5D7LE

Structure of human mr1-5-op-ru in complex with human mav36 tcr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSRDKKERFSLILESASTNQTSMYLCASSPSGYQETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7lE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7lE02
1UKQA 3BZEB 3O2VH 1A9BA 4OLZH 1NFDA 1QR4A 2R4SL 2YN3A 5MEPB 4RBPH 3VH8G 4GRWE 4Z0XA 3HAEA 4PB9H 4ZUTA 3ORJA 3S7GA 4JY4A 1A8JH 1C1EL 4N0RA 5DHYB 1MRFL 3TYGL 1JF1A 1DCLA 3L6FB 4FZEH 3EJZD 2A83A 2NY7H 4JHAL 5FF6B 4LCCC 3RIFK 4KKLC 4JG0H 4AIXA 5D5MB 5GGVY 5DJ2A 4GMSL 3VRLE 2NY2B 2F15A 3RGHA 1AO7E 3RA7H 3I6GA 4PRIA 5KANG 1T3FB 4X7CC 1UQSA 4LLYB 4MB5A 1FSKC 4TRPL 4U0RC 1IM9A 1TZGL 3PQYD 2PTVA 3MLSL 5CFHA 1BFTA 1TZHA 1NAMA 4XVSL 4LCUB 4O2CA 1LE9A 2Y7QA 4GW1B 5H2BA 2R8SL 2HJKA 1MHCB 4KPHL 5C0ND 5HHOB 2JTDA 3QXWA 3G9VA 3DX7A 3NBNA 2ICES 2GUOB 1NC4A 5L7XL 2R0KL 1MJJB 4JFZL 7FABH 1AGBA 4NSKA 4EIZC 4PJ9D 4BFIA 3TBYB 3NFPB 3PABB 1OGAA 4HUNB 4LEXL 4N8VA 3TZVB 1ZEAH 4W4NA 2B5IB 2VDQH 5EFIB 1N2RB 5I8EA 3WE6A 4NP4L 5I9QB 4MA8L 4LSUH 1HEZA 3PP3H 2NY2C 2OJZL 1D6EA 1CTNA 1IEBA 5E5UB 2OCFD 3L7EA 5JXAH 2DJUA 5CEYB 5DS8A 1RUMH 5GGTA 4BKLA 2Z31D 3IDJB 3IJYA 5D6DA 3S3PA 5D1XD 4UILL 4QYOA 5E95B 4XNYL 4HQQH 2FZ3B 3LQAL 2J3SA 1IGTB 1J86A 1KJ3H 4FP8L 4P23B 4R8WH 4Y19A 4L8BA 2ILLA 1MIMH 5HDQH 3SDDB 4FQHA 2F9BT 5IWLC 3KPPA 2VXVH 4HUXA 5F7HA 5J57B 1DZBA 1SY6H 1Q94A 4KRMB 5DT1H 3CK0H 2PTUA 4MNGB 3VXSD 2G5BB 4F7PB 1RK0A 1ZS8A 1D5MB 2FGWL 3EHBD 3L95B 4M6ML 3QA3B 5HJ3A 2B5IC 1D6VH 1FAIH 2FHBA 1CDGA 3S5LB 2D0HA 3UROR 2VB5A 3EYOA 5AYQA 3MRBA 3RZCC 4RMSA 4MYWB 5ID0B 1T21A 2H2PC 1IL1B 4Q6IC 2VWEE 3IFOB 4ZFOA 2XWTA 3IJHA 3DETD 3HE6C 4JY5L 1QBLH 1QLEL 4OCSH 3H0TA 5TPWL 2Q7YA 1DL7L 3H9ZA 3VW3H 4TSBH 1UEYA 5H35A 4H20L 4I0CC 1C7SA 4LAJH 3C9NB 4RGND 4RFOH 1RJLB 2V2WB 1NGZA 4OF6A 3WHE0 4XCEA 1BAFH 5D2NB 3T0AA 1R5IB 1U8IA 2WIMA 2FX9L 5HHMD 2OX5A 1GGUA 4Y4KB 3UAJD 3V52L 1LEKA 1FVEA 2BXYA 1YZZA 2H3NB 4YPGA 5HHVH 3JV4B 1ACYH 1JGEA 3QT2A 5T1DH 3TO4C 1FZKB 2X6MA 3FOLA 4OFYA 2PO6A 2XOTA 4OJFH 3QXDA 3ZTNL 1WWCA 5HHPA 1IMHC 4U6YB 3UTOA 2BSRA 4H26B 3MROA 4X99B 4L9DA 1LK3H 4R7DA 2WW8A 5EBMA 4J3VA 3VXUA 4RISH 3UBXA 1J5OL 2DKMA 5T5FH 4WWKD 3TBVA 3RU8L 2PXYB 4D8PA 1RQ5A 2ICEB 1IC4H 4PG2A 1X9QA 5FYJD 4G9FE 3MGOB 2ED7A 5EB9A 1A64A 5K59E 3O3EB 5HI4C 3RL2A 1E27B 2P49B 3BKYH 1NGQL 1U36A 3RWJB 5HI3C 5HYQA 4WV1A 2XZQH 4JRYA 4KJWC 3VMOA 5D7LE 1IAIH 3MRCA 2YZ8A 3MV9E 2BY1A 1PVHA 4ZUUB 3GMRB 4E9LA 1YJDC 1PY9A 2NY3D 5E8PB 1XGPB 5F7DA 3EFDH 4OM0L 3QUML 3SDXF 4CVUA 1LE5A 2A2QT 3MLZL 1SJVA 3MLUH 5IROA 2CKNA 4P5TB 2Z93A 4M7ZC 4F9LA 4YXLH 2WBJA 2X4UA 3JWOC 4I3SL 5TDNB 1HWGB 4HCRL 4JM2A 1ND0B 4MA1B 1MCWW 4POZD 1QFUH 4XAKD 4KDTA 1HSAB 5EBWA 1A3LH 3FFDB 1RIVL 2XFXA 4BYHA 3EO0B 2DQGL 2VE6B 3MRHB 3RUGB 5SX5H 4RIRA 4M9OA 4PTTB 3GHBH 3O2DH 4MJIE 1MVUB 4ZPTA 3IGAB 3Q1SL 2VQTA 3V8CA 3MV7B 1I4FA 5JW4N 2X4QA 4NO3A 2A6IB 5DJXA 4WTWA 5ID1B 3U1SL 4NN7C 4P2QE 4HJ0C 2JB6A 1J0ZA 1MF2H 4OTXL 4TPRL 4V2BA 3RNQA 1N3NA 3QB7C 4FTVA 2WM0A 4HMDA 1SY6A 2VZUA 3DSFH 4KVCL 3NH7L 5LGHH 5B4MC 3TBWA 1TJHH 1JGVL 5EC1A 2MPAH 3CPLB 3ULVC 1HINH 1JYWA 3TIEA 5EU6B 3U9PH 3U2SB 3WBDA 1DQDL 3U36B 5KVFL 4JRXD 2XRAL 4G42B 5E8OB 1MIEL 4QTIH 4X6CE 5D1QC 5IKCA 1FNGA 4P2CG 4YDVA 4G6FD 3VRJB 1GGCL 5ICZA 3P4NA 4P5MB 1V7ML 3WE6B 1MHEA 2C3GA 3AREB 3T0XA 4UOJA 4RGOH 1P4BL 4OLVH 3BIAX 4NRYA 4NQCB 5KVMC 2CKBB 3REWB 3ILQD 3HA0A 5ERWB 4DJMA 1YEDA 1W72L 1DBKH 3I9GL 3MRIA 3RY5A 1JPGB 5DYOB 5IMOB 4BQ8A 5GIRA 3FN0H 4L3EA 3V5DB 2ATKB 1AD0A 3OMZA 2YD4A 1UKSA 1TJIH 3HNTH 3RY4A 1BVKA 3E3QC 1QSED 3NIGF 4WJ5A 3HG1E 4JO3L 3CJJA 4FQHB 2HTLD 4HUXB 1NLBL 2IAMC 5F71A 2BOBA 2EDLA 5DJ6B 3OL2A 1P7KA 3CFCL 5SWSE 2HJFA 5IGXH 2M1KA 5FO7A 2J7LA 4ZDHA 1GYAA 5JMOC 1NCAH 4XWOC 3QJFA 4P3CH 1K4DA 1I9JL 1BREA 4ZMAT 2AJ3B 5DHXB 3HC4L 1MCJA 4QXWA 2FEEL 3SGKC 5AZ2H 2FL5B 5D70L 4IDJH 4FQXA 3DUUA 4M62L 1T2XA 3KWWA 3QUYD 1LDSA 1MLBA 1RUKH 4TTDD 4O4YH 3DO7B 3PGDB 4LLQB 3FB6B 3TBTB 3L3HB 4G6KH 2A73A 2X89A 5INCB 1CBVL 5ISZD 4XCCH 5ETUB 1ZKAA 4XVTH 5IVZB 4P9HH 1QVOB 5H35B 4PIRF 3JWDL 2KZWA 4B0MM 1A4JA 2CDGA 5MEOB 1CU4L 3CC5A 1YC7A 1OD7A 4OLUL 4KZDL 1CF8H 3PHOA 4YDJB 5F7LB 2PYEB 4RWYH 5F96H 5C0CB 3TWCH 2BNRA 3TPKA 4IIQC 1F4XH 4M6OH 1AY1H 2H9GB 5JIIA 3O3BB 1KULA 2J5LB 4KTEH 1AXSA 1JWSB 3SKOB 1E4XI 3DYPA 1BBJB 4IRZH 1RUPL 3ZLQC 1YEGL 2OJEB 5LAXA 4K07A 4DZBA 5D2LF 4Y16D 3ARGA 2VRAA 4JFEA 2AXGB 4LQFL 3LCYA 4X6BB 5E9DE 3O2DA 1YN7B 2APVA 3CZFA 3SGJC 1A22B 2FEDC 4PJHB 5IQ9B 4X9BA 5I8CA 5DFVD 1PGRB 1BOGB 4ZOBA 4IRJB 3REVA 5HHQB 2A74B 1VADB 4N68A 4MJ4A 3OKNB 3PGFH 3UBXI 5DJ0A 3IJSB 3H8NA 3B2UD 4LRNH 1GL4B 1BM3H 2GJZB 4D9LH 4ISVA 4JGJA 4F9PA 3ZYOA 4G8GA 3DRTA 3QDAA 1B4JH 2C7UB 4OD1L 5DHVH 4OIIH 2J5LC 1I1AC 4G8IA 2VDKL 1CGWA 2FJHB 2IWGA 2VH5H 4U1GB 5EZLB 3DBXA 2HLAB 3NOIA 5FUZH 3RHWK 5TDOB 1PG7L 2IALB 4YHIA 4JFHE 1ORQA 2WBJB 3ARYA 5C6TL 1EAPA 1CDJA 4BSVB 3H7BA 3C2SA 5M7QA 2ITDB 2JK5B 4R3SB 3L3JA 2CUHA 1UXWB 5EIIA 1R24A 4M93C 2E9BA 5DXWA 4LKXA 2I9LB 4Y4HD 4V1DE 1YEIH 3O8XC 4L29B 3HS0B 3GSWB 1H5BA 2XFXB 5TGBA 3T0EA 5ALCH 2EECA 1GOGA 3QDGD 2WQ8A 1A7OH 4M8QA 3DX9B 3F58H 1CGSL 2SEBA 5CBEB 5I1HL 1CFNB 1RSFA 2CLZA 3EYUL 3OKOB 3WXVL 1MCSA 2NY0C 5DQJB 3WKNA 1MJ8H 2VLKB 1CR9L 2DIJA 3IAQA 2VSDA 5FV1L 2OL3B 1KPUB 1OAYL 3HNSL 1SM3L 2ZUQC 1DQML 4IOFC 4LP5A 4PJGB 2AKRB 3ROLB 4GRWF 4U1GC 5I30L 5FYJL 5HDBE 4YX2H 1SMOA 1VENA 3I75A 4WFGE 3WLBA 5JW3H 3ZT5A 4HS6B 1OQXA 2V5SA 3TA3C 4U1SA 3UJJL 5C3TA 4PFEA 4TVPD 1I1CA 1NFKA 4ZXBD 1CCZA 2LV4A 2R0ZL 1PW3A 2R1WA 5J3HC 1FLTX 1NBZA 3PWLB 2VLJE 1BBDL 3KPOB 2MWCA 3BKCL 3NCEB 4JCLA 5MEQA 5C0GB 2IBBA 3QEHB 4XI5C 1A7RL 3GM8A 3T1FB 3KLDA 3QWQB 5FO8B 2E7CA 4JLRB 3O4LE 1AD9B 2AJSH 3C5JA 2X2YA 2X9WA 2IH3A 3MRLA 4EXPX 5F6IC 3ALPA 1OB1B 1W0YT 3V79C 2DICA 1L6ZA 2O5ZH 1SEBA 3UTTA 1EEUA 5GSRA 3V0AC 1FIGL 1FIEA 2AK1H 1JPST 3D3VB 4RCAA 5L8JB 3P11L 4JDVB 4LPYA 4P46A 4Y1AB 3W39B 2GK2A 1YMME 1G0YR 4K7PH 4GQ9H 1I3UA 1YUHA 5F70A 1DEDA 1NMAL 5DURB 1MQ8A 2E6JA 2HA1A 2APBA 1XF5B 3EO9L 3JTSB 5BMFL 4PJFF 1LEIA 1T03H 4RMRA 5KVGH 4R4FH 2NY4B 2UV3A 2FD6L 3LS4L 4E0RA 5FA3B 4GKZB 1P4IH 5A40E 1TVDA 2D0GA 1S7QB 5C09A 3KPMA 5FO9B 3SO3C 1H0DB 3I6KA 2IMMA 1M7DA 3JWOL 3PJSB 5DTFB 4LHUB 2Q6WB 5L2JB 4PJ8D 3ARDA 1QFHA 3MRFA 1DFBL 1YY8A 4UINL 1EFXA 4NM4H 3EO1B 5KW9H 4PJ5A 2F58H 5GRJL 1IZJA 3E8UL 2EDBA 2H32B 4Z7QF 5HHOE 4FMFA 2FSEB 4M1DL 5MERB 2EH7H 2DD8L 4OGYL 3QIBC 2DKSA 3EOAB 1RMFL 2NW3A 4GW4A 3T8XB 3K2UL 5EU3A 1J8HB 1S8DB 5DD3L 1JNNH 2HVJA 4OCYH 3HI5H 2VXTH 3DTXA 1L7TH 4LPXA 3OBAA 3QH3B 4NNXA 4LF3B 4N1HB 5JHDA 2HFEB 4HUWB 2V2TA 3CC5B 43CAB 4G3YH 1FL5A 3DXAB 3AC0A 4AH2A 5I8OH 2BJMH 2GY5A 4F7CB 3VXRA 2OLDA 4WFED 3G6JA 5DGRA 3ISWA 1NEZB 4MCZA 5L0QB 4KKAC 3KPSE 1IAII 2NTSP 3SPVB 3P0YL 4XPGL 5IEHA 4N9GB 1D9KB 3RGVA 4YBQD 5K9JH 3HE7C 4KAQH 3F12B 4QRRB 4D0DB 5ESAA 3MUHL 1M7IA 1JNLH 2Y36H 2HRPH 1KIRA 4L4VD 3MCLH 3PDDA 1QYGL 4NKDA 5JLZA 2F8OA 2V6HA 3DROA 1IEHA 4B7LA 1NGWB 2FDBP 3MV8A 2WUBH 1XT5A 4HIIA 4D94A 1D5IH 1WBZB 3W9DA 3QQ3B 4TUKH 4D0BA 4ZUVB 4GG8A 4MNGE 4GXVL 5EWIL 3SDCB 4M9PA 1FO0B 3IXAB 4HH9A 4R90H 4O58L 4DKAA 3BUYA 3A67L 3R8BB 4HAFA 5IR1B 1WBYA 1K8IB 1CXFA 4E41E 5IVXE 5IW1A 3LN4A 5JO5A 3CLEL 3KVQA 4ZQKB 5I1CH 1MI5B 4Z5RB 5DEFA 1ULVA 5GRXG 4L9LC 5L8LB 3D39B 2ZJSL 2NZ9C 1J18A 5AYUL 4N9OB 3RDTB 3V7MA 2VYRE 3DBXB 2VDLH 3GJFK 2ESVA 1KIQA 1BFVH 5IW3A 3GSRA 4U31A 5BO1H 4PBVC 2D9QB 5C07D 3VCLB 3BVNA 4CNIA 3C09C 3RI5K 1WTGT 3ARFD 1R24B 3OKLA 2WWMD 5K59F 1R0AH 4FQIH 4XAWL 5GRYA 5HYSB 2N4IA 4JKMA 5D2NE 3U7YL 4JPKH 4I18A 2HJLA 3FRUB 4RA3A 1ZHBA 4OGAD 3C60C 1VESA 4EZMA 3S36L 2XKNA 1WCBA 5JORA 2XG5A 3OGCA 1G1YA 3VD7A 5HGAA 3QXUA 4HIJA 2DLFH 2AV1B 1KC5L 4YDLC 3V0WH 4DK3A 4S1RL 4X83A 2DTML 2OR9L 1MNUH 2EIBA 3NACL 4WUUD 1WT5C 1C5BL 4EUPG 4MQTB 4YPJA 1R5VB 4JY6B 4ZNEE 1V7NH 4YUEL 4HWZA 4ZOEA 4AL8H 2ZCHL 3VI4E 4P4KC 2AXFB 5E08H 4YHNB 3AS1A 1M71B 1W0VA 3CU1A 1B0GA 4DQOH 4I2XB 4RNRA 3DIFA 3VI3E 1KACB 4NO5A 3QG6A 4UU9A 1HWHB 3OJDB 4ODBD 1HQRB 2R4RL 1T6WA 2NZIA 2BSTB 1MY5A 2R4SH 4BA8A 4D0CB 5C0JB 5E5MB 2WANA 3VG9B 1JRHL 3RVTD 3QUXA 3C5JB 2FBJL 1KJMB 2YEZA 5D7LD 1MRFH 5FKPB 1X6LA 1NBVL 2QLVB 5IJKC 3NCYP 3TYGH 3E6FB 3VFVB 1XGTB 4JHAH 4O5LH 1S9VB 3STLA 3WDHA 4RFNB 4AMKL 4MB4A 1F2QA 4NQXA 1J10A 1VB9A 3GUTB 1BQHB 3PXJA 3S35H 3ULVE 3MZTA 1G0DA 2JIXB 3MR9B 3TJHD 5KG9A 3BXNB 3GDBA 4GMSH 4JFYB 3L3GB 1S7SA 3SE9L 4POUB 4F7MA 4YXHL 1AGCA 1ZGLM 4HH8A 5FECA 1WTLA 1JUFA 4TRPH 4YWGL 4UTAL 2A6KA 1OWWA 1TZGH 4Q97A 5HYIA 2EYSB 3MLSH 1CVSC 1MFCL 2V7NB 5GS2H 4HLZH 3X14A 3AXLB 4WU7A 5B22A 3RL1A 1KN2L 4JHWL 2R8SH 5DEGA 1MJ7L 4X4XB 4KPHH 5FK9B 3VRIA 4ZO8A 1ORSB 4JFDA 4YHML 4OM1L 4F7EA 3STBA 2EIZB 1KJVB 1JGDB 2R0KH 4JFZH 3CX5K 3GJFB 4HGWA 4PRNA 3TESA 4TVPL 3UTZB 3QIWB 4LEXH 4ONGL 1T2JA 1CGTA 3OR7B 1GPOH 3E3QE 3IDMA 4C83B 3H9SB 4L8SA 2ZG1A 4NP4H 4LLMB 5F3HB 4H1LH 2OJZH 2UZIL 1WITA 1J12A 4XHQA 3TVMA 4ZTOL 4TUJB 1JHLL 1NDMA 4H0HB 3MRNA 4R4BB 1K3ZA 4GS7C 4JKPL 5E8NA 3QO1A 4HX1B 3QHZL 2AJYL 5IOPA 4YZFF 2A38A 5F1OB 3S97C 4C57C 3V6FB 5MENB 3U0PB 4N8CL 4UILH 3U4EB 1V8HA 4NWTL 5KN5A 1A1OA 4XNYH 3LQAH 3ZKXB 5IB1A 4Q9QL 4NQCE 4FP8H 2ZUWA 2G9HA 3QI9C 3HC3L 3G5ZB 2CK0L 3WIHA 1DUYB 4NKOB 2UVEA 5IVOA 4LLUB 5E2JA 1F4YL 2YPLA 3O6LL 2AGJH 2I07B 1OAQL 2I60L 1X4YA 1U6AL 4NQTA 2FO4B 3ULSB 3QIWC 2C26A 2FGWH 2GEEA 4M6MH 5E8DL 1RUQL 1MFEL 2JF1A 2AS5M 3BN3B 3QDMB 2VZ1A 2CDEA 1BZQK 25C8L 3OKEB 2UYLA 3W9DB 1BJ1H 2ADGA 4YXKL 1P7QB 4N5UA 1ZT7B 3ZKMD 3DX6A 4JFFB 5DO2D 5HHNA 1KB5L 3HG1D 2VQ1A 1TCRA 4CN4A 1TFHA 5BVPL 5FKAA 2DYPA 2W0LA 3DRQB 4JY5H 4CDGC 3W2DL 1QLEH 1JI2A 1KF9B 4JB9L 5BVJB 2NMSA 3QIUA 4GRMB 5TPWH 1DBAL 3KYAA 1DL7H 4NO2B 2QADB 4H20H 1U8NA 2W0PA 2BDNL 5EZOL 4G5ZL 2NPLX 2E8ZA 3ALWA 4GRLD 3C2AL 2FX9H 1DN0A 5EOTB 3T0VA 3GSOA 3ECBA 5C0EB 2DQEL 3V52H 4XXCA 2ZSWB 1G7HB 2DM3A 4Y2DD 1Y0LA 5BJTA 3ESVF 4LSPL 4NQDA 4QTHB 3P40A 4UQ3A 1FORL 3X3FL 4UNTA 5C6PB 5D1ZC 2GTZA 4RMTA 4GKOA 4JREC 3TO2B 4F15B 4HF5L 3UZQA 1B0RA 1KJ2B 4CL7A 3QULA 3MRGB 1OP3K 2XXCB 2PYEE 5C0CE 3C5ZB 4U1MA 4QRQB 1DANU 1J5OH 3QUZA 5M94B 4PJBA 3DI3B 3AMLA 3RU8H 4QY8A 3WUWB 1F3JB 3QWRA 2RJMA 2F19L 1NGPL 2Q76A 3GK8L 5EG6C 3C6LB 3DNKA 1NGQH 1UACL 3WN5B 2IQAA 2C3VB 3NN8A 4QGTA 1OSZB 4PJHE 4R26L 4WDIA 4MNQD 5F21B 2X42A 4OM0H 3QUMH 1HOCA 3MRJB 3CSBA 2H6PB 3MLZH 3R0MA 2MHAB 5I1AB 2W9EL 2Z8RA 5DD6B 3MFFB 5C0DB 3LN9A 4G7YL 4QRPE 4Y5YA 1CD9B 3PWVB 1A02N 3LRHA 4I3SH 2MJWA 4YHYC 4HCRH 3BQUC 3O6FD 2RFXA 1ZVSB 1T04A 4PS4L 3O3AB 5BS0A 1CDHA 1N7ML 4KKCC 4OD2B 1EV2E 3GB7A 5GRVK 1XZ0A 1RIVH 3WS6A 5HDBF 3ULUH 4NQXB 5A3ID 5DR5L 1HILB 3I2CL 4G6ML 2X4NA 1BQUA 3Q1SH 3S34L 2A6DB 5JHLL 3GSNB 5HI5C 4PJXE 3C6LC 3CX2A 4HBCL 4NRZA 4PJAE 2XZCL 4YFLI 3AAZA 1I8LA 3I3EA 4H1LG 1I7UB 3U1SH 4PJIE 4F37F 1I7ZA 4C56B 2X44D 3VWKA 1T7ZA 4TPRH 4OTXH 4V1DD 5FB8A 2EDHA 4LCWD 1IC1A 1ONQB 5K9KB 1JGVH 4CJ1A 3MLPA 3WHXA 5B8CA 2UZXB 4PYHA 4Z0BL 5F6HJ 4LOUD 5F8RC 2VLKE 3NPSB 2BY0A 4MWFB 2VIRB 1DQDH 5KVFH 3S96B 4NZUH 2XRAH 3WFCL 3CCHB 4G6AC 1MIEH 3GKWL 1EVUA 5ANMB 5KAQF 1GGCH 2QQLL 1V7MH 5DDHA 4GLRH 4U3HA 4TUOB 3RX5A 2F54A 1ZSDA 3GKZA 4GW5A 3SQBA 4X4YB 3UTSA 5DJZB 1JWUB 2JJTA 3LKOA 5CP7A 1P4BH 3H42L 2EYRA 1AC6A 2P45B 4PGDB 1C7TA 1GZPA 5FGBA 3I9GH 2P5WD 1T7VA 2BCKB 1DBML 5LG1A 2VXQL 3MBED 4YHZL 4OZFG 4GKSA 5E2WL 5GQBA 4DEPB 1S9WB 3P77A 3ZDYE 5F8QC 2J8OA 1Z2KA 4GSDL 4M5ZL 3IDGB 1FNSL 3O4LD 4EVNB 4HBQA 1I3VA 3KYKL 4JO3H 3NPSC 2XNAB 3D3VE 4PLKD 3BX7C 1NLBH 4Y1AE 4FXLA 3UZEA 3M8OL 3T3PE 3CFCH 4HT1L 4BH8B 2IMNA 4MDIB 1KXQE 1KCRL 1I9JH 4L5FH 2E6PA 3HC4H 1OAKL 5I1LB 3L3OA 3QQ4B 1DE4A 4M62H 1AR1D 3OXRB 4R97B 1FLRL 2J8UB 4HKBA 4MXWL 2ZZUT 2ZSVB 3HPLB 5EN2B 1LNUB 2VZTA 1C12A 1GVIA 3AM8A 2X9YA 2R1XA 2UWEA 3D85A 4WNQA 1CBVH 1NDGA 4Q74A 5IHLB 3IFNL 1T1XB 1KN4L 3JWDH 5CEXA 4XP5L 2VN4A 3CGTA 1CU4H 4UOW0 1JZ4A 2X4RB 4RAHA 1S7WA 3AVEA 4WTZA 4OLUH 3QUMA 3K80A 4KZDH 2ZUUA 3ARUA 4K71B 4C54A 4FZ8L 4KQ4L 4W6XB 4X7TB 3OAUH 1INQB 2P43B 5A43C 1JZ7A 1R3LA 4LSTL 5EUOA 2PCPB 4PY8I 1UC6A 4YC2B 4HUVA 4G7VL 4APQA 4HCRA 5ESVB 4IS6B 2OSLB 1RUPH 3P4OB 3KPRE 1EHXA 5CGYD 1T4KA 3QULB 4MLSA 4QXUL 1YEGH 1MQKL 3RVXC 4BQ9A 5IVXF 3TZVD 4ZSOE 3ARRA 4HMEA 1LD9B 2ZWLT 5DI8B 4LQFH 2NLJA 3GMPB 3QUZB 4O9HH 1RIHL 4ODHH 3SE4A 1XF4B 5EO1A 4QRRE 4DCQB 4J8RA 1BFOA 2DLGA 3C5SA 2P24B 3V5KB 3D69A 3RIFF 4WO4A 1S9YA 3LEYL 2D2OA 3MJ9L 3BH9A 4N5ED 4NKMB 2YUWA 3QYCA 4KJPC 1YY9D 4P23D 5IMKB 5B39G 3PIQA 4JZNB 4OD1H 5FM4A 1C08B 5D8JL 5HVHC 1FFOA 3SDDD 1DDHA 1QLRB 3BT2L 2VDKH 3KLAA 1A1NA 3WL9B 1PG7H 3CAFA 1ZVHA 1RJZB 4Y5YB 1KPVB 1BZ9A 1PZ5A 3TNMA 3BD3A 1AQDB 3QDJB 3MRMA 3VH8B 1MI5E 4OCWL 3ARSA 1KTLA 3D39E 5C71A 3MUJA 3DMMB 2P8PA 1GHFL 4TNVK 2YBRA 3VXOB 1F45A 2ATPB 4UDTA 1S78C 3EYVB 4GO6B 1CGSH 2GJ6A 4QOKD 5I1HH 1E28B 5IB3B 1I85A 3GSXA 3IU3B 1CICB 3VI3F 3MJGX 3EYUH 1JWMB 1I7TB 2EDNA 2OMBA 1XR8A 5D9SB 3WXVH 4Z7VA 4H25B 3S88L 1IM3B 5E7BA 5GPRA 1CR9H 1T1ZA 4OBRA 1FN4B 5IBTL 3DVNB 1OAYH 5F72S 3HNSH 1SM3H 1DQMH 1YN6A 5DFWH 3ZE2E 2JCCE 5SWZE 3WYRA 5I30H 5FYJH 2ZCKL 2XY2A 4LARL 4R0LA 3MO1A 1A7QL 3W9EA 4Y4KD 4PJCE 5CD3A 4KI5D 3CH1B 3L3IA 3MOBL 3QEQE 3IETA 3VXQA 1HSBB 3T4YB 2R0ZH 2A1WL 2WSKA 3MREA 2EDDA 4MXVF 1BBDH 4KKBC 3ULVF 5F1IA 2JB5L 3DMMC 3O6MH 4L8DA 1IEAA 3FO0L 1A7RH 4ZUWA 5DVOA 5SV3A 1XCQB 3UTSB 4I2XE 3U46A 4R7NA 5CP7B 3RTQB 5KSUA 2PXYD 1GIGL 2AV7A 2BNQE 4JFPA 1F58L 1GZPB 4HEPG 3P11H 1EEZA 4XH2B 4XCNA 2ADFL 4NIKB 3TYFB 2Y5TA 2XACC 1GCFA 4MS8C 5BXFB 1EHLL 2XWJA 2MCG1 4D9RD 1NMAH 2VLRB 1AGDA 3ME0A 5IB5B 3MACH 3G5VA 5BMFH 3O41B 2BY2A 1QFWL 4ELMA 2Z31A 2NYYD 1OP5H 3LKQB 1E6JL 2FD6H 3LS4H 4FG6D 1YEHL 2XIDA 5D1XA 2XWBB 1MWAH 3F7VA 4P5TD 1REIA 3HCVB 4DGIL 4S1QL 1NSNL 4MVBD 1GZQA 5ADPL 3A6OA 2EE6A 4KVNL 3VGGA 2WIIB 2R29L 1QSFE 4LEOB 4PG9A 3ZHDA 1NBQA 4OI9A 4FFVD 1X7QB 3PWPB 2NXYB 1DFBH 3VXSA 1HH9B 4UINH 5D7JB 3VXPB 1U8KA 4PD4K 5GRJH 1NKRA 4M1DH 2DD8H 1MCLA 4OGYH 3MV7D 2R2EA 1RHHB 1RMFH 2FHCA 2R1XB 1JFQL 4PRID 4M1CC 1BECA 1NJ9B 4NJ9L 5DD3H 1JZ3A 1J8KA 1QOKA 3KXFB 3GSQA 4QXGL 1NCWL 4C4KO 2I26N 5DRNA 3LDBB 4QKXB 2DI8A 5F9WC 3MNZA 3CNKA 3TIDB 1WISA 3OKKA 5GISL 4PGZA 5EU7C 4YIQA 2X05A 5D7IB 4JHZA 2V5TA 5D6DC 4ENED 1S7UB 1JZ6A 1F02I 5ACZA 4DTGH 1TVBA 3P0YH 3V0VA 4LHJB 5FOBA 5EU6D 3L9RA 3O9WA 4JKWA 3BGMB 3U9UB 4BUHA 3U6RB 1I3GL 4NUJB 4LDEB 5MENE 3K46A 5D7JC 1KYOK 3TPUA 3NCBB 1QYGH 5GGQL 1JF6A 3OB0K 1FJ1B 1SHMA 5KOMC 3ARED 1KNOA 1YNLH 2GSGB 4F2MB 3GMOA 3L5WB 1J0HA 2VL5B 1KLUB 3K8KA 5KSVA 2EH8L 4GXVH 5EWIH 4YHPB 4K7FA 4WW2B 5I2IB 4U6XA 4EBQL 5IT2L 3LKSA 5CJ8A 4O58H 3LDBC 5HVGB 2DLHA 4OV6F 5K9OA 4HPOL 3D0VA 1JZ2A 3BH9B 4YHLL 4ONOA 4ZFZB 4WEMB 5ESQA 5LWYL 3HZMA 3NCJL 1JTOA 4GAYB 4Y19D 4QRUB 4JFFE 1ZGLB 1BOYA 1IILE 1TTFA 3VMPA 2ZJSH 5EPMA 1WBXB 3BPOC 3EJYD 5ACLA 2BVQA 4LLDB 5AYUH 5JZ7D 4LSRL 3BKML 1JHKL 4LGSB 1CT8A 3BZFA 2UY6A 3HR5B 3RNKB 1BZ9B 2HT3D 2L0DA 3MUY1 1A6WL 4I9WD 3CXHJ 3L5HA 3BOVA 4XNXL 1QTYT 1MAML 5IK3B 1LDPL 4X98A 4JE4B 3ET9F 4XAWH 3U7YH 3ARZA 1L0QA 1G9ML 3T09A 1T22B 4RX4D 2PO6C 3HB3C 2XKUA 2X1PA 3ARXA 4TVSa 3S36H 4HS3B 1IGFL 1NUNB 4PJHF 3RKPA 1RZGB 2DKUA 3L5XL 3VXMB 1FZJA 1KC5H 3PL6B 1CIUA 4S1RH 4RWHA 3DUHA 1P9MA 3B9EA 4UIMB 2DTMH 2OR9H 4CVWA 2FO1A 3NACH 2AXJA 2WAHA 1C5BH 1F6AB 3UJTL 3ZL4L 4LL9A 2PR4L 4YUEH 3E6HA 5GGSA 1KG0A 3MO1B 2ZCHH 1MWAA 2DQIL 3ZDXE 2PYED 2VLLA 4MNHB 1UJ3A 2D7OA 1ZT1A 3HUJA 4WV1C 3IETB 4ZPVA 2H26B 5I17B 1P53A 5IW6A 2ADJA 1F11B 2FLRT 3GEWB 2WP3T 1A47A 3N50A 2KH2B 1PYWA 1MCOL 2R4RH 3DV4B 5F1IB 4YO0A 1RZJC 4PJXF 1JNHA 2Z92A 2K3TA 4WEUD 5C0FA 1UKTA 5LXGL 4PJAF 4WHDA 5IROC 1B9ZA 4WI4A 1LP9F 1EX0A 1JRHH 4JRXA 1G7IA 4EIGB 1GRWA 2A9NL 5JA8B 3WSQL 4DFIA 1CQYA 4PJIF 1JIBA 4P9ML 4HIEB 3HZKB 4JM2C 2A77L 3MLTA 1NBVH 2FEEI 2NW2B 3QFDB 4OLEA 4ODXB 3S4SA 3WS3B 4AMKH 4CU6A 2EKSA 3RAJL 3DVFA 4MA3B 5EOQL 3X3GL 4DFHA 1RV6X 5B38G 3VFMB 2VISB 1DJSA 5EORL 5CSZB 4FHBD 4J3WA 3FFCB 5FGCB 1I8IB 3SE9H 1OWRM 4KK9C 2NXZB 3GJEA 2ADIB 5EOCL 5FDYA 1EXUA 5C6WH 4JPIA 2E9JA 4IOSD 4XWGL 1U3HC 4UTAH 3LN5A 3PDOA 4UV4L 5ILTH 4OZGB 1MFCH 4OFIA 3QNZB 3ES6B 1I3RB 3OQ3B 5BRZB 1QRKA 2EE2A 4JHWH 4Y2OA 2Q86B 5C8JB 3OSKA 1J0KA 1MJ7H 2A6JB 5CD5D 1Y6MR 1QSEA 4BFEA 4C59B 2WBJD 5C9JB 1TITA 4OM1H 1YEFL 3QWOA 1CLCA 2IFFL 5C0BE 1KENL 4GAJL 5DA4A 4LP4A 4TVPH 1AGEB 1OLZA 2NTFA 4ONGH 1KPRA 1LO0L 1OAUL 4N0CD 4PPTA 4ZD3L 3ZDYF 3FJTA 3I6LD 1FFNB 4BZ2L 3UPRA 3OGOE 4Z7WF 1LK2B 3U0TA 4LMQI 1CGYA 5K9QG 2UZIH 2XA8H 1HQ4A 1XR9B 4ZTOH 3FB5B 2RQ8A 3NZHL 3GIVB 4JKPH 5IJVB 3T3PF 1U93A 3QHZH 4OKDA 2AJYH 2OTWB 2WINB 3JZ7A 4F33B 1ZHKA 3Q3GA 1Q1JL 4PLOB 5ISZA 4R2GD 2G60L 4WCYL 1KELH 4N8CH 2CIKA 1QPXA 4NWTH 3B9KA 2YD6A 3WNPA 4Q9QH 3HC3H 3JVGA 3KDMB 3L9RB 3O9WB 1HYSD 3CFDA 4UNUA 5CSBA 1F4YH 3EGSA 3O6LH 4Z7OE 1AIFA 1OAQH 2I60H 1FG2B 2I9TA 4HWBL 3GBLA 1M05A 2C3WA 1H3PL 2A0LC 4FQQB 3IVKA 5E8DH 4LDLB 1RUQH 1MFEH 3KGRA 5JPNB 4K9EL 3ZYZA 1PG7X 4WFHD 4LGRB 1VFOA 3VA2C 25C8H 3P2TA 3F7QA 5E2UL 4XGZB 3TCLA 2BVTA 4CVZB 2DDQL 1N4XL 4Y16A 1GXEA 2VABA 4EDXA 1KB5H 4R96A 2YWZA 1G9NL 2EYTB 2DQCL 1MFNA 4Y1AD 2HFFB 1EJOH 4L3ED 1UXSB 2WMPA 1JE6A 5BVPH 3K81A 1YQVL 3G6AA 2VSCA 3W2DH 1BQSA 5CILL 4JB9H 4G43A 5DURD 4H5SA 1DBAH 3QFJA 4PJ7A 3PGCB 5HGBA 1UWXH 3CVIL 5A2JH 2J8UE 1NH6A 2NY4D 4MAYA 5FA4B 1I9IL 3G9AB 2ICWJ 5EZOH 3KLSA 4G5ZH 3C6SB 4AIZB 5J6HA 3C2AH 3DUSA 1UADC 3BZFB 3B2VL 2DQEH 4NCC1 4WI5A 2DLTA 1BF8A 1RIUL 1NAML 2Y07L 4JN1L 5A2LH 1QRNE 1SJHA 32C2B 3IXTB 3G5XB 4LSPH 1IARB 2ARJA 4LHUD 2BVPA 3V4VL 3BPLC 3VFWB 1FORH 4OF7A 3X3FH 4FQXD 2V5YA 1F6LL 4HF5H 5JXED 5H94A 2W0KA 1CG9A 4NC1C 1ADQH 3CFBA 3VDBA 2Y9RT 3IFPA 1FH5L 5D2LA 2VAAA 4N0UB 3HRZA 4Z76B 2LAGB 1JPFA 3ARGC 4Y4HA 1R5WA 3IF1A 1W0WB 1J8HD 1NCDL 3LKPA 1BLNB 2D7MA 5GGRA 2Q1EA 2CGRL 4XP6L 4YR6B 3LV3B 1ZHNA 3H2WA 2P5EB 4HZLB 2F19H 1NGPH 2P4AB 3EOBB 3DXAD 43C9A 1WZLA 3GK8H 5SWQB 2CKBL 4OSUL 4JO1L 3RWDB 1UACH 4KK6D 2YA0A 3VWJB 2BOCB 2HMID 1D7FA 2Z8SA 5EIQA 1MHHA 1PDKA 4R26H 2PNDA 1V3LA 4F9PC 3F6IA 4LU5L 3ILPB 4P2RB 4LRIC 1D9KD 4XPBL 3SDXB 4NKQB 4QRRD 5ADOL 4O2FA 3QDHA 5DMIL 3CSYB 3O45B 4G7YH 3VFSA 5HDOA 2CLRB 4JFED 4DVBA 4E42A 5J89A 1X5AA 3BHBA 4ODVL 2X4PB 4NN6B 2VR9A 1EDQA 4NFBA 1A6VL 4GBXB 4PS4H 1GGBL 3C08L 1N7MH 3VGBA 3ZE2F 2JCCF 1T1WA 3HZVA 4KRLB 4UQ2B 3SDCD 5JNYB 5IFJA 5DR5H 4Q6YA 3I2CH 1U8OB 4PJCF 1MY7A 1H5BC 3HI1B 3MRKA 3S34H 5JHLH 3BPCB 2DL9A 1P1ZA 2CO7B 3FZUD 3SKNB 3V5HA 4P4RA 5D7SL 1Z5LB 3QDJE 4JQVC 5FM5M 5KSBE 6CGTA 2DWEB 5KSAA 2C5DC 4G8GD 3HZYB 2NX5A 1MI5D 1NMBL 3D39D 4KHXL 3R1GL 4XHJD 1ZVYA 4M61A 3RDTD 3LQZA 4X6EB 4UUJB 1PKQB 4TNWF 3D5OF 4PY7B 2HT2C 4NHUB 4KH2A 2IJ0C 4U6VH 3OJ2C 4Z0BH 4KUZH 4P57B 4Y5XB 5JTWA 1XGUA 5F1NB 2V9QA 5HDLA 1FFRA 3BD4A 2IPKB 4G9DA 3PP4L 3WFCH 3U48A 5J11B 2J6EH 4I0PB 4S11A 4ZFFB 5ICXB 3T0ED 2QQLH 3SKMA 3ARTA 1QFPA 1T5WA 4LVOC 3VGDA 1ZWIA 3P9MA 1E4JA 1HHJA 1KB5A 4LVHB 4CU8A 1ED3B 2Y6SC 2PTTB 2LU3A 4PJ8A 2R1YB 4MXQC 1BIIA 5LCVL 2CDFA 3AROA 2XPGB 4D9QE 1J0JA 1JVKA 4RQQA 1TNNA 3M07A 4QHLA 4OAWB 4W68A 4CDHA 4WUKL 1NCTA 3PWUB 3DURB 4U6HA 4JM4L 5SX4H 4GMTL 1DBMH 2BSSB 3P4MB 1S9XB 4P9HC 3G04A 1MAJA 4P46C 4Z9KB 3S37L 2VXQH 5DJ8A 3FAWA 5DK2A 1U8PA 4OCLC 5E2WH 3B9KB 5EBLA 4M5ZH 4GSDH 1JHTA 1X3DA 5E7FA 1FNSH 1FE8H 3B3IA 2AEQL 3PHQA 3OAYH 3KYKH 4RA0C 3SJVB 1B0WA 4AIOA 4PRAB 1G6RB 2AJZB 4EOWL 3EYFB 4UT6L 1NC2B 2VXSL 3MNWA 3M8OH 3U7WL 5DHVB 4NQEB 1G7LB 2J88L 4HT1H 4JFOB 1M6OB 2YC1B 2VLRE 3CDGB 3IVKB 1DQJB 2Z4QB 2DBLL 1EVTC 4MQ7A 3FAXA 1ADQA 4LVHC 3CFEB 3V4UH 1OAKH 2Y1VA 3K3QA 1C8PA 1K2DB 4J4PD 1OTTC 1DQTA 3MTRA 3O3DA 3U79A 2W65B 1Q9WB 5DSCA 3UO1L 1FLRH 5EU7E 4MXWH 2VDQL 4L4VA 4BH7A 4AENA 4OF8A 1Q8MA 3RKDD 3MRPB 5IF0A 1A7PH 1MUJB 3KG5A 5HD8C 3P0GB 1OGTB 5I1GL 1BEYL 3PWPE 3S36X 1H3GA 3IFNH 1KN4H 1HHKA 4XP5H 4FFZL 2ZUVA 3TJEL 1Z9OA 2E6QA 1PQZA 4J3SA 5CJBA 3T4AB 1KLFA 5JQ6L 3MYZA 5EUKA 2NY1C 4FOMA 1HKLL 2QEJA 4FZ8H 1QEWA 2OL3L 1I1YA 4KQ4H 4RAUA 4QNPE 1DN2A 1A9EA 2IC2A 1UM5L 5HDQL 4LSTH 2PW2B 4JZJB 3S3JA 4KRPD 4G7VH 3ARDD 1F5WA 4KFZC 5GRZA 4MZ3A 3RGVC 3L3KA 4L4TB 4QXUH 2VDPL 3MRQA 5D7IE 4PR5B 2X4OB 1K5NB 4MJ2A 2P8LA 1U91B 3ARFA 3MNVA 3H9SD 1JRHI 3QQ9D 1RIHH 4RRPA 2V7HB 5JOPE 3BJLA 1RI8A 5DEZA 4HKZA 1J05A 5J9PA 2VC2L 3OX8A 3AB0B 4XNQA 4EUPB 5MEND 4ORZC 5FYLE 1BX2B 2YUVA 4LLVB 5E6ZA 3MJ9H 4OUUA 1FL3A 2LABA 3PWNB 5T3ZD 2OQJA 3BN9C 4CBPA 1MCDA 5D8JH 4X6FB 2F74A 3WXWL 4PV8B 4HPYL 3AY4A 3BT2H 1DLHA 3QZWA 4WHTA 1SJEB 5E1HB 4CKVX 5I73C 1FZMB 4PLJC 3U4BH 2J6EA 3VXUE 1WF5A 3G08B 4XP9L 4Y7MA 4WWID 1S5HB 5DQ9B 2J2ZA 4OCWH 4ETQA 3QDMD 1A4KA 2GFBA 1P7QD 1PX3A 3ARVA 5GGUA 4HUUA 1X4XA 1K4CA 2AK4B 1VPOH 5DJAA 3ZDXF 4I18C 1UH4A 1ITCA 2W91A 3C8KB 4JRYE 1YNTB 1S7XB 1QLFA 5D7LA 5JW5B 4NC0B 4KTDL 3QEUB 5KSAB 1IC4L 3UYRL 1CGXA 3LRGA 1EK3A 3S88H 1AHWA 2QADD 1CFQA 1LO2L 2FX8L 2C1PA 5IBTH 3KPQA 3FO1A 4EI5B 3BKYL 2GITA 4MA7L 3FQNB 3TBSA 3NVQA 1EIBA 3VGAB 1OHQA 5IP4A 2ZKHL 2ESVD 4I4WA 1MFDL 3FO2A 2ZCKH 4X5XB 4GRWB 2E7MA 4LARH 1A7QH 2R23A 4KROB 3VXME 3MOBH 3GHEL 4WI3A 1CDBA 1RY7B 1ZAGA 2A1WH 5J1TC 4NQSA 4YNYB 5HGGS 5E6IB 3S6CA 2R15A 1MHPL 3MJ8B 1G6VK 4YXLL 2JB5H 3DVGB 3KS0J 1WFNA 4IJ3C 3SY0B 4BSWA 5H37H 3FO0H 2L7UA 5J06A 2FIKA 1AO7B 3C5ZD 4QHMB 5MP6L 5DJYA 1K6QL 3DX8B 5ICYB 3DPBA 1HI6A 4XBGA 4Y4FB 1BP3B 3QUXC 5ACMA 4FQJL 4TQEL 3P9LA 1GIGH 5CCKL 2JJVA 3QXAB 3UTQA 4RMUA 1UVQA 3O2DL 2IANB 3MYJA 4JR9L 1IGJB 1EH9A 1UB5A 2ADFH 4EI5C 4ZAKB 2UUDH 3CVHA 3LZFH 1N8ZA 1EHLH 3OKDB 4UDUA 4U1NB 3DVIA 4PGEB 5DMYA 1CFSA 1U8HB 3IKCB 3EFFA 1FO0L 2PETA 4OZFA 5IB4B 1LO5A 4F7TA 1IGYA 4N1EA 4ONHB 3BKJL 1QFWH 4PJFB 4NRXB 2EKJA 5LKNA 1L7IL 4X6CA 1E6JH 1YA5A 1YEHH 1N59B 3PNWB 1J7VR 3MNWB 3FQRA 4PRDA 3KLHD 3FFCE 4S1QH 3U9PL 3D6GA 5CWSB 2HWZL 1KCSL 5E94A 4KVNH 3GO1L 5TE7L 3QNXB 1VKXA 1E4KA 1H15B 1OF2B 2HH0L 4OZGE 3RVVC 1XF3B 1X6NA 4W81A 1PFCA 5DSCB 2Y72A 2XZZA 1MREH 3RWHA 1XIWB 3LPFA 2D4DA 3OJMB 4TTGA 3TGXA 2BVYA 3DYMA 4P2OB 2D7TL 1UH2A 1JFQH 5HY9A 3QP3A 4NJ9H 3HG1A 1U9KA 4O02H 2HTKD 1FG9C 3MJ9A 3TVMC 1QHOA 1EBAA 1NCWH 4M6NL 5FUCC 1KCLA 3RY6A 4C56D 3ZKNC 2WP3O 3QRGL 5SWSA 2NCMA 5GISH 4XCFL 2P8MA 1BD2B 4L8CB 2R9HC 4NZJA 1ZA3A 4DN4L 2N7AA 3J8F7 1LWRA 1UZ6E 4LPUA 1PEWA 3CMOL 1UEMA 3BDXA 4GRLA 4BM7A 3K0WA 3NPZB 1I3GH 5BOPA 5IVNA 1JPSL 3QXVA 3D2UA 4Y2DA 3OHXA 5GS1B 2DF3A 3SDAB 5GGQH 3WHE1 4OT1L 3F7RA 4U7MA 5C0AB 2C1OA 5EC2A 4F8TA 1U8MB 5F9JB 2VQUA 3OG6B 3DWTA 2DJSA 3V6OA 4PGCA 4AM0B 2EH8H 1GH7A 4EBQH 5EO9B 5IT2H 5H8DA 5CSGA 2XTJB 3FT4B 4M00A 4G6KL 1T20B 3QCTL 4GUPB 2P47B 1Q9OB 2BNRE 2GK0B 5DQDL 3QXTA 4EN3B 4YAQA 1DUZA 4GT7A 4YHLH 5LWYH 3V6ZB 3NCJH 1N64L 4FXGA 3CZJA 1J1XL 4NC1E 2F74B 4PREB 5INDB 1HIML 4R6UA 5FGRA 3ZDZE 4S2SB 4LSRH 3BKMH 1JHKH 1I1FB 4RWYL 5F89A 3ZT6A 4MMZC 4OCRL 5E9DA 1A6WH 1AQKL 4OZIA 5GS1C 3OKMA 1FVDA 4HXBL 3SDAC 3AS0A 4XNXH 5E99L 1HHIA 1C5DA 1MAMH 4XNMB 3FB7A 4G9FB 3TN0C 1LDPH 1TNMA 1BFSA 5IQ7L 5GGVL 1G9MH 4KWUA 1RU9L 5E5RB 4JEGB 1D5ZB 4MD0A 3LVEA 4MJ6B 2V5RA 3O6FA 3FQTA 1IGFH 1QLFB 4NBYB 2WQRA 2VLMD 1ETZB 1DQLL 3MV9B 3WUZA 4JFXA 3NA4A 3QIUD 3WFHA 5HYFA 4ELKB 4NNYA 1H9VA 2ZOLA 4J3XA 1ZE3C 1MOEA 1BVLA 3PV6A 4H1LB 5J12B 1SYVB 2NNAA 2CIIB 2OTUB 5CGTA 1QACA 2YPKB 5SX4I 3PGFL 5CJOL 1R3JB 3UJTH 1A6TA 1RZFL 2R2CA 2PR4H 1FNEA 1XH3B 1HZHL 1MRCH 1CDYA 2ZUTA 3BP6B 3WIIL 2DQIH 4FABL 1MRDL 4U2ZA 2OM5A 3PWJA 4E5XA 4IDLA 1DP0A 3WJLA 1B90A 1L0YA 4V1DA 5EZIL 2WZPD 2VKXA 4G8EB 4OF3A 3ROOB 2P5EE 5CZXD 5FUZL 1MCOH 5T3ZL 1A1MB 4MJIB 2Z91A 5J6GB 4PRHB 5KSBF 1T89A 5LXGH 5IIEB 3DYOA 3P0VL 2IEPA 3FQUA 1WFUA 4N0FA 1T7WA 1IBGL 1VFAA 2A9NH 3WSQH 2VZSA 1HNGA 1LEGA 3QUZD 4XBGB 4P9MH 4L3CB 3RPIA 2VDNL 2AQ3A 3CFJA 2X4SB 2A77H 4P2QB 3UTQB 3ZSTA 5I1EL 5J12C 1UB5B 3RAJH 5EOQH 2V5MA 2N1KA 3X3GH 1KTRL 3WS6C 1R3KA 3BGFC 1SEQL 3CVHB 3LD8B 8FABB 1DVFB 5EORH 3RWIA 4PV9B 3HFML 5EOCH 1EEQA 2E9IA 1SYSA 3OR6B 4KDVA 5HPMB 1HXMA 4F7TB 2DLIA 2P5WA 5KOVC 3QNYB 1S7TB 3E2HC 4XWGH 4UV4H 1I8LC 4I3RH 4DAGL 3LQAC 1FZOA 3MBEA 1RK1B 2UY7A 5F3BB 3DGGA 1MCHA 2BMKA 5JOFB 3MJ7B 4HKXB 1HH6B 3KJ4C 3O4LA 5E4EB 4YEFA 4H88L 1KTDB 1YEFH 1QNZL 4NYLA 5DUBB 5B8CC 1IJ9A 3BZEA 2YD5A 2IFFH 1KENH 4GAJH 3BUTA 1PSKL 3N06B 2XTLA 5GS3A 4I77L 5FYKD 1PKQE 5MEPA 3DHJA 3WKML 1LO0H 2AJSL 1OAUH 4ZD3H 4BZ2H 2B39A 2H8PB 3LD8C 1KJ2L 4PGBB 1CICD 5DHYA 2O5ZL 3MXWL 1F13A 3L6FA 4M6AA 5FF6A 5T1KB 2JJTC 5IV2B 4YEEA 3NZHH 4J3TA 1X5LA 5D5MA 5I71B 4K7PL 4GQ9L 3SE3A 4WI2A 3VWKD 3ARBB 5FGBC 4NO0B 1Q1JH 4KTYA 1W8OA 1T5XB 3KPNB 2EDTA 2YKLH 4WCYH 1T3FA 4LLYA 4KK5C 4U1KB 4LCUA 4GW1A 4LPTA 5ITFB 2GI7A 5AZEH 1TPXB 5DRWB 5HHOA 1ERNA 4HWBH 5F93C 3D2UB 3NAAL 3GSUB 1CTOA 1H3PH 2GUOA 1MJJA 1ZLWK 1NMCB 4XP4H 4K9EH 2ZUSA 3KHOA 1MCNA 4ZNCD 2X1OA 5I66B 3UTSD 4BZYA 3SCMB 4NM4L 3SJVE 3RTQD 3NIGE 3TBYA 5KW9L 1HNFA 5JHDE 5E2UH 3NFPA 3PABA 2IF7A 5LGJB 1N4XH 3TZVA 4MJ5A 1OAZL 2ARWA 3T3ME 5EFIA 1G9NH 4MCYB 1N2RA 3FL7A 2LTQB 5CLTA 3G6JE 4U1HB 1YQVH 5CILH 1JNNL 3VE0B 3AM8C 2VLRD 3RZCA 4KMQA 3GIZL 3CVIH 5CEYA 2D31B 3MX0A 5B39B 5CP3H 1I9IH 3IDJA 3IAGC 1QP1A 2DQDL 4KQ3L 4N90E 2FZ3A 3B2VH 4Y0GA 1AXTL 4IOIB 1OTSC 1SVZA 1IGTA 4KMTL 1RIUH 1NAMH 1FAKT 2Y07H 4JN1H 3I3BA 4KI1A 1A6AB 4JDTL 3MV8E 3SDDA 5E00B 1L4IA 4KJYB 3V4VH 1BWWA 2NXYD 2RHEA 4MNGA 4DUVA 2G5BA 4F7PA 1JNLL 4NPYB 5JDJA 3W11D 3PXHA 4APQC 1D5MA 2ERJB 3L95A 3QA3A 3MLWL 1FH5H 5J13B 4NM8H 3S5LA 1WWAX 1MLCB 3LB6C 3ULUC 4TUKL 3NIDE 3QEGL 1TVHB 4NNYB 1NCDH 2ZOLB 4M43L 5ID0A 3KXFD 1IL1A 2W9DL 2CGRH 2EDEA 3ELAT 3OPZH 3IFOA 4XP6H 3CLFL 4NQUA 3VMNA 1YMHB 4U3XA 1ZLSL 4JFQB 2BHUA 2CKBH 3WLWC 1W72B 1KIUA 4JO1H 4LVNC 4PP1C 1JTPA 4IRSB 1ZT4B 1I7RB 2EEAA 2BRRL 1F8TL 4Z78B 3PV7A 4PB0L 2H2SD 1WZ1L 3C9NA 1UCBL 1A2YB 4UT7L 1RJLA 2V2WA 1YYLL 4LU5H 5D2NA 1QFWI 1G1CA 5T5NF 1R5IA 5JOPD 4XPBH 2UZYB 4Y4KA 4D2NA 5ADOH 3WIHL 5DMIH 4JQIL 2H3NA 3JV4A 3FT2B 3TV3L 4OZ4B 4CADB 3EYQD 4ZG1A 1UM4L 5J13C 1FZKA 4LSVH 2APWA 4ODVH 2AJUL 5FYLD 3PQYB 1K85A 1KEGL 2OI9C 4JPKL 1ZLVK 2APTA 1A6VH 2VNCA 2NY6D 1GGBH 1X5KA 4U6YA 4H26A 4Q2ZB 4X99A 3VFUB 3WD5H 3IDNB 5C08B 2HKFL 4S0SD 2VDML 1C16B 4XX1G 4JM2F 2DM4A 4ZUSB 3A6CL 1Z3GL 5D7SH 4WO4D 2PXYA 3K4ZA 2ICEA 4H8WL 4LCCB 1J88A 2VERN 2C3HA 3MGOA 1N5AB 3TF7C 5IM7B 1KGCE 2VLJB 5CEZE 3EJZC 3O3EA 1NMBH 4NN5C 3FQWB 1E27A 3R1GH 1JV5B 2AK4E 1FZOB 5GRVL 3RWJA 4AL8L 5DK3A 1QQDB 1FSKB 5FM8A 3GMRA 3EUUA 5E8PA 1QR1B 1XGPA 4HWBA 4R0LC 5KS9B 4WFFE 2IADB 3PP4H 4P5TA 3KHQA 1G7MA 4MHHI 1YMMB 4XXDB 2VN7A 5TDNA 5C0NC 1WVZA 1ND0A 2GJ6D 1VGEL 2AJXL 1HSAA 5LCVH 2YSSB 1U3YA 4FFWD 3VFRB 3M45A 3FFDA 3OF6D 4O5LL 1RULL 4PJ9C 4U4BA 3EO0A 3UMTA 2VE6A 3MRHA 3RUGA 5JDSB 4WUKH 3PL6D 4PTTA 12E8L 2RBLA 3S35L 3QR2A 4JM4H 1MVUA 4JDZB 3IGAA 4GMTH 1FNAA 3MV7A 1CWVA 3HAEG 5HHXL 4MD5B 3KNBB 5CP3A 4KUCD 3NMEA 1MH5B 3JWDC 2A6IA 3S37H 2GKIA 2J4WL 1CLZH 2CLVB 1KT2B 2FH6A 4WRLA 1OP5K 5BQ7B 5ID1A 1JL8A 4OZGF 3UX9B 5L9DL 3FQXB 2PW1B 2AEQH 2IANE 5GSVB 3ZZ1A 2QKIB 3LRSB 4EOWH 2Z31C 4UT6H 3GMQB 2VXSH 3PDGA 1AKJB 2L4OA 3U7WH 5IMMB 4CW1B 2J88H 3CPLA 3MMEB 5D1XC 4CN6A 4FQ1L 2LVEA 3W0WB 4A2LA 4XTRD 5DMGD 5EU6A 2DBLH 4LNRB 2B2XL 3U2SA 5I16B 4ODUB 3F8UB 4URTB 3U36A 3W5MA 4G42A 2CRZA 4PJFE 5FUCE 5E8OA 3SGDH 1NUGA 3UO1H 3VRJA 4MJ5B 3G5YB 4P5MA 1GGTA 2RAMA 1GPOL 3EHBC 3AREA 3F7PC 5D4QA 3AUVA 3VGFA 3KPSB 5FYKL 3FFCD 1UZ6F 5I1GH 3T65B 4NQCA 1BEYH 4M7LT 3RZCB 1WZMA 2CKBA 2NXZD 3REWA 5ERWA 1FNHA 4RDQG 4P49A 4Q6IB 1G7QB 4N8VG 5T3XD 1JPGA 4OCMC 5DYOA 2FJFB 4FFZH 4OKVA 5IMOA 3TJEH 3V7AE 3V5DA 2ATKA 3HE6B 1AGFB 5HPOA 4S10A 2P44B 5JQ6H 4AT6B 4X6DB 1T0NB 4OF5A 4XMKL 3DETC 4Z7QE 5BRZD 1HKLH 4HAGA 4WWKB 2OL3H 1KCUL 1WLHA 2GAZB 3L3DB 1DBBL 1S7RB 1UM5H 1K8DB 5ELIA 2CK2A 2HVKB 3ZTJH 5DJ6A 1S7VB 5C9KA 4RGNC 2AGJL 2FR4B 2X4TB 1HXYB 5C7XL 5C1MB 1OQOA 4JVWA 4N8PA 3QO0B 2VDPH 3W82A 3FT3B 3Q48A 1BD2E 3UAJC 3TO4B 2AJ3A 4E41B 5IVXB 2DRUA 1WICA 2P46B 2FL5A 4EKXA 1OSPL 1FPTH 5HYJB 4MQXD 3QCVL 3MCKB 4RX4A 3ZDZF 2E9WA 1U8LB 3C87A 2C3XA 1Y6NR 35C8L 3DO7A 2DS4A 3HKFA 3PGDA 4LLQA 5IEKB 2VC2H 3FB6A 5D72H 3WIFA 4OQ1A 5FXCH 3TBTA 5SV4A 3L3HA 5INCA 1U42A 2VZVA 4PP2B 5ETUA 5IVZA 4XMLL 3L7FB 3LQMA 1QVOA 5C0AE 3BZ4B 4WWKC 4S1DD 1CLYL 2LVCA 2OZ4L 5MEOA 1FFPB 4K2UL 3O9WD 1F3DH 4LPVA 4X8JB 5A2IH 3WXWH 4HPYH 4U7KA 2WK2A 2XTJE 4YDJA 4B7IA 5IBLD 5EO0B 5IHUL 4W6YB 1VEOA 2PYEA 3MBXL 5C0CA 3HLAB 2H9GA 4XP9H 3O3BA 4NCDA 5DRXB 3VFOB 1JWSA 3SKOA 2NY3C 1BBJA 2E3VA 1P5UA 3GMNA 4M7ZB 2F5AL 3QHTC 2D7QA 4WU5B 1G7PB 2OJEA 4FQCL 5JUEL 1GGYA 3GGWB 2CPCA 2XYCA 4J23A 2AXGA 4X6BA 3BDYL 5E2VL 1YN7A 1XGRB 4CVXB 5HGHB 5B38B 1EO8L 3TT1L 4KTDH 3T0WA 3U83A 4PJHA 2G2RB 4POZC 5IQ9A 3JV0A 3UYRH 3C8HA 1BOGA 2H32H 3OJVC 4IRJA 4G6FB 1H8OA 1LO2H 2FX8H 4I0KA 5HHQA 2A74A 1VADA 3VXTB 3DSNA 3OKNA 4MA7H 4XC1L 1P9MC 3IJSA 3UBXG 2Q3AA 2GJZA 2ZKHH 4JJHA 1MFDH 1AFVL 3CXDL 5I1KL 2ZOKB 4NN7B 2C7UA 5T1MB 3GHEH 1PAMA 4AQ1B 1UJ3C 4ZYKA 2FJHA 5EZLA 2HLAA 4WW1B 5T5NG 4RZCB 4WIQA 5TDOA 1MHPH 1G7MB 1OL0A 2IALA 3B8SA 4JO2L 2X7LB 4K3DL 4BSVA 4QXTB 4O2EB 2ITDA 2JK5A 4R3SA 5MP6H 1K6QH 1UXWA 5D1QB 3VFTB 2I9LA 5C70A 4FQJH 4L29A 4TQEH 3HS0A 3GSWA 3ULUL 5CCKH 3U0WH 3L1OL 4BELD 3WJJC 4R4ND 1FV1B 5FYLL 3TT3L 4JR9H 4PRHE 4K94L 3FRPG 3DX9A 5CBEA 1CFNA 5EDXA 5LVEA 1AR2A 1CFTB 7CGTA 2DMCA 3OKOA 4LDOB 5FUOL 2RCSH 5DQJA 1FO0H 3VWJD 2VLKA 1CD8A 3FHAA 1F3RB 3Q6FB 5KTEL 5TH2B 1PY4A 1XCTB 2OL3A 1A0QL 1KPUA 3ILQC 3BKJH 4AJ0A 4PJGA 1DEEB 1L7IH 2AKRA 4P2RD 3ROLA 4QGYA 2Y4SA 3HTLX 2FNBA 1AJ7H 4N1CA 2JE8A 4HS6A 2QSTA 3OB8A 1AE6L 2HWZH 2IAMB 2LQRA 1KCSH 4FQLL 3BI9X 3AS3A 3GO1H 3PWLA 4NZUL 5TE7H 3KYMB 3KPOA 2ZNXA 1CE1L 3MGAA 2HTLC 5C0GA 2HH0H 1CDIA 1HHGB 4JN2B 3QEHA 4GBXD 3HC0B 4ZS6D 5HGDB 3T1FA 5FO8A 4JLRA 1AD9A 1II4E 1TQCC 1U0QA 1OB1A 1WV7T 2D7TH 1ZLUK 2JJSC 2GT9B 3VG0L 2I25N 4HFWB 1CXEA 3BWUC 2E7BA 2VDOL 3D3VA 4TSCL 3TFKD 4JDVA 3QUYC 3MUGB 1QA9B 4Y1AA 3W39A 1G7JB 4OKVB 4YDKL 4M6NH 5ENWB 1JYVA 3QPQD 4TTDC 1FYTB 2QJDA 3QRGH 5BZWB 3AFLA 3BEWB 4U1LB 1X5HA 3IDUA 4XCFH 1VACB 1AC0A 1XF5A 1WJ3A 3JTSA 3LH2L 3B5TA 4DN4H 5DC9B 3X12B 3RVUD 1KTKE 4YK4B 3VFGL 3CMOH 5FA3A 3T3MF 5M95B 2EC9U 2BVOB 3EOTL 3JVGC 4GKZA 5DRZB 3G6JF 2W60B 1Q9KB 1S7QA 4YZFE 4I0PD 1JPSH 4IIQB 5ABDE 5FO9A 1H0DA 4OLWL 4L5FL 3PJSA 5DTFA 4DGYL 3JUZA 1HDMB 4LHUA 2Q6WA 1NCCH 4TN9A 5L2JA 1MFAH 4OT1H 3EO1A 5JXEA 2MMXA 3K74B 1RD6A 4QWWD 1NCUA 2H32A 2FSEA 3WIFB 5MERA 4Y16C 4HUMB 4CU7A 3EOAA 3QCTH 2QBWA 3T8XA 3FO9B 2HLFD 5DQDH 2K7PA 1J8HA 1S8DA 2HG5B 5K33A 3EZJB 4HJGB 4TSAL 1I8MB 2NY5L 5EUOE 4HEME 3B9KD 3QH3A 2XQYG 4B50A 1T66D 4LF3A 1N64H 2HFEA 1QBAA 4HUWA 5DFVC 4LLWB 43CAA 5DVLA 4DZ8B 5C2BH 3DXAA 4OQTL 1J1XH 4ODWB 4YK4C 3QDGB 3SJVD 3SDYL 1HIMH 3UYPA 4JGMA 4F7CA 4M4RA 1RHFA 1NC2D 1NEZA 2N7BA 5T3XL 3OAUL 4NQED 3B2UC 3SPVA 4OCRH 3NIDF 4HDIB 4F57L 4Y88A 1AQKH 1HKFA 1I1AB 5CZKA 4N9GA 4HXBH 3HR6A 4G80B 5E99H 1MCIA 1D9KA 4PY8J 3MGTB 3GMNB 4PUBL 4QRSB 5ALBL 3F12A 4RGMB 4QRRA 5KVDL 3GSVB 4D0DA 5CZVL 1JN6B 5IQ7H 5GGVH 1RU9H 1S3KL 4OCXL 2QR0B 3GJFH 1NGYB 1G0XA 1NGXA 4M93B 4O9HL 1NGWA 4ZXBB 4ODHL 1DQLH 3PE9A 3O8XB 5GS0D 4EDWL 1WBZA 2EXWD 2E8YA 5DVMA 3QQ3A 4IHOB 4ZUVA 3QFJD 4Y4HC 5DK0B 3SDCA 2VITB 1FO0A 3IXAA 1J0YA 5KVEL 4UMGA 3DV6B 4HHAB 4MAYD 3B6SB 5IR1A 5CJOH 1K8IA 1RZFH 2A9ML 4QRPB 2NY0B 2J8HA 4O51B 4QLRA 5FCUH 1HZHH 4HS8H 3WIIH 4FABH 4ZQKA 1MI5A 1MRDH 4Z5RA 3THML 3D39A 2ZUQB 3BW9B 4ZYKB 4WY7L 1EA9C 3RDTA 3RWEB 3O2WL 5E6YA 5EZIH 3M1BB 4RGMC 2R2BB 1M1SA 5T3ZH 3TA3B 4L4TD 5KJRL 3VCLA 4PJXB 3P0VH 2BC4B 1D5XB 4PJAB 1LP9B 1IBGH 2FWOB 4Q7DA 2R2HA 4ZXBC 4UBDD 5HYSA 4NGHL 2VDNH 2W92A 3R06B 4PJIB 3SGDI 1A7BA 3FRUA 3IDYB 2EZ0D 3JV6B 1A6PA 3RBGA 5I1EH 5F6IB 2KPNA 1SEQH 4PYGA 4PLNC 3PQYE 2AV1A 3MV11 4J3UA 3UTPE 3HFMH 4CMMA 1B2WL 1RURL 2AEWA 2QL1A 1X44A 1YEKL 4D3CL 3QUKB 2EIEA 1OP9A 3CXHK 5C08E 1R5VA 4JY6A 5DMKB 4DAGH 2B4CL 3Q6GL 1UA6L 1KCKA 1LO3L 3VFPB 2AXFA 4YHNA 1M71A 3LEXB 4I2XA 4H88H 1QNZH 2HP4A 2IH1B 3OJDA 1HQRA 2BNQA 5FDWB 1PSKH 3FCTB 2BSTA 1GC1L 3O6ML 4PRPB 3SO3B 1IGCL 1WWWX 2P7TB 4I77H 5CEZD 4MX7B 4D0CA 5C0JA 3IDYC 3TNNB 3A6BL 5E5MA 3WKMH 3H3BC 4NQVA 2AK4D 3VD4A 2O5XL 1KJMA 2AEPL 5KS9E 3BWAB 4J4PA 1KJ2H 5FKPA 4Z7WB 5L6YL 3MXWH 5KSAD 2WWKT 3E6FA 4PJ8C 3VFVA 1EEYB 1XGTA 5GJTL 4J12A 1S9VA 4WFFD 5CMAB 2ED8A 2NX5D 4J2XA 1BJ1J 4JQXA 4MDJB 1BQHA 1CE6B 3GUTA 4W6WB 2JIXA 3RIAF 3MR9A 3QIBB 3BXNA 1CQKA 4JFYA 3L3GA 4A6YB 5GXBB 2CH8A 5T1LB 3X17A 3HMWL 5B3JE 3MACL 2IQ9L 1T2QL 5CIPB 4ESKA 4GQPH 1QSFA 4KROD 3B4NA 1FYHB 2EYSA 3FOMB 1INEH 5F1KC 2V7NA 3AXLA 5GHWL 1MWAL 1OM3L 3V2AR 5E6ID 1X5ZA 4MAUL 5I19L 2IPTL 5EA0L 4X4XA 1TETH 5FK9A 5DUPL 1U8QB 1FQ9C 3TCXA 1ORSA 3NAAH 2BX5A 4ONFL 2EIZA 1AO7D 1KJVA 1JGDA 2R56L 2EDFA 4UOW1 3HE7B 2UVFA 3GJFA 1WC7B 3P73B 3LKRB 1T7XA 2DB8A 4Y4FD 4YBQC 1QD0A 3UTZA 2X1XR 3QIWA 1OAZH 5BZDB 2X41A 4YGAB 3OR7A 2IAND 4AYFA 1Z6JT 4C83A 3W0WE 3AMKA 3H9SA 4ZAKD 5C07B 4I13B 4LLMA 5F3HA 4IBLT 4TUJA 1NBYB 4RGNE 4J1UB 3OZ9L 4R4BA 4U49A 3CFKB 3GIZH 4HX1A 3MFGB 1T1YB 4TNWK 3KPRB 3V6FA 5MENA 3QBTB 3SE8L 3U0PA 2DQDH 5AUMB 2N56A 4KQ3H 3U4EA 4ZSOB 1AXTH 4KMTH 4DTGL 2MQ0A 4L9LB 3G5ZA 5I1DB 4JDTH 1DUYA 1T83A 1U8JB 4NKOA 2HN7B 2Q8BL 4WUUB 4LLUA 1O7SA 2F8VA 2I07A 5CBAB 4Y5VB 4JHBA 4JANB 4X6DE 4U1IB 2FO4A 3ULSA 3DHMA 1ZHLA 5GZOD 1JJUA 1XIWD 3BFOA 3C09B 3MLWH 1NGXB 3QDMA 3UDWA 1YNLL 5FYJE 5D1ZA 5BW7C 2DLEA 3OKEA 2YD7A 4P2OD 5DMJB 1P7QA 3ARFC 1ZT7A 3QEGH 2ED9A 2WWMC 4JFFA 4OBSA 3GMMB 4M43H 3C60B 2W9DH 3D18B 1TZIB 3CLFH 4MZ2A 4OGAC 1IVLA 3DRQA 1ZLSH 2Q87A 2YPVL 5A16B 3SO5A 5BVJA 1OP3H 4GRMA 1VSCA 4NZDA 1IAKB 4YDLB 4LCYB 4NO2A 5HYJE 2E5EA 2BRRH 3BH8B 1F8TH 3O4OC 5AWNL 1LVEA 4QHUB 4PB0H 1WWBX 4GG6B 1WZ1H 5DZOA 1UCBH 4UT7H 3ZKSD 1YYLH 1FGVL 3IDIB 5AG9A 2BSED 1XF2B 5HSFA 5EOTA 1CI5A 5C0EA 2D3VA 4P4KB 4Y5VC 3U7AA 3WIHH 5JPMB 2QSCH 4JQIH 2ZSWA 1G7HA 4XAKE 5TDPB 3N85L 1G6RL 5E03A 5E2TL 3TV3H 2QHRL 2M26A 1UM4H 4QTHA 4J6RH 2AJUH 2R2HB 5C0AD 1KEGH 3TO2A 5I74C 1KJ2A 3MRGA 2AABL 5D93B 1X5IA 1SBBA 2HKFH 2JCCB 3C5ZA 4M7KL 1OTUD 4ZODA 5SWZB 3RVWD 4BJLA 3BQUA 4QRQA 2VDMH 4JZOB 2XTJD 3LOWA 3A6CH 3RVTC 3STZB 4PJCB 4Z7UE 4BK4A 1Z3GH 3I50L 4Z77B 2B1HL 5DVKA 3HUJE 4EN3D 1WIUA 3QEQB 3WUWA 4H8WH 4CMMB 4OV5B 1BZ7B 1MVFA 1F3JA 4UIKL 3T2PA 2HT4D 3D1MC 2Z8VC 1FC1A 2VR5A 5GS0L 5JW4R 1DSFL 3H9HB 2DQTL 2DAVA 3C6LA 5EU5B 9CGTA 3WN5A 3TJHC 4LKCB 2C3VA 4KJQD 5DD0L 1OSZA 3IS1X 4XRCB 2PKDA 1JNJA 2FYYB 2YUXA 3JXAA 4NFDA 4WHYH 3MRJA 2H6PA 2MHAA 5I1AA 4NBZB 3VU2A 2BNQB 2DWDB 4DW2L 4G9FD 5DD6A 3MFFA 5C0DA 1KLGB 1U92B 5DD1L 8CGTA 3DARA 4XBEL 1QBMH 3O11B 1H8SA 1U95B 2FATL 3PWVA 4NQVB 5D93C 3NFNB 3WO3B 3CUPB 1EAJA 1ZVSA 4RFEB 1VGEH 3MV9D 2AJXH 1A3RL 3O3AA 2RGSA 4OD2A 4HK0B 1RULH 4NOFA 4MXVE 1HILA 12E8H 1VGKB 3ARWA 1VFBB 2DI7A 2A6DA 5I6XC 3GSNA 4P3WA 1EUUA 2Z35B 5HHXH 3T1WA 5EZJB 1QSEE 3MCG1 2J4WH 4XVUD 4GS7B 1QSFB 4HLJA 4WTXA 1I7UA 1TMCB 5ILTL 1WAAA 4C56A 5L9DH 2ZG3A 5F7FA 5C0IB 2IBZX 1AP2B 4PRBB 1ONQA 4I48B 4HIXL 5K9KA 1CVRA 3QI9B 4MJID 4FQ1H 4ZO7A 1Y18B 3BJ91 2B2XH 2G75B 2C4FU 4MWFA 2VIRA 3S96A 1JTTA 5AD0B 3CCHA 5GZND 3MRRB 1N0LA 3BP4A 4JKLA 1P6FA 5ANMA 3M17B 4P2QD 1E4KC 5C92A 4TUOA 5ISZE 3KYNB 1IKFL 3NZ8B 4X4YA 2CRMA 4IMKA 1DVFD 5DJZA 1JWUA 4PTUB 5CEZL 1BWMA 2XA8L 4PJDB 5FYKH 2B7DT 2J12B 2V17L 4ORGB 1JGLL 4PGDA 2EDJA 5IMLB 3CSGA 3RWGB 3ZKMC 3B9VA 2BCKA 5DO2C 4LSQL 4OZHE 4LFHG 1HK6A 2ICWB 2GSIB 4MD4B 4IMLB 3U82B 5FAAA 1KELL 1NPUA 1P4LB 3P30L 2IGFL 1YDPB 4XMKH 1S9WA 3SQOL 3IDGA 1KCUH 3BRFA 3N1QC 1KXTB 4EVNA 5CLWA 1DBBH 1AI1L 4KK8D 3BRDA 2XNAA 2NR6D 3S98A 3WMSA 4QHNB 5E56A 5C7XH 1FYTE 1NQBA 4BH8A 3LHPL 4GRLC 4AK1A 1ZHLB 4MDIA 1U58B 4JJ5B 3P4LA 3VD5A 5EUOF 3BSZH 4XBPB 5L2KB 5I1LA 4MNQB 3QQ4A 4PJ7E 4Y2DC 5D1ZB 2AVGA 4KZEL 1NFIB 1OSPH 1RZKL 4JREB 3DECA 3QCVH 3V7AG 3OXRA 2J8UA 2ZSVA 5T1KD 3HPLA 5EN2A 1LNUA 35C8H 1EJOL 2W0FB 3V6OC 5SWSD 3ARBD 4QHKI 4NO0D 3ZSSA 5C0RL 2AI0L 2VDRL 4HV8B 2F53B 5E8EB 1QRNA 4K8RD 4YBLC 4XMLH 3X11B 1ODAA 2P42B 1T1XA 4P59L 1Z9SA 4FRWA 1CLYH 2OZ4H 5TQ0L 1KIPB 4K2UH 1X5GA 4QRTB 1IAOB 2GCYB 2X4RA 1E4WL 3NFSL 1XGQB 4HJJL 5IFHL 1A6ZB 5IHUH 3MBXH 4X7TA 3ZO0A 1INQA 3T77B 2DQFB 2YD3A 3D2UD 4U2YA 4WI8A 2PCPA 3ZE1E 4JG1L 1QPPA 3VD3A 3EYSL 5ESVA 3EBAA 2XQBL 4IS6A 1GSMA 2OSLA 3P4OA 3SCMD 3QDGE 1EHAA 2F5AH 1L6XA 4LCWB 4XZUB 4M4PA 1H3TA 4FQCH 2VXUL 1ADQL 3A0OA 2BVUA 5JUEH 4YHYB 1LD9A 3BQUB 5DI8A 3RWCB 4S1SL 3BDYH 5E2VH 3RBSA 4OB5L 3ZHLA 3GMPA 1EO8H 3TT1H 1IE5A 3K4DA 4M8VA 3CIQA 1XF4A 3O6FC 3OAZK 3QRFM 2OK0L 4GFTB 4DCQA 4JAMB 2P24A 4GKNB 3V5KA 4LHQB 2XXMB 3F5WB 5A3IC 4XC1H 3DLQR 2JELL 5F7EL 4Z7VF 4TVPE 4K7PX 1IAIM 4YLQT 5FHBH 1AFVH 4NKMA 3U30C 3CXDH 5E9DD 5I1KH 5IMKA 4JZNA 1I8KA 1C08A 4Y8AA 1QLRA 1OARL 3WEXA 4HKJB 1YPZB 4PJEB 1GOFA 3GMLB 3WJLC 5I0DA 3WL9A 5CHNB 4HLZG 1RJZA 2VO5A 1F97A 1IKNC 1KPVA 4JO2H 4K3DH 4HIHB 3VD9A 1AQDA 3QDJA 5DJDB 3VH8A 3FB8B 3MRDB 1ZK9A 4BFBD 1T89C 4LOUC 5J1AB 2IBZY 5EH1A 3DMMA 4KXZH 3KYOB 1V3MA 4UAOB 3WCYA 4EQ2A 5JW4M 3L1OH 2XZAL 3BMWA 1IC5L 3VXOA 2ATPA 5FYLH 3TT3H 3EYVA 4K94H 1E28A 5IB3A 4K3HA 3AU1B 3IU3A 1CICA 4JFHD 4QEGA 1JWMA 1I7TA 5D9SA 1D5BB 1LP9E 1M4KA 3NCYS 5DJCB 5FUOH 5E1AB 4H25A 4IRSD 5IG7B 1IM3A 1OCWL 1FVCB 1FN4A 4FN0A 1HHHB 1N26A 3DVNA 5KTEH 4PGJA 1A0QH 5C0BB 3T08A 3FONB 1XGYL 4QO1A 1O5DT 1WGOA 4XCYB 2P1YA 2KDGA 3OXSB 5I75C 3JUYA 5KS9F 3MBEC 4U6VL 2EXYD 3CH1A 4KUZL 2OYPA 1IC7L 4ELMF 2R39A 1HSBA 3T4YA 1AE6H 3EIFA 3NCMA 4FQLH 1UB6B 2XN9B 2QSVA 4PLKC 2J6EL 1CE1H 4MMXC 1RZ8B 3UTPD 3BP4B 3WNLA 4UAOC 5KZCB 3QJHB 4Q0XL 5B3JF 4X9FA 5C08D 4HC1L 4PBXA 1CD1B 4RAVB 1XCQA 4XPFL 1RZJH 3X13B 4WFGD 3KPLB 1LILA 1SMAA 2VAJA 3RTQA 3RWFB 2AAVA 2XV6B 1C5CH 3AGVA 3VG0H 3JTTB 4KKLD 2VDOH 4TSCH 1AR1C 4XH2A 3BEVB 3TYFA 4WFEE 4PRPE 2VLJD 2ZPKH 1Q9LB 2X1WL 2OZ4A 4YDKH 3AS2A 5BXFA 4U1JB 1QO3B 2GTWB 4LBEB 1D3CA 1OPGL 3HPJB 2VLRA 3SE3C 5IB5A 5CKGA 1WIOA 3LH2H 4Z7WE 1FE8L 3O41A 4I8DA 4F3FB 3LKQA 3WO4B 3BP5B 5IHZB 1ZA6B 3VFGH 2XWBA 3EOTH 4L4VE 2W59A 1P2CB 3HCVA 2O26U 3VXNB 4BZ1L 3FMGL 1T0MB 5EU4B 1YMMD 4HG4J 3LMJL 4OLWH 4U3CA 2WIIA 4LEOA 3V4UL 3WFEL 1RZIB 4DGYH 1X7QA 3PWPA 5D6CB 1G9MC 3BIKB 2AERT 4B41A 1HH9A 4HWNA 5D7JA 3VXPA 1KEML 4DUXA 4LCIL 2OR8A 1UZ8B 3MA7B 2YD8A 5CGYC 1DQQB 5BV7L 4OFDA 1A7PL 4WEBL 3FHQA 3TZVC 2RIKA 2NY2D 1RHHA 3B9AA 3SBWA 3IT8D 2J1KA 4POYA 1QRNB 1NJ9A 4TSAH 5I9QC 2NY5H 3KXFA 4QT5B 3OB0H 1IQWL 1R3HB 3CVHL 4NT6B 3EW3B 4X6DF 2VUOA 3IKKA 3WO4C 4OQTH 2VUYA 3MXVL 1FNLA 3TIDA 3SDYH 1PZUB 3I85A 4QOKB 4GAGL 5C07E 5D7IA 4X4ME 1ES0B 1AKJD 1S7UA 5T3XH 3P9WB 5HHOD 4MSWB 4HULB 4OUOA 1V05A 3W0WD 5HVHB 4F57H 4N5EC 4WI7A 3BGMA 3U9UA 1YY9C 4P23C 3U6RA 1DBJL 4PUBH 4WTZG 2GJJA 4NUJA 5ALBH 3SDDC 1BF2A 1WCQA 5CZVH 2WWKO 5KVDH 5F88B 4OI7A 2CUIA 2FJGB 4K7PY 2YOCA 1S3KH 4OCXH 1JK8B 5A2FA 4KHTL 1FJ1A 4BK5A 3F7YB 4M5YL 2GSGA 3KPSD 4U33A 4F2MA 4EDWH 4P3DB 4WUUE 3RZCD 5FIEA 2M8XA 3L5WA 2VL5A 5TE4L 1KLUA 2H2PD 4YHPA 3VA6A 1JF5A 4WW2A 5I2IA 1RJYB 5KVEH 3N0PB 4NDMB 1MCPL 1N0XL 3JV5A 1OVZA 3HE6D 3WDIA 3D0LB 1IGML 2A9MH 3S35X 4X5WB 4MLIA 4FQ2L 2KQNA 4ZFZA 2PYFB 4GAYA 3THMH 4QRUA 1I8KB 1ZGLA 2YMXL 2X70B 1WBXA 4LLDA 4K8RL 4WY7H 3WEXB 3O2WH 3D48R 3U4BL 2ENYA 3HR5A 1I1RA 5D2NC 4Z7UF 3RNKA 1PBYA 3HUJF 5KJRH 1KSRA 4Y4KC 5KSBB 4KI5C 3TO4D 3MV01 5DZLA 1T6VN 4E41D 4GG6E 5IK3A 1Q0XL 5GRUL 5J8OA 5HYJD 4NGHH 4CMHB 1A9BB 1T22A 2YUZA 1LHZA 3ZMRA 4DOHE 1VPOL 4C55A 1NFDB 1URLA 2AQ1A 5LQBL 2ICCA 4HS3A 2BFVH 3KAAA 3FRPA 4U05A 4Z0XB 2F5BL 1RZGA 5GJSL 3HAEB 3IRZA 4KU1A 4S0TD 4ZUTB 3VXMA 3OF6A 4JY4B 1VHPA 3PL6A 1B2WH 1RURH 2PXYC 1JF1B 3MLRL 4JPWL 4UIMA 5HI4D 1YEKH 2A83B 4D3CH 1NANH 4YHKH 1F6AA 5HI3D 2B4CH 3Q6GH 1UA6H 4KJWD 4NBXB 4TOYL 5DJ2B 5IBUG 4M48H 1LO3H 5KANI 4MNHA 3I6GB 4Z95H 4PRIB 4X5LA 3J7HA 3SOBL 1U3HA 1UQSB 2X9XA 2H26A 5I17A 1F11A 3QPXL 1IM9B 1TZHB 2NYYC 1NAMB 2DJ4A 3DV4A 4O2CB 4FG6C 4RBPK 3OWEA 1LE9B 2FX7H 2Y7QB 4CMHC 5H2BB 4KY1L 1GC1H 2FECL 1IGCH 4K9EC 4P5TC 2HJKB 3A6BH 4X7FC 4M7JL 4MVBC 2O5XH 3DX7B 3BO8A 1NC4B 2AEPH 1DLFL 4HIEA 3HZKA 1AGBB 1G9NC 4NSKB 4FFVC 4MA1C 5L6YH 2NW2A 2Q8AL 3QFDA 4BFIB 5GJTH 4ODXA 3WS3A 4MA3A 4Z8FL 1OGAB 1QSZA 4N8VB 5DGQA 3VFMA 3LZFL 2VISA 5CSZA 5I8EB 1EHNA 3FFCA 4OQTA 1I8IA 5TFSH 2YA1A 3HMWH 5DA0B 1HEZB 1N5YH 2ADIA 2IQ9H 5E70A 1D6EB 1T2QH 2EO1A 4F8QA 1IEBB 1J1OH 3EKCA 3LSOA 4ZFGL 4HJ0D 5F9WB 5LJYH 4HGMA 3L7EB 4OZGA 5JMRA 5DS8B 5GHWH 1OM3H 4BKLB 3QNZA 3ES6A 1I3RA 5B4MD 3IJYB 3E1F1 5BRZA 3UZVB 4MAUH 2Q86A 5C8JA 1MSPA 5I19H 2IPTH 2A6JA 5EA0H 1QG3A 1IGIL 4QYOB 5DUPH 3ULVD 4DUWA 2W9LA 5C9JA 2LU7A 4ENEC 6FABH 4ONFH 4Y19B 2R56H 4L8BB 5B21A 3KPPB 4OZHF 5D1QD 4LASL 1Q94B 1WZKA 1KB9J 1MREL 3D87B 1AGEA 2OMNA 4QCIA 1RK0B 3PP3K 5CS7A 1ZS8B 1CFVL 1FFNA 5HJ3B 5FOJA 3UEZA 1LK2A 1QFOA 1VFMA 2JKXA 1H3UA 1XR9A 4X8XA 2VL4A 3AREC 4O02L 1J1PL 3FB5A 3OZ9H 5FYJU 3GIVA 3WV0A 5IJVA 3EYOB 3ZHKA 3CMGA 3MRBB 3DOSA 5JA9A 2OTWA 2WINA 4F33A 1T21B 2YZ1A 5FFLA 1LGVA 2EDOA 1YNKL 4ZFOB 3SE8H 2XWTB 3IJHB 1IAMA 3NTCH 4PJ7F 3H0TB 4PJDE 4WI6A 2Q7YB 3KDMA 1LO4H 1QUNA 3BPOB 1VFUA