5GS0H

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
total genus 23
structure length 116
sequence length 116
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0H00
4D9QD 3IJSA 2D0FA 5I73B 3DTXA 1TETH 3QUMA 2AV1B 1FE8L 2BFVL 5EH1A 5L9DH 4S1SH 1C1EL 2OTUB 3DMMB 5A3ID 5I2IB 1CI5A 4OD3L 3UPAA 4WDIB 4G80A 1ETZA 5EBWA 3KYMA 4EQ3A 3O9WC 4NKQB 5I1LB 1Q9KB 4NQXB 5DC0A 4PRID 3MXVL 4ZSOE 3U36A 1ES0A 3T1FA 3KYOB 2DM2A 3VRLE 1HK6A 4JFZH 4DW2H 3SKMA 1T3FA 3OSKA 2FLRT 3QNZA 3PHSA 4NQCB 4OJFH 2R56L 1UM4L 2P47B 1RIHH 3L3DB 4JO2H 3VJ6B 4G9FE 1DVFC 4IS6B 4JN2B 1HCFX 5C0CE 3F7VB 4IIQB 3CVHB 1R3JB 1GOHA 4WHDA 1ACZA 3MV01 3GSUB 4GAJH 4IMKA 4M1DH 4Z9KB 4IEFB 1B3JA 4WUUB 3EOBA 3LKOA 4PBWD 3KPRB 4QOKA 2QEJA 4HAFA 3FMGL 3QYCA 3W82A 1IM9B 3HCVA 5E03A 1WWCA 4FQ2L 4KTEL 5I0ZA 4MCYA 2B5IB 2OMNA 3H0TB 5E95B 5IESL 5DVMA 5F3HB 3BRGC 3RU8H 3FZUD 5CZVH 2QSTA 2UY7A 5LAXA 1N26A 3WFEL 3I02A 3BH9B 3W2DL 3TO4A 4YHYC 4KHTH 4ORZC 4OCWH 3S96B 4FABH 5DLMH 2CLVB 3IAQA 2FATL 1ZGLB 2G2RA 1FV1A 3REVB 3DX9A 3MX0A 2A6KA 1F6FB 3TA3A 2Y07H 4OZIA 1ROWA 5KVDL 2A1WH 5EUKA 3SE3C 1JWMB 3NIDE 1CGWA 2CJUL 2QHRL 4DQOH 1QLFA 3GM0A 5HVHB 1GHFL 3WCYA 3U46B 4ODTH 5J57B 4KV5E 4FQQA 1OB1A 4X4XA 4MMXC 4QGYA 3TVMB 4KFZC 3VFTA 2IGFL 5DURD 4WFFE 4K7PH 4MXQC 4MA7L 5TQ0L 1G7JB 4APQA 1MAJA 4NKIL 4Y1AE 5CUSL 2F5BL 2BZDA 4JHAH 3S8WA 1KG0A 4F7PA 3QCUH 1YEGH 4Z7WE 4NWTL 4YHOL 4RQQA 4KDTA 4DCQB 5EOTA 5DRWA 2XFXA 1H3XA 1JUFB 4IRSC 1H3UA 5ENWB 4GQ9L 3RVUD 2ZKHL 1PDKA 3U2SA 4KKNA 2D4DA 4YDJB 4RWYH 1IQDA 1JPGA 5SWZE 1M6OA 1WC7B 5B39G 5BO1L 3CIQA 1YJDL 4XBEH 3GMMB 3DX7A 1QACA 1D6EA 2HRPH 1CFTB 3D25B 3LN4A 3BD3A 5CAYB 2UUDK 3ZHDA 3MA7B 4DZ8B 3QXDA 5FYKH 1UWXH 4ODXA 3UZVB 5J6HA 1Z9LA 1JWSB 4NZRL 1LK3H 4ZXBD 5E7BA 1TVDA 2CIKA 5ACMA 5JXED 2I9TA 4Z78B 1NGYA 4N8CL 5BXFB 2F5AL 4MB3A 2JIXA 4LCWE 1UFUA 4P5MA 4ZFZB 3QIWC 4HUKB 4N0UA 1QFOA 3I2CL 2HWZH 3QUMH 4PJGF 3QH3B 4DVBB 1MFAL 3WUWG 1MVUB 5F1NB 1P69B 1NCWL 4KKBC 1I8LA 5E70A 1LILA 3RX7A 4Y89A 3A6BL 5EOQL 1KENH 3WXWL 2J1KA 1MEXH 2GTWA 4LBEA 1JYNA 3GSQA 3RP1A 1NCAL 2RGSA 4QY8B 2E6JA 1NCDH 4QRQB 4FG6D 1OGTB 1UT9A 2GFBB 3TVMD 1R0AH 1YY9D 3DWTA 2A6IB 5DD0H 2BK8A 3TBWA 4EEEA 2C26A 4XP5L 2AK4A 1NKOA 1MCPH 3FO2B 4P59L 2FJGB 4Z7NE 3T0WA 2VXTH 4XP1H 3UYOD 3W81A 3LRHA 1WTLA 3TGXA 1I9EA 2KPNA 4QXTA 4JN1H 1FCGA 5DO2D 1F8TL 4XVJH 1CR9L 1U8HB 2CK2A 1CICB 2X4UA 3MJ8A 1LNUA 4OF3A 3ARDD 1D5XA 3MLWH 1KN2H 2DD8L 3MBXL 2PO6C 1GC1L 3IRZA 5DMKB 1IC4H 3ZKXC 3UBXG 2QV2A 4Y4KD 2AJZA 3CFJA 3ILQD 1BQLL 3PL6D 1BQHG 3BISA 5CEZD 4Q2ZB 3SDAD 3JBG7 1NC2D 1QSFB 4JGJA 1A3LH 3MRMB 5D6DA 3ZYJA 4WWKA 3VFRA 3D25A 2ADJB 1P4LB 4QRPB 1MJUL 5D71H 3CSYB 1I7TA 1MJ8H 4Z76B 3MO1A 1FC2D 1HHHB 5CEYA 1FAKT 3Q6FA 2AK4B 2VLJE 4CDHA 1QEWA 3KPSE 5BRZD 3TYGH 3WHE0 1B4JL 3MRFB 3O3BB 1MEXL 1AKJB 4KRPC 2YEZB 4GG6A 3ZYIA 2Q8BH 1ZGLP 1T1WB 2HRLA 3PABB 1I7UB 2Z8VC 4MQSB 1LEIB 1DDHB 4PRHE 1MVUA 2WP3O 2BVOA 1ZLSH 2VWEE 2QR0B 5F7WC 4JQXC 1I1AD 1JGLH 3BP6B 2XY2A 3EFFA 4B41A 4KQ3H 3FQNA 5C08D 4NZDA 3PWJB 2VQUA 4QTIL 4UZGA 3EJYD 3K74B 4NQSA 4NZTL 4PRIB 3UTPE 4LFHG 1WWAX 4ZXBC 5D5MF 1GGUA 2QQLL 3K2UL 3QQ9D 3RTQC 2QBWA 2HFTA 3VXOB 2BNRD 3H9SD 4OZFB 2FYYB 1CZ8L 4WI8A 1OGAA 1A7RL 3DMMD 4S0TD 4WNQA 4LSSH 5I1EH 5KVFH 3UJJL 5L2KA 5DRXB 2XOTA 3U0PB 3WXVH 1G9MC 2P43B 3G04B 2EYTB 1J0HA 1AP2A 4P2RA 1X5LA 3V6OE 3VFOA 1D9KD 5HPMA 3IFOB 2Z91A 2WINA 1I1RA 4JFHD 1FNSL 3OAZK 2A74A 4KJWD 1MRFH 3FFDA 4YPGA 2CSPA 2GCYB 1MCIA 1FRGH 4R96B 3QQ4A 5DMYA 1DZBA 5CLWA 4Z8FL 4J4PD 2D31B 4POZD 4PTTB 4X4XB 1V5JA 2ED8A 4LCCC 1RJZA 4B7LA 2AI0H 2RIKA 4HIXL 4NOFA 1QR1B 4Z7UE 3X3FL 1IGTA 5J89A 2V2XA 5CZKA 3L9RA 3LRGA 4KZDH 4X98B 2Y5EA 4NN7C 4HS3A 3W11D 2Q7NA 1Z0NA 3I6KA 1ZSDB 3BPLC 1CFSA 5FK9B 3ILQC 5EO1B 3VFWB 2XRAH 3NGBB 5AZ2L 4PG2C 5A2FA 3PDDA 3L6FB 5ILTH 4LHUG 4YDVB 4KMLB 3KYOA 1GAFH 1NMBH 1FFRA 4KKCC 3TIDA 3UBXB 3WL9B 2OLDA 4F37K 3GRWA 3NH7L 4XXDA 4E5XA 4U1LB 1SHMA 2ZCHH 4ZUTA 1M7IB 3WIFA 1HKLL 3BD5A 1E4WL 4GXVH 4U6XB 1EJOH 4UV7L 3A6OA 1G9NH 1GZQB 1NUFA 2GHWB 3VMPA 2VQTA 3WS3A 5CZVL 3LQZB 1T20A 2OX5A 5DO2C 3RTQD 3K80A 4MJIB 5L6YH 3O81A 2AAVA 3D69A 4HH9A 5D7IB 2F53A 4FTVB 5IVXB 3ARZA 4OGZA 4WU7B 4KGLA 3FT4A 4ETQA 2NY6B 1NMCC 3WHE1 3VXTA 4QF1A 5IHLB 2H3NB 1FIGH 1LP9B 2C1OA 5EU5B 4JO3L 4G8GD 2XWJA 3O45A 5CJOL 3CSPA 2QADD 1J87A 1MPAH 4WW2A 2VLRD 2B4CC 3SGKA 5DJYB 1F11A 2QKIA 3ZDYE 5TE6H 3RL1A 3TFKD 4NUGL 1RJLA 3WE6B 4C55A 25C8L 1Q94B 1TVBA 2A9MH 2FGZA 5I8KL 1MCEA 1D5BA 2ZUTA 1RFDL 2G5RA 4EDXB 2NY5H 4Z0XB 4GW5B 3MOAH 3RVTD 1FNEA 5FKPA 4LSSL 1BOGA 2C1OB 3GO1H 4TPRL 2X05A 3RAJL 1K3ZA 5HDBF 4KROC 4Y2DD 5F71A 3CFCL 5D93C 4ELME 1RHHB 4FHBD 1JBJA 2BFVH 1G9ML 1NBZB 3SGEH 2P48B 4F15B 4AIZA 3VGBA 3BZDA 2J5LB 4TULL 4MDIA 4K3GA 3O8XD 4U6VH 3C08L 3QEGH 5DYOA 3ZTNL 1A5FH 2VOTA 4XCEA 2DWEA 1NFDB 3M17B 4YGVB 4RA3A 2A0LD 3CUPB 3LS4H 2IF7A 2VXVH 2BOBB 1OP5K 5DJ6A 3HFML 1A6UH 4ZPVA 1CD8A 1YYLH 4LCWA 4JO3H 2HJFB 4ZOEA 1PVHA 5FK9A 4U6YB 4X6DB 5LGJB 4PJ8A 1VESA 1WK0A 5DS8B 1QD0A 2H3NA 4OZFG 4MCYB 3AS0A 3V6ZA 1A4JA 3BP4A 1UYWH 3HNSL 2UZXB 4JKKA 1U3HA 3NZ8B 4HK0A 4TQEL 4NDMA 1AGEB 2M26A 4S0SD 4FFZL 4WFHD 4OAWB 1KN4L 4GRLC 4QT5A 3P4NA 5E6IB 2K7PA 4U0RC 5C71A 3QWOB 4PJ7B 5K9KA 4Q6IC 1OTSD 3VWJA 5GRJL 3IDJA 5F21B 2ADFH 4RAVA 1HINL 1NEZG 5DEGB 1QPPA 1Z9MA 4OUUA 4WHTB 3UPRB 1RU9L 4MJIA 4O5LH 3K81A 3QCVH 3PF2A 2V7NB 3OKEA 5CEZE 4XPHL 2BP3A 2FR4A 3S5LA 3SHSA 3W39B 1MLCB 1U95A 4FABL 4NO3A 4HFUH 2ZJSL 4E41E 1AP2B 4P57A 2IFGA 3SDXA 2P8MA 5F3BA 5IW6B 5A16A 3R4DA 1OLZA 4P2OC 1BJ8A 4JJHA 5BMFH 4Y4KB 4JKMA 4RAHA 1WITA 1XR9A 1S5IL 1VFMA 2FJFA 3AB0B 4LRIC 4UQ2A 3BWUC 4MDIB 1KB5B 2A9NH 3AREC 5J11C 4XAKE 4GW1B 4JFQB 2RAMA 1P7HL 3QDJB 4XRCA 3K1KC 1EUUA 1J8HD 1XH3A 4UQ3B 1J0YA 4YDLC 1U92A 3RDTD 5DJXB 1DR9A 3B2UC 4KK5C 4RMTA 4KPHL 1LEGA 4P2RD 5KSBE 3NIGF 4HFWA 4NQSB 1BPVA 2Y6SC 3E3QC 3GSWA 3PWVB 5DQ9B 5F9WC 3EOYG 4V1DD 4DKEL 1WIUA 1AY1H 2V7HB 3B8YA 2NW2A 2FJHA 3WBDA 5I8CB 2Z91B 4WEBL 4NM4H 1PSKL 2LTQC 5HYJE 1L4IA 4PLKC 1JNLH 3DO7A 2YC1A 3A67L 4GXUM 3C9NB 4YFDB 2ARJQ 2CRYA 2R23A 1FVEA 1BIIA 5KS9B 4JPKL 1QLRA 1DEEA 5IB3A 3KLAA 4W4OA 2FECI 3DSFL 1NCBL 2DQEL 4WVRA 3LV3A 1BX2A 3HMXH 5DD3L 1A1MB 4WEBH 1AIFB 1I7RB 1WFUA 4MLSA 3WIHL 5ANMA 3ZTJG 3Q6FB 3MO1B 1YJDH 4XBEL 4DKEH 2VLLA 4BH7B 1NDMB 4YR6B 5J12B 1PG7L 2ERJC 4PRPB 3MUY1 3TZVC 5EZLB 3CLEL 1L7IH 1S7VA 5KTEH 2R1WB 2HA1A 5T3XE 4PRDB 4OFIA 1PAMA 4KPHH 1G7QB 3NVQA 4M4RA 4HIJA 2BC4B 4AEHH 1GZQA 1U2HA 3ZTJH 2OMBA 3MJ6A 5F7EL 5FA3B 3HC4L 4M7LL 5CIPH 4LRNH 4JFFE 4ZUTB 3RIAK 4U1LA 2NY3B 5DMKA 3QCUL 1X3DA 2NXZD 5DT1L 3VGHA 1OQOA 4BA8A 1AR1D 1WIPA 5CLTA 2Q8BL 4QHUA 3D9AL 2YPLD 1MHPH 4HWBH 4LQFL 5C0IA 1VA9A 3I6KB 3HLAB 4E41A 3F12B 2VITB 3RZCB 5T3ZE 5H8DA 5JHDD 2EE9A 4I0PC 5J1AA 1Q9LB 4ZTOL 1WLHA 4Q0XL 4MJ6A 1J0KA 3BPCA 3OKKB 2VLKD 1J1OL 3QCVL 5T3ZL 2JCCB 5GRVK 3RDTC 3W9EA 1ZHBA 4GRMA 1V7ML 4M93C 3S36X 3QHTC 3TN0D 3V7MA 2NZ9C 2HFEB 3MRPA 5DEZA 3OXSA 1EHLH 2FD6H 3WIIH 4GAFB 1IC4L 3NA9L 4LBEB 2MOVA 2W92A 4ZD3L 2IANE 4ZG1A 1GJIA 5F1IA 2V2TB 4O2FA 1CVSC 1GRWA 4XZUB 2NCMA 1H15B 3E6FA 4JHWH 3TV3L 3G04A 3BZFB 3TNMB 4OF7A 1HOCB 4H8WH 3QISA 3F8UB 5C92A 5I16B 1U6AL 1QQDA 3C8KB 2J2ZA 3FT3A 5I66A 4GKZA 1MLBA 4NKOB 4NQEB 4U2ZA 3RU8L 4PRAA 4FNLL 4OCXH 3QZWG 1A9BA 3BGFC 1OPGH 4FQ2H 5J13B 1VADA 4U1NA 2YD4A 5D7LA 4P2QB 1NJ9A 3VXRD 3RWCB 3JVGC 5IWLC 1ITBB 3MNVA 4KZEH 1G7HB 1XF5A 5J9PA 1K4DA 3NFNA 1A7OH 1U8QA 5E24E 1A0QL 3NIFF 32C2A 3V9FA 4RIRB 2C3VB 2APTA 5C09B 1AIFA 3QCTL 3GKZA 1Q9LA 5C0CD 1RZKH 2VLRB 3DIFB 3DO3A 4P5KA 5EA0H 5EIVA 4AYFA 1QFWI 2HKFL 3SKJL 2AKRB 4G8GB 4WO4A 2VZTA 4B53A 4GG8B 2DN7A 5E7FA 3RNQA 5HHOA 3TJHC 5HHPA 3QO1A 4P5MB 5EA0L 5FA3A 3ES6B 3TZVD 1RZJC 4PRIE 5DK0A 1BHGA 5D72H 2AQ2A 2APVA 3GEWB 2XZQL 4PJEB 3B5TA 2AEQL 3SE8L 3FB7B 3MNWB 3WD5H 2DI7A 4FFVC 5I19L 2WUCH 4HZAA 4OZIE 2WIIA 4LRIA 5C6WH 2W65B 1XF2A 1G7HA 1FNGB 4LVNB 4QEGA 3G5XA 1L9MA 3PNWA 5IGXH 2X4QB 1JFQL 2DBLL 3PDGA 5EUKB 3S36H 1IFHH 5FUZH 4K7PY 3SGDI 5IEKB 5T5NG 4LCIL 4Z7NF 5IHZA 2AJSL 2Y5TB 4Y5YA 4Z0BL 5DK0B 3TH3T 3ARBD 2X89A 4WI2A 1G6RL 3MLVL 4EZMA 3FN3A 3QA3A 4WO4B 1ZKAA 3MV8B 1NGPH 2H32A 4DOHB 4I0CC 2PO6A 1YC7A 1B0RA 5FYLH 4R4ND 4OCRL 4XZUA 2VZSA 5CBEB 2EDEA 2D03H 1Q0YL 3MODH 4LLDB 1NGQH 4LL9A 5CKGA 2WBJD 1S9XB 1U8QB 1S3KH 4GUPA 4HFWB 5FYJU 1S8DB 4P3CL 1JWMA 1UENA 3D2UA 3FFCB 5IROC 1R5WB 3EDEA 2OI9C 1U3ZA 1XGUB 4MXVF 3V0VB 4JG0H 3ALWA 1TQCB 2Q7YA 4M7JL 3X3FH 4O02L 4PGZA 2DQFB 5CEZH 3QIUA 4HF5H 2PYEE 1GL4B 4ZO9A 5E00B 1II4E 4WJ5A 1XR8A 4ERSH 5TQ2H 1WF5A 5B3NA 4EIGB 4TVPE 3IETA 1MHCA 2D9CA 2VXQL 1TIUA 5J3HD 1BREA 3K8MA 4ZPTB 3G5VA 5J13C 2XTJB 1NGYB 4NT6B 4UUJB 4HHAA 3FO9B 1MELA 4DZ8A 4JPWH 3O4LE 3ULUH 4WDIA 3MXWL 2IPUK 3WEXA 4AG4H 1AO7D 2CIIA 5HHNA 5IVZB 2YUXA 4L4TB 5EU7C 1ZVHA 4ODUB 1YNKH 4LEOB 2HT2D 3DUSB 1NBVH 1QA9B 3KPSA 1WC7A 3OGCA 3GUTB 5JA8B 2X9YA 1A6AA 1FL6A 3AUVA 1KJ2L 4XHJD 1QRNA 5FOJA 4ONFH 4JG1L 3TJHD 4PJ5E 5TFSH 5C0BA 3SGKC 2IJ0C 4QHNA 4K7FB 2OZ4A 4FFYH 3MRRB 2EDDA 3L3GB 3OAZH 1MNUH 5CJQH 2D2OA 2MJWA 2I5YL 4FQCL 2NY1D 1FGVH 5ECJE 5DJDB 2WQ8A 2EZ0C 5EFIB 4YHIB 4ZODA 3UPCA 4QTIH 1KNOA 4XBPB 1DLHB 25C8H 4JRYA 4X6CB 3ARGB 4OKVB 3FT2B 1FFNB 3NPSC 4L3EB 1MRCH 4LSDA 4DEPC 3BJ91 1TNNA 1XGRB 1H3VA 5IF0A 5FYKD 1FYTE 2AK4D 4JEGB 3OR7A 3L7FB 4N9GB 2IQAB 5I71C 5DFTA 1A7OL 3LPGA 1TETL 4EIZC 1XF3A 4EI5A 2DLIA 3SQOL 1FV1B 4EN3C 1MHHB 3QFJB 1MCQA 1AGDB 3R8BB 5TE4H 1FNEB 1QR4A 2O5XL 2ICEA 4OCXL 4BJLA 5L6YL 5LBSL 1C5DB 5E8NB 4GG6E 1GOFA 3WHXA 2XG5A 3KPOB 1IARB 4X9BA 3SGEI 3FQWA 1W72H 4GXVL 1E4WH 2YC1B 3ARGA 1RJLB 5C2BH 3WJLC 3RWJA 5IK3A 1GC1H 4LOUC 4MDJB 3ESUF 5SV3A 5DJYA 3JV4B 1WT5C 1NMBL 3EYQD 3PQYD 1OD9A 1BAFL 2P5EE 5FO7B 5K33A 1MVFA 3L3GA 4O5LL 5AZ2H 2FGWH 4F58H 1ZLWH 1HWGB 3GMNA 3NPZB 2BNQE 4OSUL 3Q5YA 1SBBA 4D9LH 2DMBA 1XEDA 2F9BT 4PUBL 1EHNA 2R0LL 2CR3A 3BYYA 5IJKC 2DMKA 1RURH 4FQPA 3WFCH 4HQQL 3WDJA 5KG9A 3SOBL 1CTNA 4L4JA 4ODUA 3MRBB 3GI9H 3DV4A 5IOPA 4P4KB 2X70B 1KCSL 3VU2A 2DTMH 1QO3A 1JZ5A 3CXDH 4OLWH 5KVGH 3EGSA 2BNQD 3GJFH 4Z7VE 2HT2C 4LLQB 5ESQA 3GJEB 4PGEB 4CRPA 1KTLA 3DMMA 3BEVA 3U4AA 5I2IA 1RVFL 5EBWB 1A9EA 4Q97A 5ACLA 1TITA 2ZOLA 2F5AH 4PJAB 5IHUH 1HZHH 5AG8A 1QBML 5TDPA 1TZIB 2YXFA 3NCFB 5FHBL 4LMQI 1TNMA 5K9KB 2QSCH 2NY1C 4RFOL 3F58L 1F4WL 2V17H 4KVCH 2H32H 2ITDA 1KJMB 4HS6B 5F1KC 4OM1L 1FDLL 4JY6A 4JQVA 1HHKB 2AJ3B 1AH1A 2AEPL 1YNTB 3K7UA 4BELD 2CH8A 3EOTL 5DI8B 1T89C 2WBWB 4L29B 2E6PA 2Q87A 4RGNC 3MCLH 3GIZL 4G8FB 3FONB 2L0DA 2NTFB 5JPMA 1YMMD 3U0PA 1H3GA 4LLUB 5FHAL 2VZUA 3TNNB 2RB8A 4JFXB 4GS7C 3WNLA 4MAYD 2CRIA 4ZSOA 1IGML 1JPTH 5GGSA 5B38B 4OGXH 3NN8A 5MENB 3HMWL 5DTFB 3QDGB 1BZ9A 4LLYB 2ICWB 5C0EA 1H9VA 3V4UH 2UWEA 1DJSA 2CKBA 4KRPB 1KIQA 2FX8L 5HGBA 2H2SC 3EFDH 1AE6L 5DA4A 5F72S 1ND0A 1MHHA 2HAZA 1I3UA 3BQUD 4CKVX 3U7AA 4WI3A 5ESVB 2LV4A 5FKPB 1DUZB 3T0EC 5FF6A 1YEFH 1P5VA 1YJDC 5ITBH 4Y4KC 2ARWA 4FA8A 3FQNB 4LPUA 2JJSC 1HSAB 2KH2B 3QDMB 4PY8I 3CSGA 2DQUL 2Z8SA 5DMIL 2VKXA 5HYSB 3FT2A 4K07A 3FOMA 1TVHB 2H45A 3JUYA 1CICA 1RSFA 1P7KA 1DL7H 5DRNB 3UTTD 3O3BA 4HJ0D 2GSIA 4CL7A 1F58H 4FS0A 1HINH 4KK6D 4Q9QL 2FECL 2ADFL 4M6OH 2XWTB 3LSOB 3SEPA 3T65A 5D1XD 5CSBA 5BV7L 1WCBA 1G7MB 3O3EA 4YX2L 1HCVA 2XQBL 1O7VA 3QR2A 1LO3H 1J88A 1VFUA 4JM2A 5HYIA 3SY0B 5HGAB 4GKSA 3WNPA 2GAZA 4PTUB 1IEAB 1SEQH 3UYRH 3GMLA 3KPLB 1OTUD 4K3JH 1NBQA 5EC1B 4O2EA 5CGYC 3U4BH 5ICZB 3REWA 1JV5B 1NCWH 1MI5B 3ULUC 3KLDA 3QQ9C 4OLVL 1QP1A 4W6WB 4N0UB 1CYGA 1NAML 3JV0A 3PWLB 3WYRA 2HWZL 4Y2DA 2NNAA 3BGMA 1QG3A 4YO0B 4U1JB 4DW2L 2J5LC 3LQAL 3QBTB 1L6XA 5HVHC 1MAML 4M03A 5D5ME 1N5YL 1IGYA 1R5VB 5J6GA 1OW0A 2OTWA 2AJYL 4GSDH 1OGTA 4O2EB 3GMOB 2HN7A 3C60D 5D1ZB 3U7YL 5FYKL 1E4XH 1JRHI 4Y1AB 3EOTH 2YPLE 5I1GH 2HLFD 2JK5A 5FUOH 5HYSG 3PWPB 1N0XL 3KHOA 4AENB 3W9DB 2Q6WA 1C7SA 2F8XC 2BVPA 2DWDA 1KJ2H 2MTPA 4FP8L 3ULVC 3KS0H 1EDQA 2PCPB 1WUNT 1E27A 1NBVL 1GGBH 2CRZA 1HSBB 2J12B 2YS4A 2Y1VA 1T66C 5MEPB 1UCBL 1B0RB 3HS0A 3V8CA 4JFEE 4KQ3L 3ULVF 2EE6A 1EJ6A 2JJVA 3CMOL 5BVJA 5DJZB 5KSUA 4MA1B 1ADQA 4PJEE 2IMMA 2G60L 4X7DC 2A38A 3MZTA 5JNYB 4P9HH 2FEEI 1CXHA 4KC3B 2V2WA 4TUKH 4Z78A 5JDJA 3AC0A 4F7MB 4KQ4L 1FYTA 2CD0A 2IGFH 2EYRB 5D5MA 4KV5F 5MEQA 2DICA 5JW4Q 5E2TH 3STBA 4BSJA 4ERSL 2F58H 1OSZA 2OYPA 3DX7B 5FUCC 4U3HA 3IJHA 5D7JD 3PHOA 1LQSR 3OJ2C 3RVWD 1FO0B 1WBXB 4NO5B 5ESVA 2EDRA 4D9LL 1QOKA 3EYVB 4Q2ZA 5DC4B 5I15L 4M6NL 1CLOH 4V1DE 2KZWA 1HKLH 1YQVL 5IB3B 4JFFD 4PG9B 1XGYL 3OKNB 2ARJB 4XP6L 1G9EA 3LKSB 4MD5A 4PRBA 2NY5C 5SWSB 2ERJB 1SY6L 2VAJA 4OI7A 3IRPX 1ZA6B 4DCQA 1DL7L 4PJIA 3PIQB 3QRGH 4H26B 5I6XB 4TVSa 1E4JA 1BQUA 5IVNA 3EUUA 1A8JH 3MJ9L 5H94A 4KK8D 3OF6A 3CH1B 2EDYA 1BEYH 4WHYH 1JK8A 2V7HA 1JHKH 2MCPL 2IBGA 2JKXA 1JYWA 4KKBD 3HS0B 4OQTA 1OB1B 3C60C 2NTFA 5JPMB 4FQQB 4EOWL 1FBIH 3QXAA 5EC2A 4RIRA 4Z0BH 3WLWC 4OLXH 3GSWB 4RGNE 2PCPA 1QFWM 3OR6B 5FUZL 3WJLA 2HT4D 4S1QH 1GGCL 2YKLL 3RHWK 4PP1C 4HLZG 1G6RA 3RPKA 1RZFH 4XMLH 3N85H 3C6SB 3KPQB 3OKOB 1FC1A 5HGDB 4LNVA 2EDWA 3TJEH 1L0XA 1EHAA 4N0YL 2G60H 5F7DB 3P4OA 2DDQH 4P46C 1UM4H 4ZFZA 5JNYA 4IIQC 5DD6B 3T3MF 5E2UH 1AI1L 1U8HA 5KANG 2ZUVA 4HKXB 1MRCL 1IC1A 2VH5L 4MNGB 1CF8L 1L7TH 1MCWM 5HVFB 4FQ1H 1XGQA 3EYFB 3UJJH 5KVEL 3FOLB 3NA4A 1CD0A 3VMNA 5JHDE 3DHMA 4NBYB 1SM3H 3VXUD 4RFNC 3ULUD 1Y6NR 4Y4FC 2EYSB 1I9JL 3LEYH 3PGCA 4YDKL 3CPLB 2K3TA 5IMOA 2F54E 2PW2A 4U4BA 2BRRH 2DTSA 5HHMB 4J3VA 4TRPL 1RMFL 4NUJB 2VTFA 1I1FB 3HAEB 4MQXD 2VDOH 4E41D 4JGMA 4HK0B 1FG2B 3O3AA 5DXWA 5T3XD 4Y16C 3KLSA 3K4ZA 3HC3L 1LEKB 3D1MC 3CFBA 1K8IA 2BNUB 2Q1EA 3ZMRA 1LE9B 4U1JA 3GJEA 1C5BH 4MJID 4HUVA 3O2WL 2AXFA 3CU7A 4LCUA 1BQHB 4Y4HA 1I1AC 1MCRA 3QPQD 1EFXD 5GJSH 5L88H 3RY6A 5D70L 2EDHA 3DI2B 1NCNA 4DKDC 3SOBH 2C7UA 4JFDD 4BZ1L 1C5DA 1ZVSA 1KJ3L 2GAZB 3GKWL 4YDLB 5HGAA 2ZOKA 3O6LH 2F54A 4N0CC 4JQIH 1CQKA 2VZVA 4YIQB 5LCVH 1A7QL 4LVHB 5IMKA 5D7KE 3TA3D 2DIAA 4P3CH 5FB8A 3ZKXB 1RD6A 1V7MH 5C0AD 4NYLA 4O4YH 4YAQA 4LLMB 4F15C 3U6RA 3GZKA 2CO6B 4DFIA 1T7XA 3ILPA 1ZS8B 2X7LA 4D8PB 2NX5E 1JTOA 4Y5VC 1F4YL 1R3LB 3RWEB 3ARWA 4UDUB 2IG2H 4NHCL 1CXFA 3MMEA 5GJSL 1K8DA 1UVQB 2AERT 4Z7WF 4LLUA 4PV9B 3VFTB 1H8NA 3VRJA 2XZAL 3D5OF 2B1AL 1FPTH 1S7QA 1DVFD 4NO0D 5E08H 3DX8A 2W9LA 3H7LA 5HHOE 5C0BB 5J56B 4OKDA 4ONHB 1PX4A 1NDGA 2ENYA 2YZ8A 4S2SB 4WTZG 1A6AB 1FL6B 1KIRA 1T2JA 5JOPD 3OGCB 4Y88A 3GUTA 3AFLA 3HG1D 1SEBA 3BZEB 3QI9D 1JCKA 3H7BB 3LKQA 2RCSH 4OUOA 4UILH 2FL5A 2W60A 1E4KA 4M7ZC 1RIHL 4IRSD 3QUML 1OCWL 2R39A 1K85A 1NAMB 4NNYB 2HVJB 3HR5A 4ZSOB 2UYLA 3IFPB 5DD3H 2IQ9H 5GGSB 4JFZL 3QUXB 1T1YB 3D3VB 5KJRH 4OCNC 3TP4A 3SJVB 4O51B 4U1GC 3V5DA 4AEEA 4EXPX 1MREL 3ZHKA 2P42B 5LAXB 4K3EL 4ELKA 1HEZB 2Z9TA 1MWAA 3B9AA 5JO5B 1LDPL 4BM7A 3BYTA 4PJFA 4LGPB 4O9HH 3TBVB 4WHTA 5JW3H 3UPRA 4NM4L 2WWMC 4U0QB 3OJVC 3RGVB 43CAA 2HRPL 2JE8A 4ZO6A 5J0BA 3FO1A 4PJAF 1A6TB 4UILL 3EJJX 3VXQA 2YMXH 3SBWC 4TTDD 4Z7VA 2VDRL 5CCKL 5J8OA 3RZCC 2HYMA 4CADA 3NGBC 3OG4B 2FIKB 1M71B 3GMNB 4NIKB 3SDDB 1INDL 4N90D 1AKJD 2XN9E 4KDVA 5T1LB 1G1CA 3UDWC 4ESKA 5BRZB 5GXBB 1KTDB 2IAMD 4OLUL 1YEGL 3O11B 1X9QA 4NQDE 5C6TH 4JHAL 3WSQL 4PV9A 1DANU 1FHGA 1JK8B 1ZANH 3RKDD 5FCUL 2AK1L 4H5SA 1S7WB 5LG1A 3QUZB 5D9SA 1MH5B 4XB7A 1JZ2A 3D2UD 4H88L 3UROR 1BFOA 4IMLA 4ISVA 1P4BH 2JB6B 4HQQH 4JM2F 4G8IB 1QBAA 3MLZH 4WI6A 2P46B 5C08E 4XPHH 4E42A 4FZ8L 3QUYD 5EUOE 1RU9H 2I25N 5EG6C 4LPCA 3ULSA 3VFMA 1E0OB 1BFVH 1T0NB 1ZLVH 3U79A 4KKAD 1EERB 1S9VB 5T3ZH 3QB7C 4EDXA 1MCDA 3DYMA 4LSTH 5EU6E 7CGTA 2YXMA 1I1YB 5D7SH 3G6JE 3O8XC 4HCRH 1SYSA 4ZTPL 1CDJA 3VFVA 5E2TL 3BUYB 3BP6A 3AS1A 3BN3B 3HI1A 4DAGH 2DJ4A 4TSCL 2X4SB 3T8XA 3RVVC 3MV7E 1YEEL 1MHPL 1DDHA 3GHEL 4EVNA 1MRDL 4WW1B 2GITB 5I74C 5C0CA 3ZSTA 1XT5A 5ISZA 3ZSSA 4MQ7A 2R8SL 4JO4H 4XMPL 4JRYB 3KPOA 4NN7B 5I76A 3VDAA 1A6VH 5FYJD 2W9DH 4I0PA 1A6WL 4M02A 1YEKH 2FH8A 5BS0D 3N1GC 4Y5YB 1JZ8A 1UA6L 2GJZA 3VWKD 4QF1B 4BH8B 3MLUL 5C08A 3CVHL 4H0GA 3BP7A 3HAEA 4L1DA 4QHNB 4PV8B 1RUKH 5CINL 2G75B 1VENA 2NXYD 1XF3B 1R6VA 4IRZH 4PB0L 2Q76A 2X44D 5CMAA 2K7QA 5FOBB 2DM7A 4ODBD 5AWNH 3P30L 4KVNL 2BNRA 2P5WD 1K4CB 1S7RB 2JJTA 1HH9A 5JW3L 5K9OB 2ATPA 1BD2D 4ETYA 4C58B 1MFDL 1ZT7A 2YK1L 1XIWD 2ZSWB 3G6JA 5F7KC 4MWFA 2VUOA 3MRQA 5ESAB 2XG4A 1DLHA 1RFDH 4N0FB 2DQGH 3FO9A 5HGGS 4W6XB 3L3KB 4ZFOA 3CFKB 3I6GB 3DMMC 4M43H 1LO0H 2E9IA 5E6IC 1AI1H 3AAZB 2P49B 3PL6C 4XNXL 1U91B 3KYAA 4Z7VF 2A77H 1OM3H 5AWNL 2MQ3A 2RCSL 1QR1A 3T4AA 1P6AB 3WFZA 5HI4D 5ALCH 3FO2A 3S5LG 4P48A 1FAIL 3TWCH 1IEAA 2B1HH 5JZ7C 1NEZB 3FFCA 1JF1A 3UAJC 2HN7B 2JELL 1UA6H 2BSSA 4FOMA 5D1ZA 3BHBA 2Y6SD 3NPSB 4DKFH 3SGDH 1CGSH 2JK5B 4MJ6B 4QNPE 1D5ZB 3X12A 2XNAA 4GJTB 1FPTL 3QT2A 1RZ8B 3GSRB 4HWEL 3BPCB 3OKKA 1BM3H 2A74B 4L8SA 2X1QA 3X3GH 3KXFE 4PRPE 4Q9QH 1TZGH 1WICA 3EYFA 12E8L 3CFKA 3RIAF 5C0RL 3IETB 4YBLC 2I26N 3ZKMD 3R06B 4CUCA 1NLBH 4W68A 4Q9CA 1AGCA 2QLVB 4S1RH 3ALXA 1INEL 2DB8A 5DMIH 5JOEA 1UEYA 8FABB 1O5DT 2OJEA 5EC1A 5I1JL 3QDHA 4KTDH 4ZUSB 3WLBB 3PWNB 1G7QA 4JM2B 4XCFL 4HMEA 5EBLA 4KJPD 4OV6F 4MXVE 1LVEA 3K46A 3MA9H 3KPSD 1H5BC 2UVFA 1D7FA 1BX2B 2QR0A 1I7RA 1ZLVK 3QO1B 1ZTXL 1CDBA 4OI8A 4GQPH 2R0ZL 3LDBC 1S9WB 1EAPB 2NY4D 2GITA 2NY6C 3BP5B 4FQLH 1KG0B 4F7PB 5CJ8A 2VZOA 1F5WA 3KJ4B 1DBJL 1DQDH 3MYJB 3PG2A 3UX9B 1CL7I 4RRPA 1G6VK 4YDIL 1NLDL 3QJFA 4B7IA 3B2VL 4MLIA 5DQ9A 1EGJA 1H3PH 1KEGL 4Z76A 4L29A 2HP4A 3CAFA 4MXQD 3L7EA 1YEIL 5C07E 3SKNB 5FYJE 5TF1L 2Q6WB 1U8MA 5I1EL 3NCYP 3W9DA 3C5ZA 3ULUE 1ND0B 3RWCA 3MNWA 3PP3H 4YXLH 5SWQB 4OLYL 5JMRA 5KW9L 4X99B 2R69L 4FMKA 4LLWB 2ADGB 2XKSA 3S34L 1UXWA 3DPBA 4MNGE 1ZGLM 4NC0B 5JOFB 4EN3D 3LMJH 4KROD 4NUGH 1KPVB 3DIFA 3QULB 2Y7QB 4DK3A 1JPSL 5JTWA 1UQSB 1YEHH 5F3HA 4G6FD 4L8SB 5T1DH 1W72A 4ZUUB 5HDLA 3RUGA 5F89A 4KI1A 1H0DB 2HFGH 4HIHA 4LLVB 3MRPB 2DQHL 3HUJF 4PJ9B 5DK3A 1TCRB 1HILB 5H37G 1QRKA 1S9KC 3GSQB 4XCYA 4NFDA 5GGVH 1QFWL 1FZJB 2AJUH 2ZCKL 1YNTA 2DLFH 3ZLQC 1U3HD 1OPGL 5E6ZA 1A47A 1X5GA 3L5XL 3CVHA 1JGDA 1KFAL 4F7CA 5ISZE 4LKXA 1CDHA 3DRTB 4XXCC 5J6GB 1MJ7L 1A22B 5B8CA 4HEME 2C4FT 1MY5A 4CU6A 1YYMH 2K1MA 2J88L 2AJVH 5IMLA 5F1SA 4LDOB 3OB0H 3S4SG 4FG6C 5CFHA 2VB5A 4Y4FB 5IB5A 4R2GB 4KJYB 3VA2C 2MCG1 2BNQA 5E2WL 5K9OA 2EIBA 1N3NB 5LXGH 4JM4H 2EH8H 3D85D 3SY0A 1N5AA 4G9FD 4P0DA 2DWEB 5I15H 1CS6A 4X7TA 3Q2CA 2R2HB 2ZZUT 3SCMB 4CDGC 1SMOA 2EC8A 3LKRA 4P2CG 3TBYA 3VI3E 1HKFA 5T1KB 5DVLA 4NKMA 3KJ6H 4J7RA 5IB2A 4K9EL 4KKLD 3WN5A 2DQJL 3BN9D 4LLYA 3OJMB 5TPWL 2Q8AL 2IQAA 4UTAH 1IJ9A 5IF0B 1FNFA 4WWID 4F2MB 4AJ0A 5INDA 1LE5B 5E2VH 1DFBL 1MCOH 4OCYL 5KSAD 1D6VL 4PJDB 5EOCH 2NY7H 4HKBA 2B5IC 5CJXA 4N8CH 1W2KT 5EFIA 4F7TA 4YQXH 3VRIA 3U1SH 2E9JA 1LP9A 3JTSA 5F1OB 2VL4A 5IBTL 3GBML 1YMHB 1KULA 1S9VA 3A6CH 2C3WA 1KB5H 4U1IB 4YAQB 1RHHA 4HUXA 5HGBB 3KLHD 3NCEB 4YHKH 4HXAH 4FQJH 2ICWA 4OD1L 4EI6A 3VFMB 3MV7D 4R4FH 5FYJL 3MRDB 4N9GA 1YEDA 4J8RA 3CJJA 2BNRE 4L9LC 4M3KB 2R0KL 3OKMB 3U1SL 4BYHA 3T0AA 4YK4B 5DGRA 1N5AB 2DQTH 4IMLB 2LE9A 1BBDH 3H3PL 3RWIA 3H9YA 4JRXB 4UNVA 1BQHA 4Y4HB 1I9IH 3QEUA 4WTZA 2AXFB 2PNDA 4NO3B 2IEPA 3G5ZB 1OOAA 1KGCE 2PETA 3ARFD 4N0YH 3CXHK 3G9AB 4XBPA 1HHGB 3I9GL 4A2MA 1C12B 5EO1A 3VFWA 4MVBC 1F00I 3HCVB 4X4YA 4CVXB 4AL8L 2ICES 3DURA 3GNMH 3LB6C 5JPNA 3RGVC 3O3DA 1SJHB 5DK2A 3VG9B 3RBSA 1T1ZA 4OAWA 4Y16A 4JVPA 4HKZB 5DJ2A 3OF6D 4KKLC 3BH8B 4YXKL 3UJIL 1Y6MR 3DXAD 2EH8L 3KVQA 1ZT1B 3CLFL 4XPGH 4HZLA 5C3TA 4KUZH 3MJ9H 1QZ1A 4D9QE 4PRNA 4M7ZB 4POZC 2XN9D 3B6SB 5CZXC 3G6DL 4NQXA 1FFQA 5FV2A 1OTUC 3DV4B 5IIEA 3MRBA 1VGKA 4ZDHA 12E8H 5C0RH 2VO5A 3QDJE 4XMKH 5D1QC 4OZGE 4I2XB 3VI3F 5IOPB 4P3DA 1DBMH 5F93C 3MLSH 1KPUA 1QYGH 3NCJL 3QIUB 4NN5C 4BUGA 3QUYB 3O6FB 2D9QB 4OT1L 1I3RB 4XP9H 2Y23A 3DETD 2F58L 3T2QA 1CK0L 1IFHL 1FZOA 1NCDL 2K9UA 1G6RB 4GUPB 2OSLA 3DX6A 3MPCA 4OD2B 5KSAC 1OGAB 2B1HL 4NSKA 4D0CB 4GW5A 3V4UL 2E9WA 3LDBB 1UXSA 3IDNA 5ALCL 1KXTB 5F97E 4X4YB 4JFPB 4ZNEE 3TM6A 2H2PD 1DN0A 3UC0L 5T33H 1IGJA 3WD5L 2R56H 1XGRA 2OQJA 5C8JB 4XX1G 4W4OC 1LO0L 1MCKA 4ODHL 4H20H 1IGCL 2CMRL 3HG1E 3ARFC 35C8H 3ULVD 2WAHA 5F96H 1J9CT 3TT3L 2VDKL 2CQVA 3C2AH 3PABA 1R3LA 3OX8B 3RWFA 3WJJA 5FO8B 1LEIA 1LK3L 5HHOD 5IBLC 4HLZH 2ARJA 3TZVA 4R4FL 5FYJH 1U8PA 3H6JA 4U7MA 3VH8G 2DQIH 4FQJL 4OD1H 4LPXA 4WFED 4MJIE 4F33B 3DJ9A 3MRIA 4ZS7H 2ZG2A 4KVCL 5TF1H 3U7YH 5IV2B 2IC2A 4HPOL 4PY7A 4X80L 3KPNA 4JZJB 5GRWA 1P4IH 4WIQA 2E7BA 3HNTL 4JAMB 2VDQH 4Y19B 4JR9H 3B2VH 3R0NA 4RX4D 4PJEA 1BBJB 1NL0L 4MAUH 4OB5H 1BVLA 4JFDA 4XVTL 3BDYL 5ALBL 2NY7L 1CBVL 1T1XB 4HUUB 5AUMB 1CTOA 1EEZA 3WO4C 5C0AE 1UACH 4P9HC 1EXUB 4PJDA 4HUVB 4Z7QE 2FHBA 2F54D 2H6PB 1QSEE 2BSRB 3MR9A 4L8DA 3RBGA 5IROA 4FXLA 4YHIA 3KPPB 4MA7H 5I1DA 5JQ6H 1J05B 3CNKA 2F15A 1JVKA 5B8CB 5LKNA 4TSCH 4K3JL 3VXNB 3VFPA 3TBSA 2EXWD 1H8OA 4X4ME 4KDTC 4LSUL 2IBZX 2VL5B 2DQFA 4LSPH 2XA8H 2V2TA 3LEVH 5GZND 3MGOA 3C2SA 1LK2A 1J1XH 1OAQH 4MNQD 1W0WA 1N6QH 4HULB 2I9LB 4RWHA 4R96A 2GKIA 2GTWB 1PZ5B 5SX4I 4XMKL 1ED3A 1ZK9A 5F7MC 1NUDA 4P2OA 4PJIE 5DUMH 1H5BA 3LD8B 2H2PC 4IRJC 4NC1C 4UT6L 4J23A 4JFED 2Z31D 4NKOA 4NO0A 3VFOB 1DCLA 1GAFL 3KDMB 1UB6A 4ZAKD 5EIIA 1MHCB 3TIDB 5B4MC 3NACL 4UTBH 2X4UB 3CXHJ 4PJ8C 4PP1D 5K9QG 5I1IL 1P5UA 3B43A 3FT3B 4IRJB 3BW9B 3LKNB 3WKML 4LQFH 1NGPL 4JREC 4D0BA 1XGPA 1KPVA 4JLRA 5D2NC 2CGRL 1IRAY 1OAZH 2EDTA 3QUZC 1GGTA 4Q6IA 4EUPB 3CDFA 2XICA 1A7NH 4RGOH 4PJFE 5E8DL 1S7RA 1DQML 4Z8FH 4LSQH 3OXSB 2Q86B 2ZCLH 1LMKA 2GTZB 5CMAB 4QY8A 4XP4L 3SO5A 3WXWH 5ELIA 1VB9A 4QYOB 4DZBB 1BOYA 4A6YL 3JUZA 2HFGL 1D5IH 4M7LT 1IT9L 3TBSB 3MC0A 1RK1A 5ADOL 4U6HB 3V0WH 5EULV 3VXSD 3VD7A 5I1DB 1RJYB 4PJGB 1FLTX 1U8JB 4QHKJ 4ZFOB 2PXYD 1E28B 4LIQE 3V4VL 1MAKA 1I8LC 4W6YB 1TPXC 4MA8H 4R0LB 3EYSL 3MTRA 2CIKB 5ANME 3OKLA 5C07B 5F9OH 3W5MA 4Y4HD 1QSEA 5AUMA 1WZ1L 2AVGA 2X4QA 3QUXC 3QAZB 2HVKA 2CLRA 4DVRL 1WZMA 4F9LA 4I9WD 5DJ0B 4XC1L 4CNIA 1K4DB 3NFNB 4QRRA 2OM5A 1RK0A 2Y25A 5FHBH 3UTSE 3VXPA 1FLRL 4JPVH 4PRIA 3BT2H 4XWGL 3UTTE 1OF2B 5D5MB 3M07A 4I77L 1M05A 5CGYD 1CXEA 1ERNA 2E6QA 4K8RC 1C16A 1G9NC 3CX5J 4GLRH 4M7KH 4UIKH 5KSVB 5MEQB 1TZHB 1KIQB 5EOCL 2J4WL 1ZV5A 5MENA 2LU7A 1A6VL 5C07A 5C0EB 3C6LD 3KHQA 4GG8A 3Q1SH 3RNQB 1OAZL 2QQNL 1BIIB 1QTYT 4ACPA 3BO8B 2R9HD 5BW7A 3PWUA 4HPYH 4R6UA 4CMHC 5IW6A 4WW1A 1FFPA 2COQA 4NQVA 1TJIH 1EEYA 5JR1H 3IU3A 4PJFF 3FQTA 3OG6B 4YPJA 2FR4B 3LY6A 3ZKNC 5ITFA 1F6AA 3PGFL 4XWOD 2BERA 4D0CA 1DQQB 4R7NA 4U1SB 3IDNB 2YD3A 4JY5L 3MBED 2YRZA 4NJAL 4UQ3A 1KBGL 2VAAA 4NJAH 2XQYG 4UMGA 2BSED 3GSUA 1J12A 4NP4H 4MX7B 5DUPH 5E2WH 4DWHA 1NGQL 4U1GB 3VA6A 2ZUSA 3L3DA 4I0PD 5F7LB 4TOYH 3RGVA 2LFGA 1ODAA 1VGEL 1HOCA 5IVOA 3OAYK 4PJAA 4N8VA 2P8MB 4G9FB 5F3BB 2R29L 5A2LH 4HPYL 1W72L 2VLJB 4N0FA 1U93A 4G7YL 1QBBA 2UY6A 1G7IA 3REWB 4BZYA 4JAMA 3L5JA 2EE2A 3HN3A 4LEXL 3QUXA 5DD0L 3AM8C 4OF6A 4XVTH 5CGTA 1UWGH 4LSRH 4I77H 4J2XA 1HH9B 1N59A 3C5JB 3MSPA 1I8KA 5HHVL 3ZE0F 4I9WE 3DTXB 2YD6A 1C7TA 4KJQD 2VDRH 2J8HA 3I75A 4D3CL 4OJFL 3E3QE 1BOGB 4ODSL 3K8LA 4WW2F 2V9RA 1A4JB 1KELH 4ZNEA 4GKOA 2C4XA 4HJJL 3O2DH 4L3EE 1JGUL 2BVQB 3EYSH 4X4MA 1P7KB 5IBUB 1W8OA 4UOW0 1OL0A 2LABA 4K2UL 1NC4A 4LOUD 2R9HC 3X14B 2CRMA 4HKJB 3VXSE 1MWAB 5HD8D 2W59A 3EDDA 1JGUH 1CF8H 1L7TL 1I8MB 1G7JA 1BFSA 1QSVA 4ODSH 4ZFOL 1BZ7B 2XZCL 3MUJA 5JIKA 4R9HA 5T33L 1IT9H 2DKUA 4P46B 1YQ2A 1WISA 2HFFA 4ZXBA 1MCJA 2CUIA 4IOFD 4PJXB 4HG4J 1T4KA 4ZAKA 1A1MA 3VFNA 1WJ3A 3ULSB 1NLDH 3U2SB 3CVHH 5C0JB 4FTVA 4YE4L 4K9EC 3V6BR 1K3IA 1JUFA 2CKBB 3HE6A 1UWEL 4HMDA 4JRXE 5ID0A 3MUGA 3IAGC 3L3IA 2V5TA 4MHHI 2EIZB 1S5IH 1P7QD 3Q3GA 4NRYA 4PS4H 4CU7A 4L3EA 1EFQA 1OAYH 2HLAB 2P5EB 1X5IA 4HC1L 1NBYB 4LASL 4R4BB 5DWUL 4YZFF 4WI7A 2X4TA 2C1PB 2CDEA 1W0VA 2X4RB 5INCB 3ZDZE 1EA9C 2IALA 2X10A 5GGRY 1EEQA 1JI1A 5DRZB 3QXTA 3OZ9L 4PPTA 2OSLB 3DX6B 4OLEA 4J3OC 2E7HA 1IE5A 3E8UH 1UXSB 3D39A 3EYOB 2DL2A 3VXMD 3VXTB 1BFVL 1OW0C 4QHLA 3DV6A 2VISA 1IM9A 3QWOA 4PJ7A 4W81A 1CLCA 3MRKA 1U8NA 1INEH 5DHYA 1BVZA 1NGZB 3ROOB 1X6NA 1KJMA 1AGEA 3ISWA 3WS3B 1UJ3B 2NQCA 5DK2B 3NIDF 1MHEA 4Q0XH 5I75B 4L4TA 5IB4A 4JM2D 1T20B 4H0HB 3U0WH 4M1CC 3CC5A 1GIGH 4UT9L 3QEUB 4XPAL 1QSED 5E8PA 1CD9B 3VH8B 4CU8A 3SDAA 1KCUL 4ZPTA 3IXTA 4U7SA 1U8IA 4JZNB 5C0FB 1MQ8A 3L6FA 4X4ZA 4FQXD 5EIQA 2GK2A 4HS3B 2P7TA 2Y4SA 1FVDB 1CFSB 4GOSA 1MHEB 4OQ1A 3CK0H 2OP4H 4J8RB 1AO7E 2R0KH 1Z2KA 3FCTA 5MEND 5DHYB 3IJSB 4JZOA 1CG9B 2Q3ZA 1F4XH 2AV1A 3C6LA 5I19H 1FZJA 1A7RH 3MUHL 5DHVH 3TT1L 2YD8A 1NFDF 3RA7L 3HMXL 4O9HL 43CAB 3GO1L 2YN3A 4MZ2A 5C0GA 1BZQK 1A2YA 3TCXA 5D96B 3MOAL 5C0BE 2WZPD 4GBXD 1LO4L 1OP9A 2M8XA 1UQSA 4LIQH 2DM4A 4PGCB 3BMWA 4LGRB 1CU4L 1K8DB 1UVQA 4ZUUA 4JRXA 4S10A 4Z7OE 2BY3A 3P9LA 4L9DA 2VUYA 2XI9A 1JNHA 5GRZA 3X11B 3KYMB 3E0GA 4U31A 4WW2B 3H9SA 2PO6B 3EYQC 1I9RH 5E1AA 2CDGA 4GH7B 3V7AG 1IKNA 1R3IL 1TFHA 3WFHB 4WY7H 4JHBA 4WEUD 3D3VE 2FZ3B 1N59B 1FIGL 1CFQA 3QUMB 1EBPA 2B8OT 2VDNL 1B4JH 4BSVA 2XQYK 2R2HA 3OB8A 2IPTH 3MCKA 1TDQA 2E9BA 5ETUB 5SWQA 5KN5A 4QKXB 1HXMA 3HB3C 1SBSL 3QDME 3U7WH 4XB8A 1TQCC 3MLYL 4PRHB 3DUUB 1YMHA 1D9KA 5DDHA 1ITCA 2B1AH 4TNVF 3EDKA 2YWZA 1A3LL 1KJ2B 5GRXG 3MLXH 1BF2A 4JDVB 1X7QB 2C7UB 1EH9A 2R29H 1IKFL 1RV6X 1F58L 5F6HJ 2Z4QB 3GB7B 1Y0LA 1I8MA 5IB5B 3UO1H 1ULVA 1MOEA 5L2JA 3QPXL 1ZHLB 1PY4A 5MHSE 2X7LB 2XWBA 5IT2L 3M45A 15C8H 2AJVL 3LAFA 4J3UA 3PUCA 4GW4A 1KT2B 3U6RB 1UJTA 2X6MA 3K4AA 4YXHL 3OKNA 3BIKA 4O2CB 4C56E 2LTQB 3LH2L 3ME0A 4NFBA 2DL9A 3TF7C 1JGDB 1J1OH 1J5OH 4ALAL 2J6EL 4M61A 4Y5XB 4ZYKA 2DJSA 1SVCP 5DUBB 4I48B 1EEUA 1JGVH 5GGTL 1WWBX 5FECA 1K5NA 5E8OA 4NBXB 1XAUA 2ZCKH 1KCVH 1M7IA 4RGMB 3BZ4A 2JB5H 1NJ9B 4LVNC 1FO0H 3C5ZD 3CFJB 5FYKU 1KXVC 3MJ8B 4P9HL 1YYLL 4PB9L 4X6EA 2OXGA 4JB9L 5JQHC 4FZEL 5I75C 4PJCB 5JOFA 3LIZH 2O26U 2PKDA 1FSKC 4OFDA 4NQEA 5DVOA 4HWZB 4UAOC 1CLYL 1AGFA 4H8WC 4PGBA 3BZFA 5ALBH 4A2LA 5F7EH 1CBVH 4M1GL 4DK6A 1G7PB 4CN4A 1CL7H 3B9VA 2VDOL 4IJ3C 2VDML 3GIZH 3O9WD 3V2AR 1QFHA 4Y5VB 2R2BA 3BVNB 4PTUA 4OZFA 4MX7A 3VGEA 4MB4A 2ITCA 1KXQE 2AXGA 1N0XH 1BLNB 3ARSA 3HZKB 4M48H 1IQDB 4I3SL 3T4AB 1TCRA 4GSDL 3THMH 4OZFH 5EORH 2DLGA 3GMRB 4K3EH 3QXAB 4NC2B 5E9DD 5EC2B 3AMKA 2YSSA 2BHUA 4GRLB 4YDIH 4L4VD 1RIUH 4I18C 4A6YB 5EWIH 5E5UB 4P99A 4OLVH 4QCIB 5IVXE 1YPZF 1MF2L 4RZCB 3EBAA 2JCCF 2VLKE 4OI9A 4HC1A 4OZHF 5GSRB 4L4TD 1RUMH 4WGWB 3AY4A 1RHFA 3MLTB 5IHZB 2ZCLL 3VXOA 3EYVA 3GFUA 1GGCH 3GMMA 4NZJA 3O8XA 3VW3L 4Z95H 3AS2A 4RGMC 3LN4B 4G3YH 4WUUE 2GSGA 1FNAA 1GHFH 3DROA 5GS1C 2EDOA 2CLRB 3PWJA 2P8PA 1FFOB 2VABB 1YUHB 5IEHA 1G9NL 5GS0D 1Z5LB 5FM8A 2BY1A 4QO1A 2EDQA 4JM4L 5I0DA 3BP7B 4F58L 1F97A 4U2YA 3KDMA 3VGGA 2XFXB 4PLJC 5JA9A 4GLRI 4I0PB 4P4RB 1T1WA 3QPXH 1B88A 1LHZA 5HDOA 3CFIC 1X5JA 1TJGL 1EGJL 4KUCF 5DRNA 1A7BA 2OR9H 2XKUA 3ZE0E 3RUGF 4Z77A 1IC7L 3PXJA 3F7PC 1RZGA 4YBQC 4KAQH 2IADB 5C9KA 1CLOL 3G6AB 3BWAB 1N2RA 2ZWLT 2E7MA 4DGYH 2PYFB 3F5WB 1JHLH 2EEDA 3O6LL 1N6QL 5IEHB 1CE6B 1J1PH 5C09A 4LVOC 1KFAH 1FO0A 1ORSB 3UDWA 5F7YC 1U42A 5FF6B 3I85A 3DROB 2ZNWA 5BOZG 3N9GL 5L8JB 1KLUB 4QYOA 3UAJD 2FX9H 8FABA 4WUUA 2QQKH 4WWKB 1A1NB 1B9ZA 1J05A 3AGVA 2A6KB 4U1NB 1VKXB 3FB8B 4PIRF 4PRAB 4K71B 3IDIA 3L3KA 4TUKL 5SV4A 2EC9U 1P53A 3FO0L 4QCIA 5KOVC 5DVKA 3GMPA 1BVLB 2CDGB 4JFDB 1REIA 4PGEA 4QOKE 3H2WA 3HNVH 4OZHE 3VD5A 2E5EA 1EHXA 3I02B 5D2NA 3NCMA 3SDXB 4NM8H 2YSSB 3O6KH 4C83A 1A21A 3BPNB 1JYVA 1FYHB 2YA2A 1CE1L 2ZG3A 4M6ML 3T2OA 2R69H 3UXFA 4ZS7L 3BESR 4HXAL 4V1DA 2EICA 4OD3H 1CCZA 5MERB 1QFPA 4HV8B 4TPRH 3RAJH 5SWZB 2GK0A 3SE4C 3BPNC 1F4XL 3LQMA 2V17L 3TESA 5CBAA 3VJ6A 2X4PB 4YZFE 2OP4L 2F19H 1YNKL 3O3DB 4KXZI 1F13A 1QHPA 2KKQA 4WU5A 3HR6A 1Z0MA 3IGAB 3VE0A 2CXKA 4PLJD 1PW3A 2XWBB 1DQDL 3NAAL 4UNUA 3MRHA 3KR3L 1AGFB 2NY4C 1OAXL 3FO0H 3QIBD 3STZB 1NAMH 2VMFA 1PQZB 3BMVA 1EO8L 3RNKB 4MWFB 4LCWB 4QRUB 4HUMB 1VPOL 5HHXH 4PJ7F 3KWWA 3P4MB 1MRDH 5TQ0H 4F7EA 1MCFA 4MD4A 4WWKC 4N5EC 2EECA 3VXRB 3RI5F 4BSWB 2DQJH 3JXAA 5M95B 3GI9L 3CFEA 3M8OL 2FX9L 3GDBA 4LHUB 5I71B 2J8UE 4NN6C 2UWEF 1D6EB 5DVNA 2I60L 4TNWF 2XQBH 4PREB 3MV9D 4XP9L 5HYJD 1FBIL 4R0LC 4YX2H 3SKOA 1YNLH 1JHLL 2HT4C 2A1WL 2BOCA 2MCPH 3L3JA 4U1MB 2VLLB 2YPLA 4EI5B 3LSOA 3BIKB 4O2CA 5FM5M 5HVWA 1NFKA 3UTOA 4TVPL 4PBVC 2GJ6D 3OZ9H 4KMTH 2MKWA 3C8DA 4CJ0A 5I76B 5JHDA 4H1LH 5HY9A 5IUSA 2DIJA 5TJWK 4S11A 4L3CA 5D1ZC 1YN6B 5KVMC 5FDYA 3VMOA 3GM8A 1S7XB 4AH2B 4KUZL 5EU4B 5DWUH 5ISZB 4KY1H 3ARRA 1IKFH 1V7NH 2BDNL 3TVMA 1TZGL 1DQJA 5ISZD 4HS8L 4XAWL 2OQJB 3TO4D 4JCMA 3VGAB 5HXMA 2I60H 5F6HI 3ILPB 1UZ8B 4TTDC 4R8WL 5SWSD 4POYA 3GSOB 3FKUS 4K71C 1JP5A 3FMGH 4ZQKA 5B21A 3FN0L 4XCCL 5FO9A 5IGXL 3FQXA 1KENL 5C9JB 5HYFA 3TBYB 1U41A 3I9GH 3KPMB 3HMWH 2ICWI 1KC5L 3R0MA 4Y4KA 3U4EB 5JO5A 2ED9A 4KHXH 1YEHL 1HEZA 3CFEB 4OIIH 3F7QA 4UQ2B 4ZFFA 3OMZA 4Q9RL 4OQTH 5EN2B 5B3JF 1RIUL 4HWUA 4XXDB 4E5XB 4RBPK 5DC9B 1PFCA 4HD9A 1KB9J 3GSNA 1XCTA 3LVEA 4J3XA 3AY4C 1S9YA 1WFTA 3MOQA 4PY8J 2DQCL 5D1QA 1AQDB 1ZHNB 2RFXB 3QPQC 1BD2E 4LCUB 3VH8A 3FONA 5J7CC 5HTSA 4MMZC 3IVKA 1U58B 3EO9L 3QIBB 2YK1H 3OKEB 1MCLA 4X9HA 3GSVB 4I13B 1OSPL 3MRKB 3DNKA 2V2XB 5T1LA 5C07D 3BKML 3RWDA 1PGRB 4ONOA 5J06A 5FGRA 4DKAA 4BQCA 1M71A 1I1FA 3O6KL 4RFNB 2CUHA 4DGIL 1QBMH 5DJ8A 2Y06H 3MRGA 3VFGL 5T5FH 3OV6A 3BI9X 2SEBA 2DOCA 3DVGB 4BK4A 2DAVA 2EYSA 3PGCB 1CDIA 4LEXH 1RUPH 4FN0A 4Z18A 5C86A 1ZHKA 3BFOA 4NRYB 3DXAE 5F8RC 1OHQA 2EYTA 4P2RB 2HMID 1XCQA 5D1QB 1B90A 4R4BA 2WINB 3DRQB 2DTML 3KGRA 1VACB 1FO0L 2VLJA 4XPAH 3UYPA 4FXGB 5AG9A 1J8HB 1N64L 4K3DH 4EBQL 5B39A 4I18B 1BP3B 3QQ3A 4NKMB 5IB1A 5F88A 5IHBA 4QXUL 5EBMA 1K6QH 4NRZB 3WDIA 5AEAA 1CD1A 1YZZA 4WNQB 4J3WA 5DUPL 1UH2A 4PREA 4F9PA 2VXUH 4Y0GA 2EE3A 4J6RL 5D6CB 4L9LA 2FYYA 1FNGA 2CR6A 2X2YA 2AXHA 3MBXH 2N1KA 3DX8B 4FZ8H 2EDBA 1VACA 3BOVA 4NN6B 4JCLA 4NGHL 4RMUA 1TVBB 3VFSB 2DQDL 4Z6AT 3I50H 3KYNA 2NR6C 4J4PA 2J88H 2RHEA 1KYOK 4IJ3B 4JO1H 4OF8A 4QNPF 1CQYA 3IU3B 3LKPA 4UB0L 3CH1A 1RIVH 2CXGA 4MNQB 3SQBA 4OKVA 1J18A 1HXYB 2JF1A 3Q3GB 4R3SA 3RQ3A 2PUQT 4HDIA 1IL1B 5E8NA 4LLMA 2AJXH 2GK0B 1I7UA 4LRNL 3MUGB 1RUAH 5HI4C 1A7PH 5KBNC 2JELH 4OV5B 1F4AA 2F53B 5IQ7L 5JZ7D 5IMOB 3SQOH 1RUML 3B83A 5IR1B 4WU7A 1WCQA 4U1MA 2NYYD 4FTVE 3LQZA 1U58A 3QIBA 1RMFH 4LAJH 5IW3A 4UU9B 3MJGX 4XC1H 1I9RL 1IGMH 1JPTL 4XVUC 1G0YR 5DJ0A 1SMAA 1OAUL 2UV3A 3BE1H 4IDJL 1T04A 3WEXB 3IT8D 3EO9H 2E7CA 3VI4F 3MJ7B 4NQTA 1PKOA 3QZWA 1NAKH 2C3HA 1JF5A 2DQCH 4LIQL 4K2UH 3INUL 3MCLL 3T1WA 3JZ7A 4M5ZL 5KJRL 5KW9H 2J7LA 4JRWA 4P23A 3RA7H 4OZIF 1YDPB 5C0BD 5KSUB 3E6FB 4J1UA 4JHZA 3MRRA 5DQJB 4L4VB 3ARED 3KPTA 1ACYL 4K7FA 3IXAB 4H25A 2Q20A 4GRLD 5CGMA 2A6JA 5E4IA 4F7CB 5JOPE 5GZOC 2ZPKH 1P7QA 3I75B 1YA5A 4H0IA 4YUEH 1IAOB 4KZEL 4LF3A 4XCCH 3CPLA 4PYHA 3BGAA 3OXRA 5FAAA 5MENE 2MQCA 2GCYA 1K2DA 3P11L 3QDGE 5D2LB 5DSCA 3VG0L 2R2BB 4N8PA 4AENA 5HGHB 1F6AB 1FORH 1A6WH 2X9WA 4JDTH 3D18B 1OAKH 4XNZC 1P1ZA 5EU4A 1DN2A 1XF1A 1JI2A 3F7YB 3QQNA 1XGQB 2EDLA 1A4KA 3CXDL 3EJZD 4OLWL 3D39D 4WTXA 3VXMA 4Q7DA 2BHYA 5D2NB 3QEQA 4XPTH 4EI5D 2JB5L 3BGMB 4DAGL 2YPVL 4H8WL 1DQLL 1QQDB 1FNLA 3ARPA 4HSQA 1CICC 1UB6B 5J6HB 4PJBB 4UT6H 4O02H 3C09B 5SX5K 5D7KD 4RISL 3QDAA 3TO2B 3PGDA 5GISH 5J3HC 1ONQB 1IQWH 2OL3L 2NY0D 2NYYC 3T4YA 1F90H 1L9NA 1OAQL 3MLTA 15C8L 2QSVA 4LCWD 2FO4A 1NGWA 5T1MB 3R06A 3T65B 4X5WA 2X1WL 3I3BA 4KHTL 3NOIA 5L88L 1OAYL 4XCNB 4E41B 5DJZA 4GRWF 3D0LA 4FQIH 1S9WA 3WFDH 3V4PL 4MQ7B 5DT1H 3H9SE 4C4KO 2AGJL 4OBRA 3SBWA 5TH2B 4CN6A 4PJIB 5SWZD 3UTPD 2VSCA 3MRNB 5FEBA 2ITCB 1QSZA 2RJMA 4AEHL 4D2NA 2X1PA 3MRFA 3V79C 2VDNH 1UCBH 3JSSA 2W9EH 3V5KA 1SVZA 3BVNA 1EO7A 4X6BA 1QSFA 3MCKB 3KXFA 3L5HA 4ODWA 4CVUA 1I7TB 2AV7B 1CLZH 4QRPA 1QLEH 1XH3B 3RHWF 5IW1B 4Y1AA 3ZYZA 2XZQH 4YFLF 3SDYH 1KB9K 1MQKL 4M6MH 1JNNL 1FN4B 4HWNA 4PG2A 1R5VA 3HMXA 1U8PB 2NY5L 4ZAKC 3MRQB 5ESAA 5E1AB 1V3MA 3EJZC 5DZNA 3SKJH 2NY2B 4KU1A 4ZMAT 1INQB 4U3XA 3ZL4H 1GGIL 3X11A 1IGCH 2CMRH 2O5ZH 4Z7UF 4BFIA 1MH5A 2XV6B 4HUNB 3AU1B 3T2NL 2GY5A 3MQIA 4IDJH 5KS9E 1SQ2N 4L3ED 5BVJB 1MFBH 3F7YA 3S6CA 1C1EH 3NCCB 7FABL 2FO1A 1FE8H 4NNPL 4JPIA 3RWGA 4HEPG 1ED3B 3SDCD 4L8SC 5HI5D 3LQAC 1WCBB 3O3EB 4MS8C 5GPRA 3ARYA 1SEQL 2YD5A 2O5YL 1NEZA 1CK0H 3FTGA 1T03H 1U92B 3LPFA 3MREB 4Z7VB 5ADPL 4HS6A 3PXHA 5ICXB 2VL5A 1UEMA 3KPPA 3QG6A 3V4PH 1FVDA 1HNGA 4XAWH 3VGAC 4L1HA 1QYGL 3NCJH 5F7FA 3CD4A 4PJXF 1E6JL 4L5FH 2GSIB 4JLRB 4UB0H 2GYSA 4KY1L 5CEXA 1T0MB 2PXYC 4MD0A 3NFPA 2CKBL 4G6KL 5C0IB 4UDTB 3IDMA 5BXFA 1XZ0A 2J8UB 1SJVA 2EDXA 5CEZL 1SY6H 2XTJD 5ILTL 3S5LB 1ETZB 3W39A 1C5CH 3U0TA 1DBBL 4KMTL 2HVJA 3HR5B 1AJ7H 1FJ1B 1TJHH 2PTTB 4RNRB 1RQ5A 5B4MD 3V52L 1IQWL 2OL3H 3PGDB 2R1WA 3MV9E 4PJ8D 4PR5B 2EDJA 4G42B 2R4SH 3IFNH 1JPGB 2UWEB 3ARDB 4WFFD 4BFGA 3IF1A 2DKSA 2YUWA 1CICD 4K8RD 5DTFA 5E99H 3QWRA 3C5SB 4Z95L 4OV5A 3EDFA 5DFVC 5JIHA 5JR1L 2V5YA 3T77A 5K59F 4CJ1A 2WLYA 4H5SB 3DURB 1A4KB 4KI5D 3HE7B 4PS4L 3F62A 3GK8L 5DQDL 3RWFB 5FO8A 3AXLB 3KLAB 5CILL 2NY3C 5TDOB 4GRLA 3WN5C 3TCLB 2WMPA 3WMSA 5HYEA 4RMQA 2ESVA 3HI1B 5BVPL 4R4NC 3BDYH 4NKDA 1CGVA 1A5FL 3CMOH 1F45A 4LARH 1P84J 3QDMA 5T5FL 1I4FA 2DQTL 3MV8D 3FQWB 4XNUH 2FSEA 3HI6H 1EVTC 3CU1A 1B2WH 1KJ2A 3FB6A 1Q0XH 1DUYA 3GRWL 3O9WB 5BS0E 1PG7H 4MYWB 4P2QE 3OKMA 4NWUH 1ZA3A 4JZOB 4OZ4A 4L9LB 3TBTB 1K9TA 4JY6B 4BSVB 1VSCA 3HZVA 3JWDL 1OSPH 5H35B 4MB5A 4YNYA 5D7IA 1Q9WB 4YDKH 1I3GH 2FZ3A 2XKNB 4KRNA 4LSVH 4M5ZH 4P46A 1AQDA 1ZHNA 3BEVB 3F58H 4KK9D 3SDXF 2H1PL 5C1MB 2VDMH 2H9GB 4NM8L 3C2AL 4PJHA 4FXGA 2R0WL 4WV1C 3BKCL 3ETBF 3FQUA 3O2DL 1BD2B 5ID1A 1KTLB 4ODVL 5AZEL 3NIGE 3HB3D 1DTUA 1D6VH 3N50A 1ZLSL 1KIUA 2QTEA 3WL9A 2JLLA 5EOCJ 3HAEG 4PD4J 1R3HB 3LIZL 1W0YT 1K8IB 2BNUA 1LE9A 1ZT4B 2PXYB 1NQBA 2XWJB 4HKZA 2Q8AH 3U4BL 2Z92B 2Z0BA 3H42L 2GUOA 1AXIB 2N7BA 3VWKB 3LPWA 5HHQB 1S78C 2V9QA 2AJ3A 2FIKA 3HPJA 4ZO7A 5IVXA 2AJXL 4GW4B 2R0LH 4H1LG 4JVWA 3B9KA 4JKPH 2FNBA 1ZLUK 5IQ9A 4KK6C 2P7TB 2XTJC 3IU4L 4UV4L 5J12C 4PJ8B 5DS8A 5GQBA 3SDCC 2NY0B 3LS5H 3GSNB 4HCRA 4R7DB 4EDWH 1ES0B 4V2CB 3T1FB 4N9OB 4YHZH 4PJXE 2D0HA 4XX1E 3UZQA 3MV8E 5FYLD 4O51A 3V5DB 1T83C 2GJJA 5HJ3A 3H8NA 1AGBB 3QEHB 2BOBA 2JIXD 5D6CA 4U1KA 5CHNB 4Z7WA 4J6RH 1M1SA 5FCSH 2F8VA 3HZVB 3ARQA 2OZ4H 2OTUA 5ITBL 4ZAKB 1OGAE 5DJ2B 4L8CA 3F6IA 4I18A 1UB5A 3HKFA 4ZTOH 1A1OA 1MFCL 2Q7YB 4NCC1 3WS6C 2W0LA 4K3DL 4EBQH 5JIIA 1NCAH 5IBUG 4ZFGL 2XIDA 4MQTB 1BZ7A 3MJ9A 4DJMA 4AL8H 5K93A 3DI3B 4HKJA 5IJVB 2Z92A 3VRJB 5HHXL 1IMHC 1FNSH 4AY0A 1S7QB 4F2MA 5D7IF 1OAXH 1IAKB 5CBEA 2XTJE 2YR3A 4QGTA 1T6VN 1T21A 1MFNA 1F4HA 1Y18A 1X6LA 3OAUL 3LMJL 1XGTB 4L3CB 4UDUA 5F6IB 4XWGH 3SE3A 4JZJC 5KVFL 2EXWC 4KI5C 4Y8DC 1U8KB 1GGBL 1P9MA 1ZS8A 2DYPA 4FP8H 4PJCF 4J3SA 4HX1B 3WFBH 1JHTB 3MNZA 5GZNC 3DUSA 1I3GL 5EZIL 1MCBA 1N4XH 5FGBC 4GG6F 2YBRA 5TFSL 1N4XL 4YHNB 4EUPH 2AEIT 3DSFH 3UP1A 3MROA 4YIQA 5CJBA 4KRMB 1RJCA 2J8UA 4JPKH 4LEOA 1CXIA 5I1KH 1HNFA 2MFNA 2W65A 3NFPB 3JTTB 3WKNA 4QHKI 3ARXA 4UDTA 1QSEB 4M1GH 2GY7B 4PJEF 5GRVL 4MD4B 4ZO8A 4EUPG 1X5ZA 1DBJH 2OCFD 3K4DA 3C09C 1MCOL 3QHZL 1IBGL 4YHOH 1FL5A 1FFNA 3MV9A 4XBGA 5F7DA 3ULVE 3UBXA 4CVZB 5DHXB 5DJDA 3UC0H 3SDDC 2VZ1A 3RWHB 3QG6B 5C9JA 1NMCB 2W07A 4NNXB 3N85L 2BVYA 1I1AA 4M5YL 5EU5A 3GMQA 3U30B 2BXYA 3QWRD 1GIGL 4UINH 1QRNB 2RR3A 3U0WL 4LMQE 3P9MA 5E8DH 32C2B 1JGEA 2FDBP 5D2LE 1JJUA 1UCTA 3A0OA 4JRYD 4OT1H 4EOWH 1H3WM 2ORBL 3MNVB 1MJ8L 4LLAA 1N2RB 3B4NA 2CGRH 1J0IA 1JMXA 4XCYB 4HBCH 4NQVB 1OGAD 4MVBD 3RY4A 2A6DB 2FWOB 4JFYA 3ZKND 4UTBL 1HHJB 3G6DH 1U2CA 3RUGE 2NLJB 5EPMA 4YHMH 5HPMB 4NPYB 1NLBL 2MQ0A 3W5NA 1CR9H 4Y4FA 5L2KD 3L3IB 3WUWA 1A14H 5DHVA 3CMGA 4JN1L 1C08A 3FB8A 1M05B 2DRUA 3GIVA 3HPLA 1WWWX 4X6BB 5L2KB 4JKPL 4X98A 2I07B 4V2BA 5F1IB 4ODWB 4P46D 5CKAA 2VRAA 3V5HB 1ORSA 1R0AL 3O4OB 3GHBH 3AROA 4HXBL 4JRYE 2H2SD 3MREA 1KLUA 5EU3B 5ACZB 1S9XA 3G5XB 4S1DC 4TTGA 2C3XA 4LQ1A 1N6VA 5D1QD 4GRMB 5GGUA 3X13A 3EHBD 5EZOH 3W9EB 4YDJA 3BSZL 4YWGL 1AD9A 4CMHB 1VPOH 5J1AB 1H0DA 4WCYH 1R5IB 5MI0B 4A6YA 1C8PA 2VXVL 4G8EB 5T1LD 1F02I 1U8JA 1KIPB 4HIEB 5FHAH 1IEBB 2A73A 3ARVA 3QA3B 1GGIH 2R0WH 4TULH 2D7PA 5GIRA 5GS3A 5LQBH 4Y7MA 1FFOA 3EIFA 4X8JB 1FGVL 4MD5B 4NZRH 4PRBB 4RGND 3V6OA 2Y36H 1JNNH 1RI8A 4LSVL 1MNUL 4BQ6A 1OF2A 3CDGB 3TT1H 2GTZA 2P8PB 5KSVA 3H3BC 1C16B 3U46A 2OJEB 1H3TA 5CP7A 1QEWB 5EDXA 4PFEA 2OTWB 4PY7B 3RJDA 3DUHA 5FDWB 4R90H 5IV2A 4PRDA 4ZUSA 2GIYA 2B4CH 3UTQB 2BY0A 2Y9RT 3PHOB 4N5ED 1N5YH 2G75A 5I73C 3MRLA 2G5BA 5HYJA 1CL7L 4LSRL 4MHHG 5GIRB 35C8L 4LCCB 3HPLB 3MZGB 1A9BB 3MRMA 5KSBF 5BZWB 2PW1B 4Y2DB 3VG9C 3HAEH 3MXWH 4HIEA 3EOAA 5E6YA 4QTHB 4M9OA 1E28A 5EOTB 4RQQB 3HRZA 4HWBA 3NFSL 4BQBA 4HJ0C 2QHLA 4M3JA 2VLRA 5F9WB 3GSRA 1CGTA 3CVIH 5ERWA 1AHWC 4TSAL 5AYUL 4NHUB 5IFJB 5D2LF 2NW2B 3TYGL 1MWAH 1EX0A 1R5IA 2WBJB 1NANI 3V6FA 1DVFB 2XNAB 4Q74A 3S35X 1DLFH 5I18L 2IAMA 2J6EH 4X0KA 1PD6A 2HLFC 1UJ3C 1E27B 2JJWA 2P24A 2IADA 5KVDH 1UG9A 4MQXC 3QJHA 4MZ3A 5KZCD 1G7PA 2FGWL 1BQLH 5BJTA 1CDGA 1ZHLA 1IC7H 3SE4A 2DD8H 5ERWB 3FB5B 3MGAA 4QTHA 3VD3A 3BO8A 4AM0A 4L8DB 3HRZB 1N8ZB 4UOJA 2CKBH 4G6KH 1NSNL 2WW8A 4OBSA 2X4NB 3QH3A 4IOIA 1WQVT 2XRAL 3LHPH 1E6OH 4DGVL 3LS5L 1G7LB 3WUWB 4BZ2H 1Q8MA 3I84A 3LD8C 3LKNA 3IU4H 4UV4H 3BZ4B 3D9AH 2JIXB 3MACH 4E0RB 1KUMA 2V5RA 3WSQH 3MRLB 5HYJB 1QO3B 3P73A 4U0RB 4O2FB 2O93L 4DTGL 1VFBA 4UIKL 3QXDB 2DLFL 2FX8H 4IOFC 2E3VA 1NFIA 4N1CA 4P5TC 1WAAF 2DQHH 1S7TB 1MRFL 4X8JA 3LV3B 4TSBH 4NNPH 4FRWA 2DYPB 2DI9A 5T1DL 5GS0C 2W0KA 1IC5H 3CSBA 3HTLX 4JFXA 1W8NA 2A6JB 3BXNA 1U3HB 3NZ8A 3FQRA 3RX8A 3VCLA 1S7SA 5HVGB 1BJ1J 5JXAH 2RQ8A 3C6LC 5TDNB 1DN0B 2YD2A 4JFPA 5HYSA 1XF4A 5FA4A 3VGDA 4FXKA 3RPIA 1LO5B 2X4SA 3T8XB 4FQCH 2AXGB 3W0WB 1T1XA 3MA7A 5KN5B 3OQ3B 5KSBB 3JWDH 4NQUA 1R3KA 1FDLH 5DJXA 4L8CB 4F57H 1IC5L 5DDHB 3SGJC 4AQ1B 3ZKQD 1JZ4A 3RVWC 3GBMH 3NMEA 1RZJL 3TO2A 2FEEL 2HTKC 2CUMA 1KEGH 1UGNA 1HDMA 3QI9C 1J8HA 1NBZA 3QWQB 4YQXL 3OAUH 3CH8A 4K94L 4PV8A 3RIFF 3MLUH 3QQ3B 1XR9B 5GS2D 4P3DB 2BSTB 5KANI 3KNBB 1C08B 1UH4A 5DHVB 3S96A 4JFEB 3QIUC 1X4YA 2FIRT 5GJTH 4PJ9C 4NCC2 3WE6A 3BKYH 3TO4B 2BVEA 5KZCB 4APQB 3CZJA 3WKMH 3TN0B 3IKKA 1H5BB 1IAKA 2PR4L 2WM0A 1KNOB 4AT6B 1T2XA 5BV7B 1F4YH 1MLCA 2X42A 5KSAB 3FHQA 2YPKB 4R26H 2VNCA 3KYNB 2FJHB 1NGZA 3S3SA 4HGMA 3R1GH 5BRZA 4DQOL 2ZUXA 2OZ4L 3MGOB 2C4FU 2GJ6B 3KAAA 1GSMA 1GPOH 4JFFB 4CVXA 4YXHH 2ITDB 5GISL 4JY4B 4CMMA 2M1KA 4OCSL 2VDPL 3ZDXE 4GW1A 1J1XL 1WBYB 1C5CL 1LD9A 1BMGA 2RFXA 3UTTB 4XRCB 3JV4A 3SCMA 4I3GA 1A3QA 1DLFL 4X7TB 3GKWH 5L8KB 5D93B 3F7VA 4IIQA 1PLGH 1S9YB 1P4BL 5FYLL 1TTFA 1KPUB 2ADIB 3EAKA 4JGUA 4OFKA 5C7XH 3ZE1F 2WLZA 3WHXB 4Y19D 2YZ1A 4YHLH 3PJSB 3IXTB 2KL6A 2GEEA 4WHCA 5K59E 1MJJB 2QQNH 3KPMA 3O2WH 3U36B 3KXFD 5IMLB 1HIML 3KYKL 4HIIB 3U4EA 1R24A 4HAGA 4OLUH 3L3OB 3MLYH 4CMMB 3H0TA 4DKFL 2CLZB 5GGVY 1LD9B 3CFBB 1MY7A 3MROB 1NL0H 3DVGA 4MAUL 1XR8B 1Q9WA 4AIZB 4K94H 5LJYH 4AEFA 4JR9L 1IGTB 4ONHA 3O3AB 1INDH 1FAIH 4P23D 3HNTH 4RGNB 5C70A 5E9DB 4JFOB 4F7TB 3NCBB 5E56A 4I3RH 1WTGT 3JTSB 3K8KA 1RJZB 4Q9BA 3VI4E 2CK0H 4HKBB 1Z3GH 1TQBC 3PDOA 3DOSA 5KAQF 4AH2A 3RL2B 1F2XK 4F3FA 3TPUA 1SY6A 4ZUVA 4O58H 4HUWA 5DJCB 5DYOB 1JN6B 3BE1L 4C4KT 3QCTH 4S1SL 4KHXL 4XTRD 1KC5H 4LPYA 2BX5A 4P4KC 1UB5B 2HFFB 4ZXBB 3QIUD 5CINH 1I3RA 4ETQB 5DD5L 3OKOA 4OLZH 3GBNH 5HHME 3CGTA 5B39B 4XAKD 4YC2B 3U0TB 5CJXC 1YEKL 1IM3B 4HIIA 1NC2A 1IAII 3IYLW 4FQLL 1I4FB 5I74B 2A9NL 1NMAH 2F5BH 3MOBH 5DEFB 1X4ZA 4RDQF 1FG9C 3TFKC 4UV7H 5CEXB 2HTKD 1Q9OB 5LGHH 1Q94A 1YEJH 2XPGB 4MD0B 4UT9H 1VGEH 4R2GC 4WJ5B 1PLGL 3RKPA 1F11B 2QKIB 4ZTPH 4JHWL 3TV3H 1IVLA 1HYRC 4ODTL 1FVCA 1U8LA 3HE7A 1KYOJ 1ZE3C 2IPUG 3IF1B 2VE6A 4QRPE 1T7VA 2R4SL 1QRND 3IFNL 2VDPH 3TEUA 1EHLL 3ZDXF 4XNQB 5SWZA 3FTGB 4CVWA 2AK4E 1FYTD 1I8IB 4HIHB 4OFYD 3KPSB 1HILA 1Q0YH 3MODL 2J8OA 3ARFB 4DN3H 2NMSA 1R3HA 2D31A 4OCWL 3RUGB 4P2QA 4OIBA 5D7JA 1HHIA 2HLAA 3MV8A 4XPTL 1EVUA 4KQ4H 4G9FA 4K23L 2H9GA 3ARBA 3IDMB 2LAGB 3GMPB 4F7MA 3KWWB 4PJ5D 4ELMF 4GKZB 1VKXA 3QFDB 1BQSA 1OT2A 5IEKA 4QXTB 5GSVA 3ARDC 3P77B 4PJHE 2C3GA 1JRHL 2PO6D 4QXWA 3WO4B 3IDGB 3S36L 1FSKB 1FIEA 1HDMB 4LP5A 5H35A 3S4SB 3S98A 1FLRH 4JPVL 4ENEC 4M8QA 2FCBA 4YUEL 1GC1C 4N90E 3G5YA 1NEUA 5JIPA 7FABH 5D7JC 2IAMB 2A77L 3M1BB 1OVZA 2GFBA 5MEOA 4QRQA 1KB5L 2N7AA 3IJYA 4GAYB 5ABDE 3MYJA 1MIEL 1N6UA 2NR6D 3BP5A 3RZCA 4XPFH 1DSFH 1Y6KR 4L4TE 1ZA6A 2NY6D 4HJJH 3ROLA 4NQCD 1Q1JH 4WFGE 4GG6B 3H9HA 4X5LA 1U3YA 3WN5B 4YO0A 1CFVH 1RZ7L 2NNAB 3HUJE 4I3RL 4HJGA 3O0RH 4PJ5B 3BSZH 1DBAL 3FRUA 3O6FD 4YWGH 1UXWB 2ADGA 2AEWA 5EU3A 5ACZA 4QRRB 2KDGA 1CFTA 3VXUA 3C5ZB 2QQKL 3SPVB 3O41B 4S1QL 2BY2A 1OP3K 4L8BB 3V5HA 2NXYC 3ELAT 4R2GD 2AQ1A 4CNIB 1J1PL 2NXYB 2P44B 2V2WB 5I66B 5BMFL 2VSDA 1KIPA 5L7XL 1FYTB 1N7MH 2F53D 3S9DB 4F37F 5HHPB 3P0VH 1KOAA 3TIEA 5HPOA 4QLRA 3VCLB 4QWWD 3MLWL 4KUCD 1T7WA 3BKJH 4YHML 4WRLA 4NGHH 3DO7B 3PQYB 3QEQE