5GS0H

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Toll-like receptor 3
total genus 23
structure length 116
sequence length 116
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0H00
5KAQF 1OF2B 4FQXB 3K3QA 3BWUC 3QUKA 3QJFA 1H15B 4ZTPL 3I6LE 4X0KA 4XWOC 4AEHL 4FNLL 1PX3A 4MJ5B 1J1OL 1RIHH 1TNMA 2EDRA 4LVNC 3RJQB 3JVGA 2OR7A 4PJBE 3SGEH 4PS4H 3HZVA 1RIVL 5BV7B 2RB8A 3CLEH 1UCBH 2DMKA 1FZKA 2FDBP 3VXME 4IOIB 3VFGL 2OQJB 2ZUQC 4N90E 5K59E 5H8DA 3NZ8A 3RFZC 4LSRL 5AYUL 3EFDL 4UNTA 4JHAL 5INDB 2P47B 2VITB 3O6KH 2JJSC 4Q0XL 1KEGL 3L5XH 3TYFB 4BUGA 4WV1C 3AU1B 1HXMA 4YDJB 3UEZA 3G6AB 1U6AH 1QYGL 1HSBA 4U1IA 4NN6C 4JVUA 3TNMB 1M7IB 5C07D 2VL5A 5BXFB 4MNGE 4PJFB 4JZOB 4JPKH 5DJXB 1MCSA 1GH7A 2F19L 3D3VA 3CPLA 4M7JH 3NIFE 4GLRH 3RWJB 1P9MA 2BJMH 3MYJA 1FORH 4TUOA 2VZUA 1TIUA 3VE0A 2ZCKL 2DIJA 2JB5L 3HE6C 5D7IB 3RX5A 3GBNL 3WXVL 3FQTA 1NC2A 3RY5A 3HZKB 3BP4B 1L7TH 3VXRD 4HC1L 2VQTA 4OSUL 1LE9A 1CD9B 2R23A 4ERSH 3PV6A 1OHQA 1NFDF 2HRPH 5CJOL 1BVKB 4YBQC 5AD0B 2CDGA 1XGYH 2AABL 1JN6A 5DUBB 4UDUA 5ENWB 3V52H 3LS4L 2NTSP 1INDL 4HWNA 3O41B 4M7ZB 2MHAA 3MROA 3QYCA 1MCBA 3QHFL 4XB8A 3V4PL 1WWWX 4PJCA 1FVDA 3MNVB 4JFPA 1GYAA 2MNUA 4YPJA 4ZFZA 2IPKA 5JORA 4MMXC 3ET9F 3CSYB 3HR5B 1QR1B 4R97B 1YPZE 2KPNA 3NGBC 2YMXL 5KS9E 4U6HA 4LKCB 3HAEG 4ZS7L 4O02H 2KQNA 3REVB 3TV3H 1EHXA 1SJHA 2FX7H 1NAMB 1YEHH 1WAAA 5A2IH 3WFZA 3TBVA 3L5JA 1FBIL 3BUYB 2SEBB 1WCQA 2XZZA 2YOCA 2VTFA 4L4TB 5CIPA 3G5VB 2OP4L 4MJIB 5C08E 1ACYH 3N9GL 4XC1L 3T0AA 4JZNB 4GW4A 2CPCA 2AK4B 4R96B 4L1DA 4RZCB 1TPXC 5CEZD 2C1OB 1U8KB 2HTLC 4DJMA 4P9ML 1KLGA 1MUJB 1OP3K 4XCEA 2R4RH 3O8XD 4ZFGH 1MCFA 3OAYK 1WC7B 2QQQA 3IDXH 1FHGA 2IAND 1H8SA 4FXKB 5DZOA 2YPVH 2D7MA 4OIBA 5JHLH 2GJ6A 4L8BB 4QCIB 2BDNL 1W0VB 3T77A 1T1WA 3EBAA 5TE4L 1DZBA 1H0DA 1HSBB 4JLRB 2VLRD 3NN8A 4G80A 3RA7L 2NNAB 3BO8B 2EH8L 4ZOBA 5DLML 1YQVL 3U0WH 1EFXD 4HMCA 4PJFA 4HX1A 2V17H 4TYUA 4Y4HD 2W60B 1C5DA 4JPKL 5E95B 3ZDXE 3HI6L 3MLUL 4LCCB 2Q8AL 4P2QD 1N6QL 4TPRH 4U1NB 4LSTL 2Q6WB 2PETA 4HZAA 5GSRA 2W07A 5LXGH 5TE4H 3VE0B 3JV6B 3LD8B 3UX9B 2LV4A 5IEKA 1OAKH 3HHRB 2ZCKH 3PDOB 1MRDL 4GSDL 3RTQC 3KPNB 4GXVH 1BWWA 1ZANH 1QFUL 4ALAL 15C8H 1AGFA 1OAUH 3PQYB 4Y8DC 3QXDA 2XTJE 3Q6GL 3CH8A 2CDGB 3HC0A 4G9DB 5C2BL 4DKEL 4OCSL 2MHAB 3ULSA 3VWJD 5EBMB 4LDLB 3U79A 2H1PL 3S5LG 4R2GD 4EDWL 1S7UA 4ZD3H 4L4VB 3FQWB 2YN5A 3P0YH 4ZS6C 3ZKSD 1A0QL 5CMAA 3GMPA 4YEEA 4XP4L 5FYLH 1PKQE 3VWKA 3VXMD 4P59L 1O7SA 3MUHL 3SKNA 3F58H 4HIJB 3JWOC 2SEBA 4JRWA 4KJQC 4OZ4A 1OAQL 5JOPE 1QP1A 3QA3A 3QIBA 4JQXA 2WBJC 1N64L 3V6OC 1WT5C 1R3IL 3VXSD 3SO3B 2V5RA 4K7PX 3T4AA 3QXVA 3ARSA 4JQIL 2VDOH 1AO7E 1QZ1A 4D9RD 4I9WD 1RI8A 4PB9L 1A3QA 2R2HB 2YD9A 1EO5A 5EZIH 2OI9B 4QF1A 2BMKA 4TNVK 5BOPA 4PGEB 1C12B 1MI5D 2KUTA 2J5LC 1NC4D 3FFDB 4NKIL 5ID0B 5HYJE 5DVNA 2OZ4L 2Q3AA 3RDTD 3OL2A 4MB5A 3MZGB 2HFGH 3MLXL 4JFEE 4M1GL 2R2BA 3MPCA 5IVXA 3PDDA 2CIIA 1UZ8A 4JFEA 2HAZA 4Q7DA 3WEXA 4G6KH 5DJDA 5EO1B 3BD3A 2MWCA 3IU3B 3WJJA 1MF2L 1A1MA 4X7TA 1OGTB 1GVIA 2ZKHH 5HHXH 1A3RL 1SJEB 4LEOB 2LFGA 3FHQA 3TM6A 2V5MA 2Y5EA 1V3KA 1MJ8L 1U93A 3RX7A 1PJ9A 5HHME 1WFOA 1C5DB 1OAZH 3K80A 1CT8B 1BQUA 4LHUG 4MJIE 5I1IH 4P57B 5HYSG 4YFLI 1AFVL 1AQKL 5FUCC 5TE7H 1MWAB 2F19H 3LKSA 2ERJC 1NGQL 3OPZL 4PRBA 1S78C 4UZGA 4G8EB 2LU4A 5C0BB 4U1HA 1X4YA 1KLUB 3VD7A 2VLJA 1CK0H 3UYRH 3ARVA 3H3KA 1S9YB 1Y18A 4CNIB 5BMFH 3GJEA 4KTEH 2H9GB 3OPZH 1FO0A 4JJHA 3JV4B 3MO1B 5F71A 4UBDC 2BVQA 2EZ0C 5EBMA 2Z92B 2ADIA 3VRLE 4H1LB 1T6VN 3S88L 1KBGH 5EBWA 4BQ6A 2JJTC 3KNBB 4AK1A 1CF8H 5HI5C 1JPTH 3V6BR 1S7XB 2CRYA 3HLAB 1MRFH 2ICEB 5C09B 3BEWB 5D1QB 7CGTA 3O6FB 5EU7C 4DW2H 1ORSB 2R1YA 1X6NA 3ALXA 2OXHA 1G6RL 4NBYB 3L3GB 5ANME 2HVJB 1K5NB 4M8QB 1JZ8A 3L5XL 4L9LC 4N0YH 4JY6B 3GSUA 4LSPL 5I1LB 1T2XA 1PGRB 5C0CD 1FPTL 1T0NA 5A3IC 5FKPB 1HKFA 2FJHA 2H32H 5DRXA 1GPOH 1V8HA 5T3ZE 3FAWA 1ZOXA 2W65A 3DMMD 4GG8B 1TJHL 3SO3C 5I19L 1B0GB 3T2QA 1AD9B 4Z76A 1T6WA 4O9HH 4WWKC 5ISZB 5DJXA 2WUCH 3BAEL 2OXGA 5SWZD 1XF2A 1EFXA 2J6EL 1FNFA 3LEXB 1LEKA 3MXVH 1JF1B 2EYSA 5B38B 2Y9RT 2VLLA 5IQ9A 2FL5B 1YNLL 2AJVL 1UB6B 4FMFA 4G8GB 5J12B 5C6WH 3NACH 3LIZL 1X44A 4HW6A 2VZSA 1CFTB 4XMLH 2D31B 2GK0B 2WQRA 4WDIB 3WUWA 4P2RA 3VI4F 2WNGA 2AKRB 4K2UL 5KN5B 5C0JA 2QADC 3MLSH 1PD6A 2DWEA 3G04B 4HBQA 1CFQA 3EFFA 4EDXB 1P4LA 4JO1H 5MEQA 4F7TB 5GSVB 2EKSA 3MUGB 3NACL 2AJ3B 4JO3L 3UBXA 4UT6H 5TPWH 3NFSH 5EOCH 3CJJA 4CW1B 4OBSA 3QXUA 4XNYH 4HD9A 4L3CB 1QR4A 2J4WL 3L7EA 1XMWA 4O51A 5ACMA 3SDAC 4JM2A 4UINL 3WN5B 3P77B 1YY9D 4IS6B 5C0FB 1D6EA 4LRNH 3LHPH 1A2YA 3QFJB 4JO2L 2ICWA 2IG2L 3JTTB 1IC5L 2C4FU 1TFHA 3FHAA 2HH0L 5E8OB 3BQUD 1NGPL 3VWKD 3DYPA 4S1SL 4X4YA 1I8LC 3Q1SL 1E6OL 4GG6B 4RFNC 2GSGB 3LMJH 2HYMA 1OP5K 43C9A 1BVLB 2LE9A 2ZPKH 4LAQL 5I8CA 3V6ZB 5JOPD 4GRWE 4DN3L 4C56E 4RZCA 5FGCB 1KF9B 1IGYB 2AJXH 5D1QA 3QUYC 1N2RA 4R26H 1G7PA 1UEMA 3TH4T 5JOFB 2WQ8A 3CFDB 4OZIA 4JZJA 3EUUA 5IEHB 4PJ9D 1A9BB 3A6CH 4KRPD 3MQIA 3DX7B 2IANB 4QRSA 4NQEE 4FQLL 1NGXB 4NZTL 4OUUB 3DO7B 3QWOB 3QDGE 4HPYL 3BZEA 1FPTH 1CZ8H 3ZDYF 3SKOB 3KLHC 2DQJL 5DC0A 1MFNA 3ARQA 4KTDL 2DBJA 4HXBH 1RZKL 4LLQA 2XQYG 3V5KB 1KTLB 4X9IA 2IADA 1D3CA 1U92B 1BWMA 3PXHA 1JGEA 4XPFH 3I9GH 4D94A 5E1HB 3E3QC 3U0PB 3VFUA 2DTMH 3H2WA 4PRDB 2A6DB 3TBSA 5HHMD 3PL6A 5IMMA 4HK0B 1T1XB 3DX8A 5DK0B 4EXKA 2ZCLH 1P7KA 3RIAK 1UM4H 1I9EA 4HGWA 1XCTB 3GRWL 2NY3B 4MA1C 4QHKI 3QUZB 4XH2B 4OI7A 3B9KB 1J1XH 4Y2DD 1A22B 4PTUB 2GAZA 1ITBB 4LLWB 3EFFB 1YMMB 4G9DA 4LU5L 1SYVB 3CFJA 4F7MA 2I9TA 2EKSB 3D87B 3MUGA 3OWEA 3O0RL 5C9KA 1J8HD 3C5ZD 3GJFA 4NO5A 1N4XH 4R4FH 4GRWH 1IFHH 3MLTB 3SKUD 1DSFL 3FOLB 5EU4A 4KI5F 3VFSA 5K9QG 5KSBA 4DVRH 1JRHH 2HJLB 1C08B 4P9HC 5KS9A 4GW5B 3NCJH 1N7ML 3IFLH 4EI5C 1AQKH 5TE7L 4YPGA 3QEGH 1EUTA 1ZVSA 2HP4A 1D6EB 4ODHH 3UAJD 3JUYA 3E3QE 2ZUVA 3H7LA 3H9YA 5ADPL 3ARGA 5DFVD 3ZYJA 1N26A 2XT1B 2YUWA 2C4XA 3WIHA 1RFDH 4YHKL 2CXGA 4NRXB 2CSPA 1NCBH 1SJVA 1BPVA 1HQ4B 2NYYC 5EU3A 4HLJA 4L1HA 3ALPA 3BESR 4MD4B 4XVJH 2DIBA 3D3VD 4NRYA 3FQXA 1HSAA 2J8UF 1U8NA 1EAPA 5T3ZD 1OW0C 1T0MA 1T83A 4OLUL 5C6PB 1YEIL 3QH3B 3IDNA 2QTEA 2L0DA 3O6FD 4EOWL 3JSSA 2HKFH 4CJ0A 3QBTB 1OL0A 1YPZB 2W9EH 5GGQH 1CIDA 2DD8H 3BKJH 4G6JH 1UM5L 4TVPD 3QDJB 2YD1A 2AABH 5L7XL 4DZBA 4QTHB 1MFEL 4P9HL 1FC1A 4Y5VB 4ACPA 1UWGH 4OLVL 3H9ZA 2RIKA 5IUSA 2XZAH 4NQEA 5EC2B 4PFEA 2YD2A 4YHMH 4TUOB 4G5ZH 3NH7H 2V6HA 3BAEH 3O2DH 4N5EC 5DHVH 5IV2B 4DKFL 3B8YA 1CGTA 5EO9A 2NXZB 4RGMC 3DX8B 1K3IA 2VLKA 5DK0A 1MI5A 3EDEA 4GO6B 4JRYA 3AROA 5F7DB 1MY7A 3QSKB 4C54A 2BVOB 3WE6A 5KTEH 3T2NL 1GGTA 3B4NA 3B9EA 5HYEA 5JOEA 1ZT7B 3UTQB 1OSZB 4Q9BA 3MNZA 3JV4A 2BY2A 2DLFH 2VKWA 1FQ9C 1CQYA 4QRUB 1KIQB 1J12A 3BQUA 3SCMA 3FO9A 2CK2A 5B38G 3BDYH 2MMXA 2CIKA 2IAMB 3QPXL 2A0LC 4H25B 4PGBA 4MAYB 3PWLB 4LSUH 4AG4L 2CUMA 5GHWH 4IDJL 5HHOA 3KS0H 4YPGB 4M5ZH 1KG0A 2BNQA 5INCA 4IMKC 3DRQB 3REVA 5D1XD 43CAB 4ZSOB 1DBKH 2NLJA 4G8FA 5A2LH 5ABDE 5T33H 5C7XL 2F9BT 4D0BA 1KFAL 5FECB 4X5WB 3VFTA 1J18A 4QGTA 3GSOB 5DD6A 1UYWL 5FKPA 2EDNA 5E2VH 1RZKH 1NGPH 5JZ7D 5C0AB 1QNZH 2PXYC 1CGVA 4L5FL 3JTSB 2X4SB 3L7FB 3BP4A 3MRNB 4Z7WF 3SGDI 2R0WH 5ISZA 5C3TA 1T89A 5JIHA 1PY9A 3GIZH 1CDGA 3UO1L 4K3DH 4JFQB 1MHEB 2R39A 4R0LC 5HHMB 1I1YB 2OS7A 5F3BA 1T20B 3CFCL 3HRZA 4MQSB 2XICA 2ZOLB 1JN6B 5ENWA 1EEYB 2UY6A 1FL3B 2NY0B 4B7IA 5IB1B 4GBXC 4XX1E 15C8L 4O4YH 4OZGF 3H3PH 2C3VB 5D7LD 2AQ3A 4YHYB 1G7JA 3BGFC 1VADB 2XQYK 5MP6L 4KK6D 5FYJU 4PBXA 3THMH 4RDQG 1LVEA 4PJXE 1A14L 4FG6D 3C87A 3VWJA 3DMMA 5CGYD 3IXTB 3CD4A 1WAAF 1J05B 1SMAA 4NQEB 5EC2A 5F3HB 5CZXD 5D2LA 3D2UB 5CJXA 3OJDA 4MA8H 1J86A 5H35B 3WFEL 4M9OA 4O51B 5FK9B 3PDOA 5IQ7L 5FM4A 3SEPA 3ARBB 2Q7YA 2R2EA 1A2YB 1QSFD 1IM9D 1DBBL 4PJBA 2HH0H 2APFA 5EC1A 1FJ1B 3L95B 4Y4KD 4H26A 1MUJA 4X5XB 1EH9A 5C0RH 4FQCH 5JMRA 4J6RL 2DL2A 2HRLA 5DJ6A 1J5OL 5FOJA 4ODVH 1H3WM 1XF3A 4D0CB 4OCLC 1W0VA 3MLVH 4ONFH 1U3HD 5C08D 5D71L 5C3LD 5IMOA 3VXUD 4X83A 2QADB 1ODAA 4NJ9H 1U8JA 2P48B 1FGVH 4LCUB 5D2NA 2P8MB 1MHPL 1Z9SA 1VACA 2R69H 3NN8B 4QRRD 1JPST 5CSGA 4U1KB 5JOFA 5GGTH 4IMLA 4I2XE 3D39B 1BQSA 3C8KA 2UZXB 5HVWA 2V2XA 1HZHH 1A7NL 1E0OB 1UGNA 5IG7B 4OV6F 4NBXB 1EA9C 2CLZA 4OIIL 3ZE1F 3IFNH 1KFAH 5IMLB 2C3XA 2FB4L 1FNEB 1OP3H 1I8KA 1OP9A 3HR6A 4KKLD 5J6GA 1TZGL 2APBA 3LIZH 2EO1A 4NOFA 3NCMA 3SDYL 3U9UA 4FFWD 2R8SH 4KZDL 1BFTA 2DLIA 5DRWB 2WMPA 1CICC 4JVWA 2EE3A 2VR5A 1NGQH 1FNHA 1ZTXH 4MD0A 1QSVA 2XA3A 4IBLT 4MQXD 4APQB 3B2VH 3PHOA 5FUZH 5F93C 5T3XH 1P4BL 1G6RA 5BVJA 2VR9A 2ZCLL 1T5WB 4TQEL 4EIZC 3BRFA 3DVFA 3FOMA 4HXAH 5IFHL 3LEVL 2BNUA 4J12A 3IU3A 5H2BB 5FYKU 3RY4A 4IRSD 4PTUA 5IB3B 3IKKA 4H20L 5MENA 3RVWC 1YMMA 5C86A 4LKXA 2I9TB 1NC2D 3TBYB 4JPWL 4PJCB 1JRHL 1KT2A 2FJGA 1RULL 4IDJH 2R0LL 1MRFL 4V2BA 3P0VL 4RSVA 2P5WE 3EHBC 1WCBA 4G5ZL 4GRLC 4RGOH 3QIBB 2VDRH 3GHEH 4KKBC 1XF1A 2E8YA 4I77H 3FB7B 5C0CA 3SDCA 1WFNA 3UTSE 1IGMH 2R0LH 3L95A 4KQ4H 1RJLB 3VXQA 4PJ5B 4FN0A 5MEQB 4G3YH 4DQOH 5HYFA 1P7HL 4YLQT 1Z2KA 3WV0A 1C12A 5KSAB 5IBTH 4ZXBB 4YHNA 1CXHA 3JUZA 4MWFA 2YEZB 1XH3A 2VOTA 3HMXL 4F7EA 5DJ8B 3HG1E 5IVZB 5GZOC 4FTVB 2G2RB 2CDFB 2NW2A 3MC0A 4NQTA 3WEXB 5D71H 1VACB 3JWDC 2H3NA 5T1LB 2Z8VC 5JXAH 1MJUL 4MS8C 3DGCR 1FFRA 2BHYA 2FRGP 4L29B 3H42L 1JIBA 3O8XB 4HJGB 5E2JA 5GS1C 3GSNH 5I74C 5D7LB 3CDFA 4BSJA 5TDNB 1QLFB 5CZVH 3FO2A 4OGAD 3QPQC 4B5EA 1A14H 4XPTH 3O3EB 3ARGD 4OB5H 4WU5B 4KUZH 1BOYA 1X5LA 3IFNL 5DZLA 1I3GL 1RZ8B 4FZ8L 4NNPH 3QQ3A 1CLYL 2FHFA 3U9UB 5GGVL 5GJSH 2XNAB 1ZT4A 5JPNA 3VMNA 1DQMH 4G9FD 2FNBA 1EGJA 2W60A 3FFCD 1NCWH 1R3JA 4OTXL 1YEGL 3SY0B 3ARDC 1EVTC 3BGMA 5C8JA 4OCXL 5EZLB 4NGHH 1KCRL 3HMWL 1QSFB 4XVUC 5D70L 1G6RB 3ROOB 2BVQB 2ZOKB 2CXKA 1KCSL 1GIGL 1KCUL 3DTXA 1NGWA 1P4BH 1NEZA 1B9ZA 4NWTH 5JO5B 3A6OA 3SPVA 1URLA 3BEWA 3Q1SH 4KGLA 1RZGB 3O81A 3QUYA 1G7MB 1P4LB 3AS0A 3S3PA 2BDNH 3MNZB 3ULUF 3PQYD 5CAYB 1V3JA 2VDNH 4YIQB 3HMWH 3LS5L 4I3SL 1F02I 2DQFB 4DN3H 3FL7A 3QULA 1NBYA 3ARFC 4MQTB 3TN0A 3DETC 4J4PA 4JFDB 5E2UL 2P5ED 3GMQB 3CU1A 5I1LA 4J23A 5FYJE 3RVTC 1MJ7H 3KJ4C 1JYNA 4YGVB 5DRXB 2NCMA 1ZS8A 3SGEI 4MAYD 3ILPA 4ZUVA 3CVHB 4EUPA 2VQ1B 5DZNA 3VXUE 4G6ML 2VLKD 4K7PL 4WNQA 3EDDA 2NY6B 3TBTB 5JXED 5IM7A 5IW6B 1MQKH 3N85L 4PUBL 5GQBA 4DUWA 2GEEA 3C6LB 1VEPA 1LEKB 1OLLA 1CZ8L 3D85B 3QNZB 5DD6B 2BY3A 1FSKC 1F42A 3EHBD 4GRLD 2ZCHL 1BBDL 4HXBL 4JPVL 2MKLC 4F9LC 2XRAL 3QO0B 1S9VA 1MFAH 5I1GH 3JWNC 3SCMD 4YAQA 4KKAC 1IGYA 5DURB 4KJYA 3X13A 4Y16B 1GOFA 3KYKH 4JCLA 5DJZA 1W0WA 5F3BB 1RIUL 1YDPB 2YWZA 3BIAX 3MXWL 2BMKB 1NCAH 5B8CC 4H8WC 5K59F 5DJ0A 2FD6H 4UQ3A 1BQHA 4JDZA 4QHNA 2VZTA 3ZE2F 3O6LH 5FYJL 1EV2E 1BM3L 5TE6H 5IT2H 4MHHG 5E94B 3CFIC 4OZIE 3CSPA 3DX9B 5EPMA 4EI5B 2AEPL 3FRPA 5SV3A 1XZ0B 2WK2A 2YA0A 3HC3L 1W0YT 1N5YH 3V5KA 2V7NA 4JG1H 2MPAL 1U8PB 2D0HA 1B4JL 2VSDA 1IEAB 1OT2A 5FYJH 2VDLH 5DQJA 4F2MB 4LIQE 3WFCL 5D9SB 32C2B 2BVEA 5FM8A 3QJFB 3KPMB 2XXCB 3BZ4B 2LU7A 3HS0A 3S4SG 3HB3C 1HHJA 4Z78A 4WY7H 2VLJB 3G9AB 2R2EB 3MBEB 2X4QA 4PRPE 4XNQB 4R3SA 1CU4L 2YA2A 3DXAD 1MCOH 5JO5A 1U8MB 4NZUL 2EIZA 4AENB 1IGTA 3ZZ1A 4OZHA 3KS0J 1KCKA 4GW1A 4YHKH 3R4DA 4PJ7A 1Y6NR 4WEBH 1OTTC 3BKYH 3L5HA 3WSQL 5HGDB 3MV8D 1NQBA 3QZWG 2X6MA 2P44B 1UZ6E 1BBJA 1NFDE 4KROD 3BX7C 4MNHA 1MVUA 1U8LA 3GSWB 4P9MH 4ENED 4DZ8B 2PYEA 4E9LA 1FIEA 3BFOA 2YS4A 4XCCL 3AU1A 4GW5A 1HXMB 3F6IA 4FZEH 4YDJA 1DQDL 5GIRA 4X6BA 2P7TB 2EDWA 3O6FA 3F7YB 3KXFE 4I3RH 4YXHL 2OSLA 2DM3A 1LK2B 3EYUH 1JP5A 4O2EA 4WW1B 2P5WB 4AM0B 1U92A 2PW1B 3PWVA 1JBJA 1AGEA 1QVOA 4LCYA 5DJAB 1INDH 4CRPA 4JFXA 2EH7L 3B2UC 4N90D 4OIAA 5C0EA 2IH3B 4KHXH 4I0PD 1NCWL 3GIVB 4O4YL 3EYOA 4MVBD 2UV3A 5BO1H 4GKZA 5FV1L 2VABA 4ZTOL 1HOCB 3AC0A 2IALB 3LEXA 3QI9D 5C08A 2A6KA 3IDNB 4NCC1 1CIUA 2W0KA 2GSIA 4JY4A 1QYGH 1Z3GH 3VXSB 1NUGA 5F9OH 4APQD 3GJFB 1J8KA 1FN4B 4OT1H 1UFUA 5KZCB 4H0HB 3GMOA 2LQRA 5L8KB 1HN1A 2GUOA 5BRZE 4BM7A 5J6HA 2XKSA 3GM8A 5IFAL 1HIMH 4XI5C 3C5SB 4YFDB 1XZ0A 1TTGA 4FABL 1JYXA 4RMWA 5HYSB 1P69B 1U91B 2OR9L 1EFQA 3MRMB 5FYKH 5LJYH 3VFNA 5IVNA 3HAEA 1PKOA 1ZHLB 2XKUA 4ZFGL 3FFCB 3HA0A 5I2IB 3P0YL 4M6OH 4AQOA 3W9DA 1ROWA 1E4XH 1YJDC 4YDVA 5DF0A 1CXFA 5JW5B 4Z18A 4FABH 4BZ2H 4I2XB 3EOAA 5AWNL 2P5EE 3L3JA 1WIUA 3FQNA 3TIDA 2PXYA 4R8WL 1HSAB 3NABL 5HPMA 5ICXA 1A7OL 5E9DE 2IEPA 4NJ9L 4Q9QH 1CWVA 2XWTA 5KVEL 12E8H 1T0MB 5CBAA 1BZQK 4D9LH 3QEHA 2ARWA 5DMYA 1QNZL 3EFDH 3UPAA 4W6WB 1Z9LA 2GYSA 5KSAA 3GI9H 3CZFA 2GY5A 2D0GA 3DV4B 4ODXA 3GFUA 2JTDA 2AJSL 5IJVA 4OBRA 1FG2B 4OCYL 5TF1H 5ICYB 5I15L 2P7TA 3QISA 3OHXB 4LBEA 4HGMA 1ZHBB 1E27A 2GTZA 4S11A 3TBVB 4POZD 4GUPB 1DQJB 5F88A 3DOSA 3I6KA 4OZGB 3G5ZA 4D0BB 1A1NB 4JFFA 4WW1A 1CDJA 3PWNA 3DJ9A 3JV5A 3MRLA 5D1QD 2FHCA 2WWMD 3MBXL 3RP1A 1BOGA 4DCQA 2CMRL 1ZKAA 4U3CA 3DUUB 3RNQB 5GS0L 4BSVA 2JE8A 1KLGB 4NKDA 4Y4HC 2EH7H 3TWCL 2C5DC 2CKBA 4FFZH 1TNNA 4Y4FB 4HLZH 4WU7B 3WFBH 2IANE 8FABA 3QQ9C 1KIPB 4NN7B 3MRBB 3CSBA 1CD1A 2IBZX 2WWKO 3TBWB 5SWQA 5F9JA 5CJOH 5EBGA 3MCLL 4ORZC 4XBEH 3PF2A 3LN4B 1IVLA 3QCUL 1GGCH 3S6CA 4NWUH 1IGCH 3RTQD 2BSTB 1RIVH 3OBAA 4OLZH 1EZVY 1NEZG 5IB1A 4HKZB 1RIUH 4XXDB 2FX8L 4AYFA 4YHZL 4GAYA 2AK4D 1BP3B 4D8PB 4NO3B 1NGWB 2HLFC 2NY1B 4JKMA 1OAQH 5DTFB 2FEEI 3PP3K 2Q8BH 4HX1B 3NTCL 5ITBL 4DN4H 2R1WB 5CBEA 3DLQR 4BH8B 4KWUA 4BFIA 1DANT 1KYOK 4YK4B 1V7NL 3MLZH 4P23A 4NKMB 1DN0A 3QUZD 3DXAE 2RFXB 1XF5B 4FQLH 4NO5B 5KJRH 2WZPD 4NC0B 1ZLSH 3MLVL 2FX7L 1U3HA 1MRDH 1MRCL 3C6SB 1Q0XH 4ODWA 4YDIH 3D0LB 2DQUL 4DOHB 2HKHL 1QFWM 1ND0A 5I30L 4X5WA 2ZUYA 4JGMA 3MRJB 3ARUA 3NCEB 4LDEB 4XAKE 2FO1A 4PJDA 5F1OB 3EYUL 3VFRA 3C5JA 4NNYA 2R0ZL 3HNSL 5ADOH 5K9KB 2WIIB 4PJFE 5H37H 1FFPA 3MJ7B 3OX8A 4KKCD 2R4SL 3PP4H 3EJYD 2BY1A 2AGJH 4N0UA 1R5IA 5HHVH 3S4SA 3SDYH 3TT1H 4PD4J 2XTLA 2F5BH 3BDXA 3OV6A 4CVXA 2EDKA 4M62L 1GC1H 1KJ2B 3FQWA 3WO4B 1DVFB 2F8OA 3V9FA 2E9JA 1UH2A 2R2BB 4Z7OF 4Y0GA 6FABH 5IVXB 3W5MA 1Q9LB 1I7UB 4LLMA 3WNPA 3V4PH 1HHHB 2E7LA 1NBZB 1RUML 4K55A 2FD6L 3G9VA 3TO4C 2VXQL 1T66D 5F9AC 3FTGB 1SY6L 4LPXA 3QCTH 4CN4A 3DI3B 3TIEA 2X9YA 1KJMB 4OLEA 5E5RB 3RDTA 2VXSH 3BT2H 2X05A 4LHUA 4JRXA 4JFZL 4M1CD 1PZ5B 3KJ6L 3EZJB 4GRLA 3OKMB 4JG1L 3ARBA 3B9KC 4UT6L 5TPWL 2X4RB 2HT3C 2EDFA 3QCTL 5CJ5A 3W11D 4NKIH 4PGDA 2DQTL 1M05B 5FCSH 1NBVL 1N3NB 1NEUA 4LPUA 3SHSA 2F15A 2XYCA 1A8JH 4X6DB 3QI9B 4BZ2L 2PW2A 2VNCA 5EUOB 1FO0B 4KI5D 1D5XB 2I60H 4MHHI 3FT2B 2BOCB 4MNQB 2OJEB 4RFOL 3P11H 1F4AA 5ETUB 1MCOL 4ZYKA 3Q3GA 3T4YA 3MLRH 3SDCD 5KVEH 3HKFA 4M7LT 5A2KH 1BJ1J 2LAGB 4QHLB 1Q94A 4GW1B 3NAAL 3GRWA 3GK8H 2UUDK 3L3IB 1NAMH 2B39A 3U1SL 2HTKD 4HKBA 4N8VA 5GRYA 4X80L 2BFVL 1XF5A 1CR9L 2DD8L 3LKSB 1N59B 3TO4B 4N9GA 2BNRD 2P8PA 1M71A 5EOTA 5EUOF 4BQBA 3GB7B 3U36A 4JY6A 3VMOA 5HVFB 4P46D 4WEMB 2Y6SD 3SGJC 4LLAA 1SEQH 2AJVH 8CGTA 5E08L 2CUIA 2EDDA 1RJYA 3VDBA 2BNQB 3KYMB 5BW7C 1MCKA 3T0ED 4C57C 1EJ6A 1ZWIA 1FFPB 4LHQB 3E8UH 4UV4L 3K1KC 5D1XB 1QQDA 5FV2A 5D2LE 3GSRB 4KMLB 4GXVL 4PJ5A 5SX5H 1U6AL 2DQJH 2H32A 2YSSB 2BSRA 4JFXB 3AMKA 1HH9A 4ALAH 2BRQA 1DVFC 5L2JA 1VFUA 4FRWA 4WTZG 3PGDA 4PJGF 3L3DB 5FKAB 1IARB 5T3XD 1ZGLM 4JM2F 2ITDB 2VABB 4LPWA 1YA5A 2H26A 4JG0L 5JIIA 2BNUB 3X3GL 4BYHA 4RA3A 2CJUL 3BPOB 2H1PH 3LHPL 3RWEB 1MCCA 4U0RB 3UP1A 1G7QA 3BH9A 4EDXA 3VXSE 3GSQA 2LU3A 3BD5A 4TNWK 3LKRA 3TBYA 1XF4B 3U4EB 1OAZL 4YGAB 1PQZA 4JDTL 3VXNA 1B0GA 2EDQA 2FBJH 3P4LA 4BFEA 4JQVC 3WN5A 4W4NA 1WCBB 5FUOH 5L6YH 4CN1A 3S7GA 4WI7A 1IC4H 2DQUH 3GUTB 1JF5A 2O5XL 1P9MC 4PGDB 3QDGA 4MDJA 1F5WA 3OZ9L 4OFYA 5DVOA 5KVFL 4ZFOA 1NBVH 4LLDB 4Y5XB 5GRUL 3H0TA 3K7UA 2IAMC 1MLBB 1MFCH 2NMSA 3FT2A 2ORBH 1QO3A 5I0ZA 5D7JD 1GGCL 3KXFB 4RMVA 3NPZB 2XFXA 3DTXB 3SE9H 4DFHA 1JZ6A 3OKLB 3O11A 5H94A 4WUKL 2FECL 3IT8D 4ONFL 1W72B 3U46B 4WI9A 1UXSA 1JFQL 4FFYL 1MH5A 5FGCE 3UBXB 1R3KB 1QFWL 3MFFA 4XCFL 1QKZL 4MDIA 3Q5OA 4AH2B 1IT9L 1S7WB 2Z9TA 1LK3L 5CLTA 2RR3A 4N9GB 5INDA 3BSZH 3LSOB 5CILH 2JELL 3RNKA 3NFNA 4RGNB 3RVVC 1XF3B 3CVIH 4NZDA 3DGGA 4MQXC 2IC2A 5I1CL 3KAAA 3V7AG 2A73A 2E9IA 2X1PA 5IJVB 3QIWB 4YNYA 3BVNA 1MAML 4KI1A 3QP3A 4OJFH 5GRJH 1IT9H 5ILTL 1TJHH 2VL5B 1BZ7B 3IJHA 1DQJA 5F88B 5SX5K 3CXDH 2DLEA 4ZOAA 1IAKB 4O2FB 4XP9H 1NGZA 3GJFK 3ZTNH 5TFSH 2EDOA 3MRRA 4U1LA 1N5YL 3WKML 3QHZH 1WJ3A 3QT2A 1YQVH 3U0WL 1KV3A 1MCJA 4YXKH 1FNAA 8FABB 3HE7D 5HDOA 4U6VL 3B43A 4CDGC 5GS0D 2H26B 3BPLC 2DQEL 4F33A 1GZQB 2P42B 4PJEE 2VITA 4IRJD 4MXQC 4RCAA 1G7LB 1MREH 4EUPH 3WHXB 1G7QB 2JCCF 1CL7I 5EIIA 2NZ9D 1YEFH 3EYSL 5DJ0B 3CFJB 4F7MB 1BEYL 1G9ML 2F8VA 3MLTA 3NFSL 1BLNA 1U8OA 4ZNEE 1OY3B 4OD3H 5MEOB 4XCNA 2OP4H 2ADJB 4BKLB 2J4WH 4XMKH 5BRZA 5DEGB 1NFKA 2QSCH 1CR9H 3MV8A 4U6HB 1MLCB 3S37H 1X7QB 5E8DL 2NPLX 2V7NB 1G9NC 1S5HA 3D9AL 3IDGA 3KPRD 2PYED 4PRDA 2EZ0D 3ZKMD 4FHBD 4NSKB 3PWPA 4S1QH 3LZFL 3RGVB 3GHBL 3SDXE 4HC1H 4J3UA 1UM6H 3BYYA 4LVOC 4IRSA 4R7DB 1CLZL 1IL1A 1MLBA 2YPLB 1ZE3C 1CL7L 4G3YL 2WUCL 3VD5A 1CFNA 3MV9D 5MEND 2DDQH 2J6EH 3SJVD 3O11B 2DYPB 5DMIL 1EAPB 3HZMA 3O41A 3B2VL 1W8NA 4K9EL 4ZDHB 4Y16A 3VG0L 1R3KA 5C2UB 1J1PH 3MNVA 4N0UB 3I84A 4F7PA 1GJIA 1H9VA 3F8UB 1BREA 4JFOA 4X8JB 3HUJA 3L1OL 2DQDH 4NYLB 4O00A 4Q9RH 4I0PA 1TVBB 2UY7A 2OZ4A 3EYFB 1KB5B 2EDBA 3HC4L 1JL8A 3PIQA 4X80H 1TCMA 5DJ8A 2YPLE 4OLWL 3TV3L 2IF7A 2ZNXA 2AQ2A 4ISVA 2G2RA 3GDBA 2QQNH 3U9PL 1U8QA 1JGVL 3F7YA 4RX4A 1JUFA 4S2SA 1JPTL 2BOBB 1CE6A 5TGBA 1LK2A 1BAFL 3QRGH 2DM4A 3S96A 1S3KL 1FC2D 2HFEA 4MXVE 4LQFL 1WZMA 4JCMA 3D3VE 1KJMA 2BNQE 4H8WL 3V0WL 1LNUB 1L6XA 4X99B 1P84J 5D4QA 2VDPL 2YUVA 3JV6A 3FQXB 5ALBH 1IGCL 4QRRB 2F8XC 3MJ9H 3MNWB 4M1DL 1JTTA 1R5VB 3P0GB 3IS0X 3F6LA 4KQ4L 2A2QT 3QQ4A 3VXPB 4LSUL 4MQ7B 3VRLF 2K3TA 3ZE1E 3GRWH 3ARXA 2DQGH 2GT9A 4D2NA 4G9FB 4RQQB 5A2FA 1CGUA 5D1ZA 1DJSA 3UTPE 4PIRF 3MJ9L 1UEYA 2G60H 2VLRE 3BWAB 4WHYG 4OFYD 1IQDB 3M07A 3ULSB 2PXYD 3MLRL 2IBGA 3DVGB 4RFNB 1TQBC 5KSAC 5LQBH 2BRRH 4HQQL 3EO0A 3ARPA 3EO9L 4GMSL 4MNQD 2F53A 4Y5VA 5D7JA 1HILB 1AO7B 3WJJC 3RZCB 1JWUB 5SWSB 2QKIA 4GXUM 4HBCH 5GGTA 2QHRH 1QBML 2W92A 4Z5RB 5AZEL 4MSWA 1AKJB 5F96H 5HGHB 4CDHA 1CFVL 4FQQB 1EJOL 4Y7MA 4PJXF 4ZODA 1RPQA 1KBGL 4RMQA 2R9HC 4AM0A 4ZNCD 1Z0MA 1WAAE 4N0CD 2O5XH 4LPYA 3TC9A 1I85A 1QRNA 3GHBH 1F6FB 1CFNB 1ZS8B 4LF3B 4JFFD 1JMXA 2LVCA 3BH8B 1O7VA 4P3WA 5HPMB 5KSUA 5D1XA 3O3DA 4P2QB 3JWDH 3MRIB 1CGWA 4KDTA 1KCRH 3C6LA 4HWEL 2EKJA 3AMLA 1BQLL 3S8WA 2NY6D 1T7WA 1T7VA 3V0VB 2Q3ZA 4QF1B 1PVHA 5ITFB 3TO2B 2DI7A 3NVQA 1IRAY 3SQBA 2RCSL 2H6PA 2GCYA 4JM2D 5CKGA 2FWOA 2ITDA 3BKJL 3QIUA 4G6JL 4YDLB 1PX4A 1WSST 3C5SA 4BUHA 1RSFA 2F74B 4JB9H 5FOBB 4F58H 5EN2A 1CDHA 4X4MA 2ADFH 5I74B 5CINH 3MRMA 2D03H 2ESVD 5CCKL 2VKXA 4PB0H 1U3HC 3OSKA 3RGHA 5ANMA 3RHWF 1G0YR 3NH7L 4HZLB 4K2UH 1KTDA 1J5OH 4BSVB 4MNGA 5E2WL 4EIGB 2X2YA 2IH1A 5C92A 3TZVB 2DJUA 2ITCA 1NDMA 3LKOA 4JAMB 4KRPB 1XGRB 4F9PA 1FZOA 2ADFL 4P3DB 5I16A 2ZP0T 4CNIA 2KKQA 1S9XA 4XBPA 3T0WA 4E5XB 5ID0A 3V4VL 5C1MB 2A77L 2BVPA 5J12C 5DI8B 4R90H 3LRSB 4Z78B 3QWRD 4I3GA 4M48L 4J3SA 5DMJB 2JJWA 2XTJC 2XQBL 2MQ0A 1INQA 4G42A 3V5DA 1JTPA 5D7JB 1AGBA 1HINH 4PJIF 3MV9E 5D6DC 1FG2A 2C3WA 4YZFE 4ONOA 3O3AA 1IM9A 1LO2H 4MDIB 5T1KA 5FO7B 1E6OH 1S7WA 2CKBH 2QSCL 1RZFH 2RFXA 1WBXA 1LO3L 4LCWE 3OKEA 5GS2H 4XNXH 2NYYD 4PJFF 2AXFB 1X4XA 1K4DB 3BISA 2WLZA 2ZPKL 5IVXF 3M1BB 4L4VE 5D72H 3SDAA 1MAMH 1B4RA 5IMLA 3NIGE 4AL8H 3RDTC 3E0GA 5JNYB 1F3JB 2E7HA 1AIFB 2WP3T 4NNYB 2D7QA 2EYTB 2J7LA 4Y2DA 4ZTOH 2P5WA 4JFDD 5K33A 1EFXB 5DJ6B 1AHWA 1PYWA 4O02L 4R7NA 2YXMA 5DMIH 4WY7L 2A1WL 3MV7A 1NGZB 3P4OA 1RZIA 4EEEA 1I8LA 2Z93B 1BQLH 3MV7E 5ITFA 1YN6A 3ARBD 4WJ5A 2IFGA 2AEWA 5FF6B 2VDQH 4GAYB 1N5AA 1UJ3C 4JN2A 4TN9A 5I8EB 4CAGA 2IALA 4RGNE 2F54E 5EU5B 4M5YL 4IIQA 2I5YL 3MODL 2CDEA 4HIIA 5FUOL 5IG7A 3CLFL 1F6AB 4JZJC 3MMEA 3QUXC 5L8JB 3VXSA 1MCDA 4FZEL 1PW3A 4XVSH 1AO7D 3DSNA 4D9RE 5I19H 1RV6X 4WHTB 5L88L 4L3CA 3DBXB 2ADJA 3MBEC 2DB8A 2VJXA 4XZUA 1UQSA 4BFGA 5C71A 4HWBL 5BJTA 1NDMB 4LDOB 2H8PA 3OG6B 1K8IB 4OLXL 3RWCA 5D93C 5FYKD 5D8JH 4APQA 1UYWH 1A4KB 3BEVB 4JRXE 4P46A 1IFHL 2ICWB 1TZHB 2C7UB 4MCYA 5KS9F 1A6AB 4OZIF 4KPHH 3AY4A 4NC1C 3PL6C 4Y1AA 3HZYA 4GG6A 3D25B 1KJ2L 1QRND 5CJ8A 1KJ2A 1TJGH 3KYNA 2X41A 4G42B 3TNNA 2FATH 4PRNB 1X9QA 4KUZL 5ERWB 2HJFA 4F7TA 3ZO0A 3SGDH 4C56B 2APWA 3ULVH 4HUNB 4F7PB 1UG9A 2KDGA 3DRTB 1QRKA 4X98B 1D5IH 5IB4B 1C8PA 3UBXG 5HYJB 4L29A 4EN3D 4G6FD 4JM2B 5EU6B 5CSBA 2VRAA 3T04D 2B7DT 5KVDH 4DKEH 2PNDA 4N0RA 1P53A 4U3XA 5C0DB 2CQVA 5E5MA 4V1DA 5DHVB 4CMHC 4EXPX 1A4JA 3U9PH 4Y2OA 3BZEB 1IC5H 3UTSD 3BPNB 3OXRA 3Q0HA 4AL8L 2EYTA 2J12B 3L3OA 2NY3D 4MJ2A 1FIGL 1UM4L 4X4YB 5FA3B 5GPRA 3FCTB 2O5YH 1FP5A 1LEIA 5AYUH 4LOUC 1AHWB 1PYWB 1ADQH 4RWHA 2W9EL 5GGQL 4DVBB 2HVKA 3D69A 1FFOB 4MWFB 1AXTH 1XH3B 3BYTA 4IM8A 2QSTA 2EXYD 5F8QC 1D5ZB 1ERNA 2ESVE 3FQTB 5E03A 3NZHL 4GRWB 5A3ID 1C5CL 1Q1JL 3QCVL 4K07A 1JI1A 1S7RA 5E2UH 1I9JH 4NQXA 3CX5K 2Y07H 2ARJA 5JLZA 3OXSB 5EU5A 4IOFD 2VAAA 4OD2A 3SDDB 3VFWB 5LXGL 4Y5YA 2AJZA 4ONHA 5AG9A 3BMWA 5ACZA 1WF5A 2EDJA 2P1YA 4K3DL 1IM3A 4GT7A 4QY8A 4U1IB 4PB9H 1YZZA 3BXNB 1FVDB 2GIYA 5SWZE 4GMTH 2MCPH 5HJ3A 3VH8A 5SWZA 5KSBB 2M8XA 4XVSL 4XNMB 3MOAL 5EOQL 1E4KC 5IKCB 3CX5J 3D3VB 5CD5D 2Q7NA 2AEQH 2DDQL 5DRNA 5I1EL 4HWBH 5IHZA 2G9HB 3DETD 2EDTA 1ZA3B 2Y06H 5EZOH 4QT5B 2VSCA 3ROOA 5A16B 3ARGB 4P5TC 5D1ZD 5FGBA 1R24B 5EO0A 3LKQA 3O4OB 3KDMB 4EBQL 3G6DH 3SDAD 3O6LL 4MA8L 1N0XL 4PGZA 1QSEA 3B5HA 1KJVB 3QUYB 4NRYB 3PGDB 5L8LB 4UDUB 5E8EB 3T2PA 2PO6C 5KSUB 1IC7H 3MROB 4OLZL 4C56A 2NY5L 1YNTA 3A67H 4HT1L 4LK4A 2XA8H 4P2OB 2Q76A 2B8OT 3QG6B 5JW4M 3GMMA 3W11C 3HE7A 2YD5A 5DQ9B 4U6VH 2YPKA 4LKCA 3GNML 4KJQD 1V7NH 4ZFFA 1ACYL 2FWOB 3BZFA 3GIZL 3UO1H 4PV9B 1ETZA 3ABZA 1DQTA 1CICD 3MCKB 1Q9LA 1MWAL 4LLMB 4BZYA 2QSVA 3WUZA 1I3GH 1F00I 1ZA6B 4LGRB 4LRIA 1AGDB 1MHCB 3K8KA 1TDQA 4V1DE 3N06B 1LEIB 2UWEF 3TIEB 3QAZB 5JHDB 5E6YA 3C09C 4MD4A 3WD5L 2DLTA 2V9RA 3GHEL 3UBXI 1MWAH 1KTDB 2CUHA 1JGDB 5D7SL 2DAVA 1FYTB 4K3HA 4I48A 4HIEA 1U3ZA 1R3LB 1KXVC 1HXYA 2AGJL 4JAMA 1H3PL 1ES0A 2YWYA 3OTTA 4GMSH 4BQ8A 4R3SB 1F4HA 3IJSB 4AG4H 4I0CC 4L9LB 3HFMH 4R0LA 4Z95L 2BX5A 1FZJA 5HI3C 4GS7B 1DR9A 1KIRA 2HT2D 5AZEH 3MA9L 3BJ91 1PBYA 1A7BA 4JRXD 5TJWK 1T1ZB 1KCVL 3ISWA 1EAJA 2OJEA 5J13C 5I8OL 4I0PC 3SCMB 1BLNB 5JQHC 1YEHL 1S7QA 4GMTL 3ZYZA 4Y88A 2AXJA 5MHSE 3WIHL 1TXKA 1VGKB 4L4VA 3HG1B 3DXAA 4XMLL 3HN3A 3AAZB 2CH8A 5T1KB 3CFEB 1P5UA 1WITA 4D3CL 4WO4C 4PJIB 5AUMA 2R56H 1NMAL 2ZJSL 4M6NL 4OZ4B 3WL9A 2NTFB 1AGEB 3I2CL 1AR1C 4WFGD 1U8MA 1FO0H 2VN4A 3G5YA 2VH5H 4JPIA 1SM3L 2ICES 2CLRA 1J10A 3CMOL 3G6DL 2UZIL 5T1MB 2WP3O 3EYOB 3F62A 3EO1A 3HZMB 4RGOL 1KJ3H 1F90L 3VXTB 1HIML 1A7RH 2FJFA 4FQJH 4MJ4A 4YEFA 1WZKA 3RJDA 3MV7B 2CJUH 5D1ZC 4KMTH 3AVEA 3HTLX 1NCAL 4C83B 1E4JA 1T4KA 4WJ5B 1S7VB 1JPSL 2FGWL 4M8VA 4NN6B 5KW9L 4HFWB 5HYQB 4N5ED 1L0XA 4OZFH 5INCB 4P48A 1IKFH 4FXGB 1ETZB 3IKCA 2EIEA 3V95A 3ULVC 4Z7WA 1PG7W 1XCQA 3HUJE 3ZT7A 3VW3H 3UDWC 4PJ5D 3UTZA 5HBBA 1A6WL 2ATKB 3B3IA 3OJVC 3UTSB 1MLCA 2XPGA 4M6AA 3PWVB 3HC3H 4WWKD 4OF5A 3HNTL 1MCQA 1KB5L 5T3XL 3LKRB 4ZUSA 4F15B 2XI9A 5EWIH 3HE6B 3CUPB 1EX0A 1DEEB 1I9RL 1Q9KB 4D0DB 1D5MA 2Y4SA 5EFIB 2QR0B 1VEOA 5HI4C 1KXTB 1FYTE 4KHTH 5IESL 5C0BA 1DANU 1NKOA 2ED9A 3QR2A 3TESA 4ZOEA 3U0TA 4OFDA 1F8TL 4NN7C 4WRLA 4FOMA 3BKML 1S78D 4K3JL 4J8RA 5I75B 4JN1H 4GS7C 3UTTE 1F4XH 4ZDHA 4WV1B 5D7LE 4NRZB 3QJHB 4ZPVA 5H37G 3W39B 5HDQH 3QEHB 2PN5A 1TZIA 3UC0H 3MO1A 3G6JA 1TVBA 3N1QC 3J8F7 1T03L 1RMFH 3NGBB 3PIQB 2VUOA 2NY4D 3LAFA 1CDCA 4PGCA 1JGLL 3RZCC 1AO7A 4DOHE 3TPUB 5IW3A 1LO0H 1U8JB 4HAFA 5LWYL 3UYRL 1GIGH 1KCUH 4PJHF 3MZTA 2HJKA 1YEEL 2X70A 1RUPL 5IBLC 1NCUA 2D9CA 3EYQD 5CEYA 4HS6A 3FFCA 1J1XL 4PRBB 1CE6B 5KZCD 3BHBB 5I0DA 3E6FB 4NJAL 3VFVB 4X0KB 3CVHL 1EO7A 3UPRB 3BN9D 1OTSD 1P7QD 1F58H 5JW5A 3GM0A 2CLZB 5K9JH 2B0SL 1D9KC 4X6CF 1I7ZB 4XBEL 2R56L 3WFHB 1FNEA 3TIDB 1R6VA 4PJHA 1JNJA 3OXRB 1A6ZB 1BF8A 1P5VA 2BSSA 2DQCH 4XNUH 5DR5L 3A6BL 3D2UD 3PWJA 4JFHD 4NDMB 1I3VA 1KN2L 4HIXH 2W59A 3BP7A 3QUYD 2FJFB 4M1GH 5IWLC 2CRIA 5CGYC 4G6MH 4K7PH 4M7ZC 3CH1B 4W6YB 3DV4A 5HHOD 3O3BB 1WEJH 4XP1H 3U6RA 2VLJE 4PJEF 1IQDA 1CXEA 4LFHG 2P5EA 5J11B 3MGOA 3OGCA 3OHXA 5F7EL 4EN3A 3ZKQD 4BJLA 1JPSH 3VA2C 2GK0A 3V4VH 4F7CB 4HPOH 1G9NH 1F4WH 3MA9H 2FX9L 4LSSL 3S5LA 1AQDB 1MPAL 5D6DA 1WGOA 4R90L 3B3IB 3K74B 5K9OA 4Q6IB 1MIMH 3QUMB 5I1CH 1EHNA 3C8HA 3LKPB 1IM3B 2KBGA 4PLOB 4I13B 5IR1A 4NWTL 3NAAH 4PJEB 3QIWC 4NKDB 4GBXD 4N1EA 5IKCA 1VFAA 4BSWB 1CE1L 5BS0E 1XF2B 4YUEH 3MRBA 1TPXB 2X09A 4MD0B 5E5UB 4OM0L 4HWZA 5IHZB 2XWJA 3QFJA 3WS3A 2KZ1B 3F7VB 5T5NF 1IQWH 1UB6A 3RRQA 4KROC 2YN3A 2L7JA 5TFSL 4AIOA 1JNHB 3ARDA 4QRPE 1H3UA 2VH5L 1FVCB 1FLRL 1PAMA 1MCHA 4ZAKC 3JVGC 3HFML 1SY6H 3NPSB 3GSNL 4DN4L 1OD7A 4XNZC 4ESKA 3ULUC 4XNYL 1O5DT 5I1DA 3VGHA 1WFUA 1YYLL 3HNVH 1DE4A 5HGAB 4R6UA 4OM1H 5HDBE 2FJGB 2ZG2A 3D0LA 1RUPH 2EEAA 4Y4KC 5IB5A 3CK0H 1N8ZB 2IMMA 4BELD 4OSUH 4MCZB 3QXTA 1S9KC 3KG5A 1UT9A 1UWXH 1NC4B 2PCPA 4U31A 5B4MC 1NGXA 5JHLL 2V2TB 4RMUA 1LE5B 3PG2A 1FG9C 3LKNA 2CMRH 4LSVL 2HTKC 1YNLH 3S35X 4JHBA 3RPIB 5DMGC 4F37K 3VXQB 4XCEB 1H15A 2X4RA 2X7LA 4N5UA 3OKNA 1U95B 1KUMA 3VXUA 4M43H 3NFPA 1JHLL 1RVFL 1BVLA 5I18L 3DPBA 1IKNC 2X44D 5I8CB 4QRRA 3T77B 5EUOA 4U0QB 5IVZA 4LASL 1A7OH 5IMKA 2ZOKA 2RJMA 4KMTL 2AW2A 1MJUH 4KU1A 1UZ6F 4WCYH 2YXFA 4HQQH 4OZIB 4MQ7A 1C1EH 3WDJA 4CN6A 5DDHB 4ETQA 2B2XH 3F5WA 3R06B 4IIQB 4HJGA 1FL5A 4HUUB 2ZWLT 3DUHA 1RZGA 1Z9OA 1GOGA 2E3VA 5TDOB 1DLFH 1IM9B 5CEXA 2NY7L 4LAJH 5ELIA 3IDYB 4YHLL 4Y19D 2ZSWA 1DVFD 5GGRB 1MQ8A 4P2CG 2JB6A 2P8PB 3BIKA 3FB6A 1RZ8A 2FLBT 2MOVA 3ZDXF 2F53B 4JZOA 3O2DA 3T8XA 4NKQB 1EXUA 1T2QH 1F3JA 1BFSA 2J8UA 1SYSA 2APTA 3W0WE 4YUEL 3WLWC 1ZWIB 2HRPL 3QI9A 4X4ME 1QEWA 2XKNA 3HC0B 2MKWA 1XGYL 2N1KA 4LAQH 3KVQA 4MNQA 5FDWA 3RA7H 3HI5L 5CUSL 3QHFH 1NAKH 4ZMAT 4LVOB 3MRQA 2B5IC 3WJLA 4ZSOE 1DBJH 1LD9A 4URTB 1VA9A 1QPXA 2I24N 3MGAA 5EORH 3QEGL 5JDSB 1UJTA 1T21B 4Y89A 4Z7UB 4KJYB 1BMGA 1RURL 2VXVL 3GBLA 4LLYB 1PFCA 1BIIA 4JFPB 2F5AH 5B22A 3IDMB 3P9WB 3P73B 1KC5H 4NCDA 3VFPB 3MV9B 3GSQB 3FB8A 3GSXA 5KANI 1S7VA 1ZGLP 2Y07L 3WBDA 5SV4A 3GSNA 2H6PB 4ELMA 2GCYB 5IF0A 1F6LL 2QHRL 4CMHB 1VCAA 5DHVA 3B5TA 3KLSA 2MTPA 4XPHH 4QRTA 3QIUB 3TVMB 4OCNC 2VLJD 3H7BA 3LKNB 4J1UA 4I0KA 5IFJB 2IBBA 5DXWA 4J3TA 2XN9E 3B9DA 3RPIA 1G7HA 4M7LH 3GBNH 3WXVH 3MA7B 1HYRC 3UYPA 4WFFE 4ELKA 3W2DL 4UTBH 1HYSD 1IGIH 2XRAH 4OV5A 4P46B 3RI5F 3FFDA 5DUPL 1A6PA 2HLFD 3CXHK 3D69B 2D9QB 4RRPG 5BV7C 3LY6A 4MX7B 4XAWL 5IV2A 3FRUB 3QPQD 2PR4L 3D9AH 2R4SH 3TCLB 1LP9A 1S7RB 1OGTA 5F7DA 2NW3B 4S1QL 3KYOA 1FZMA 2AXGA 4K3JH 1TETH 4PRPB 2PO6B 3OKYA 4YO0B 1JHKL 1C1EL 3SDDC 1U93B 4OF8A 4Q6YA 1BFOB 2EDEA 4FFVC 4BK4A 1MCPL 2NY2B 4E0RA 4ZFZB 3TJHC 3JV0A 4K71B 5HYJA 4XNXL 5I8KL 3RKDD 4YZFF 4E41D 1SJXA 4M61B 2E6QA 5D72L 4YXLH 4GLRI 5LGJB 2FX8H 3ALWA 4X5LA 3TVMC 3EJYC 5DJYB 3O3AB 5IVXE 1XT5A 1QLRA 5C0RL 2HJKB 5BQ7B 4U1NA 4GRWF 43CAA 1HHIB 4FTVD 3QWRA 4PJ7F 3BUYA 2YKLL 3E6FA 3IAGC 1AJ7L 4MJIA 3OGOE 1GC1C 1BFVH 2PW1A 1MF2H 3EOYG 2Y36L 4O2FA 1C5BH 3ARFD 3WNKA 5DJAA 5DHXB 4HCRL 4GRMA 2VDMH 2AK4A 3K2UH 5JNYA 4AENA 5TF0A 3IDXL 3PQYA 3WHE1 1A5FL 2R15A 3ZL4L 3IVKB 1L7TL 4JHAH 3ROLB 4KRPC 1A0QH 1NDGB 1XEDA 2JELH 1KNOA 4OIIH 1UA6L 2LVEA 4P2OA 3V8CA 3OKOB 1G84A 1D7FA 4I77L 4R2GC 3F7RA 5EB9A 3CH1A 2OTUA 4RIRA 3DGGB 3QXAB 4MAYA 1YN6B 3BPCA 2AXHA 1XR8A 1FL3A 4GAFB 2VLKE 4M1CC 5HHOB 2EC9U 3LDBC 2XIDA 4J3XA 3GMOB 2IQ9L 4FFZL 1A3LH 5EDXA 5JXEA 4IRJC 2WSKA 4WHYH 2Z4QA 1V5JA 3DIFA 2V7HA 4PLKC 3N1MC 2JLLA 2HMIC 1XGQA 3IXTA 4UIMA 4ORGA 4YFEA 3HPLA 1G9MC 5EUKA 5D7IF 1D9KB 4WO4A 2CGRL 3QZWB 1AY1H 1EHAA 3NOIA 4RNRA 2X9WA 1FYTA 1NCTA 3W9EB 5BJTB 3FB5B 2ZUWA 1MFDH 5ESAB 2B4CH 3G5XA 3FQNB 4JHWH 4DUVA 1NUDA 2XG5A 4J3WA 3HRZB 1A4KA 4PRPA 2AJUH 3WFDH 3UROR 1QHPA 2EIBA 1V05A 2BXZA 1DSFH 4TVPL 3T3ME 4OFPA 5GRVK 4U6XA 5EG6C 1D6VL 3KLHD 2CIIB 3LQAC 2JJTA 3K81A 1A1MB 1KB5A 1GHFH 5CEZL 5EIVA 3LDBB 4X9GA 3RVXD 1QD0A 5F7HA 4WW2C 4LHUD 4S0TD 3ZHKA 4NQDD 1Q9WB 2BC4A 1ZMYA 1VGKA 1JYVA 5DD0L 3SKJL 4PY7A 3SGKC 3HAEB 3HRPA 2VQUA 4R26L 4KKBD 3UDWA 2P45B 5H35A 1OF2A 4FQXA 2YUZA 2V17L 3N9GH 4GUPA 4NCC2 5F7YC 3DYMA 3W9DB 3AREC 4QXTB 4JQIH 3IU4L 3TT3H 1JWSB 5LGKA 1RAMA 5CHNA 4XWOD 5KVGL 1GSMA 1A6WH 1A4JB 2EDLA 3ZTJG 3QEQB 2AV1B 5JUEH 1DL7L 4WWKA 4W4OA 3RQ3A 3RWIB 3OF6A 1SEQL 3NZ8B 3GGWB 1QFPA 3KPSD 4U0RC 5CZVL 1YPZF 1HWHB 1RD6A 2YPLD 3TYFA 4P4RB 1CYGA 1JMZA 4QTIH 2ZNWA 1CN4A 5C07B 2LTQB 4HUVA 3LN9A 1RK1A 4NHUA 5EO1A 5DJ2B 4NC1E 2ZG3A 5SX4H 4OLVH 3SKOA 2R1YB 2DRUA 3EO0B 5CWSB 5HTSA 5T5NG 3BN3B 5TDPA 4M8QA 2L7UA 1U42A 2C4FT 2ENYA 1IJ9A 4AEHH 3GSUB 3BPOC 2DN7A 3DXAB 5DJCB 4K23L 3TLRA 1BHGA 5B8CB 5J1SC 1FFNA 5CKAA 4ORGB 3I3DA 3JWDL 4NUJA 3LS4H 1IEHA 4S1RH 1JGLH 1TMCB 1KT2B 3PL6B 4DEPC 1CBVH 3HZKA 1X5KA 4C55A 4WFHE 4MZ2A 3H8NA 3WNMA 3B9KA 3LEVH 2RQ8A 1UACL 5IBUB 5J9PB 3CVHH 2G9HA 3DARA 1WTLA 2J6EA 4XP9L 2WWKT 4ODVL 1P7QA 4XPAH 5D5MF 1AXTL 5B39B 5GS3A 2XV6B 3SKMB 4Z7VB 1T5WA 5LQBL 2E7CA 3NIDE 3IAQA 1J1PL 4YXKL 2JJSA 3DO3A 3RU8H 5GGUA 1LQSR 2DOCA 3KNBA 3LKQB 4YHNB 5C0JB 3KPRE 4Y19A 4XP4H 3GO1H 3VRIA 5I6XB 1ORQA 3DX6B 2GTWB 4Q2ZB 1HHGB 1K6QH 4NNXA 5GZNC 3VG9C 1CFVH 5B3JF 4Z7UA 1KXQE 2I27N 1CDUA 4LSVH 4CW1A 5IOPB 4N9OB 4LGPB 5EU7E 1FE8L 1YNKL 3PNWA 1I1AC 2R4RL 3O2VH 4KH2A 2M2DA 3ARWA 4D9QD 1QSED 4ZUSB 2WUBL 3HE6A 2A6JB 5IB2A 4XX1G 5KOMC 3EDKA 1ZT1B 3WD5H 3C9NB 3V52L 5HI5D 3ZE2E 4PGJA 1MHCA 2Z8SA 1XR9B 4G7YL 1H3XA 3HCVA 2YZ1A 4NDMA 5JPNB 2VL4A 4ELKB 1AY1L 2B2XL 1Q72L 3KLDA 3NCFB 2GJ6B 4L8BA 4QCIA 5J57B 3VGBA 2BVPB 4NBZB 5EZLA 1S7TA 3FRUA 3WUWB 4NZTH 1F2QA 1R3LA 5DJ2A 4DKFH 5ETUA 5L9DL 1TETL 3RL1A 1FYTD 3MFGB 5FA4A 4RWYH 3U7WL 2BNQD 3WKMH 5EOCL 1CF8L 5TDPB 3OZ9H 3KPPA 4Q9RL 2WINA 2VE6A 5CCKH 1FZJB 4B0MM 3QQ9D 1JCKA 1KJ2H 3CX2A 3QEUB 4JE4B 2VIRB 3IDJA 2OJZH 2DQFA 5F44A 1PZ5A 3TZVA 1KN4L 4PJXA 1WISA 2ENSA 1H5BC 2BY0A 2H2SC 3AAZA 3BE1H 3KYMA 3SE4A 1PLGH 4X6DE 1I7RA 4JJ5A 4YBHA 3ZTJH 1KOAA 1CFSA 3QXDB 4XMKL 3BGMB 5F9DC 1BFVL 4TUKL 2B4CL 3SKMA 2P8LB 1UVQB 2XQBH 1U41A 1FVCA 5L2KA 4P5TB 3MRDB 1TQCC 4ZQKA 1DQDH 4PREB 1RZJC 3SPVB 5HDBF 3G5YB 1AGBB 4U2YA 3QUZA 4LMQE 3RU8L 5C9JB 3P9MA 5L2JB 4UOW0 3MGOB 3OGCB 3VI3E 4FP8L 1DE4B 5HGAA 3UXFA 2BNRE 5BOZG 4FQIL 3IS1X 5DC9B 3OF6D 4AT6A 3VW3L 2NY2C 4R8WH 4OB5L 2BSED 5EBLA 1J88A 4IDLA 1PG7X 1ZHNB 3M17B 3DX7A 4JFDA 4QO1A 4FZ8H 3BPCB 5JIPA 3KPSE 4ZUTA 2Z91A 5EZIL 3CFCH 3DI2B 1H3VA 4WCYL 4D9LL 3RWDB 3T0EE 4PTTA 4O5LH 5C0AA 1EVUA 4MJID 2GI7A 1TENA 2I25N 4WNQB 5GRZA 5C6TH 4L9DA 1GXEA 2OM5A 1MREL 4XMPH 3SE3C 4OGYH 5DMKB 3QEQD 4NZRH 1V7MH 1W2KT 1XR9A 1T04B 1AH1A 2FATL 3BP5A 3IETA 4NFCA 2HT4C 4UIMB 4I4WA 2FYYB 2GKIA 2D4DA 3TF7C 1EEYA 1FO0L 1FYHB 4KUCD 4ODTH 5FF6A 1E28A 4ZFOB 4U6YA 5J8OA 4HV8A 3L3DA 5FKAA 4RNRB 3S36H 5E6IB 4LQFH 2F54D 4FNLH 3T0EB 1UZ8B 4JFEB 1WWBX 3NMEA 4NQVB 1XCTA 4XPAL 1FH5L 3EDFA 1P6AB 3WHE0 1IAIM 5CP7B 2VDPH 5ALBL 4PS4L 3VGAB 2B4CC 4J7RA 4LOUD 5T1DL 5C0ND 3F5WB 1OP5H 4HS8H 3C60B 4LPCA 1QBLL 1KELH 2E7BA 5MEPA 2Z31C 3IGAA 5L88H 1R3IH 4MB3A 5C0BD 4CUCA 2XOTA 3DBXA 4P2RE 3BI9X 3QIBC 2P43B 5A1AA 1Q9WA 5ADPH 1S9YA 3BVNB 1I75A 3ESUF 3QCVH 1BJMA 1HDMB 4G6AD 5FFLA 4HS6B 1ZAGA 1MCWW 2GJ6E 4DWHA 5F9WC 3U2SB 4GG6F 2VXTH 3C2SA 4S10A 4TNVF 1UC6A 5BS0B 4PJDE 1RHFA 2YRLA 4IRSC 4OCYH 4HGKC 1L9MA 1MY5A 2YRPA 1UADC 2DF3A 2YD7A 1C7TA 3FO1A 2EIZB 2BVOA 4NC2B 1TTUA 2X1OA 4HDIB 3DWTA 4GFTB 2Z8RA 1T89C 3W2DH 2MCPL 3D39D 4YDLC 2VLMD 2WW8A 3QFJE 1HI6B 4X7CC 5JDSA 2HFFB 3L3KB 4NQXB 2R8SL 2IPUG 2Q1EA 5EOQH 3UYOD 5HD8C 4LNRB 2FSEB 4L8SA 4TTDC 2YR3A 3SDDA 3D18A 3VFWA 5LAXA 3ULUH 3OAYH 5C0DA 4M1DH 1QA9A 2AERT 5CJQL 5DWUH 4X6BB 5GGRA 3ZSSA 4LSQH 3LEYH 1I8IB 3L3OB 1AD9A 4Z76B 3DVNB 3AB0C 4KQ3L 2E27H 4J1UB 4XNMA 3DMMC 1JI2A 3VH8G 5DRWA 4M7KL 4CMMA 3F7PC 2ADGA 3PHSA 4Q6IA 5I1HH 4LCCA 1ZLVK 5DRNB 4H20H 5CJXC 5IQ9B 1NCDL 3QHZL 4OCRH 3LV3B 3QFDA 3VFNB 4KRNA 3EO9H 1E28B 3HUJF 4YBLB 4CGTA 2AJYH 3GMLA 1LEGB 4MX7A 1KGCD 4FXLA 5IJKA 1INEL 4K94C 4OI9A 1XIWC 1GZQA 5H2BA 2LABA 4GG6E 1I1YA 1LD9B 4AIZA 2DYPA 4PJBF 3UTQA 4R4FL 5TQ2H 3ARDB 1MFBL 4HULB 1T22A 1A6UL 4QHMA 2G75B 5C0GA 4N1CA 1OB1B 3FZUD 2LTQC 1N7MH 3IFLL 4NYLA 2DWDB 4PGBB 1XGTA 4FA8A 3PWLA 1D5IL 1AGCB 3CZFB 3P2TA 3WFEH 1J87A 1DUYA 5T3ZL 4H8WH 4IS6A 5I1DB 5BCAA 2VZ1A 4Y5VC 2J3SA 1FAIH 5DVMA 5JXEC 1WBZA 3EYVB 4EI6B 2VO5A 4G8FB 3H7BB 1AI1L 5C0CB 4Y8AA 4RFEB 1FNGA 4NOBA 1HNGA 2WANA 5C07E 4JM4L 4S2SB 3RIFF 2DM7A 4Z7OE 5I2IA 2H2PD 2ZCHH 1R3HB 3O4LE 3I6KB 3QUKB 4Z7QE 3PJSB 4XB7A 4MXQD 5MENE 3A6CL 2NY4B 2R0WL 4ZXBA 4OCMC 1LO3H 1X3DA 1DLHA 4X99A 3GEWB 5F7FA 2X4SA 3L7FA 1OAKL 4XXCC 5EC1B 1E4WL 3RL2B 2OQJA 4Z8FH 5E70A 5DD3H 1CICA 3LRHA 5LVEA 1JE6A 5E7BA 3ROLA 1HXYB 1B6DA 3C08H 4O2CA 3L3HB 4G8GD 2VXUH 4JFOB 4OLYH 4RAUB 5GRXG 3OKNB 3GMMB 2D7TL 2WWMC 4P4KA 4QOKB 2F54B 3Q6GH 4XTRD 2YPKB 1UM5H 4H5SB 5D1ZB 5IT2L 5J0BA 3OR7A 1Y6KR 1AR1D 4TSCH 4ZS7H 1T66C 4KK5D 5DO2C 4J4PD 1SVCP 3HNVL 3BOVA 3E1F1 4OCXH 4XP6H 2B1AH 3MRCA 4ZO8A 3RWGB 5FA4B 4JREC 5ID1B 5TGBB 4Q97A 3K0WA 3KPPB 3REWA 3CDYA 5GHWL 1MNUH 4CU8A 2ADGB 1KTRL 4Z5RA 5D2LB 1RY7B 2GITA 3B6SB 2ARJQ 2VIRA 3ECBB 4NQUA 3MRLB 2J8UE 3HB3D 4QHUA 4X9FA 4LU5H 4KK9C 5E4EC 4PJIA 5AUMB 4M3JA 5IGXL 1WTGT 4OF0A 4HK0A 4JKPL 4H1LG 3MRJA 5F1SA 1A6TA 12E8L 1W72L 4E41E 1MJ7L 5FGSA 3R1GH 3DUSB 4PP2A 2DBLL 4JDTH 3FN0L 4L5FH 3SDCC 4KK6C 2OX5A 1N0XH 1WIPA 1FJ1A 4H26B 4ODHL 3ARTA 3I6GA 4G43B 1T0PB 3P9LB 3X14B 5K9JL 3EO1B 5L6YL 3AUVA 4GBXB 5E00B 4N8CL 2MSPA 5FUCE 5E9DA 3HI1A 5HI4D 3ZKXC 4FTVE 4HT1H 4NPYB 1CDIA 4ZQKB 2R1XB 4K9EC 2AP2A 5B39G 5DTFA 1XGTB 5F89A 1C08A 5I30H 1DFBH 1G7IA 3KWWB 3RWHB 3E2HC 2IQAA 3MRFB 3WLBB 5D7KE 3KPRA 4DGVL 3TJEL 2LAAA 4NKMA 1DQQB 1WBZB 3EYVA 3TZVD 1FAIL 5AAWA 5FM5O 1WEJL 2HVJA 5FAAA 1NAMA 4TVPE 5GS1A 5IM7B 1IAIH 4I1NB 5DD5L 4A2LA 3MV9A 1CVSC 3D85A 3QNZA 1A9EB 3N0PB 4F80A 4UAOB 4XCFH 4KQ3H 4JFFE 4L8CA 2A77H 4LF3A 4DEPB 1S9VB 4WGWB 2QV2A 4B41A 1KCLA 2YK1L 3OX8B 5CILL 4Y16D 3X3GH 1EK3A 4YAQB 4GKNA 4IOFC 2C1OA 5I66A 2IH1B 1CQKA 4S1DC 3VXTA 1QFWI 3FB5A 1A7QH 4G6FB 5EU6D 2VLLB 1ZLWH 4RAUA 2WM0A 1AHWC 4GAJL 4X4ZA 4UQ3B 4KK8C 4HLZG 4KTEL 5DYOB 2PW2B 1CFTA 4KFZC 2IGFH 3B9KD 4HUVB 1HH6A 1D5XA 1VESA 2W38A 1J7VR 3PHQB 1I7UA 2J88L 4V1DD 1F58L 4P5KA 1MQKL 3N85H 5E1AA 3KYOB 2F5AL 4TNWF 3UTSA 4K3EL 4CVZA 1QBLH 2DI9A 1UWXK 4HUKB 5DA0B 4IRZL 4MLSA 4HSQA 4PY7B 4NUGL 1MEXH 5GSRB 1MFCL 3V8OA 3ARGC 3VI3F 1KN2H 3OKEB 2R0ZH 3HNSH 4HIXL 1F4YL 1I1AA 3GI8L 5F7NC 3BHBA 4LCWB 5EOTB 1F3DH 2A9ML 3QQ3B 4Z0XA 5HHNA 4Z77B 4UTAL 1YEFL 3EYSH 1UB5B 1IAOB 1R5WA 3P11L 1N6UA 2BZDA 2VAJA 4OFVA 4X6EA 2FBOJ 2I07A 3FB7A 3DUSA 4PP2B 1V3MA 2YUXA 2AJYL 3VXRB 1J9CT 4A6YL 1S9XB 1Z6JT 4F8QA 1X5FA 5JPMA 1T83C 2IFFL 1OARL 3RWIA 1VSCA 4P46C 2NY0C 4F37F 2VMFA 3PWJB 1QQDB 4A6YB 4WWID 2XY1A 1F90H 2BVYA 5F7LB 4G8IB 3UZEA 3QAZC 2BJML 1QG3A 5HVHC 4MNHB 2A9NH 4I9WE 4XBGA 3O4LD 5CIPH 5AZ2H 3TFKD 1NUFA 1MI5E 4FTVA 2IQAB 4U7SA 1RK1B 3WLBA 1MAJA 4JO4H 1KG0B 1FRGL 1HI6A 4NNXB 4DUXA 2WLYA 1PY4A 4TRPH 3UCRA 1KENL 1IAMA 5FM5M 5CEYB 2X4NB 4NP4L 5JA9A 2J1KA 3BT2L 4O2EB 5IOPA 1OAXL 2OTUB 2DICA 4RIRB 3KGRA 4OM0H 5J1AB 3EZ8A 3MMEB 1L0YA 2E9WA 4QYOA 1OGAE 1GAFH 3L9RB 4UT7L 1LILA 4OFKA 1AIFA 2EDYA 5LBSH 1NCCH 5BXFA 2D2OA 2XNAA 2QQLL 4QXWA 1AP2B 1K2DB 2H8PB 2ZSVB 5HHOE 4NWUL 2I9LB 3J7HA 3SE4C 3MSPA 4G7VL 1MIEL 4C56D 4LMQI 1P7QB 3V5HB 3KLAA 2VDML 3K2UL 3OMZA 2EE2A 3QIUD 4OLYL 4PLJC 3BQUC 1YJDL 4JN2B 3H0TB 4RGND 4HKXB 1MHHA 1P7KB 4NQCA 2JCCA 5GGSB 3QUZC 4W68A 3GKWH 4HIIB 2CDEB 5DQDH 1G7MA 3BH9B 2GTWA 3MR9B 4Q2ZA 1GL4B 1W72A 3U46A 1NGYA 4MAUL 5HYSA 1BQHB 4JDZB 4ZAKD 1JPFA 4Y5YC 4GAGL 5F3HA 4C4KT 1B2WH 5TH2A 1ZSDB 4P57A 1RUQL 4JFYA 4AH2A 3CU7A 3C2AH 1NSNH 4PJEA 3G08A 3ARDD 4WTZA 3GMQA 4EBQH 3WFCH 1ADQL 5KS9B 4X7SH 4JHZA 1JZ4A 2ED8A 5BZWB 4M43L 1X5HA 4OLXH 2G60L 1X6LA 1RURH 2B0SH 3L3JB 5DS8A 2VQ1A 4PV8A 1EEZA 4JKPH 3UPCA 2W0LA 1GRWA 1FVEA 1JNHA 4QEGA 4HIHA 1I4FA 4LLDA 4PRHA 3IJHB 3CDGB 1R3HA 4K7FA 2YA1A 3PJSA 4LARL 4PJGE 1IBGL 3BZ4A 1AE6H 4X7FC 4QXTA 4LPVA 5F1IA 1G9EA 2QEJA 1OSPL 4N68A 3RTQA 4H1LA 5EZJB 5J7CC 2QADD 3MTRA 5CSZB 3OB8A 3QEQA 4D9QE 4FQ2H 1UXWA 3LVEA 5DMGD 4I5BA 5T1KD 3HLAA 5D70H 4LCUA 5L2KE 1I3UA 3TA3B 4PG9B 4CVUA 1OTTD 1BAFH 5F7EH 2OL3H 3L3HA 4L4VD 1ZHBA 3O2WH 2ICWJ 1F4WL 2F54A 1CXKA 4F15C 4Y5YB 7FABL 5EU6E 1GHFL 1J11A 2AJZB 5CEZH 4V1DB 5E8PB 1NPUA 3HE7C 3IDJB 4OCSH 4JFHE 5CD3B 2VWEE 3BXNA 2W65B 4JFDE 4KKCC 4MZ3A 3ZE0E 1Y6MR 1NAKL 1CGSL 1VEMA 3GBMH 4HXAL 1NMCB 2ED7A 2BK8A 3Q5YA 2CRMA 2V9TA 4WU7A 2VWEC 3MV7D 1H3TA 4KY1H 3ARRA 2XWBB 4ZUWA 2VISB 1IAKA 3K8LA 4UU9B 4NO0A 4QRQB 3WKNA 1AC6A 2HVKB 1EMTL 3TBWA 1QVOB 4LCYB 1SBSH 1UWEH 4MA7H 1K85A 2VXVH 2EXWD 1WZ1H 5A16A 1M6OB 1JYWA 2BNRB 4XCYB 4LLUA 4P4KD 1IAII 3R1GL 1A6TB 5E6IA 3B8SA 5KBNC 2IFFH 4HJ0C 1R24A 5EO0B 5DDHA 2OTWB 5I76A 4FQ1L 1JV5A 2OL3A 5IW1A 2BFVH 2VDRL 2NY7H 2AQ1A 4GKOA 4PJ7B 3IF1B 1DN0B 4I3SH 3P9LA 3DV6B 3QNXA 3OAUL 1C5BL 5B39A 4LEXH 3O9WB 4AT6B 3CNKA 5HJ3B 1YC7A 3IRZA 4H0GA 4ODWB 3IDMA 1U8LB 3EKCA 3LB6D 5C09D 3GSWA 5J06A 3M17A 5GGUB 2RAMA 3S3SA 4EOWH 1S7UB 2RBLA 4XI5D 1EEQA 2V2WB 1ORQB 3DX6A 5I1EH 3E8UL 4PBVC 3WXWH 4PV8B 4FFWC 5I1JH 3ILQC 3QRFM 4UV7H 2W9DL 3JTTA 2JB5H 1ZA3A 2NXYD 2XZCH 4YQXL 4CU7A 4TUJB 3JXAA 2IPTH 5CUSH 2ICWI 1RJLA 4LCCC 3IXAB 5LGHH 3VG0H 2XZQL 1X5IA 3H42H 3BRGC 2EE9A 4CVXB 4JANB 3EOAB 1A47A 3O2DL 4PRHE 2OLDA 5HYIA 4M7KH 1JHLH 1ZT1A 2BXYA 4OQTH 3T4AB 2W9DH 4OF3A 5I8OH 3STZA 1ED3A 2ZUQB 3O4LB 1MELA 4LASH 1G0DA 1F3RB 4NQVA 4RBPK 5DSCB 1MHEA 2FR4A 3VFPA 3IJSA 5CD5C 1NKRA 3OKDA 5LAXB 3C60A 2ATPA 3BKYL 3WSQH 1VKXB 1DLFL 2VERN 4FMKA 3O3EA 4J2XA 3HPJA 1UJ3B 2X4UA 1F8TH 1G7HB 1S7QB 4LLQB 1KB9J 3B9VA 1RFDL 3HG1A 2HFEB 3BD4A 1M05A 5FO8B 1NAML 3NCBB 4Z7WE 1YEKL 5FIEA 1MWAA 4Y5XC 4EVNA 1EMTH 4XAWH 3CDCA 3HI6H 5FYLE 3MCG1 1MJJA 25C8H 3SOBL 5F72S 3U2SA 3TVMD 1M6OA 4LLVB 4XHQA 2E5EA 1X5AA 1ES0B 1WZ1L 4JR9H 1CLOL 1Y18B 1LE9B 1MJ8H 4JEGB 2QSQA 4UNUA 2Q8BL 1IGJB 2PTTA 3L1OH 3FO0H 3UJJL 5J1TC 3O45B 1RZFL 4IOIA 5F9JB 2OL3B 4TSAL 5IW1B 2HKFL 4WHDA 5T1MA 1OCWL 5DUBA 4HJJH 3MLZL 4A6YA 4XPTL 2VXSL 4HKZA 3O9WC 5C2BH 5FEBA 4D8PA 1M71B 5FHAL 4KTYA 1IAIL 5EBWB 4PREA 1YEDA 2IPKB 3N50A 4ODXB 4ZG1A 1EHLL 5T1LD 3P9MB 1QLRB 3RVTD 3GMNA 2OTPA 7FABH 3IKCB 4FQQA 5L2KD 3D39E 4JG0H 3QFJD 1FCGA 2P46B 5HPOA 4P5MB 1KCSH 4V2CB 2B1AL 1U58A 4QYOB 1TCRA 4OM1L 5EN2B 1BQHG 1YY9C 1Z5LA 2ZUSA 1U2CA 3C5JB 1AD0B 2GQHA 2X1XR 5JR1L 3GK8L 1WLHA 4ODTL 5ICZA 1H5BB 4M62H 4R96A 3GMLB 4M5YH 1U8NB 2RCSH 2GJJA 1X5ZA 3O4LA 1GGYA 1NDGA 4O2CB 5IGXH 3P4MA 1WC7A 3MJGX 2A0LD 1BJ8A 5EA0H 4FXKA 3LN4A 2BRRL 2DS4A 4K3EH 3X11B 2IG2H 2XN9B 3RWFB 3FN3A 4P4KB 4TSBL 1UKQA 5KANG 1FIGH 3O6ML 4WV1A 4U6XB 1WBYB 1B3JA 3QDJE 4HKXA 1TQCB 1AC0A 3BP6B 1H0DB 5D1QC 4ZO9A 2Z4QB 3RZWA 1YYMH 5E6ID 3UTZB 1NANH 2WBKA 3VGEA 5CFHA 1KGCE 3KPLA 2F74A 3T1FA 2APVA 5D5MB 5HHPA 1NGYB 4RAVB 3VFGH 4HF5L 4EI6A 5DEFA 5EUKB 3MRPB 3QDGB 2EE6A 1DEEA 1Q9KA 4D0DA 3RBGA 3QZWA 4KY1L 2MQCA 1ND0B 5I1IL 3SGJA 2AXFA 3MGTA 2NXZC 5EO9B 2GFBA 4YDKH 3HS0B 3V7MA 3ZT5A 5DRZB 4NZJA 5I73C 2UWEE 4NZRL 4JDVB 1EEUA 5DS8B 3OKLA 3MJ7A 4EQ3A 3BKCH 3DURA 3UJTL 1L6ZA 1CGYA 1SMOA 3CFKA 2C9AA 2HFGL 3CDGA 2X40A 4OF7A 5E99L 4HPOL 1OTUD 3V79C 2AEQL 5JW4Q 2OI9C 4LNVA 3S4SB 3CSGA 1P1ZB 4NP4H 5ACLA 4NPYA 1FCCA 35C8L 4NM8L 4ZAKA 1RZIB 3MLYH 3N1FC 3SQOH 3FQRB 1DVFA 1YEDB 2FIRT 4YWGH 4UIKH 5LWYH 4MD5A 1CFBA 3FRPG 5CJQH 5DWUL 2P5EB 1HCFX 1UKTA 3DRQA 4F8TA 2D03L 3P4NB 2NX5A 2DTSA 4LP5A 1OM3L 1F97A 1NLBL 1HYSC 3W81A 5IEHA 4WUUB 3NTCH 2OSLB 5GRUH 5ITBH 2DMCA 3VFVA 3VA6A 3RBSA 5F7MC 1B0RA 1HQRB 4G8GE 4P5MA 5K9OB 4W6XB 1QLEL 4MJ6A 5I1HL 5E8PA 4GQ9L 1S9WB 2GK2A 3PE9A 1M7IA 4GH7B 1QUNA 1OPGH 4JQVA 3WN5C 4LSRH 4DGYH 4IOSD 5KSVA 2DMBA 3RY6A 4GKNB 2W0FA 3SJVA 1A6VL 1RZ7L 1ZLVH 5I66B 5E8NA 5BZDA 3WO3B 2IADB 3GI8H 1AGFB 1F4YH 4LVHB 1SBSL 1UWEL 3RWCB 5J9PA 3MRGB 3P4MB 3HG1D 1B6UA 3UMTA 1QSFE 2A6DA 2YSSA 1YUHB 4Z6AT 2BHUA 3HI1B 4EN3B 4LLUB 4KTDH 1L7IH 2NZIA 1HH6B 3FN9A 4TSAH 1OW0A 2JCCE 4OZFG 3BP6A 4R4BA 4MMZC 1CL7H 2A38A 3MV8B 3KPLB 3I9GL 3KPRB 4LLWA 5E56A 1ZEAL 2HJFB 4RX4D 1CCZA 3MRPA 4QHMB 1H3GA 1PQZB 4PPTA 3PWPB 1RUMH 1L9NA 3WUWG 3LEYL 5DK2B 2HJLA 5IB5B 4UB0L 4LCWA 3HR5A 4U1JB 2DQDL 3QQNA 4BSWA 1RJYB 2DYPD 4XTRC 1UACH 5E5MB 3CVHA 2O5ZH 1IC7L 2XWJB 3WS3B 5GGRY 4DKDC 5D7KD 5DGQA 1CLYH 2A6IA 5FO9A 1FDLL 2OK0L 2OL3L 3HCVB 2KH2B 5DD1H 1NFDB 1HKLH 2VDQL 3G5VA 3FCTA 5IBLD 4NQDE 1GC1L 3NCJL 4YBLC 3QRGL 4X6DF 2PYFA 1SBBA 4JANA 3D0VA 2VB5A 2W9LA 4XBGB 4YHLH 3PQYE 1CLCA 5E8DH 3LMJL 4MA1B 3ZKNC 4E41A 1D5ZA 1U8KA 2I60L 4G7VH 2F53D 4JKWA 3S88H 4NN5C 4UIKL 4CADB 4NHCL 1FDLH 1DBML 2XY2A 1W0WB 2G5RA 4HWUA 3UJIH 1K4CA 5FYJD 2B1HH 3PNWB 1KEML 5DHYA 3L3GA 5IB4A 2WV3A 5GISL