4OGAD

Insulin in complex with site 1 of the human insulin receptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin A chain
publication title Protective hinge in insulin opens to enable its receptor engagement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/hormone/immune system
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogaD00
1GOFA 5F6IB 2NW2B 4R26H 3BXNB 3WFBL 1FZJA 1X4XA 3W11D 1I8KA 1ZLVK 4LPYA 3W11C 2OZ4L 3KPOA 4TVPD 4XH2A 3D5OF 5HYJA 4X6DB 2NY2B 4EVNA 3T0EE 1RU9L 3FB8A 4QHNB 1S8DA 4CNIB 2XKNA 1OW0A 4LCYB 4PJ7E 4OTXH 3MCKA 1QHPA 1RK0B 4JGUA 2QEJA 4ZD3H 5KW9H 1J88A 3NIGF 4YHIA 3U9UB 4WW2F 1RHHA 4CMHC 3VJ6B 3DRQA 1T1WA 1AGFB 1T89A 2R0ZH 1T4KB 4FQHA 4LLYB 3NGBC 4YZFE 4PGJA 1OAKL 5FB8B 5GSVB 4CU6A 5T3ZH 3PG2A 2C9AA 4QHMB 1UXSB 1A1OA 5J6GA 1F00I 2IGFL 4JR9L 1QQDB 4LRIA 1EAJA 4HLZG 4LPUA 3BAEH 1JUFA 2IQ9H 3WS6C 2CSPA 2ZSVB 4UNVA 5BW7C 5ID0B 3T3ME 1B0RB 1GPOH 5DQJB 5JW4M 3FAWA 4MAYD 4HDIB 1SEBB 3HE6A 3PWNA 1LD9B 4MDJA 2XA3A 1UA6H 5C07B 4LL9A 1U8MB 2KH2B 3MV8D 1FZMB 4NNPH 4U05A 2AXGA 1AR1D 2UZIH 4NC1E 1S7SA 1W0YT 1AR1C 4CN4A 1FL6A 3IXTB 3ULUL 3N1PC 3QEGL 3S4SG 1PFCA 4HAGA 4MJID 4S1DD 5CZKA 4ZO7A 2EIBA 2R56L 2O5ZL 3FQNB 2HVJB 4S1DC 3CFIC 3KYMB 3EYFB 2WNGA 3VFMA 3RP1A 3HS0B 5E99H 1FN4A 4PTTB 3EO1B 3MQIA 4Y5XC 2G2RB 1Q9OA 1TITA 2B2XL 4HGMA 4RMSA 3MRDA 2P8MA 3QNZB 1CT8B 3BGFC 4YFDB 2J8UF 5E08L 5DRXA 3KPLB 2J8OA 3G5YB 1KJVB 4V1DE 1I8IB 4J3WA 1RZJH 4GS7B 3EBAA 4KY1H 2ADGB 1HKLL 2YRPA 1R5IB 3HCVA 4QRSB 3TH3T 3OG6B 4CDHA 3Q0HA 2H32B 3KDMB 5CIPH 5DMYA 3PHOB 4MHHI 1KOAA 5C7XH 3IETB 1UEMA 4MSWB 4XI5D 4W6YB 2D0HA 4IRJA 2X4UB 4MAUL 5J11C 4LSUL 4JPKL 1A7RH 4JFHE 1QHOA 2H26A 3FT2A 4U6YA 4JG1H 4WEBL 3P9LB 2MCPH 4FQLH 4D0BB 3REWB 2GJJA 3U6RA 3LZFH 2BY1A 4IBLT 5ETUA 2R9HD 3AC0A 1A6ZB 2GJ6D 3ARSA 4IS6B 5CJQL 3RDTD 4D0CB 3U2SA 5H2BB 3FQWB 3WSQL 2Z93A 3RDTC 4FABH 1XFPA 4M1GH 5DLMH 1EUTA 4PBXA 3MACL 4OD2A 5TF1L 3SDYH 4KZDH 5A2KH 3JVGC 2ZG2A 3CXHJ 5LG1A 2W07A 2HG5B 4IHOB 3QYCA 4OIAA 2VLKD 4X8JA 2P5ED 4QYOA 3IRPX 3ULVD 2H8PB 3AXLB 3ARGB 3ULVC 5KS9B 8FABA 5ERWA 3QDMB 5F7WC 1IEBA 4LEXL 4AEHH 3QDGA 1VA9A 4OD1H 4OF0A 3C08H 4NNXB 4UT7H 2VDRH 5EZOH 5HDQH 1ZLUK 5I8KH 5AAWA 1HQRB 3O0RL 4S1RL 4PJBB 4F15B 2OS7A 2EYSA 3O4OB 1CCZA 3OKOA 2VZUA 1P53A 4F9LA 3U30B 2NZ9D 4WI2A 1HHIA 4Y2OA 2NZ9C 1C16B 3A0OA 3E6HB 1KC5L 3C6SB 1VEOA 2BRQA 1U3HC 3D0VB 4FQ2H 4M93C 3DNKA 5CKGA 2HJKB 5ENWA 2WUCH 2NY5H 3RIAK 2O26U 1EFXD 4GAFB 2AK4D 1IT9L 5EOCH 5DRWB 1ZLSH 2EEAA 5F9WC 5F1NA 4GUPA 1A6AA 3B8SA 4H20L 3T08A 3NABH 3WS6A 3BP4A 3OZ9H 5D1QB 2R39A 4MAYA 3H3BC 2ADJA 1PQZB 1OAUL 4FQXC 3FQTA 4WFHD 5C0AE 3GIVA 1MELA 4NQEE 4E9LA 2R2HA 1YEJL 1HILB 5KSBF 1GOHA 3SKJL 2FWOA 2F74A 3BIBX 5IHUL 1N3NB 1A21A 3QCTH 4EI6A 3RRQA 1QP1A 4H88L 3IVKA 1S7UA 1OWRM 3OB0K 3LOWA 1MI5B 2OL3A 3DUUA 4LP5A 5EUKA 3EYVB 4LIQH 4D9LH 3ES6B 3HZKA 1KEGH 1N8ZB 3VXOB 2AV7B 1YEHH 4IMKC 4PJFE 4ODUA 4YDVB 4KU1A 4Y5XA 1P6AB 3FOLB 3EFDL 2DMBA 1VKXA 4LHQB 1YMHB 5D2LF 1ACZA 4K8RL 4HV8A 3QUMH 3M1BA 2B0SH 3RHWK 3P3YA 5KVEL 4G43A 4GBXB 3UBXG 2W59A 2P8PA 3U9PH 2WIIB 4GMSL 5FO7B 3C09B 4W70A 3CGTA 3BKMH 3VI4F 2V5SA 4FP8H 5FGCE 1ULVA 3S5LG 3STBA 4EBQL 1VADB 3B5HA 3EHBD 1HNFA 1S9YB 3WIHH 2CKBH 3WD5L 5C8JA 2G9HA 2JK5A 4QY8A 2P47B 2BVOA 3KPRB 1GGIH 4RRPA 4OFVA 4I48A 3QXAB 4BKLA 2VR9A 3WFHA 5HYSB 3FONA 1FFPA 2BNQD 4RIRA 4M48H 3O3AB 5T1KB 4KK9D 5ILTL 4KK9C 5EU6D 4WI6A 3ULSA 2ICEB 1DFBL 4PRDB 1WWWX 1NCBH 1DQQA 5D96C 1IM3A 2E7MA 1TQCB 3KNBB 4ODTH 1Q9KA 4X98B 3BZFA 3LHPL 2GJ6A 2WUBL 1CE1L 2QKIA 5FYLD 3RDTA 1DANT 3VH8A 5JXED 1EZVY 2FBJL 1UB5B 4OGAC 1TETH 3O45A 3H7LA 1UWEL 3FT3A 1C5BL 2ITDB 3NA4A 1A7QH 5HHMB 2Z92B 3JVGA 4JHZA 2WBKA 3BT2L 4LAQH 2HJLB 4G8IA 1HYRC 2KZWA 1WV7T 1X7QB 3PQYB 2VLKA 5IK3B 1T1ZA 4L9LB 2Z8RA 3DYPA 2P5EA 2C1OB 1E4WL 4LCCB 1BEYH 3MUGB 2EXWD 2QSTA 4ORGA 1RIVH 1IKFL 2EXWC 1FYTA 5BRZB 2G75B 5F9JB 2AQ3A 2NTFA 2ZKHL 5T5FL 1KJ2H 5CSBA 3OXRB 4GKNB 5BV7L 5I1AB 2GTZA 4PJGB 1Q72H 2IAMB 1X5HA 4DFIA 4WI7A 5JUEL 4EQ2A 5CLWA 3U0WH 4LOUD 3HLAB 4Y16B 3LMJH 1ZWIB 3R4DA 3F7VA 3GMLA 4I77L 1NCNA 3IKKA 1NGZA 5I1HL 4LEOB 1HZHH 4LCIH 1DBML 4WO4B 4OZFA 1ZHNB 2DBLH 2EIZB 2HLFC 5FF6B 4JFEA 4P46D 4NKDA 1H0DB 4P46C 1F11A 1FHGA 3MREB 4OZ4A 1A1MA 2IG2H 1DQMH 2K9UA 1YEGL 4QRQA 5GS2H 3SKMB 3UPRA 1QFWI 5DJZA 4G7YL 2OYPA 4D9RD 5C0RL 2A1WL 3NH7H 1CGSL 4LARH 4Y7MA 3QI9D 1XGYH 3RWJB 1E4KC 2ADFL 3QI9C 2BJML 1DLHB 1VEPA 1NPUA 1GAFH 1P1ZB 4Z0XA 3T4AA 3MRQB 2IALA 4WFGE 3VFUA 1HDMA 1D6EB 4MDIA 3TCLA 2DQCH 5TFSH 5EO0B 5DSCB 1VFBA 4KK6D 3HI1B 1DLFH 3ZL4H 5GJTH 4KK6C 4PJCB 1AGEA 5IV2A 4P2QB 1UM5H 1G7QA 3G5ZA 1QA9B 2ORBL 1A4JB 2Q1EA 4XP4H 5K9JL 1DUYA 5INDA 2QTEA 2GAZA 4H5SA 4X5LA 4DGIH 1KPRA 2JCCA 2Q8BL 1E28B 4HKZA 5EUOE 3LD8C 4F7PA 1Z3GL 3U0TB 4F9PA 4O4YH 4JDTH 2AQ1A 4RWYL 4N8VG 4NRZA 1XZ0B 4BQCA 1RZFL 4ZTPH 1S9VB 1W72A 2R0WH 1QBMH 2X41A 5FYJH 4OSUH 2FSEB 4L4JA 3FQUB 1BFTA 4MA3A 4X4YB 3VFVB 5CSZB 1JNNL 5K9QI 1AY1H 1EAPA 3V95A 4E41B 2P5EE 3ROOA 3WN5C 4JFYB 3EYSH 5CJBA 5E2UL 1OGAB 3NFPA 1QFHA 2VSCA 4M9PA 1KTDB 1G1YA 2NY4B 2PNDA 1FYTE 4U1GB 1YEDA 2WWKT 3S36X 4JO1H 1K6QH 1CGXA 4ZNEE 1HOCA 2JF1A 2NY7H 3NCYP 3TGXA 2ERJC 5I8OL 1EERB 4TULH 4YDLB 3LKNB 5IF0A 4Z7OF 1BIIB 1EV2E 4OF3A 2A9ML 3KPQA 5EU6A 4PRHD 4F58L 1N64H 3TO2B 2A6KA 2VQ1A 5BZDB 3Q1SL 4P2OA 4IJ3B 5A43C 4O02H 4JREC 1JPTL 2VL5A 4HQQL 1EH9A 12E8H 3BUYB 4JY5H 1H3PL 5JXEA 1MRDH 3CFCL 5DC4B 1F4XL 3L6FA 5IBUG 4JFEE 3ZYIA 4HJ0D 1X5IA 3FMGH 4JY6B 2Y4SA 3BN3B 1I1FB 2LFGA 3MPCA 3RNQB 5C0JB 3RZCB 3TBVA 5CD3A 2X4QB 3A6BL 4PRID 1G6RB 5FOBA 3DYMA 4XPTL 3M17A 5FGBC 4AMKL 4HSQA 3MOBH 5DK3A 2XTLA 3ARWA 3H3PL 5C1MB 4MNGB 1VEMA 1KB5B 4YHKL 4N9GB 2CQVA 2FLRT 4UB0H 1WAAA 1IAII 1UH3A 3CFDB 4CADA 2EDOA 1NGXA 4HEME 3CMOH 4R2GB 3Q3GA 4ZSOE 3B5TA 3MLWH 3GKWL 4DKDC 1IQDA 1JYWA 3QCVL 4YBHA 5CUSL 5FYKH 3WCYA 1AGBA 3WNKA 2OI9B 5DHYA 5JMOC 3PNWB 3V0WL 2ATKB 1FLTX 3F5WB 3S4SB 4BSJA 1AGDA 3ARVA 3QA3A 3VWJC 3RNKB 1CLYH 1UWXK 1EK3A 2JCCE 4M5YH 5C2BH 3GFUA 2OZ4A 1Q0YL 5F44A 4KMTL 5DQ9B 5EZJA 4PJ5E 5LBSL 4Z5RB 2OQJB 4MX7B 1YQ2A 2X1XR 1RK1A 4P46A 2DQUL 5JOPD 1J5OH 1CLZH 3K2UL 4I3SH 2LTQC 4BA8A 5I16A 1RJLB 3DVNA 3MBXH 4NZTH 5D7IA 3DROB 3D87B 2PTVA 4RISH 2RB8A 3HR6A 4UUJA 1HHGB 4JB9H 4IM8A 1E27B 1C7TA 2FJGA 1MCDA 2AJXL 3MLUH 5B8CB 3EZJB 4GMTH 4HMEA 5F9OH 2CUMA 3QIBD 3P30H 3QT2A 4N9OB 4LF3A 2YHGA 3QIBC 2HP4A 3CX5K 4MA1C 4KFZC 3AUVA 4L1HA 3WFZA 1I9IH 4ONFL 3WIIL 5L2KE 2PYFA 1Z0MA 1ZA6A 2VO5A 1LWRA 2I07A 3H9HA 4ZFFB 1XH3A 4KJPC 2J8UB 2DIJA 3C8DA 3QIWB 4Z7VA 2XYCA 3GSWB 2ATPA 2VXUL 1T04A 3MRBB 1JF1B 1OF2A 5IMLA 4XPHL 1T7ZA 3V4UH 3LS4H 2WLZA 4MD0B 2OLDA 4J3TA 3IDXL 4OZHF 4HUWA 4GJTB 2PF6A 2PYEB 3HG1B 1NCUA 3O3DA 4HWBL 5IB1B 4OD3L 3HC4L 4OAWA 2VDMH 3PV7A 3QUKA 5BVJA 2Q86B 3RIFF 5DJCB 1K4CA 4KV5E 4NRXB 5D8JL 3CVHL 4J3SA 5A2IH 2YPLE 3HFMH 4N90E 3DX8A 5GSRB 1UG9A 3HZVA 1CFNA 5EOQL 3OR6B 4ODHH 5EU4B 3T65B 3ROLB 3UTQA 2WV3A 3SDAB 2P5WD 4P9MH 3FRPA 4GKZB 4U1HA 1IKNC 3EZ8A 1F42A 3LKQB 3ARFD 4UIMA 5CZVL 3GSVB 1UCBL 3DURA 3ARFC 4L4VD 5HI3C 1KACB 2XZZA 4K7PH 3HRZB 5MEQB 2F54D 2VDPH 2P7TA 5HHXH 1KIQB 4WU7A 1IEAB 2PTTB 3T0WA 2Z31B 4JPVH 3WE6B 3IDGA 1MPAL 3U1SH 5IQ7L 2D7NA 2Q8AL 3UJTH 1OAXL 1CE6A 3FO9A 1MAJA 4OLUH 1IC5L 2YSSB 1J8HB 1NUFA 2YXMA 3D6GA 5F93C 3MRJB 43CAA 4ZFGL 1IGJA 4R96A 2IADB 2XWBA 2I25N 3MRPB 4GAJL 5INCB 5GGTL 4PJ8B 5KANI 5HY9A 1U8IA 2HTKC 4PLOB 1PKQB 3J8F7 2RQ8A 2HFEA 3P4NA 3MO1A 1YNTA 3QFJD 1PLGL 1T22A 5HGDB 3T0DA 2UWEA 3BX7C 2J6EL 4XNZB 4NO5A 3MLYH 4M61B 3MJ9H 2IFFH 4PRIA 5TF0A 5FGBA 3VFTB 4G6JH 5F7HA 4Z8FH 3EO9H 1TENA 2R23A 4K7PY 3S9DB 3DX7B 3PWJB 1BQSA 2Q76A 4OCRL 4YK4C 2YK1L 1CDYA 1T83C 4Q0XH 1U3YA 2ZNXA 1CQYA 4PJ7F 3EKCA 1KCRH 1BZ9A 1S5IL 3PF2A 1LK3L 3RUGE 3K80A 1L4IA 4BSWA 4QOKB 4KGJA 2DQTL 3ARDD 5DYOB 1VDGA 4Z7VE 5IB2A 1HQ4B 1KCVH 1X5ZA 5EBMA 3D2UD 3B9KB 3ULUE 4OLEA 2PW2A 1OQOA 5DO2C 1JCKA 3RVVD 1FVEA 3RVVC 4KVNL 4PGEB 5E8PA 3PGDA 3FJTA 1A2YA 3NACL 4RGND 1T2JA 4C83B 5MEPA 5JW3H 3JWOH 4HWZB 1BD2D 3AM8C 3EJYD 5EPMA 3LRGA 3SO3B 3EJYC 2DM7A 3UBXB 1DQDH 1NGWA 3GJFA 4OCMC 3CSYB 5IMMB 1XF5A 2Q7YA 1FVCA 4UU9B 3QBTB 3QIBA 4R4FH 5DHXB 5FYJU 3L3DA 2LE9A 4K9EC 5SWZB 5EO1A 4KTYA 2RCSL 4MYWB 5H35A 5I2IA 2E8YA 2FIKA 4AM0B 4KVCH 2EDBA 3FN9A 4PREB 3DETC 4JN1H 3LN4B 5DS8B 3QUYB 1A9EB 1HSBA 1V8HA 5D2LB 1QLRB 3GI9L 4FTVA 3R8QA 1BM3H 4YXHL 3K4AA 3PWLB 2FD6L 3WXVH 3HE7D 2PETA 1BVLB 1H3TA 3DHJA 4LLDB 3WNNA 3HE7C 4I18B 3DV6B 4WEMB 1ACYL 1SBSH 5DEGA 5E8EB 2FBOJ 1DDHA 3QISA 1YN7B 3LKSA 1YYML 4EXKA 4QCIA 5FO9A 3FO2B 2X9WA 1NLBL 2X2YA 1VB9A 2VXQH 2IF7A 1W8OA 4K3GA 1TTFA 3S96B 4L1DA 2E6QA 3MA9H 1HINH 2CK0L 2IQAA 3TIEA 2W0PA 5DQDH 5FA4A 1PX3A 5CFHA 2FDBP 2D31A 2JJSC 4GRWB 3RL2B 3OJMB 4X7TB 1MJ7L 4JRXE 1HEZB 5D72H 3E0GA 3UAJD 4Y5VC 2X4OA 2P5WA 3TESA 4QXGL 3MODL 2IANE 1P4BH 3X14A 4OLXL 5DJ8A 5LWYH 3SPVA 4C59B 5ANMB 4IMLA 4LHUD 1F2QA 2AJSL 2BZDA 4Q6YA 5F96L 3VGFA 1UZ8A 4YUEL 1VFUA 2V17L 2ESVB 3G9VA 2F54A 1ZSDB 5DEFB 5DJDB 2IH1B 4Q6IA 2DQFB 4JDZB 3VFNA 3HMXL 3IDNA 3SE8L 2D4FA 4J1UA 4XP6H 1MCKA 2ED7A 3ZZ1A 3BZEA 2XNAB 4UTAL 1MWAL 3PGFL 1K8DB 1JZ7A 1MNUL 2CLRB 3H8NA 1I7ZA 1G9NH 3W0WE 4HBCH 3MJ8A 5F97E 4HS6A 5JIHA 5I8CA 3SJVB 3QFJA 1BFVL 5F8RC 1DBJL 1G6RH 2WINA 5IW1A 2FZ3B 4FQ1L 3ZMRA 3GSUB 1E4XH 2AXHA 4L8DA 1KB5H 2R4SH 2WM0A 2H6PA 3GMPA 5DZOA 3FCTA 2ADIB 2GCYB 5JORA 4KKAD 4U1NB 5DDHB 1T83A 3MLRL 4KKAC 4Q9BA 1NJ9B 5GGUB 3MR9A 3HPJA 5D7SH 3MCLH 4ELMA 1TLKA 3L5IA 5HVWA 1KBGL 1MJUH 5GS0L 1VACA 4P5MA 2GITB 3KPNB 4FTVE 3DRTB 3ARDA 2DB8A 4KTDL 4XNXL 4KRNA 4XNQB 2XV6B 2YEZA 1RULH 4B41A 3D2UA 3SE4A 4PG9A 1XR9B 4FQQA 2AEPH 1BZ7B 1KTLA 4CGTA 2D9QB 5TE4H 4DKAA 4NQDB 3QPQC 3MRHB 3KLAB 5GS1B 1R3IH 3PHSA 3QHZH 2Z91B 3BP7A 4IIQC 1BQUA 3IJSA 3AM8A 2GY5A 2J1KA 3BPCB 5DRZA 1BD2A 2F19H 3AREB 5ITFA 2YBRB 3LEVL 4ZUTA 3MLTA 2CLVB 4RMWA 1UGNA 3D1MC 3P77A 3BHBA 5KG9B 4JFZL 2GK0B 3JBG7 1A9BA 5IROA 2I60H 1Z6JT 2NY6B 3OV6A 1V3JA 5I74B 2DYPD 1T7VA 4ODVH 4QRPE 1RY7B 2W60A 3F58L 1BLNA 3F7YA 1IGIL 4D8PB 1W0WA 2W65A 3GRWL 2VXTH 4LSSL 1YJDH 1J0ZA 3IAPA 4Z7UE 4GFTB 5KVMC 1WBXB 4AL8L 1UJ3B 1JZ5A 1YMME 5I18L 1I7RA 3HE7A 1NANH 2YC1B 4EI5B 1E4JA 4NP4H 3AAZB 1QBLH 2DAVA 4TTGA 1B9ZA 4C56B 1A5FL 1P5UA 4IRSB 4ZUVB 3VXMD 4FS0A 2HLAB 1A3RH 2Z4QA 3K4ZA 2MCG1 5IFHL 3NA9L 4FNLL 3TFKD 2P46B 2ENSA 1L9MA 3TFKC 3MRLB 4XNUH 1NBZB 5IJKC 2V5MA 3B2UC 5CEYA 4NQSA 3S3SA 4NM8L 5CP7B 4YHLH 3VGDA 2BHYA 1NL0H 6FABH 3LKRA 4D3CH 1TJGH 3RGVB 5E5MB 2D2OA 3MRCB 3VDCA 2X4PB 3EJJX 1KEML 1GC1L 4GG6A 4XMKH 4JRWA 3EIFA 4P9HC 3OJ2C 1OT2A 3H9SD 3QQ9D 2ZNWA 5JLZA 2HT2C 4ELME 4ODXB 2B4CC 4LHUA 3H0TB 4R4BA 1J18A 1JTPA 1SYVB 3ZKQD 1UB6B 2HKFL 4Y1AB 2VUYA 2CR3A 5KAQF 4ZG1A 4ZUSB 1B4JH 4U1LA 1FFNA 4S11A 3U36B 1BGXL 1EGJH 2OMNA 4Y19B 2VABB 1KCUL 5E1HB 2X9XA 1ZGLA 1R3JA 2F53E 3D3VB 3WO4B 3VXUD 2PO6B 3N1QC 1TQBB 2BDNH 5JPNB 4RGNE 4LQFH 4ZOEA 2R69H 4JKPL 5DD0L 5ITBL 2BSTB 4C54A 1GL4B 5GRUL 4G80B 3AFLA 1YECH 1BPVA 5KAQG 4KH2A 1RSFA 3DMMB 3JWNC 4ZS7H 4UOJA 4LRNH 1EHLL 2CLZB 2VZ1A 3G5XA 3WLWD 2HFGL 4P4KC 5CMAB 5C0IB 3WLWC 1C1EL 5GPRA 1ED3B 3P4LA 2FL5A 2HT3D 4PRAA 1DN0A 4L8CA 2ZUXA 2IPTH 5D6CA 5JMRA 2KKQA 2XWTB 3TIDA 5IW6A 4PY7B 1L7TL 1MCOH 3OKKB 1CFTA 1A3LH 4LVOB 1QSZA 3WIFA 3BIKA 3VXPA 3NCCB 3RWGB 4WWKB 1MVUB 1IEHA 4HIHB 5EU5B 1MAML 5I1DA 3F6LA 3VMNA 2QBWA 3QWOB 1XF2A 4TSCL 4MLIA 3MV7E 1P4IH 2CGRH 1LE5A 1F8TL 1A6UH 3G6AA 3QDJE 4S2SA 3VXQA 3L3GB 4LU5L 2A9NH 1RQ5A 4OV5B 4IIQA 5F6IC 5DD5L 1TPXB 3CH1B 1NBQA 1WC7A 2HJFB 2BP3A 1I4FB 1J86A 4HS3A 2BC4A 5IJVA 1WLHA 4GG6E 4DKFL 1A6TB 5D70H 1FNEB 2FX9L 2NNAB 3V5HB 5L0QC 3PV6B 4XCFH 3OKNA 1T5WA 3S6CA 2NXYB 3S36H 5F7UA 3DO7A 1FORH 5GRJH 5J12B 3BEVA 3LRHA 1TCRA 2M26A 4MA8L 4OZHB 4Y4HD 2X1QA 4LMQE 1OL0A 4PGCA 4OB5L 3C2AH 1ZHKA 5EBLB 5C71A 4RRPG 4XPFL 1ZT1A 2R4RL 5HGGS 3X12B 4BUGA 3CMGA 4YO0A 5IG7A 1F4HA 4YBLB 5C6WH 5D4QA 2ICWI 1YMMB 4X6FA 4BSVB 2GSIB 3CLEH 2X4TB 5I73B 4CVZA 3IDMB 3TA3D 4G8GD 2RBLA 1NAMA 2KQMA 3TA3C 3ULVF 3VXMA 1MCEA 4PJIA 4RWHA 4EDWH 5BZWA 3O41A 3K8LA 1T5XB 3GO1L 4PGBA 5TH2B 1U8LA 2R1XA 4O9HH 4GSDL 1EFQA 1D9KA 1P7KB 4GRWH 4HFWB 3VH8G 5MEOB 1WSST 3HUJB 3NIFF 3K8KA 1CXLA 1DZBA 4HWBA 3H42L 3LKOB 4P2RB 3QFDA 4WVRA 2UV3A 4MD4A 3DYOA 3KS0J 5KZCD 4JE4B 2I9LA 5M94B 4MNQD 4POYA 25C8H 3MFGB 3QEHA 5ELIA 3H9SA 3C87A 1MRCH 1U8PB 3LIZH 4KI1A 4X7EC 4JN2B 1LEIB 3BQUC 3GB7A 2FIRT 2PR4H 1M4KA 1VHPA 3VXRD 1MFNA 5HPOA 3GUTB 1HHKB 4AENA 1G9EA 1C5DA 4R0LB 3MTRA 2UVFA 1MHCA 4AT6B 3HRPA 1MSPA 4M5ZH 3RA7H 4X4XB 4FQCL 5CILH 5IIEA 4JFOA 5E8OA 4M6NL 3X13A 4DOHB 5F7KC 4FRWA 1TTGA 4PV8A 5JZ7C 4DVRL 3LQAL 3ZLQC 3WFBH 3RBSA 5IUSA 3EO0A 1MHHA 3ZDZE 5L9DH 3I85A 1X44A 1ZHLA 1P84K 3VXUA 4FXLA 5HHOD 1KG0B 3TBSA 2MKLC 1KPUA 3C60B 2COQA 3U79A 2UYLB 3C5SB 3JZ7A 1S5HB 5IWLC 1FBIH 5HYQA 4HZLA 4OZFG 4CW1A 5GGTA 4BH8B 1BIHA 4KK5D 4NZRL 5CEZH 4XVUD 2AGJL 2R2BA 1ZVSA 4KK5C 3UZEA 4XVUC 3NFSL 3ZKSD 1EA9C 5KSVA 5IESH 1MH5A 2NXZD 4XP9H 1KF9B 2J6EA 1JL8A 5EU7E 3ZKMD 1QRNE 1J0HA 1MHPH 4GW5B 5C08D 4NC0B 2JCCF 4LCUB 4TPRL 4QXTB 3S35X 1CR9H 3MRIB 1FE8L 1IFHH 1WBZA 1FRGH 3RPIB 5IOPA 4Z7WA 3O9WD 4HWEH 3O9WC 4O2FA 2AJZA 5GS0D 2IPKB 1KELL 1WIUA 3I75B 1AKJB 3ZE0E 1YNKL 4AQ1B 1G7MA 3BPOC 4P3WA 1J0IA 2O5ZH 3VXME 5T1DL 4PJIE 2Z8WC 4Z18A 3THMH 1AJ7L 3VG0L 1MVFA 4KMLB 4NJAH 1PD6A 4HK3N 4AJ0A 5HYFA 3TWCL 5GIRB 1RZ7L 2V9TA 4WTZA 4PD4K 1VPOL 4I9WE 5IB5A 1SJHB 4WI8A 4LK4A 4NJ9H 5EIIB 4XRCA 3VD7A 4N0FA 4UIKL 3PHQA 3MLZH 3KPMB 3CUPA 1ORSA 4YPGB 1HKLH 5AZ2L 5F3HB 2O61B 2PN5A 2I9TB 1X4ZA 2QSCL 2XTJB 5F3BB 3VG9B 3QZWA 1GIGL 2XQBH 4Y4HA 3TNMA 3GSNB 4RDQF 3MMEA 4LSRH 3BMWA 3VE0A 1CFBA 5ALCH 2Q3AA 4F2MA 2OBGA 3MNWB 3NBNA 4I8DA 1DBKH 4MAUH 2XACC 4P5TB 3VXTB 3LB6D 4KV5F 5JQ6H 3LB6C 3QRGH 2QV2A 4RZCB 1ZTXL 2WBJB 3GJEB 4QHLB 4G8GA 3I6GA 3O81A 1FZJB 1L6ZA 3M07A 1I8KB 1HH6B 3KPOB 4XH2B 3AMKA 5CJQH 5HYJB 4DGVL 1WAAF 3UTSB 1AGCA 2VZVA 4D9QE 3MBED 2ZOKA 3FB8B 1S8DB 2XKNB 3MBEC 3KYKL 4HWNA 1Z9MA 1RV6X 5D6DA 3MCKB 4L4TD 1AIFA 5F7DA 4RDQG 4KHTH 3QXUA 4YHIB 4LDLB 1T20A 3NVQA 3ZDXE 3G6DL 3DRQB 1T1WB 1WCBB 4MNQA 4FQHB 4QRUB 5EA0H 2X9YA 4U4BA 4HIIA 5K59E 1GGCL 1A1OB 5AEAA 5J6GB 4F7MA 4XHJD 1O5DT 4QHKI 3VXRA 1RUPL 3AVEA 2BERA 2WP3T 4G6ML 1JUFB 2BFVL 4XHJC 5IBLD 5IBLC 1OTTD 3I9GL 2GTWA 1RFDL 4ODBD 1JRHH 5D5MA 4A2MA 3QXTA 3HE6B 3PWNB 3RU8H 5CAYB 1EBAA 1HH9B 3GBNL 5IQ9A 5D7IF 2LU7A 1SVZA 3INUL 3UP1A 2WSKA 4M7LT 4X4ZA 5H94A 3T77B 1H5BB 2AXGB 1IGYA 2WQ8A 1S7SB 3IGAB 1FL6B 3HAEA 4DW2H 3VFSB 2HWZH 4M6AA 4QF1A 5HTSA 4E42A 4WI3A 4XVTH 5IMKB 1NCCL 1P5VA 1MWAA 5HHOA 2ARJB 1A7PL 3VFMB 4WHYH 1OCWH 5IWLA 1FN4B 2O5XL 1MOEA 5BXFA 1L7IH 3TLRA 3QNXB 1IT9H 1Q9OB 5F1OB 1IAKA 4PG2C 4UT9H 3L3HA 1U58A 4M7KH 1F6LL 4Z7VF 4HJJH 4OTXL 4P99A 5KW9L 3NN8A 5C08A 5BVPH 4D0DA 3HCVB 2R0ZL 1OP3K 3B6SA 1I8MA 1FGNH 1U8QB 1OAUH 4G42B 4MJ4A 5T3ZL 4GAGL 2Q3ZA 4TOYH 2UVEA 4N0CC 1YEJH 3QJFB 3O9WA 5EIVA 5A16A 2V7NA 2IQ9L 4IRJB 1GPOL 3VFWA 4WI9A 3R8BB 4L8SC 4G8GE 2QHRL 4H0IA 4G9FB 5FM8A 2H26B 4MQ7B 4HJGA 4U6YB 5SX4I 1UA6L 3IFNH 2ZZUT 4U0RC 3U6RB 1G84A 4JM2D 3WLBA 4NNPL 4HWUA 4WEUD 1AD0A 4JM2C 1ETZB 4M3JA 4JZOA 4JFDE 2MFNA 4K8RH 3U2SB 4MB3A 3FFCA 1JWUA 1MCNA 3UCRA 5KVEH 2VLLA 2DLIA 1S7XA 1O7SA 1D5ZB 4JFXB 4Y2DA 3KLSA 3IFOB 4GMSH 1CXIA 2Y9RT 5E99L 5IM7A 3DJ9A 4AEIH 5FUCE 1ND0B 5DUBB 3SGJC 4U1JA 4XT1C 4LPXA 4KMQA 3JUZA 3RIFK 1CFSA 3FRPG 4B7LA 2FATH 4X8JB 2EYRA 1F4AA 5HVFB 3LEYH 4HUVA 3TBTA 5ERWB 3T3PF 1RZJL 5CKAA 4KY1L 3QDGB 2UWEF 4YHNB 4ELKA 1KULA 2IBZY 5ILTH 2IEPA 2EC8A 2JB6A 1QBAA 2EYSB 4PY8I 2YS4A 2D03H 3OKOB 2WWKO 1GGYA 1KLFA 2XZQL 3L3IA 4HUUA 5C3TA 5C0EA 2KQNA 2WUBH 4HPOL 5FKPA 3MBEA 1A7RL 3O6FA 2X4RB 1BHGA 1CIDA 1UWEH 3DBXB 3O3EA 4JG1L 4L4TA 4RNRA 5ENWB 4CMHB 5I75C 2DS4A 3SDCD 2MCPL 4FQLL 1PW3A 3NGBB 5LXGH 3LZFL 1IAOA 4Z6AT 3BKYL 1AHWA 2VWEC 2YN3A 4LBEA 2MTPA 5F1NB 4J3XA 4GUPB 1A6AB 1NSNH 4Z7QE 2ZOLB 1SVCP 4X5WB 3BP4B 4M1GL 5LAXB 2DMCA 3VFPA 4W4OC 4YDJA 5I1KH 1IKFH 4PJEA 1MFAH 1U8HA 4MAYB 5C0DA 5JXAL 2IBGA 3SDYL 5T5FH 3JV0A 3N1GC 2ADJB 4G8EA 4NIKB 4HK0A 3FQTB 4XVJL 3Q5YA 4NO0B 3GIVB 1QFUH 1F97A 1T3FB 1FO0A 2R2HB 4XBPA 1UKSA 4OLVL 1PZ5A 3MV8B 2FWOB 4AIOA 4HKXA 5JNYB 3T2OA 4FFVC 3UTPD 3RY6C 2H9GA 2NMSA 1S7UB 4AEHL 4MJIB 3DUUB 1GZPA 4I77H 4KKLD 4OD1L 4YFLI 5H37H 4UT7L 2VDRL 5I8KL 5HDQL 3KAAA 1P7HL 3IDUA 2W0FA 3KPSE 1DBMH 4ODUB 2VLRD 4U6XA 4Y5XB 4JO3H 4XB7A 3FFCE 4PG2A 1PAMA 2A6JA 1VKXB 4H8WH 4LLQB 2G5RA 1KIPA 2V2WA 2N56A 3M1BB 4RFEA 1WFTA 4G43B 4FQ2L 1SHMA 4G7YH 4H25B 2WUCL 2OK0H 4EDXB 1HHHA 1JHLH 4HCRL 1A22B 1QUNA 2ARWA 4UINH 2C3GA 3CFBA 4PP1D 1I3UA 2BJMH 2G9HB 2JK5B 4OCWL 2BVOB 3QG6B 3NABL 4I48B 1CZ8L 4L3EA 2B7DT 1LP9A 3OZ9L 1Y0LA 1QSED 3WFHB 1CXHA 3OAUH 2W0KA 3FONB 4L8SA 1FFPB 1G0DA 4TSAH 4TTDD 3ZKND 1AO7B 2V5RA 2BOCA 4TTDC 5ESAA 4FFWD 5K9JH 4FFWC 3ULSB 4JFFE 2OTUA 5JTWA 4WW2C 4JM2A 1DQQB 5AG8A 1UZ6F 4RMQA 1IM3B 3WNPA 3ALWA 3BZFB 3QCTL 3MLVL 2GJ6B 4DFHA 5E9DE 3RDTB 4NQCD 3QEQD 3VH8B 1RZFH 4LIQL 2HYMA 3FT3B 3SBWA 7CGTA 1KEGL 1X4YA 1YEHL 2P8LA 5GRVK 1AP2A 3W2DH 4IDLA 4G8IB 4X9FA 2HKHH 1TZHA 4NM4L 4PJ9D 3SGJA 2CPCA 5I76A 3GSNH 3DLQR 4PJ9C 2FX7H 4PUBH 2VLKB 1T1ZB 4JKWA 2B0SL 5IMOA 5DFWH 5ISZD 2FEEL 4I5BA 4MMXC 4ORGB 1JGVL 3BKML 2NTFB 4FP8L 1ES0B 5B8CC 3ZYZA 3U46A 3BEWA 3WIHL 3HNVH 4NQVA 1R3KA 2CKBL 2A9MH 2I5YH 3LY6A 3PDOA 3C5ZA 5GJSH 1WF5A 5EC2A 1GGIL 5F89A 1Q9WA 4ERSH 2O93L 3LEXA 4XAKD 1C7SA 4HQQH 1U3HB 3F7VB 4ELMF 4M93B 3WUWA 3GMLB 4JZNA 1XGRA 4GW1A 4MQTB 4OZGA 1NGZB 5IB4A 4PTUA 3Q6GH 1FL5A 1YZZA 3SDCA 4OZFB 4LNRA 5DJXA 1WWBX 1EFXB 3WS3A 5DJAA 1NCBL 2AK4B 5IEHA 4U31A 1PG7L 4ODTL 5F9WB 3SY0B 1D5MA 3A6BH 4NKDB 4AEEA 3DXAA 4NSKA 1KSRA 3GMQA 2EICA 2YD6A 4OQ1A 3OKYA 3BVNA 4OZ4B 2X70A 3K3QA 2XQYG 4HFUL 1U8NB 5JHLH 3DTXB 1CS6A 4M1DH 2F5AH 4W4OA 4BQ9A 4YHKH 1JGEA 5CZXD 5DJZB 2AI0H 1BQHA 1A7QL 1R24A 2VZTA 5CZXC 3RVXC 2A2QT 5D7KE 4ETYA 5IFJB 3OHXB 3TO4D 2OJEA 4I13B 4L3EE 4PJAE 3TO4C 5EIQA 1CLCA 1IGTB 5JDJA 3MGTA 3GKWH 2X7LA 1NAKH 2Z8SA 1BEYL 2J3SA 2IALB 3RY6A 1F4WH 1RIVL 3TCLB 3S88L 2DWDB 1VFBB 3GIZL 1KJ2L 3GK8H 5IV2B 1G7QB 2VH5L 4JVPA 1DUYB 1Q0YH 1TMCB 1IC7L 2VLRA 3ARUA 1KPRB 4HKZB 1BFSA 4YAQB 1RURH 1YPZE 1V3LA 4F7PB 4OF5A 3K2UH 2EIEA 2CRYA 3AB0C 5DK0A 3CZFB 3I3DA 4NRZB 1W72B 2OM5A 1J1OH 2EDJA 4JKMA 1HZHL 5D7LD 3A67H 5C09B 1E0OB 4BFGA 4QTIH 1FJ1A 1EAPB 4RAUA 1JNJA 4FMKA 5CJXC 1OWWA 15C8H 2OTWB 2XWJA 3NFPB 1NMCB 1YEDB 2IG2L 1DQML 1OGTB 2V7HB 3WIIH 2FECL 4XXDB 3OKLA 3GI8H 3QO0A 1C12B 3GM0A 3NH7L 1DVFD 2BNQB 5KVFH 4GG6F 4FHBD 1DVFC 4LARL 5IF0B 1PZUB 3CDGB 1XGYL 5IVZA 4YDIH 3KPQB 5EU6B 2JIXA 2A6KB 4LKXB 3OR7A 5D96B 1XCQB 1HE7A 2CIIA 5HDBE 3U48A 1JI2A 4OZGE 4AIXA 1CN4A 3O4LE 3MUJA 2DQCL 5TFSL 4NQCA 3QEQA 1DLFL 3ZL4L 1Y18A 5GJTL 3SE3A 4KHXH 1UM5L 1S7RB 3UTTD 3L6FB 4XP4L 3CVHH 2EIDA 3DXAE 4DGIL 3QIUD 5EC1A 3TYGL 4OQTA 2NX5E 3RI5F 3QIUC 1FDLH 5CD3B 3HC0B 4PJ9A 4OI9A 4K94C 5HI4D 5DTFA 4O4YL 5FOBB 4JDTL 3M17B 5HI4C 1D5IH 3Q5OA 3ZKXC 3KPPB 4APQD 2R0WL 1QBML 5CZVH 4OSUL 1UCBH 5ISZA 4APQC 3VGBA 4WI5A 4KDTC 3KLHD 1FG2A 1TJIH 4JANA 3KLHC 4CADB 4LHUG 4ZAKD 2QR0B 4X6BA 1NGXB 3OMZA 1PYWA 2MQ0A 4B0MM 3Q3GB 3RWFB 1BJ8A 2HT4D 1FIGL 2VR5A 4X4MA 4JQIL 1EEQA 2HT4C 3NIDE 3UTPE 1IQDB 1YN6A 1N5AA 2Q8AH 4QTHA 4JO1L 5DHYB 4YFEA 5IEKB 3MRNB 2NY7L 3QUYC 4PRPE 3WJJA 4M4PA 2J4WH 4QWWD 1AGDB 4XXCC 5MEND 3QA3B 4N0UE 1EHXA 4TULL 4QWWC 1N7MH 5T3XH 3TPUB 4I18C 4XPGH 1N64L 1RUML 3TBWA 5E7BA 4LLUA 3RJQB 4F57H 5EZJB 1T2QL 2OSLA 3I3EA 4O02L 3CJJA 1RK1B 3P9MB 4P46B 5C0BE 4Y5YC 4TUJA 1Q8MA 5I16B 5D7IB 12E8L 3ILPA 3D0LB 5C6TH 4JY5L 1MRDL 3FRUB 4LLMA 3S35H 3ZDZF 4UUJB 3G6JB 2FJGB 3FMGL 3CSBA 3KPTA 2FHBA 1UH4A 3OKDA 4LF3B 2FR4A 3ARXA 1Y6KR 3TO4A 1NKRA 3QI9B 4ZODA 3AY4A 2FCBA 5JA9A 1YY9D 3MJ7B 2FO4B 1T0NA 1YY9C 1INDH 3ARRA 4P4RA 2I07B 3H9HB 1ITBB 5I0DA 3X3FH 2VERN 1SJXA 4H0GA 4XAWH 4MWFA 2B1AL 5DMKA 1C8PA 4OCXH 5J13C 4RX4D 4NNYA 2VLJD 5IMLB 1MJJB 3L5WA 5DMGD 3QRFM 4I2XA 2AABH 5DMGC 1X5YA 3OTTA 1LGVA 5FYKL 4HUWB 5JIKA 1PY9A 3LD8B 2ICWJ 4U1MA 4MMZC 3N1MC 4UNUA 4XBGA 4B5EA 5ACLA 2IJ0C 3L5HA 2VXVH 5E8DH 3QUKB 2IMMA 3ISWA 4TSBL 1PGRB 1CLYL 4GO6B 4YR6A 1VSCA 2C5DC 4RBPK 1K4CB 4NDMB 3BN9D 1XIWD 1J1PL 3SGDI 1GGBH 1XIWC 5EOCJ 5BOZG 2GQHA 4X6CE 1FNFA 3DX8B 5BOPA 4PJIF 3WN5B 1CFNB 5CJXA 5ISZE 3UTQB 1J5OL 5KSUA 4U1HB 1CLZL 4I3SL 1XGQB 3MBXL 5CJ8A 1X6NA 4MB4A 3S37H 2NY5C 5IVXA 4UIMB 2UY7A 3BKCL 4RISL 3VXNA 2BVUA 3GZKA 5D2NC 3EOTL 2ERJB 4KI5E 5K9OA 3MLUL 4PBWD 1QEWA 1DVFA 4GMTL 3I84A 5F9OL 3P30L 4TYUA 1FSKC 4NCC1 1ZK9A 3IDGB 5ADOL 2MPAH 4PRHB 1YYMH 1MLCA 1CE6B 1N6VA 2R2EA 3FO9B 2E7HA 4XC3H 1NLBH 1I9IL 2N1KA 4JREB 3VCLA 4OF7A 1BOGB 2V9QA 43CAB 2ZPKH 1LEKA 1IGJB 1FZOA 4EUPH 4R96B 4XNYH 2XWBB 1JFQL 2CK0H 4I3RH 4WNQB 2E7BA 4P48A 1EJOH 1GH7A 1FP5A 3UTTA 5SWSB 4XCNA 1WQVT 3V4UL 4XP5H 3P4NB 3MO1B 1YNTB 3QIUA 2UWEB 4YXKH 4R7DA 2AAVA 3CXHK 1JV5A 4PRIB 4PD4J 3I6LD 3CSPA 3MODH 1A6VH 1EEZA 1CI5A 2RR3A 4APQA 4OLXH 3TN0D 2R23B 3TN0C 2Q76B 1DE4A 4NYLA 3FZUD 3NPSC 3HFML 4WHTA 4YUEH 4ZAKA 3FZUC 4HGWA 1N0LA 1ZT7A 3S5LA 4U1KA 1MEXL 1VFMA 1BZ9B 4ODHL 4QHUA 3ZDXF 3SCMC 4P9ML 3SE8H 5I74C 4BSWB 5BQ7B 5CHNA 3C6LD 4QRRB 2FHCA 3EW3B 5K59F 5IB2B 2EDLA 3KXFE 1W2KT 1AE6H 1MNUH 5EBMB 5CIPA 5FKAA 3S3PA 1MREH 3DARA 2VDPL 2PW2B 5HHXL 3I50H 5MENA 3E2HC 3S7GA 4OZFH 1L6XA 1FVEB 1U3ZA 4JPVL 4GLRI 4OKVB 4AEFA 5E8PB 3UJTL 4Z7WF 1BFVH 1DBJH 1FNGA 1K8IA 5AUMA 1WFNA 2GHWB 1A2YB 4L3AA 4OLUL 4PBVC 3WO3B 4Y5YA 3RY4A 5MEPB 2LTQB 1JN6A 3DX6B 3I6KB 3SQBA 1U91A 1NGWB 3GJFB 4N0YL 3FB6A 2EYTA 2RFXA 2Q7YB 1FVCB 3M45A 4A6YB 3P73A 3TJEH 3QIBB 3QULB 5IVXE 3X11A 3MLYL 3L3DB 1RVFH 3MJ9L 1CGYA 1JGDA 3VXSA 2IFFL 5T3ZE 3JV6B 5H35B 2FIKB 3LPFA 4G6JL 2NY0C 2GT9A 3UYPA 4GOSA 4XNXH 4Z8FL 1VFAA 2QQLL 1FNSL 4P57A 5CEXA 1HSBB 1I7UA 4Q0XL 2J2ZA 3B3IA 1KCRL 3FTGA 3D39D 4RX4A 3VW3L 2VLJA 2J7LA 4LDOB 3LKSB 3ZTNL 5FO9B 3EYOB 3FQRA 1QBBA 1KCVL 5AYUL 1HWHB 3OKEB 4WTZG 2AV1A 1P2CA 4W81A 3KYOA 3AU1A 3WO4C 4BK5A 5FA4B 1XIWA 3IJHA 5SV4A 4U33A 2ICWA 2UY6A 1ADQA 3IFLH 2BNUB 3JWOL 3V6ZA 2X4OB 1J9CT 2P5WB 3F58H 2MHAB 1I9JH 1MRFH 3SDXE 1IGIH 1T7XA 4I4WA 4G5ZH 3GRWH 3SGKC 3X14B 3ARFB 4XVSH 3FB5A 1DQDL 1IGML 5D2NA 5DJ8B 3QZWG 5DC9B 3SPVB 4L4VB 1V7MH 1JNLH 3JV5A 1EO7A 4IMLB 4WUUE 4Z78B 4DK3A 2XN9E 4QHKJ 2F54B 5I18H 4O2CA 4R4FL 3QUXD 3VFNB 3MRKB 3IDNB 5I1CL 5J0BA 3H9ZA 5MHSD 1CD1B 4J1UB 4WGVB 3RVUD 4HS8H 4KVCL 1ZANH 3RVUC 3QXVA 5FYLH 3BZEB 1AXTH 4JN1L 1A6WL 4DVBA 5E03A 5ESVA 5I15H 1WTLA 1Z9OA 2J5LC 5MP6H 1JMZA 3BP6B 1BM3L 2BRRL 5D5MF 2EEBA 1SBSL 1JJUA 3STZA 4U1SA 3DUHA 3F6IA 3W81A 4XCYA 4R4NC 1RZGA 3QWRD 1U3JA 3QFJB 3T1FA 5GXBB 2WINB 5IW1B 1NFIA 2C3HA 3D69A 3V6OC 4L8DB 5F8QC 1X5KA 2Q87A 1A7BA 4MCZA 2H6PB 3GMPB 1HINL 3MA9L 3FCTB 5E5UB 5JORB 5DQDL 1MUJA 1WFUA 1BWWA 1HXMA 2DTMH 4UQ3A 4YK4B 4KAQH 3TN0A 3P9WB 5DMIH 3VXSE 3VFRA 1SJVA 2ZJSH 3QUMA 3HPJB 1P9MC 5EN2A 1A14H 3N50A 5FYJD 1MCHA 2HKFH 2APVA 5D72L 3H9YA 1FVDA 2RHEA 4P5MB 1G9MC 1WIPA 1Z5LA 1P4BL 3C6LA 2X05A 3ARDB 5LWYL 4S1QH 1RZIA 1HHJA 2YEZB 3WIHA 1UYWH 5J9PA 2CKBA 2VLJE 3BWUC 3D2UB 4ZPVB 5HHPA 4FOMA 5D7JD 4PG9B 3TVMD 3HAEG 4FQQB 4OZIA 4KZEH 3ZTJH 1KTLB 1N2RA 3OJDA 3L7FA 1AH1A 3EYUH 4XP6L 4JKPH 5I19H 5DD0H 5JOEA 5ITBH 3UC0H 3IJSB 4KUZH 1QACA 2C1PA 5DRZB 1BD2B 5ITFB 3OPZH 4ZUTB 3MLTB 1I1AD 2FJFA 4KXZH 4YX2H 3KWWB 2VR4A 5HHQA 1I1AC 1I1YA 1G9NL 1REIA 5FECA 4LGPB 3BHBB 2HFGH 5C0FA 4G9DA 2UZXB 1KPVA 1A9BB 1JF5A 4PJXA 1G6RL 3FQXA 1R5VA 1E4XL 4NUGH 5HGHA 1KB5L 1BLNB 2AJVL 2R4SL 4L5FH 4ETQA 1W0WB 1Z2KA 5FCUL 5E6ZA 1LE9B 3EDDA 4OFKA 4NO3A 4JO4L 1MAMH 4PIRF 5D7SL 3HE7B 3MCLL 1B3JA 4RA3A 1BF8A 1T6WA 5HI5D 1F58H 3DUSB 4G6FD 4QGTA 3D39A 1F8TH 5ID1A 1MJUL 2FEDD 2FEDC 3MV9E 1KJ2A 5DD5H 3ZHDA 1M7XA 4JKKA 2WANA 2Z4QB 3DGGB 4F7TB 4HXBH 1PEZA 2C4FT 4UV4H 4NHUA 1L0XA 4KRMB 4X6DA 2AEPL 3P4MA 4HUKB 5CEYB 4NQSB 5TE4L 3CU1A 4CNIA 3LKRB 4LIQE 2J88L 3T0ED 1R3IL 2FX9H 3GNMH 3I6LE 3T0EC 4J3OC 3V2AR 3VJ6A 4LP4A 2WW8A 3GHEL 1RZKC 4O00A 4LLYA 1VFOA 2F19L 1MY7A 4U6HB 2P4AB 3SGKA 4BZ2L 1UXSA 4OF8A 5JLZB 5IP4A 1UWGH 5A2JH 4XCEA 4OB5H 4XPFH 4LHUB 1QG3A 3VU2A 2DKMA 5DQJA 2I60L 3TCXA 2JJTC 4ENED 2V2TA 1UEYA 2GJZA 3QUXA 4HDIA 3RWHA 4ENEC 4ODVL 3ZE2E 5FV2A 4F80A 4U1LB 1FFNB 1RPQA 2VXTL 1FC1A 5C07A 4OZIE 3MRGA 4X5XB 1U8MA 4HUMB 1FZMA 1FL3B 4KPHH 5FUOH 1R3JB 3GMRA 3T2PA 3QDAA 5I17B 4NP4L 5BMFL 1JPFA 2VLMD 3TBYA 4QT5A 4NC1C 4PJDA 3MFFB 4ZUWB 1QBLL 3EYFA 1CLOL 3JWDC 3QWRA 2VB5A 5KOMC 3HS0A 2ILLA 3WHXB 3U4BH 3V6OA 3U4AA 2Y72A 1HYSD 2ZUTA 1HYSC 3QNZA 4HXAL 4XNUL 5J6HB 3GMOA 2DTSA 3GHBH 1NL0L 4HUNB 3G5XB 3KPLA 4JQXC 4MD5A 6FABL 1TJGL 3WXWL 2YD3A 1G7HA 1P9MA 3G5YA 1KJVA 2XXCB 2FL5B 4PRAB 4L8CB 2ADGA 4J6RH 4XMKL 3V6FA 3TIDB 3FB7A 4EZMA 1OSZA 3H7BA 5IW6B 4PGDA 4OFIA 4JO2H 2WP3O 3WIFB 3BIKB 2IH3B 3VXPB 2E3VA 4JJHA 4XZUA 3D39E 4NKIH 3JV4B 4C58B 1ZLWK 5D7JA 5I1DB 3TVMA 3V52L 1N59B 1G1CA 1XF2B 4ESKA 4JRYE 4Q97A 1LE5B 3G6AB 3VXQB 3EFFB 4LLAA 4LSDA 5BS0E 3GJFK 3P9LA 4IIQB 1EGJL 3IDJA 4JFHD 4PR5B 4X6DE 2HRPH 1LP9F 2YZ1A 1CFVH 2MWCA 4GRMA 4I0PD 4WY7L 4D0CA 4I0PC 3FQWA 2H41A 4A6YH 1VGKB 5IT2H 5IJVB 2EDXA 1OW0C 3FFDA 4LQFL 2R69L 3DVGA 3OJVC 4RQQA 1T5WB 4JM2F 3DO7B 1NFKA 1T89C 3CNKA 3BEVB 4CVXA 1TCRB 2DYPB 3CVIL 1K3ZA 4OUOA 1AFVH 2HG5A 3OKMA 3IFPB 3DHMA 2VN4A 4LRIC 4PGCB 4ZS7L 4HX1A 4LRNL 4UT6H 3T8XB 2H8PA 3AXLA 4E5XA 4ZPTA 3FO1A 2NPLX 1I75A 1OT1A 4HF5H 1YNKH 2EEDA 4YO0B 5IG7B 4IDJL 3U4EA 5T1DH 3ZO0A 5C07E 5E94A 1CU4H 1BJ1H 4PB9L 4CVZB 1M05B 1H9VA 5DWUH 1NAMB 1JPGA 1UACH 1WZ1L 4PJBA 1NFDA 4KJYA 1MCOL 1JP5A 1A3LL 5BZWB 4MLSA 2AEIT 4OCYL 4PGBB 1FZKA 4M00A 2R1XB 1VPOH 1J87A 4LPVA 3OB8A 2JB5L 3D18A 3D0VA 2CGRL 5ABDE 4TVSa 1A6UL 1ITCA 5EBWA 4KRPD 3PGCB 3QFDB 4Z76A 3T0EA 4MD4B 2A9NL 3G9AB 4KRPC 2HJKA 4OCNC 5AZ2H 2I9LB 1RIUH 3QPXH 1KN4H 4PJ7A 2LVCA 2APFA 4KTEL 5ALBH 1FNAA 1J12A 1GIGH 4KQ4H 3GB7B 5JIPA 5HDBF 4OZGF 1XGTA 1QVOB 1RJZA 1SYSA 2FGWH 5D70L 1DR9A 5JHDB 5JR1H 4M62H 1B6DA 1C5DB 5GGSY 4XCFL 3SOBH 5KANG 3S36L 1A1NB 1FORL 1J0YA 1MIMH 3ARBD 5IIEB 1S7WB 4JFOB 1PQZA 3ARBC 3X13B 5I1LA 2A83A 4YE4H 5HHNB 5C0AD 4DN4H 1MHHB 2DWEA 5C0CB 4NQED 3HNSL 1LK2B 1N3NA 4DGVH 1OAYH 4EJ1C 1ZHLB 4G8FA 5CCKL 3VXUB 2YUWA 1P6FA 1HK6A 1AQKH 3KYKH 3WUWG 3TBSB 2XQYK 3EYVA 3CLEL 3CCHB 4UZGA 1EUUA 2DOCA 1IQWH 3G6DH 2AV7A 2AXJA 3O11A 4HZLB 4EDWL 5HYQB 1RJYA 4CW1B 4CMMA 3SQOH 3NIDF 2R2BB 4PLKD 2YWZA 3R1GH 1ZVSB 4PLKC 1CD9B 1NLDH 1YMHA 4O9HL 3W9EA 5KSVB 1WVZA 2DDQH 1TZGH 3LCYA 1H3VA 1RUPH 1KIRA 4JQXA 5EOTA 4P4KB 4GBXA 1EO8L 5L2JB 2KDGA 2WIIA 4NN5C 1BQHG 25C8L 1MCPL 3PL6D 1NCTA 1VADA 1WBZB 2WK2A 1HN1A 5KS9E 4HC1A 3LIZL 4GAYA 3INUH 3EOYG 1H8OA 4Z7WB 5IOPB 4N8CL 2PR4L 3QDME 3QEUA 4WV1A 3QXDA 4O2FB 4HZAA 4HMCA 3QXAA 2N7BA 4FQJH 1AXSB 1EXUB 4M5ZL 4ODSH 1G7MB 3RA7L 4PJBE 4S1SH 5CILL 4LVNB 3SKUD 4LCWE 2NCMA 5I1EH 2XG4A 4UILH 2O5XH 2YXFA 1F3RB 5FYKE 3T0BA 4F9LC 5BS0B 2YMXH 5L9DL 1HXYA 3ETBF 4X98A 4M7ZB 4I0PA 5IB5B 4NKOB 4J7RA 2BVPB 3WNMA 1ZLVH 4N0FB 1FCCA 1UB5A 4BQBA 3CUPB 4LMQI 5I1IH 1ORSB 4K9EH 5L0QB 5DGQA 3O2WH 2ITDA 3FOMA 4PRNA 1FBIL 4IOIB 2FGZA 5C3LD 5CEZL 4GAGH 5HYIA 3K7UA 4Y89A 3SKNB 2FJHB 4P0DA 4XPBH 1U36A 4ISVA 3QZWB 1IL1B 4Y4HB 5IESL 4XP9L 1JPSH 3MMEB 3VE0B 4Y4KD 4BM7A 5D71L 1MHPL 1TNNA 3MJ9A 2OMBA 4LCCA 2SEBA 4Y4KC 1LO5A 4F2MB 4KK8D 1NDGA 2H1PH 4KK8C 5IFAL 2AERT 5BRZA 4MAYC 2QHRH 5F9JA 1D3CA 1CR9L 1IFHL 4X6CF 4CU7A 3OG4B 1FRGL 3TA3B 1B4RA 5I1AA 1SY6L 1TJHH 3I6GB 5ICZA 1M71B 2BSRA 4HWEL 2GSGA 2VLME 1KFAH 1MI5E 4U3HA 2ZOKB 4F8TA 1ZWIA 2YZ8A 2HN7A 2AP2A 3THML 5F7DB 1AIFB 1KXVC 1X5LA 1T20B 4LEOA 5I66B 4NJAL 5DJYA 4MNQB 1CDUA 1MCIA 3RY5A 4KRLB 2X5PA 4HIIB 2EDRA 5FF6A 4EN3D 1EPFA 3ZHLA 2HH0L 1H0DA 3BQUB 4EN3C 5EZLA 5TDNA 5HJ3B 4NJ9L 3VXRB 3K1DA 4TNVK 3MLZL 1ZAGA 3LDBC 3QDHA 3SKMA 4ZNCD 2H45A 3G04A 5D5MB 2EO9A 1A7OL 3ARBA 2C4XA 4NQXB 3KPRE 2VZOA 5IQ9B 1MCCA 4Z9KB 5F9AC 3RWJA 3G5VB 3I02B 5H94B 2XQBL 2XZQH 1P1ZA 4LSRL 1IGYB 5GISH 5C0AA 4XI5C 5ALCL 4NQEA 4HPOH 1DBKL 2DI8A 4E42B 4JGJA 5JQ6L 1QLEH 3QRGL 4WFGD 3QIWD 5DSCA 5HHOB 3HI1A 3OAZK 1YJDC 3GSOB 2BVEA 4P2QA 2N4IA 1QA9A 3BDXA 4M7JL 2ZCHH 5D1XD 3BKYH 2NY1D 3FL7A 3L3HB 1U58B 1MLBA 1NUDA 2Y5TB 4PJFA 2R9HC 1JZ8A 2NY1C 1V3KA 3BO8A 3U0TA 3WDJA 1XZ0A 4LAJH 3UXFA 5HHME 1S9VA 3NN8B 4KHTL 5C08B 4D0DB 5JW4R 2P45B 4NPYA 5F1IA 3REVA 5JXAH 3VFVA 4FMFA 1CBVH 1WEJH 3B6SB 5EA0L 1I8MB 2AKRB 3PQYE 1JTTA 5DJ2A 3PL6A 4XVJH 2NLJB 2XY2A 4JFYA 5FEBA 2ZUWA 5J4MA 4OLVH 3O9WB 3QQ4B 5BRZE 4DUXA 2W9LA 5J56B 1I85C 3VFWB 2Y7QB 1FYTD 2G60H 2ZUVA 3BPOB 3O2DA 5I0ZA 1JRHL 4PJGE 4YIQB 4XC1H 3GDBA 2FYYA 3RU8L 4HJGB 4TNWF 3JTSB 1X5FA 2APTA 3SKOA 1BIIA 5IVXF 4UDUA 4M03A 1H3GA 4K71C 3E6FB 4LCWB 4LSQL 1ZLUH 5I1GH 5BZDA 1EVTC 1CXEA 4JZOB 5E7FA 4DW2L 2HWZL 4NO2B 1JWUB 4XVTL 3ZT6A 2VLLB 1S7XB 1QLFB 2B1HL 1NUGA 1KLUA 1OCWL 4U49A 5IM7B 1L7IL 4HCRH 3S8WA 4JFED 2OTPA 4UT9L 1KYOJ 5C0JA 4U1JB 1EHNA 5EU3A 1CFSB 4M7KL 4OCWH 1G6RA 4HJJL 1CZ8H 3BH8A 4Y4KA 5FHBH 1XF1A 3TBTB 5BVPL 1KB5A 2KUTA 1QR4A 1TNMA 1FGNL 1NAMH 2B39A 4XMLL 4K55A 3O6LL 1MFDL 4TOYL 3MRFA 1YYLH 2JB6B 3EJZD 4PJHB 5JDSA 3EJZC 3T09A 4PV9A 4CN6A 1GGUA 4HUUB 3L3IB 3F12B 5C0EB 1KB9J 3MLVH 1N0XL 4WFFE 5F88B 4PJCE 4P2QE 1DQLH 1ONQA 3MBEB 3F5WA 1U8KA 4N1EA 2VMFA 2R2CA 1MHEB 5LGHL 3O3EB 4L4TB 4RNRB 3NZ8B 5EDXA 3IFNL 4P9HH 3RX7A 2F8OA 3OB0H 3PXHA 2DQEH 1OD7A 4U6VH 1IAOB 5SX5K 5DQ9A 1AHWB 4NM4H 1CVSC 2B4CH 4MX7A 4LBEB 4EN3A 1T1YA 4PJ5D 4F9PC 5SX5H 1RJLA 5IB3A 2E7LC 4YDJB 1G7PB 1EMTH 4E41E 1HHGA 3LQZB 1JGVH 1QRKA 4PJEB 3F7RA 2JLLA 4HBQA 5C0DB 4AEIL 1OGAE 4YLQT 4G8EB 4UQ2A 1HSAA 3EHBC 1FO0B 4HT1H 5DJ0A 2FATL 1BBJA 2DD8H 2CO6B 5HGAB 2YPVH 1NMCC 3LEYL 3B9AA 3T0VA 1GCFA 3CFEB 1MF2H 4D2NA 2VDLH 1F6FB 5L2KD 3QIWA 3GSWA 1JF1A 2W0FB 1XR8B 2D03L 3V4PH 1R5WB 4MD0A 4P2OD 5D1XA 3OXSA 2A6JB 1PG7H 4P2OC 1MAKA 3WUZA 3HG1A 3IU3A 3C8KA 4H1LH 3ABZA 4RFEB 5EUOA 3ARPA 5JXEC 3RWEB 1BBDH 4HFUH 2DF3A 3HC3H 4LVEA 2A6IA 5DJCA 2GUOA 2VTFA 4KKCD 1YEFH 4KKCC 1HHHB 5LXGL 2LAGB 1Q94B 3BPNC 5GSRA 3UZVB 3VDBA 4AYFA 1A4KB 2YPLD 1X5JA 3T1WA 3OR6A 3T04D 5EU4A 4N90D 4MNGE 1NSNL 2MQ3A 5DK2A 5FAAA 1I85A 1LP9B 4YWGH 2BVYA 5JO5A 3S88H 4ACPA 5I1KL 4L8SB 1MFAL 3GIZH 3HRZA 4ZNEA 5ESAB 1KIQA 2VH5H 4N8PA 5GGRB 4NOBA 5L6YL 3UMTA 1QFUL 1XMWA 4U0RB 4Q2ZA 1O0VA 3WE6A 1IC7H 1QFWM 3RL1A 3WKNA 4JM2B 3X3GL 3O3UN 5JOFB 3L5XL 1NEZA 4GW4A 4LOUC 4PLJD 4MJ6A 4CJ0A 3O8XD 5FFLA 4Z7NF 3UO1H 1RD6A 2GY7B 5DEZA 1QZ1A 4J12A 2A77H 5INCA 2P8LB 3WFDH 1BVKA 4JO3L 5K93A 2YA0A 4MXVF 2D0GA 4H8WL 5DJ6B 2A73A 3MYZA 4ZQKA 4MXWH 5IMOB 1BECA 3LH2H 4DWHA 4FFZH 1MCQA 3N85H 2OK0L 3DX7A 2C3WA 1JHLL 4X99A 5KVGH 4F37F 2BY3A 1H3WM 4UINL 2PXYD 3BEWB 1MCSA 3MZTA 5I71C 5I30H 4NQVB 1R3KB 3PDOB 2F58H 5EC2B 1LEGB 5F89B 4GXVL 1PG7W 4ZSOA 1Q9WB 5SWQA 4CRPA 2J8UE 3B9EA 3LEXB 4M1CD 3C5JB 3OAUL 4M1CC 4OUUA 1URLA 4TSAL 4F7EA 3JWDL 2BMKA 1CGTA 4EOWH 3WUWB 3B9KA 4JZNB 4E0RB 4H26B 4JLRB 5I75B 5IB4B 3KLDA 3RHWF 1FL5B 3ULUD 2PYEE 3MC0A 3HG1E 2UUDK 3ULUC 1RAMA 2FO1A 4JDVA 4LNRB 5DJXB 3TYGH 1F6AB 4PGEA 5IEHB 4C4KT 5F7EL 1FYHB 3UYOD 4NSKB 4C83A 5E2WH 1OQXA 2ENYA 2Y6SD 4PJ5A 4OZIF 3FHQA 4OKDA 2E7LA 4JVWA 3P2TA 1MQKH 2V9RA 4OFYD 4GKOA 3MXVH 5IMMA 1JF6A 2H32H 3W2DL 3E1F1 2HKHL 3GSNL 3L9RB 5GRVL 5HVHC 2FX7L 1FIGH 2GI7A 4PUBL 3MGTB 4JQIH 1R3HB 4YEEA 2X7LB 2DQDH 1U42A 2E9BA 1QFWH 3VD3A 1ZV5A 1MCWM 3S98A 5DS8A 4TUKH 1UJTA 3GMNA 5EO9B 2LU3A 4PJXF 4B50A 4DKEH 2MNUA 5L2KA 1CGUA 3TT1H 3HNVL 3L3KB 5E8EA 5F1KC 2I5YL 4UTBH 5GJSL 1RUMH 1J8HE 2VLRB 4RCAA 1T2QH 1IAIM 4MJ5B 4IRSD 4WFEE 4ERSL 1WWAX 4DEPC 4LLWA 4ZMAT 5DK0B 2CDGA 1CL7I 4BZ1H 4OBSA 1PKQE 5IW3A 4YH6A 5CWSB 5FO8A 3Q6GL 2W9DH 4CBPA 4HJ0C 5CP3A 4JG0H 2EDYA 1II4E 1FJ1B 4HAFA 2DKSA 4RAUB 4X7TA 1JWMB 2YPLA 4ZFOA 5LVEA 1SM3H 4X6DF 4JRXD 4MB5A 4JM4H 2QHLA 1UM4H 3OAYK 5JHLL 4X7FC 3JSSA 1NH6A 2F5AL 4M1DL 1QSEB 1F4YH 3OKLB 3WKMH 5DHVB 3QO0B 2AI0L 2IAND 3PIQA 2QQKH 3OAYH 2B1AH 4QOKE 3VFOA 4I0CC 5JW4Q 5DJDA 3ALPA 2IH1A 4XX1E 5I9QC 4WW2B 1Y6NR 2CIKA 3P4OB 1CDCA 1NAKL 5L88H 1CICD 3JUYA 2W9EL 2CIIB 1CICC 2XNAA 3L1OH 1F4WL 3P40A 2CXKA 4NQCB 3QEQB 1H8SA 4TSBH 3VRJB 1WZMA 5F21B 2BX5A 3GK8L 3O8XA 1Y18B 5CS7A 2L7UA 3O6KH 3PWUA 2PO6D 1J1PH 1IMHC 2M8XA 1KLGB 4KROD 1UWXH 2XXMB 4KJWD 1FAKT 4KROC 4X8XA 4KJWC 4HKBA 3W0WD 2PCPB 5L8KB 5E1AB 4RGMC 4PJ9B 1RURL 1BFOB 5DTFB 3MXWH 2OR9H 3BKCH 2GCYA 1J1OL 1D5XA 5TE6H 4PJDF 4UOW1 5K33A 3EOTH 3D25A 4JANB 4RMRA 4DTGH 5FA3B 1ERNA 3A67L 5DURD 5SWZE 3BDYH 5GGUA 4QTIL 3GBLA 1PYWB 2PXYA 15C8L 5ADOH 4JCLA 1YN6B 3U0PB 2AS5M 3KPNA 4QTHB 5D2LE 4YEFA 3DRTA 1XCTA 3RUGA 1IAIH 4XNQA 1XGUA 3GI8L 5GHWH 3PE9A 4FTVD 3PWVA 5EZIH 1NQBA 4N5UA 4WENB 5KVFL 1JFQH 4BZYA 3S34H 3J7HA 1BZ7A 1TZIB 4J4PD 1NGPH 4YDIL 4J4PC 1A47A 4LPWA 4X9GA 4DZBA 3MRHA 3KLAA 3TBWB 4LLUB 4JPWL 2OSLB 4LGSB 5ICYA 1MQ8A 2XKSA 4TUJB 3I2CH 2YWYA 3BE1L 3ILPB 2VJXA 3AREA 3ORJA 3V5KA 4XP1L 1JK8A 1MJ8H 4LLMB 4GRWE 1A7NL 4KHXL 1P4LB 1GHFH 2X40A 1FNHA 4OFYA 2DL2A 2P43B 1J10A 4K8RD 3HI6H 4NRYA 4ALAH 2GK0A 3SHSA 2BNRB 1MEXH 2A6DA 2FR4B 1FDLL 3TO4B 1EZVX 5DZNA 4WGWB 1D5IL 5ANME 4P3DA 1H8NA 1T0NB 3A6OA 3WNOA 3U7YH 1FGVL 2ESVE 2C7UA 2X09A 4QRPD 1TJIL 1NBYA 3BW9A 4P4RB 4U3XA 2B20A 3HN3A 1F3DH 4QGYA 2DIBA 5DMKB 5I1JH 2CMRH 4KKBD 2YC1A 4NNYB 4Q6IC 1M7IB 4KKBC 1XT5A 2IPUG 1YMMD 4I2XB 4TVPL 3AAZA 1S9WA 2M1KA 3T4YB 1T21A 3MJGX 4IRSA 4XBGB 2EH8H 2HLAA 3AB0B 3IAQA 1LO0L 4N0RA 1F02I 2J4WL 1LILA 2XI9A 2NR6D 2KL6A 3BKJL 3MRLA 4YGAB 1N7ML 5T3XL 1F2XK 3SJVE 1IGCH 2NR6C 1AR2A 1MCWW 4XPGL 4N0YH 2EE3A 5CP7A 5D7LB 1JE6A 2XFXA 4PJBF 1NFDF 1UM6H 4ONHB 1IM9D 5E5MA 4F57L 3MRMB 1KNOA 5CEZE 1FIEA 5C6TL 4JRXA 4HG4K 5E70A 3S35L 2QQLH 1FNSH 2JELH 4GRLD 2IANA 1QEWB 1DVFB 1CWVA 4Y1AA 3VW3H 3FHAA 3BISA 2KPNA 1MLCB 4M6OH 3ZTNH 2R2EB 4YZFF 1CICA 3BH9A 3ARDC 1INDL 1C08A 1BF2A 3TJHD 5AYUH 3VCLB 1LEKB 5BV7C 3X3FL 4NQDE 1FZOB 2ZUQC 4XAWL 2ICCA 3SE4C 2A74A 4OCXL 3T3MF 3QHTC 4EIZC 3UTTB 2PO6A 1F45A 2F53D 2AABL 4YHZH 5KJRL 4JGMA 1U6AH 3QIUB 5FOJA 3W0WA 4R7DB 5FHAL 3MYJB 1NMAL 4RGNC 1W0VB 2VXVL 3ZKXB 5E8DL 5I8EA 4NGHL 5MERB 4APQB 5KSBB 1V05A 1OP5K 1IGMH 4RMUA 4BELD 3DMMA 5B3JE 5IGXH 5GGRY 1DE4B 1GGBL 2D7MA 2EE2A 3W9DA 4WHTB 4ZAKB 3S5LB 1ZT7B 3F62A 3IT8D 4WW1A 5IROC 4U1KB 1OTUD 2E8ZA 1PJ9A 4QHUB 1OTUC 4O58L 4LVHC 1G7JA 5I1CH 1IZKA 4X9IA 3VD9A 1E6OL 5CHNB 3DWTA 4HHAA 3O3BA 3S37L 1QSVA 5ESQB 1A6WH 2OR7A 1O7VA 3H3KA 4JCMA 4QLRA 5CIPB 4YFLF 5FKAB 4MZ2A 3SGEI 4WWKA 5MENB 3H2WA 2BRRH 3IDIA 4C56E 3QWOA 2G5BA 4J4PA 2NY3D 4JFQA 2NY3C 2MPAL 2Y5EA 1FQ9C 3L3GA 3Q5TA 1CGVA 1FNGB 3MV7D 2E7CA 4XC3L 5AUMB 5ACMA 4OV5A 3QDJD 4Y5YB 1D5BA 3DGCR 4K3JH 2ZPKL 4HIJA 4WTXA 4XNYL 2Q6WA 4BUHA 2BOBA 3M8OH 4I3RL 1I4FA 5BCAA 4LKCA 1EJOL 1MCBA 3FB6B 3NCBB 3WFCH 4XP5L 2EYTB 1AXIB 2RFXB 3VFGH 1FNEA 3O6MH 1IBGL 2QJDA 5HDLA 4KKNA 3MSPA 4YXKL 1NCAL 3PV6A 3V5HA 3X11B 4HIEA 3ULVL 2EH7H 3HMWH 3KYNA 1JGDB 5KBNC 1BAFL 4YGVA 3UAJC 4N1HB 1A6VL 2VL4A 1I3RB 2CRZA 4OCSH 1FV1B 4P57B 5LKNA 2BVQA 5CEXB 4QRPA 4OM1H 1NDMB 1I7UB 4QRTA 4Y1AE 1OY3B 4UBDD 3B3IB 5J13B 3PP3K 3CFJA 4Z7UA 3STLA 4LNVA 3FAXA 1YMMA 4Y19E 3V4VH 1F3JB 3IDMA 3PP3H 1V3MA 3FQRB 3BPLC 2AJUL 1KIUA 1AE6L 3D3VE 2KBGA 4Z77A 5B21A 1MREL 5TH2A 3I50L 3BUTA 5DD6A 2EC9U 3AU1B 5FYKU 1P7KA 4MJ2A 2FH6A 3F65A 4Z95H 5MEOA 1XIWB 2ICWB 1S9XA 3OBAA 1IM9A 4HLZH 1KCLA 3TV3L 1ZMYA 4AIZA 3V6ZB 3ECBA 1N5YL 2AJVH 5DHVH 3TEUA 1K2DA 4I4WB 2ZSWA 5FCUH 5D2NB 5DD3H 2R1YA 1T7WA 2VDOL 1QFOA 4GRLA 3R06B 1A0QL 4JO4H 4O2CB 5E4EC 3TJEL 1FSKB 4AT6A 3BI9X 2DJ4A 2HTLD 1RVFL 4X4XA 7FABH 4BFBD 1EDQA 4DVBB 5ESVB 3P0GB 4OLYL 1IE5A 3STZB 1EX0A 4U1SB 1OARH 4U3CA 3FN0L 4HLJA 2J88H 2F53A 3T1FB 3C60A 4ZXBD 1NGYA 3MX0A 4ZFZB 5FXCH 1NFIB 2UYLA 3HB3D 4ZXBC 3D69B 2PKDA 3GHEH 1W72L 3HB3C 4GG8A 1HKFA 3VWKD 4BH8A 4MCZB 1CGWA 3B83A 4N8VB 4Q9QL 3VWKC 2XPGA 4BZ2H 5DA4A 3IDYC 1MUJB 4UQ3B 1U8JB 3TN0B 4LPCA 3NAAL 3NPSB 3VFRB 1LQSR 1LVEA 3QUMB 2VIRB 4GW5A 4LSVH 3IFLL 4WHDA 1QRND 5TDOB 3SCMB 5EU7C 4OZHE 3KR3L 2QQQA 4PJFF 1KENH 1FVDB 4K3EL 1OAZH 1GZQB 1KN2H 1I9JL 1MRFL 4OJFH 4Q9RH 1JZ6A 5C0GA 4G5ZL 3VRIA 4XVSL 3UPAA 1RZIB 1V7ML 2YD4A 1JNLL 2YKLL 1HHJB 4JJ5A 2CKBB 4JPIA 2DL9A 3E2HB 1FPTL 2P42B 3RVTD 1AKJA 5E6ID 1N2RB 5BMFH 3RVTC 5E6IC 3UZQA 2J8HA 1RMFH 5JW5B 1CLOH 4HS8L 1LNUB 1ZANL 2HFFB 2YUXA 3MV7A 5FYLL 1AXTL 2UZYB 2PUQT 3QDJA 1VERA 5I15L 1KXTB 2C1PB 5GIRA 5MP6L 3HUJE 1TDQA 3GSQB 4HXAH 1D9KD 2FJFB 4DK6A 4P2RE 5HHQB 1U92B 2BY0A 1D9KC 1I1YB 3NZHL 1SJHA 5IBUB 5FECB 5EIIA 2ED8A 4L3CB 4ZYKB 4G9DB 4I9WD 3WXWH 3MUY1 1KPVB 3KPMA 4PJXB 4ZS6D 1S78D 4ZS6C 3FQXB 1S78C 1R5VB 4M8QA 4QO1A 4YHML 2NY0B 3CDYA 1JGUL 1RHFA 3QQ9C 2DTML 4KAQL 3GSNA 1HWGB 1HIMH 5EBGA 5EWIH 4NO3B 3UJJH 5DMIL 3MNVB 2W0LA 2ZJSL 3B43A 4JKLA 1QSFB 3TYFB 3V52H 5GRWA 5E8NA 1A14L 4DOHE 1VGEH 4K23H 4F7CB 5ID1B 4PP2A 4K7PX 2WBJA 1G0YR 3UTZA 2LU4A 2XRAH 4S1QL 4X80H 3ARZA 1UYWL 1HH6A 4NHUB 4KZEL 4WY7H 1CTOA 3L7EA 3UTSA 4TNWK 3P4MB 2OJZH 4OGZA 1A8JH 4D9QD 3EYUL 5I19L 4YHOL 5T3XD 1WCBA 4KUZL 3UC0L 2C3XA 4QRUA 4M43H 3CVIH 4NKMB 5HPMA 3EGSB 3OPZL 1JI1A 4YX2L 4PLNC 4XCEB 1J1XL 5J7CC 4R90H 2CO7B 4PPTA 2QSQA 4BFEA 1IVLA 4RFNC 3FT4B 4IDJH 2V2TB 2HT3C 2GJZB 3QUXB 4XGZB 3RWHB 1QYGL 3PWPB 5CINH 4NUGL 1WK0A 4PB9H 4L5FL 4NO0D 1HH9A 2IFGA 2P44B 2CJUH 1I9RL 3EDFA 2FB4H 1WZ1H 4RAHA 1MIEH 1NCWH 4LFHD 3MRGB 3T77A 2J5LB 2BCKA 1ZT4A 1H5BA 4OCYH 4MGXA 4DCQA 3GMRB 3IGAA 1FG9C 1I7TA 3HZYB 3E3QE 1K4DA 3VFSA 3D85D 1F58L 1JPFB 2JB5H 3TBYB 3PDGA 4QT5B 3VGAC 2MSPA 5IMKA 4PJDB 1VCAA 2ARJA 2VQUA 4LVNC 4K94H 1JZ4A 1GVIA 1LHZA 1JHKL 3VA6A 5HVGB 4ZXBA 3PP4H 3QNYA 2RGSA 1QKZH 4Y4FD 1UVQA 4HUXA 5AAMA 3Q6FB 4Y4FC 3LKPB 3QNXA 4OGXL 4OFDA 3VWKA 4HXBL 4KTEH 4Q7DA 3PABB 4UV4L 4AG4L 3UX9B 4M7ZC 1ORQB 3W39B 3GMOB 3E8UL 2Z35B 3EOAA 4MD5B 1ZHBA 1WT5C 1W8NA 1G7HB 1I8LA 4W6XB 2WMPA 3GNML 2HFTA 4IOSD 5ICXA 3TF7C 5C9JA 2XTJE 3I3BA 1QRNA 3V6FB 3FB7B 1IZJA 1U8QA 2XZCL 4G42A 1OSZB 3H7BB 1U8OB 4PGDB 4LLVA 5EUOF 4X0KA 1UWGL 3QJFA 4Y4HC 1MFEH 3WEXB 4XZUB 3HNSH 3MA7A 5D7JB 5CCKH 3TVMB 2YA1A 5E6IA 4RAVA 1AO7D 1KJ3L 4G9FA 1BREA 4MQ7A 4ZTOL 3EDEA 3NFNB 4JHAL 4O51B 3K46A 3IDJB 5HYJE 1SJEB 3UTSE 4K07A 2GK2A 1WBYB 3JTTB 4KPHL 2QQNH 4GRMB 5FUOL 3K2MC 1ETZA 1I1AB 1EHAA 3FFDB 4JFDD 5D6DC 1HI6A 1EO8H 2P1YA 1D5ZA 1K9TA 1CXFA 3DVGB 2VNCA 4JFXA 4RQQB 4Y8DC 3IFOA 3U4BL 4MZ3A 3OX8B 1ND0A 1MCPH 4CVXB 5DUBA 3CVHA 3ARYA 3BJ91 3A6CH 2E27L 1QOKA 3OKMB 4N8CH 5FUCC 4GT7A 4HX1B 1QD0A 3GHBL 4P5KA 4E5XB 4ZPTB 4NUJA 3FO1B 1G7LA 4NBZB 2L0DA 4TN9A 1JBJA 3MROB 4J6RL 3U4EB 4G6FB 5FDYA 4YHNA 5E94B 3UYRH 5E5RB 2DQJH 1INEH 1JPGB 1RIHH 2WLYA 1NFDB 4KJYB 1BOYA 3V9FA 2DJUA 4JO2L 1NC2D 3ILQD 3WL9A 1QPPA 3TPKA 2Y07H 3ILQC 1FZKB 3RWDA 1TIUA 4NKIL 1T1XB 1NEZG 4YJZL 3IF1A 1U3HD 1DL7H 5E2TL 1ADQH 3AROA 3D18B 3IKCB 5EBWB 2X4RA 4Z76B 3T0EB 3DBXA 3QAZC 2FEEI 4JEGB 1OM3H 3BESR 5AD0A 4PJ7B 1AD9A 2HRPL 3SE9H 3BWAA 3ZDYE 1CFVL 1M7DA 3R0MA 3VMPA 3DSFH 1CFQA 5IT2L 4A6YL 1XGTB 2NXZC 1B6UA 1WGOA 1RJZB 2X4SA 2ZOLA 4X5WA 1SYSB 5D71H 5BW7A 5LAXA 3ZKMC 1LO3H 2YPKA 3ZT7A 4HH9B 2ID5A 5IFAH 2X1WL 5CJOH 4KDWA 5C9KA 4WU5B 4FQXD 3GGWA 3RWCA 4J2XA 3V8OA 1AFVL 5E0QA 4NWTH 5I1LB 4NO0A 1SY6H 1T3FA 4UT6L 5ACZA 2A83B 1AC0A 2DWEB 3MV8A 4XX1G 4G9FE 4F37K 5JNYA 5GS0C 4G8FB 4HF5L 1R6VA 5K9KB 3PJSA 3D85A 4MJIA 2CDEA 2DKUA 1CU4L 4X83A 1KCSH 1RZ8B 4IOFD 5DWUL 4JHWH 1UACL 4XWGH 4IOFC 3O11B 4FXKB 4PRBA 1QO3A 1RJYB 4Y4FA 2VDNH 4CMMB 4Y88A 4J3UA 2R0LH 2VN7A 3BZ4B 3KPSD 4UDTA 1NC4B 3WDIA 3QQ3A 2HH0H 3W9EB 4LLQA 3FFCD 1KIRB 4L29B 5TQ0H 2E9IA 5EOTB 1IC4H 1T7YA 4Y2DD 1WT5A 4DGYH 5IHBA 2P24A 4Y2DC 1I3GH 4PGZA 4H25A 1I1CA 3V0VA 1KJMA 1RIUL 3QPXL 5C09D 3K4DA 4EDXA 1KN4L 3AMLA 1A7OH 2AVGA 4V1DB 4NBYB 1IILE 1R3LA 5ALBL 4GAYB 2AJYH 4KQ4L 4WV1B 3QEUB 2VKWA 3QXDB 3QG6A 1INQA 2FGWL 3QDGE 4O5LH 5JR1L 4M62L 5EFIB 3B8YA 1YY8A 1U93A 3SOBL 4GRWF 4BQ6A 1T03H 1WCQA 1HCFX 1MIML 1AO7A 2ZP0T 2ZCKH 2WIMA 3LSOA 3MLSH 2EC9T 4M7JH 4TVPE 3TC9A 2AEQL 4YE4L 4DN4L 5E00A 3GBML 1MCFA 4JFFD 1HXYB 3AS2A 1OAYL 4EVNB 4WJ5A 4I0PB 3O6FD 4NC2B 4OGAD 1AQKL 3O6FC 1BWMA 5J1SC 4RMVA 2NZIA 5T3XE 3BGMA 4JFDA 5E9DD 3WMSA 4JQVC 1LO4L 2EE6A 1RHHB 1IQWL 4EUPA 4PRNB 3FOMB 2FECI 4OLWH 1DN2A 2YN5A 1YUHA 3SQOL 2IMNA 3R1GL 1AHWC 3TH2T 1ZA3A 1JZ3A 3S3JA 2R1WA 1NLDL 4JFPA 2OXGA 4ISVB 5GQBA 1JHTA 1BX2A 2DDQL 1TZGL 2GW5A 4NBXB 4KGLA 1GC1C 4DQOH 3MGOA 2SEBB 5TPWL 1LO5B 1OTTC 1NDGB 5E6YA 1L9NA 3VGGA 4R8WH 4OIIH 4XPAH 1ES0A 3MZGB 3RWIA 4MDJB 2DLFH 3MV8E 2X4NA 5ICZB 2BSRB 5DR5H 2LABA 3MOQA 4LSQH 1NC2A 2GSGB 4MJIE 5B4MD 3HMXA 3GMMA 4PB0H 5B4MC 4FQJL 4ODSL 2HN7B 1U3HA 4S1SL 5A40E 2B1HH 4KRPB 2YRZA 1NUNB 1CQKA 5FM5M 2JTDA 2CD0A 5I1EL 4UILL 5DJYB 2HLFD 1EFXA 3RUGF 2AK4A 2P8MB 3MRDB 2YMXL 1T2XA 3NCMA 2EE9A 3SY0A 4AZ8A 5EZLB 4TRPL 5TDNB 2K7PA 5DRXB 3GSRA 4X7SH 4G6KL 1U8NA 5I1IL 3DTXA 4K9EL 3ULUF 3O2WL 1JNHA 5E95B 5TQ2H 3QH3A 3G04B 4XMLH 3ARBB 5IFJA 4FQXA 1B0GA 1MFDH 2YD9A 3O6LH 2DQHH 3OHXA 4WIQA 4XPBL 1OP3H 5KVDH 4HG4J 1IGTA 5D7KD 1ZVYA 1JPSL 1ZVHA 4L3ED 5C0AB 1RI8A 4NQEB 1KT2A 1AO7E 1N0XH 4M6ML 1KUMA 2H1PL