4OGAD

Insulin in complex with site 1 of the human insulin receptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin A chain
publication title Protective hinge in insulin opens to enable its receptor engagement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/hormone/immune system
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogaD00
4JG0H 3BKCH 3D69B 3E6HB 3ZDYF 5DMIL 5FOBA 3QISA 3NN8A 1KTKE 4OT1L 5EC1A 5TQ0L 2AABL 2E27H 2BFVH 3KHOA 5ICZB 1OL0A 2QHRL 3GSUB 4XMKL 4O2CA 1VCAA 3NFSH 4EN3D 1V7ML 3IDXL 2GITB 1HWHB 3OJMB 1T4KA 2BNUB 4Z5RB 5E9DD 2FWOA 1FYTD 5F9OH 5FGCE 1X6LA 1M05A 4LCIL 2XRAH 4RMWA 4X8JA 3GMRA 5D72H 4C56B 1NGZB 5CEZD 1TQBC 4GBXA 3QQNA 3H9SD 2X4QA 1NBQA 1FFOA 2IBZX 2OJEA 1NCWL 1Y6NR 4Y5XA 4UDUA 1OM3H 1HEZA 3UTTE 4DQOH 5DR5H 3SGKC 1RU9L 4R4ND 1PVHA 5CP3A 4G9FE 1OY3B 1LK2B 3JWDC 1R0AL 3K7UA 5E2JA 1JZ5A 3B9KD 1I7TB 4XCCH 4R6UA 4S1RH 3O8XC 4YX2H 4NO3B 4RSVA 3OMZA 5T1DH 3X11A 4XNMB 4YDKH 1BQHB 5JW4Q 1FH5L 3VXUE 4U1NB 3TO4A 3K8KA 2LQRA 4X9IA 4N8VB 3VFNA 1LE9B 5B22A 4I0PA 4FP8L 1N64H 1NEUA 2I60H 3U36B 3MV9A 3PWJA 1NC2A 2GK0A 1NGYB 4XXDB 2NR6C 5DZNA 5KSAD 4JAMA 1I1AB 3AY4C 1NLDH 3CPLA 3F7PC 4JFED 4H5SA 1JRHL 4FTVA 1EO8L 2CLVA 1JTTA 1GHFH 2DD8L 4QRUB 3AM8C 4PJGB 1FL5B 3IJYA 5F6IC 3EAKA 1FDLH 1V8HA 3DX7A 4FQJL 4M5ZL 4GAJL 5JHLH 1PLGL 3Q6FB 1NAML 4XMLH 2XTJD 4DGIH 5CJ5A 5JOPE 5E56A 2BHUA 2IANE 3HFMH 3QUZA 1F6AB 4DOHE 1UM6H 2DMKA 3J7HA 3S3PA 1I3RB 3NA4A 1VGEL 1Z2KA 2VXTL 1DANU 4JZJA 5HDOA 2YWZA 1KPRB 4YFEA 1ZEAL 2CSPA 3QDMD 3IDIA 4GXUN 3AAZB 3W9EB 2X89D 5GS0L 4KMQA 1MI5B 1QBLH 3C2AH 1S5IH 5FYJH 1AI1H 1DVFA 4WDIB 3QWOB 4IMLB 2C1OB 3SQOL 4O5LL 1MWAA 3ZTNH 4J3XA 4P4RA 1SBBA 4KJYB 5GGQL 3MRCB 1CLYH 2OQJA 3H9YA 4Y16B 2J12B 3BJLA 1A2YB 3FQUB 2CLRA 1F3DH 4PJIE 4BA8A 2BNRB 2XZZA 2Y06H 1TZIB 1FRGH 3MGTA 1U8OA 5JW4R 3SPVB 3NCCB 4XTRD 5HDLA 3V6OC 5IFHH 3KYNB 3IFOB 3O2DA 3ZTJH 2D7QA 2W9EH 1NMAL 3GSNH 1HHKB 1I9EA 1Q38A 4NQDD 4M48H 2W9LA 1KJMB 3UBXB 3MV8B 3EYUL 2FRGP 2XN9A 4J8RA 4GMSH 4MXVE 7FABH 4TULL 2VUYA 2F9BT 4PIRF 1QKZL 4QRPE 3G9AB 5DDHA 2V17H 5D2NA 3QIUC 3X13B 1KCLA 2OMNA 1ACYL 1X3DA 4F15C 2R8SL 1OAZL 3CFBA 5BO1L 2DBJA 3OKMB 4P9HH 4AL8H 4QYOB 4PJFE 5C0AA 4XPFL 1SJXA 3PGCA 3U1SL 1EEYA 2W91A 3DGGB 1RZ8B 2CRZA 4RMTA 2X41A 3WIFB 3JTTB 2YSSB 5T3XD 4NKOB 4XNQB 3SJVE 1ETZB 1PJ9A 1S9XA 2BSED 4TNVK 3B2UC 3M8OH 5F8RC 1OTSC 3FKUS 3SDDC 3QFJB 4JRXA 2QKIA 5HHNA 3BSZH 3I84A 2R56L 2W1NA 4G6KL 3D39E 5KSVB 1OHQA 3ECBA 3U30B 4M1DH 4HUXB 1YNTA 3QA3A 1YMMB 3O6FC 4PJIF 3P4NB 4Q9CA 3PHSA 1TVHA 4JZNB 2CKBB 2F54B 3FN0H 4X9BA 4PS4L 5CINL 1I7RB 4KXZI 1LILA 5HYJA 5DSCA 5E99L 4G43B 3ARDD 4CW1A 1EH9A 4CADB 4KI5E 4M7LL 4ZFGH 4PJEB 3L95B 4FRWA 5AYUL 1WK0A 2EYTB 4O2FB 3FOLB 5F9WB 3C08L 4JFFB 4LARL 2WWKO 3OKOA 1A14H 1IEHA 1IAOB 3REWB 4APQD 4R9HA 4MXVF 5C6TL 1J05A 5GGTL 4AEFA 4X6DB 3M45A 2XICA 3LRSB 3F7VB 2X1XR 2BCKA 2HKFL 4NC0B 1NCTA 4GKSA 4Y2DA 4YDLB 3TM6A 3BYTA 2H8PA 1RURL 4NKMB 4NZRH 4LLMA 4PJFF 5GJTL 4CUCA 1FV1A 3FT2A 5CEZE 5C0NC 4ORGA 3TN0A 3ZKMC 1B0RB 2XKNA 5DC9B 1W0VA 3U4BL 5DEZA 5ELIA 1LGVA 5F7EL 3BZFA 3UROR 4OLEA 3Q5OA 2A73B 4IDJL 4M1GL 1IAIH 1MCOH 2J5LB 5L6YH 5EFIB 3WCYA 3ZKND 1BX2A 4KKCC 3KLHD 3I75A 1MCBA 1LHZA 1MY7A 1TZHA 4N5EC 1IGYB 5DK3A 3C5JA 4Y4HB 2XQBL 3SE3C 1JF5A 3RTQB 4RIRA 2VLRA 2E8YA 2HYMA 3JV6A 3AC0A 4L8SA 2NY6B 4RAVB 4BQ9A 1TFHA 5EU6B 3V4UL 4O51A 4GKOA 4WFGD 4H1LH 5IG7A 5EO0A 3O3EB 1S8DA 2EDHA 2O5ZH 4LEXL 3X3GH 3WHXA 3LZFL 3H42L 5IKCB 4I0PD 4UV7H 2HJKB 3I6KB 3LD8C 4D9QE 4XGZA 3S96B 4U0RB 2V2WA 4KI5F 5IVNA 3MV9D 1HQRA 1NC2D 1M7DA 3QULA 4NRYB 4BK4A 1QEWB 1G9MH 2MSPA 3BUYB 1YEHH 2EIZA 1C5DA 4NNXA 5GGVL 2D7TH 4GW5A 2VDQL 2XTJE 3I6LE 4PY8J 5JLZB 4XB7A 4N0YL 5MEPB 4OZIB 2NXYC 3V5KB 4YXKH 2R1WB 4P4KA 3CFCL 1J5OH 1CGWA 4K2UL 3E2HC 1KEGH 4FQ2H 4LDLB 4HJJH 1U3HB 4PJ7B 1VB9A 2GAZA 4XC3H 3HC0A 1MFDH 4PR5A 4LVHB 1C16A 5DURD 4PLJD 4PJXF 3JZ7A 5I1CH 2EC9T 2D4FA 5EZJA 2AEWA 3B5GA 3KPNA 1TVDA 3H3KA 3ABZA 5GRWA 4CN6A 4CVZA 1YYMH 2DF3A 1AC0A 2AJUL 4M43H 4NUJB 3S35L 5IEHB 2YD1A 3BVNA 4HK0A 4OLUL 3V2AR 1UJ3B 1UEYA 4JDTL 5TGBB 1IQWH 4WRLA 3SBWC 2C1PA 1DVFD 4JY6B 4Z0BL 1IC5L 2OM5A 1F4XH 2NZIA 4ZXBA 5IBUG 1TPXC 1E4XH 5ITBL 1IEAA 1U6AL 3C09C 4U1JB 5ESQA 4DUWA 1OT1A 1WWAX 3KS0H 2RFXA 5CLWA 5MI0C 3K1DA 3LKRA 4XBGA 3IFLL 4J6RH 1KOAA 2YD2A 3VI4E 1KULA 4R2GC 3BP7B 4AEIL 4KY1L 4YXLH 4XVUD 3C5ZB 2NPLX 1A7PH 5TE7H 3IFPB 3VXNA 2CR6A 3GKWH 4EN3C 3DHMA 5K9JL 2XZCL 1QRNE 1RI8A 3MOBL 5ECJE 4I48B 4UQ2B 3EDEA 4XXCA 2WINA 5DK2B 4S2SB 3UZEA 2YRZA 3T04D 3MLSL 2V9RA 1LDPH 3DVIA 3MREB 3QFDB 1QZ1A 4HKXB 2P5ED 5F9JB 3IRPX 4XNXH 1YQ2A 5FO7B 1A0QH 3FB6A 3VFUA 2X4SA 5E6YA 3LH2L 3MLVL 4DVRH 5T3XE 5F7HA 1D5XA 2Y6SC 5C0AD 4R4NC 1R3JA 1WAAE 2BVOB 4P2RA 1I9IL 1IKFH 3WJJC 1P4BH 5FA4A 2FEDC 3QXAA 1BVZA 1YEFH 2AV7B 5JQHC 2ITDA 4PJHE 1ORSB 3QEHB 1CIDA 4YQXH 4XAWH 4JCMA 2F74B 3O41A 2Y5TB 3CDGA 4JRXD 4Q7DA 3OJVC 1LO0L 3AMKA 1WBXA 4P48A 4YO0A 4O58H 3A67L 43CAA 4JVUA 3HRZA 2N1KA 5IFAL 5EU5A 4CJ0A 5FO8B 4K8RD 4NT6A 5ISZA 1T7WA 1UQSA 2IG2H 4N1CA 5FUZH 1FFNA 2HH0H 1E6JL 1WBZB 4HS8H 2WAHA 3VI4F 3KJ6H 4PV8A 1EHXA 2A9ML 2CUMA 4WFHD 5LBSL 5HYJD 4HF5H 4D0CA 5EBMB 4EDXB 1JP5A 4DCQB 2VIRB 2D03L 1NMBH 4NCC2 4Y4KB 4QHUA 4WWKA 4X9GA 5DK0A 3QAZC 5F96H 3VFOB 4YHNA 4LVNC 4EEEA 1BMGA 3TA3B 1NQBA 2ZNWA 2A0LD 4F58L 5I16B 5CMAA 4PGDB 1H3PH 5EO1B 1NLBL 3RVXD 5CJQL 4Y2DD 2Q6WA 2WP3O 1XGUA 2OSLB 4G8IA 4EI5C 1EUTA 4HAFA 5LGHL 1WAAF 3AS3A 1A7NH 1OF2B 3CZFB 2XG5A 3WHE1 2E6PA 2HFGL 1YY8B 4UB0H 2HJFB 1PG7X 5DD6A 1D6VL 2HKHL 4MSWA 2QSVA 3H3BC 1EFXA 1F00I 2XIDA 4Z95H 1UYWL 3GJFB 1YUHB 3MLYL 1Q9WA 4YHLL 5IB2A 1KLUA 4FXLA 4GS7B 4PV9A 4XCNB 3OR7B 3VFGL 1Y6KR 3O6LL 1B4JL 4LNRA 2R4SH 1JJUA 3C6LB 2OX5A 1CE6A 4WFGE 1ZLSL 5K9QG 3P11L 1FHGA 3OWEA 2MMXA 3U4EB 4MQ7B 3P77B 4XTRC 3DETD 3OKEA 4PRID 1I85C 1ADQL 2NMSA 5EORL 1LK3L 1KN4L 2X4OB 3TJEL 3W2DL 1MJ8L 3EZ8A 3BWAB 3QIUA 4TN9A 1MPAH 1MNUL 1KB5L 4EZMA 5T1KB 4NWUL 4HCRL 2VXSL 3HPJB 1N3NA 4FTVE 1FLRH 4KRNA 1A22B 4HWUA 1T5WB 2DQDL 5TDPB 3BIAX 4GXVH 5I6XB 1EVTC 1UADC 5I8KL 1CLOL 4R96B 4HHAB 1RHHB 5BV7H 3L5XL 5D2LB 1Z3GH 3E8UH 4XP4H 2A83B 3ULVL 4L5FH 4UMGA 1OB1B 3QNZB 5HGHA 1ZHLA 4HIEA 5BVPH 1XH3B 1FNSL 3U7WL 4MLIA 4KRPB 2YUXA 1INDL 4D9LH 3FO9A 4MA1B 1UCBH 3RZWA 4XP5H 1OSPH 4G5ZH 1G6VK 1TETH 3S37X 1TVBB 2HVJB 4N0CD 5E95B 1B4RA 2VKWA 1FIGH 4YBLB 5J7CC 5J6HB 3ZKXB 1VFAB 5E2UL 2P8PA 5I75C 1X5LA 2FSEA 1KCSH 1NGXB 4PG9B 3PHQA 4WUUD 4OTXH 4HLZG 1DL7L 4M8QA 1CTOA 1LO2L 3W9DA 1CD9B 1LD9A 4QRRA 4U1MB 3UAJD 5C0BB 4XBPA 4FQQA 3ARGB 1BZ7A 1J8HA 2BXZA 3RIAK 1S7SB 3SDCA 4APQC 4OZFA 5E7FA 4Y0GA 3NCBB 4BM7A 1QBMH 5IFJA 1P2CA 2PTUA 1WVZA 5C9JB 3QEGH 4KKLC 2V2TA 4PRAA 4YXHH 3KYKL 1EZVY 3V0WL 4I4WB 5DD1H 2RCSL 2XN9E 4XNUH 4ZFZB 4G3YL 3IDNA 2I07A 4J1UB 4XCFL 5HHOB 2IAMD 1VADB 1NAMB 3RY6C 5C0FB 1CYGA 25C8L 2VH5L 1A4KB 4HKZA 2WUCL 4HT1L 1ZA6B 1H8SA 4P57B 3MJ9L 1BEYL 3ZKQD 1W72A 2CDGA 1NDMA 4DZBB 3MC0A 1JWMB 3MBEB 2V9QA 3GO1H 5C0GA 3ZKNC 2XACC 4JQXC 3U6RB 1F58H 1QSZA 1S7WB 2UVFA 3BMWA 4NNPL 2F19L 4RCAA 3SHSA 5IJKA 1KENL 3G5VA 4YGVB 1MREL 2FYYB 4MX7B 1OWWA 3RWCB 2FHCA 4N8CL 5GGSA 1E4KA 1BP3B 5C1MB 5EA0H 2IWGA 5F71A 1SEQL 1YPZB 1ZVHA 5DMGD 2X4UA 2MKWA 4PP2B 3C9NA 3VWJA 3QEQD 1L0YA 3FHQA 2WBWB 3O4OB 3ZT5A 1DANT 1KPUB 1PYWB 5C0DB 3HMXL 1NMCC 2D9QB 3K4AA 3O45B 5IB5A 4UIKH 3VXOA 3NTCH 3S88L 3UDWC 1NCBH 4NRZB 4ODSL 4TUKL 4U2ZA 4HV8B 1NC4B 1Y0LA 4BUHA 4ENED 4WFHE 5HYJE 4LHUB 5ISZD 3O2WH 4MB3A 1KNOA 1KIRA 4MD4B 2H45A 1YEEH 1RUPL 1IC4H 1YNLH 3VWKB 3HRPA 1R5WB 2XY1A 1ZHNB 3MLWL 2ATKB 4ZFFB 1ZSDA 1QNZH 4JE4B 4TVPD 2B0SH 4XCEB 1CF8H 4F9LC 4A6YL 1EMTH 4UT6H 3EHBD 1U58A 3MJ6A 4DGYH 4WW2A 4FHBD 2IBZY 5JXAL 3RWFA 4WWKD 3LCYA 3MPCA 1KCRL 4JHAH 5C9KA 2GIYA 4JFZH 5K93A 2HTLD 2VISA 4X5WA 1FNGA 1QO3A 4JR9L 3LY6A 2P8MA 1BZ9B 4TTDD 1JPFB 1Q9LA 4JFDA 5SX4I 1E28B 3BGAA 4NKIL 1OARH 4RGMC 3BEWA 4HUUB 1T5XB 1F3RB 1ZANL 1IBGL 3CFJA 1UH4A 3W0WB 1CFSA 4ODVH 3BE1H 1SHMA 2D0FA 3OX8A 4LU5H 2E7HA 2P8LB 5DS8A 3VGFA 4MGXA 2JCCA 5C08A 2VLRE 2DQCH 5GJSH 3ARFA 4M6OL 3RVUD 4MVBC 1DBJH 1SY6L 4FFWD 4CVWA 2BMKA 3GJEA 1INEL 3QHFL 3FQWB 4MAYA 2CK2A 1L7TL 3GHBH 5F44A 4YFLI 3WFCH 2MNUA 2DQHH 4YHYC 5J1AB 5KOMC 4BUGA 3OGOE 2AXGA 5ID0B 2WWMC 1MHEB 4I9WD 4HUMB 4GT7A 4WIQA 2GJZB 2IGFL 1UKTA 4NO5A 1D5MA 2BERA 3SGDH 1YQVH 1VACB 2AEQH 4F7MA 4U7KA 4HFWB 1F4WL 2DLTA 4GG6B 3NFNA 5TFSL 4PGEA 2H3NA 4J12A 12E8H 5ALBH 3OKYA 1C08A 4MQXD 5GSRB 4HBCH 4Z7NE 2FGWH 2BRRH 3CVHA 3VFMA 3PXHA 3Q0HA 1PG7H 1AIFA 4MCYB 5EZLA 3ARBA 3ARWA 4FQXD 1X7QB 4NO0B 1V5JA 3H7BA 2F5BL 3RUGA 1XCQA 4EXKA 3SGJA 2AJZA 3ZLQC 3QO1A 1OGTA 1G0DA 2ILLA 5GIRB 4WW1B 5I1GL 3X17A 1CXIA 2IQ9L 5CUSH 4B41A 1NCUA 4QHKJ 5I2IB 2HG5B 2DTML 2RQ8A 1DQTA 3WXWL 4YGAB 5DRNB 3NCYP 4P2OA 2NXZB 4K8RC 2ZKHH 1H5BA 2OTUB 5DUBA 5MERA 1UA6H 2NW2A 5IF0A 3TYGH 1EXUA 2VXQH 2AI0H 4P3DB 2JIXB 3QPXH 3BPCB 1R3KA 3BH9B 1G9NC 3KR3L 2DJUA 2NY1B 3TZVC 2ESVB 5K59E 1U91A 3TP4A 4LAQL 5D1QA 4WEBH 1A3LH 1NDGA 1J8HD 1MLBB 4H25B 1NCDH 4JHBA 1GOGA 4XVJL 3A6BH 3MRRB 4C83A 2HT4C 5HDBE 4LF3A 1AXTH 1BQUA 3I02A 4RFNB 1YJDL 1KJ2L 3SKOB 4TPRL 1JIBA 4JO4L 3EJYC 5D7LB 2XZQL 5I1DB 4RAHA 1KYOJ 5DWUL 3RDTA 4Z7NF 3DXAA 3TJHD 3HE6B 3S37H 2W65B 2O5XH 1HINH 1YN6B 4Z0XA 4NZTH 1JV5B 3VH8B 3TVMC 4PJAA 3GSXB 5E2VL 4KDTA 2YKLL 2IADB 1IM3B 1FIEA 1YECL 3BGMA 4P2RE 4JQVC 3G5ZA 4ONGL 3N1MC 4M4RA 3TYFB 5C2BL 4JO1H 3HC3L 1QTYT 1K4CB 1GGBL 5DEFB 4KK8D 2WSKA 1R5IB 4G6MH 3L5IA 1MCWW 2VLJB 2ZCLH 4OCRL 2OYPA 4UINL 3LN4B 1TCRB 3E6HA 5DRZA 2VUOA 2XA8H 3RVTC 4ETQB 3DBXB 4YK4C 4NM8H 1JZ6A 5CSZB 5DZLA 2R2BB 4MD5B 4LHJB 1IL1A 5ISZE 5I71C 5ICZA 1OCWL 3LKPA 3LEYL 4IIQA 8FABA 5K59F 2GITA 1T22A 2PYEB 2WWKT 2BNUA 1XIWC 2G5BA 4X6BB 1Y18B 1EHLH 3MRGB 5DJ2B 5E24E 1T0NA 4TVPE 4ZS7L 1AGFA 4ORZC 2FB4H 1KT2B 5HDBF 1JGDB 2EDXA 5FEBA 2Z93A 2ICES 1JUFA 3RWEB 4UTAL 3D2UB 3WIHH 3L5JA 3SE9L 5L0QB 3LS4L 1G6RH 3MR9B 4WHCA 5D1XA 5DVNA 4MWFB 2GI7A 1LO4H 4RWYL 1UXSB 5CJXC 4OCNC 3SY0B 4K07A 3MBXL 2LU3A 5E4EC 3HS0B 4WO4A 5C0JB 5GGUA 1G9EA 4XWGL 4N0CC 1IGFL 3LQMA 4N8VA 4JFDD 1ITCA 3RHWK 1A02N 4NC1E 3UTPD 5C0RL 2VR9A 1YYLL 1FORH 4OUUA 5E70A 3FAWA 4EXPX 2IPTL 1WZKA 3GGWA 4ISVB 4AENB 5D6DA 5B8CB 2D31B 1T83A 4JFPB 3GSQA 1I1AA 3DJ9A 3MCKB 4AY0A 1EUUA 5GQBA 1TTGA 5FOJA 5AG8A 5FYLE 1FL5A 5DJ6A 1GC1C 4HKBB 5C08D 1D9KC 2VSDA 4IHOB 3O9WB 2QSQA 4Q2ZB 1AXSB 3ARFD 4ZO8A 3LKQB 4WU5B 1A4JA 3TH4T 5EPMA 4MA3B 2AJYL 4UIMA 3MACH 5D7JD 3FT4B 4KZEH 5DD3L 1VESA 1BQHG 5DF0A 4MAYD 1VPOH 4GRWB 1RIHL 4K3EH 3H3PH 5I30L 4R7NA 1I3RA 3OKKB 5JIHA 3U0TA 2QEJA 5KZCB 4N8VG 5F7KC 5DEGA 5FCUH 3WJLC 2VE6B 5F89A 2IAMC 5C3LD 4YC2B 5GS2D 3QUKA 4JGMA 5C07B 5BMFL 5D71L 3D3VA 4YDIL 5IVXB 3BOVA 4MQTB 3VE0A 1GZQB 3KHQA 1S7XA 5IT2L 2MCG1 1F13A 3P3YA 2Y7QB 4ALAH 4P59H 1A6VL 4Y89A 1JK8A 2KL6A 3BP5B 4BZ1H 1BOYA 1XF5B 1FZOB 2ARJB 3B43A 4H26B 4LLAA 1GL4B 1WLHA 3VXRE 3PQYA 3W81A 4KJYA 2O5YL 3GRWL 3ARBD 1U8QB 4Y1AB 4IRJD 4IMKA 3WNNA 4PJ8D 5IHUH 4HULB 1QFWH 3MSPA 4XAKE 3OB0K 3VG0H 3BKCL 4MNGB 1YN7A 3O4LB 3ZO0A 4MLSA 1Q1JH 2WV3A 1H8OA 4UV4H 1C1EH 4HBQA 4KQ3H 3KYNA 3QUMA 4GW4A 5CILH 3WIIH 2R29H 1KJMA 4BSVB 3NFSL 2X40A 1P7QA 3IJHA 1YY9C 2P24B 5HI4D 1I8KA 5F9OL 5D1ZA 4ZUUA 4YIQB 2XRAL 4QRRE 1OAYH 5IP4A 3QDGB 1RUQH 1P4IH 3X13A 3VRIA 3MFFB 4KRLB 2ADFH 1OTUD 5ETUA 4QYOA 1J8HE 1L6ZA 4OFDA 3S4SB 3WHE0 4KTYA 4JN1H 2CRYA 5LQBH 1OM3L 1FE8L 1KB5B 4KJPD 2XWBA 4OF8A 5DR5L 5CBEB 5JW3L 4Y5YB 1MFCH 4U1HA 3W39B 3RZCB 5D1QD 1CFTB 1H3GA 2CXKA 1ETZA 3P30H 4JFOA 5EBWB 4XCCL 4YX2L 2NLJB 3KPPB 5T1DL 4YDKL 1XF1A 3U48A 4QHMB 3NA9H 2CRMA 1BFVL 5FGSA 3UBXG 1P7HL 2LV4A 4D9RD 2GT9B 4DUXA 1WZ1L 3KPQA 1GVIA 3RDTD 4HUXA 4ZPTB 2VLME 1U92B 2AQ1A 2I60L 3WL9B 1KB9K 3P4NA 5I1IH 5MP6H 1NLDL 5JW4M 3ZYIA 3SCMA 4OZHA 1I7RA 1LNUB 3DHJA 1KIPB 1UFUA 2QR0B 5TPWL 3PGFH 5JXEA 4QCIA 3ULUD 1LO3H 1WJ3A 4NOFA 3MLPA 3O2DH 1FDLL 2VDKL 1WGOA 2RHEA 5B38A 4FFWC 5DJDB 5DC0A 3D85A 4E5XA 4PJEA 3QG6A 2EYTA 4XMLL 4DGIL 4GRLC 5FGCB 1IAOA 1W0YT 3MZTA 3Q6GH 4NO2A 1UM6L 1T1XB 1CBVH 3TBVB 5BZDB 4IOFC 1JHLH 2VAAA 2B1AH 2R0LH 1U8IB 3A6CL 3DVNA 3ES6B 5LAXB 3C60C 3R06B 5J3HC 3KLDA 1G7LA 2ARWA 5F7YC 3UTTB 3HB3C 1OAXH 3WFEH 1AHWC 1J10A 4G9FB 3G6JA 1AY1L 3FQXB 3C2AL 5FYJL 2B1HH 3O11B 2DQGH 4MQXC 2YEZB 3KPRA 4YHPB 3RL1B 2YD4A 2UY7A 2ZPKH 5ITFB 4C56D 3VXUB 1FO0A 3L7FA 4FQXC 1CLYL 5E8EB 1BJ1J 2MQ0A 2WP3T 2YPVL 4GSDL 1MCRA 1J11A 3AFLA 1R5VA 1NBVL 1S9WB 4NBXB 3DRQA 1X4ZA 3JVGC 4K8RH 3U46B 4CRPA 4OQTA 2Y06L 5D1XD 1AGDB 4QHNA 5DVMA 3TBTA 3QG7H 1B6DA 5J9PA 4JFDE 1P5VA 2EXYD 4FABL 4ZD3H 3T0AA 2D3VA 4WWID 4WO4D 4UDTB 3C8HA 1LEGB 4OJFH 1Z0MA 3UPCA 3GHEL 5E08H 3O3EA 3MNZB 3O0RL 1G9NH 5HHVH 2W9EL 3GSNL 1T7VA 3SEPA 2ZOKB 3DX8A 4ZPVB 4M48L 3QDHA 4JO2L 4QXTA 1A6WH 5B4MC 2DLEA 3IDMA 5DT1H 4RQQB 4GMSL 2YA0A 2PNDA 3FB5B 4MHHG 2IANB 1UB6B 2V17L 5I1JH 1KB9J 3BUYA 2JCCE 4LBEA 5C08E 1I1AD 2AVGA 4DOHB 2CJUH 4P9HL 5CEXB 3HI6H 1MHHB 4QNPE 3S6CA 2AXJA 3OSKA 4KK6C 5JLZA 3QUYC 4OZIA 2R1WA 5DC4B 4IBLT 4CNIA 1RIVH 5KAQF 4H88L 4I77H 3FB7B 4PRBB 5FYKE 3BZ4A 3QO0B 4PJ7A 3LVEA 1CQKA 1QYGH 3N1FC 2BY2A 5FCSH 5ALCH 5GRJL 1IGCL 2A74A 3BSZL 3CC5A 4M61B 1V3MA 3HLAB 2Q7YB 3RX7A 3D3VD 5IHBA 4NUJA 4MD0B 1X5FA 4WW2F 2CIIA 4PJIB 5L9DL 2HMIC 1A1OA 4HJGB 1MI5D 4FXKB 2VDPH 2YK1L 3DUHA 2WZPD 3RKDC 3FN0L 1BQLH 1DQDH 1B6UA 4X7TB 2FX7L 2DRUA 3RUGE 4U1IA 4N0UA 4KKBD 3PQYD 1JGUH 1HSBA 4CJ1A 5DHVA 2OMBA 4TQEL 4ZFGL 1ERNA 4J3WA 3VFRA 1G0XA 3FMGH 2GSIA 3TF7C 2BNRD 3EBAA 2H6PB 3QQ3B 4QRPB 2M1KA 1RVFH 3UX9B 2JCCF 3IFPA 4DKEH 3MA9H 4WFED 5MENA 4PJFB 5FDWA 3C5SB 3VD4A 4NZRL 3VFPB 4P5KB 4RISH 2X1OA 4UILL 5HYFA 3FONB 4ZTPL 5DK2A 3RNQA 1AD0B 1P7QD 3MV8D 1X6NA 5DQ9A 4JREB 3PABA 4LLYA 3SJVB 4R26H 1P9MA 5D1ZD 1UACH 2NY4D 1JPTL 2QADB 4HKXA 4FQPA 3AREB 1CR9H 4MZ3A 3NZHL 4X4MA 2BVQB 5L6YL 4J3OC 1JWSA 3I85A 4NHUB 5DRXB 4M7ZC 3OXRA 5SWSA 1MIEH 1KTLB 3DARA 3WLBA 3D39B 4DGVH 2XWJB 5IW1B 2FBJH 1EAPB 1SYVB 3DSFH 2ADGB 4M03A 3R1GH 4LPUA 3U9UA 4KAQH 2KH2B 1FL3B 4D9RE 4YHMH 1LO5A 3SGEI 3DXAE 4LGRB 5HY9A 4TNWF 2O5ZL 3MUGB 3X3GL 2UY6A 3RUGF 4CN4A 4PJAE 5EIIA 1SJHA 1C5BH 5HDQH 4X4XA 4Q9RH 2BOCB 3DTXA 2ZUUA 4ZYKB 1MRDH 2BVEA 1YEHL 4X98A 3RWDB 1ZVSA 2D7TL 5KVMC 4QY8B 3SCMD 5EUKA 3IAGC 1NFDA 2N4IA 2BVPB 5JXED 4FQIH 4YFLF 4YXKL 4GH7B 2X4TA 4DCQA 3LQAL 3EOYG 1J5OL 5D7JC 3D85D 3L5WA 2FDBP 1T7YA 5JOFB 3B8SA 4NFCA 4B53A 1MCFA 5JDSB 5HVGB 4NQVA 1G7QB 4JFFD 3OHXB 3OBAA 4OD3H 4XC3L 3VFOA 3TT1H 1WICA 1T7XA 2E9WA 2E7MA 2J8OA 5E6IA 1N2RA 4S10A 1QFUH 2R69H 2PTVA 2FL5A 3MRIA 4YHZL 2FO1A 5SWZA 5DFTA 1DSFL 3B9KB 3P0VL 1P4LB 1REIA 5DHYB 2EIEA 1JPST 1O0VA 4TSBH 5CJBA 4ZO9A 1IQWL 1AQDB 2JELL 3UCRA 3OL2A 2Y72A 3WLWC 2YUZA 1YY8A 2W9DH 1QBBA 1N7MH 1ND0B 4KK9D 1QUNA 1OWRM 5ILTH 2A6IB 5AAMA 5JPMB 3WUWA 1I8IA 3GJFA 4N0RA 5HI5C 4IRJC 5FKAA 1DBKL 2OR7A 3P9MA 3DO7A 1RK1B 2M2DA 4KQ4L 5CIPB 4PJ8C 3TBWA 1UG9A 3OXSB 1ZT4A 3C87A 3MROA 4J6RL 1U2HA 2DYPB 3C6LA 4PJAF 5I74C 1PAMA 4PJ9A 5DQJB 4PD4J 5CP7A 3U4EA 5F88A 3FN3A 4U33A 2K9UA 2UUDH 2XXMB 4LVOC 4YPGA 4F7PA 3ULUF 1A7PL 2D7NA 5TE7L 4K23H 4LKXB 4IJ3B 2E7LA 2XTJB 4L4TA 3WXVH 1P5UA 3LDBB 2YZ1A 5F3BA 1GH7A 5T3ZE 4JPIA 4JHWL 4P46A 2W07A 4JFXB 3VG9B 1FYHB 1OP9A 5BVJB 1LDPL 3U82B 5IROA 1T5WA 1I3GH 4FFZL 3ILQC 3JWDL 1MSPA 3BH8A 1K2DB 1A0QL 1S7UB 4ZO6A 4GUPA 4KRMB 3VXTB 3CD4A 5KW9H 4R96A 5E6ZA 4DVRL 1OSZB 3RPKA 4KJPC 2C7UB 4LEOA 1RHFA 1KLGA 5D2LA 5I73B 3MODH 4QEGA 1I7UB 1JRHI 4WHTB 5DO2D 1X44A 1P4BL 5C6WH 3D0LA 4ESKA 1WEJH 2NZ9D 4F8TA 4MDJB 2I9TA 2J2ZA 5DJCB 4RGOH 1RZIA 3IDGA 1U3HD 4XAWL 4XPGH 1BFSA 5HPMA 4ONOA 3UPAA 4HH8A 3K81A 4M7LT 1RZ7L 4JM4H 3D3VE 5C7XH 2X05A 2DQIL 1HIMH 1OLZA 4UQ3A 1X5IA 2GTWB 2QQNH 1MHCB 2D7MA 3T8XB 3CMOH 4Y4FA 4F2MB 4ZTOH 2NW3A 4MAUH 3FN9A 3PQYE 5T1LB 1P84K 1T6WA 1AO7A 3O3DA 4HS8L 4UNVA 3KJ6L 1GGIH 1K8DA 5I15H 1HN1A 1KTRL 1HOCB 4Y19A 2IPKB 3BPOB 3T2PA 4M7JH 2VN7A 4HEME 4AMKH 3TC9A 1NGPH 2Z35B 2W0FA 2Q76A 3VXQA 3KXFA 4NYLA 1NMBL 1QRNB 4U2YA 1A6TB 3GMQA 2P47B 3LIZH 4HPYH 4L8DB 4P23A 4AK1A 4LSVH 1NAKH 5GRVK 3DX9A 5DJXB 2K7QA 4WFEE 3BQUA 2COQA 5C9JA 4NBYB 4YUEH 5IMOA 4WI3A 1EV2E 4AIOA 3FB8A 4Z78A 3BGFB 5EOQH 1KTDB 3FQTB 3W11D 1T1ZA 5I8CA 1GGUA 2ADIB 4R0LA 1H3PL 4EQ3A 5MEND 2PCPB 3FQNB 1FG9C 4HMCA 4F7TA 4OLVH 5EZOL 3BDYL 4U6YA 4OD2A 3WE6B 4L3EE 2EDRA 2DL2A 3HC4L 4BFGA 1NAMA 4K3HA 5DYOA 1A4KA 2F53A 4JDZB 3QT2A 3V6ZB 4X80H 4PJHB 4UB0L 2G2RB 3IVKB 2Y9RT 1FG2A 1HWGB 3UC0H 2DLFH 1VFUA 4LPXA 3BUTA 2OTWA 4QWWC 4ZSOE 4MX7A 5SWSD 4XCYA 5FYLL 1WT5A 4JCLA 3HI1A 4XMPH 4OGAD 4HXBL 4N8PA 4Z77B 1U9KA 3VD3A 4JZOA 1HILA 5B39A 1DFBH 3ARDB 1WFTA 4JB9H 4KH2A 1CL7H 3JTSA 1JGEA 2DQFB 1IZJA 5BRZA 1OTTC 2VDLL 3FRUA 2PW2A 3GSOB 1MPAL 1QR1A 5ADOL 1INQA 3THMH 4M62L 5EN2B 4OZHE 1FLRL 5FOBB 3VW3H 4GXVL 4MD4A 3NN8B 5EC1B 9CGTA 1AFVH 1P84J 2R0ZH 4RGND 3KG5A 2HT3C 1RK0A 2VZSA 3O2VH 4O2CB 4YBQC 1AP2A 1Z3GL 4QOKA 4XP4L 4L5FL 1CU4H 2B7DT 2FWOB 1M05B 4X8JB 3GMRB 4Y4KD 1Q9KA 2PO6C 1N5YH 4GBXB 2X4QB 2OJEB 1FFOB 2JE8A 1BPVA 4S1DD 4Y5XB 4Y5VA 4D9LL 1HEZB 5E6ID 3STBA 1SEBA 4XP5L 5H37G 1OSPL 1BGXL 1L0XA 1TETL 5DJZB 3G6JE 5SWZD 1E28A 1NCAL 4P5TB 4K3JH 3KPRE 4LHUG 2V2XA 3QIWC 1D5ZB 5LGJA 3X11B 2CO6B 4HUUA 3WS6C 4Q6YA 3TO4B 3W0WA 1KCSL 4Y8AA 4WV1B 2ZUTA 4KKBC 3VFNB 2X5PA 4I0PB 2YC1A 4Y16C 3D5OF 2P8LA 5IMMA 4PB0H 1T89A 1K8IA 2EE3A 5FGRA 3UYPA 5ANME 4BSWA 5KVFL 4PP1C 4FOMA 1MQKL 1G1CA 2AXHA 3PWJB 1NC2B 1U8LA 2GK0B 4XP9H 1LEIB 4B7LA 5CGTA 3DI3B 4JAMB 4RAUA 3MRPA 1KXTB 2C3WA 3C6LD 3IKKA 4H5SB 4NDMA 1EJOH 4FTVB 4PJ9D 3FQWA 4Z7VA 1QBML 3ESUF 4XWOD 4OZHF 1QOKA 1QRKA 4YXHL 3IJYB 5AG9A 1UH2A 2NY3B 2ZNXA 3DX7B 5IGXL 5DD1L 3MTRA 1MIMH 1R3LA 4L4TD 4PJEF 1T0MA 3BXNA 3MGOB 3QUZB 3CUPA 4P46D 5DURB 1EBPA 2X42A 4HFWA 5D7IA 5C8JA 3UXFA 3AUVA 4GAFB 4KHTH 3OF6A 2J4WH 2VLLA 4OLXL 5GGTA 1F58L 3IDIB 3QWQB 1T21A 3G6DL 4TRPH 4KPHH 1VKXA 2EECA 3VGBA 4Q0XH 1L6XA 1P53A 5L7XL 3G6JF 3ZTJG 1MWAB 2G5RA 4P4RB 1XF4A 2G60H 4R90H 1MFAH 2YWYA 2I27N 3JV5A 4KRPD 3MXVL 2DB8A 5JORA 2CLRB 2LE9A 3BIKA 4RFOH 5BOPA 3OB0H 3U30C 5LJYH 4UIKL 3MGTB 1YEGL 4J4PC 5F7FA 1U8OB 4GLRI 4HZLA 4K9EH 1T0PB 4N0UE 4HEPG 4WCYH 2CRIA 1AO7D 1ZTXH 1YNLL 1MAML 5CZXC 4Y19D 1S7VA 2XN9B 3KAAA 2ID5A 3GMMA 3DNKA 4HS6B 5C0BD 1KXVC 2VQUA 5F9WC 3U9PH 3KXFD 2EKJA 1EMTL 3MV7A 4UT6L 5BS0A 4DGYL 5I8OH 1BJ1H 3CFBB 4JHAL 5MENE 3BQUD 4JFZL 3PGCB 1EEYB 3WN5A 4GAGH 5AWNH 4YDLC 1RULH 2LTQB 1EJ6A 1VSCA 1TNMA 3QP3A 1K5NA 1S9XB 1OARL 3TCLA 4OB5H 5HD8D 5EZIL 5DJAA 3FCTB 3G08B 4X4ME 4OZ4A 3UEZA 1YN6A 5KN5A 1JV5A 4CKVX 2QKIB 5HHNB 4KK9C 2JJUA 2GHWB 2VWEC 3BE1L 1QA9A 1CGXA 1JN6A 1IM3A 5D9SA 4G7YH 3L5HA 1PEWA 1EBAA 3V6FA 3LEVH 3ECBB 2DQCL 4Y4HC 5GJSL 1VENA 1YNTB 3QA3B 1ZLUH 1N6VA 3RTQC 1TVHB 5GS0D 2H1PH 4OGYH 4Z8FH 2DTSA 2NY6C 3DVGA 3LN4A 1PSKH 5HYJB 5FYKL 4XPHL 5DSCB 1RMFH 1KJ3H 4FFVD 4TOYH 4CW1B 5KTEL 5ID1A 2HLAA 3S97C 2EDEA 2DQHL 2NY7H 3H6JA 1GIGH 2WQRA 4POZD 1HE7A 5TQ2H 3QNYA 5IUSA 1FL6A 4U0RC 4HC1H 3VH8G 3CSBA 1N6QH 1KG0A 1YQVL 2AEQL 4RGNE 1U8MA 2JKXA 1NFDE 1J05B 2EDKA 3MRGA 3CCHA 1YEJH 2BCKB 4JM2A 5D93B 3QUXA 4O9HL 2B4CH 1F90H 4Y2DB 4GKSB 4YHIA 2H8PB 2ZCKL 4LLMB 3D18A 1KBGH 4HBCL 1FV1B 5IEKA 2BRRL 3FT2B 1PG7L 4KMLB 4ORGB 3ELAT 3TN0B 1DBAH 2AJVL 1P69B 1W0VB 1Q72H 4MJIA 1U3HC 3BZFB 1I8MB 3CH8A 2YN3A 4LVHC 1Z9OA 4FZEL 5CUSL 5SWZE 2VR5A 3I75B 1TZHB 3RI5K 3C5JB 3EFDH 3ULUH 2Y07H 3FZUC 4RIRB 5TF1H 2VLRB 2ZKHL 2J6EA 4OFYA 3QQ4A 2H2SD 1UA6L 4M1CD 3JV6B 4L8SB 5EWIH 1I4FA 1UJ3C 4MXQC 3TYGL 2VXQL 2AI0L 4D3CL 1WCBA 5IG7B 2N56A 3QNXB 1C8PA 3QPXL 5EO0B 4JFPA 4HIHA 4NIKB 1S8DB 4LCWE 3MCKA 5I8EA 3W0WD 1WF5A 3WHXB 3Q2CA 1DDHA 2A1WL 2YRPA 2FIKA 4Q9QH 3HZKA 4XGZB 4DN4H 4PLNC 4IHOA 4PTTA 4CMHB 1HQRB 1ZLVH 3RPIA 1M7DB 3LKQA 3QULB 4WEBL 4WU5A 2AJ3A 5H94B 1FAIL 4MA3A 1O5DT 1C5DB 3FT4A 4JG1H 4OF3A 5FM5O 4M3JA 2ZSVA 4GW5B 3KPMA 1WBYA 3C5ZC 4JY4A 4L4TE 3B8YA 4UOJA 1AKJA 1TZGL 1NFDF 3GNMH 1AXTL 4P4KB 5INCA 3B5HA 3T08A 1RZFL 2VITA 5DVOA 3ZT7A 5TE6L 3U7AA 2GAZB 5EH1A 1WTGT 1CFBA 2O5XL 3HC0B 4OCXH 4PR5B 1C16B 4NZTL 1F3JB 5F1SA 2BSTB 1NANH 2AJXH 2A6JA 4X99A 4PLKD 5EZJB 3OF6D 3KPNB 5HI3D 4FFYH 1XF5A 4H26A 3TFKD 4LSRH 4PG2A 4CVZB 5IB3A 3RKPA 4HK0B 4DK3A 4MXWH 4Y1AA 1K6QL 4G6ML 2XA3A 4OFIA 4MMXC 1I1YA 2C1PB 4RMSA 3ILPA 3HE7B 4ZXBB 2Y23A 1IEAB 4YZFF 5ESQB 3MA7A 4NM8L 1MF2H 1KN2H 3BW9A 2RFXB 1N4XH 2EDTA 1CIUA 4RA0C 1MLCA 4XBGB 2L4OA 2Z0BA 2NXZD 4JKWA 4U1LA 5L2JB 1AO7E 2BZDA 4LFHG 2XKSA 4IRZH 1EHLL 4YIQA 1T2JA 4Y19E 4AH2A 3VXNB 4XC1H 5JUEL 1NL0L 1ADQA 2FB4L 5KVDH 3ALXA 1OAKL 3KXFE 1QD0A 1AR2A 1UC6A 2NY1D 2WINB 1I1FA 2PTTA 3NCEB 3WIHL 4X6FA 3BO8A 4XX1G 4MJ6B 1KB5A 4Y4KC 4U49A 4KKNA 1G6RL 3W39A 2JLLA 3NCJH 5AEAA 3VFUB 3FB6B 3MV7D 1LO4L 1XEDA 2X4SB 4L4JA 5JNYA 1S9VA 4EOWH 3C8KA 2R2CA 3KPPA 2BY1A 3SKMB 3TA3C 3VXSE 1S78C 2DN7A 1X5GA 2X10A 4OBRA 3T2NH 2NY0D 1MFNA 2PXYA 5D2LF 4P2RB 2CMRL 3E3QE 2F53E 5FA4B 3X14A 3QXAB 1HHGA 2H32A 5KG9B 5D7LD 1HXYA 2H26B 4QXUH 2ITDB 1R3HA 2IBBA 1UEMA 2DWEA 4G6JH 1MFEH 3HE6D 1NBZA 3O41B 4GW1A 3CDGB 4DAGH 1RFDH 3PDOB 4J3UA 3BKYL 1YC7A 3S4SG 5LGKA 1WBXB 2MFNA 4I3GA 4OBSA 4YO0B 4NQXA 2VDMH 2QR0A 3M1BA 43CAB 4GS7C 3HRZB 2DIJA 5EU5B 4NT6B 5F6IB 5ISZB 1UQSB 3D1MC 4MS8D 1KLFA 3B2VH 5HVHB 1FFNB 4NZDA 4HW6A 3LQZA 4XWOC 3HMWH 3T3MF 4HWNA 1CDUA 5I1EH 4PV8B 5BRZE 4D0CB 2QHLA 1J1XH 4K3EL 5IBTH 1GRWA 1T1XA 2OZ4H 4X4YA 5FCUL 3K4DA 1U8IA 5AUMA 3BZEA 3OPZH 2UYLB 2RB8A 3MUJA 5LAXA 3BEVA 4U0QB 3DURA 1TJGL 1V3LA 4NRXA 4QHUB 5DK0B 2ZSWA 3UTTA 3N50A 5D4QA 4YHNB 2DKMA 4DTGL 5I6XC 5KSBA 3EJJX 5KVEH 4P59L 2YEZA 5CMAB 4QOKE 4JM2D 2DBLH 4P99A 3EYQD 3QUXD 4GKNA 4UT7H 2Q6WB 1XGUB 2V5YA 4G8IB 1G7JA 4S1QL 5IHUL 2H2PD 3MJ9A 2WBJA 1QFWL 4MJID 4MNHA 3IDJA 5DD5L 5IVZA 4Z7QF 3VG0L 1AGDA 4K94H 3TIDA 5DD6B 4I1NB 1EFXB 1Q0YH 1TTUA 2CKBH 1Q9WB 2VDRH 1L7IH 4UV4L 3GBNL 3OKLB 4MA1C 5IB2B 1SJVA 1KLUB 5I1HL 3QUML 4PV9B 4UDTA 4KQ3L 4G7VH 1CQYA 1OP3H 3LS5H 3WIIL 3RQ3A 2YR3A 1CE6B 3K0WA 3ZKXC 4OFYD 3VFWA 3VU2A 2YD5A 3OKEB 3T0EA 1XZ0B 3RGVA 1EK3A 3BRGC 2IANA 1RUQL 4LMQE 3QIBA 2ADFL 1A3QA 1ED3A 3HR6A 1J1PH 3QIUB 4S1SH 1U3YA 3HMXA 2XPGA 4JN1L 3H0TA 5LQBL 3GIVA 1N3NB 3ARGC 4Z7VE 3I3DA 4WTWA 3O9WD 1NGQH 1MFCL 2A6KA 1VFOA 2NYYC 4WNQB 5I9QB 4PRBA 5FDYA 1RAMA 3TGXA 3LSOA 3VFSA 2JB5H 2OI9B 1AKJD 1M7XA 1CFQB 1A6AA 5F97E 2WLZA 3MLRH 5INDA 3NIDF 3EYOA 4KV5E 1FVCA 3VXRB 4DN3H 5HD8C 3HLAA 2Q7YA 1GGCH 5D7IE 5HGHB 1T04B 1EPFA 1ZHLB 4HIEB 4M6ML 4A6YA 4MD0A 3U4AA 3S9DB 3Q5TA 3SDAA 3MBEC 1IRAY 4FXKA 5I1IL 5MP6L 3FO9B 1AH1A 2CDFA 4GRMA 3MLUH 1XAUA 4HJ0D 3OB8A 1FZKA 2SEBA 3BPNB 4EI6A 4Y1AD 1DBMH 1ZK9A 1N0XL 2FSEB 3QWRA 4R3SA 2Q1EA 2HRLA 1J87A 1UWXK 3PHQB 3W5MA 1OPGL 4M8QB 3QDAA 3W9DB 3O4LD 4QRRB 1LD9B 1CBVL 1JHLL 4XPTL 3RHWF 4EUPA 2R0LL 1Z0NA 3O3BA 4XBPB 2LU4A 3TNNB 4V2BA 3C8DA 3D25A 1J8HB 4NFDA 3F62A 3P4OB 4MNQA 3SDCB 3VFPA 4OZFB 1U8KA 2GY5A 5CJOH 3SQBA 1SY6A 4WTXA 5IFJB 5GZOD 1IGIL 1OAXL 1AD0A 3WFEL 1JNHB 4Z7VF 2IBGA 4PRAB 2B1HL 4N90D 3EO0A 5L2KE 2W60A 3HAEA 3VWKC 2ZPKL 1ES0A 3QDGD 4IRSA 3BAEH 3IDNB 2I07B 4X9HA 43C9B 2UV3A 4NHUA 1J18A 5DRXA 4OCYL 3MV7E 2DDQL 5BS0E 4HKZB 1KTLA 1CK0H 3NAAH 4OQTL 1W72B 2CDGB 4JPVH 2EEBA 1GYAA 3KNBB 1EAPA 5D7IF 2HT2C 4HGMA 4BZYA 4RMRA 1WCQA 4KVNL 4AZ8A 2Z9TA 5E2TH 3G5VB 4R4FH 5C09A 4ZD3L 1PFCA 2ERJC 3DMMC 5AAWA 3CXHK 1MY5A 4NZUL 5EOTA 5GGSB 1O7VA 5E08L 1HH6B 3ZSSA 1G9NL 5HHVL 2H2SC 4JJ5B 3MUGA 2CR3A 5DHVH 4KTDL 3ULVD 4MB4A 1QPPA 2X4UB 4DWHA 5DTFA 3VWJB 3KPLA 1QQDB 2YS4A 4HIIA 1DE4A 4ZYKA 4HFUL 5I1JL 3T77A 1WIUA 3RWIA 2GW5A 3KPSE 4KJWC 4OGXH 1FNLA 1JHKH 4QY8A 5IB5B 2MWCA 5IV2A 3VXOB 5GS1A 5HYSA 2RGSA 4ZUVA 3QHTC 2NXYB 1RIVL 3HG1A 4KJQC 1QFPA 5JOFA 3TV3H 1AE6L 2IC2A 1QHOA 4E9LA 1G7QA 3ZL4L 1PW3A 5EU3A 1ZSDB 5JPNA 1EIBA 2N7AA 3J8F7 3LB6C 5DFVC 3IJSB 1W8NA 3FRPG 4LCCA 4ODUA 1U58B 2X4PA 1P4LA 3WS3A 3RWFB 2EO1A 3MRBA 1A7OH 3UTTD 3CSYA 1AGBA 2VISB 1UB5A 4G9FD 1FNGB 1QO3B 3TESA 2DIBA 5ESAA 2P8MB 2VDPL 4A2LA 5J0BA 1JBJA 1ND0A 3QPQD 4JFDB 3MCG1 5F1OB 1KJ2A 3B4NA 4MJIE 5F6HJ 3VXUD 1TPXB 4Q6IA 3BEWB 3C09B 1J9CT 1CI5A 1KIQA 3ARQA 4U05A 1KF9B 5ESVA 5MI0B 4KDWA 3CFJB 3FT3A 1CFSB 4R7DA 1XF3B 2WBJD 5FGBC 3EFFA 3OX8B 3MZGB 4HGWB 3HNSL 4Q58C 2JCCB 5C08B 3MUY1 2Z31A 1FVEA 3ARFB 4DKEL 3MA9L 2B39A 1CG9A 3BPLB 3MRDA 4ETYA 2BMKB 1A8JH 2DWDA 3GJEB 1A64A 1A6UH 2DM4A 3U7YH 1RV6X 2GQHA 4LQFH 5TJWK 4PUBH 4P3CH 4R26L 1RZJH 1UACL 5JOPD 3MXWL 2IAND 2DM2A 2R23A 1OAQL 3PDGA 1S7UA 3VXTA 2AXGB 5B3JE 4G80A 1E4JA 4I3SH 4NGHL 4NO5B 4KMTH 2ATPA 1D5MB 1MIEL 4JKPL 4M8VA 4F7MB 1I7UA 4LDEB 3DSFL 3NFNB 4PGEB 3NIFF 4ZNEA 5KANG 4E0RA 4GXUM 5T5NF 3R1GL 4JM2F 1F2XK 5FV1L 1MCKA 2YD6A 4RFNC 3CVHB 4UUJB 3VFMB 4WEUD 2R2EA 1AIFB 2V5TA 5EZLB 3ARBB 4JRYA 4FQ1H 3QXTA 4KUCD 1J0YA 3RUGB 1XCQB 4YEEA 3GJFH 3LMJH 1AGCA 2AJZB 4JPWL 4L3AA 4HMEA 1HQ4B 4OCLC 3QO1B 3K2MC 3HE6C 1HNGA 1GC1L 5HDQL 3GFUA 4Z7WE 1D5IH 3QCVH 3IAPA 4AQ1B 35C8H 1GOFA 2KQNA 3BN9D 3SDAD 3GMLA 1MRDL 1RD6A 5EB9A 2M26A 4CMMA 4P2OB 4YDJA 5D96B 4MYWB 1KELH 4OIIL 1H5BB 3V4VH 2IPKA 5MERB 4FQIL 4MS8C 3ARVA 2NW2B 3L3JA 4OD1H 5IF0B 4QTIH 5DJ0B 2FH8A 1EXUB 4LRIA 1MHPH 4NJ9H 1A6TA 4FNLL 5D70H 4OKDA 2VN4A 1R3KB 4I13B 4IM8A 4OD3L 5L8LB 1I7ZA 1TENA 1XGRA 3CDYA 4OSUH 4QRPD 5DMIH 3VJ6A 4HQQH 2OR8A 3N06B 1QFUL 1KTDA 1U91B 2R69L 2VQTA 4OT1H 2NNAA 2ADIA 5D1QB 2AABH 2W38A 4NM4L 1JF1B 2DJSA 2PCPA 4QF1A 5B3JF 1DQLH 4MNQD 2QHRH 1G9MC 3QI9A 3RIFF 4QGTA 1FBIL 5FK9A 4C83B 1JVKA 2A38A 4TSBL 1FNHA 2ZCHH 4F80A 4XH2A 1HHIA 3I02B 3EYQC 2W9DL 4PJHA 2G2RA 4FG6D 1N7ML 2QADD 3FFDB 3GMPA 2HP4A 5ILTL 4IRSD 4M4PA 3CU7A 2C3XA 3RDTB 1C5CH 4ONHA 4ZAKA 3DXAB 5L0QC 3N85L 4PLOB 4BKLA 4Z0XB 1GPOL 1RU9H 4PJAB 2R0WH 2WNGA 3AS1A 4IEFB 3UTQA 2W0PA 5HHMD 2EIDA 3BGMB 4Z7WF 1EERB 1BIIA 4DFIA 5GGRB 3ULVE 1FH5H 1YC8A 2BHZA 4K23L 3TO2B 1DBBH 3S35X 4NQEA 3GRWA 5FYKU 1NCCH 4YWGL 4KI5D 4PBXA 3QQ9D 5DRZB 5EN2A 5B8CC 5JHDA 3RWJA 3QXWA 1I3GL 1XGQA 1IL1B 1T66D 1EO8H 3DV4B 3GM8A 3LKOA 1M4KA 5KW9L 4DJMA 3NH7L 3LKPB 3O9WC 4PRHA 1DQJA 2JJSC 4IIQB 1A3RH 8FABB 1Z6JT 1T22B 3LAFA 4M5ZH 1J1OL 2G5BB 2V5SA 1A9BB 1NAMH 3HG1D 2Q8AL 1WEJL 8CGTA 1T0NB 4OF5A 1AGFB 2ICWI 4RGOL 4J2XA 1SVZA 2RBLA 5BW7A 2Z93B 3KVQA 1JUFB 4U3HA 3MCLL 4JM4L 1SM3H 1ZHBA 2ED9A 5C7XL 2CDEA 3EUUA 4YC2C 1HIML 4ZG1A 4DKFH 3N9GH 2HFTA 5DJZA 1BD2A 5D1XB 5GISH 5KSBE 2EE9A 3WDIA 4P5TA 5F7WC 1G7IA 3P0GB 5CKAA 3CMOL 1D5ZA 4OI9A 1VHPA 2ZOLA 3P2TA 4ZTOL 2EXWD 4W4OA 5FECA 4WO4B 5JOEA 3VFTA 4LOUD 5GGUB 5I75B 4HUKB 4WV1A 3SQOH 1GGIL 4NQSB 4RDQF 1Q0XL 5GSVA 2DS4A 5I15L 2Z4QB 5IQ9A 3CFKA 1MJUH 2J7LA 4F9PA 2R9HC 4M7JL 4OUUB 5A1AA 5I76A 3ULVF 2X9YA 3L3DB 3L7EB 3GGWB 4XNYL 3S5LA 5GRUL 5H37H 1LEIA 1YEIL 4HPYL 3LIZL 4TUOA 4W6YB 1JWUA 3GSQB 5DFWH 1GXEA 4D9QD 2DYPD 5DGQA 4POUB 1QSFA 4CVXA 3G6AB 4YUEL 2MHAA 5I1AA 5DJ6B 1JPSH 3EOAA 1IKNA 2Z31D 3MRMA 2IPUG 2A9NH 2GK2A 3HI5L 3TNMB 2CQVA 3V4PL 1A4JB 1MH5B 1D3CA 2VKXA 4QHLA 1NMAH 5EPMB 3T0EE 4MDIA 4UIMB 4OLVL 3I6LD 5C0EA 2V9TA 3MGOA 3CDCA 3CX5J 2BJMH 1P7KB 2XI9A 1TLKA 4UT9H 4WUKL 4R7NB 4J3VA 5AYQA 3U0TB 1XF2A 2QJDA 4MB5A 5DEGB 2I5YL 2PR4L 3P40A 4YE4L 5F89B 1UWEH 1OAZH 5DD0H 3QUKB 1MRFL 4ZUSA 3D3VB 1WTLA 2ZG1A 4J3TA 3HPLA 4Y5YC 3VE0B 3DMMA 5K9OA 1S7XB 5E5MA 3RZCC 3PP4L 3TBYA 4OI7A 4XMPL 4I18A 5KSBF 1FJ1A 1BIHA 4HKJB 1JK8B 5LG1A 2VWEE 2W59A 3PQYB 4TSAL 1EGJH 1CL7L 3O6ML 2C5DC 1M1SA 1TMCB 2VNCA 1JF6A 5J8OA 4JRYD 1A7QH 1CVRA 3T0XA 4PBVC 2CLZA 2AK1H 1YN7B 2AK4A 5F1NB 1U8JA 1IMHC 4NKDA 3B6SA 1AFVL 4UU9A 5T1LD 1IC7L 3RVVD 4PS4H 1BVLA 3Q5YA 3QUMB 4GW4B 2VJXA 3IS1X 3GSNA 1IFHL 1P7QB 3IJHB 5ADPH 1CD1A 4LLUA 1FAKT 3PWPA 1I8KB 4KK5C 4M7LH 1FZMA 1CU4L 3NGBC 4HS6A 4K55A 5IB1A 5D1ZB 2NY4B 4ZUUB 4OM1L 5AYUH 1UT9A 4L3EB 1QRND 4EQ2A 3C08H 3VRIB 1OT2A 4LARH 1MCIA 5E1AA 1I8LA 5ETUB 5C6TH 4MNQE 5E00A 3GZKA 2XWBB 1F6LL 2XOTA 4U1HB 2HKFH 4PRPE 1CICA 4ZSOB 5GJTH 1JYVA 2BVTA 3QI9D 4JFOB 4K3JL 2GYSA 4X5LA 3FCTA 4K71B 3ZE1E 5FHAL 3G08A 1X5HA 5BZWA 5BV7C 1P6AB 4LNVA 4EVNA 4QXGL 3U4BH 5HPOA 5HGGS 5IMLA 1RUAL 1MCJA 4XPBH 4KUCF 2IMNA 2ICEA 4LIQH 4L8CA 4M1GH 4PB0L 3VGEA 3KPQB 4ZAKD 5HHME 5DJ8A 2A6DA 3MLTB 4I2XA 5C09E 1BOGA 1IAII 4HWBH 3MRLA 1HYSD 3SCMB 4OZHB 4HLJA 1XCTA 4QCIB 2C4FU 3V0VB 3V4UH 5B38B 2JF1A 4XI5D 3D85B 2X4RA 4U3XA 4E5XB 1BM3L 3QG6B 3SE8L 1MIML 3HTLX 1DCLA 3LZFH 1PX3A 1KEML 1YEKL 5EUOA 3VXMA 2VYRE 4NO2B 3PNWA 5DUML 2VAAB 1CD0A 3DVNB 1CCZA 4J3SA 2XXCB 3CGTA 1HKFA 4TRPL 2EDYA 3HG1E 2GTZA 1F45A 1G7LB 2O93L 1T1YB 4N0YH 3V7AE 4PRHD 1HH9A 5EU7E 5GPRA 2C26A 3G6JB 1GJIA 3CFCH 4Q0XL 1OGAE 4K2UH 1N8ZB 1B2WL 3KPRB 4K3DL 1I8MA 4L9LC 2G60L 4GBXD 1V7NL 2R15A 3ZE1F 4OCSL 4U3CA 1MFAL 1FO0B 3L7FB 1PKQA 1XGPA 2X2YA 5C0IB 3T2QA 1R5VB 3FO0H 3DRQB 4EDWH 3WO4B 4RFOL 5ANMB 4YHOH 1BD2D 4QHNB 4F7EA 4P5TD 3S35H 1FNFA 3TBTB 5J9PB 4ZOBA 2VL5A 4WCYL 3QNXA 3TO4D 5A3ID 4FMKA 4H1LA 3DX8B 5T5FH 1WFUA 4QXTB 5ITBH 1JYXA 3UZVB 3IDMB 4HIJB 4P2CG 5L88H 2APVA 3I6GA 3WBDA 3U9PL 4ODXA 5CBAA 5H94A 4LBEB 4NBZB 5C86A 1E4XI 5I8OL 1WSST 3RVWC 4FTVD 1RJLB 4KY1H 1I1RA 2J8UA 2VMFA 2BNQA 2NY3D 5AWNL 1RULL 1CT8A 1ZA3A 3PL6C 4CNIB 3RY4A 4M93B 3FFCA 3BZ4B 4BQ6A 2XZCH 2IH1A 4JREC 5JZ7D 3QUZD 4F7CA 2QADC 1F3JA 2J3SA 2BSTA 3AREC 5EO9A 2BXYA 2A74B 1G7HA 3CC5B 3QZWA 4NQCA 5TE4L 3SO5A 3RAJH 4HH9A 3LEVL 4DFHA 4ZNEE 2R1XA 2CIIB 2FD6H 1A1OB 5CLTA 1B0GA 3VCLA 1I9IH 2EH7L 4JKMA 5IIEA 3FQRA 1DEEA 5FYJD 1AJ7H 3HE7A 1PSKL 4JRYE 1OW0C 4U1IB 1UM5L 4N0UB 2XZAL 1HSBB 4TOYL 3CSGA 1E4WH 2NX5A 4OF6A 3HCVA 5DHVB 4OIAA 1LO0H 2NY7L 2ICCA 2ZJSH 3VFRB 4X7DC 3HKFA 3H9HA 5TQ2L 3WMSA 3ZMRA 2GSIB 4KI5C 1UWXH 3HNTH 4HC1L 3A67H 5L2JA 1BF8A 3UO1L 3MJGX 4PJBA 4W6XB 5IFAH 2DQUL 3BD4A 1BBDL 1BVKA 4KDVA 1H3UA 3SKJL 2B2XH 2HTKD 3T09A 1XIWB 4IOIA 4KGJA 2R2HA 4XP1H 5JMOC 3SE4C 4GRWH 2JJTC 3ORJA 5MENB 1KV3A 4WI4A 1F90L 1MVFA 2IFFL 5FDWB 5I18L 1KBGL 2VDNH 3RNQB 1HHHA 1AD9A 1X5YA 4QRQA 5DQ9B 2XN9D 1DBAL 4MJ6A 3PABB 3PWPD 1ZT7A 4LLYB 3OJDA 3SGKA 3V95A 1DQMH 2EEDA 1Q94B 2ZZUT 1K4DA 2IALA 1JWSB 3SKMA 3DV6A 3O8XA 3OXRB 5SWSB 1W0WA 4AIXA 1BECA 3WLBB 4F58H 2J6EL 3B9KC 1NLBH 3MX0A 4U6HA 5TF1L 2ITCA 5KG9A 2H26A 3UTSA 3U9UB 5IHZA 5ENWA 1XGTA 4PREA 4RRPA 2MPAH 4K7FA 1LO5B 1FFPA 1KXQE 3PDOA 4ODHL 1FCGA 1D7FA 1U2CA 4HK3J 5HY9B 3X12A 2NY5C 3AY4A 3PP3H 4G6FD 5EIIB 3PHOA 1SJHB 4QLRA 3BRFA 3MLYH 4LSDA 3AM8A 4X4XB 1J0JA 4DN4L 3EJZD 5JA9A 5KSAC 2VTFA 2Q8BH 3DTXB 3EYSH 4LSSH 3HNVH 5EULV 4C59B 4X98B 2E6JA 2HLFD 1ZLSH 3AS2A 1ZVSB 3P11H 2JJVA 4RGNB 5EUKB 4J23A 2VR4A 1NFDB 2QL1A 4NQEE 1IGJA 3GNML 3OKDB 3ARRA 5FUOL 4C4KT 3MLZL 1ADQH 4IJ3C 1VDGA 2X4TB 3PWUB 2XTJC 1KN4H 2QQLL 2ZWLT 2UYLA 3LDBC 3TJEH 3L5WB 3W2DH 2JJWA 1JNJA 1MJ8H 2VXVH 3BJ91 5JHDE 1GZPA 3M07A 2DQEH 5IWLC 1MNUH 5GZND 1KB5H 2W0KA 1ZGLA 4NQVB 1QP1A 2N7BA 4HCRH 2AAVA 4OCXL 3RX5A 1VEOA 2AJXL 4ZS6D 5E6IB 1N2RB 4PRHE 1IAKA 1M6OB 3ZZ1A 5J11C 2FL5B 3LRGA 3MRIB 4FFYL 5I8KH 5SWZB 2YPKB 4NN5B 4H8WC 4LSRL 5I73C 2BC4B 3F6IA 4Y88A 1IQDA 4YNYA 4O4YH 1G7PB 3CLFL 3TN0D 3QH3A 4PJHF 2ENSA 3OAUL 1BLNA 5CZVH 3V7MA 1I8IB 3WUWB 1MOEA 2YXMA 3U7WH 3VD5A 1BD2E 3OKLA 5FKAB 1MF2L 3MYJA 3P9MB 1T2QH 1KN2L 4LCWB 3DO7B 1N4XL 3TBWB 2R1YB 1ZT4B 3TT3L 3V6OA 3MROB 2ORBL 1J0IA 3S8WA 4PJ9B 5IJVB 2UZXB 5A2LH 2G75A 2VLRD 3WFZA 5CP7B 4U6VL 1Q8MA 5F88B 3ARPA 1XGYH 3CAFA 3EO9L 1XZ0A 4IRZL 4WTZA 4YPGB 4F7PB 4XC1L 2ZUVA 1FLTX 4NQUA 1ITBB 4L4TB 3FO2A 3BPOC 4AEHH 5F3BB 4OLZH 4JPIB 2EH8L 4P46B 5BQ7A 1QSFE 3U2SA 2P43B 3NCJL 3BH8B 4WNQA 2VC2H 4GUPB 5LCVH 3KJ4B 4EOWL 1NH6A 1H0DA 3ZE2E 3L3GB 2Q7NA 1J86A 2OTPA 2XWTA 4L1DA 4LEOB 1KLGB 1CFQA 3SDDA 3V0WH 2BNQD 2RCSH 4P4KD 3VXRA 4G3YH 3IXAA 3D0LB 3QCUL 2I9TB 2BRQA 3ARTA 3BP4B 1T04A 3FFCD 4KTEH 4LSQH 4OZGE 1RZIB 3IDGB 1MFEL 2VH5H 3PWNA 1DLHA 4HT1H 2WUCH 5HPMB 1BEYH 3GI9H 1HXMA 1RFDL 5J57B 3NOIA 4JQIH 3O6FA 4UQ3B 4PGBA 4NQCD 2F19H 2VDML 4PRNA 3DPBA 1BHGA 1MREH 5FYJE 1NKRA 4N8CH 4Y4FB 3B2VL 2NW3B 1L4IA 1PBYA 2AGJH 3QJFB 3HMWL 3RA7L 4GG8A 1AO7B 3O3DB 3PIQA 4JO3L 1K8DB 3HE7D 4GRLB 3ARDC 5C71A 4I5BB 5GHWH 1J1XL 1VFBA 5IBTL 3BP6A 4G8GA 4Y19B 4ZXBD 3MUHL 2OZ4L 5EC2A 3BT2H 2DL9A 2P7TA 5FO9A 3TNNA 3MRNB 2W0FB 2AK4E 2Q76B 5IM7B 3MMEA 3VXQB 2XNAA 3KXFB 4NYLB 4XBEH 3GMQB 2AW2A 3P4OA 4P23B 2VZUA 3F5WA 3UJTL 1CXLA 3DX9B 3BQUB 1FPTL 4ODSH 4TUKH 1JNHA 1U8HA 5IMOB 2VABB 2VZOA 3FB8B 2YD3A 2DICA 5KVEL 4Z78B 3AU1A 3SKNB 1FNAA 1T1ZB 2YMXL 5HHQA 5I8CB 3VA6A 4NN7B 4R0LB 2DBLL 2CD0A 3PWPE 3ZE2F 4KZDH 3MRJA 3D9AH 4TYUA 43C9A 4F7TB 4L9LA 4UT7L 4U6YB 4OD2B 3MLWH 3CDFA 1YMHA 5DYOB 2VERN 2H41A 1TCMA 2F53B 5FUCE 1S3KL 3RP1A 2J88L 3KNBA 1E27A 4GBXC 1JZ7A 5FM4A 1FG2B 2PYFA 3SE3A 5JXAH 3T3PE 3KLHC 1Q0YL 2CKBL 4Y5XC 2OTWB 3LV3B 1PKOA 3O8XD 3V9FA 4LGPB 4XCYB 3UTZA 4PTUB 4G7VL 4U6XA 3WFBH 1HH6A 3HI1B 5IESL 4OZFG 4P2RD 3LS5L 4JJ5A 1MCSA 2J1KA 4FQHB 1KCVL 3ZKSD 4JZOB 1HILB 2C3VA 2PKDA 3GBLA 3UTSD 5B39B 1QQDA 3TO4C 3JTSB 1JGEB 5A3IC 4WI5A 1IBGH 5BRZB 4I0PC 5E5UB 4X7FC 3FRUB 3K8MA 1J1PL 4S1SL 2PW2B 4I2XE 1QR1B 3V6BR 1INQB 5JQ6H 2GCYA 4I3RH 3B9EA 1CFNA 1SY6H 4F3FA 3HZMA 4EBQL 1INEH 4LPCA 4G8EA 4L29A 3I2CH 2JB5L 1L7TH 3FO1A 1RK0B 1NEZA 1A7BA 1AP2B 4QOKB 4NN6C 4XPAH 3MLRL 2GY7B 5EUOE 3VXME 4DN3L 3IJSA 4NUGH 4LLWA 1GGCL 5HJ3A 3I50L 4NJAL 1CGTA 1F11A 1Q9KB 3CX2A 4MMZC 4PLJC 5E8NA 1PZUB 2WBKA 1FVDA 4JZJC 5E7BA 1F4WH 3JUZA 4Y5VB 1SEBB 4OI8A 5TFSH 2YZ8A 3SBWA 1AGEA 4HPOL 3T3PF 4PJCA 1GGYA 4YPJA 3SGDI 5F72S 5KAQG 3MOQA 2V2XB 2P49B 1KIUA 5LGJB 4R8WH 1DVFC 5AZEH 1T03H 1T2XA 1DBML 2GSGA 1PKQE 3VD9A 1XF3A 5A16B 2YC1B 3PWLB 3BESR 4GQ9L 3N1QC 4HGWA 3OAZK 5IMMB 1EFXD 2IQ9H 1K8IB 1JFQH 1FQ9C 4BSWB 1DUZA 2UUDK 3D48R 1QFOA 1U8LB 5GRVL 2E5EA 2YXFA 3MRPB 4RAUB 5FYLD 3BD5A 4NDMB 3UPRA 1TJIH 4XVUC 2HTKC 4Z7VB 4EN3A 3BHBA 2QV2A 1NJ9A 5E9DA 4PJDA 1FYTA 5KANI 5CEZH 3SOBL 2MQ3A 4NSKA 2ZUXA 4WY7L 3Q48A 4M5YL 1KYOK 3H9SA 1R3LB 3KR3H 1T0MB 3BXNB 5FIEA 3QIUD 3IAQA 2YRLA 2UZIL 2WM0A 1CK0L 3CUPB 4ELMA 3VFVA 5EUOF 5E94A 4LAQH 5D7IB 5D2NC 3DWTA 5C8JB 3L3HA 4F57H 2VLLB 4YLQT 3WJJA 2J8UE 4ZQKA 2BNQE 5CHNA 1T21B 5AZ2L 1D6EA 4MJ5A 5E2TL 3B2UD 1VKXB 4UUJA 1PEZA 3FFCE 1I3VA 2C4FT 2X09A 4CDGC 1OTSD 2C3GA 2QQKH 3I3BA 4UOW1 2NY5H 4TPRH 4HD9A 5FFLA 3VXRD 1HQ4A 2OL3L 2XZQH 4NC2B 1HCVA 4LPYA 4WJ5A 5CIPH 5DWUH 2V7HA 5K33A 1XF4B 1MCPL 4NQCE 5JA8B 1MCNA 2R0KH 4NNYA 5F70A 4XAKD 1CLCA 5JORB 1L9NA 3CLEH 2YKLH 2ADJB 1YDPB 1YECH 1JHKL 3LPFA 3MUZ1 3BIKB 3MFGB 3EJZC 3WEXA 4OAWA 2X1PA 1JNNH 5C2BH 2JB6A 3HC3H 3HA0A 4HZLB 1LVEA 5DJ0A 2DMBA 3NCFB 3D87B 2NX5E 3TV3L 5J56B 3ZE0E 2YPLA 4UINH 1ZT1A 4N9GA 4CBPA 5A2IH 4FA8A 5L2KB 2OP4L 1S7VB 4G8GD 4QRRD 4LASL 4HIXH 3GMMB 4PJBE 4PY8I 3QDMA 5GZNC 2P5WA 1JF1A 1U95A 5JMRA 2OK0H 4H8WH 3UYRL 1S7RA 3MV7B 3SDCD 5BS0B 1ZHKB 3CH1A 3DRTA 3DO3A 1YNKH 3DX6A 2A0LC 4EI5A 3SDYL 4DW2H 2NY0B 3WN5B 4P9ML 3RVXC 5KVGH 1HCFX 4Y2DC 4GQPH 5DRWB 3FFDA 2J8UF 4ZS7H 3VDCA 5FA3B 5E8DH 4GMTH 1NFIA 4UAOB 1K5NB 5ACMA 3TCLB 3TN0C 4UTAH 5DJAB 3AXLA 4XHQA 4OZ4B 1NPUA 2AS5M 4KKCD 5KN5B 4BZ2H 2P46B 1A9EA 2AKRA 4N5ED 5CD3B 3R8QA 4LLDA 2C3HA 1QA9B 3CXDL 3JSSA 1JN6B 5D9SB 2VLMD 4RWYH 2B20A 4M7KH 5I74B 2X4NA 4ODWB 3T0WA 1T6VN 3DOSA 3HZYB 3V6FB 4CVUA 2EE6A 3SO3C 1S9YA 3OKNB 3MRFB 5GGRA 1P1ZA 1I85A 3UTSE 3TO2A 1DUYA 3VDAA 1JZ4A 1KFAH 5C0RH 4DEPB 3DVGB 1FFRA 3DETC 1YYLH 1A6UL 5D8JH 2BDNH 3AVEA 3U7YL 4LQFL 4PUBL 3V0AC 4YBHA 4M6NH 3VWJD 5ID1B 1KUMA 2HLAB 1IJ9A 4AYFA 3P0YH 1CFVH 3KPOA 4PJ5A 3DV4A 4D0DA 3QNYB 4WI9A 4HWZA 1JHTB 1FL6B 4I3SL 4KROB 4KMTL 1TDQA 2Y5EA 4PY7B 6FABH 4CMHC 5T3XH 1KGCE 1KG0B 1TJHL 4PJBF 1U8MB 3TPUB 1JE6A 3E6FA 2NXYD 1A9BA 2EC8A 3DYOA 1I3UA 1HI6A 3V52L 3CCHB 2AJYH 4JM2B 4WEMB 5DD3H 3QUXB 4YHIB 1EDQA 3D18B 1RIHH 5IEKB 3BDBA 4P4KC 3NPSB 3GIZH 3KWWA 3TEUA 3LQAC 3ROLA 3LMJL 2NTFA 3WIHA 4MJIB 1BWMA 3BKMH 1GCFA 1G6RA 4AT6A 3QCVL 3CVIH 35C8L 5IT2H 2I9LB 2Q3AA 4JRWA 3BD3A 1MAJA 5DZOA 1A6VH 5JR1L 4NQSA 5DVLA 2Z4QA 3V4VL 3QQ4B 4DVBA 3RY5A 1G84A 2O5YH 4QRSA 4W81A 3L3DA 4OD1L 1I4FB 1FC2D 3L7EA 4QTIL 1MHPL 5CWSA 1WCBB 4NJ9L 5D70L 4HIHB 5TDOA 3IGAA 5I8EB 2GEEA 4ZXBC 3UAJC 4APQA 4HXAL 1DDHB 5LWYH 2FIKB 3G6AA 3V6OE 1PX4A 4OSUL 4F37K 3LKSA 3HZKB 4HQQL 1RZGA 4R2GD 3WSQH 5F7MC 3IXTA 1QFWI 2DLGA 4PTTB 3TNMA 2EDQA 3RPIB 3ROOA 1MH5A 2AJ3B 1DQLL 3MQIA 4QTHA 1JGLH 5HGBA 1ODAA 2ZSVB 4N0FA 2QBWA 3KPMB 1VEPA 1P7KA 1WBYB 32C2A 4JY4B 3EOBB 3RY6A 1AKJB 2D7OA 2ZCHL 4BH7A 4HWEH 3F12A 1IM9A 2HRPH 1ORQA 2L7JA 5FYKD 5IMKA 3JWOC 1W2KT 3DYPA 4HX1A 3WNLA 5INCB 1CLZH 2BVUA 4QO1A 4XXCC 4V1DA 1FNEA 2VITB 4JQXA 2R4RL 1C5CL 2FNBA 5MEQA 5CP3H 4HUNB 1FE8H 2F8OA 2Y6SD 5JW3H 3BRDA 2A6JB 2OJZH 2R0WL 4X99B 1NBYB 4Z7WB 3GI8H 5D6CA 4HKJA 2FEDD 2FJHA 5IB3B 1DBBL 1EFQA 5DMGC 1BFVH 1MCQA 1DLFL 1I1YB 3REVA 4BQ8A 1F2QA 4L8BA 1BFOA 3ILPB 1WZ1H 4JG0L 3NCMA 1NCCL 3OAYH 1F5WA 4UNUA 5D5MA 2H9GA 2ZUQC 5F9DC 5F1NA 2HVKA 3UDWA 4JFHD 3MA7B 3V8OA 3BW9B 4K7PX 3QHZH 3EIFA 5FKPB 2E27L 2BFVL 1MLCB 4P2OD 5TPWH 2X9WA 4U1LB 3RU8H 4ENEC 3T4YA 4PPTA 1A3RL 3V5DA 2VDKH 5HVHC 3EOTH 5H2BA 4XB8A 4G8GE 1UXWA 4L3EA 4AH2B 3CSPA 5D72L 4F9LA 4LSUH 1JPGA 2VL4A 4X0KA 2YPLD 1JGVH 2PO6B 1PY4A 5T33H 4GKZA 4TVSa 1I1FB 1SM3L 2PTTB 4X6FB 3BO8B 4RWHA 4DQOL 3A6CH 4GAYA 3EHBC 4DKFL 3N9GL 2CK0H 4WWKC 2P5WD 1RJZA 5GISL 4ZSOA 4XVTH 1U8NA 4AG4H 2HTLC 5JNYB 1S9VB 4RZCA 4TNWK 4S1RL 3C8KB 2Q86A 4N5UA 4R97B 3QDJE 4TTDC 1AY1H 4EI5D 3QCTH 3QIWB 5SX5K 1MWAH 2PXYB 3D0VA 3PV6A 1RSFA 3MV11 5I1LA 3X14B 1HHGB 4IS6A 1MJUL 4LCYA 2H32B 1N64L 1HXYB 3VRJA 5C0CE 1R3HB 1I1CA 2NY2B 1A47A 2DWEB 3DXAD 4NC1C 2YPVH 4GSDH 2EICA 2I25N 1NBZB 3MLTA 4GW1B 1NBVH 3STLA 1ZLUK 2E6QA 3O6KH 3WV0A 1Z9SA 5D7KD 3PG2A 1GHFL 3BMVA 3IB4A 6CGTA 1J0KA 4NQXB 3M1BB 2HFFB 1CE1H 4FABH 5HGAA 3VMPA 3RVUC 2VB5A 4XP6H 1JPSL 3TBSA 3V0VA 2KPNA 4Y8DC 2A9NL 5T1MA 3WKMH 3GHEH 4POYA 5JHLL 3O0RH 4ELKB 1WITA 3LQZB 3A0OA 3HFML 4JO2H 2WQ8A 4XRCA 2BJML 4UT9L 2P48B 3INUH 4X4YB 1R3IH 2P5EA 4B7IA 5AUMB 3BZEB 5DA0B 2UWEA 5DI8A 2E7CA 1UWEL 3BEVB 4JHZA 4PJ5D 3DURB 5DD0L 1S7TA 4H0GA 4NRXB 5IBLD 4QT5B 4LKCB 2ZSWB 1AQKH 5HHXH 1T1YA 4HUVA 5JO5A 3GSVA 4ERSH 1S7QA 1QBLL 5IR1A 1S5IL 1AI1L 5I9QC 5KSBB 2Z92A 2Q3ZA 1SMAA 4H88H 1N8ZA 1A1MA 1MFBH 5DHXB 2VZ3A 1CDGA 3ZTNL 4GKNB 2OI9C 4LP4A 1IC1A 5B38G 2EDBA 1EGJL 3PDDA 1G7JB 4LQ1A 5GRJH 2HFEA 1IGCH 1DN0A 2FR4A 5C0IA 1H3VA 4EKXA 1A7QL 4YJZL 2AK1L 4MNHB 2CIKA 2WBJB 5ANMA 1FCCA 3IDJB 4OKVA 5IVZB 1FRGL 5JIPA 3SDXA 3TIDB 3CNKA 5L9DH 4KHXH 4PJCE 4MA8H 4FZ8H 5K9KA 4X9FA 1RIUH 2HJLA 2YK1H 5IFHL 4FXGA 2ED7A 1CWVA 2P42B 3LKNA 2FX7H 2YOCA 4JKKA 5E8PA 3BPNC 3HR5A 4KC3B 3M17A 3P73B 3VFWB 4HIJA 5ADPL 2IQAB 1HSAA 1A7RH 7FABL 4TQEH 3T0EB 3TZVA 2XFXB 3RGVB 1ZLVK 3OTTA 5T3ZD 1ZS8A 3QIBB 1ED3B 2CGRH 1RJLA 4AL8L 2XPGB 3WUZA 3H0TB 1LEKA 3GIVB 4KKLD 5CKGA 1AXIB 3SDCC 1HHJA 3QR2A 2A6KB 4PJDE 5E9DE 1FYTE 1KCUH 3ME0A 4ZFOA 2RAMA 1EX0A 4UILH 4L1HA 4ZTPH 3M8OL 1F4YH 5DUPH 3KGRA 3LSOB 3VFSB 3H9SE 3P9WB 3OR6B 1ONQA 4PJXE 3IT8D 1A6AB 1IM9D 1JPTH 2X7LA 5HHPB 4JANB 3TVMA 4E42A 4Z6AT 5INDB 3EYOB 4XPBL 4ELME 1FVCB 3RL2A 3NZHH 3BN3B 4LIQL 5FAAA 3TJHC 3RJQB 4V1DD 5ACLA 3EDJA 4JQVA 4M1DL 4A6YB 2EKSA 4KXZH 2YN5A 5F3HA 5MEOA 3QXDA 4TUJA 3SDAB 4U1GB 5J13B 4HWBL 1A5FH 2CDFB 4GRMB 4XZUB 5JW5A 5IJKC 3Q1SH 4OLWH 3BX7C 1PQZB 1FZKB 2BOBB 4PRIA 2SEBB 4PJCF 1CTNA 4KK8C 1E4KC 2GJ6A 2Z8RA 4EI6B 4G8FA 4JFHE 2MTPA 3VWJC 4R3SB 1WC7A 4JFEE 4RNRA 1A14L 2FATH 4EUPB 3U79A 3O3BB 1XIWA 3GB7A 1BAFH 1T20B 1Q9OA 3D25B 2IMMA 3KYMA 4MNQB 4QRTA 4QNPF 4WI8A 1U8KB 4HDIA 4OF0A 2AQ3A 2YPLE 4PRPB 3LQAH 5J06A 1QLRA 3EO0B 4PJDF 2W60B 3EZJB 1KACB 3HAEB 5BXFA 1U8PA 4L3ED 5E5RB 1ES0B 1Q94A 1KJVA 4UI2A 4IRSB 4X5XB 1IAIL 1MCOL 3QDME 2P5WE 1MCCA 4JDVA 5CJXA 1LE5A 1IEBA 1XFPA 5EBLA 4AQOA 3FO0L 3L3KB 4ELMF 3GEWB 3PF2A 3AS0A 4EDWL 4PD4K 4YHZH 4WW2C 1DSFH 4YHOL 2B5IB 3MJ8A 4L9DA 2A77H 2KKQA 5HHMB 3P0VH 4D8PA 1LQSR 1FGVH 2OLDA 2BVYA 5C09B 4U1SA 2JELH 3PGDA 5EOTB 2E7BA 4QHKI 2JK5B 3WNPA 3PE9A 4WUUA 5F7NC 5T5FL 4K7PH 4P5MB 4UV7L 4BQCA 5D7KE 5DTFB 1DBKH 3KPLB 2OL3B 4KQ4H 5L88L 1X5XA 2QLVB 3P4MB 4HIIB 1DE4B 2KBGA 1D9KA 3Q3GA 5IB4A 1G9ML 4PRDA 3T77B 3RWIB 4MVBD 2AERT 2VLKA 5E4IA 1OOAA 1EEZA 3GBMH 4NQDE 5IV2B 5GS1B 3ARFC 3OKDA 3P9LA 2CH8A 3JUYA 3JWOH 3BPLC 5HYSB 3PWUA 4ZUVB 4CN1A 4RFEA 3JV4B 1IGTA 2EYSB 4K9EC 4W70A 5L8KB 3HG1B 2LVCA 3WJLA 2V5RA 3NFPA 1KEGL 2IAMA 5FB8A 4MAYC 4FQ2L 4C54A 1I9JH 4HJJL 1UM4H 3TWCH 4UOW0 4JHWH 2WWMD 5IW6A 2YUVA 1OGAB 4PJ5E 1MFDL 1YEDA 4H0IA 5F1IA 5EU3B 5CD5D 5JPNB 5I1CL 3R4DA 4FFZH 3JWDH 2DQJH 1C7SA 1M6OA 4G9DB 5DMJB 4WU7A 4URTB 2D2OA 4LCCB 2YPKA 4H20H 4ODUB 3RAJL 3U0WH 3QYCA 2BC4A 1YYML 2BSRA 2X4PB 3WS3B 3MRBB 4M43L 1JZ3A 3CSYB 1AGBB 1RQ5A 2FD6L 1UB5B 1G7PA 3GMNA 5K9QI 4LCUA 1H15A 5ESAB 3AB0B 5ICXA 1CDCA 1IE5A 3KPRD 1AJ7L 1F4XL 3EDKA 3QEQA 4AIZA 1EHAA 4L4VA 1KJ2B 1CGVA 1E4XL 5HYEA 1E4WL 1EO5A 3ARBC 4GO6B 4NHCH 4Q6IB 1RZ7H 4LCWA 4TNVF 1JZ2A 3SGJC 5SWQA 1TQCB 2Z8VC 2ZJSL 3LOWA 4Z76A 2APFA 2DQIH 3IETA 2R1YA 1KIQB 5ESVB 1MJJA 1MCHA 3FT3B 1OP3K 2D7PA 4R7DB 3HNTL 5IJVA 1I9RH 3ARZA 3EFFB 3OAZH 4BH8A 4YXLL 1JNLH 2B2XL 2Z31B 4XNZB 4XP1L 1FVEB 4P2OC 5D96C 3G5YB 1CG9B 2QQQA 4W4NA 3MRDB