5GS0H

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 116
sequence length 116
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0H00
2RB8A 5AZ2H 4PJDF 1M7DB 3GSNA 2F74B 5A3IC 3RI5K 1RHHA 1IZKA 4G5ZL 3M07A 2I25N 2CPCA 4E0RB 3QDJE 3DECA 5IFHH 3U9PL 1CGWA 3CFBA 3QDGE 1KCKA 5DUMH 1K4DB 2ZG3A 5ADPL 1E27B 1EBAA 1L9NA 3DX8B 4O5LH 1OAUL 1BAFH 3DBXB 3FOMA 3SKOA 5KSBA 3M17A 1YECL 4I2XA 4XB8A 4JQVA 5T1LA 3HZYA 1S7TA 1VFMA 1K85A 3C87A 3T8XA 4AMKL 5DDHB 4GG6A 3WNNA 5L2JB 4KC3B 3DSNA 4UQ2A 5FYJU 5F7EH 1JGLL 2R2HA 1QSFE 4LLAA 4QF1B 2W0PA 2NY0C 5D2NE 2MCPL 4OM1H 4NQDB 5E5MB 1JV5B 3HHRB 3EYSL 5IHZB 4HULB 5DTFA 5D93C 2E27H 3MUY1 4XX1E 5MEPA 3SE8H 2AAVA 4F15C 5ETUA 2P42B 4HZAA 2VSDA 1Q1JL 1DN2A 2CO6B 4JM2A 4PJCA 1WLHA 4N0UA 1ETZB 2MQCA 3KPLA 4K9EL 4MA3A 3JZ7A 3QQ9D 2P47B 3GBLA 3VXNB 3A67H 3EYOA 4OF8A 5TGBA 3ILPA 3RPKA 2IQ9H 1VGEH 43CAB 4BFBD 3L6FB 4LSVH 3FCTB 3ZTNL 1HEZA 1WJ3A 4LSSL 3MNWB 4GMTL 4F57L 1BGXL 3CDGA 2IGFH 5FOBA 4G6MH 4HUWA 2XPGA 4D8PB 2BSRB 3O6FC 1KBGL 2A1WH 4PYHA 1A6WH 2BVUA 3DX9B 4GAJL 4FNLH 4Y2OA 4QHNA 5B21A 1KLFA 5HHOD 2P44B 3TO2B 2GSIB 2FJHA 4GQ9L 5DJDB 4PJEB 5FA4A 3TNNA 2CR3A 4U31A 3JUZA 3HNSL 3THML 2YD8A 4F3FA 5HHVL 2OJEB 2WSKA 4AK1A 4IOIA 2AK4A 4NJAL 1CICC 1KB5L 4J4PD 1C1EH 5HDQH 2AXGB 4X99A 4QRUA 3ME0A 1A9BA 3T08A 5C07A 5AZEL 5DD6B 1NGPH 1PX4A 5CEYB 4Y2DA 1T7VA 3RPIB 3WJJA 1JHKL 4JFPB 3RDTD 4GBXD 3PDGA 2RCSH 3LB6D 5KSUA 4IRJD 5DJXA 4JZOB 4EBQL 2P8LA 5I66A 1ED3B 4UBDC 4N8CL 4HUXB 3WN5B 4C59B 3Q6FA 3P77B 2XTJC 2R2EB 1QACA 3QQ4B 4JO3H 2AK1L 1MCKA 3KYKL 3RY4A 2HWZL 1JHTA 3OGCA 5C0ND 4IIQC 4HWEH 1HSBB 2VXQL 5KANI 4RBPK 1F8TH 2FLRT 4FQXA 1S9XA 4NHUB 4XC3H 4D9RD 3L5HA 4Z7UA 2GYSA 4Y4FD 3NA4A 4HDIB 1OD9A 3IS1X 2NR6C 3DXAD 3C2AH 5GISH 4ONHB 3MLZH 1UKSA 3L7FB 3VXSB 4AH2B 5ABDE 3P4OB 3OKYA 4R90H 2GFBB 1HOCB 4HGWA 1YNLH 3VD9A 1Z9OA 5I15H 3V4UH 4XPFL 3SO5A 4UILL 3VJ6B 1RY7B 2BSED 3ULSB 2PETA 4PGDB 2Q87A 1N0XH 1BVLB 2ZCLH 5TDNB 4MA8L 3T77B 4LVNC 3IAGC 1FLTX 1U91A 2PTUA 4MXVF 4CNIA 1GOFA 1LDPL 2CKBH 2HTLC 4PJAF 5IT2H 4XPBH 4WU5B 5F96H 1B9ZA 2HRPH 3B9EA 4X4YB 4IRSC 3LRGA 2DWEA 1JNJA 4QWWD 2AEIT 3BRGC 5DJZA 4RISL 4PRHE 2H26B 4G3YL 2B20A 2WWKT 5IFAH 4XI5C 4XC1H 4KV5E 3D85A 5GGQL 1NEZB 4JG1H 3W9DA 5JW5A 4EDWH 3ARVA 5KSVA 2EH7H 3C5ZB 5FK9A 1HXYB 4TVPL 5A16B 3LV3A 2VDKL 5EULV 3RZCC 5D7KD 2IAND 4LLMA 1WT5C 2GK2A 3LZFH 4YGVA 5MHSD 5D96B 3DRQB 1AO7A 3BPNB 3FFCA 4XH2A 2YD1A 3CFJA 1FNSL 1KB9J 1IKNC 1QD0A 2E8YA 3PJSB 1GHFL 2B5IC 1FNAA 3LCYA 1NFDE 3OQ3B 3GMQB 3OTTA 4Y4HB 1I3VA 4DOHB 1DDHB 5IBLC 1RZ8B 3HG1D 5DEFB 1ZT1B 4OFYD 2VDOL 3NA9L 1SM3L 1BBDL 4ZTPL 4P48A 2YBRB 3MCLH 3N1FC 1EHXA 1CFBA 4DN3L 2KZ1B 1LD9B 3V8CA 4CVZA 1M7DA 3IKCB 1EERB 2F74A 2I5YL 4ZXBD 1PZ5B 5BV7B 1N0LA 3RU8L 2RQ8A 4E0RA 3OKOB 3NIFE 2VN7A 2X4PB 5BRZE 5IBUG 4DTGL 3JSSA 2GT9B 3CVHL 3P11H 4PJ8C 4G8EB 1K4DA 1IGIH 1E27A 5ESAB 2WAHA 1ZLUH 1SBBA 5I8KL 3DX8A 3QEGH 3TZVB 4XAKD 3DBXA 1OVZA 5CJ8A 1BWWA 3T3MF 1I8LC 4B50A 3NZHH 5DD1H 5DDHA 5L2JA 5JLZB 4GW5B 3KJ4B 4MJIE 3G5YB 4TSAH 1YJDL 4MAUH 5E2UL 3LKPA 1J86A 3MV11 4FG6C 4QF1A 5I0ZA 4UTBL 2CMRH 2OZ4H 4NQDA 5E5MA 1WZMA 3DI3B 1JV5A 5IHZA 3WIFB 1CVSC 3ARDD 4W4OC 4XP6H 2BVTA 4L5FL 4OGXL 2VNCA 5IBTL 3VFOA 4X9IA 2C4XA 1G9MC 4AL8H 4NUGL 2FGWL 4UUJB 4YBHA 3MFGB 2VABB 4XNXH 4OQTL 5ICXB 2EDKA 4XWGL 3RGVB 3VXNA 4MHHG 4PRDB 4P2QB 5KVFH 1U8OB 3AB0C 3QXVA 3K2MC 3QCUH 4P57A 3ZYOA 1CE6B 2NY6B 1R3KB 43CAA 1DQDH 3CH1B 3L6FA 5F7NC 2WLYA 4YH6A 3FCTA 4OGAD 3U4BH 1OAKL 5I1AB 1ZLWK 3MNWA 4J2XA 1XFPA 1O7SA 3DGGB 4RDQF 5IJVB 2NY5C 2DLFL 4R97C 4D8PA 2BSRA 4XCCL 1BHGA 4UT7H 3MXVL 3BSZH 3DO7B 5GS1C 3TFKD 2F5BL 1M1SA 3DX9A 1V8HA 1KFAH 2XNAB 4YBLB 3VMOA 3ZKMC 1X6NA 3TO2A 2GSIA 2XQYK 3Q1SH 5DJDA 4ZDHB 4PJEA 2OJEA 4R8WH 5J56B 3W81A 3MV8B 3QRFM 5D70L 5ESVB 4RRPA 2AXGA 4TPRL 2MTPA 1F4AA 3WS6C 4OF3A 3BFOA 4XMKL 1ZTXH 4HFWB 4PY7A 4Y1AB 1MCPH 1OPGH 3CFKB 2OK0L 5CEYA 4PJGE 4U1IB 3RPIA 4FFWC 3Q5OA 4JFPA 5JORB 2DWDB 4DGVL 5KVGH 2YR3A 2YWYA 4JZOA 5T1MB 1ED3A 2BXYA 4HUXA 3WN5A 4LQFL 3P77A 3V7MA 2R2EA 3QQ4A 1NQBA 3W2DH 1HSBA 7FABH 4BSVB 3N06B 3FKUS 4Z7OF 2AEQH 3ZDZF 2EH8H 4NHUA 4MNQD 1FIGH 4OKVA 2AJVH 4GLRH 2APBA 4OIAA 1UACH 3N0PB 3P30H 3NBNA 3ARUA 1U92B 4OSUH 3KJ6H 4OD1L 4HDIA 1OOAA 3OAYH 3S5LG 4ONHA 3L7FA 2OXHA 3VXSA 5C9KA 4AH2A 3P4OA 3VG0L 4BK5A 1H3UA 1DBBL 3GRWA 4RWYL 2GFBA 2MQ3A 1HOCA 3JV4B 1G1YA 4X9FA 4NCC1 3VJ6A 4OJFL 3ULSA 1EEQA 4PGDA 4NN7B 2BHYA 4OB5H 2C9AA 2HKFH 4OM0L 5TDNA 4RAHA 3T77A 3WFDL 1TIUA 1NGYB 2BRQA 3VW3L 1NCDH 5EZOH 4WU5A 5GGUB 1G6RH 5T3ZH 5DD3H 1JZ7A 3DLQR 3DIFB 4X4YA 1EX0A 4HFUL 4K71B 4G6FD 3V52L 1R3LB 1YEJL 5IGXL 1OWRM 2EZ0D 3T0XA 2H26A 1N26A 4OIIL 1NAKH 3C6LC 1A7RH 5DUBB 2P5ED 2AQ2A 3LPGA 3B8YA 3C5ZA 4QOKD 1HXYA 5A16A 5GHWL 1DCLA 1NMCC 3O2DH 4C56E 1CTNA 1JRHI 3HI6H 4ODXB 2YSSB 3MR9B 3LHPH 3DRQA 4HH8A 5BW7A 4DCQB 5SX5K 3MMEB 1T83A 1WITA 1ZAGA 2IPTH 2XRAH 3PJSA 3GMQA 1L7TH 5C0BD 4Y4HA 1JHLL 1FZJB 1DDHA 2OBGA 4RA0C 2X9WA 4K94L 1WC7B 1RZ8A 1B0RB 4V2CB 5DEFA 4G9FD 1ZT1A 4NOFA 4UB0H 4NZUH 4XVSL 1E4XI 3KHQA 1BECA 4BYHA 1OQXA 2YBRA 2NTSP 2FJFB 3C8KB 1LD9A 4G7YL 3ESVF 1P7KA 3PL6D 3IKCA 2APFA 1BIHA 2DTSA 4IRJB 1HHJB 3VD5A 1PZ5A 3AFLA 2DM4A 3OKOA 2X4PA 4H8WH 4JO2H 3TBVB 2GT9A 1RUQH 4ZUVB 4M3KB 4G8EA 1A3RH 4KKNA 2PR4H 2EDLA 5DO2C 4R26H 1A8JH 1I9RH 4FHBD 3QIWB 5DVLA 2CDFB 4BZYA 4NQCE 4FQ2H 3SGEI 4Z9KB 4DW2L 4Y4FB 5I1HH 5JOEA 1YEFH 3DXAB 5JLZA 1B2WH 4GW5A 4X0KB 3G5YA 4NFDA 2Z4QB 3T0EE 1OWWA 3U79A 2DLEA 3QI9D 3FRPG 3ZT5A 4HK3N 1U36A 1W72H 2DMKA 3CFCL 3WIFA 3GK8H 1HE7A 3QIUD 1MQ8A 4BQ9A 4NGHL 5J6GB 3PWPD 1YZZA 1QKZH 5JDJA 2JJTA 4LNVA 4GS7B 5F6HI 3DMMC 4M62L 2Q8BL 3FO0L 1C5BL 1U8KB 4UUJA 4IS6B 2YZ1A 2VABA 2XA3A 2YA1A 4WCYH 2XWTB 3H7BB 5ICXA 1F58H 3RGVA 1OAYL 4PRDA 4U6HB 4P2QA 2Y72A 3VI3F 1U8OA 5IVXE 1CE6A 1R3KA 3CH1A 5HYSB 4YC2B 3VXUE 5HI3C 1D3CA 3B8SA 1EFXB 2NCMA 5I1AA 1JZ4A 2DLIA 3DGGA 2ZUTA 2BVQB 1AXIB 5IJVA 4N5ED 2IANB 2LAAA 5HD8D 1CG9B 1N8ZB 2QR0B 4C57C 5I76A 3FQRB 3DO7A 4CJ1A 3IGAB 3VGAB 2XNAA 4GG8A 1K6QL 4FQLH 4ZDHA 4PJBF 2JB5H 1INDH 1Z3GH 4RNRB 3MV8A 5ESVA 2C4FU 5HHNB 2NXZB 4WFEE 2OQJB 1QFOA 4FQPA 2NY2C 4Y1AA 2EEAA 3CFKA 3O6KL 2IG2H 1EIBA 4U1IA 4H88L 4P23D 5JORA 3QUKB 2DWDA 1DSFL 5D7IE 1U0QA 2KUTA 4OCMC 5T1MA 5FA3B 4KH2A 1CFNB 4KK5C 4PJHB 3GEWB 4FP8L 1UKQA 1RJYB 1AQKL 1GVIA 4JHWH 4LARH 1HHKB 5FYJE 2B1AH 3HI5L 1IKFL 4GKNB 4BSVA 1DANU 2XZAH 2VLKB 2AQ3A 1CDIA 3VA2C 5C0CE 4M7JH 4ZOEA 3MV9E 1MFCH 3QWOB 5C6TH 3RA7H 1U92A 1JPTL 4K8RC 1IGML 1LMKA 4MSWB 4NFBA 1GGBH 3MODH 1CL7I 5J13C 3CX5K 2I24N 5CJOL 4HX1B 3A6CH 4O4YH 3UTZB 2A9MH 4H25B 5E9DE 5E8DH 3NCJL 5I1EL 5CBAB 2BK8A 1RUML 1GSMA 3JV4A 1YPZB 4EN3B 3D0LB 1GGIH 2IALB 4KRPD 4Y8DC 3A6OA 2BHZA 5TE4H 3BZFB 4MA7L 1G7IB 1NGYA 1MRCL 3WYRA 5GGUA 2DQIH 3DIFA 1R3LA 3UJTH 1O5DT 1TJGH 1MEXH 2YPVH 1PLGH 5DUBA 1D5ZA 4PRPB 5IROC 5ICZA 3AS1A 4FN0A 5MI0C 1MJ7H 3T2PA 3QUML 1FYTD 3QDJD 4IHOB 4ZUSB 2XACC 3QDGD 4ODXA 2YSSA 3MR9A 3ILQC 3UZEA 4DKFH 1ZVYA 4DCQA 1Q0XL 3KLDA 4ODTL 3MMEA 5SV4A 4DFIA 1ZGLB 1QP1A 2HT2C 5LQBH 4JFDB 2R0WL 3UYPA 3N50A 1D6VH 1TPXB 1AI1L 1FZJA 3HRZB 5EOCJ 1RUAL 3T65B 5GZOC 1ZVSB 1WC7A 1B0RA 5ILTL 4FFVC 5HYJB 1QSFD 1SY6A 3QR2A 3PGCB 5C92A 1UM6H 1TQCC 1LEGA 2XTLA 2FJFA 3C8KA 5IHLB 4MJ4A 3U2SB 3P3YA 4IRJA 5IVNA 2NY3C 4QRPB 4L3EB 3TN0D 4IMLB 4ZO7A 3TBVA 3UDWC 4JVPA 1T1WB 4ZUVA 4I1NB 1A14H 1ZSDB 4PJ5B 4U1SB 4KK8D 1PKQE 2F15A 3QIWA 2DRUA 5ANMB 2B1HH 3DO3A 2J5LB 2CDFA 3T4AB 5C0FA 4M7LH 2BX5A 2VH5L 2XYCA 1KEML 4Y4FA 1RK1B 5FO7B 4W6XB 3DXAA 5FM8A 4P2OB 4X0KA 5IV2B 1HQ4B 2Z4QA 1R24B 3FN0H 5FIEA 4KQ4L 3EYQD 1GRWA 4MD0B 5H94B 4OZFB 3UJIL 4U6YB 1ZK9A 3ULVF 5FECB 12E8L 1N4XL 3TVMC 5T5NF 1EGJH 3D0VB 5J6GA 1IM3B 1FBIH 3R1GH 4YGAB 4UIKH 1IQDB 5GRVL 4YQXH 1EA9C 1MHHB 5DEGB 3U82B 2AABH 5D7LE 3I6GB 3TV3L 1U8KA 4IS6A 1EXUB 5CINL 5FYLD 4XCNB 5EWIH 1IC5H 1ROWA 2XWTA 3H7BA 4G6FB 2O5YL 4I9WE 4U6HA 1UWXK 3A6BL 4RAUB 4LPUA 4P2RE 5HYSA 4PRBB 1I8IB 4K3DH 1EFXA 4QOKB 2BVQA 1ZEAH 2IANA 1CG9A 1N8ZA 2QR0A 4P4KD 5EBGA 1LE5B 4LLDB 1LILA 3FQRA 5JHLL 4QTHB 3IGAA 2JCCF 3IJHA 4P99A 1JPFB 5F8QC 1DVFB 1TCMA 2EXWC 2VDPL 2OL3L 2H41A 1A7OL 4JFXB 2HJFB 4WWKC 5C0BB 3RVTC 3BN9D 4RNRA 1S5IL 5CP3A 5HHNA 1REIA 3WFZA 3SGDH 2OQJA 4CU8A 1WCBB 5L2KE 4KUZH 4OFYA 4WFFD 2HH0H 1T22A 4QTIL 4KK6C 1BAFL 3QUKA 1S3KH 4OLXL 2NTFB 1J1XH 3CVIH 5C3TA 5D5MF 5DEZA 4DVRH 5FA3A 4ZXBA 1CFNA 3HE7D 5EU3B 4LK4A 3FOLB 4I3RL 4PJHA 4KJPC 1RJYA 3CPLB 1BLNB 3BYTA 3OR7B 1HHKA 2AW2A 2HJLB 1JF6A 1FFRA 2NPLX 3V0AC 3O9WC 2GY5A 4PR5B 5BVPH 2VLKA 4PRHD 3QG7H 3U0WL 1IILE 1SVCP 4GRMB 3B4NA 3SE8L 3QWOA 4MSWA 4TRPH 2AI0L 2AV1B 3FQXB 3IU4L 2B0SH 4Z8FL 3QWRD 3ULVH 4HX1A 3UTZA 5M95B 3D3VE 5I73B 4H25A 1IFHL 5CBAA 2HLFC 5JO5B 2DLGA 2CH8A 4C4KT 3QPQD 1YPZA 4PJDE 2DBJA 4EN3A 3D0LA 1SYVB 1UEMA 2IALA 2FCBA 3BPLB 4PJ9B 3VMPA 3PWPB 1K8DB 3GSNL 2WM0A 4AG4H 1NLBL 4S2SB 5E4EB 4S1SL 5SX4H 2J6EL 1G7IA 4F37F 3F58L 3VFNB 4NPYB 3EO1B 4WGVB 2IGFL 4G6ML 1KV3A 4ZNCD 5IW1B 3ZE1E 1K9TA 4Q2ZB 3JWOL 4FXGB 4ODWB 3BD3A 3UTSE 3ZDXF 3FN3A 4F37K 1MY7A 2E9WA 3LAFA 2ADGB 4M1CC 4L4TE 4P46D 4Z77B 4PRPA 3O41B 2AXHA 3S4SB 4JB9L 5IR1A 3JWDH 5GGTA 5BRZD 3HC3H 5CEZL 3U0PA 4APQB 4ZUSA 3C08H 3FONB 4G8IB 2DQDH 1CK0L 1WWCA 3MRMB 4JKMA 3SE4A 4EJ1C 1MH5B 4Y4KD 2OI9B 1T0NA 1ZGLA 2HTKC 3VMNA 3QUYC 3B9KB 5EC1B 1NMAL 4XPHH 4JFDA 1XGQB 3S97C 4N8VB 4U6VL 4QXUH 4R4FH 1NLDH 5EORH 2HRLA 3HRZA 3T65A 1ZVSA 4XX1G 4MJID 4KRMB 3EYUL 1P9MC 5HYJA 3PGCA 4E5XB 3VRJB 3D48R 2DQGH 5IB2B 1I1AC 2D03H 4MMZC 3QO0B 5DT1H 4RFOL 5F8RC 4WI8A 5FYJH 3U2SA 5J1AB 4X6EB 2E7LA 2WZPD 1J8KA 4UOW1 4QRPA 4MA1B 5D9SB 1V7NH 4KMQA 1TQBC 3C2AL 1T2QL 4L3EA 4L8SC 4IMLA 4KJWC 2JTDA 3MLZL 2KQNA 1SEBB 1T1WA 2F53E 1NANH 4P5TC 2A77H 4RRPG 1A6VL 1ZSDA 1W2KT 4PJ5A 2JJSC 4U1SA 1HILB 5DUPH 5GPRA 5ANMA 4LCCA 3MBEC 3T4AA 1OAZL 3TIDB 2E6JA 4P0DA 1F4WL 5CSGA 3MLVH 6CGTA 4NKOB 1XMWA 1RK1A 5FO7A 3QCTL 4FS0A 3NCFB 5HYEA 4P2OA 4U0RB 5IV2A 1F4YH 4ODHH 1HQ4A 1R24A 2HRPL 1U41A 3ARFD 1YN7B 3RX7A 4MD0A 2PKDA 4OZFA 5H94A 1AC0A 4U6YA 5CILL 5I19H 4LPVA 5FECA 1FGNH 1QUNA 4WHYG 3PWUB 4NWUH 5IHBA 1C08B 3D0VA 4ZS6C 1IM3A 4PUBL 5GJTH 3TO4C 1P4IL 4YHML 1CGUA 4EDWL 1IQDA 4HQQL 3IJSB 1MHHA 2APWA 5DEGA 5CJXC 3I6GA 3V6ZB 5FO9B 5CD5D 1OCWL 4EI5D 4XCNA 4HD9A 3OAZK 5FGBC 3ARRA 3VFUB 4PLKC 1SQ2N 4JREC 1R0AH 4PLOB 2YUWA 1LO3L 4RAUA 2OR7A 3HZKB 1LO0L 1C12B 4PRBA 3SCMC 2ZSVB 2VOTA 2YMXL 4OLUH 4QOKA 1CF8H 1KUMA 4OCYH 1EZVX 3OJ2C 4HV8B 3F8UB 1FYTB 2ESVE 4NFCA 3SDAB 1TJHH 4XVUD 1U8MB 1LE5A 1AHWC 3GSUB 4LLDA 5F21B 5JUEH 1U3HB 4QTHA 3GMLB 1CDJA 4ZOAA 5D2LB 5IB4B 1JNLL 1YY8B 1XIWD 4QXTB 1JPFA 3BN3B 1DVFA 4N1EA 4FQIH 3P73B 4G9DA 3DVGB 1NEZG 1S7QB 2HJFA 4JFXA 1I7UB 5C0BA 4ISVB 4MXVE 1RI8A 4ZOBA 4NO0B 3N1QC 5CGMA 3RJDA 4LHQB 5LGKA 3K3QA 1WCBA 4W70A 1UENA 4ONFL 3QULB 4RZCB 4NKDB 1TNMA 4OCSL 2AV7B 4M48H 2NTFA 1QSED 2YD4A 1ADQA 4G6AD 1EPFA 1SBSH 5DD1L 5EU3A 3FOLA 4OI8A 1QVOB 2DL9A 3TN0B 3CPLA 1BLNA 3OR7A 1GZPB 2HJLA 2IAMD 4I3SH 4J3UA 4PJAB 3MOAH 4Y5YB 4YPGB 2BVEA 2JB6B 4JANB 4PR5A 3BEWB 1VSCA 5HHPB 3O6MH 5CEXB 3O3DB 1IAMA 2UZIL 2OTUB 2EKSB 3NIDF 1OAQL 4F80A 3RUGB 4LMQE 5F1IB 3FQUB 2AV1A 3FQXA 5KVEL 2ICES 4LRIC 4GOSA 3JVGA 2DYPB 2HKHL 4POZD 1Z9LA 1MRFH 2YKLL 5JO5A 4H20L 4UT9H 5FUCE 5KVFL 1OGAB 1SYVA 3GJFB 4PJ9A 3PWPA 3BPOB 1K8DA 5GJSL 3OF6D 5EUOB 5LBSL 1WUNT 4S2SA 3B5HA 5IJKA 1BQSA 3VFNA 3C9NB 1MCEA 4NPYA 2YN3A 1MJUH 3EO1A 3H3PL 5IW1A 1EJOL 4OFVA 1II4E 3CC5B 1SEQH 3ARGD 4Q2ZA 3HUJF 2P48B 4O58H 4Q9RL 2EO9A 4FXGA 5C2UB 4ODWA 2VXUH 2DDQL 4JDVB 2PYEE 3T3ME 2ADGA 4Z77A 3GM0A 4FZ8L 3O41A 4KROC 3CSYB 1T7YA 5ACLA 2X42A 3S4SA 3RWGB 4NOBA 5E00B 3MBXH 3QAZC 4APQA 3GMMB 3FT4B 3V6OC 3FONA 5C7XH 4G8IA 4MXWL 4P4KB 4XBEL 2DQCH 3GHBL 3MRMA 4YXLL 4LCYB 5E08L 3CMOL 1MH5A 1T80A 3QYCA 3B9KA 5EC1A 4NQCD 4U1NB 1SJVA 3BQUD 1XGQA 1N6QL 2W0LA 4N8VA 1RQ5A 5KVDH 4FQCH 4YHYC 1FQ9C 4C54A 3V8OA 1A7NL 2C5DC 5LAXB 2HVJB 4HPOH 3UCRA 3VRJA 2OS7A 4QGYA 4TUKH 5IB2A 2AEQL 3QO0A 4KU1A 3LS4H 3KXFB 5J1AA 4X6EA 3P30L 4X7SL 2YK1H 3FB6B 5JZ7C 3KPSD 3S37H 5D9SA 1D5BB 3WIIH 1O7VA 1MVFA 4A2MA 2HFTA 5C0IB 1SEBA 4U2YA 2ATKB 2MCG1 2R4SH 3WFBH 4LAQL 3U1SL 4M8QB 5JR1H 4WTZA 3SKJH 2V2WB 1HILA 1RZKC 3SBWA 1FFPB 1NCAH 5AYUL 5F1KC 4X6CF 3TIDA 3HI1B 2NY0D 5BMFH 1A6UH 4NKOA 2HKFL 3DARA 4D0DA 5EDXA 4N1CA 3K4ZA 4L8CB 3P4MB 2J4WL 4NZRL 1D9KB 3LD8B 4POYA 2NX5E 2K1MA 1UWGH 4HT1H 1YEKH 1YN7A 2BP3A 4XVJH 4JE4B 1F3JA 1J7VR 5FYKD 3PWUA 1C08A 1Y6NR 1LO5B 3SQOL 3IJSA 5I8OL 2A6DA 3V6ZA 5FO9A 4LHJB 2VJXA 3V4VH 1UKTA 3N9GH 1FO0B 2Z8WC 4WFED 2IWGA 3VFUA 5CCKL 4KI5F 1G0XA 1CFQB 3D69B 4Z7OE 3ZDZE 1AXTL 1DBAL 3UTQB 4LGSB 3HZKA 3O6FD 4M1DH 5GRUH 2YRPA 3JTTB 1C12A 2ZSVA 1KN2H 3AAZB 2Y7QA 4WEUD 5C0RH 2QKIB 4HV8A 1FYTA 4HAFA 5JHDE 3QUXB 4M5ZH 3SDAA 2CQVA 3RP1A 1U8MA 5LVEA 3GSUA 1OTTC 2R4RH 1X5IA 4G7VH 5FYJD 1U3HA 1A6AB 2J2ZA 5GRVK 1CICD 3GMLA 5D2LA 3GRWL 1YY8A 5IB4A 4ELMB 3B2UC 3E3QE 2DI8A 2GY7B 4OCRL 3FMGH 4Y4KB 4URTB 3ALWA 4M6NH 3P73A 1VPOL 2R69L 3MV9D 1BF2A 3DVGA 1DLFL 1S7QA 2O5ZL 3BH9B 3STLB 1I7UA 5D1QB 4ISVA 1XCTB 4QLRA 3WIHA 4JKPH 3BZDA 4W81A 1T7XA 2GCYB 3RAJL 4GSDL 3PGFH 1GC1H 2ERJC 2ZPKH 4XMLL 4UBDD 5E2VH 4G80B 4G6JH 5GGSB 2XTJD 4BJLA 1CTOA 3QULA 5E9DD 2W1NA 4RZCA 5C09E 2LVEA 2VKXA 4NKDA 4LSTL 4R96B 5TFSH 3C60C 2AV7A 3BDBA 3ABZA 4L3AA 4GAFB 4WDIB 2A2QT 3C09C 2PO6B 3ARWA 2D0HA 2MPAH 1WIPA 5CP7B 1QVOA 2BSTB 2ZUQB 3TN0A 3O8XC 1GZPA 4KY1L 3IFOB 4PJAA 1CZ8L 1U3ZA 1QRNE 4Y5YA 2NR6D 4YPGA 2JB6A 3VFVB 2FATH 4JANA 3QT2A 2XY2A 1LO4L 3BEWA 5HHPA 4LDLB 5CEXA 3O3DA 1RUPH 5L6YL 3P0YL 1WICA 1ZE3C 2OTUA 1N7MH 2EKSA 2E6QA 3NAAL 1GGCH 4R0LC 3RUGA 4XPAH 3AC0A 1MCRA 3DX7B 5F1IA 3FQUA 1PQZB 3C5JB 1SJXA 3WKMH 3BXNB 2F58H 4RBPH 5FUZL 2VDNH 2DYPA 3MRPB 4WCYL 5IQ7L 3B5GA 4XP5H 1I1FB 2HTLD 1MPAH 3SO3C 2UUDH 1KN4H 3WEXB 2I9TA 4R6UA 4LRNH 2PW2B 1OGAA 4JVUA 3GJFA 1E4JA 4DGYH 3PP4L 1OLLA 1FFNB 2FD6L 4WW2F 4GAGL 5EUOA 5T3XD 4ZO6A 4ODSL 1J1PL 4XI5D 4WIQA 1QR1A 1DBKH 2OMBA 2WANA 3C9NA 3KPNB 4UV4H 5BV7L 4HWUA 4JPVL 1G0YR 4EI5B 3CC5A 2ATPB 2Z31B 4PJIF 3RZWA 3RZCD 4M6OH 4S0TD 1PG7L 1MCOH 3TBWB 2A73B 2WV3A 3L3KA 4XPTH 4JDVA 4JFQB 3SDXB 5GRWA 5K9JH 2MQ0A 3RL1B 4CMMB 3CSYA 4GRWF 3O2VL 3RWGA 3ULUL 4A2LA 1KJ3L 5DMKB 3MJ7B 3L9RB 1IAOB 4LPTA 3GMMA 4FFYH 3FT4A 4PPTA 1ZGLP 3D9AH 4P4KA 1RMFH 5GIRB 4F58L 5IBLD 2MNUA 2Z0BA 4AIXA 1IC7H 2IG2L 1TZHB 4LCYA 3UZQA 3TIEB 4ERSL 5KSBF 4U1GB 4NM8H 4U1NA 2QADB 2L7JA 4JFED 5HYSG 3EDDA 5AYQA 4GG6F 5IMOB 3IRPX 5HDLA 4FZEH 1MAKA 2NW3B 3FJTA 5D7JB 4GRLC 4JHAL 1RJLB 5LAXA 2HVJA 2MMXA 1J1OL 5DA4A 3VI3E 3STZB 3ZL4H 3NVQA 4PJ8D 5GQBA 3KXFA 3SPVB 4LIQL 5L0QB 3GJFH 5C6TL 1QSEB 2ZUYA 3FB6A 1FHGA 3KPMA 3GMOB 5D1XB 5E7BA 3SE3C 1D5BA 4PJCF 2JLLA 4I77H 5D7LD 3Q6GL 3OBAA 5C0IA 1CGXA 2VLRD 3DUSB 3U6RB 2IAMB 1CBVH 1F02I 3AREB 3DVIA 4K2UL 2V2WA 4I9WD 5I16A 1FFPA 2WBJD 2OMNA 4FG6D 3FZUC 3HI1A 4P2RD 3RWIB 1JIBA 4PJBE 4M5YH 5D72L 2OP4L 5KJRH 4J4PC 4L4VB 5E5RB 5C2BL 4L8CA 3P4MA 3BDYL 1D9KA 3L95B 1NC4B 3CDFA 4KMTH 1FCCA 2DQIL 1NUGA 4M02A 3UJTL 4M7LT 2Z93B 4RMTA 4GBXC 3SDCB 1TJGL 2HMIC 1Q72H 3O2WL 5L88L 2YPVL 2FHBA 5LWYL 5DHYB 1PLGL 5FDYA 3FO9B 3V0WH 1LO5A 3EHBC 1QYGL 5HHXL 1MJ7L 4NJ9H 2AP2A 4R4BB 4JJHA 4WW1B 3KGRA 1FO0A 3KYOB 5FV2A 5L2KD 1CFQA 3D69A 4NSKB 1NMBL 5BZWB 3UTQA 5C0EB 4G42B 4NM4H 1YC7A 2EDJA 3JTTA 1J8HE 1SVZA 4RCAA 3AAZA 1CFTB 3VXMB 5IB5B 5CIPB 2X05A 1L0XA 2QKIA 3ZKMD 5ECJE 4R3SB 1KB5B 4KZDL 3QUXA 3WFEH 3AVEA 4ZPTB 1A6AA 1Y6KR 1AXSB 5C08D 1AR1D 4ELMA 1RIHH 2CXGA 1AR2A 3LDBB 3NCYP 4TSBH 4PD4K 4MJ5B 2YUVA 4LCWE 4Y4KA 3GIVB 5KSAC 4X5LA 1V3MA 3BH9A 3STLA 4OCWH 5D1QA 2V7HB 1XCTA 4JG0H 1E6JH 1BPVA 3UTTD 1HIML 5SWSE 3S88L 1KCRH 3OJMB 4OLWH 1MCSA 4QWWC 5TQ0L 1CIUA 2DQTL 4XHJC 2CRMA 4G80A 4M6ML 5GGSA 3U0TB 3D3VD 5ALCH 2XXCB 5AWNH 4RWHA 3H9SE 3I84A 5EZIL 3S98A 3F7YB 1Y6MR 4Z7VE 3D39E 4WDIA 5JW4Q 2JELH 1CGSH 2PO6A 2J88L 5F7YC 3KPSB 4JRWA 1VEOA 5CP7A 1VCAA 4HIXH 1TVBA 3IFOA 3EZJB 3GFUA 1WZLA 4R2GC 1FO0H 3VFVA 3WD5L 2VB5A 1MNUL 2HVKB 1UM4L 3UTSD 3WLBB 5B4MC 3ZKSD 2I26N 1T21B 1QLEH 2Z91A 2APVA 4L9LC 3DX7A 1MCJA 1PQZA 3C5JA 3MRLB 4QCIB 1VEPA 3BXNA 3HMXH 4F15B 1F4HA 1CLOH 2MWCA 3MRPA 5EWIL 3SGKC 5DGQA 4D2NA 5SX4I 1BX2B 4JO1L 1I1FA 3TYGL 1SY6L 4PJFE 2YUZA 4WU7B 2QQQA 3WEXA 3F6IA 2PW2A 5TDOB 4RX4D 2NNAB 2RIKA 4J3SA 3MGTB 1FFNA 1X5ZA 3IB4A 1KCSH 1Z9MA 4LVHC 1KIPB 3KPNA 2OR9H 1GPOH 3QPXH 4YEEA 1AD0B 4K3EH 4BZ2H 4EI5A 1KENL 4OV5B 3EW3B 4LASH 4BH7B 2ATPA 2Z31A 3I85A 5AG9A 1H3TA 4MCZB 1TCRB 2FX9L 3GSVB 3TBWA 2A73A 3DOSA 3DSFL 1CR9H 1NCCH 3Q48A 4JFQA 3SDXA 3O6FB 4GMSH 2R29L 4V1DE 4JLRB 3RL1A 4CMMA 3GHEH 2Q6WB 3NFSL 5L7XH 3RX5A 2V9RA 3I9GH 5DMKA 3MJ7A 1U3YA 3PQYE 3L9RA 1IAOA 1PDKA 1EO8L 1FSKB 3IVKB 2H45A 2CXKA 1TJIL 3BEVB 5C6PB 2V2XB 2VR9A 4QRRE 2XN9E 5I1KL 3ARDC 1C8PA 1CICB 4GXVL 1TZHA 1XIWA 3TIEA 1HKLL 3QEQE 4NC1E 1XGYH 2R1YB 3O4OC 1TNNA 4WFHE 4YWGL 4UT6H 2E7CA 3DVNB 25C8L 4HS8H 2X40A 2D0FA 4XAWL 5IMOA 3EOTL 5D7JA 2NW3A 2DTMH 5JIIA 4XNYL 5SX5H 4NHCL 3CVHB 3WS3B 5F9DC 1G9NC 3SDYL 3PQYB 2XTJB 3STZA 2W9DH 3QB7C 1FPTH 5BVPL 5TH2B 4YJZL 5FOJA 3V6OE 3BGAA 2WK2A 4D3CL 1RFDH 4OLZL 1X5HA 2XN9B 3S35L 1KJ2B 3SPVA 4IIQB 3CH8A 5DO2D 1QSEA 4XP4L 3AY4C 1OAXL 3WXVL 1A02N 1HI6B 3GMOA 5D1XA 4TRPL 3FB7B 4HXAL 1HHHB 1KOAA 5K59F 7CGTA 2PW1A 3DUSA 3U6RA 3ULVL 2IAMA 1BFTA 1NSNL 2GAZB 3AREA 3W0WB 2JCCE 4P9HH 1E6OL 4HKZB 1AJ7L 4OLEA 5JTWA 2GJ6B 4D9LL 1GIGL 3UPCA 2FZ3B 3RWIA 3LS5H 5IESH 4AG4L 4L4VA 1F90L 4JRYB 4M4RA 4ZODA 1P7QD 2ADIB 5E99L 2FECI 1EUTA 3L95A 1NC4A 4EXPX 3EKCA 5BXFB 3MLPA 4LVNB 2Z93A 1NCTA 1I9JH 4XP9H 4J3WA 1AGBB 5IK3B 4IRSB 5DHYA 3RWEB 1P84J 4I8DA 5D5ME 4PJEF 3D2UD 3OF6A 2PXYB 4G5ZH 1U58B 3I3DA 1T4KB 4R4BA 4WW1A 2FDBP 3U9PH 3LQAL 5HSFA 3KYOA 2I07B 5FAAA 3VXRE 3IDUA 4NSKA 1EUUA 3C8DA 3GI9L 5BZWA 1QLRB 3RZCB 2BY1A 1IBGL 5C0EA 3SGJA 4G42A 1MFBL 1I85A 2XA8H 2UYLB 1OAUH 4JO4L 4YPJA 4XPHL 5E7FA 1YECH 2VR5A 1CFTA 3VXMA 5CIPA 3QEUA 4HWZB 3M1BB 1ZXQA 1NLDL 1ULVA 5D5MB 2FH8A 3BX7C 1E28B 4R3SA 3MV7E 4AMKH 1KB5A 4JJ5B 3TWCL 2B5IB 3INUL 1WIOA 4ZPTA 1JGLH 3TNMB 4TSCL 2MCPH 4MJ5A 1T0MB 4MAYC 1IAIL 2K7PA 3EYSH 3GIVA 5EFIB 3EFFB 2ZKHH 2NY2D 1EFQA 3CU1A 2V7HA 1MLCB 3S4SG 3DYMA 4HC1A 4JQVC 4WEBL 3U0TA 2XKSA 3ARBC 3AGVA 3HR6A 4K9EH 1FYHB 2EDEA 5E8EB 4D0BB 3ZDXE 4ZNEA 4PJ8B 3F7YA 4Y5VB 2X41A 1F42A 2A6KB 4PREB 4TQEL 3KPSA 3ZTNH 2VZVA 4NN5C 4LSSH 1F4YL 4GMTH 4N8VG 1MJ8L 1BGXH 4F57H 4PJ7B 5GGTL 2VLRB 1FNFA 1KBGH 4NBZB 4AYFA 2HVKA 4KAQL 3WLBA 4JM2C 2BJML 2J3SA 4GAJH 3RVVC 2PYED 5DRWB 1T21A 2M1KA 4ZUWB 3BIAX 3L5XL 4GQ9H 3NGBC 4WI2A 3E6HB 5CIPH 3MRLA 3KPPB 3HNSH 4OZHB 2FBOJ 5HHVH 4NJAH 1KB5H 2R39A 2B4CL 1GJIA 1BX2A 1R0AL 1Z2KA 4WU7A 1RURL 4WFGD 5AZEH 4WTZG 5DYOA 5TDOA 1F13A 4N90E 2NNAA 4LVOB 1QFWL 1BD2E 4UV7H 3MGTA 1JHKH 4X6DE 1BVKB 3JBG7 3AB0B 4OCYL 1KIPA 2FO4B 1AD0A 1T04B 4AQ1B 3HS0B 4HXBL 4OV5A 4XCYB 2VUOA 4BH7A 4GKZA 4MCZA 3KYKH 1RPQA 4U4BA 1TCRA 2HWZH 3GSVA 1UXWB 2LQRA 2VZOA 1RZJL 2VXQH 4R97B 3O6FA 3ILQD 4G8FA 2BNQE 4JLRA 2UVEA 2Q6WA 1GAFL 4HMEA 5EIVA 2VWEC 1MI5B 4KDWA 1OP9A 1FZOB 1VDGA 5GSRB 2OXGA 4WI4A 5TPWL 1CLZL 4Q7DA 4Y2DC 3IVKA 3WJJC 1GYAA 2V2XA 3PDDA 1FZMB 3EYFB 3QIUC 1CICA 5C08B 5GZOD 3L5WB 4N5UA 3K0WA 4FFVD 2R1YA 5DWUL 1H3WM 2APTA 4RFEB 3MRHB 4XPFH 3ULUF 4UILH 3DVNA 4I48B 4YIQB 2L0DA 1RZIA 2AERT 5EG6C 4L1HA 1W0VB 4MA8H 3UTTB 4KJQC 4PY8I 4K7PL 5IWLC 1LDPH 2NY3D 4I3SL 3WS3A 3TBSB 4U6TA 3WLWC 4OCNC 4ZSOE 5TH2A 2YPLD 4DFHA 4RISH 4G3YH 1JJUA 1KJ2A 4IM8A 4IIQA 3CUPB 5GGQH 2R23B 3MOQA 3VRIB 1HI6A 2FIRT 4P5MB 2XWJA 3FB7A 1MCBA 1ORSB 1HHHA 4H5SB 1UG9A 4TVPH 2VDKH 1VFOA 4XT1C 2GAZA 3V9FA 3W0WA 4HKZA 2XFXB 4BKLB 2GJ6A 1M6OB 2FZ3A 1WBYB 5I30L 1FNSH 3TA3D 1QG3A 4NNXB 4XNZC 1GHFH 4JRYA 5FCUL 4KUCF 2X10A 2PCPB 3QO1A 3TVMD 1J87A 2ADIA 3BUTA 2YHGA 2EE2A 3KAAA 5JHDD 3QFDB 3LKQB 3MV01 5BXFA 3LN5B 3EBAA 2G5BB 5DGRA 1NKOA 2CDEB 1KLUB 4TNVF 3V4PL 2VDOH 4M43L 3NA9H 4GO6B 1SM3H 3LEVL 4D9QE 1AGBA 3MRBB 4ZTPH 1A7PL 5IK3A 4IRSA 5BZDB 1ZKAA 2EDFA 3RWEA 3S3SA 5IIEB 4DN3H 4XNMB 1XGPB 2LTQC 2PXYA 1ZWIB 3U7YL 4WI9A 3GSQB 2I5YH 1ADQL 3PF2A 1U58A 3C6LB 1T4KA 3RU8H 3QBTB 1XZ0B 2I07A 4B7LA 3CVHH 4HZLB 1QLRA 3RZCA 1NMCB 2DQUL 5C09D 1WT5A 5I8KH 2UYLA 3ZE2F 1BQHB 3NIDE 3RIFF 4DAGH 2ADJB 3U30B 2WP3T 5BVJB 2E9BA 4HWZA 3M1BA 1NH6A 5T1KD 5KVDL 2EXWD 3ZYIA 1ZOXA 1E28A 5I18L 5J11B 4JJ5A 1UWXH 4YDIL 3OWEA 4WWKD 4GAYB 1YJDH 1ZV5A 2GI7A 3TNMA 4HK0B 4PP2B 4RGMB 2HAZA 1JGDB 3M8OL 2VR4A 4UTBH 4TUKL 4DN4L 1N6UA 1T0MA 3LS4L 5EFIA 3EFFA 4E9LA 1IM9B 1R3JB 2DQEL 2XG5A 3OPZL 4JFEA 4L5FH 3S37L 4OGXH 3GI8L 3LSOB 4WRLA 5IBTH 1YMMB 4HJGB 5F7MC 4AQOA 4NUGH 1P4BL 1MLCA 2FGWH 3BP4B 3HUJE 2DM7A 1JGVL 1HYRC 4OQTH 4WV1C 1FNEB 5EIIB 4KJPD 5E8EA 4D0BA 2OM5A 4XWGH 4PJ8A 4Y5VA 4X83A 4YUEL 5E6IB 5IW6B 3MLYL 3I6LE 3UO1L 2A6KA 4PREA 5E6ZA 3EUUA 4NKQB 1X5FA 4YBQC 5JA8B 32C2B 5DS8B 1OAKH 5DJ2B 5F9AC 3QDME 4PJ7A 3C6SB 1WVZA 4KTYA 1UWGL 2VLRA 3I3EA 3LEXB 1OY3B 4XCCH 3WDIA 4PB9L 3MXVH 2X7LB 5F7FA 2F5BH 1RV6X 2RFXB 5DRWA 2VDQH 1U8JB 2HLFD 4ZUWA 3NCMA 1UGNA 3E6HA 3KPPA 4OZHA 5CFHA 1B6DA 4HG4J 2HLAB 5D70H 3BKCL 5CZVH 4TPRH 2V2TB 1E4KA 3DMMB 4MZ2A 2CK0L 4XMKH 5I71C 1XF4B 1BJ1H 1J0IA 5HGDB 4YFDB 2OK0H 2EYTB 3ALXA 3S6CA 1LEIB 1KC5L 4TTDC 4DGVH 4AJ0A 1BVKA 1U8QB 2FO4A 3DVFA 4M1CD 1T04A 3HS0A 4LQFH 1P53A 4XCYA 1J0JA 3MOBL 1I3GL 4UNVA 4WTWA 3FTGB 4NQEE 1UXWA 3RBGA 4RDQG 3VFSB 3QZWG 4X6CE 5TE7L 2XQYG 1AD9B 1A3LL 2FH6A 1FJ1B 5SWZE 3MXWL 4KDVA 4N0YH 1MI5A 4PTUB 1FZOA 2GIYA 1JTPA 2FEEI 2HTKD 4OD1H 5GSRA 5CBEB 1SJHB 3TCLB 1KCVH 1FZMA 3NN8B 3EYFA 4R4ND 3VG0H 1QFUH 3QG6B 1DBBH 5C08A 1TZIA 2R1XB 2VDRH 3L5WA 3WN5C 4RWYH 3WS6A 4RFEA 1D5IL 3MRHA 5HY9B 2W38A 4YIQA 1I1AD 1SJEB 4OM0H 4HEPG 1W0VA 3UTTA 2WWKO 3WFDH 2GSGB 1UB6B 3VW3H 3TBSA 1R5IB 4XVTL 1VENA 1XH3B 4HFUH 1FGVL 3V52H 1YEJH 1JZ8A 5IGXH 2W0KA 1RUPL 4P5TD 1Z5LB 4LMQI 2X1WL 4OIIH 3CUPA 2R23A 3X3FL 2E7HA 3VRIA 3MRKB 4P5MA 2C3HA 4G8GB 3WMSA 4WO4B 3MBED 1ORSA 4H5SA 5GHWH 2YD3A 2VDNL 4UIMB 4RMQA 4CU6A 5E1HB 1DQLL 4LGPB 4Q6IC 5JIKA 3JUYA 4RQQB 3P0GB 3IF1B 1I7RB 2XFXA 4H8WC 4BKLA 2EO1A 3E2HB 4LPWA 1EHAA 3UPRB 1M6OA 4X4XB 3ZTJH 3G08B 1WBYA 4FTVE 4G6KL 4NNXA 4J23A 1VFUA 2PCPA 3U48A 2XICA 2VAJA 4ZS6D 2VMFA 3H42L 1JHLH 2X1OA 4EUPH 4PLJC 3TO4D 5JXEA 5K9QG 3JXAA 3WIHL 2W65B 1MWAL 3UBXI 1PW3A 2P5WE 3QFDA 3LKQA 5CD3B 3LN5A 4K94H 1A4JB 4O9HL 2G5BA 4OF5A 1DN0B 5DD0L 5EU6B 2CDEA 5CSZB 1KLUA 4EKXA 3C5ZC 1DEEB 5AEAA 4XVSH 2VZUA 1JUFB 5D71L 4LCWD 3MRBA 2FEDC 4XBPB 2FIKB 1OP3K 5BZDA 5K9JL 4YK4C 5IIEA 3HE7C 4XNMA 3UJJL 1XGPA 2D2OA 4G7YH 5EUKB 4MNGB 1ZWIA 4KKBD 3BW9B 3BPNC 2XXMB 3GSXB 3C6LA 1N5YL 3SCMD 1JYNA 1T83C 1YC8A 1XZ0A 3ZHDA 3GMRB 3O3AB 5MI0B 3VA6A 1Q94B 5I1LB 3QHTC 4HZLA 4KPHL 1F00I 4JY5H 4E41B 1DQML 3C5SB 4RGNB 3H9SD 4KRNA 1BQHA 1CLYL 2UWEB 2ADJA 3H9YA 5BVJA 1YDPB 5LCVL 3OAZH 4DW2H 4S0SD 1OM3L 1J18A 5CJQL 2M8XA 4JPWL 2C4FT 4GAYA 3I6KB 4HK0A 4M7KL 4PP2A 3RTQB 2JKXA 1JGDA 2NZIA 3I02B 1QBAA 3I3BA 4HCRA 3CFCH 3TH2T 4LKXB 1IM9A 2CGRL 1R3JA 2Z8VC 1P1ZB 2QQNL 1TQCB 4NGHH 3LSOA 3VWJB 1YMMA 2JJUA 3HC0B 2BRRH 3BH8B 4HJGA 3EJZC 3TZVC 3RQ3A 4Y88A 4M62H 2Q8BH 3BP4A 3FO0H 1C5BH 2VE6B 5DJ8B 4BQ8A 2NY3B 4UQ3B 5FYLL 2DJUA 5EIIA 1FNEA 5GGRY 3WBDA 4P46C 1YPZF 1OAYH 2YPLB 5BQ7B 5E6IA 5IW6A 2IC2A 4GRWE 4M5YL 5FUOL 32C2A 1LE9B 3BHBB 5DS8A 1F3DJ 3PXJA 1GGTA 5DJ2A 3C6SA 3KPOB 4FA8A 1S7UA 3LEXA 1QNZL 3Q0HA 3ECBB 4I0PB 5A40E 4PJIB 2X7LA 2DOCA 4KKCD 4A6YB 2DQJL 5KSBE 4I2XE 4WVRA 2RFXA 1IC4L 5I8CB 2BOBB 2LU4A 3HZVB 4V1DD 1U8JA 1K6QH 2Y5EA 3MCG1 2VZSA 3GSNB 1Z0NA 4GG6E 4OAWB 4YDLB 3RGVC 3PABB 5ESQB 1HSAB 3KWWB 5FGCB 2HLAA 1W8OA 2DQHL 2RHEA 2LU7A 2V2TA 2I27N 3DMMA 2E3VA 1CD1B 3WCYA 2P49B 1XF4A 5HGDA 3O6KH 2EYTA 2R9HD 3QEQD 5I2IB 1LEIA 4H88H 4WFHD 3NMEA 1A21A 1DSFH 2NY1C 4I2XB 5DFVC 2DB8A 5DVMA 4MCYB 2HP4A 5TQ2L 2HFFA 4PJCE 4N0UE 2VLME 2HYMA 3P4LA 4KROD 1RD6A 2Z9TA 4FP8H 3MRQB 1AQKH 3NPSC 3FTGA 3QIBD 5LGHL 1EO5A 1R3HB 2H9GB 1IL1B 3EJJX 3HI5H 1IKFH 4JR9L 5DFTA 3VFSA 1BJ8A 4G43B 2KKQA 2EXYD 1FJ1A 5F97E 1RZGB 4NZJA 3R8BB 4OCWL 5C8JB 5JXAL 1JP5A 4PTUA 3MLRL 3IJYB 5T1KB 1VHPA 1JPTH 1Y0LB 1YN6B 4ZAKB 4Z95L 1IGMH 5C0AB 5CBEA 1SJHA 1K5NB 3TCLA 1KXTB 3NN8A 4WWKB 5ENWB 5DJCB 3QG6A 2R1XA 3P2TA 1I7ZB 4BA8A 3NCJH 5I1EH 2CO7B 1RUMH 5D1ZC 5HY9A 3U4AA 1KJMA 1SJEA 3LKNB 2AK4E 4QRTB 2YS4A 1H5BB 5E24E 2QL1A 1MVUB 1D7FA 4MA7H 4MQSB 2GSGA 5JZ7D 1UB6A 2A9NH 2IBGA 3K2UL 1MRCH 4MB4A 5C07E 1R5IA 2IMMA 1NDMB 3OB8A 1PBYA 2VKWA 2QTEA 1FO0L 5EN2B 1XH3A 2VDML 1X5GA 2BDNL 1FIEA 1Z5LA 4FOMA 5I75B 3K8LA 3O9WB 3DRTB 1KYOK 1TETL 3MRKA 2CLRB 4G8GA 1BOGB 4PRIB 2DL2A 4WO4A 4LOUC 1KCLA 5B38B 2F54B 1WFTA 2V5RA 3QUMH 4UIMA 5TJWK 5TE6L 3Q5TA 1KTDB 4X6BB 4Z18A 4RQQA 3IF1A 3G5ZB 2R2BB 43C9B 4PRAB 4ONOA 4Z7UE 1Q0XH 5CHNB 3UPRA 5HHMD 1WAAA 4ODTH 2IPUK 4X4XA 4ZS7L 3G08A 1VA9A 3T04D 4I13B 4AENB 3UTPD 4K71C 3CZFB 2P8LB 4U05A 2R0WH 5EA0L 4BZ2L 1A7QH 1AI1H 2W65A 5CWSB 2DMBA 3TYFB 5I1GL 3QUZC 1RUAH 5CD3A 1A4JA 5GS0H 2Z92B 1DN0A 5EU6A 5BS0D 5ILTH 1DEEA 1JUFA 1X6LA 3ZSSA 1CR9L 4M1GL 4XBPA 2D3VA 2FIKA 4FQXB 1NGQL 4GMSL 4KWUA 3NACL 1P69B 4YHZL 5EUKA 4MNGA 1FCGA 1HCVA 1I3RB 4UAOC 3BW9A 4MJ6B 3TPKA 3GSXA 4CADB 4ODVL 3BUYB 4LVEA 2N56A 3GMRA 3O3AA 2EC9U 1FVCB 1Q94A 5I1LA 1NL0L 5BCAA 3QJFB 4E41A 3C5SA 4H0GA 4GUPB 2NY4B 1OTTD 2UWEA 1YDPA 1YQVL 3CXHJ 1PX3A 1MOEA 1Q0YH 4HS8L 2VH5H 3VFPB 5A43C 1KEMH 4LSRL 4QNPF 4K07A 5C70A 3QUYB 4JDZB 1BOYA 1U91B 2VDLL 1AO7E 3I6KA 3RTQA 3FFCE 4KQ4H 4YFEA 3I02A 2DWEB 3HA0A 4N0RA 3UJIH 4LKXA 1FNHA 2X89A 3HE6C 12E8H 1P1ZA 5HYQA 5IVZB 1OTUC 5H37G 2QLVB 3VWJA 2FRGP 3VFTB 2Q20A 3C60D 3HC0A 3BH8A 3P9MB 4DZ8B 4DZBA 3QXUA 2V6HA 1F6AB 3VE0B 5DJ8A 2VE6A 3TV3H 4UQ3A 5CINH 1RULL 1MIML 4W4NA 1TQBB 4L8SB 2X1QA 4I18B 2O5YH 3O8XD 2YPLA 3AMLA 3UDWA 5BQ7A 3A6BH 1IGFH 5C3LD 3NIGF 2PN5A 4XTRC 2Y5TB 3BHBA 1LE9A 1OTSC 3MBEB 4EQ3A 3HCVB 2CUHA 3KPOA 2KPNA 5E8NB 5DMIL 5IM7B 4KZEL 3DETC 2O61B 3ECBA 4I0PA 4PJIA 4YHKH 4XP9L 4L1DA 1UCBL 4A6YA 4YHPB 5JHLH 3BQUC 5I8CA 2BOBA 5AAMA 3HZVA 2BNQD 2VDPH 5SWQB 1M7XA 4CVZB 2OL3H 1GCFA 1A7OH 2DIBA 4OAWA 3PABA 2J6EA 3T0EC 4XZUB 5ESQA 1HSAA 3KWWA 3TESA 5T5NG 3TO4B 3I50L 1S5IH 4S1DC 4MQXC 3BMVA 4OI9A 4NQDE 4YC2C 1INEL 1CD1A 4KDTC 3HAEH 1F45A 3TJEL 2XA8L 1WBZB 4MS8C 4QTIH 5I2IA 3ULVC 5C0GB 3KYAA 2AGJL 4OLXH 4MCYA 3RVWC 1RUKL 3BWUC 4FQQB 5K59E 3UYOD 1B88A 4I3RH 1T1XA 3MRQA 3LKPB 1R3HA 2H9GA 1IL1A 2BNRD 4JPIB 2FSEB 4G43A 1AHWB 3U0WH 2ZKHL 4M93B 5J3HC 1IT9L 2YA2A 4B41A 1MCFA 1RZGA 5C8JA 1PEWA 5CJ5A 3IJYA 5T1KA 1YN6A 1Y0LA 3VFOB 4ZAKA 4M3JA 5C0AA 4YEFA 3MZGB 2AI0H 4DUWA 4CN6A 1K5NA 2YRLA 4AEIL 2Q8AL 1UJ3C 3IU4H 4WWKA 4Z8FH 4HWNA 5ENWA 5DJCA 2XKUA 1GL4B 4GFTB 1ZHNB 1I7ZA 3JWDC 4GRLD 3VFGL 1NPUA 1IFHH 1JK8B 3B3IB 5FHBL 4PJEE 4P57B 3VRLF 3AM8A 3BGFC 3LKNA 3T0VA 4QRTA 2ED9A 3HFML 5T3ZE 3GSNH 1NLBH 5IG7B 1H5BA 1NDGB 3F12B 4S1SH 5CZXC 1MVUA 3EGSB 2J6EH 3F58H 1EJ6A 4GRWH 1S7RB 2H32B 1NDMA 5EN2A 4BZ1L 3ES6B 3JWOH 3KYMB 2X4SB 5B8CB 2QQLL 3CFDB 4DKEL 3O9WA 3DRTA 2P24B 2CLRA 1YEGL 2ADFH 1BOGA 4PRIA 3L3IB 3FZUD 4RA3A 5B38A 2F54A 1JMZA 4JB9H 4S1RL 4EN3C 1AY1L 5CEZH 1KTDA 4X6BA 4M9OA 3OB0K 1PG7W 2VLJB 4NUJB 3G5ZA 1CK0H 2R2BA 43C9A 4PRAA 5KG9B 4PY7B 2H8PB 1AKJD 5CHNA 4FQ1L 2W9EL 1B90A 4UV7L 4B5EA 4AENA 2WIIB 2AXJA 1NMAH 1YEHL 3CZFA 2HMID 3ARYA 4P9ML 4U6VH 3VXSE 5CWSA 3KR3L 4OUUB 3TYFA 3EHBD 3TBTB 5I1IL 2Z92A 4HC1L 3EAKA 3EYUH 5D2LF 2W92A 5A2JH 3DHJA 1G84A 3UX9B 4C58B 4PLNC 1QEWB 3T2QA 5ADOL 4OKVB 4RFOH 1DTUA 1VGKB 3VH8A 1I3RA 4JRXD 3BAEL 2UUDK 4MJ6A 4CADA 3SE4C 3BUYA 1T2QH 2Y06H 3OAUH 4KROB 2VRAA 2ID5A 5MEND 1FVCA 3BESR 3VGEA 4U7MA 3QJFA 1A6VH 5JA9A 3QAZB 3AS2A 1EEYB 4GUPA 4Z7NE 1QPPA 3EJYD 4MXQC 1UB5B 3I6LD 1OAZH 2LAGB 1F4WH 1WGOA 3VFPA 3UROR 2N1KA 1N64L 3QCTH 1JCKA 3QUYA 5KSAD 4JDZA 3QDMD 5B3JE 4N8PA 4IDJL 3IDMB 4V2BA 4XMPL 3FAWA 3ZHKA 3DYOA 4YHYB 5KZCB 4PJXB 1HHIB 1IVLA 5CILH 3KPRD 4XHJD 3B9AA 4QRSB 3FL7A 5FYKL 3RUGF 3SJVD 3ZTJG 5IVZA 8FABB 4DOHE 4PUBH 5B39G 3VFTA 1P4IH 4YHMH 3P9MA 4DZ8A 4HQQH 1F6AA 4I4WB 4J3TA 4EUPG 3VE0A 2J5LC 1OCWH 4B0MM 3KDMB 1RIVL 2WW8A 5AG8A 4L8SA 4I18A 1MAML 4X8XA 5DQDL 1LO3H 4R2GD 5EUOF 1LO0H 4YFLI 1T3FA 3GNMH 2EDQA 2Y5TA 4XXDB 5B4MD 3MBEA 2YMXH 3HCVA 1T1ZB 5EC2A 1A5FL 1GH7A 5E8NA 3GJFK 4LFHG 5JW4N 5IM7A 2O61A 4KGLA 2ENYA 4NQED 5DMGC 5E2JA 1YEEL 4YHPA 1P6FA 1JNLH 2D7PA 2MJWA 5DRNB 3ULUE 2GTWB 5SWQA 3IETB 4S1QL 5D6CB 5SWZD 1P7KB 1Q9WB 4PRNB 3H6JA 4K3GA 5ISZB 4XZUA 4XWOC 2EDRA 3TO4A 3HC4H 4NQSA 2HT3C 2QQKH 4NZTL 3CSGA 5CJXA 4ONFH 3AU1B 4Q0XL 4UTAL 1WBZA 5FGBA 4XNQB 4DGIL 1KTRL 5C0GA 4OCSH 4DAGL 1KJ2L 4HJ0D 3MROB 1C7SA 4FQQA 5F71A 1NBVL 3V7AG 5L8JB 4P2QE 2WBJC 2QSQA 4JPIA 2X70B 3O3EB 3LN9A 1URLA 4LIQE 4FFZL 1H8SA 1HZHL 2FSEA 1AHWA 1T6VN 3A0OA 3ZT6A 2WQ8A 1F97A 2UZIH 2B8OT 1CU4L 3ET9F 3LKRA 2X6MA 1OAQH 3REWB 3BD5A 3O4LD 5CGYD 4C4KO 5KVEH 1YMHB 2R0LL 1FNGB 2HKHH 1ZHNA 1G9EA 4JFZL 3X3GL 3ZYZA 4Z7QF 1JK8A 2YKLH 4H20H 2ERJB 3GKZA 3B3IA 5HI5C 3MJ6A 1CDUA 4FTVD 3CJJA 1BQHG 3K8KA 3MV8E 5GJSH 5T3XL 5LBSH 5IG7A 1NDGA 1PG7X 3F12A 3EGSA 1IEBB 2C3VB 1S7RA 2P5WD 2H32A 3H3PH 1EJOH 2XZQL 4Y1AE 6FABL 2C3GA 2C1PB 3QRGL 4Q9RH 3ES6A 4YLQT 5F88B 3KYMA 5I76B 2CLZB 4WUUB 2X4SA 3ZE2E 3LQZB 5B8CA 3CFDA 3GMNB 2DDQH 2VDQL 3JVGC 2P24A 4GG8B 4YHNB 4FZ8H 2IEPA 3O6LL 4PGJA 3L3IA 1RAMA 4PG2C 4J7RA 2HJKB 4R0LB 1AR1C 1CT8B 2ICWJ 4PJ9C 2VN4A 5F1NB 4KVCH 5CZVL 2JIXD 2D7MA 4YX2L 2HFEB 2VLJA 4NUJA 1ITCA 3H9HB 4MXWH 3GZKA 4XBEH 2EIDA 4LRIA 5KG9A 3EDKA 2H8PA 3GHBH 2YPKB 5DRXB 3VD3A 4ZTOH 5E6YA 4YXLH 5E08H 2P7TB 3CMOH 2PTVA 2LE9A 3DV6B 3RWDB 2WIIA 5DJ0B 5DSCB 4JY6A 2XZZA 4IJ3B 3JWNC 4HS3B 2YOCA 1N6QH 5IEHB 4OUUA 4JN1L 2A0LC 3TBTA 4JFHE 1A7NH 1UWEL 4ELMF 1JPST 4F8QA 1OD7A 1I1RA 4X4MA 2FBJL 1OB1B 1QEWA 1VGKA 1NFIB 2YZ8A 5KAQG 2BCKB 3RNKB 4N0YL 4X7SH 5FHAL 1RZ7L 2X44D 2H1PH 2ZCKL 1KCVL 3B9KC 1FP5A 2Z8SA 1T0PB 4LAQH 1QFUL 4I0KA 3U1SH 2R8SH 2VDRL 1EEYA 4NIKB 2G60L 5AYUH 1UYWL 1UB5A 1DFBL 1EH9A 4MAYD 1X5XA 4ODBD 1MIEL 2XOTA 2X4NB 3RVUC 3N1MC 2J4WH 2PF6A 3IDMA 4NZRH 1DBJL 4Q9CA 2Y36L 3DPBA 3MNZB 3HPLB 1G9ML 3S7GA 1CDHA 4MA1C 3FQTB 3VD7A 2YD5A 4PJXA 4L4JA 1HHIA 1K3IA 4GRLB 2BC4B 2R0KH 4QRSA 2Q86B 4MNHB 5EOQL 3ARBD 8FABA 3WXWL 1D5ZB 1L0QA 4BM7A 4NZDA 5ICZB 3SBWC 3SQOH 5DRZB 4I4WA 5I8OH 3KDMA 4QT5B 5F9WC 5CCKH 1HH9B 1CXIA 2Y1VA 1IAIM 2NY5L 1AXTH 4ZOCA 1DBAH 1G7JB 1GC1C 1J5OL 3L3DB 4WHYH 5C71A 5T33L 1N5AB 4MHHI 4XXDA 5HHOB 4JM2D 3RVVD 2EDOA 1T1ZA 2VLMD 3WL9B 1NAMB 1ZHLB 3HZMB 3N85L 5EOCL 1QBML 5J12C 1H3XA 1QHOA 5T5FL 3SDXF 3GRWH 3B83A 1AKJB 1LEGB 4ZYKB 5DRNA 4OCRH 3I2CH 2GTWA 1TTGA 2AVGA 3IETA 5D6CA 3RDTB 1Q9WA 2D7TL 2JF1A 4GBXB 1VPOH 3BRFA 3DXAE 4PRNA 2R69H 5ISZA 2E5EA 3V5HB 1DLFH 3LOWA 2FHFA 2O5ZH 2VQ1B 1FL3B 2VERN 1OT1A 3RAJH 4GSDH 1IEHA 4AIOA 4JKWA 5BS0A 1JMXA 1KB9K 4XMLH 4PS4L 4JY5L 4X7TB 5F6IC 3P0VH 4KHXL 3AU1A 4GJTB 4XNQA 1NGWB 1MJJB 4LSTH 5IFJB 3SDAC 4HWBA 5SV3A 3AS0A 5C0FB 3WO4B 1U3HC 4JRXB 2GJZB 5C0JB 1IJ9A 2AK4D 2ZCHL 1JYXA 3MROA 4LHUG 4HUUB 1EHLL 3QNXB 2N7AA 1DQQB 3ZMRA 3QFJD 1T89C 3H8NA 4QHKJ 5C07D 5MENB 5JQ6L 4U1KB 3CGTA 4KY1H 1MCWM 1CZ8H 2X70A 3O3EA 3E6FB 4Y2DD 4LSDA 5GRJH 1LO4H 1QFWM 5L6YH 3P0YH 2D7OA 5EH1A 2YD9A 3NAAH 3REWA 3CLEL 2BRRL 3RWFA 3ULVE 2IANE 2IMNA 1OSPL 4AM0B 1LP9B 1YMHA 5FUZH 3OL2A 1FNGA 4NP4L 1DJSA 3QXWA 5IQ7H 4KJQD 3IFLH 5MERB 1KACB 3KPRB 1RVFL 3WLWD 3SJVB 3PP4H 2FD6H 4GAGH 3CDYA 3C60A 4ODSH 1J1PH 3LN4B 3T3PF 1IEBA 5E70A 1UM5L 2C3VA 3E8UL 5BV7H 4JPVH 2BMKB 4XNUL 4LEOA 3BWAB 3MNVB 4LSUL 4BFEA 1MCWW 2C1PA 3FAXA 2NXYD 5F88A 2CLZA 4OCXL 4WUUA 1PG7H 3LQZA 3GMNA 3IJHB 3WNPA 3HAEG 4R2GB 4JFFD 4YHNA 2E7MA 3S8WA 4PJHE 5CKGA 4OGYL 4QXGH 3O2VH 3ULUH 3L5JA 1HYSD 1KJ3H 2Z8RA 3RFZC 2HJKA 4R0LA 1CT8A 5F1NA 4L9LB 3OMZA 3BKML 2HFEA 2VLKE 3H9HA 3HG1B 4XAKE 1B0WA 3D85D 3TP4A 5DRXA 4F58H 2YPKA 2PTTB 3MJGX 2P7TA 4HCRL 4CUCA 1T22B 3BMWA 4ERSH 3DV6A 3MJ8B 3RWDA 4NO3B 5DJ0A 5DSCA 3PG2A 4HS3A 4DEPC 4U0QB 4ZXBB 5IEHA 2BERA 1G7PB 4F8TA 3S35X 5FUCC 4JHAH 3FT3B 3FFCD 1J1OH 1YPZE 3O0RL 3L5IA 1OB1A 3IDJB 3Q2CA 3BVNB 1ODAA 1NFIA 5FGSA 3WV0A 2BCKA 4LIQH 3RNKA 1TITA 3H9ZA 3SE9L 2DIJA 3H0TB 3PWNB 4X98B 3K81A 4TNWF 5I6XC 2NQCA 3Q6GH 1JBJA 4Y19D 2MKWA 2BNRA 4K2UH 1J9CT 3HB3C 3NFNB 4PRPE 4TNWK 3ARDB 3CU7A 5HPOA 4X80L 5D72H 1QZ1A 3JV0A 4HHAB 2OP4H 2F19H 2QJDA 3O4OB 2X4NA 5C2BH 3O4LB 4HJJL 1U9KA 1BQLL 2A9NL 3BDYH 4RGOL 1CXLA 1ZHBB 1HXMB 3ARPA 3MNZA 3HPLA 1MFEL 5DQJB 1A47A 4NRZB 3FQTA 1DR9A 3VDCA 1F2QA 4GRLA 2BC4A 3SY0A 1WZ1L 3NTCL 4JFDE 5EBMB 2Q86A 4MNHA 3O2WH 5L88H 4TN9A 5LWYH 4W68A 1ZA6B 2D9QB 3GIZL 1S8DB 3MRIB 1KTLB 1QYGH 2DLTA 5DRZA 5HHXH 4OV6F 5HYJE 5ITFB 5IR1B 3MO1B 4YBQD 3QEHB 5HGBB 2D4DA 4QT5A 3U0PB 4NQDD 5I1CL 3SE3A 4MVBC 2FEEL 1HH9A 1F6FB 4RMRA 5GXBB 1NMBH 4NWTL 1G7JA 4PBWD 3LD8C 3L3DA 5HDOA 2P46B 4MDIB 3RX8A 1TVHA 1T0NB 4QRPE 1CDBA 1N5AA 1UEYA 5HHOA 4L3EE 1S7VB 3KNBB 1CD9B 1A7QL 1J11A 4FXLA 3WL9A 1NAMA 1ZHLA 4PJ5E 3HZMA 4J4PA 4EIZC 4KZDH 5GS0L 2DIAA 1T66D 1JPGB 1T5XB 4U1JB 2VISB 3UAJC 5ANME 5E4IA 4FABL 4PY8J 4PB0L 1AKJA 4ZYKA 4OZIB 5D7IF 5DK3A 3RDTA 2D31B 2AEPL 4GBXA 5J6HB 3J8F7 3V5HA 1NCBH 2VQ1A 3DUUB 1YYLH 1FL3A 1A6ZB 4TTDD 4ZG1A 1HIMH 3S88H 3LEYL 5AUMB 2ICEB 1P6AB 2VAAB 2Y07L 2UY6A 5TQ0H 2DQTH 2VXTL 4X7TA 3REVB 2ARWA 4M6MH 3OV6A 2OJZL 3T2NL 4S11A 2CR6A 1NGWA 1MJJA 3QUXC 2LV4A 1ZANL 5EZIH 4MNQB 4LCCB 3TC9A 5IFJA 4HLZH 1Q0YL 4JRXA 1PAMA 2GJZA 3P9WB 4FQJL 4X9BA 5C0JA 5LXGH 5AD0B 3RKDC 2J88H 5T3ZD 4HUUA 3ALPA 3QNXA 5CLTA 1BFVL 3WDHA 5DVNA 1DQQA 3ZHLA 5MENA 4U1KA 4K8RL 1U95B 3FB8B 3E6FA 1BBJB 2E9IA 3WD5H 1P5UA 4D94A 4OZGB 3TA3C 1MNUH 1NGXB 1UM4H 1EEZB 1CCZA 4QOKE 1OL0A 4L9DA 1F3RB 4MAYB 1KCUL 3IFPB 1IQWL 1E4XH 1XT5A 4AM0A 1GZQB 2BVPB 1LP9A 4ZPVB 1D5XB 4Y16C 3E3QC 2EEDA 2PO6C 5E5UB 5HVWA 4JO1H 4KFZC 3TYGH 4CN4A 5MERA 1SY6H 4XBGB 1N2RB 3KPRA 1IGFL 3WNOA 4ZFFB 4ENEC 1RK0B 4HUVB 5C0BE 3SJVA 3ARBB 3T1FB 5KTEL 2VXVL 2P5EB 4O2FB 2IBZX 3LN4A 4XCFL 2O5XL 3DYPA 2BMKA 4Y7MA 5EU4A 1KENH 3BWAA 3MNVA 3SGEH 4CW1B 2BY0A 2GJJA 4YHKL 3VGDA 2FX9H 1KULA 4ACPA 1T7ZA 3DSFH 2IH1B 2R29H 1U2HA 5DMJB 4G9DB 3TT1L 4QNPE 1F11B 3NFSH 1P4LB 3HR5B 4YXKL 1EO8H 4L9LA 2I9LB 3NGBB 1TJIH 3HG1A 4ELKB 5IUSA 4PLJD 4G9FB 3IDYC 2PTTA 5I1KH 4GXVH 1G7HB 1HHGB 3SGKA 3C2SA 1HKLH 3MJ8A 4NO3A 4Q6YA 3C5ZD 4P9HC 4TULH 4YWGH 3PL6B 9CGTA 5ALBL 2L4OA 2FEDD 25C8H 4XAWH 4N9GB 2UVFA 3EOTH 1G7PA 2CRIA 2ORBL 1JYVA 3BPCB 4KTEL 4HW6A 2APXA 1U8LB 4XNYH 3FT3A 4NHCH 1I9IH 1IGJB 3SDYH 5HVHB 3IDJA 3BVNA 3PWPE 4D3CH 3NIGE 4OLZH 3S35H 2XG4A 3TGXA 2CKBB 4XP4H 3WXVH 1OAXH 4F7TB 3QQ3B 3H0TA 3PWNA 4X98A 4HXAH 3BJLA 3QFJB 1I3UA 1OP3H 4CRPA 3ZDYF 1NSNH 2V17L 4YDJB 3OSKA 3VWKC 1E6OH 1B0GB 3QI9B 3NFNA 1AJ7H 4HGKC 4NNPH 1ND0B 4A6YL 3UP1A 3CXDL 2DF3A 1UZ6F 2QHLA 2OYPA 3QIUB 3ARDA 4D9LH 5JW4R 1GIGH 3T09A 1NJ9B 3LPFA 5GZNC 4HHAA 1F90H 4PJ7F 3L3HB 3O4LA 1W0WB 5E99H 1ZHBA 1HXMA 4GT7A 4LSPL 5CP3H 4LU5L 5I0DA 3IAQA 1LVEA 3EJZD 3TZVD 5DQJA 4OTXL 2ZJSL 3FT2B 5BOPA 4NRZA 5D1XC 2IFGA 1TENA 4H1LB 1U6AL 5EBMA 4HKBB 1JZ2A 1ZA6A 1S8DA 2ADFL 4JZJB 2J8OA 3MRIA 1NCNA 1KTLA 2YWZA 4OZHF 4JKKA 5ITFA 4YZFF 3MO1A 3AY4A 3QEHA 5HGBA 3NABL 3LQAH 1ONQB 3GI9H 4LGRB 1M7IB 1IBGH 2AJ3B 2IH3B 4UU9B 5DA0B 1FVEB 2EDHA 5LKNA 4MDIA 1DL7L 1MFBH 3CIQA 3Q3GB 3TJHC 4DK6A 4ETQB 4AT6B 3EDEA 4JFFB 5DLML 5DFWH 4JO4H 4K9EC 5B22A 1S7VA 5K33A 3KNBA 3SDCC 2AJXL 4R4NC 4XNZB 3TWCH 4IOSD 3RGVD 2ZOLB 3INUH 1JPGA 1T5XA 4P2QD 4U1JA 2VISA 4OIBA 4Z7WB 3S37X 3X14B 2NY6D 1FDLL 4TSCH 2OTWB 3ROOB 4OZIA 1IAIH 4X7CC 4Y89A 4P23B 2D31A 3RY6C 1NEUA 4HUMB 3BT2L 3VRLE 5J6HA 2FL5B 3DUUA 3FN9A 5EO1B 5A2LH 1A6ZA 3R06B 2EDXA 1I85C 2EECA 3CFEB 2Y06L 3OAUL 2LTQB 2NY1D 5DFVD 3OZ9L 5AUMA 2ICEA 2VAAA 3WFCH 4TOYL 1UH3A 1IMHC 1QFPA 3UTOA 1U8HB 3REVA 3RNQB 4WEBH 2J7LA 2G75B 2ZOKB 3F7RA 4F9LC 4MNQA 4R7DB 1MCDA 2FX8L 4TVSa 4MD5B 4TQEH 5LG1A 5AD0A 2WIMA 4D0DB 5FV1L 5KANG 1LO2L 3G6JB 1VKXB 1MJ8H 2CIIB 3K4AA 4Y19B 2J8UB 1U95A 4Y1AD 5GGTH 3ARQA 3PP3K 4TYUA 1SYSB 3FB8A 5FYKU 1BBJA 5I9QB 2F8VA 3BP7B 3G9AB 4P5KB 4OZGA 5DHVB 2DMCA 3QP3A 5JW3L 1NGXA 4KAQH 1F3JB 2BJMH 1EEZA 1WEJL 2XQBL 5E1AB 1UVQB 2Q76B 3MCKB 2H6PB 4KRPB 1A1OA 2OCFD 1FYTE 4MAYA 4YHOL 3IFPA 5D1ZD 4EOWL 3L5XH 5DI8B 2CUIA 5JIHA 3ZE1F 1C16B 1GZQA 2A6DB 2BVPA 4ZPVA 1D5XA 3T0BA 5D2LE 3PHQB 4EIGB 2B4CH 2L7UA 4OD3H 2Q3ZA 1EMTH 4RMSA 4XBGA 1N2RA 1RURH 4KKBC 4ZFFA 1MRDL 1RK0A 3OKEB 5D7SL 4HUVA 3T1FA 3ARBA 1X7QB 4WV1B 1QFWH 5KOVC 1NBZB 4JQIL 3GNML 3ZLQC 5IMMB 2C1OB 2P5EA 4O2FA 2Y7QB 1YNKL 1I75A 2WINB 5MEQB 3S9DB 3QDJB 4X7DC 4HXBH 4YXHL 4JFHD 4CW1A 5GRYA 4LOUD 1JNHB 3G9VA 2ENSA 1TZGL 3QDGB 5ITBL 3C8HA 2VIRB 3GBML 2IH1A 1RZJH 4ORGB 4DUXA 1EVUA 1FH5H 4U3XA 4IRZL 1GAFH 1F11A 1A1MB 1P4LA 3HR5A 3ZKXB 5F1SA 3HC4L 4PJAE 1MWAB 5TPWH 1T20B 1CLZH 2QQKL 4UOJA 2I9LA 2J8HA 1BEYL 1S78C 4ELKA 1QSFB 4G9FA 4N1HB 2QSCL 3OGOE 3QUZD 1VFAB 4IMKA 5D2NB 1G7HA 1HHGA 4OZFH 3RUGE 3LQMA 5DWUH 5E94B 2E7BA 3GO1L 5EZJB 5I71B 3PL6A 1ZS8B 4MB5A 1OW0A 3MPCA 5DD5L 2Q7NA 4N9GA 1E4WH 2EE9A 4GLRI 5F3BB 3BPCA 1U8LA 4K7PH 5KS9A 4F7EB 4ZD3L 1IGJA 5IQ9B 1OGAE 4LCUB 3MACH 3WNKA 3MRFB 3NCBB 3IXTB 4X6FB 5EUOE 1FSKC 3EO9H 2CKBA 1KPRB 4F7TA 1S7XB 3KS0H 3QQ3A 1G6RB 5FYLE 1WIUA 2H2PC 2P8PB 1NCWL 1HNFA 4C56D 3QFJA 1S9VB 4HKJB 4KKCC 2H3NB 3AMKA 5L9DL 1ZLVK 4YDJA 1B0GA 3QI9A 4LSQL 1ND0A 4WUKH 4FMKA 2I9TB 3QIUA 5INCA 1NJ9A 5I30H 2HT4C 1XR9B 3I75A 1G7MB 3HE6D 5FCUH 2C3WA 3L3HA 1PZUB 1QR1B 4CVXB 1J12A 1W0WA 1OTUD 1PKOA 4OT1L 5BOZG 4HBCL 4MB3A 3FT2A 2R9HC 4NC1C 3QIWD 1QA9B 3T2OA 5KAQF 5IWLA 4H1LA 3V4PH 2ZSWB 3L3KB 4M43H 1A4KB 2ZUVA 3LEVH 4HKBA 1YJDC 5FFLA 1A7PH 4DQOL 1HH6B 3OKLB 5TF1L 1KIRB 4JZJA 3TT3H 5HVFB 1EAJA 3U7YH 4F7MB 4PV9B 3S34L 1ADQH 3IDIB 3QIBC 4XTRD 2MSPA 3MLXL 4CMHB 3MLUL 4WFFE 4KVCL 1LNUB 1OTSD 4M8VA 1X9QA 5FM4A 1IZJA 1ONQA 1CFSB 4R9HA 3KXFE 3BDXA 1YEIL 2EXYC 2DQUH 1M7IA 2AJ3A 2IH3A 4UU9A 4ZTOL 1FVEA 1NBQA 3DETD 4ETQA 4Q6IB 3Q3GA 4AT6A 4UZGA 1WV7T 2VSCA 4JFFA 4ZFOB 3DWTA 4UNUA 1CXKA 1FAKT 2R0ZL 3MLWL 3S36H 5I18H 3IDGB 1CIDA 3U36B 3R0MA 2ZOLA 4YDIH 1YYML 5HI4C 3T0ED 2PXYC 4Z7WA 4Z7QE 4AIZB 3X14A 4S1DD 4MQXD 3ROOA 2OTWA 3M8OH 4DN4H 4ORZC 5GRXG 3RWHB 1EFXD 4P23A 2FL5A 4GXUN 3WUWB 4O02L 2DQEH 3OPZH 5F89B 4MS8D 5EO1A 3GI8H 3KPMB 3ULVD 3NCCB 3R06A 4YK4B 4OF0A 3HE7B 3CFEA 4OGZA 4J3OC 5CAYB 2OZ4A 3VG9C 2H1PL 1P4BH 1MHCB 3RVWD 3GUTB 1R5VB 1W72B 4NCC2 1U8HA 1Y18B 3RNQA 2R8SL 5DZOA 4RIRB 1JGVH 3B9DA 1JWMB 2V5MA 1MCHA 2G75A 5CUSL 2ZOKA 5I16B 4H1LH 4PRHB 2C26A 4POUB 5D8JL 3T0DA 4YUEH 3MLYH 4R7DA 5FGRA 2FYYB 3UO1H 4MD5A 3ARSA 3VXUD 3WJLC 2NXZD 1CDGA 5J3HD 4U33A 3G6JA 1F3DH 1VKXA 4MD4B 2XKNB 2CIIA 4Y19A 4AEFA 2J8UA 4ZO8A 1CGTA 1SYSA 2Z35B 4HIEB 1WFUA 2X4QB 2VITB 4I3GA 3BP7A 4PB9H 1LDSA 2DQFB 1U8NB 4P5KA 5DHVA 3GSRB 2R0KL 3ARTA 4XGZB 5EU7C 3SKUD 5E1AA 1UVQA 2Q76A 3MCKA 2H6PA 4Y0GA 3MA9L 1LQSR 1FE8L 4YE4H 5DI8A 3QHFL 1NFDB 3MRRB 2F8XC 3R8QA 1C16A 4Y5VC 3PHQA 4ELME 2A74B 3BKCH 5CZXD 4LDOB 3HMWL 2VLKD 1SHMA 2AJZB 1GOGA 2CK0H 1WAAF 1DUYB 4EXKA 1ZMYA 3OKEA 1X7QA 4WV1A 1F2XK 1NBZA 1PEZA 1KC5H 1JF1B 4P46B 5IMMA 2C1OA 2XZCL 1X44A 4Q58C 4WHTB 4YDKH 3CX2A 1CE1L 2WINA 5MEQA 2G2RB 4U7SA 1YEDB 3QDJA 4XXCC 3TEUA 8CGTA 4LPXA 5BRZB 1DE4B 1JNHA 1KF9B 3QDGA 4LEXL 1GGYA 3MOBH 4YAQB 1I3GH 2DKSA 3BYYA 4EN3D 2VIRA 3MLSL 4LCIL 5TE7H 1KTKE 3DGCR 4ORGA 3I2CL 1A3LH 1UQSB 3RHWF 4HIJB 2FX7L 3EDFA 3J7HA 4HLZG 5C0CD 4HH9B 3LY6A 1E4KC 1B4JL 3MXWH 4JCMA 4N68A 1A1MA 3TH3T 3F5WB 3SDDC 5E2TL 1ETZA 1MWAA 5FO8B 1T20A 4LVOC 2MFNA 3BIBX 5F3HB 4MJIB 1PD6A 5C1MB 1QSFA 3RHWK 1H3PL 3P0VL 2DI9A 1VFAA 5D2NA 1W8NA 4JM4L 4PRPD 2UWEF 3H3BC 5DHVH 4AEHL 5E94A 5EZJA 3FRUB 1D5IH 3T0WA 1ZS8A 4F9PC 3OB0H 1F4XL 1L6XA 4LPYA 5F3BA 2NY1B 4NC0B 5CSBA 2LFGA 4F7EA 1TVBB 5I1DB 2BZDA 3GM8A 1V7ML 5IQ9A 4XVTH 4LCUA 2D0GA 5GRJL 3MRFA 1FGVH 5INDB 3IXTA 4X6FA 1V5JA 3NPSB 4JFDD 4K94C 3V5KB 4JPKL 1RZKL 1KPRA 3X3FH 1S7XA 2FB4L 5DZNA 2Z91B 1G6RA 2VZTA 1IGCL 4MXQD 2DD8L 2P8PA 4QO1A 1RIUL 5HYJD 3ZSTA 1S9VA 4U49A 4HKJA 4M7ZB 2H3NA 2LABA 2EDTA 3TF7C 1DQLH 5DD6A 3SDXE 1QHPA 3ARFB 3CX5J 2UV3A 3IFLL 4OLYL 2V5TA 4QRPD 3QHZL 3O2DA 4G6KH 3IRZA 1XR9A 4FQHB 4L3ED 1CI5A 1G7MA 3PXHA 4OZ4B 5D1ZB 1FORL 4X7FC 3U7WL 4CVXA 3H42H 4O2EB 3VCLB 3WIHH 1MWAH 2E6PA 4LP5A 4PJ5D 1AGCB 3ORJA 4O9HH 1PJ9A 5DD0H 1I8KB 1TXKA 5T1DL 1JNNL 1QA9A 1OLZA 2ZSWA 1A4KA 4AZ8A 5D71H 1I8MB 4PJGB 4OD2B 1HH6A 3OKLA 4WNQB 2N7BA 1KIRA 4ZFGL 4HWBL 3UJJH 2J1KA 4P2OD 1QQDB 4MJ2A 1WF5A 4F7MA 4PV9A 4QXGL 4J6RL 3IDIA 1JWUB 4DVBB 1N5YH 2AKRB 2QHRL 1N3NB 1LNUA 1FFQA 2WP3O 1CFSA 4Q74A 2VQTA 4KPHH 3HLAB 1DQMH 1XIWB 1QSEE 5JXEC 3BO8B 4Q6IA 1BVLA 2XT1B 5DMGD 4ZFOA 1CWVA 1CLYH 2ZUXA 4XCEB 3T1WA 4GKSB 5LCVH 2WLZA 3BKYL 1OM3H 3IDGA 5IHUL 5CJQH 3U36A 4UINL 4JPWH 4XWOD 1KXQE 3NH7L 5DC9B 4AIZA 4M7KH 5LGJB </