NACH 4OQTA 3RUGB 2UZXB 2A2QT 1A4KB 4H8WH 4PGEB 4BUHA 1RUML 1ZWIB 1FVCA 4N9GA 4DKAA 4YBLC 3RUGE 1Y0LA 1FZMB 3FB5B 1JZ2A 5D5ME 3MGTA 3BH9A 4N5EC 3H7BB 3PGDB 5IJVB 4L3CB 3UTSA 2XY2A 1HE7A 2ZCHH 1K4CA 4XPTH 3BP6B 4M6ML 4DGVH 1CICD 1IEBB 1RD6A 2R2HB 4K3EL 2DWEA 1B0GB 2IH1B 3GHEL 5B38G 1IZKA 1PYWA 2WBJA 2CPCA 3PWUB 3VRLE 4QHLA 4KK8C 2ZOKB 4ZOEA 3QRFM 3OQ3B 4JFQA 1J7VR 3O6FA 1UFUA 4H1LA 1AP2A 3MV7A 1G9ML 5JPMA 1ED3A 1OP3H 4ZOAA 3OGCA 1IEAB 3LSOA 1AGFA 3GMMB 1IAIM 1MCJA 4QGYA 1OP5K 1QRKA 2RR3A 4TUKH 4DQOH 4P46B 1OD9A 3VXSE 4CW1B 4QLRA 2VXSL 5DD1H 4LIQE 3PGCB 4KHTL 3HZYB 4NQXB 4I3SH 3HMWH 3RDTD 3U46A 1JHLH 3DLQR 3W9DA 3HB3C 1TPXB 1PJ9A 1MRFL 1MHCA 1I8KA 1ZEAH 4A6YL 3GBML 1HHGA 3MV9E 1MFDH 3LRGA 1YUHA 4PJ8B 4DCQA 4M4RA 2FYYA 3HC4H 4GBXA 5DDHA 1QR1B 3B5TA 4PRIB 2FX7L 4JANB 4M7ZC 5INCA 2UUDH 2JJWA 1CZ8H 4K3JL 4LRNH 2GT9B 5E7FA 4RMWA 1I1AA 1KJ2L 4LSQL 3PDOB 1D5BB 4FQIL 2BDNH 4ELMB 3AAZB 1BWWA 1HOCA 3ESVF 1FFPA 1UQSA 3P0YL 2O5XL 4CN1A 1JWMA 4WWKC 5F1IA 4Q9BA 4P9HL 4YX2H 2FR4A 1SJEB 1KNOA 3TP4A 1FL3B 5HHXH 4ZOBA 2Q8BH 3Q1SH 1HCFX 1P1ZB 2A9NH 4Y4HD 5ICXB 1ROWA 4HS8L 4F57H 2BJMH 4YXKH 1A5FH 3GI8H 5IKCB 2QHRL 3IAQA 3QDMB 5JQ6L 1VADB 5F3BB 2JJSC 5C0BA 1J1OH 2W38A 1HI6B 4F3FB 2XKSA 2DB8A 3HRPA 4WO4D 2YBRA 1UACH 5IOPB 4CDGC 1U8KA 2VR5A 4GRWE 3EO9H 3P11H 4YEEA 1ZLVK 2P48B 2CKBL 2ZUVA 3T0AA 5E6IA 2DTSA 3QP3A 3WJJA 5ITFA 5HI3C 1DBML 3C87A 2ZNWA 3QB7C 3ESUF 3C5ZD 4FQLH 5DD6B 1KG0B 5IW1B 3FQWB 5F3HB 1R0AL 1X44A 2P24B 5EC2B 1FSKC 4ZUUA 5JW5A 2DTML 5IROA 2G5BA 3EOAB 3WS3A 5L2KD 5HYQB 4G8IB 4K94L 5IBTH 4XPAH 4ZO6A 5EFIB 3OKKB 5DK0B 5EZJA 1NJ9B 1S7SA 4JO4H 3RZWA 1X6LA 4L3EA 5EZOH 4NRYA 3FMGH 1J1XL 4FTVE 5JDSA 4XH2B 2YPLA 2Z31B 4ZFGH 3V4PH 1XGRB 3DPBA 4NZRL 5EA0L 1CDBA 1DVFB 2XQBH 3E6HA 1WC7A 4KQ4H 1XT5A 4O4YH 2DQEH 4XCFH 3TJHC 2C9AA 4LCCB 5GPRA 4DWHA 4KPHL 3DOSA 2VAJA 3K46A 4U1KB 5FYJE 4R96A 1CFNB 4FA8A 3QIBD 5CSZA 3RVUC 4L3AA 3L9RA 4GKZA 3O0RL 2CD0A 3SKMA 4G6JH 1H5BB 4LF3A 3MUHL 7FABL 4U1GC 1XF3B 2WQ8A 4LMQE 5KVEL 1AD0A 1EGJH 1EUTA 3FOLB 4L4TA 5E8PB 4J12A 4H26A 1KIQB 1NL0L 4ONOA 5CZXC 5JO5B 1KOAA 1ORSA 4W68A 2A6JB 4M93B 5BV7H 1DBKH 5IP4A 2E9IA 4LLMA 1LE5B 1SQ2N 1NUFA 2CLRB 4JFZH 4LP5A 3WIFA 3UC0L 5IFAL 5H37G 4J4PD 3MV8E 5F7EL 1OLLA 1T3FB 3OJ2C 2B0SL 1WF5A 2ORBL 1I1YB 2IQAB 3V5DB 2I9LA 3WNLA 4LSUL 4HFUH 1UG9A 4P23B 3EFDL 1G7HA 2IPUG 3BMWA 5I1EH 4HUKB 3D87B 4JKPH 3QPQC 1TZGL 3QXAB 4NT6B 2R0WH 1T0NA 5E9DE 3VXUA 3NIDF 2EC9T 3DBXB 4U1IA 2DYPA 5D7SL 4CN4A 3AM8A 5FIEA 3B6SB 3L3IA 1IAOA 4OTXH 4U6XB 5DFVD 5TDOB 1U92B 4YBHA 4AH2A 1PQZB 2O5YL 1OAYL 5HJ3B 4DK6A 3VXQA 5GXBB 5FHBH 5FOJA 1DDHA 4GBXC 3TFKC 2DBLH 4OZGB 2HRPL 1QO3B 1CVRA 4UT9L 1H3PH 4OCRH 2GTWA 1WBZA 4N90E 3TM6A 4N0CD 1I1AC 5K59E 1G6RB 3WD5L 4JFEB 2CIIA 4XVJH 1P53A 2X4TA 4XAWL 1S78D 1FAIH 1HSAA 4P2RE 4PJXF 2GCYA 4WFFE 1U8QA 3HAEH 1RZJH 3F7VA 5BVPH 2ZUQB 3QAZC 3S7GA 2V5TA 3NIFF 5C09E 2Q86A 2ICWI 1MI5A 1KLGB 1CL7I 3L3GA 3LB6C 4RMRA 5JHDA 3MOBL 4YJZL 1CFBA 2CIKA 5F88A 1T5WA 4YBLB 1IGFH 1VGEL 4HIJA 3ULVD 3I6GB 4HWEL 4R7DA 3PP3H 3IDYC 2FL5A 2YPKB 1U8NA 3GKWL 1ZANL 1HHJB 1F58L 3MZGB 4BZ1H 1YYLH 1HHIB 1IQDB 5J1TC 2EH8L 3TWCH 3DX6A 3WJJC 1KEML 5HVFB 4Y16A 4FFVD 3VDAA 3MLVL 1DSFL 4JFFB 1JGVL 3VXRA 4ORGA 3IDNA 4MNHA 3VFWB 3BHBB 3TVMB 5D4QA 5IROC 1G0XA 3LRSB 1JF1A 5IK3A 1DLHB 3WXWL 1TFHA 1D9KA 2AGJH 2VDOL 4C57C 4Z77B 1KV3A 1EEYA 2ZCKH 4JR9L 2IPTH 2DQHL 1XCQA 3L5WA 3H0TB 3SDYL 4RQQB 4S1SH 4HJGA 3UPCA 1S5HB 3CSGA 3K4DA 1UEYA 5DD0H 3H8NA 5C70A 2VZUA 1KYOJ 5GGUB 1A3QA 3ZSSA 4BZYA 5TH2A 2VDLL 4R0LA 2HJFB 1C5CH 5ICYA 2GTZB 5J06A 3WDHA 5HGBA 4D9QE 1AR2A 3WDJA 3RGVD 1EV2E 2NZ9D 4KAQH 5EO9B 1NCCH 1CBVH 4BFEA 3WNOA 2PW1A 1KSRA 1RQ5A 3MLWL 1A0QH 4XC1L 2X1WL 3RIAF 2JIXD 4PLKD 2OL3B 4KWUA 3S37X 3VXMB 2R1XB 3C09C 4Y89A 4X6CE 4HAFA 4JQXA 3QWRA 1NANH 5GRXG 4Y0GA 1AO7A 2PYED 1N8ZA 3EJYD 5C08A 5KSBA 3DVFA 3BPNC 3MYJA 3ZMRA 2MCG1 4OCSL 5I1CL 3G04B 2A6KB 3K2UL 5CWSA 4U49A 1FBIH 4LEXL 4JO2L 1JN6A 3IKKA 1EERB 2ESVD 4ZFFB 3CIQA 3M1BA 1FFRA 1K8DB 1W0WA 2YSSA 4J1UB 4XXDB 3GK8L 3VXTB 2BY1A 3VMPA 3VCLA 1IC7H 4HFWB 5JHLH 3MFFA 2X9XA 2Y06H 3DXAE 3KLAA 2EIEA 1YEIH 4PY7B 4CN6A 1NGYA 3AM8C 3QUXD 3IFLH 1CICA 2NX5D 4I77H 3RX8A 3LKOA 3QHFH 1BZQK 1LP9F 4WW2B 5FA3B 2HLAA 3QRGH 5GGSB 4KK5C 4DKDC 1N7ML 3G08B 3MREB 1J5OL 3I3EA 2RCSL 3CX5K 4YHLL 1QSFB 2IC2A 3LHPH 3JUYA 3QG7H 4AEIL 1S7XB 1UJ3A 1EVTC 5CEXA 2APXA 5FFLA 1IC4H 4UNTA 5ELIA 4OI9A 1BQHA 2BVOB 1FSKB 1DBBL 2DKMA 3RFZC 4R4NC 2H3NB 3OF6D 1F11B 2DQTL 2IALB 3RDTA 4HKXB 3LZFH 3KPMA 5KSUB 1G9NH 1JNHB 3C08H 5FUCC 1U42A 3J8F7 4MXWH 1NAMH 3MJ9A 3W11D 2DWDB 4JFPB 2EKJA 1TZHB 5JQHC 2J8UA 4AL8L 1NAKH 4P3WA 5DJ2B 4RGNE 4C55A 4U6YB 5E4IA 4YBQD 2QQLH 5K9QG 1BJMA 4PTUB 4OLZH 2ENYA 3IGAA 1LILA 4WFHE 3UPRA 4PJHE 3D0VA 3DO7A 1FVCB 3LKNA 4N9GB 4X6BA 1KN2L 5C2BH 1Y0LB 3HI6L 4URTB 3RY6A 3MGTB 1OAZH 4QRPD 2OP4L 3BH9B 4YXHH 4U1GB 4JPWH 3UTSB 1K4CB 2JLLA 4OD3H 4C56B 1YPZA 4L4JA 5DMKA 3CNKA 4YHZH 1Q0YH 2DWEB 4LLWA 3TJEL 5ECJE 5C0EA 1PYWB 2WBJB 4YWGH 1S9VA 4QHLB 4GG6E 1WUNT 5I1IH 4JFQB 4HEME 3O6FB 4C56E 4H1LB 1AP2B 3QUZD 1M71A 4Y4HA 3MV7B 2VLRE 2FCBA 4IS6A 4V1DE 5ALCL 1I1FA 3ZZ1A 5JPMB 5MEQA 4R6UA 1ED3B 2ARJA 3OGCB 3KJ6L 5J3HC 1AGFB 1AXTH 4KJPC 5I2IA 1D9KC 2AAVA 4Z7VA 5GGRA 5DA0B 5FK9A 4FQXD 3VXPB 4WO4A 1TETL 2HTLC 3OZ9L 4U33A 2Z8WC 4UILL 1QG3A 4UOJA 1XF1A 4MSWA 4QT5A 3U46B 1NCUA 3ARBD 5I1HL 3W9DB 3REWA 1DL7H 2DKUA 5HDLA 1BAFH 3IJSA 3RWFA 2VXVH 2FO4A 1MHCB 2EO9A 2WMPA 4MJID 5ITBH 1I8KB 1HHGB 4EI6A 3WUWG 3C5ZA 3C8HA 1YUHB 5C92A 2BHZA 4DCQB 4JGJA 3I6LE 5CSGA 5GSVA 5IWLC 2FYYB 4GBXB 5DDHB 3B2UD 4JZOA 3SDDC 5INCB 5EWIL 1CGTA 5L2KA 1T7WA 3K8KA 2WUBL 2H2SD 2ED7A 4PJIF 1N2RA 4NC1E 1S7QA 2P46B 1I1AB 2AK4E 2HKHH 4JQXC 3P4LA 2K3TA 4KJWD 1UB5A 1OGAD 1HOCB 1BWMA 5C0JA 5FYKD 2VQUA 2X9YA 1FFPB 1UQSB 5MI0B 4U0RC 3I50H 3P9WB 1JWMB 1G6RH 1QUNA 5F1IB 4OFIA 3TIDA 4QHMB 5F7MC 3OBAA 2FR4B 1IAKA 1KNOB 3MSPA 3QAZB 3SPVA 3ZKQD 5IHUH 2YWYA 2XACC 5F7WC 3U6RA 2FX8H 1NGXA 5E99H 1DQDH 4YGVA 1KT2A 4KI5E 1A6WL 1JPFA 1T66C 2E5EA 4BQ9A 5CEZE 4Y88A 3QIBA 1B0WA 1GC1H 2P5WD 3TT1L 4DEPC 1FGVL 4LHQB 5C0BB 2E6JA 5KOMC 2X4OA 4RDQF 3D25A 3QCTH 1FVDA 4FQJL 2YBRB 4HUXA 1U8PA 1U8KB 1P4BH 4TVSa 3QNXA 4UV7H 1DFBH 2JB5H 4HXAL 3ARFA 4J4PA 1QACA 4IMLA 3K0WA 4UT6H 5E6IB 4AQ1B 5ITFB 2XZAH 4HPYL 8CGTA 3LMJH 5IVOA 1UJ3C 4WEBL 5CUSL 1U93A 4N8VA 2X10A 4QOKE 4B41A 4ZUUB 5D5MF 5JW5B 2G5BB 2WK2A 3WS3B 2KH2B 4WJ5A 3X13A 4ZUVA 3QXTA 3JV6A 5EU7E 5EZJB 5CCKH 1S7SB 4F58H 5ACLA 4L3EB 3FFDA 1BJ1H 1QLRA 3IF1A 4NRYB 3VRLF 5IBLD 3E3QE 4JY5L 2WUCL 5JDSB 2YPLB 1N6VA 32C2A 4ISVA 1INEH 4R4FH 1BBDH 3VJ6A 4NFCA 3RBSA 3E6HB 1WC7B 3EYQD 5TF0A 3OGOE 2EDDA 4LSDA 5IF0A 4HWBH 1JHTA 1NCWL 4CJ1A 3HE7D 3G9VA 1N64L 3BKYL 4R96B 5I8OH 4YNYA 5CSZB 1XCTA 3L9RB 4GKZB 3RY6C 3SKMB 3D85D 4RGOL 3CFIC 3U9PH 3C6SA 1AD0B 2HAZA 4L4TB 3HMXL 4H26B 5T33H 1AY1L 3BPNB 5ABDE 5DUPH 4RWYL 1GOHA 3RVXC 2B39A 2VOTA 2CGRL 3LKQA 1KLFA 3QQNA 4LLMB 3BIAX 5HI4D 3WIFB 4I0KA 2R0LH 1E4KA 4Z7UE 5M7QA 4Y4HC 3PHOA 3UDWC 3QWQB 2I9LB 3O2DH 3RVTC 5LBSL 4LGRB 5F9DC 1G7HB 1MSPA 3DVNA 5ESQA 4H88L 4WO4C 2A9ML 3VXUB 4U1IB 4MQSB 2DYPB 4NM8L 4RAVA 4G6FD 3HG1E 1IFHH 1NSNH 3VGEA 3L3IB 1KB9J 1IAOB 1RZ7H 3LAFA 3SDXE 3GHBH 2VRAA 4C4KO 3SQOH 1RMFL 3ZYIA 1G7QA 4AH2B 1YECL 1A7BA 3VXQB 4D94A 2YD4A 1A6UL 1DDHB 1WZ1L 3HNTH 1G1YA 2ARJQ 1K85A 3UTPD 5J12C 4FP8H 2GTWB 3D69A 4X6DF 5J4MA 1WBZB 5DQ9A 2ID5A 2OTPA 4GRWF 1MRDL 1T04A 4IM8A 1AIFA 5E6YA 2CIIB 5KVGH 1WBXA 2ARWA 2X4TB 4EUPG 1CTOA 4G6KL 1HSAB 4Y2DC 1BVZA 4M61A 4M7KL 4OGYL 5F7DA 4OCLC 3O6LH 2GCYB 4JN1L 1U8QB 1I3RA 1A14H 3S36L 3GSNL 2NYYD 4XPHL 3S35H 3ZKXC 3RGVA 4X7SH 1RUQH 4HIHA 3QUMA 4J3UA 3AY4C 1CK0H 2Q86B 2XWTA 2Z93A 1MI5B 4XPGL 3MRKA 4JHAH 4TSBH 2YRLA 5FEBA 4OZIE 2JIXA 3FN0L 3L3GB 3QIBC 5JHDB 4N8CH 3GSQA 3HZMA 3LQAC 3Q48A 2CIKB 2NZIA 3OWEA 4UIKL 5F88B 2NMSA 2DBJA 1T5WB 4G8EA 4LNRA 4OQTH 1HNFA 2NY3D 4HIJB 2PYEA 1L4IA 1RURH 4R7DB 2A83A 4I4WA 5DJCA 4OM0L 4WRLA 5D7KD 3SKOA 2B2XH 2FL5B 1U8NB 4GXVH 3MO1A 3EGSA 4G9FE 1BD2E 1KJ2A 1M4KA 4YHKH 5HVGB 1BOYA 3Q6GL 4ALAL 3ARFC 4J4PC 4PBVC 2ESVA 1KIUA 4OLXH 5EBMB 3DX6B 2GFBA 4Y16B 1T2XA 1HNGA 1QFWH 1A2YA 3JWDL 1FPTH 3C8KA 3VXRB 2Y9RT 4ORGB 4KHXL 3IDNB 5I0DA 5LAXA 5IJKA 2BY2A 4YR6A 5JW3H 1EMTL 2XWBB 4FQQA 4MNHB 1NFKA 2DQGL 5I71C 1JF1B 5IK3B 1D9KB 2QQNL 3Q5TA 1EEYB 3AGVA 5JA8B 3EYOA 4H1LH 1KC5H 4U6HA 1XCQB 3L5WB 3ZL4H 3LVEA 3PV6A 1T03L 3GM0A 3GMLA 4HJGB 2L0DA 2NX5A 4S2SA 2EDYA 4F33A 5FECA 2Q76A 5TH2B 1FO0A 2M26A 5CP3A 5ESAA 2J88H 3EO0A 4R0LB 3KXFE 4NHCL 5ICYB 5HGBB 1F97A 2D03L 3NA9L 4J3VA 2GY5A 3C6LC 4NUGH 4ONFH 5C0FA 4NQCE 1PX4A 1ZVHA 1PG7L 3NZHH 2CKBA 1I3GL 2HLFC 2PW1B 3QO0A 5TPWH 5E8OA 5I6XC 4M7LT 5IQ9A 3JWOL 4PRHD 4RZCB 1SVZA 3CXDL 4PUBH 3OF6A 4WHYH 2GIYA 3L3OA 3O6KL 4JO1L 4QXUH 1CD0A 4JY6A 1S78C 4FMFA 4FRWA 1FORH 3FT3A 5C0RH 4TQEL 2BRRL 4NFBA 4FXGA 1N8ZB 1MIMH 5C08B 5KSBB 4XNUH 3P2TA 3MYJB 3MJ6A 4HUWA 1KFAH 4U0RB 2IBGA 5CWSB 3IKCB 4LDLB 1X5KA 4OF8A 1E4KC 1JN6B 1JF5A 1JPGA 3T1FA 2O5ZH 3M1BB 4DUXA 4OFKA 1W0WB 2YSSB 3GDBA 2WWKT 4NBYB 5K59F 4NQDD 2FJGA 5IM7A 1ZHLA 5CEZH 1KN4L 1RSFA 2XFXA 3VCLB 1X3DA 2UWEA 1B3JA 1XEDA 4Y1AE 2BC4A 1Q94A 2CO7B 5H2BA 5ADOH 1FNSH 4QRPA 4DEPB 5JXAL 3MFFB 3OAUL 3GBNH 3KLAB 4UT7H 5HDOA 4N68A 2EDFA 4RISL 3PQYE 3SE9H 1NGYB 1XF2A 1KPVA 4DVRH 1CICB 2XQYG 3MCG1 2EXYD 2YD6A 3LKOB 1JK8B 1RHFA 1VHPA 2HLAB 1XGYH 4NKIH 3L3JA 3OKEB 1K8IA 1N59A 4XWGL 1FE8L 3QUZA 3ZE2E 1R6VA 1TJGH 1BIHA 5FYLL 3BKJL 2QL1A 4PRPD 3CD4A 1QYGL 1UJ3B 5CEXB 1OAUH 3VD4A 2DJSA 1BQHB 1JGDA 4OUOA 3DVIA 3NPZB 4M7LL 4FQXA 1ZGLA 3EDJA 5TQ0L 1G9MC 2D0FA 1ONQA 2P8LB 2P5EE 2AABL 3NFPA 3RDTB 3ARBA 3KPMB 4M9PA 4HG4K 4MJIA 4ODWA 2J8UB 4XGZA 1X5JA 3VH8G 2J6EL 2NZ9C 2YK1H 2MJWA 1CF8H 2FX9H 1ES0A 5I8EA 3HFML 2DIAA 1P7KA 4GJTB 1OPGL 1PY4A 5DWUH 3IGAB 3TCLA 1KJ3H 4F7EB 2NTFA 3UPRB 2C3GA 3EYFA 1JUFA 3D0VB 4YHIA 3DO7B 3LKNB 3WNPA 2IADA 5DZLA 4X6BB 3ARXA 3QJFA 5IHZA 1MFAH 3EJYC 1ZAGA 1OGAA 4XNXH 5IFHL 3MLTA 2XTJD 3V0WH 5E8EA 1CI5A 2J4WH 1FP5A 4KRPD 4MHHG 5SX5K 1Z5LA 1YPZB 5DMKB 3RVVD 4LLWB 2RB8A 5C0EB 1S9VB 2EE9A 3CFKA 5GGRY 4Y4HB 1M71B 1JYVA 4IS6B 3QCVL 5MEQB 5IJKC 4X6CF 4P9HC 5I75C 2ARJB 2P5WA 1SJHA 4W6YB 4TNWK 5MEPA 1QA9A 5E08H 5I2IB 5D7IA 2V5MA 2XZQL 3HC3H 5FK9B 2E7BA 1MFEL 4WO4B 1OWRM 1SEQH 1NFDA 4MSWB 1SYVA 1KCRL 5HYFA 4QT5B 5E00A 1YEFL 3CH8A 1U3YA 1YQVH 3L5JA 3REWB 4X5XA 1GGYA 3IJSB 2OZ4H 3RWFB 5JW4R 1Z0NA 2FO4B 5E70A 3JTTA 2R0ZH 3MA7A 5FF6B 5D2NC 5DT1H 4EI6B 4PGCA 3C5ZB 4G7VH 5GSVB 4JZOB 3ULSA 4AEHL 5EORH 1JWSB 5J12B 5L2KB 2JCCA 4OCNC 1OP9A 3OSKA 1S7QB 2LAGB 1FIGL 5HTSA 1UB5B 1RULL 4G6AD 2E7LA 5C0JB 1CLOH 4K94C 4Q0XH 5D70H 3TIDB 1YMHA 2DDQL 4U6VL 4YBQC 5C0ND 4BSWA 1IAKB 3BVNA 3RHWF 3SPVB 2JTDA 4PYHA 3ZKXB 2AV1B 4G9DA 1SY6L 3U6RB 1NGXB 4YGVB 1KT2B 1JPFB 4JPKH 1UM6L 3HE7A 4HMDA 1IGIH 3QIBB 2QLVB 1U2HA 3BI9X 1BLNA 4R26L 3D85A 2W9LA 2X4NA 2X4OB 3OMZA 5B4MC 1N26A 3D25B 1FVDB 1MLCA 1BIIB 2CR6A 3NCFB 4N0FA 3N85L 4HUXB 1U8PB 1UM4H 5KSAD 4JFDE 4PJ9D 3GB7A 2VXTH 5JR1H 1I7RA 2MKLC 3QNXB 4YDLC 4OCYL 4YUEH 2RFXA 3S3SA 1V7ML 3QUZC 1A1NA 4IMLB 4XNZC 2DM3A 4PRNA 4PJHF 5LXGH 4JZJA 4GAFB 5HHVL 1U93B 4N8VB 1KB5A 1RVFH 4G42A 4IMKA 4Q9RL 4LSSL 5CJOL 1BF2A 1T2QL 5I71B 1QSEE 3FAWA 2NQCA 4DFHA 1N4XH 4XBGA 4JFHD 4WJ5B 3X13B 1LO4L 3JV6B 3A6OA 3PHSA 1URLA 2E6PA 2OR9L 4J3TA 5F21B 1RUKH 1NUGA 3FFDB 3IF1B 1QLRB 3MA9L 3G6DH 4GG6F 3O6MH 1Z6JT 4HJ0D 1INDL 3NACL 1JMXA 2IFFH 3KYNA 4FFYH 4R97B 32C2B 4ISVB 4ZNEE 2MOVA 4P2QE 2B8OT 3VJ6B 1EEUA 3B2UC 4LP4A 4LHUG 5DMGD 3NCCB 4NC2B 4MVBD 2H2SC 3T2QA 4WDIA 1OB1A 4CMHB 5IF0B 5I6XB 1LEGA 2BOCA 4MCZA 5MENE 1JHTB 3VFSA 2ZCHL 5T3XL 4XPTL 2LABA 3RKDD 1NBQA 4DGVL 1EA9C 2CMRH 2ZG2A 4JRWA 1XCTB 4YNYB 1JGEA 1CWVA 3LQZA 4KJWC 2AXGA 2ICWA 3ARGD 4ZD3H 3DYOA 3C6SB 3BP5A 3ARQA 4KV5E 3WHE1 1X6NA 5FO8A 2NY6C 5AZEL 4FZ8L 3LKQB 4TUKL 4DQOL 4JKLA 3PHOB 4YHYC 5DD1L 1LK3L 3WO4C 3GI9H 4PB9H 4I3SL 3HMWL 3CX2A 1JHLL 2ZUUA 2BP3A 5E1HB 3GJFA 3SGKA 5SV4A 5ESQB 4YDVA 4DKFH 4LPUA 4RIRA 2DLHA 4RAVB 2C3VA 2KQNA 4YDIH 1KXQE 3QZWG 2IAMD 5D1XD 5ANMA 3ULVE 3DECA 3BYYA 1NC4D 3IDXL 4D3CH 1YQ2A 4KI5F 4X9BA 2L7JA 4JDTH 1G7QB 2ZUYA 3NMEA 4LRNL 4GRMA 4NM4H 5DRNA 2D7OA 4HKBA 4KU1A 2NTSP 3T0XA 1EBPA 4PLNC 3RJDA 3BPLB 1U2CA 4NHUA 4EIZC 4IJ3C 3R06A 3D69B 5LVEA 5C86A 4MB4A 5DQ9B 2WSKA 1C1EL 4Y7MA 5T5FH 3WNKA 2VR9A 1T04B 1AIFB 4PB0L 1WBXB 3LKRA 5HHXL 4M61B 5F7DB 2Q8BL 4YHOH 3TBTA 1I3RB 4NJAH 4F57L 4YXKL 1A5FL 3RGVB 3HI5H 3K7UA 2V5RA 4HIHB 3QUMB 4UV4H 2XWTB 2Z93B 2HH0H 4MZ3A 3MRKB 2Y36H 4PRHA 3HE7C 2Z92A 5BS0E 2YPVH 2JIXB 3ZO0A 5D7LE 3NZ8A 5HD8D 2PKDA 3QEQD 1UACL 3GSQB 3HZMB 1S7TA 4GAJH 5HHME 2ZSVA 1K5NA 3P11L 3V5HA 3RIFK 1CR9H 4G8EB 4LNRB 4J8RA 4X4YA 2PYEB 5B39A 3ZYOA 4C58B 2A83B 4I4WB 3FHAA 3BD3A 4L29A 5DJCB 5GRYA 1A1OA 3N0PB 3SKOB 3MO1B 4FQLL 1ODAA 4NGHH 3PWPE 4K55A 1YEHH 3EGSB 3RZCD 4R3SA 1KJ2B 4J3XA 1N5AA 1E0OB 1T83A 4NN7B 1MFBH 5TQ2H 3FB8A 2ESVB 4CADA 2GFBB 4UOW0 3MLXL 5IBTL 4JZJC 1A2YB 4NQDA 1FRGL 3C8KB 4HIEA 5DVLA 3QPXH 4IMKC 5LAXB 4HWNA 4YR6B 4FQQB 4D9RE 5I75B 3FMGL 4WUUD 3WDIA 4EZMA 1MCEA 3BIKA 3FQRA 1WCQA 3EYOB 4XPFL 5CHNA 4ZFGL 3V4PL 4WIQA 2XQBL 3PV6B 3QUXB 4JGMA 2XZCL 3GMLB 4KQ4L 4S2SB 2NX5B 5E8DH 4EXKA 2DQJH 5E24E 4F33B 4O4YL 1UVQA 2DQEL 2QJDA 3EJZC 4XC3H 4XCFL 5FECB 5DMYA 2Q76B 4Z7UF 3FOMA 4FABH 1FO0B 4WFED 5ESAB 3EO0B 4GAYA 2V2TA 4I2XA 3NCJH 4PRPA 1WAAE 5C0DA 5EU6D 4DUWA 2R0KL 1TENA 2OTUA 5C0FB 3INUH 3T0EE 5T3ZE 2CKBB 4Z0XA 3QO0B 4UBDD 5E8OB 1EGJL 5I8CA 5IQ9B 1QEWB 1TCMA 2XN9D 3E2HC 3VFOA 3BIBX 3PWVA 3L3OB 3T3ME 2WWKO 4RNRA 4JY6B 5BV7L 3SDXF 1DBKL 2GSIA 3BKMH 3IFPA 4U3XA 1L6XA 3FT3B 1HKLH 1AKJD 4HKJA 3OKYA 2YD1A 3P73A 3UJIL 4FXGB 2V7HA 2NYYC 1H15A 3RA7H 5C6WH 4HUWB 5AZ2H 4DGIH 1XF4A 2ZCLH 3RRQA 2FATH 5I1EL 4XCCH 4HQQH 4P5TD 2PTUA 2P8PA 1JPGB 4KQ3H 3R8BB 1JNJA 5EOQH 1MEXH 1CGSH 2DICA 5IM7B 1ZHLB 4MX7A 4OTXL 5F1SA 2XFXB 2NY3C 3ARPA 1XR8A 2YD3A 2UWEB 4LARH 2BC4B 1Q94B 4YQXH 5H2BB 5ICZA 4QRPB 1YEKL 1KCKA 5E95B 3BISA 1ZSDA 3MACH 5F7HA 1XF2B 1KPVB 3UTTD 1KYOK 4PJBA 2YKLL 5DLMH 2DLTA 1C7TA 3UYRL 2DBLL 2NY0D 1X5YA 3KYAA 4N5UA 4YDLB 3L3JB 1K8IB 1N59B 4OZIF 1MOEA 1KXVC 2JELH 3QUZB 4MXQD 4OGAD 2FGZA 5C6TH 4XNZB 1X5XA 5TDNA 4PRBA 4QO1A 2OR8A 3WFZA 4ZQKA 3OV6A 4XVJL 1JGDB 4FQXB 1ZGLB 4WFGD 1ONQB 1S7UA 1RZJL 4OZ4A 2W59A 3NFPB 3QEHA 4P4KD 1V05A 1OQXA 4M8VA 5GSRA 5BVPL 1XIWD 3ARBB 3D9AH 2Y25A 2BRQA 4W6WB 4O00A 4MJIB 1GIGH 1TTFA 4XGZB 1B9ZA 1MCWW 4GXUN 2M2DA 1ACYH 3QFJE 3DURA 2X1PA 1ES0B 5I8EB 3ZTNH 2YA1A 1P7KB 3IJHA 4F15C 5IIEA 1HILA 4P5KA 4XP5H 4RGMB 4M03A 3TCLB 1KTKE 2NTFB 1N0XH 3EYFB