4OGAD

Insulin in complex with site 1 of the human insulin receptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor/hormone/immune system
molecule keywords Insulin A chain
publication title Protective hinge in insulin opens to enable its receptor engagement.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogaD00
3SGJA 2EDTA 4CAGA 1X5XA 4R8WL 4MJ4A 1S9VA 2APFA 1FV1A 3T8XB 4L4VB 5TDPB 2NX5E 3QDMB 4JY4A 3SGEI 3UJIH 5MEOB 1B0GA 2Y06H 5F3HA 3RWEA 2NYYC 1AP2B 2XG5A 4N0FA 1CYGA 4Y16D 3O3UN 4J12A 2LFGA 1X4YA 1JPSH 2ZUUA 5E8DL 2A6DA 2VZ1A 1MRFH 1EGJL 1BAFH 4HV8A 1KC5H 2NY3C 5FKAA 2UWEE 3GI8L 5BCAA 5CHNA 1HKFA 3JBG7 5C0BB 1HOCB 3SBWA 1U3JA 2J6EL 3F7YB 2HN7A 3GEWB 4RFOL 5I15H 4MMXC 3WFEH 4NN5C 3N1QC 4WO4B 4CVZA 4IS6B 5LGHL 1AQKH 3ZDXE 3DVNB 4L3EE 5EOCH 1QRNA 1NMBH 3BP7B 5J9PB 3JWNC 3NMEA 5I66A 2DQHL 5FECA 5TDNB 2EIDA 3PJSA 4FQHB 4E41A 5JXEC 3S35H 3P0GB 3OZ9L 4HKBA 4ODXA 4BQCA 3WN5B 3QIUD 3QBTB 5FO9A 2VR4A 1DQDL 3GBLA 2V7NB 4MWFB 5D1ZD 3T8XA 3QDMA 5MEOA 3FB8B 3SKOB 4KMTL 1JNNH 1F2XK 1AP2A 2DQIL 1Q0XH 5T1DH 4JPVL 1JTOA 2OLDA 1AR1C 1MUJB 2YXMA 4WEBH 1BIIB 3HI6H 3FTGB 1INQB 2J8UF 1BECA 4KKAC 5DMKB 2BZDA 4BUHA 5I76B 5F9OH 1FQ9C 1NUFA 3EDKA 5C0BA 1HOCA 4Z8FH 3F7YA 2R4SL 2PW1B 1T6VN 5FDWB 5GZOD 4WO4A 4IS6A 3P9MB 3DVNA 1LE5A 1YMHA 5ILTH 4G7VH 1KNOB 1PFCA 3P40A 5TDNA 4FQHA 1ZA3A 3L3KA 5F1NB 3WN5A 1OPGH 3JV6B 5DZLA 1XMWA 5HDLA 5ETUB 3K0WA 4GG6F 2V7NA 1OAUL 3QHZH 2B4CC 3FCTB 1MCOH 1G9MH 3DROA 3FB8A 4RZCB 1A3LL 1KCVH 5DTFB 3IU3B 3T2OA 4P99A 4KMLB 4LK4A 3I2CH 4XCNB 2EDJA 5B39A 1J0IA 1CFVL 4FP8H 1MCDA 4B0MM 2MMXA 1MUJA 2V9QA 1BIIA 1EJ6A 3FTGA 4GXVH 3JVGA 4N0UB 4PY8I 1MFNA 3QRGL 1CVSC 4OGYH 3FHAA 2P48B 4LPVA 4BK5A 2FX9H 5E6IB 4C4KO 4KPHH 3O0RL 1I1AC 2PTVA 4H25B 3BPCA 3GK8L 3M45A 5FDWA 12E8L 1ROWA 4EI6A 1YN7A 3P9MA 2PTUA 3IGAB 4MNQB 4MVBD 1BF8A 3LOWA 4NC0B 4K94H 1DSFL 1KNOA 5HGDA 4UAOC 1NEUA 3A6OA 5F1NA 3JV6A 5GRUL 4PYHA 4JN1H 3QDGD 3FCTA 1IL1A 2QEJA 2ARJB 1IAOB 3N0PB 5M94B 3UDWC 5ISZD 5K59F 2VJXA 5KS9F 4RZCA 1E6JH 5C08E 1C5CL 4Y5YC 5GRVK 2CDGB 3IU3A 4K8RH 4XCNA 2PF6A 1RZJL 4FABL 5L2KB 5D1XB 5HI5C 5DRZA 4LAQH 4YNYB 5F6IC 4P2RB 4F37F 4Z7WB 4S1RH 4PJ8A 4NYLB 3V6OA 2JB5L 4N0UA 6CGTA 5CWSB 3QO0B 5HYIA 3VWJB 1K5NB 3ZTNL 4WI6A 1JPST 5E6IA 1U91B 1R5WA 4JLRA 4GKSA 3NTCL 5GGRA 4JB9L 3X12B 1N7ML 4LBEB 1NEZG 1DBJL 1MQKL 1ZGLB 3FT4A 4R8WH 3GHBL 4JQIL 4MS8D 1YEDB 3IGAA 2WUBL 4HLJA 1C08A 3V5DB 3CX5J 3O4OC 2X4TB 2CLVB 1CDBA 1D9KC 1FBIL 4HEME 3RY4A 4X8XA 4PGBB 1T5XA 3TESA 3BH8B 1B4RA 3IF1A 3MV9E 5JMOC 3RX8A 2BDNL 3V0WH 3ULSB 5E8DH 3RU8L 5J0BA 3STZB 2ARJA 1EGJH 2A2QT 4H1LH 3GI8H 1S7VB 4G9FD 2CDGA 4JVUA 3I3DA 2MKLC 2VAJA 2XXCB 5DS8A 4P2RA 4JVPA 5FYLD 4RFOH 4Z7WA 3VFNB 4K55A 4TNVK 4NYLA 5F9AC 5LGHH 5DGRA 3VWJA 4KAQL 5FYKL 1K5NA 4QRTB 1V5JA 4TRPH 3SO3B 2BOBA 4XZUA 2DQHH 1U91A 4XHJD 2NY1D 3X12A 3OZ9H 4JPIB 3H0TA 4ZUSB 4LBEA 1ZGLA 7FABL 1A3QA 1CE6B 1DQDH 4X5XA 3DMMD 5E5MB 1MCRA 3OAUH 2F58L 4NQDA 3V5DA 3TEUA 4KMTH 3TO4C 4KDTA 1G7QB 2DQIH 4PGBA 3VDCA 3BH8A 3IRZA 2FEEI 3QNXA 3BH9B 3AGVA 3ULSA 3KJ4B 3CDFA 3MJGX 1CGYA 1S7VA 3H3KA 4FFVD 3EYSL 1A6TA 5EBMB 1CDCA 5IP4A 1TTGA 5EUOA 1F6FB 3B6SB 3AMKA 2ID5A 1TETL 2R4SH 4YPJA 3K3QA 5HD8C 3VFNA 1ACYL 4G8GE 3OAZH 5I1EL 1GYAA 4I9WE 1FZKB 1IE5A 4QRTA 1K9TA 1MCNA 3RJQB 2CRMA 4HSQA 4JPIA 4ZUSA 4Y16C 1XFPA 5F9DC 4OCMC 1CE6A 4HH8A 1OAUH 5E5MA 1BJ1H 5D6CA 1ZXQA 3QPXH 4QNPE 3SE4C 1JNJA 1BZQK 9CGTA 1CDHA 4MJ2A 1KSRA 1A7PL 1I9JL 2VWEE 1G7QA 4Z78A 4GS7C 4FQ2L 2AK1H 5TQ2L 2VLRB 1CFVH 2R2HB 1DEEB 4UNUA 4DFHA 1EAPB 4LLAA 4XVJL 3KYOB 4A2MA 5CKGA 4WU5A 3L3OB 1J1XL 5F7MC 3QRGH 1HILB 1OB1B 4RAVB 3LRGA 2LU4A 3B6SA 4WUKL 1XIWD 1NSNL 2P49B 3O0RH 4NC2B 1JHTB 4TPRL 4ZUTA 5JW4M 1I3UA 1U8PB 3GK8H 3ULVH 1IVLA 3MYJA 5AEAA 4UT7L 1BD2B 4L29A 1DSFH 1EMTH 1AY1L 3ARXA 1QFPA 2PKDA 2ZG1A 5GRUH 2VLKA 2QR0A 2BVUA 4GRWE 4KJWC 3VGDA 4F80A 4O51A 1F4AA 1C5CH 1CDJA 1S9YB 4MDIB 2B5IB 5A1AA 4AEIH 1UZ6E 4CU7A 1RZJH 2VLRA 2O61A 3G6DL 2OMNA 3QEHB 3B9AA 2R1WB 1DEEA 5KSBB 2G60L 5INDB 1VEPA 2JB5H 5GZOC 3L3OA 2IH3B 1JTTA 1PX4A 1HILA 3RVXD 4RAVA 5J8OA 3ZTNH 4O02H 4LF3B 1IQDB 4PRIA 1MQ8A 1JHTA 4JB9H 1NC4D 4GRLC 4F2MB 1N7MH 3ES6B 2XACC 4WFHE 3B9KC 4XX1E 1DBJH 1MQKH 4KGLA 3QQ4B 3GHBH 1DQLL 4JQIH 1UZ8A 4PJHB 1FCCA 5KSAC 3L9RA 1N0XL 4JFYB 1FBIH 3M1BB 3WNPA 2CK2A 4MLSA 5MP6L 1H3GA 2F54B 4OF7A 5C0CA 3R4DA 1V3KA 1OOAA 3RU8H 4M3JA 3LQMA 3CLEL 4L9LC 4OGZA 1KACB 2QBWA 5BZDA 4TUJB 2CKBL 2HFFB 1S9YA 4NO2B 4MDIA 3D2UB 4OFYD 3QEHA 3KYNA 3OR7B 2JCCF 2R1WA 3K4AA 4HJJL 1O7SA 3MJ8B 4GOSA 2GJJA 2ZKHL 5INDA 3N1GC 6FABH 5F7WC 3MLRL 1QSEE 5EBLB 3HI1A 2IH3A 3UZQA 4KAQH 3F58L 4ENEC 1K2DB 3FT2A 4NRXB 3EO9H 2D0GA 5CD3B 1IQDA 3RWHB 4FA8A 5C6WH 4ETYA 5MEQB 4F2MA 2A83A 3VFMA 7FABH 3S36X 3QQ4A 4K9EL 1QEWB 2UVFA 3H9SE 4PJGB 43CAB 2F58H 4XWGH 1PYWB 4JFYA 5BVJB 3BWAB 1XF5B 1KPUB 2COQA 1T7YA 1X5AA 2VDKL 1JI2A 4L8CB 1RSFA 4KVNL 3G9AB 4GQPH 2OL3L 4DZ8A 2WLYA 4PJXB 4TUJA 2FEDC 2NY6C 2HFFA 5EZJB 4NO2A 4Z7NF 3D2UA 2X41A 1K4CB 4LSDA 3OR7A 3S37L 1LK3L 3BZ4B 3MJ8A 3DJ9A 1TETH 3ZYJA 4XP6L 1HHIB 1MCQA 1ACYH 3UTOA 4HPYL 4Z6AT 5EBLA 5F7HA 3H9YA 5I1EH 4TOYL 1K2DA 4JM2B 3TZVC 3QSKB 4FFZL 4AG4L 3RWHA 2OJZH 2V9RA 1T03L 4NCDA 2A38A 2OI9B 1U92B 4PJGA 4S1QL 5DJCB 2J1KA 43CAA 4DUWA 4L4JA 3QYCA 4E0RB 5B38G 1PYWA 2P5EB 1KPUA 1A7PH 1I9JH 1NGZB 3C5ZB 4M8VA 1QPXA 4QKXB 3T0VA 4FQ2H 2X4QB 2XQYG 4X9GA 5TQ2H 5KW9L 4L8CA 1W2KT 2FRGP 4NQEA 4L5FH 4XVJH 4PJXA 1V3LA 1F8TH 4YXHL 3UMTA 5EZJA 1J1XH 4TNWK 5IB3B 1F3RB 2YSSB 3WJLA 4HGWB 1NJ9B 1WVZA 3GMQB 1G6RL 2XY2A 4J3UA 4WV1B 1K4CA 4WUKH 4OD1L 1BVZA 4CJ0A 1NKOA 4U0RB 1NSNH 2OTWB 2B0SL 5JHDE 3I75B 5C86A 4MXQC 2X4PA 4YDIL 2J5LC 2NY1C 1HHIA 2VLJD 1WFOA 1T2JA 4UT7H 4YGVA 5ACLA 1HIMH 3FO2A 3HHRB 4JM2A 3BUTA 4M7LL 4NOFA 4N9GB 5GHWL 3ARQA 2Q7YB 3FFCD 3TCLB 1H9VA 5JOPE 4JGUA 3QXAB 2BVQA 2HMID 3LKQB 3IYLW 5DJCA 3BX7C 1KXVC 4G6JL 4E0RA 1VFOA 1RUQL 2P5EA 3C5ZA 1KIPB 4YC2C 4BUGA 1MI5D 1CI5A 4HQQL 3G6DH 3WFDL 3BRDA 1ND0B 4I4WA 4D8PB 3PXJA 3T0ED 4URTB 4LSVL 4HGWA 1NJ9A 4WV1A 3VA6A 1BFSA 2Z31A 5D2LE 1CFQB 5GGVH 3CZJA 4OCXL 1KFAL 3EFFA 3I75A 1DLFL 3H9HB 5ELIA 5SWZB 3GJFK 1IGTA 4NJ9H 1V3JA 2HRLA 3F8UB 3KPRD 4JKWA 1DQLH 4PJIF 3ROLB 1U42A 3CVIH 5I1JL 5HHNA 1G7LB 3WHE0 1JPGA 5C0RL 4JDTL 3RY5A 2GJZB 5LBSL 4PIRF 4N9GA 1JNLL 5SX5H 3CFCL 1KJ3H 2Q7YA 4ZODA 3WIFB 2ENSA 2QTEA 3DX9B 3TCLA 4JZJC 3LKQA 1VGEL 4EUPB 5EG6C 4ODWB 2CKBH 1KIPA 1WBYB 3I6LE 2C1OB 1GGIL 2ICWI 3QUXB 5J3HC 2CIIA 4PGDA 5TJWK 1IAIL 2AAVA 1XIWC 1ND0A 4LRNL 4D8PA 1OP9A 1MSPA 3CVHL 3KYKL 3WV0A 5DZOA 3MLRH 2UY6A 3WXWL 2JKXA 1FAIH 2VXQL 4XPHL 2GY5A 4CRPA 4HIJB 2GYSA 1FJ1B 3F58H 1PSKL 2W91A 3K2UH 5C0AB 2W65B 1KF9B 1J1PH 2YKLL 5D8JL 2WIIA 3C6LB 3H9HA 5GJTL 1IAKB 5SWZA 2EDFA 5ECJE 4KZDL 4WHYH 4YHML 3OXRB 4OF0A 4OZHB 4G6AD 1PD6A 4IMKC 5DFTA 3ROLA 4K9EH 3ZE1F 1DE4B 2NCMA 1KLGB 2XY1A 1KXTB 3JWDL 4BKLA 4D0BB 2GJZA 2Z8VC 1ED3B 4I48B 3ME0A 2VDKH 3MLXL 3WIFA 1UWXH 3DX9A 4F37K 2B39A 4ZD3H 3DBXB 4AIXA 3IFPB 2XN9B 4KVNH 2H32B 1T2XA 4WHDA 1EUTA 4EUPA 4GMTL 4ODWA 4R0LB 4HUXA 4GRLA 4R7NA 3GM0A 3B9KA 4LLDB 4NKDB 3LZFH 4LRIC 5AAWA 3QUXA 1TVDA 3RVXC 3VGAB 2EDOA 3HE6D 1J5OH 5KSAA 3S37H 1LK3H 2HAZA 4KQ3L 2CGRL 1CFSB 4XP6H 1PKQE 4RGND 1RZGB 4L4TB 5I6XB 4ESKA 4HPYH 4PRPB 3L7EB 5T5NF 4TOYH 2Y6SD 4HIJA 1FJ1A 5F96L 4MZ3A 4XC1L 4BZYA 2N4IA 5C0AA 2W65A 3GBML 4FFZH 4AG4H 3C6LA 4F7PB 1IAKA 2ICES 4N0RA 4P2OD 4F15C 3UO1L 1T03H 4Y19B 1EA9C 3KLHD 3OXRA 4OZHA 1T4KB 3L5XL 4GRMB 4WWKC 5TGBB 1MCWM 2IMMA 2YN5A 4S1QH 1OGAE 1WAAE 2ZUWA 1G6VK 4D0BA 1DBKL 2WZPD 2A9ML 4HBCL 3TN0A 5GGUB 2X4SB 1KB9J 3DBXA 4DN4L 5KW9H 3IFPA 4M6OL 3RGVD 2H32A 1QFUL 5FV1L 4R0LA 4YXHH 2IG2L 3PP3K 3RDTC 4LLDA 4MD5A 1YMMB 1IEHA 2DTSA 4Y8DC 1G6RH 3S4SG 4OSUL 4OD1H 1YJDC 2YD2A 4O4YL 3RGHA 4YDIH 1VA9A 4L4TA 1D5MB 4ZOEA 4W4OC 4PRPA 5F7FA 1N2RA 2E8ZA 3WFCH 4L3ED 1GXEA 4APQD 4JCMA 4Z7VB 2Y07L 3MLSL 5GHWH 3HMXA 3QUZC 4F7PA 1ZVYA 4GKOA 4XPFH 3TYFB 3DSNA 4Y19A 4X4XA 2DD8L 1T4KA 4GRMA 3MJ9A 1R3JB 4OLVH 3RZCD 4G6JH 1RUQH 3KPQB 2LTQB 4PRAB 4WEUD 2ESVE 5D93C 1CU4L 4QWWD 5C70A 1G9MC 1IFHL 2X4SA 4HQQH 2WIMA 4F9LC 4GG6E 3TZVA 2Z8SA 5FUCE 4CN6A 2A9NL 3CXHJ 2DDQL 5CSGA 3NA9L 2VNCA 2NY0B 5IBLC 5DMYA 1YMMA 2YUWA 4LSVH 1RULL 2Q3ZA 4X4ZA 2ADGB 1CICD 1X5YA 3ZSTA 3O3AB 3G08B 4OCXH 1KFAH 1YC8A 1DLFH 4E5XB 4XTRD 1D5MA 5IM7B 1QVOB 1TCMA 2ORBL 3MGOA 5HGGS 3X13A 5I1JH 2X7LB 4JDTH 4XNZC 5LBSH 4Z7VA 5KZCB 3C5SB 1H8NA 5DZNA 4KJQD 4PLJD 1DUZB 4NT6B 3UJJL 3TYFA 2QADD 1CIUA 4YBQD 1G0XA 4LGPB 1R3JA 1YY9C 3GMLB 3O6FB 4FQXB 5BS0E 1VGEH 2Q8AL 4GFTB 1FL6B 3V0VB 4JREB 4PRAA 1G0YR 1GGIH 1M7DB 4HFUH 1MPAH 3BP6B 2O5XL 1IAIH 3PQYB 1I85A 3K8KA 4LRNH 1IGMH 3BZDA 3CVHH 3KYKH 4OV5B 5K59E 4Z7UF 3LKOB 5KS9E 3OWEA 1U3HC 2VXQH 2AK4B 4IOFD 4H26A 3AREC 2ADGA 4G6FB 1PSKH 3UEZA 3GB7B 4ZOCA 3ZKMD 3D39E 4QHMA 3O3AA 1U93B 4M1GL 5D8JH 1P2CB 3G08A 4GJTB 1TTFA 3FOMB 2FHCA 2IFFH 4OZ4A 5I71C 3REWB 5GJTH 5I19L 4KZDH 5JUEH 4I0PB 2UUDK 4YHMH 5IM7A 1QVOA 5GXBB 1ZAGA 1RU9L 4OTXL 5JLZA 2HMIC 1MHCB 2X7LA 4JRYE 4Y5VB 3JWDH 3A67L 1WFTA 4Q9RH 1DUZA 4NT6A 4PR5B 3MLXH 2X1QA 4N1HB 4MGXA 3O6FA 3GMLA 4FQXA 1FG9C 3L3IB 4NO5B 4Y4KC 5L2JB 3BPNC 1YPZB 3TFKC 4GMTH 3WCYA 1FL6A 5ENWB 4ELKB 1FE8L 4DVBA 3WEXA 4FXLA 3DHJA 3T0EC 3W5MA 1ZEAL 4AJ0A 4HH9B 4ZUVB 3REVB 5GSRB 1UVQB 3BP6A 5FXCH 1TZGL 1S8DB 3PQYA 1AH1A 3C60D 4KQ3H 2CGRH 5F8QC 3VXTB 4OFDA 3HUJB 5LG1A 2AKRB 4PGJA 3EYUL 5FA3B 4MNGE 2E9BA 2V5YA 4D9RD 4M6NL 1UWEL 3GB7A 4XC1H 3TBTB 5CJOL 1U93A 3GBMH 1P2CA 1U8NB 3FOMA 2NY2B 4JHBA 5B21A 3SKMB 3LS5H 5HHME 3S3SA 2ITCB 4I0PA 3KXFD 3UO1H 3L5XH 4X9IA 1MHCA 4PJBB 1Q9LB 3QXTA 4Y5VA 1FVCB 1DBKH 1NCBL 4OQ1A 4MB4A 4HBCH 4PR5A 1S78C 4DN4H 1AC0A 4M6OH 1QFUH 3Q1SL 4YR6B 4PJDE 4ELKA 1QOKA 2IG2H 3LD8B 2GTZB 5IEHB 3REVA 1JP5A 5GSRA 1UVQA 5JW4Q 4RRPA 4OSUH 3TA3B 2P4AB 1KT2A 4O4YH 3DXAD 3VXTA 4JZNB 3HUJA 2NY4D 2DQDL 2V17H 2VUYA 4R2GB 4U2YA 5FA3A 1ZS8A 1IGYA 5DRXB 1MCWW 4G6AC 2EXYC 4LP5A 5DT1L 4JFOA 3WHXA 3GMOB 4LVOC 3TBTA 5IFAH 3ALXA 1GZQB 1U8NA 2Y07H 3F6LA 3GSQB 3IU4L 1LNUA 3SKMA 5GS0D 4LSPL 2K1MA 2ITCA 3RTQD 3ARBC 1HQ4A 1YECL 1ZLUH 1WBZB 5HYJE 2LU3A 2DD8H 2R69H 3E1F1 2BNQB 3I3BA 3SGKC 4PJBA 1VERA 1Q9LA 4P5KB 1FVCA 4K3EH 4NC1E 2FGZA 3GIVA 2NW3B 3OV6A 1CU4H 2BJMH 1IFHH 4TUKL 3MSPA 2VB5A 3NOIA 4CMMB 5HVFB 1RJCA 2VR5A 2A9NH 4YR6A 2DDQH 2ZUVA 1O5DT 3NA9H 4RGNC 4Y4HC 1JL8A 2GTZA 4Z7WF 1RULH 5FGBC 2Y6SC 2YD1A 4MJIB 4RCAA 4WWKA 5IWLC 4N0CC 4KWUA 3N85L 5HHOB 1AGCA 3VXRA 4NWUH 4JZNA 4WTWA 3KLHC 4ZXBC 2ORBH 2VDNL 4I9WD 2RFXB 3DVFA 1BFOB 3QDJB 3BGFB 4Y2DB 5JXAL 2EEDA 2X10A 1GZQA 3GSQA 1B0RB 5MEPB 3O6KL 1X5JA 2DTML 3BVNB 1WBZA 4TTDC 3G6AB 1NGYB 3DSFL 2BNQA 2Q8AH 3D3VE 4P5KA 5F97E 4D3CH 1PVHA 5ITFB 2AQ1A 2PYEB 2BNUA 5MENB 2X05A 2O5XH 3GRWL 3QEQB 4CMMA 3ET9F 4GUPB 5EUOF 3VFWA 1P5VA 3QUZA 4P23A 4B53A 4XP9L 3VGFA 5J1TC 3OKDB 2I5YH 4LQ1A 4MJIA 5D7LE 4UIKL 2AEWA 3QZWG 4M1GH 5HHOA 4BH7B 4AMKH 1FFNA 5I19H 4KTDL 1D7FA 4JHZA 2VDOL 1RU9H 4OTXH 4AH2B 4OCWL 1BFOA 3QDJA 4ODVL 1GSMA 3RFZC 4Y2DA 5IJVB 1TQCC 3A67H 2NZ9C 1LDSA 1B0RA 1DLHB 5MEPA 3TVMB 4XNMB 1WWAX 2WK2A 3QI9C 1KN2L 1R24B 2PNDA 1YEKH 1FE8H 1CE1L 2CO6B 1EHLL 1DQJB 2DKSA 1SY6L 1ZEAH 3PGCB 4M8QB 3RKPA 3VI4E 5MENA 4OUUB 1EJOL 1TZGH 1ZLVK 2EDDA 2GT9B 4GUPA 4LIQE 1WT5A 3S88L 1OSPH 2JTDA 3BD4A 4NKMA 1IQWL 2D03H 3Q5YA 4M6NH 4OFIA 3OKDA 1I8IB 2AJVL 4UU9B 1DBAL 3IAQA 1G9EA 5CJOH 4LSUL 3O11B 3AVEA 4BH7A 5E1HB 2DN7A 2JCCE 4HKJA 2YEZB 4PLJC 2VTFA 4V1DB 2QADC 3VDAA 4MQXD 4YBQC 4GBXB 3WHE1 4H1LB 4ZO9A 2QHRL 2FSEB 4CADB 4CNIB 5IEKB 5ALBL 2FLBT 1NCBH 5DK0B 1U3HA 1DLHA 1NMCC 1LEIB 3TVMA 2CSPA 1D6VL 3IJYB 1FLRH 1JMZA 4WI9A 3MV7D 1R24A 3L5IA 3MNVB 4MXVF 3DNKA 3Q1SH 2RGSA 5EU7E 5T3XL 1EBAA 3TIDA 3NAAH 3UBXG 1J8HB 3DOSA 1DQJA 4P3WA 3BEWA 2JJTA 3PGCA 2R23B 4M8QA 5DURB 3N50A 4OUUA 3ZKMC 3FFDB 1UB6B 1V3MA 2GT9A 2P7TB 4PJFB 1FIGL 5ICXB 1QSED 3DX7B 3GSWB 1HQRB 4UU9A 2V5SA 3ZT5A 3IDGA 1UCTA 1EO8L 1A7RH 5ESQA 1BQLL 4UB0L 2YEZA 4F33A 3LQAC 3JUZA 4LSPH 1PBYA 1YECH 5EFIB 4XBGB 3AUVA 1EGJA 4GBXA 3QRFM 3THMH 4H1LA 4MCYB 4CU8A 1RQ5A 2FSEA 4CADA 4U6YA 4CNIA 5IEKA 4HUUB 5DK3A 4MSWB 5DK0A 1OQXA 1UB5B 4TUKH 1LEIA 3PP4L 5GRXG 3IJYA 4MNHB 1LO2L 4QT5B 3C60C 3MNVA 5EBWB 2PETA 1TIUA 1S9WB 3OJDB 4WHTA 2H3NA 5E2VH 3S96B 5F44A 4M7ZC 4ZTOL 4LSTL 2R23A 4NQTA 5D7JD 4F7CB 3D5OF 1OAXL 3LEVL 3N85H 3FFDA 1UB6A 3T1FB 3OKEB 2P7TA 4PJFA 5IOPA 4P4KD 5BZWA 5T3ZE 5KN5B 1WZ1L 4ZUWB 5ICXA 3N06B 3DX7A 5F6HJ 2WSKA 2VDNH 4EN3D 5IVXA 5IK3B 1HQRA 4LSRL 5EA0L 4ELME 5KBNC 5JXAH 4M62L 1HNGA 1IC4L 3O6KH 1E4WL 2DTMH 5EFIA 4XBGA 4MCYA 4HUWB 1CLYL 3OKOB 4HUUA 1YEIL 1PG7X 4MSWA 3GSUB 2EEAA 3CSBA 4PLNC 1UB5A 3P11L 4MNHA 3D69B 4QT5A 4OCRL 3QR2A 5IB5B 2BXZA 4TVPE 3WDIA 4HULB 5TDOB 3G6JF 1S9WA 3FB6B 4XPAL 3S96A 2W9DL 5E4EC 3V6ZA 5IB4B 2XTJE 4UIKH 5DR5L 4Y89A 3T1FA 4DOHE 3OKEA 5E94B 4NQCE 2F8OA 2P44B 3O8XD 4ZUWA 4KTDH 3RTQC 4P3CH 1LHZA 5IK3A 5D1QD 3SDAC 4ODVH 5DD1L 4X7TB 4ZDHA 4PJGF 3CDCA 4Y4HA 3SO5A 3WL9B 5FGBA 5JOPD 2VSCA 4PFEA 4PJIE 1KN2H 3LHPL 5EZOH 4HUWA 1DVFD 1CE1H 4JN2A 1Z9OA 1EHLH 4BFBD 3GSUA 1SY6H 1HYSD 3KPPB 5CJXC 4YFDB 1Z3GL 5C71A 2DMBA 4XAKE 3NACL 1KGCE 1X5GA 3VXSA 3GKWL 1XF2B 3D69A 4XP5L 2B1HL 4Z95L 5IB5A 1F42A 2GKIA 5TDOA 2MCG1 2WQRA 3FB6A 3S88H 5TH2A 1IQWH 4XNQB 2IPTL 2AJVH 4D2NA 1DBAH 3RWDB 4EBQL 3MLYL 4LSUH 1HN1A 3HNSL 3PDDA 5E94A 4C56E 4X0KB 3KPSE 3NABL 3ARWA 3V2AR 2W9LA 1IKNA 2QHRH 5I17B 4X7TA 3ARTA 5ALBH 4Q0XL 1BM3H 2VWEC 2F8XC 1L6ZA 4PRHE 4MZ2A 1TJHH 4S2SA 5HGBB 2VIRB 1D6VH 3NZ8B 4YBLC 1ODAA 3VGHA 1ZANL 3SDDB 1MCEA 5JTWA 3RP1A 3ZE1E 4OZGF 4NN5B 5T3XH 1VKXB 1XR8B 1KV3A 4R96B 3MCKB 3KPPA 4NQXA 4LLWA 1I9EA 1XF2A 2EDLA 1OQOA 4GW1B 2WM0A 1FIGH 1QO3B 2AJZB 2HLAB 2QSQA 2GITA 1CD8A 3QI9A 1URLA 3RWDA 2NW2B 1P84K 1EO8H 5I8KL 4XBPB 5ANMB 4UB0H 3MV11 4R4ND 4OJFH 5CGYC 5ERWA 3RVWD 1JRHL 4M03A 5EC2B 5I17A 4KI1A 4LHUD 4ZUUB 4JRXB 1T20A 3VWKD 1FVDB 1FZJB 4UDUA 4LPXA 3OB8A 2NY5C 1NCNA 3ARYA 1YYML 4AY0A 3QIWB 5HGBA 2VIRA 3NZ8A 3PP4H 1QSFB 4R90H 3SDDA 1LO2H 4JFQB 3ZMRA 3HE7D 2H26B 4P2CG 2GJ6B 4KK5D 3VRLF 5GZND 1VKXA 4R96A 1AIFA 4ZTOH 5ABDE 4LSTH 2AI0L 1WIPA 1OAXH 3LEVH 3C9NB 1KJMB 3W0WA 4GW5B 1WZ1H 1QO3A 2AJZA 2HLAA 4NHCL 5C0DB 1RK1B 4I1NB 4P2YA 1JIBA 3RWCB 2NW2A 2X4OB 4LVEA 4M62H 4YK4C 4XBPA 3IB4A 5ANMA 4QRPB 4QEGA 1S9KC 1IC4H 4FNLL 4UTAH 1E4WH 3CFBA 5FUZL 3X3GL 1CFTB 4EIGB 5EC2A 1X5FA 4C4KT 1U8QB 4ZUUA 1CLYH 4JRXA 2GSGB 1FZJA 1VEOA 1YEIH 3PHQB 1S7UA 2D9QB 5CZVH 3QIWA 3OKMB 1QSFA 1WWBX 1BJ8A 4JFQA 4POUB 2GJ6A 3T08A 4I3GA 4R3SB 3LB6D 1UENA 2OTPA 2W9DH 4YDJB 3ALPA 2NXZD 5DR5H 1YDPB 2BX5A 1KJMA 4UAOB 4GW5A 4S10A 2XWBB 5GS0L 5C0DA 1RK1A 4IRJD 3Q5OA 1LGVA 3C6SB 2Q7NA 1DUYB 1YN6B 3RWCA 5DD1H 2AXGB 2X4OA 1A3RH 2H8PB 1U36A 1QRNE 2BRQA 1VADA 2XIDA 4QRPA 3CSPA 5C0ND 1TJIL 4E41E 4B41A 1FDLL 1I8MB 3M07A 2HP4A 1CFTA 1GOGA 4WFFE 1GGUA 2R2BB 3LHPH 3K2MC 2ZUQB 3MUHL 3SKNB 2GSGA 3TJEL 1OW0A 3IRPX 1XF4B 3PHQA 3QDME 2HJLA 5CEXB 4UINL 1Z3GH 3UJTL 3OKMA 2Q1EA 3GKWH 4XP5H 4CBPA 4Z95H 1OAKL 4XX1G 4LDLB 4P4KC 4OFPA 4PBXA 2HJKB 4YDJA 2IPTH 3IJHB 3O4OB 3WFHB 1D9KB 1MAJA 2Y36L 4DUVA 4EBQH 1L7TH 3BWUC 1YDPA 3HNSH 3MLYH 4JFED 1R5VA 5B8CB 3OSKA 4NN6C 4LVNC 5DEZA 1ZT7B 2XWBA 4TSAL 5CZKA 5C0BE 2IGFH 3NABH 2IEPA 5I9QC 4QYOB 1DDHB 1RD6A 2WBWB 5BMFL 2CKBB 3BSZL 1X5HA 2BY0A 2VQUA 3C6SA 1DUYA 1YN6A 1AD0B 2H8PA 1XF3A 3U79A 3QFJA 4Q0XH 2EH8L 4J4PA 1FIEA 3DVIA 5T1KD 1MCJA 2R1YB 4BH8B 3MR9A 5IHUL 1ZANH 2IAMD 2E7MA 4NGHL 3KPLB 1J18A 5BS0D 1N64L 2R2BA 2XZAL 1BZ9B 4HK3N 3SKNA 3V6FB 5IHZB 3AY4C 4UOW0 3PG2A 2IBZY 3LRSB 8CGTA 3L3GB 2EDBA 1JZ4A 4PREB 4LOUD 2CDFA 3IJHA 4JM4L 4QOKA 5D1QC 4NO0A 3D39D 2P43B 1SEBB 2EH7H 5B8CA 5GRVL 1QLRB 1ZT7A 4ZAKD 1FLTX 4Z7VF 2OL3B 1IRAY 2C4FT 4X5WB 1UM6L 4TTGA 4QYOA 1DDHA 4AEHL 4ZS6D 2ED8A 2CKBA 2ZOKB 4MXWH 3B2UD 2GK0A 2JIXD 4PTTB 1DVFC 1AD0A 4Z0XB 1HYSC 3X17A 5IVOA 2N7AA 3ZT6A 4M6AA 4ZS7H 4BH8A 4M6ML 4EVNB 5F71A 1CR9L 3U4BH 3KPLA 2WP3T 1Z2KA 4F58L 1BZ9A 1QP1A 1PEZA 4JGMA 3V6FA 3WUZA 5DEFB 2XTLA 4ODUB 5IHZA 2AI0H 2GEEA 5GGSA 3RL2B 1F58L 4XRCB 3D87B 4G42A 3LRSA 3QG7L 1XGRB 4MD4B 5T33H 4NHCH 4PREA 3BZEB 5C0EA 4F3FA 3UBXI 4IIQC 3MUZ1 3V6OE 4BSVB 4N0UE 4GS7B 1SEBA 4UBDD 2VXSL 3HRZA 1QLRA 2HVJA 3P4MB 4FNLH 5HHMD 4X5WA 4W6XB 5D6DA 3X3GH 2ZOKA 4Z0XA 3BW9B 1G6RB 5J6GB 3WFZA 4JDVB 3MYZA 3CSGA 4EVNA 1X5ZA 2AS5M 3QIUB 2FD6L 3ARGD 5C3LD 5D1ZB 5DEFA 4JO3L 5IUSA 4ODUA 3ARUA 3MPCA 4MA8H 1A1OA 3PWPD 1GCFA 4MD4A 3QCTL 2JJSA 4ZFOL 4R4NC 5GS0H 1SYSB 3BZEA 4M4RA 4P2RE 3RVWC 1OP3K 2EZ0D 4Z7WE 4XMKL 5DMGC 4BSVA 4PBVC 2IADB 1AJ7H 2YPVL 1ADQL 3VWKC 2L7UA 4Z7OF 3G9VA 2Y5TB 4NO3A 3BD3A 1KYOK 3OKYA 1TJIH 3R8BB 4CDGC 1FDLH 3NH7L 4B5EA 3RA7L 1BQSA 3V4PL 1U8JB 4Y4FD 4KK5C 4XVSL 1T3FA 1OAQL 3TC9A 3BW9A 5GZNC 1RPQA 1AR2A 3TJEH 1G6RA 4BFIA 5J6GA 4NQDE 3VXMA 4OM0L 4JDVA 4UINH 1WK0A 1IEAB 3H2WA 3UJTH 1OAKH 3Q6FB 3J7HA 2NQCA 1N6QH 5D1ZA 4WW1B 4DVRL 1MNUL 3SEPA 5ACMA 1F97A 5E0QA 2RAMA 2E9JA 2Y36H 4XXCA 3RBGA 1WBXB 3GMNB 2PTTA 2X1WL 2QSCH 5EUOE 4GAJL 3EJYD 4BELD 4G6MH 3BSZH 4ZSOB 2VKXA 3ZKXC 2IADA 2O93L 5B38B 4X6BB 1AGDB 3BFOA 4YQXL 2EH8H 2Y5TA 2K3TA 4NZRL 1I7ZB 4YZFE 3WE6B 1JRHI 5IHUH 3CVHB 4NGHH 4P5TC 2J4WL 1N64H 3WDJA 2XZAH 5IROA 5IB1B 4ONHA 3LB6C 3K46A 3LN9A 3SGDH 5SV3A 5TE4H 3BPOC 4RMTA 4IRSD 2WBJC 1IEAA 2D2OA 3PL6B 3W11C 5MHSE 3WXVL 4XVUD 4OF6A 3Q6FA 1BFVL 3QDGB 5EDXA 4N0YL 2APVA 3FRUA 5BVPL 3O3DB 4WW1A 1VB9A 4NZDA 4LHUG 3SE3C 5ISZB 5D7LD 3VXNB 3SDCC 3ARVA 1KCUL 4PP2B 4UDTB 2FHFA 2BY2A 5C0NC 3ULUH 1UM6H 4P46D 3T0AA 3TBWB 2GFBA 4M1DL 4X6BA 1AGDA 1J05B 3HC0B 4IRZL 3OJMB 4XMLH 1CT8B 1MY5A 4Q9BA 3WE6A 2DQTH 4UUJB 2DWDA 2AJSL 3CVHA 1CR9H 4YO0A 4NWTL 1RUKL 5FUCC 3WUWA 5IB1A 1RAMA 2OS7A 2VLKE 3NCEB 1ORSB 3I9GH 4LCCC 2R8SL 1VPOL 4GO6B 3PL6A 4GSDH 1E27A 1F58H 1M4KA 3ZYOA 4UNVA 3QUML 3QG7H 4R97B 4TULL 4MXVE 4PJ7A 2VLRE 4ZQKB 3IDYC 3BIKA 4JG0L 4LCIL 1T1WB 3IVKB 1IEBB 3MLTA 2F19L 4RMUA 1CTNA 3VXNA 1A4KA 1BOYA 5E8OB 4G9FB 2BHZA 4PP2A 1OARL 1VESA 2VXSH 5DJZB 1VGKB 3DRQA 3ZL4L 1A1NB 3NCCB 5FIEA 1AXIB 4PRIE 1ZLSH 1BQHG 4JR9H 4PJ9C 1HINL 5H2BB 4Q6IC 4DKFL 3K7UA 4RQQA 5BQ7B 1NCWL 5J1SC 1J05A 2EDEA 3Q3GB 5DVNA 1FFRA 2KDGA 4UUJA 3BD5A 1G7PB 2ARWA 5C0CE 4PGZA 1ZWIB 1H3UA 2FD6H 4AT6B 4M3KB 3DMMB 1U9KA 4JO3H 3QT2A 1UKSA 5ADPL 1UFUA 2EYRB 3QAZC 3Q5TA 1HSBA 3STBA 3QCTH 4ZQKA 3UTPE 2X40A 4MCZB 3PGDB 3IVKA 1IEBA 2HG5B 3SHSA 4XMKH 3SDXB 2K7QA 2YPVH 2CLRB 1ADQH 5E8OA 4G9FA 3U30C 2EE6A 5DA4A 5DJZA 1VGKA 3OX8B 1UXSB 1A1NA 1EDQA 2HA1A 4LPUA 1HHJB 3S34H 2E7CA 5SV4A 3NH7H 4JFDA 4MMZC 3RA7H 3V4PH 4LASL 4Q2ZB 4XVSH 3QG6B 2CIKA 1OAQH 2I25N 1U8OA 1MAKA 3O4LB 1MHHA 5DHVH 2X4RB 3LEXB 2HJFB 1I7TB 4F9PC 3PWUB 5IR1B 3Q0HA 1NFDF 2F54E 3VCLA 3ESVF 4JZOB 4LKXA 2Q8BL 1M05B 2CXGA 3TPUB 4AT6A 3DMMA 3MRDA 4I77H 4DVRH 1EAJA 3FQRB 1MNUH 1E4XL 1TTUA 1ITCA 2LU7A 3VFGL 1P7KB 2AEPL 3OHXA 5T3ZD 5E56A 1BGXL 5D5MB 4GAJH 4MCZA 1A6VL 3PGDA 2Q86A 5C9KA 4NM4L 4FTVB 2CLRA 4YQXH 1UA6L 4RNRA 3QWRD 3OX8A 4HMCA 1UXSA 4NZRH 3S8WA 3A0OA 3WS3A 4PV8A 1XIWB 5FO7A 4PG2C 4YGAB 3TT3L 1HHJA 1BPVA 2J4WH 3IXAB 2I24N 2VAAB 3BGMB 1C1EL 1DQML 1A0QL 1QHOA 3QG6A 4Q2ZA 5D7KE 3PDOB 5DO2D 4PJGE 3O4LA 1W0VA 2X4RA 3LEXA 4MA1B 1XGTA 3VFUB 1UKTA 2OR7A 1IM3A 3PWUA 3MGTA 4HDIA 1JWMB 3G5VB 3WXVH 4TVPD 1M05A 3V5HB 1BFVH 2AGJL 3TPUA 3C09B 2D0FA 4N0YH 5BVPH 3KAAA 4NQEE 4PJXE 1JF1B 2JLLA 5LAXB 1XT5A 2DYPB 2P5WB 3JWOH 1KCUH 5IVXF 1P7KA 2EKSB 4U49A 5D5MA 5IFHL 4DK6A 3H8NA 5BV7C 5D7SL 3RUGB 4HS3B 5J57B 3RAJH 4Y4FC 1X9QA 4FTVA 3U7YL 4UIMB 4IRZH 2FYYB 5E1AA 4NC1C 1H5BC 2ZZUT 3SPVB 1P7QB 1NC4B 4NWTH 3MBED 1RUKH 4U1HB 5HVWA 4YDKL 2AV1B 4F7MB 2VZUA 2DQUL 2R8SH 1VPOH 3VFUA 2P5EE 3KPNB 4OZIB 1MVUB 2J2ZA 4GT7A 3N9GL 3WNMA 3G5VA 3QUMH 1ULVA 4F15B 4X7CC 3FQUB 3EJYC 4JG0H 4RIRB 1NC2A 1P4IH 2EIEA 3NGBB 3CXDL 2XG4A 3HB3C 5F3BB 5LAXA 4KUCD 5D71L 3NN8B 2DYPA 2P5WA 4YWGH 3ZYZA 5I1KL 4NP4L 3SE8L 2HT3D 2EKSA 3UYOD 3ZL4H 4C56D 1AD9B 2EC9T 1UC6A 3KPSD 3RUGA 4P57B 4J3VA 1HINH 4DKFH 4HXBL 4HS3A 4QXTB 5GGQL 4QXGL 3ZKND 1NCWH 3QO1B 4UIMA 1OP5K 2FYYA 1JYXA 3ZTJG 4PRHD 5I73C 5I8CB 4OZFH 4IRSC 3CFJB 3SE3A 2C4FU 1P7QA 5HY9A 3O9WB 2XPGB 1NC4A 2YPLD 1YEFL 1D6EB 3NPSC 5IW3A 4WY7L 5HI4C 1QFHA 5D9SB 3U48A 4IJ3C 4F7MA 3ULVF 1SMAA 3D1MC 4UOW1 5L88L 4KRMB 5ADPH 5DK2A 3KPNA 4TSCL 1MVUA 3T2NL 5M7QA 3VRLE 4WUUA 3FQUA 3PIQB 1KLUB 2ESVA 1RFDL 3PV6B 5DFVC 5AZ2L 3KJ6L 2FL5B 4P46C 4JANA 2BVOB 3NFPB 3QXDB 5D93B 3W9DB 5TF1L 1AD9A 2QQNL 4LCCA 5HDOA 3MZGB 5ESAB 2OK0L 4P57A 2BSSA 5SWZE 4QXTA 1NCDL 4LASH 1L4IA 2OX5A 3QO1A 2DJ4A 2A77L 1CXEA 5I8CA 5FHAL 3MFGB 5IW1B 3M17A 3O9WA 2XPGA 4CUCA 5DQDL 3MA9H 2Q8BH 1D6EA 4OGXL 4QHUB 3TO2B 3U2SB 1JCKA 4I13B 5D9SA 5DXWA 1UCBL 2HTLC 4OKDA 4F7TB 1NLDL 4XNZB 4GAGL 4PJ9A 1LWRA 4P9HL 3VFGH 3I6KB 3HPLB 4YFEA 4OFVA 4ONGL 2AEPH 3LVEA 1BGXH 3VG9B 3PIQA 1KLUA 1N59B 1A6VH 5I1LA 1KUMA 2FL5A 3DHMA 1R3KA 4RGOL 2BVOA 4JFXB 4NM4H 5JHLL 1KTLB 1EVTC 4XCEB 1UJ3B 3W9DA 1UA6H 2ZSVB 5C0AE 4PG9B 4NOBA 2DL2A 3TT3H 5ESAA 4UQ3A 2ZG2A 2VLJB 4PJCB 5EU7C 4OZHE 1C1EH 1DQMH 1A0QH 1H0DB 2AERT 5F7KC 4NCC1 2ZCHL 5JW5B 4H5SB 4XP1L 4X8JB 2BC4A 4LLMB 3NIGF 1REIA 3JXAA 3EDFA 5FO8B 2ERJC 3VI3F 4GKNB 5IW1A 2CRYA 4JRYA 4KQ4L 4GG8B 3FFCB 4Y5XB 4QHUA 2AGJH 4XPBL 2W0LA 1RJYB 1G1YA 3FOLB 4MYWB 4ZO6A 4OLXL 4Q97A 4F7TA 2ATKA 3EIFA 1WF5A 3R0NA 1UYWL 1ZHKA 4OGAC 1YEGL 3QFDB 5GGTL 3UTQB 1MI5B 4J8RB 5HGHB 5IFHH 3E2HB 2Z35B 3VD7A 5BV7L 4WVRA 1N59A 5D7SH 3BPNB 4ODBD 1IILE 4L4TE 1LO0L 4YPGB 1IMHC 4JFXA 4PRPE 3RKDD 1KTLA 3T0EB 3U7YH 4XCEA 1UJ3A 2BFVL 4HKZB 3LN4B 5D96B 2ZSVA 3KHOA 5I1IL 1LD9B 4U1GC 1FHGA 1LO4L 4WFFD 3QH3B 1ZGLP 2VLJA 4Y19E 4MAYC 4PJCA 4YDKH 1EBPA 3QIBB 2X42A 3QDMD 4U4BA 2DQUH 2PYFB 4G43B 4H5SA 2H2SD 5FO8A 4RBPK 3N9GH 4XWOD 4GKNA 5I2IB 5HYSG 4Y5XA 5C0FB 4YAQB 1RJYA 3FOLA 4KK9D 4XCCL 1CZ8L 1T21B 4KRPD 1ZSDA 4K71B 3ROOB 4WJ5A 4GLRH 5E00A 3MNZA 3CXDH 1TNNA 5D71H 4G80A 4HG4J 4NP4H 1I4FB 3SE8H 1YMME 1I1CA 5L7XL 4PJDA 2E6PA 3QFDA 2P8PB 3CMOH 1MI5A 4J8RA 2PO6D 5HGHA 1L7IL 2G2RA 3P4OB 3MRGB 1EHXA 1FO0L 4YPGA 4HXBH 4YEFA 5GGQH 4WO4D 4LARL 1SY6A 2BNRB 1FNSL 5DGQA 4X6CA 4Z7VE 1EX0A 2NTFA 3BDYL 3CGTA 1OWRM 3QH3A 5FHBH 3OGOE 1HXMB 1WZKA 4WY7H 4IM8A 3QIBA 5ADOL 5L88H 2PYFA 4LVOB 5HYJA 2XTJC 2DLFL 2XI9A 3MXWL 4JQVC 4TSCH 5EO1B 2WUCL 2I9TA 1ZKAA 3QZWB 3ARDC 3T2NH 3ZE0F 2Q6WB 4CMHB 1H5BA 1P9MC 4YAQA 3QNZB 3ROOA 1IZKA 5CCKH 5AZ2H 1E4XI 2A1WL 1AGEB 3KJ6H 2Q87A 5TE6L 2FB4L 4QRUB 4QRRD 1V7ML 1I4FA 4OD3H 2ADIB 2E27H 3ARFB 3U7AA 2P8PA 4S1DC 2PXYB 5I75B 4MB5A 1HWHB 3HE6B 1JGLL 3P4OA 2OK0H 4RGNB 1NCDH 3MBEC 4K3DL 2BNRA 4RWHA 3MRKA 2D7OA 4PUBL 2A77H 3MRHB 2RJMA 3QJHA 5EU3A 2AJXL 2Z93B 4FMKA 2B2XL 3GMMB 3EOYG 4EI5D 5DQDH 4P2OB 3TH4T 5BJTA 4OGXH 3U83A 1HXMA 3RPIA 2BHYA 2BY3A 1UCBH 2VH5L 1W72L 1QQDB 1NLDH 4P9HH 3QZWA 4PP1D 4ONGH 1UEYA 2DLHA 1CGSL 3HR5B 2Q6WA 5AG9A 3PQYE 1FG2B 3RGVB 3OAYH 4N68A 5IJKC 4EOWL 4RFNC 1AGEA 4PJ8D 3VFOB 4RGOH 2UWEB 3ZKNC 2ADIA 32C2A 2ADFH 2ZCKL 3ARFA 2PXYA 3HE6A 3LV3B 5E6ID 4P3DB 3B83A 1IKFH 4BYHA 4EIZC 4AIZB 4O2CB 5FCSH 1S3KL 2CUIA 2J12B 3DARA 3UBXB 2ZCHH 3MRHA 2N7BA 4PRNB 4NQVB 4XP1H 3MRBB 4APQB 3ZTJH 3HFML 3CIQA 1KIRB 4KQ4H 1VDGA 3SY0B 1U8IB 3CUPB 4XPBH 1T89A 4QNPF 4UNTA 4OLXH 3DIFA 3RZCB 1CG9A 1FH5L 5F7LB 3W9EB 2E9WA 2Z8RA 5GGTH 3HR5A 4JPKL 4JFPB 1MOEA 4OCLC 1T66C 3W2DL 1FG2A 3OGCB 2BVTA 4HJGB 3HUJE 2FBOJ 1LO0H 1UM5L 4HKXB 3VWJD 1YEEH 2BFVH 4JJ5B 2F53D 1CICB 3CU7A 2DQCH 4D0CB 2DQEL 4P3DA 4NJAH 2IC2A 1K4DB 1CGUA 1ZHLA 1LO4H 5EO0A 1NBYB 3LKPB 4AIZA 1NH6A 2NXYD 3GSXB 4HCRL 2DLTA 4NQDD 4PJBE 4PRNA 4NQVA 1AO7B 1S9XB 4APQA 1JF6A 1ETZB 3SY0A 3U4EB 4S1SH 3TGXA 1U8IA 4GRWF 3CUPA 4XCCH 5T3ZL 1CZ8H 1MELA 5SWSB 4PLOB 5D72L 3RZCA 2E7LC 3W9EA 1CD1B 1UZ6F 3DPBA 1E4KC 1U58B 3SQBA 3VMOA 4YHZL 5L7XH 4MHHG 1NMCB 1XGPB 4XCYA 4U33A 4HZLB 3BQUA 4JFPA 3OGCA 2ZUSA 4HJGA 4CVWA 1FO0H 4KK6D 1KBGH 3G5YB 3SGJC 1KIQB 1TZHB 4LARH 4HKXA 1B88A 1JZ6A 3FAXA 3ULUC 4NNYB 1FNSH 3KNBA 1QBML 4JJ5A 4L1HA 1CICA 4M5ZL 2Y1VA 1N6UA 4YXKL 4DKEH 2ILLA 2NY3D 3BDYH 3DUHA 4LVHC 1NBYA 2EDRA 2ZPKL 2OQJB 4M5YH 1Q9KB 2R39A 4ODSL 4TVPL 3GDBA 3GSXA 5E5RB 2UUDH 5DVKA 2BNQE 5ADOH 1P6FA 4WW2B 3WKML 1AO7A 1S9XA 2W60B 3VFSB 2DLFH 3MXWH 2WUCH 5CGMA 3U4EA 3CX5K 1GPOL 3FB7B 4IOIB 3H3PH 5SWSA 5T5NG 1OTSD 1UXWB 5TE6H 4W81A 2FB4H 3R06A 5HJ3B 2RCSL 1CD1A 1V7MH 2AEQL 1U58A 4MJIE 1XGPA 1NBVH 1JGLH 3WJJA 4HZLA 3G5XB 5HHOE 4ZYKB 1M71B 2AVGA 5C09B 3WS6A 5IBUG 5C0IB 1RHFA 3G5YA 1KIQA 1T1ZB 4K3DH 5DMIL 1AHWB 1B3JA 2BVPB 4P48A 4NNYA 1JZ8A 4PUBH 1HXYB 4HT1H 1ZA6B 3QDJE 2AJXH 1Q9OB 2EC9U 4ETQB 4Y1AB 2B2XH 2H2SC 1WJ3A 2Q76B 3UXFA 4KKAD 3BXNB 1NGXB 1HDMA 2OQJA 5F6HI 5LCVL 3KXFB 1EK3A 3HAEG 3LN5B 2VLKD 4X6EB 4FQ1L 1W72H 3TNMA 3PF2A 4WW2A 5IMMB 2W60A 1N5AB 3VFSA 4I5BB 2XNAA 5MENE 1CGSH 4MX7B 2OTUA 3FB7A 4AL8L 5L6YL 3TNNB 4TUOA 1X5IA 4HIXL 4EOWH 1UXWA 4LFHD 2BSRB 4LNRA 4WO4C 5HJ3A 3OXSA 4O58L 3VXUB 4KGJA 2H6PB 2ZCKH 1FFOA 2A0LC 1QFWI 2ZJSH 4PRID 4ZYKA 4M48L 4ALAL 1MJ7L 5C09A 3DXAB 5C0IA 2V5MA 2NY4B 1J9CT 1GZPB 4QXUL 1S3KH 3WN5C 3AU1B 3WMSA 1T1ZA 1K85A 2MSPA 1C5DB 5HI3D 1AHWA 2BVPA 3E8UH 1IARB 2AEIT 1HXYA 4Q74A 5I1GH 1Q94A 2F74A 3QHFH 1Q9OA 3HFMH 4Y1AA 2VERN 2Q76A 3OKNA 4C55A 3BXNA 1FL3B 5C0CD 3KXFA 3HR6A 1DBBL 3RVTD 3M8OL 4PS4H 4PJ7F 4X6EA 3SGEH 2Q20A 3TV3H 1T1YB 1I1AD 3JVGC 5EN2B 2XQBH 1FH5H 4I5BA 5DUPL 4E42B 3RWJB 5EORL 2R0KH 1SM3L 4MX7A 5C07D 3IDXL 3UTPD 3W2DH 1DCLA 4Q6YA 3TNNA 5KVEL 5F93C 1UM5H 3VXUA 4XPGL 2H6PA 4KKNA 4OT1L 5DSCB 4PV9A 3VRJB 1F11B 5J12B 2DQEH 5JOFB 5FUOL 4LLVA 3CX2A 3DXAA 2VDRL 4G5ZH 1GZPA 5JO5B 3AU1A 5HGAA 3JUYA 1C5DA 3MA7A 4HCRH 4XCFL 1QR4A 3VG0L 3ZDZE 1RK0B 4Z5RA 4JO2L 1T22A 1HI6B 4HF5L 4G3YL 1OY3B 4PP1C 3IETB 5JIKA 1FL3A 3VXOB 4HIEA 3HN3A 3T4AB 1T1YA 4LGRB 5EN2A 3V6OC 4WI4A 1JNHB 2MHAB 4L8SB 3FQNB 4YHZH 4E42A 3ZLQC 2FEEL 3RWJA 4U1IA 2I27N 1QKZL 1X4XA 5E6IC 3JWOC 4PJFE 5BO1L 2FDBP 4LNVA 2YZ8A 1PZ5A 3HKFA 5IVXE 5D2LF 5EIQA 1SJHB 1UQSB 5DSCA 3FRPA 4M5ZH 1F11A 5JOFA 2IQ9L 4JKPL 5B39G 1YC7A 1Y0LB 2ZPKH 3ZHDA 3DO7B 5JO5A 3GSNL 4JFFA 3FN0H 1A6AB 5D7KD 4G8FB 1ZT1B 3UP1A 2DWEB 5H35B 5E08L 4A2LA 3WKMH 5T1LD 1QSZA 1NCCL 4JY6B 1RZ8B 3IETA 3WSQL 3VXOA 1GPOH 4CN1A 4I18B 4OLZL 4NQED 3LH2L 2VUOA 3UCRA 4C54A 1T2QL 4BFEA 5GJSH 1JNHA 5AG8A 2MHAA 4JVWA 2RCSH 3RL1B 4L8SA 2AEQH 3FQNA 3VWJC 3QWQB 4LLQB 1UH2A 1B4JL 4DKAA 3MNWB 1G7IB 1INEL 1D5XB 43C9B 5DMIH 3F65A 1MFEL 1XCQA 1T0PB 2FX7L 5IVNA 1SJHA 1UQSA 1VFUA 1Z9MA 1PQZB 4KDTC 1J12A 3GJEB 2UY7A 1Y0LA 2HKHL 4PJAA 2JJUA 4YHPA 2MWCA 3DO7A 2RHEA 3RNQA 1A6AA 1U3YA 4N1CA 4WGWB 1G7JB 4G8FA 5IHLB 1ZT1A 4FQ1H 1S7TA 2DWEA 5H35A 1KTDB 2P5ED 5HD8D 5J11B 1WIUA 4JY6A 1RZ8A 2WWKT 2OXGA 2AV7A 1NAML 2R0ZL 3QQ9D 3VXSE 4UI2A 4AL8H 3ULVE 1DEDA 3MV7B 1G9NL 2ADJB 2Y7QB 4OF5A 3O6LL 4KK6C 4Q9CA 1HH9B 5GGRY 3RL1A 1LP9B 3B9DA 3MC0A 1SVZA 4LLQA 2FO1A 2CH8A 1GC1L 5JPNB 1XGQA 1U3ZA 2Z31D 2GY7B 1MJ7H 4Z9KB 2YRZA 1CL7L 4QXUH 1D5XA 43C9A 4ZOBA 1JPTL 7CGTA 1H3PL 5E2UL 5J7CC 4O2FA 1BBJA 1KLFA 4OLUL 3H6JA 4HX1B 2DIJA 1TZIB 3QQNA 1CLOL 1PQZA 3MBXL 4R26L 4ZFOB 3QWOA 2MPAL 3VFPA 4RWYH 1WAAF 1DBBH 3VW3L 1YUHA 3M8OH 3PABB 5IB2B 3T3MF 1J11A 3RWIB 1UT9A 2YBRB 2NMSA 1KTDA 3EYQD 1OTSC 2AXHA 4M9OA 4C57C 5JORA 2ICEB 2Z91A 5DUPH 1A4JA 2WANA 3EDDA 5EORH 2YOCA 3IDXH 2IPKB 4L4VA 1GL4B 5TDPA 2OCFD 3SKJH 3MV7A 2ADJA 2Y7QA 4MA7L 5KVEH 1I8LA 3CD4A 5DHVB 3RUGF 1LP9A 1U6AH 4XPGH 4KJWD 5D7JB 5JPNA 4OT1H 4DN3L 3DETD 5FUOH 4P4KB 2VDRH 5SWZD 1JHKH 3V7MA 2E5EA 2BERA 4EN3B 4XCFH 3VG0H 3MX0A 5SX5K 1HCVA 4JO2H 4HF5H 5IGXL 4G3YH 2Y72A 5KTEH 4NN6B 4LVNB 4NKQB 3C08L 4ZFOA 1JGUL 1OD9A 2GW5A 1WISA 3SOBL 3QXVA 1AXTL 4JE4B 1P53A 2DS4A 5I30L 4NDMB 2WMPA 3I50H 3BP7A 1X4ZA 3PABA 4OIAA 2FZ3B 4QCIB 5IB2A 5J9PA 2YBRA 1ADQA 4P59L 4GRLD 4RAUB 2ICEA 4LSQL 3B9KD 2R2CA 2XRAL 3NIGE 3VI3E 3OQ3B 3V8CA 4MWFA 1QKZH 4EDXB 5CS7A 5KSAD 1A9EB 3W0WE 5BO1H 3SKOA 2EIZB 3ILQC 1RIVL 5DD0H 1ONQB 5DHVA 2VDQL 5HI3C 3MRQB 3BKJL 2BCKB 4KKLD 5C0AD 2D7NA 4KFZC 1INQA 2IQ9H 5ANME 4QLRA 2VLLB 2WV3A 3O8XB 5DMKA 3GSNH 5I76A 3RVTC 4EN3A 1GOHA 4J6RL 3WIHH 3S9DB 3IFOB 5E08H 4JRXE 4IHOB 3B3IB 2PW1A 1NCCH 3AC0A 3CSYB 3TN0D 2B5IC 3WSQH 3IDMB 4H8WC 1MJ8L 4ENED 1QSFE 4NDMA 4OLZH 1MFAL 4QCIA 2FZ3A 1N5YL 2GJ6E 5CEZD 3EO0B 4JAMB 1JUFB 1T5WB 1T2QH 4WI2A 4RAUA 4XHQA 3EHBD 1DZBA 2W0KA 1KIUA 5ETUA 1MFCL 5FK9B 3VFRB 2W59A 1B4JH 5A2IH 1A9EA 1INEH 1FZMB 3IDNB 5DTFA 2EIZA 4L4TD 2FIKB 1EV2E 1ONQA 3BZFB 4YHNB 4S0TD 3DX6B 3NCFB 1MFEH 1KENL 2FX7H 4MHHI 1NANI 3QUMB 1XCTB 1BFTA 2FEDD 2NY6D 4PJEB 4QTIL 4QRPE 2HKHH 3O8XA 4DGVL 2J3SA 4HUNB 2RBLA 1VSCA 4IIQB 4FQCL 4CW1B 4LFHG 3PWJB 1FYTD 5AWNL 2CK0L 4HGMA 4L8DB 4H25A 1NAMH 2VDLL 2R0ZH 3IDMA 4MNQA 5FYJD 1S7SB 4XAWL 3MO1B 3TZVD 2NNAB 1G9NH 3DUUB 3EO0A 3VDBA 3GBNL 3O6LH 1BWWA 1JUFA 3KVQA 2LABA 1TITA 1TPXC 2G5BB 2DKUA 1D5BB 4OZFB 3BN9D 1ZV5A 3P0VL 5FK9A 3ZE0E 1IAOA 4PD4J 1IM9D 5KANI 1BEYL 3BZFA 1JPTH 4YHNA 4FRWA 1H3PH 5E2UH 5H37H 5L2KA 4PJCF 5D1XA 2J6EH 2W9EL 1B6UA 4OLUH 4YNYA 1CLOH 3QUMA 4JFZL 1XCTA 3QFJE 4K2UL 4PJEA 1B0WA 3AS1A 3MBXH 2VRAA 5CWSA 3QO0A 2MPAH 5HHXL 4M02A 3VW3H 4CW1A 5BRZD 1BJ1J 2VXVL 3BIAX 3KPMB 4LHUB 5J13C 4MXQD 5D70L 5K33A 1J0ZA 2C3GA 3WJLC 1R3LB 1YEDA 2DQJL 3QQ3B 4EXKA 1S7SA 4PJDF 4HJ0C 3MO1A 2X4TA 2CLVA 2NNAA 1ZLWK 2B8OT 3QP3A 3HE7B 3QUYB 1ZHNB 5CZXD 1KB9K 1G0DA 5GPRA 4NSKB 2NY0D 4JPVH 3PV7A 2G5BA 1MCKA 1D5BA 4WFGE 4OZFA 4QOKE 4X99B 3STZA 4JM2C 4DN3H 5EZLB 1QLEL 2CJUL 4X6CF 4U6VL 5HVGB 4X83A 1EO5A 5CEYB 1PJ9A 2HFTA 2OI9C 2FCBA 3O6ML 5IGXH 3C5ZC 1EFQA 2C3XA 3C08H 2EYTB 1JGUH 1WSST 3L3DB 3SOBH 3QQ9C 4I0CC 1AXTH 5I30H 1NBZB 2HLFD 2WP3O 1N8ZB 4FQXD 3ZKXB 5HDQL 3NCMA 3KPMA 1N0LA 4LHUA 1PY9A 4N8PA 4U1SB 4I3RL 3U0TB 3U36B 4DFIA 2QJDA 4HFWB 5C92A 4LSQH 5KVGL 3F12B 3VMPA 2EXWD 2CKNA 1R3LA 2JB6B 4WV1C 5A43C 2B4CL 3IKKA 3PQYD 2Z31C 4U0RC 1BQHB 2CD0A 1A3LH 3LAFA 3HE7A 3QUYA 1B2WL 2DIBA 1ZHNA 3P2TA 5KSVB 3TH3T 4NSKA 2VDML 2VDQH 2X89A 3ILPB 5GS2H 3BH9A 3MV8B 4G6FD 2NXZB 1BHGA 3BKJH 3CXHK 1I3VA 3MTRA 5K9JL 4X99A 4LCWB 1HEZB 1RMFL 5EZLA 3O2DL 3BDBA 1VACB 5F89B 4I0PD 5CEYA 5J3HD 5EBMA 1WZMA 2J8UB 1HNFA 4IRJB 1QR1B 2K7PA 4J6RH 4BQ6A 3DGCR 3MJ6A 1GHFL 4JG1L 3EYQC 1I9IL 2ZNXA 12E8H 5JZ7D 2BP3A 2EYTA 2YHGA 3L3DA 1FPTL 1FZKA 1QD0A 1NBZA 1CLCA 3FQXB 3FQTB 1X6LA 1N8ZA 1MFAH 1N5YH 1JYVA 4DEPB 2ICCA 3U0TA 4DUXA 4WHCA 4YIQB 4FG6C 3VRIB 3MLUL 3ZT7A 5GIRB 5DLML 3B43A 2JB6A 2C7UB 4HBQA 4KV5F 4GG6B 3DETC 1BQHA 1KTRL 1D3CA 3GJFB 4LPTA 5KSVA 1CGXA 2EKJA 1A7OL 2EO9A 3ILPA 3PGFL 3MV8A 4FABH 4RFEB 1KENH 2R2HA 1RUPL 4G9DB 4LCWA 1EAPA 1HEZA 3BPLB 3KYOA 4JFEB 1ZVSB 2NY2D 1CL7I 1VACA 5DJYB 2R0LL 5F89A 1OB1A 2YN3A 4DGVH 4RX4A 2J8UA 2EE9A 4IRJA 4FQCH 1QR1A 5TFSL 1VFAB 5AWNH 1E0OB 2CK0H 3RX7A 3NTCH 5DJ0B 1J88A 1U8PA 5LQBL 4W68A 3VXME 1OWWA 2C3HA 4ERSL 2R29L 3QUXC 1CQYA 2VDLH 3OR6B 2ICWJ 1BD2A 3N1PC 3DWTA 5C2BL 2IAMB 2WUBH 3FQXA 4XAWH 2DLIA 4Q6IB 5BS0B 3GBNH 3EFDL 3DI3B 3MCG1 3VI4F 5F7NC 1RZKC 2Y9RT 3MCLL 2BDNH 4WWKD 3E6FB 3P0VH 5DD6B 4KKLC 4ZFFB 1FRGL 4CKVX 3VXRD 3C6LC 2CRZA 1XH3B 3W39B 1BEYH 2PN5A 4BA8A 4RFEA 3EJZD 4IDJL 2W9EH 5KSBA 4G9DA 5J6HB 4JFZH 4AEFA 4K2UH 1SJEB 4JFEA 1ZVSA 3RDTD 1IGJB 1MCSA 1ZLUK 3TN0C 4ZAKB 5HHXH 5FYKH 4R4BB 3AM8A 4NUGL 1VFAA 4LF3A 5ESVB 1UADC 3PWLB 4R0LC 2W1NA 5D70H 3U30B 3EHBC 3ES6A 4POZD 3V7AE 3VGAC 3OR6A 1VENA 3PHOB 1TJGL 2DQJH 4PJHA 2IAMA 1TQBB 3M1BA 4I2XB 3UTSB 3QUZD 4P23D 3W82A 2F54A 3RNKB 3IXTB 1PX3A 4MJID 5H94B 5AAMA 1C16B 2DBLL 3K4DA 5D2NB 2VISB 3JZ7A 1QLEH 2CJUH 4U6VH 4H88L 3W39A 3EYSH 5FM8A 2YA1A 4K7PY 4LLYB 1BF2A 2VN4A 2C9AA 4EUPG 4ZSOE 4G8EB 4K7PX 1PG7W 3ARPA 4Y2DD 3O6MH 5FAAA 4BQBA 1SJEA 3NFNB 5IBLD 4ZAKA 5HHMB 4NRXA 4R4BA 5HDQH 5CD3A 3QCVL 5ESVA 4PGCB 3PWLA 4I3RH 1KJ2L 3OKKB 5MEQA 3GM8A 4DKDC 3BN9C 5MEND 4JFHE 3DYMA 1QEWA 3PHOA 2B4CH 4OQTL 5E9DD 2OSLB 5BVJA 2H41A 3BWAA 4I2XA 1XF5A 4PJ7E 3UTSA 1B2WH 1C12B 3ARGB 3D25B 2D4DA 2C3VB 3IXTA 2OM5A 1OGTB 1YY9D 3L3JB 4GH7B 1C16A 3PWPB 4RDQF 5D2NA 2VISA 1RMFH 3MACL 3O2DH 3VD4A 4J3OC 2G75B 1J0KA 4LLYA 4ELMF 5F70A 1GHFH 3BZ4A 3GSOB 4FFYL 4JG1H 1I9IH 4K8RD 2LTQC 4TPRH 1OP3H 3LKSB 5IVZB 1U8LB 3NFNA 1U3HD 3CH1B 3WLWC 2VL4A 2I60L 1M7IB 5BV7B 3ARED 5HDBE 1FPTH 5DF0A 1A6PA 2XXMB 1I85C 4KRLB 2E3VA 3S36L 1AY1H 1XGUB 2FHBA 4PGCA 4DCQB 5CZXC 1CF8L 3GHEL 2NY0C 3LEYL 3WO4B 3JV4B 2A6JB 4KI5F 4Z76B 5DLMH 1U92A 1RZFL 2OSLA 1CK0L 3AXLB 4XI5C 5HHQB 1NGZA 2WNGA 5CLTA 1C12A 4DQOL 2OR9L 2E6QA 3ARGA 1RY7B 1A7OH 2X4QA 3PGFH 4Y4KD 1OGTA 3L3JA 3HC4L 3TFKD 3PWPA 4G9FE 3U9UB 2G60H 5A2KH 1MAML 2N1KA 1HZHL 2I07B 4UMGA 1FC2D 2R0LH 5IB3A 1EH9A 3BRGC 2YSSA 3GMQA 4GBXD 2HLFC 4JFDE 1I75A 3ZDYE 3O6FC 3EDJA 4FQXC 5TFSH 3KR3L 2OTWA 3GSOA 4JREC 3L95B 5GGTA 1LEGB 3LKSA 1U8LA 5LQBH 3OBAA 3T65B 4ERSH 2R29H 1M7IA 3I02B 2JJWA 2FJFB 2YC1B 4HIIB 2EXWC 5C2BH 1FO0B 1N0XH 1P1ZB 4BSWB 5MP6H 5K9OB 3EFDH 3TIEB 1F45A 3FO9B 3MCLH 3JV4A 4HWUA 3QXAA 5FDYA 2A6JA 1BBDL 4Z76A 4IRSB 2HT4D 3CLEH 1MFBL 1FRGH 3FT3B 1MFDL 4U3CA 1A8JH 2X9YA 2VC2L 1A1MB 1V05A 4WTXA 5HHQA 2QQKL 4I0PC 1S78D 1X5LA 3DV4B 2LE9A 4IDJH 1FSKB 4HJJH 3T09A 4Y5VC 1SYVB 2ZKHH 3U9UA 1DL7L 1IJ9A 1LILA 5JZ7C 4YHYB 2VR9A 3SN6N 1Z0MA 5F8RC 1F3DH 4NUGH 4R7DB 1CFQA 1U95B 2DQFB 4FHBD 5FOBB 3IS1X 3SJVB 5CEZL 3DVGB 4KJPC 3L95A 3CCHB 3O4LE 1LEGA 5ICYB 4WTZA 3T65A 4QTHB 2EXYD 3I02A 3TPKA 1HHGB 2FJFA 2YC1A 3L1OL 4HIIA 1OHQA 1FO0A 1G7LA 1P1ZA 4BSWA 1T04B 1Y6KR 5K9OA 3H3BC 3TIEA 3L5WB 1OCWL 3FO9A 3ARBD 1H3VA 2P47B 5JQHC 2OL3H 2NTSP 2DBLH 3ZKSD 3AS0A 4HMEA 3FT3A 3KS0H 1FAKT 1A1MA 2NY2C 4X7EC 5D5ME 2AXFB 4H88H 1WBYA 4UZGA 5C8JB 2C1OA 1W72B 3DV4A 2OBGA 2IANB 5EU6B 4FTVE 5FOJA 3PXHA 1SYVA 5DMJB 4Y4HD 2ZG3A 4OV6F 35C8L 5HYSB 5ACZB 5GQBA 2C5DC 2FLRT 4N0CD 2YWYA 5FYJL 4R7DA 2C4XA 3FZUC 3QCVH 5HYFA 5FOBA 1H15B 3SJVA 1KJ2H 4PGEB 3CCHA 3LD8C 1MVFA 2V2WB 1JPFB 4QTHA 4ZXBD 3VXSD 3U82B 3SQOL 4OQTH 1DE4A 3TBYB 1KLGA 2NX5D 4CJ1A 4C58B 3ULVD 1T04A 3T3ME 3ZO0A 1ED3A 4I48A 4R2GC 3P77B 3L5WA 3INUL 1JWSB 4TTDD 4X9FA 2XN9A 2P5WE 3EJZC 3GZKA 5HXMA 1XEDA 1I9RL 3B8YA 5FYLL 2YWZA 4NKDA 1BIHA 2AXFA 3PHSA 5C8JA 1W72A 5HSFA 3RUGE 1QFOA 2D7PA 2P8MB 4O9HL 4PJAF 4N90E 1HKLL 2IANA 5EU6A 4AQOA 1UH4A 2B1AL 2B0SH 2A6KB 3C5JB 1CFSA 3C8KB 1RZGA 4JDZB 4R6UA 4FXKB 2FECI 2R0WL 3L7EA 4RRPG 4POZC 3MQIA 5FGSA 1Z5LB 4M61B 5HYSA 2GCYB 1A7NL 4OB5L 3ULUF 1VFMA 4JEGB 4M7LH 3S36H 1KXQE 2H2PD 4K7FB 1H15A 1G7MB 4PGEA 4P23C 1CF8H 3GHEH 2VE6B 3LEYH 4HWEL 2V2WA 4NIKB 5TGBA 4OZIE 1QLFB 2CMRL 1ZK9A 1FZOB 1RZFH 3EOTL 3TBYA 1CK0H 2NZ9D 3P0YL 1J0JA 4WUUE 1S7RB 5E24E 4DQOH 2OR9H 3P77A 2BVEA 4PRDB 5GGUA 4J3TA 3FHQA 4U6XB 3QI9D 3BGFC 3P4LA 4Y2DC 1Z0NA 3WFDH 4YDLC 2QSTA 1MAMH 3WD5L 1VFBB 5ID0B 1ZOXA 1HZHH 4TVSa 4LEXL 4HUKB 3I84A 4HLZG 4LP4A 1NL0L 4OUOA 2P8MA 2RB8A 3KR3H 4YHIB 3EDEA 1FGNL 5JDSB 4FXKA 4G8IB 2DJUA 1CXFA 1Z5LA 4M61A 5ICZB 2GCYA 4AEEA 5DD3L 1X44A 5C0RH 4M93C 2P24B 2IALB 2O26U 4HPOL 4XMPL 2AXJA 1JNLH 1MEXL 4K7FA 5KJRL 1WT5C 1G7MA 3CFCH 3P9LB 3P9WB 3S35X 4FN0A 4K94C 1BBDH 2W0PA 1QLFA 1LP9F 1FZOA 1MFBH 4M43L 3BHBB 1MFDH 3W0WD 3KPQA 1I1RA 1S7RA 1DFBL 1MIML 2QQKH 4HCRA 5CSZB 4PRDA 1A5FL 1F4HA 4U6XA 3MJ7B 4XB8A 4K8RC 1DL7H 5GS3A 4LHQB 1VFBA 2UVEA 3WXWH 5ID0A 4XPHH 5L8JB 3TVMC 2WWMD 2XWTB 1PZUB 2X9XA 3GNML 2Y4SA 2EDQA 3KYMB 3S6CA 2YKLH 3FO1B 2V2TB 4ISVB 4YHIA 4V2BA 4GKZB 1KOAA 4JRXD 5CEZH 5DA0B 3B5GA 5JDSA 3OJ2C 4E5XA 4G8IA 2JJTC 5JA8B 3QWRA 2ATPB 3QIWD 5ICZA 5J4MA 2P24A 2IALA 3CAFA 1INDL 2GJ6D 3MBEB 3C5SA 1CD0A 1MCIA 2DB8A 1OCWH 3P9LA 3UPRB 5HTSA 4EKXA 1EERB 4I0KA 1K8IB 3BHBA 5FM4A 3C8HA 3V0VA 3ZKQD 5C08D 1W0WB 5FGRA 4HGKC 2OJEB 3HLAB 5CSZA 1M7DA 1MRFL 4GBXC 4J3WA 4Y0GA 3FQWB 3MJ7A 1KC5L 2PUQT 3VGBA 4OV5A 4J23A 3LKOA 2VDPL 4KHTL 35C8H 4C56B 1YEJL 2QSVA 2AK4A 3KPSB 1GGYA 3TBVB 5F96H 2LAGB 4CVXB 2XA3A 4M1CD 2V9TA 5FYJH 3SCMB 2VLJE 3FO1A 4PJCE 4ISVA 1JGDB 3REWA 2NLJB 5EOCL 3G5ZB 2PW2B 2ATPA 2HT4C 5JW3L 2NPLX 1B90A 3SQOH 2YPLB 3FFCE 2HYMA 1R6VA 2IH1B 1F4WL 2Y23A 2A9MH 4KHXL 3UPRA 2ZNWA 3MV9D 5SWQB 3INUH 3RQ3A 3MRLB 1JNNL 4NO5A 5L2JA 3L3IA 1K8IA 1YPZA 3LQZB 1MLCB 1FNEB 1I9RH 5ENWA 3OG6B 1MI5E 5FYLH 2AP2A 4M7LT 3ETBF 1DTUA 4HH9A 4ZUVA 5DDHB 1A6UL 5FA4B 4NHUB 4O9HH 1HKLH 1S8DA 3UTTB 4ACPA 1YJDL 1WZLA 2J88L 3QFJD 2AKRA 4J4PD 2IPUK 4X6CE 3DURB 2FO4B 1LK2B 3TBVA 1OL0A 4OB5H 2QLVB 5DWUL 3SCMA 3HZVB 3MLSH 1RJZB 4HWEH 4M7KL 4QY8B 3G5ZA 2PW2A 2CMRH 3SDAD 3EOTH 1MCLA 1NGWB 4ZPVB 4LU5L 3P0YH 5IBUB 2VZTA 4RGMB 2IH1A 3CNKA 4KROD 4H1LG 2FNBA 2VOTA 5SWQA 1G9ML 1TFHA 2R1XB 4WFGD 4W70A 4QOKD 5C0GB 4NO0D 1KCVL 5GS1B 3LQZA 3WD5H 4OI8A 4U1MB 4P4RB 4PJEF 4IOSD 5CLWA 5T3XE 4FXGB 5IEHA 5DDHA 1NL0H 3VJ6B 3HAEB 5FA4A 1Y18B 4NHUA 1E4JA 3EYVB 3TA3A 3UTTA 1RURL 5J89A 3L6FB 1T83A 2BNRE 1TNMA 3KG5A 3KPOB 1N3NB 1ERNA 1XF1A 2E8YA 4P5MB 4G8GD 3DURA 5DRXA 1Y6NR 4X6FB 2FO4A 4U6TA 3QULB 3L7FB 1JE6A 5DD3H 4PRBB 3GMOA 5SX4I 1AC6A 4LMQE 3ULVC 4HPOH 4XMPH 3T0XA 3VMNA 1MEXH 5AZEL 1AGFB 5KJRH 1RJZA 3UJJH 2ZUXA 2B20A 4QY8A 5CILL 5I8OL 3RWEB 3GIZL 1NBQA 3V0AC 4ZPVA 3GSNB 1DQQB 4JN1L 2NW3A 1DFBH 2A6DB 1MIMH 2DKMA 4KKBD 1A5FH 1MF2L 1DBML 2DI7A 1IKNC 5GS1A 2F8VA 4ZMAT 4KV5E 1P4LB 1RZJC 4WCYL 4U1MA 4P4RA 4JJHA 4FXGA 1CXKA 3OMZA 1Y18A 4FS0A 5DHXB 1R3HB 3DLQR 2YUZA 4YJZL 2H2PC 4NUJB 3KPOA 3T2QA 4YZFF 4Z0BL 4P5MA 4X6FA 2RFXA 3L7FA 4N8VB 4PRBA 3SKUD 1INDH 5FO9B 1AGFA 5CGYD 3BVNA 5EIIB 2BOCB 5JMRA 3G6AA 1NGYA 1SJXA 1BMGA 1J86A 3GSNA 4RBPH 1DQQA 3V0WL 4NFCA 5ITFA 2PYEA 4KRPB 3WIHA 1QFWM 3EO1B 3QEQA 3BRFA 3KLSA 1C8PA 2F5AL 5FYKU 1NAMB 1FFQA 1P4LA 2PCPB 2VDPH 3EYUH 2PO6B 4KHTH 1YEJH 3B2VL 4NRYB 4Z7UB 1UWEH 2IWGA 3SDDC 4G6KL 3A6BL 4HLZH 1R3HA 4HUVB 3GMPB 4QHKI 4NUJA 2D7QA 1TLKA 4WFHD 2D31B 3VXMD 1LE5B 3FAWA 1YMHB 4TRPL 4PYGA 2VABB 3U7WL 4TNWF 4L9DA 4NZTL 4AH2A 5JW3H 4N8VA 1ORQB 1ZA3B 5IJVA 3L3KB 5E95B 1F4WH 4F57L 3K74B 2DM3A 4KHXH 4ZTPL 4XNMA 3OAUL 3DROB 5EIIA 2BOCA 5IMKB 15C8L 1CIDA 2ZCLL 2VLME 1MWAL 4NQSB 3CFEB 2KQNA 3VD5A 5B39B 2BRRL 2WWMC 4LDEB 1A6UH 3EO1A 1EO7A 4OFKA 4NPYB 1YJDH 2DMKA 4QRRB 4YFLF 1HYRC 1NAMA 2J88H 2DQDH 2PCPA 3U4AA 2PO6A 3MXVL 5DT1H 5B3JF 3QIWC 4NRYA 4Z7UA 1I8IA 1NCTA 5F7EL 4NN7B 5DWUH 2NZIA 2YD9A 3BPCB 3O11A 4HUVA 3GMPA 3BKCL 3IU4H 2X4UB 4EI6B 1YN7B 1HHKB 5MI0B 4M7KH 2D31A 4V1DA 3QXUA 4X6DB 5DD5L 2VABA 1AO7E 5HGDB 3H9SD 4EI5B 1ORQA 4LU5H 4KK8C 4LGSB 2YRPA 3H7LA 5SWSE 1IL1B 2J6EA 3QPXL 4P0DA 4D0DB 3LS4L 4HWZB 2GTWB 2DAVA 1S7XB 5IMKA 3DECA 3MRRB 4OIIL 4NQSA 3CFEA 5CD5D 2AK1L 1J8HA 5KSBF 4FFWC 3EKCA 4OIBA 5DRZB 2DM7A 2X09A 4M1CC 1V7NL 4PJ8B 1RURH 4NPYA 1MREL 4QRRA 3U1SL 1OSZB 3HG1B 1OW0C 3S7GA 2OXHA 1R5WB 3GSWA 4JLRB 4GKSB 3O2VL 5GGRB 5E2JA 2YD8A 3IDJB 3ULVL 4PJHF 4P2QB 4TSBL 5F1KC 3FT4B 5AZEH 3FB5B 2X4UA 3CDYA 2H9GB 1HHKA 3F5WB 3FJTA 1C08B 5CILH 5I8OH 4X6DA 1EMTL 4JFHD 3DSFH 3PL6D 3GIZH 3SE9L 4EI5A 1T5XB 4FQPA 5H8DA 3IF1B 1I3GL 2XYCA 1OTTC 4D0DA 4HWZA 3GRWH 1MF2H 2VZSA 2GTWA 1DBMH 3LDBB 4KI5E 1S7XA 3MRRA 4LCUB 5EBWA 2YUVA 3H9ZA 3OJDA 4J4PC 4WCYH 4AEIL 4XP9H 5HPMB 5DS8B 5E03A 5C09E 4F7CA 1U2CA 5HVHB 1CVRA 2PR4L 2ZUQC 5JHDD 4D9RE 2QHLA 1OSZA 3HG1A 5KN5A 4Z0BH 4TN9A 2F53B 3B5TA 2BOBB 2VDOH 4O02L 4XZUB 4Y1AE 5I0ZA 4OCWH 3H0TB 5FGCE 3BAEL 3IDJA 3KXFE 4P2QA 2YMXL 2NXYB 4NM8L 2GSIB 3FB5A 4X5XB 2H9GA 4KROC 3F5WA 1MH5B 1EPFA 1UM4L 3KLDA 4N8CL 4NQDB 3ZE2F 3OKOA 5AYQA 1LO3L 4JKLA 5B8CC 3QNXB 4D94A 4PJXF 3W81A 4RMWA 5EU5B 2BMKB 3GMRB 1EJOH 2OYPA 2F5AH 4LCUA 2X1PA 3VXUE 3EUUA 1A6TB 5DJ8B 2FGWL 2X1OA 2BHUA 5EUOB 3B2VH 5IB4A 5HPMA 3DXAE 4G6KH 4JFDD 4U2ZA 3A6BH 1X3DA 6FABL 2P42B 4JM2F 1TCRB 2F53A 3LMJL 1CCZA 3EO9L 3U7WH 4BQ9A 1T6WA 4NZTH 2NY3B 4U31A 2MOVA 4WIQA 3V4VL 2GSIA 4F57H 4K9EC 5AUMB 1X7QB 5D6CB 3WL9A 4ZTPH 1MH5A 2FATL 5AYUL 3KYAA 5CP7B 4KKBC 4XWGL 2IQAB 4UQ2B 1OT1A 15C8H 1PG7L 3DYPA 2ZCLH 5CP3H 4Z78B 1MWAH 1L9MA 3BISA 2BRRH 3I6LD 2V7HB 5DJAB 1MJUL 5D6DC 5EU5A 1NFKA 2HRPL 2BMKA 3GMRA 5HBBA 4WU5B 2MQCA 4U3HA 5DC0A 5DJ8A 2WQ8A 1FC1A 2VN7A 3MXVH 2IF7A 4XNQA 3U9PL 4ZUTB 5F7EH 3HTLX 2KH2B 5GGVY 2HFGL 3VD3A 2ICWB 3BKCH 3MYJB 4JFFE 1JI1A 1BQLH 3TT1L 1CDUA 5E6YA 1U8KB 3O4LD 1WLHA 1CLZL 3LQAL 2YXFA 4KU1A 4L29B 1TCRA 4X0KA 3U46B 4YE4L 5DD5H 2EECA 5DMGD 1RZ7L 1WIOA 2OJZL 3BE1L 1NQBA 5T1MB 2JJSC 2VLKB 2QR0B 1X7QA 5AUMA 1JBJA 1I1YB 5CP7A 3LS4H 2IQAA 5J06A 4UQ2A 5C2UB 4O51B 4OIIH 1XR8A 2O61B 3MCKA 2V7HA 5DJAA 5JIHA 4L5FL 1V7NH 1F8TL 5JXEA 3S5LG 1MREH 4B7IA 4FTVD 1HWGB 1LVEA 3U1SH 1XAUA 4GW1A 1QNZL 1NEZB 2VITB 4MB3A 5F1IB 2FR4B 1JN6B 1YYLL 4PRIB 2J8OA 4L3CB 4MJ6B 4WHYG 4LSRH 3O2VH 5EA0H 1RHHB 4PJAE 1ZE3C 1E6OL 3QIUC 2ICWA 3X14B 5DQ9B 4TSBH 5GGSY 2A6IB 1U8KA 1HIML 5D1ZC 2VKWA 1UZ8B 3F62A 3U46A 3L9RB 4XXCC 3VGEA 3SE9H 1OGAD 2D7MA 2WWKO 3I3EA 1FVDA 3ULUE 5C0CB 5T1MA 5F7YC 1I3GH 4Y88A 1NC2D 5LWYL 1P7HL 1I1YA 5BZDB 5IBTL 3P11H 1I1AB 3O41B 4P5TD 2DYPD 2P5WD 3G04B 4OCRH 2H26A 2EEBA 2EDXA 4MAUL 4XPAH 2CUHA 5C07B 4HAGA 3TBSB 3KYNB 2WBJD 1F2QA 3W11D 3D85B 4BFGA 4N90D 2PR4H 3C9NA 1L9NA 4QF1B 5DUBB 5IROC 3HI1B 3S37X 2EDYA 4FOMA