4GKZB

Ha1.7, a mhc class ii restricted tcr specific for haemagglutinin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Alpha chain of Class II TCR
publication title Minimal conformational plasticity enables TCR cross-reactivity to different MHC class II heterodimers.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB02
1U93A 5L0QC 1LWRA 1WCBB 1MCRA 2DM7A 4JHWL 5GHWL 2DD8H 1A3LH 1CVRA 1FH5L 4OV5A 1L0XA 3U46A 5EU5B 1UQSB 5I76B 3NAAH 1RJLA 3TT1L 3H8NA 4JY6B 1IFHL 3SO3B 5I1HL 3RWDB 2OS7A 5HGAA 2QHRL 2E27H 4OFIA 3VMNA 5ICYB 2R0KH 3R1GH 1WFOA 4M48L 2G5BA 2J8UF 1F5WA 2VYRE 2I26N 5C07B 2FSEA 3WDHA 5C7XL 3F7VA 2UVEA 4RA0C 1VSCA 3DHJA 3VXUB 1E4WH 4OKVB 5JDJA 1JHKH 2WBJB 4UI2A 1R0AL 2AW2A 5L7XH 1CL7I 1S3KH 4APQD 3I6GA 3QDGB 2BNQD 4LPTA 3VXOB 4UT6H 2R56H 3FQUA 3RVXC 5C0FB 1FPTH 4PY8J 3S96A 5BV7L 3MTRA 1JJUA 1R5WA 5LGJB 3RDTD 4KKBC 4WY7H 3D2UB 5DHVB 4MNGE 3IXAA 3FQWA 3M07A 4MDIB 5EU6E 2NX5E 5FOJA 4ZDHA 5IEHA 5DK2B 3UTSA 1SMAA 3SDDD 3BW9A 4HZAA 4PRNB 2YD7A 5IMKB 3UEZA 1CE1H 3DARA 4FG6C 4OT1L 4PJ5B 1OTUD 3E8UL 4Z78B 3K0WA 5KN5B 5IOPB 3F7PC 5F3BB 1QA9B 5EH1A 3X11B 1A6VL 2HFFB 2Q3ZA 4S1SH 5EO9A 4OGXH 1DZBA 4OTXH 1AY1L 4PD4K 1U42A 1T7WA 1X7QA 3BGFB 1JGLH 2Q7NA 1N3NA 5FV1L 3HUJA 4G9FA 4GG6E 3L9RB 3MJ8B 3WLWC 2QBWA 2AXFA 3QCVH 4MSWA 2IADA 4WUUA 1X44A 3LEYL 3JTTB 3CX2A 4HFUL 4XAKD 1RUAL 2D03L 3PQYE 4XP6L 3MA7A 1J5OL 5DJ6B 2J7LA 3JWDH 4BKLB 2A9NH 2WQRA 5K9KB 5HPMA 1MLBA 4ZD3L 1JMZA 3T3MF 3QEUB 1U6AL 1FHGA 1DFBL 4WCYH 5EOTA 4IRSA 1LMKA 3N1PC 2NW2B 3TA3B 1R3KB 1H0DA 5DJ2B 3JZ7A 3UYPA 4PJ7B 3C5ZC 4OLYH 3RKDC 1U8PB 2NZ9C 1KB5A 1BREA 5I8CB 1UENA 3CU1A 3DX9B 2C7UA 3SKNA 4EUPB 1UA6L 2P4AB 4LGRB 4KUCF 4YXHL 1IKNA 2GAZA 2QL1A 4KQ3L 4XCYA 4LEXH 2YD4A 2RBLA 4FN0A 3RTQA 4YNYB 1X5IA 3CFKB 3OPZL 2BSRB 1YJDC 4NGHH 4BQCA 1JVKA 2D4DA 4CVUA 3U48A 5IFHL 3BAEL 1ERNA 3MMEB 3CDFA 1EHXA 1SHMA 1GOFA 2VSCA 4HCRL 3KLDA 4X9HA 5FUCC 1AO7A 1FFNA 2FB4H 1CICC 3ARGB 2CDFB 4NQSB 5HY9B 5KW9H 2H2SD 2R4SL 2EDTA 3CCHB 1A4KB 1GGTA 3GNML 5IJVA 2MOVA 3GJEB 4U1KA 1QSED 5F7KC 4ZNEE 5F1SA 2VAAB 5JZ7C 2YPLA 1BEYH 1KJ2B 3MACH 3SDXA 2D7QA 3HUJF 1XR9A 3MBXH 1FFPA 2FECL 5H2BB 5L2KA 2NY5L 4U0QB 5DMIL 3KXFA 1MRFH 1KNOB 5FK9A 3MBEA 3C8DA 3WHXA 2CK0L 1SYVB 3KYMB 2FGWH 3OAUL 4P46A 3SOBH 1AGBB 2LABA 3QZWG 3MRPA 4Z7VE 3QFDB 5LCVH 4WHTB 4G8EA 4NUJA 4YIQA 3LQZB 4DFIA 5F7EL 1KPRB 3BD5A 3LS4L 5E99H 2C3HA 5F1NB 1NLBH 1HI6A 2J6EH 5J11B 3H2WA 3D2UD 3PP4L 4YC2B 1R3IL 5D2NA 3L3OA 3FFCB 5FF6A 2FEEI 3CVHA 3F7YA 3QCUL 1FRGL 5DJCA 5EORL 5ICZA 3TH4T 2DF3A 2IH3A 5EOQH 4CNIA 4X5XB 4GAJH 4ENED 4XNYH 3FZUC 4BSVB 3HLAB 4FXGA 1JGEB 3QDJD 2X4RA 3MGAA 3BN9D 1R3LA 5F7DB 2EYRA 4P5KA 3LQAL 3GRWH 5A2JH 2A6KB 5EZJA 1HQ4A 3T0XA 4PYGA 2E6PA 3T2NH 2R8SL 4WHYH 2AJXL 2YEZB 2CLZA 5LJYH 1B0GB 2XACC 3VFNB 2AABL 4OZIA 3VGBA 4XPTL 4BH8B 2AJZB 4J8RA 2G60L 3IF1A 3CVIL 5E9DA 1MJJB 4H88H 3HE7B 2P44B 4NJAL 4QRSB 4GAFB 4XBGB 1UYWL 3SDXF 3U0WL 2NPLX 4LSPH 2OBGA 2AXJA 2PN5A 3FAWA 4PJ8A 3S3SA 5ID0B 2HG5B 1YDPB 4H5SA 5GS0C 1U8IB 1CLOL 3VFPB 1JNLH 3KHQA 4PG2A 3C5SB 3VXPB 1HEZB 4L5FL 4R0LA 3V0VA 4MAUH 3MRNA 4WUKL 1NCCL 5T1MA 3B9KB 3H9ZA 1KB9J 2OZ4A 1S7RA 2VQ1A 3AREB 2X2YA 4LVHC 3RL2A 4XCEA 3TWCL 5I30H 4ORGA 5TQ0L 4MJIB 4DN3L 2VLMD 1JRHH 1D9KA 5T1KA 4N0YH 4IRZH 4JFEB 2G9HA 3M1BA 5D72H 4QOKE 3GSNH 3KR3L 1FYTB 4GKOA 1G9NL 3QQ3A 2R2EA 4JFHD 3X3FL 3DETC 2LVCA 1AGCB 1KXVC 2XI9A 2Y72A 3B6SB 4FP8H 4PJGB 3P0YH 1D5IH 3UCRA 4RFNC 1W0WA 3TH3T 4BELD 3C60C 4LSVL 4NN7B 3FQNA 4IIQC 4PRID 1DBAH 4S1DD 1T03L 2MFNA 2HKHH 3KPSE 2E5EA 5CHNB 4K2UH 2BC4B 3OX8A 3SBWC 1O7VA 2B1AL 2DN7A 1EEYB 1TVHA 4OZIF 5EU3B 3VH8A 5T3XH 4TSBH 2L7JA 3CSPA 1XR8A 2D7NA 3JUYA 4YHPB 5E2VL 4OD3L 7FABH 5F9JA 2IQAA 4KJPC 3TN0B 3BN3B 4LAQL 3HPLA 2QHLA 2Z35B 4YFLI 5BVPL 5B21A 1HOCA 5AG8A 1FE8L 1JHTA 2IPTH 3CIQA 1OD9A 5ENWA 5GGTA 3AY4C 3QI9B 1N0XL 1EFXD 3BESR 4BQ9A 5F9OL 1ZV5A 3I84A 1ORQB 5ESVB 3SE4A 4TUJA 3S35X 4Y4FA 5IFAL 2NY4D 3ARTA 1HDMA 2GT9A 5MERB 1EXUB 3KYNA 2ICWI 1JNNL 1NAMB 4KMLB 1KIQA 5I18H 2RCSL 4MXWL 1RI8A 1ZGLP 1KELH 1H3PH 2N7BA 4U1SA 4M03A 3B3IB 3LRSB 4HWBH 1WISA 5CSGA 2E8YA 4LKCA 4HK0A 2VR5A 4HUUB 3QIBD 1MHHA 1U8LA 3CSGA 5CSZB 2R39A 4NZTL 1LEGB 3C08L 3L3DA 4X7EC 3MV8A 2O5YL 1PX4A 5C07E 4EI5C 1WT5A 2VLKD 4R8WL 4QF1B 4Q9RL 5I74C 1SYSB 3H9HA 3VXUE 4AMKH 2R2BA 4MXVF 1KULA 2CKNA 4EVNB 2EDQA 3V0WH 5I8EA 1JN6B 3TO4C 2EKSB 3QDGE 1ZWIB 3KDMA 2W0PA 3KYOA 4U1LB 5BV7C 3UTTD 5HYSA 1MRCH 3PDOB 1DVFD 4NN5C 5DZNA 2R29L 3EOTH 4Z77B 1KB5H 1XMWA 4F15C 1YEDA 1HKLH 3VGFA 1S8DA 2FZ3A 1TZHB 2W9DH 3QNZB 4PJ5E 3GMLA 3IFOB 5IV2A 5DJZB 1Q9WB 5JA9A 5MHSD 1UKQA 2VAJA 2XZCH 3WS6A 2VITB 3FB6B 1BHGA 4YHMH 3LN5A 1E28B 5F1OB 5EG6C 2HLAB 1TENA 5FB8B 2CUMA 5DJDA 5FYJH 4PJHA 3DI2B 1OSPL 3RNQA 4ZSOB 1JCKA 1DN0A 4OI8A 3VFGH 2VZUA 4N0UB 4X98A 1TPXC 4RAVA 1QEWA 1BQHA 1G7PA 2OJEB 4TVPD 1FCCA 4KPHL 1IQDA 1SJHB 3D69A 3MLTB 5FA3B 2QR0B 2YS4A 4YDKH 4KI5E 3S35L 4Z0BL 3LPWA 5I1KL 5GRXG 5C0CA 5GZNC 1MLCA 2FATL 2LU3A 2QADB 1DQML 1HNFA 1VGEL 3K4AA 4OZFH 5IFJA 3GB7B 1LE5B 5DMYA 2J8UB 1W0VA 3F65A 4PJ7E 3DXAD 1J0HA 2ZUWA 4GSDH 2B4CH 2OTUA 5GGRA 1RK1B 3ZDYF 4JZJB 4DKEL 1JL8A 3SCMB 5F7MC 5C0RH 1LD9B 3KPMA 2I07B 4UAOB 3U7AA 4H0HB 4S2SB 5HHNA 5IMLA 3O9WA 2Z92A 4G80B 3MGOA 3ILPB 4M7KH 1E4JA 3DPBA 3LKOA 2P5WD 2GK0A 2FO4A 4W6XB 4HIIB 1V7MH 1KPUA 3DOSA 3OBAA 4JFXB 4K8RL 4X80H 2DLTA 5IK3B 1QFUL 3RWJA 5DFWH 2OR7A 1AJ7L 2HRPH 2H8PA 1HINH 1NFDE 1EBPA 1PG7X 4QXWA 1N4XL 2XRAL 3DVNA 3K46A 4EBQL 1Q9LA 1Q9KA 1OP9A 4PJHF 3RWHB 2C3XA 1Q38A 3DVGB 3RBSA 3U7YL 1YMME 2MQ3A 4LCYB 3IDJB 4P2OC 5HTSA 1MF2H 3VFOA 4QRPA 5KVDH 4NWTH 5C9JA 2EDXA 2R9HD 2DS4A 4OV5B 3U46B 4JDTH 4PLOB 3B9VA 3EW3B 3X3GH 3SJVA 5K9QI 1RJLB 4BFGA 1MRDL 4LHJB 3O2WL 3WNLA 3JTSB 4ORZC 1OAZL 4HLZG 2R4RL 5HGAB 1QNZH 3JV0A 3OKYA 2NY1D 2G5BB 1WK0A 5C6WH 2FSEB 1KCUL 2RR3A 3LH2L 3F7VB 4YH6A 1ZT7B 4QRRE 4Z7OF 2AEIT 2DIJA 1U58A 5IMMA 3FFCE 4LLVA 4OFPA 2ADGA 4F9PC 1F42A 4LF3A 3N1GC 5ITBL 4YEEA 3HC3H 3I6GB 4KUZH 3WFHA 3D87B 4HT1L 4I5BA 3FQUB 1IE5A 4LFHG 1E6OH 3S96B 1R5WB 2X1QA 4GKZA 5E0QA 4DJMA 4YQXH 5FHAH 3FQWB 5GRZA 3REWA 4ZDHB 4M5ZH 5IEHB 3UTSB 1QFWL 5BRZE 1P2CB 1HHGA 3BW9B 5AAWA 4FMKA 1UM6H 1BF8A 2HT4D 3OAZH 2FJFA 4NZUH 2WM0A 4A2MA 4BYHA 4MQSB 1G6VK 2ZUTA 1A0QL 1RFDL 2VXTL 4HAGA 3ZTNH 1YPZE 2DI9A 2WLYA 1XCQA 5D2LA 1HYRC 1OTSC 1X7QB 4LSTL 3X13A 3KPLB 1KTDB 1WWWX 4IOIA 1N3NB 5J56B 3E2HC 3ULUD 5JOPE 3HUJB 4G9FB 2QADD 4ODWA 1EHLH 1CXIA 4OFVA 2AXFB 2BJML 1RZIA 1LGVA 4J3SA 4MSWB 3WCYA 2IADB 4WUUB 5D71H 4M02A 1PG7L 5M95B 3MA7B 4OV6F 5E5UB 3NGBB 4GRWF 1S7QA 5E6ID 1ED3A 3SCMD 5HPMB 2HVKA 3WXWL 5GGTH 3O6MH 5EOTB 5D7KD 4IRSB 1FAKT 2Q86A 1H0DB 3WHE0 4D9RD 1PY4A 2PO6D 2XTLA 4KU1A 4XHJC 4MJIE 2PTUA 1KCKA 4TUKH 4WWKC 4M61A 4JFEE 5D93B 5DGQA 2KUTA 1OARL 1FYTE 2C7UB 1G9NC 3SKNB 4HX1A 4UQ2B 4Y16A 2GAZB 3QHFH 3RVVC 1NLDL 4X9FA 4PJGE 2CDEA 3P30H 3MOAH 3CFJA 3DIFA 1J8HB 1X3DA 4ELKA 4KVCH 4DFHA 5FCUL 4M6ML 5DQ9A 3SGKA 3S4SA 2O26U 3VFRA 1FV1A 4YGVA 2XKSA 1AO7B 1FFNB 4K9EH 2VB5A 1OAUH 2RJMA 3I75B 5D2LF 1NDMA 1WBZA 2Z4QA 4U1KB 2YPLB 3AB0B 5T3ZH 3SDXB 1I7TA 4G7YH 4NZJA 6FABH 5GS2D 1FFPB 5L2KB 4KVNH 4ETYA 5I66A 2Y36H 3KXFB 5C0AD 5FK9B 4M5YH 3MBEB 2O5XH 4R6UA 3WHXB 5KANI 2JIXA 1J12A 5LQBL 4P46B 2VL4A 3A6OA 1AQKH 1JHLH 4DGYL 3DV4B 2F5AH 5BZWA 1OP5K 5I1CH 3MRPB 4Z7QF 2VXSH 4IHOB 2FGZA 4BSJA 2XXCB 3R0MA 4O5LH 4GAGH 4NUJB 4KUCD 4YIQB 3ARWA 1J8KA 4ZXBB 3NABH 4LARH 5F7YC 3SE3C 3L3OB 3RZCA 3GI8L 3NFSH 5FF6B 1CFVL 3MNVA 3EYFA 4P57A 3CVHB 3F7YB 4YHZH 5DJCB 3WBDA 5ICZB 1WAAE 1BJMA 1ZVSA 4CNIB 3EZJB 1T1XA 2AJUL 2OCFD 4GLRI 1BFSA 1DQJA 4D8PA 3B5TA 1J1PH 1KTLA 4FXGB 3NIDE 3PWPB 2X4RB 1CD1A 1YUHA 4UOJA 1R3LB 4KXZI 2EYRB 4P5KB 1K5NA 4WGWB 2M2DA 1FC1A 3H42H 3OR6A 3WJJC 2H2PC 1HQ4B 1CFNA 4UOW0 4ODHL 3BEWA 5F72S 3OKEA 1GIGL 4QGTA 1O7SA 3QXWA 3VGDA 2CLZB 3KJ6H 1D3CA 4QWWD 3ARBA 1DR9A 4L9LA 4OZIB 35C8L 5ICXA 1QG3A 2D7MA 3LIZL 1VHPA 4J8RB 3IF1B 4GS7C 4XI5C 5E9DB 4WUUD 5DSCA 3N1QC 5EUOF 5SV3A 4P2RE 5D1ZA 5DJAA 1IVLA 5CILH 4XWOD 1OM3H 4PJ8B 4TSCL 1MCEA 1P84K 4H5SB 4JKMA 4IRSD 4X4XA 2HJLA 1CR9H 2Y5EA 2FIKA 4CW1A 2J88H 5C9KA 2XKUA 2QSQA 1EO7A 1FNGB 4R0LB 3ISWA 3V0VB 1L6ZA 3MLUH 3OKKA 5CBAA 3MRNB 4ZSOE 5T1MB 1I3VA 4G7VH 1S7RB 4D9LL 2VQ1B 4ODVL 3EYQD 3KPTA 5GPRA 3RL2B 4XCEB 15C8H 4QHKJ 2HJFA 2E6QA 4ORGB 4XVJH 4O58L 2RGSA 4D3CH 3UTOA 4K3EH 1J8HD 2BNRA 3WUWG 1D9KB 5T1KB 1EVUA 1K3ZA 2XZAH 3QXAA 2G9HB 3M1BB 4PRBA 5FUZL 4RFEA 5EZOL 5KS9A 1YN6A 1PX3A 2DQUL 3ARFC 5KVEH 2RQ8A 1I3GL 3QQ3B 3ZKMC 2R2EB 2HKFL 1HCVA 4JM2C 4HPOL 1IZJA 1BPVA 4RRPG 1H3XA 1PEWA 2J8UE 4YHNA 2AKRA 4FFWD 3A6CH 5E4IA 4LVNC 3EJYD 5DD5H 3ARYA 2YPLD 1MAMH 5K9JL 3LDBC 2QSCL 3WFCL 1KSRA 3D9AL 2SEBB 3OX8B 4G6FB 4HXBH 5EZIL 4XXCC 1UB5A 4WNQA 1TVHB 4KHTH 1E6JL 3VH8B 1FDLL 3QO1A 3LAFA 2YK1H 3VG9B 3BKCL 2LQRA 3V4UL 4K7PH 5KAQF 4HUMB 1MWAL 3O0RH 5ESAB 3RL1A 1EIBA 5F9JB 3VD7A 3HPLB 3DROA 1DLFL 1B88A 1OWRM 2VLRA 2VERN 4UTAL 1HOCB 4P2QD 1QD0A 1JHTB 1HHIA 5ENWB 2DQCL 1L0QA 5EWIL 3RJQB 4UIKL 5JIIA 3Q6FA 3O8XC 2IBGA 4ZXBD 3VXMD 2VDRL 4OM1L 3QH3A 4Y4FB 3FB8A 3WFBL 2NXZD 5A2FA 4MQ7A 1HDMB 3EDEA 4NQDA 3KYNB 3UBXA 2MKWA 4LHUA 1T66D 4UDTA 5JQ6H 1FGNL 3PL6C 3UO1H 3BKJH 4R26L 4DOHB 1KCRH 2CPCA 3PWPD 4KJQC 4NJ9H 4U1SB 5HXMA 3R06A 5CZVH 3KPQA 3ALWA 4FQIH 1F2QA 1FZKA 1NBZA 4LKCB 3QB7C 3JWOL 3EYOA 5KS9F 3B8YA 3EFDL 4ONGL 2FYYA 1J9CT 1MHHB 2LTQC 1U8LB 4M3JA 4FFYH 4LCWA 3T3ME 3RP1A 1BWMA 3L3DB 3B9EA 4AENB 5T3XE 3MV8B 4MGXA 2NY6B 1UADC 2DDQL 1IAOA 4C56A 1RZJL 5IB3A 1ZVYA 2GQHA 4R97B 3H9HB 3SDAD 1TMCB 4TSAL 2R2BB 4LNRA 4C54A 5C71A 4XVTH 5I8EB 1DEEA 3O3AA 1PZ5A 3IKCA 3KYOB 4KK5D 4QCIA 1I8LC 5MI0C 5HYSB 3WEXA 5E2TH 5ACLA 3RFZC 1RJZA 5D7LD 2BMKA 1RSFA 4F9LC 1Y6NR 3VJ6A 2DD8L 1A3LL 1YEDB 4LCCC 2GITA 3HN3A 3UTSE 3IKKA 4XNXH 2ICCA 1S8DB 2FZ3B 1MFCL 3NAAL 3GMLB 5IV2B 2H6PA 3LKPA 3MV9A 3FTGB 4U1IB 4HC1A 3GMNA 3P4OA 3VRLE 4M9PA 4MDJA 8CGTA 1EJ6A 3KGRA 2E27L 1IQWH 5DJDB 4X7SH 4PJHB 5DYOA 2C1PA 2R0KL 3RNQB 1I9RH 1DN0B 5HYJE 5J4MA 4GT7A 3MV7B 5EZLA 3HUJE 4G9FE 2Z91A 1E4WL 2DAVA 1IAII 4RAVB 1QEWB 1BQHB 1G7PB 3BH9A 4L3CA 1BP3B 4WUUE 5EOCH 1CDYA 3EO9H 2EYTA 2ZZUT 3D69B 1GH7A 4FS0A 5F9WC 1S3KL 1A2YA 1FGVH 1AKJA 4UT6L 2R56L 5C0CB 1MLCB 1FPTL 4HWZB 3TBWA 2J4WH 2XA3A 3A6BH 5IFJB 4KQ4L 3UYRH 4DQOH 1W0VB 4U4BA 5IF0B 2ZUQB 3U1SH 2EEAA 3V5KB 5D1XC 1I1AA 3CSYA 2OTUB 3OB8A 4WTWA 5GGRB 3QWRA 4PFEA 5B8CC 2Z31C 1EGJA 1DANT 3KPMB 2I9LA 1GCFA 3V4VH 5HHNB 32C2A 3HB3D 4OGXL 4Q9BA 3O9WB 5IMLB 3QUMA 4OTXL 2Z92B 3BZEA 1NMCC 3NCJH 1JGLL 3MGOB 3S37H 3QG6A 3LKOB 3FO2B 2MTPA 3IDXH 4CMHC 5BCAA 2GK0B 2FO4B 1M1SA 1KPUB 25C8H 2CO7B 5FYJE 5JPMA 3R8QA 2W0LA 1J7VR 4NPYA 4UDUA 5D70H 3QCVL 3RWJB 2P42B 2DLGA 2BY3A 2H8PB 4I0PA 1A02N 3IU3A 3BHBA 2WBKA 3H7LA 1AO7E 3JWDL 2HT2D 2A9NL 3DVNB 1I1FA 3OB0K 1U36A 1Q9LB 4G6AD 5I2IA 1Q9KB 4CL7A 3O4OB 4JQXC 1RZKL 2FD6H 4WCYL 4KH2A 4MJ2A 1QLFB 1TJGL 3BUTA 3MRGB 5KSAD 3SDXE 4MJ5B 3VFOB 3K3QA 4QRPB 1MFNA 1UWGH 4OLYL 3DRQB 5HGBA 5L2KE 5CS7A 1XFPA 1G6RA 3H7BA 3KXFE 4Y5XA 3N9GH 1UH3A 3GSWA 4G5ZL 5KG9B 5DC4B 3SJVB 4GRWB 3WD5H 1CDIA 1DEDA 2Y7QA 5CINH 1WTLA 2YWZA 2ED7A 3BRGC 4NGHL 1HHKA 1WZKA 4JY5L 4NKOA 5FM5O 5CUSH 2QSTA 1RZ8B 3SO3C 4PGZA 2IANA 4OZHF 5D2NE 1U58B 5IMMB 5JUEH 2Q8BL 2CKBH 3WSQL 3OAYH 2ADGB 2HFGH 3D3VB 4LF3B 5KW9L 4DKAA 3WFHB 4I5BB 3LHPL 3Q6GH 3ZT6A 1KC5H 1BEYL 1M7IA 1YEFH 3MACL 2WBJC 1MJ7H 3MUJA 4GKZB 3ARZA 4F80A 3GO1L 5GRYA 4MMZC 2DL9A 4OF6A 5F96H 2ESVD 3REWB 1MRFL 4BQ8A 5FIEA 2D9CA 5M94B 4ERSL 3MV7D 2FGWL 2C26A 1ZT1A 1MCJA 1L4IA 5TDOA 3SOBL 4PYHA 4OZIE 1T5XA 2G5RA 1VACA 2FJFB 2C3VA 3K7UA 4TVPH 5E9DE 5LCVL 1HSAA 1IAIM 5DC9B 2KQNA 4LSRL 1XCQB 5D2LB 1JMXA 3UDWA 4HIHA 4EN3A 3X13B 1GGCH 4ELMF 5E99L 4IOIB 1LDPH 1NLBL 2J6EL 2VH5H 3G5YA 3JV5A 1DBML 4ODWB 4U1GB 2WINB 4QXUL 1FQ9C 5I1JH 1MQKH 1RZIB 1LILA 3BGFC 2D31A 4NN6B 5EOQL 3QQ9D 5LBSH 2Z8WC 5FM8A 3MXWL 3UROR 2DQHH 5JR1H 5I17A 1ED3B 4Q2ZA 1MHPH 2HVKB 3THMH 1MVFA 3DGGA 3P77A 3L5HA 4JG1H 4ACPA 4S1RL 1U8QA 3HI6L 3VA2C 4KI5C 2Q86B 4IS6A 4R90H 4DTGL 4IRJA 4Y1AA 4WW2A 1GOHA 5B22A 3D39A 3BIKA 4AL8L 4M61B 5IHZB 3TA3C 6CGTA 3DJ9A 1DBJH 4P23A 3A0OA 1XIWC 4H88L 4HX1B 4X4MA 5MEND 1I1YA 3HRPA 4Y16B 2Q8AH 3EOAA 4LPCA 2ICWB 1IGMH 4LSPL 1LO2H 3S9DB 2CDEB 4RGMB 1TQCB 3CFJB 3MYJA 3G5XA 1ADQA 4WTXA 1LO0L 3JWNC 4HV8A 2CDGA 4ODUA 4ELKB 5F3HA 5IT2L 4I2XA 1XF2A 4LSQH 5DQ9B 5JORA 3S4SB 4I3SH 1JNLL 3BMVA 4MXVE 4AQ1B 3VFRB 3PE9A 4CU6A 1FV1B 4I1NB 4YGVB 5SWSD 3QUXD 3AFLA 4N5EC 4FQCH 3TVMD 4MAUL 3HG1A 1KFAH 2N7AA 2WWMD 1RZ7L 4NM4H 1NDMB 1WBZB 2XNAA 2Z4QB 5EUOB 4EUPG 4N1HB 4R7NB 5I30L 3D48R 5IP4A 3QNXA 1I7TB 5T1LA 1NANI 2YRZA 3ARGC 4ONHB 4HKJA 2AVGA 1JRHL 3VWJA 3SKUD 4N0YL 1FBIH 4IRZL 4OGAC 4RGND 5D72L 5DT1L 3PWUA 2JIXB 1T2QH 1PGRB 2AV1A 1BZ9A 3BWAA 2F53D 3QXVA 2D2OA 4G8IA 4BZ1H 3HKFA 4K3DL 2QKIB 3ALXA 4Y5VA 4JPVH 2OL3H 3D3VD 3O4LD 4FP8L 3P0YL 5BQ7A 5EIIA 2OSLA 5HYFA 1DQDH 1U3JA 2VDKH 4DKDC 1DBAL 1EO8H 4JFZL 3H3BC 4U7SA 4K2UL 1X5FA 4WW2F 4A6YH 4BUGA 3CZFA 4ZODA 1VCAA 3VA6A 5DWUH 2A0LC 2E8ZA 3EYFB 5F1IA 4P57B 4TSBL 5T3XL 1F3DH 1ZVSB 5DQDH 5J11C 3NCMA 3DUSA 1T1XB 2F54D 1GYAA 1DQJB 4YC2C 1BQUA 4D8PB 1FSKB 1KTLB 4C4KO 3MV8E 1CD1B 1YUHB 2IPTL 5DQJA 1ZANH 3NIFF 1K5NB 1TNMA 1JTOA 4Y19D 4QXTA 2XT1B 1CFNB 3BEWB 3OKEB 4KROC 5T3ZE 3ZDYE 4OKDA 2IAMD 1N64L 4PY8I 4LVOC 4Z5RA 3OJDA 3ARBB 2VIRA 4KHXH 4L9LB 3DYMA 5ICXB 4UBDD 5I75B 4I0CC 1GSMA 3OQ3B 5SX4H 2DI8A 3BOVA 5AG9A 4Q74A 5D1ZB 5DJAB 1KELL 1K6QH 3T0VA 3TO2A 2FECI 1JBJA 2EYSA 3HE7C 1IRAY 2MCPH 1CGVA 3GJFK 3QUMH 4X4XB 2HJLB 1WCQA 4M9OA 2FIKB 1F4YH 4CVXA 4CW1B 4FQ1H 3STBA 3X14A 4RBPH 3OXSA 4JFDA 4PJHE 5CBAB 3OKKB 3RPKA 4ZPTB 4M00A 4NNXA 2BVEA 5FXCH 5AYUH 3WS3B 3MLYL 2HJFB 3ZMRA 4TQEH 4AMKL 2BHUA 5IW1A 4JFOB 3B9KC 2BNRB 3INUL 5BVJA 3V0WL 5EBWB 2GYSA 3W9DA 3GZKA 3QXAB 3AREC 1KCVH 3ZHKA 2FHCA 4G8FA 3M45A 2HTKD 4PRBB 3RA7H 3KPOA 4RFEB 5KS9B 1YN6B 2PETA 5C0CE 4TOYH 1U8OA 3EJZC 5B38A 1MRCL 1FC2D 3EOTL 4U3HA 2MNUA 1G6RH 5C92A 2YXMA 1KJMA 1KB5L 3A67H 1PAMA 1JYWA 1U3YA 4ZTPH 3Q1SL 2AKRB 1HZHL 1YEJH 1EAPA 3GSXA 4JCLA 4Z7OE 2X7LB 2D0GA 3QEHB 4OSUL 1ODAA 1ITCA 2XZCL 1N7ML 5DFVD 5E8NA 5GS2H 3U0PA 3S88H 1UB5B 1XGRA 3T0EA 4NN7C 3QO1B 1BF2A 4U6VH 4KKNA 5FYJL 3FT2B 5C08A 5EULV 4PRHA 2YMXH 3RL1B 4JGJA 4XX1E 2E7LA 3DROB 4YZFF 3VFGL 2XG5A 1NUDA 1VKXB 5JIKA 3P73A 1HHIB 1U92A 5C0BA 3FONA 3PDGA 5IBUG 1BZ7A 5A16A 1NEZG 1JTTA 4K3HA 3TN0C 1NKOA 4KJWC 1DTUA 3Q6FB 3CX5K 2A6JA 3ZE2F 3O2DA 2EEDA 3QH3B 4YE4H 1KLUA 2KZWA 3U0TA 4KZEL 1RZKC 3QI9C 4QHNB 4MQ7B 4LEOA 4NQDB 4PLKD 3ARDA 3UBXB 5J6HA 4LHUB 3MLWL 4UDTB 1I4FA 4QRPE 1NUNB 1AE6H 1RUQH 1XCTA 2X70B 4GSDL 2B4CL 3EFFA 3UAJC 4E9LA 2W38A 2H3NA 4FQXB 3QUYA 3R06B 4HS8H 1EDQA 3KPQB 5C0RL 4LRIC 3WL9A 1NBZB 1FZKB 5IKCA 2M8XA 3MRJB 4RFOH 4UQ3A 1GAFL 4NQCA 3SJVE 4EJ1C 1YEEH 3SGJC 1S7SA 2FYYB 1R24B 1MJ8H 2H26B 1LE9A 3T8XA 2APFA 2YD1A 4M7KL 3K80A 4HMEA 4JQVA 1JYVA 4X4ZA 1KG0A 1YNLH 1V7ML 4JFFD 3CVHL 4X80L 5MEQA 4C56B 1QACA 3SGEI 5IB3B 1FIEA 4S10A 1HINL 2CLRA 4LNRB 1KOAA 1BJ1J 1DEEB 4MLIA 3O3AB 3B9DA 2OM5A 3IKCB 1JUFB 4NQUA 4QCIB 3L7EA 2EE9A 3WEXB 2WWKT 4HLJA 1MF2L 1RJZB 2BMKB 3CU7A 1G84A 3VJ6B 4POZC 5KVDL 1SJVA 1NGWA 4NWTL 4RX4A 2BVPA 4PTTA 4L8SA 3P0VL 2NY3B 1RPQA 4JDTL 5DD3H 3UTZA 3RX5A 2H6PB 4PP1C 3X3GL 3MV9B 3B43A 3LKPB 4XPHH 1X5XA 4KV5F 3GMNB 1GC1H 3P4OB 5E4EB 4MXQC 4MDJB 3C6LD 2AAVA 3QEQD 3EHBC 2YN5A 2YPKA 3B2UC 5D2LE 2BX5A 5EZLB 3KJ4B 2ZCKH 1F3RB 3RBGA 3BP5B 3G6DL 2K1MA 2X89A 3NPSB 4L3CB 4ZFFA 2OZ4L 5F6IB 2EYTB 5FYKE 5ACMA 1A2YB 2DJUA 3HC3L 5ERWA 5H37H 4EKXA 1AKJB 2UVFA 1KN4H 4KKLC 1N8ZA 4Z7QE 1E6OL 4WFED 3MLXH 5HVGB 3TBWB 4N0RA 5CZXC 5J6GA 2YUWA 3MOBH 4CN4A 4YQXL 4Y88A 4M5ZL 1TQBB 2X9YA 1I1AB 3CSYB 4JM4L 4HQQH 4OZHB 4L9DA 4NBYB 2DKMA 1I1RA 3U2SB 1F6FB 4NZUL 3L3GA 4XNMA 2I9LB 3VXSA 3CD4A 3QWOB 2XY2A 32C2B 4IJ3B 3ZTNL 1AGEA 3QUMB 3BZEB 2VDNH 4CU7A 4JZJC 1QBBA 4HIEA 3QG6B 4X6FA 4WHYG 3VWKD 4NO5A 3I50H 2I9TA 2CGRL 1EBAA 4NQDD 1MJUL 4NPYB 3BPNC 4UDUB 2GCYA 5MEPA 3KAAA 2QSVA 1IAKA 2VKXA 4LPYA 4I0PB 5D71L 3IT8D 4LIQH 3IU3B 3BHBB 4NUGH 3GSQA 2XTJB 1VESA 3L3IA 2BK8A 2OMNA 2HTLC 1I1FB 5EUKB 4FQXD 5I2IB 5I71B 4Q0XH 5I0DA 5E00A 5GGTL 2PUQT 4GBXA 5BS0B 3VRIA 4NM8H 2DQTH 3SKJH 4ELMB 1U2CA 5CKAA 1CGYA 4RSVA 2PYEA 5HGBB 1R6VA 3VD9A 5HDQH 1G6RB 4MNQA 1ZKAA 4XVSL 4ZFZA 4HCRA 4Y5XB 3TNMA 1CF8H 4Y4KA 2C3WA 3VXTA 3DV6A 4BUHA 3SDYL 1CFSA 1A7QH 1NMBH 3G9AB 4P3CL 1IEAA 2Y5TA 3P30L 3MOAL 1HHKB 4NKOB 4RDQG 4KVCL 3C5JA 3TFKD 1CI5A 2JJSA 2IANB 3MFFA 2NR6D 4XC3H 2VUYA 3TJHC 3UZVB 4WI6A 1MPAL 2DMBA 1VADA 1JF6A 4L4JA 1J86A 2R69H 5IVZA 1HXMA 4NHUA 3CFBA 3CSBA 1DANU 1OVZA 4OAWA 1CVSC 4NC0B 1M7IB 4YBLB 5T3ZL 3T3PF 6FABL 2VDOH 2ZOKA 1FNSH 1FFRA 4I3RH 4NWUH 5DUPH 4PRDA 1NGZA 2Y36L 4W6WB 2O5XL 5DJYA 1F4XH 1RK0B 3ULVD 2BDNH 1ZT1B 3PGFH 5TDOB 3GIVA 5CP3A 1AQKL 1JHLL 1T5XB 2VZ3A 3ZO0A 2F5AL 5I1CL 1VACB 1S7WA 2VXSL 3C09B 2C3VB 3GM0A 4WFFD 3KLAA 1HSAB 1BVLA 1I3UA 4O5LL 2HWZH 4QEGA 1G7QA 4GAGL 4HIHB 4X7CC 4C83A 4EN3B 3W0WA 1TNNA 1B2WH 3G5YB 3NABL 2DIBA 4LARL 2GEEA 5JLZA 2P8PA 4OF5A 4XPBH 3W82A 3NFSL 5C0JB 4Y8AA 1L9NA 3VG0H 3W9EA 3VD4A 4YHZL 1YECL 1EUTA 2F5BH 5HGGS 2D31B 1I1AD 1NL0H 4K7PX 4XGZA 4HKZA 4Q2ZB 1KCSH 1J1PL 2EDDA 3MR9A 5IQ7L 3B4NA 5HBBA 5EA0L 5DRWA 3DGGB 3IGAB 5E2JA 3V5DA 1IGIH 3P77B 5GJSL 5BJTB 1BGXL 2BHZA 3QIUA 4TTGA 2XQYG 2NY7H 3NGBC 1K4DA 1U8QB 3RVUC 1CL7H 5MEOA 4NO2A 4IS6B 3D0LA 3BYYA 4IRJB 3S5LA 4Y1AB 5CLTA 2YHGA 1JZ2A 3CNKA 3KJ6L 4WW2B 5E8EA 4AT6A 3U4BH 2BNRE 3D39B 3BIKB 5CJQH 2WLZA 3BWUC 4MA3A 1MCDA 2CQVA 4IRSC 5KS9E 5HHOB 4P23B 1HWHB 5TE6H 2ADFH 1I1YB 4K23L 3ILQD 3EOAB 3K74B 1QBAA 1RULL 3LB6C 5CILL 1RY7B 1L7IL 1OM3L 2VLLA 3MYJB 4E41A 1NBVH 4HV8B 2CDGB 4KMTH 4ODUB 3SY0B 5BS0D 1IKNC 1QFWI 1HWGB 4I2XB 4HG4J 1XF2B 3CXHJ 1IARB 1OP3K 5JORB 5EU7E 5J1AA 1MCSA 2J88L 3RTQC 4OD2A 3NCYP 4MVBC 4F7CA 1I8KA 3VE0A 4HXAH 2BOCA 2J8OA 3D6GA 4HK3N 4O9HH 5HHXH 4YBQC 1H8SA 3MLUL 3HG1B 2DOCA 1M7DA 1EAJA 4OUUB 3LSOA 4G7VL 1EH9A 2XNAB 3B2VL 1N59A 3VFTA 15C8L 2BY2A 2VLRE 3E1F1 1A7RH 2EDLA 3QNXB 5T1LB 5F9DC 4DVBA 2YPVL 3OF6D 4HKJB 5DJXB 1WZLA 4K3EL 3TBYA 4PRPD 3VWJB 1U8KA 3HE6A 2YD5A 2XZAL 3MREA 3PWUB 1IGCH 4HEME 4K7PY 3AB0C 2AV1B 2LV4A 1BZ9B 1CICB 1RZGA 1NUFA 3BWAB 5FHBH 4PY7A 4G8IB 1QLEH 3MJ9A 43C9A 2O93L 4OQTA 4Y5VB 2FX9L 4NQDE 4GRLA 3MBEC 3ALPA 5GQBA 2BSED 2OSLB 4OCYL 1YEHH 4OCSH 4P46C 4C57C 2YD3A 5DD5L 2B4CC 2Q87A 3DMMA 1MAML 1DE4A 1VB9A 3BDYH 3PWVB 4XP1L 1Q94A 3CZFB 5F1IB 2YK1L 5GRVL 3N06B 2EECA 4MD5A 3VGHA 4CVZA 3BPLB 3DUSB 4LCWE 5D2NC 1NC4D 2OLDA 5I6XC 1QO3A 5E95B 3RVXD 5DQJB 4C56E 3EOYG 4QXTB 3D0VA 4KKBD 1C08B 4UV7L 5D9SA 2AK4D 4Z5RB 3OJDB 2VIRB 5DDHA 4G6JH 2IPKB 3FKUS 4FG6D 1OPGH 2YD6A 5FEBA 5I8OH 5EOCJ 3PHOA 1A6WH 1BOGA 4TULH 1KCLA 5CEZE 1S9WA 1CG9A 3BKJL 3TLRA 1YC7A 4UU9A 4HDIA 1KCRL 3TO2B 1AP2A 4NJ9L 3K8LA 4X5WA 4PGCA 5CZVL 2EYSB 1BZQK 2E9BA 1B6DA 1Y6MR 3FCTA 4FQIL 4YHKH 1UACH 1BQSA 5D96C 3MV9E 2VLJD 3WLWD 4CVXB 1CGWA 2E7HA 3X14B 4H8WH 3TGXA 4FFYL 4PJ8C 3OXSB 3S37X 2C1OA 4JFDB 2VXUL 2XFXA 2EXWC 4TNWK 3K8KA 5HHOD 4YX2H 4P23D 5DD6A 4NNXB 5D4QA 1EEUA 5FYKL 3TPKA 4JJHA 4LHQB 4RQQA 1AC0A 1ZLSH 1NMAH 4R0LC 5FGSA 2ZSWA 1WC7A 3SDCA 3PIQA 1Y18A 5IW1B 3QNYB 2IGFL 3KPNA 3C5ZD 3W9DB 3RKDD 3GMQA 2QQNH 3WUWA 4G8FB 2Q6WA 3KPOB 4GG6A 1XT5A 2NZ9D 1QFWM 1MNUL 1U8OB 5DK3A 2X4SA 1KJMB 1D9KC 5CEYA 4YHIB 5HHPA 4XNXL 5L9DH 4IBLT 1EAPB 5GS3A 2BRRH 3Q3GA 1MIMH 4JO4H 5E8NB 3U83A 3N85H 3U0PB 3IXTA 1XGRB 1P5UA 2KKQA 4HSQA 1TDQA 4IMKA 1TZIA 4X7SL 5C08B 5E70A 4PRHB 4EZMA 1I9RL 1CICD 4J7RA 2BXZA 4K7FA 4X7TA 1CLCA 5IIEA 3P73B 3VG9C 3RWCB 4L3EA 1U92B 2M1KA 5C0BB 5JZ7D 4JRXA 1Q72H 1BZ7B 5A16B 3NCFB 5EOCL 3TT3H 5JHDD 2ZUUA 3RVTC 2A6JB 2XTJE 1FGVL 1LHZA 2ZJSL 1KLUB 4DZBA 2AXGA 3U0TB 1CCZA 2J4WL 1U8MA 4LEOB 3VH8G 1FO0A 3ARDB 3A6BL 3GBML 3UYRL 4FQ2H 3SE4C 5IW3A 1I4FB 1U8NA 4PB0L 4Y4FC 3U1SL 5GGVL 2XQYK 1XCTB 4HWEL 1S9VA 2BVQA 3EFFB 4LP5A 4ODTL 5F9AC 1VPOH 1GZQA 2H3NB 4XMKH 1U2HA 4X6DA 3QUYB 2DL2A 2A6IA 2WP3T 3WL9B 4D0CA 5IKCB 2B1HH 4WJ5A 4UQ3B 1FL6A 4NQCB 5FKAA 3V4VL 4GG6F 3UJJH 3BQUA 1S7SB 3NH7L 1IGTB 3EYSH 2AQ1A 4G8GE 5I19H 3T8XB 1LE9B 3S37L 2D7OA 2LAGB 2WUBH 1KG0B 4ODBD 2D9QB 3ECBA 3O6FA 5ACZB 1ZHLB 25C8L 4NZRL 2W60A 5MEQB 1OAYH 3FZUD 1RUMH 4LCIH 3DTXA 5D70L 5E2WH 5ISZD 2HLFD 3VCLA 2IANE 2IF7A 3LN9A 1S9YA 4V1DE 2DQEL 3P2TA 2NY6C 3L5WA 4NRYA 1WT5C 4NHCL 4R97C 2HFTA 5FCSH 3M17B 4NP4H 3VFSA 2XZQH 2YUZA 1UWGL 1NGWB 3LRHA 4MMXC 4U1JA 3KVQA 3H9YA 2BVPB 4JO3H 5GJTH 4PTTB 4L8SB 1LO5A 5TDPB 1OAQL 3QUZA 3UTZB 3ROOA 4I8DA 5GS0D 1QQDA 1SBSH 5CINL 5D6DA 2CIIA 4KJYA 2ZKHH 5HHVH 2YPKB 3DX7A 3HC4H 5CUSL 3HI5L 1MHCA 4U1NA 3WS6C 3NZHL 4PLJC 4WHDA 5IR1A 1AXTH 5HYSG 3VFWA 4L4VD 4GUPA 5BMFH 3G9VA 2CKBL 3O2VL 2CIKA 2P45B 2HFGL 1UCTA 4JKLA 4ZFFB 4NKIL 3EO0A 3GMRA 5KZCB 4BQBA 5ERWB 4PG9B 4XNUH 1N8ZB 3Q6GL 4P3DA 4H1LH 2BZDA 3RIAK 1KC5L 1YEFL 2HT3C 4X99B 4R3SB 2MHAA 3DETD 4B5EA 2GJZA 1TPXB 3MRLB 1BFOA 3DURA 1MREH 4GFTB 1T0MB 4JEGB 1X5HA 4Y1AE 1JPTH 4HJ0C 3MJ9H 3C60D 3MGTB 3D39E 3QO0A 4M93B 4OQTH 5HVFB 12E8L 5KVFH 1C1EL 3L3GB 4TVPL 4XNMB 3VD3A 3WFEH 1BQHG 4X4ME 2V2TB 2ZUQC 3BPCA 1AGEB 4LLYB 4WFGE 3QEGH 4MAYA 4HIEB 4CRPA 4JDZA 1LDPL 4X6FB 4NQED 1NC2A 2APTA 4MCYA 2VH5L 3OJVC 4NO5B 1D7FA 3NIFE 2I9TB 1HQRA 3ARDD 1T1WA 4F8TA 3O9WC 4HUVA 5I1JL 1MQKL 2GCYB 5MEPB 1IAKB 3IJYB 4WEMB 5JOFA 3GSQB 3L3IB 2DQHL 3D85D 5JR1L 3IU4L 3VI3F 3HG1E 3WE6A 3THML 5E00B 2DKUA 5F70A 3IJSA 1UT9A 2XIDA 5C09D 1F3DJ 4TPRH 1OGAA 4ZO6A 4R90L 2PYEB 3C2AH 4XX1G 2A9MH 4P4KA 4X4YA 4ZFZB 1MCIA 3D1MC 3GJFA 2R1XA 2CLVA 5T5FH 4Y4KB 3VXTB 3DV6B 1JGUH 4XXDA 4DAGH 1CFSB 1UFUA 4OJFH 1DJSA 2OK0H 3WKNA 1IGML 5GGQH 1LO2L 1IEAB 2Y5TB 4ODSH 3QFJE 3OR7B 1MI5D 2HH0L 3GSUB 2WUCH 2CRZA 1SM3H 3C5JB 4LSQL 3MFFB 4EI5D 4W68A 3DHMA 3CLEL 3QXUA 1M7XA 4RX4D 4OLVH 5F88A 1TLKA 5JNYB 4FQCL 1XF3A 4NM4L 5AZEH 4LIQE 4JFQA 3P11L 1NBQA 5IGXH 3IFNH 1EMTH 1HXMB 1RIHH 3ZDXF 3CFBB 4OAWB 1KPVB 2AP2A 3QDMB 1FAIH 1WZ1H 4WFHD 1XF5B 2ZOKB 1NCBL 5C0DA 1NGZB 1T6VN 2K3TA 1CK0H 4HGWA 5GRUH 5DJYB 4LKXB 3BPOB 5SWZA 4YJZL 3SE9H 3GIVB 1A8JH 4BZ1L 1S7WB 4JPVL 2OP4H 1BVLB 5DC0A 3QAZB 2AJSH 1DQDL 1G7QB 3CAFA 4C83B 3U7WH 5H35A 3MLRL 3MO1A 1D6EA 3LVEA 3F12A 4PGEA 3QWQB 5A40E 5JLZB 1MCOH 2P8PB 5DWUL 3SO5A 1A5FH 4P59H 3W9EB 5LAXA 2FX8L 2CR3A 2K9UA 2V9TA 3K1DA 3ZE2E 4XB8A 1RJCA 5A43C 4GQPH 1JZ8A 2O61A 4U1GC 1NBYB 4JFDE 4HKZB 3MR9B 4OB5L 4KK6D 1JV5B 3ARSA 5DRWB 4JO2L 3B5GA 3V5DB 3LMJL 1ZANL 3QIUB 5GZND 3L7FA 4NN6C 5E56A 4JRYA 4P4RA 4D0BA 5MEOB 4NO2B 4FFVC 3D0LB 3S5LB 3GGWA 4WEBH 3T0AA 4AT6B 1TTFA 4LRNH 3BMWA 2ZUYA 5E8EB 4MA3B 3V6FB 5BOZG 4YO0A 3S3JA 1FO0H 1U3HA 2C5DC 2I24N 4OGYH 4CMMA 1W8OA 2GTZA 3IDNA 2Z0BA 3HZYA 5E08L 2VLLB 2BRQA 4OLZH 5I1DA 4ONFH 4Y16C 2MCPL 1CU4L 3ZZ1A 3QUML 3Q0HA 1XF1A 3CPLB 2DWEA 1OAXL 4FQ1L 4YDVA 5J1AB 1NAKH 4JJ5B 4OD2B 1TQCC 4RGMC 3T0EE 1I8KB 4F7CB 2BOCB 3HCVA 3V95A 5C08E 3W2DH 1MVUA 1M7DB 4PRHE 4I4WA 3SGKC 1BLNA 2JK5A 3ARUA 5AYUL 2X10A 3RY6A 1N59B 3RGHA 5L6YH 1NCDL 5EU4B 1A6UH 2X44D 4TQEL 5C0BE 5IB4A 4DVBB 4M6NH 4P2OD 1MCQA 3IYLW 3TBYB 2CRMA 2VDQH 1QHPA 1U8KB 3HE6B 1KCVL 3MREB 3RA7L 4KV5E 3QISA 4TOYL 4PY7B 3S4SG 1IGJA 43C9B 4X6EA 2W9EL 4WO4A 1G6RL 1D5ZA 4P9HH 3DBXA 4GRLB 1NFDA 3T08A 3ZE0E 3PV6A 4ZTPL 1YEJL 1FL3A 1A21A 3BRDA 3VXRD 2DBJA 4Y2DA 3BZDA 1KENH 5CAYB 3DMMB 5CGMA 1DE4B 3I3DA 2XN9A 4MD0A 3QDMD 1R3JA 4FTVA 5J12B 4JVUA 4LFHD 3T2OA 1Q94B 1IM9D 3S88L 1X5GA 4M6AA 1NGQH 4R96B 4NQCE 5EFIA 4U6VL 4HWUA 4MD5B 5CEXA 2VMFA 2YXFA 5B4MC 4CVZB 3ULVH 1EV2E 3T1FA 4M7LH 1LO4H 2DI7A 3P0GB 3QULA 3RZCC 1QO3B 5F93C 4KI5F 4K07A 4ZUTB 1ZGLA 2O5ZH 3D0VB 4BH7A 1HYSC 2A74A 1FSKC 1KN2H 3SGDH 1PG7W 3RUGA 4XPFH 5DDHB 2NTFA 4YE4L 2CXGA 1Z3GH 4AQOA 2WK2A 4NO0B 2WANA 1P7QA 1A1MA 2PCPA 3MRMA 4ZFOA 4WU5A 2IBBA 3JVGA 1BOGB 3ARBC 4FQPA 1S9WB 1AE6L 1RUQL 1CG9B 2PTTA 4L9LC 4X6BA 1AP2B 1OTSD 3H9SA 2APWA 1JF5A 4HS8L 4XNZC 5EIVA 3FCTB 3QIUD 1JRHI 1KIPA 4RFOL 3RY5A 5D1ZC 5DEFA 1YEEL 1QR1B 2IJ0C 4MNGB 2F19H 1N5YH 2NX5B 4HD9A 2YKLH 2C1OB 3S34H 1YNLL 3HMWH 3V4PH 1NFDF 2XFXB 4UILH 1A14L 3JV6A 5DD6B 5HI4D 3P4MA 2YA1A 1SY6H 2VXQH 3UPAA 2N4IA 5KAQG 4RQQB 4GLRH 1YPZA 2ZSWB 1WC7B 1PW3A 3SDCB 3PIQB 1Y18B 4XAWH 5C3TA 3KPNB 4KRPB 1C5DA 4XHJD 1IM3A 1AI1H 5DHYA 3GMQB 5DS8A 3WUWB 2Q6WB 4AEIL 1S9XA 1P4LA 4GG6B 3O45B 4WWKD 1TETL 2P5ED 4ZPVA 1FVEA 1NFIB 2X4SB 4Q9QH 5L2JA 3PQYB 2UZIL 5CEYB 3RVVD 4H0GA 5HHPB 2GI7A 1EUUA 3SPVA 1AXSB 4JAMA 3Q3GB 1A6ZA 4XPHL 3RUGF 1TZGH 2VQUA 3VFVB 5GRVK 3IXTB 1GC1L 3SQOH 2DYPA 3VXSE 2DTSA 3AU1A 1MAKA 4U2ZA 3DX6A 4ODXA 1TZIB 1QPPA 2I60L 4G3YH 4X0KA 3ZKXB 5EU7C 3OKNA 5EC2A 3T3PE 2ZCKL 4O2FA 3KG5A 5IIEB 3AM8A 1CXFA 4AEHH 4L3EB 4ALAL 4JRXB 4F7TA 3LDBB 3TBTA 4F33A 1VFUA 1NEZA 2WQ8A 2Y06H 1UZ8A 3TJEH 3CFDA 3MRBA 5CJ8A 4WTZG 4HG4K 4DZBB 3MLXL 5I1AA 3MOBL 5AZ2H 2FR4A 1FO0B 2LFGA 5CGTA 5KSUA 4E42A 1ZAGA 3GKWL 3NTCH 1U8NB 2PYEE 5FFLA 4XP4H 1CFTA 1S9VB 4HQQL 2A2QT 1V3LA 1YPZF 1TIUA 4MNQE 1GGBH 1GZQB 1MOEA 2X1XR 3O8XB 4D0CB 1FL6B 2X41A 1XGQA 2PNDA 3BQUB 4B0MM 4NO3A 2VDNL 5ILTH 3EOBA 5DRXA 3ME0A 3ZKNC 3I50L 4NO0D 3ECBB 3O6FB 2IBZX 3HAEH 4JPIB 1A6TA 2W60B 1WBYA 5JW4Q 3DTXB 4B7LA 4YAQA 3VCLB 4UTBL 3UBXG 1C12A 1JF1A 4LHUG 1NDGA 4LIQL 1S9YB 4NUGL 5HDOA 2H2PD 1A7OL 4YBHA 1PFCA 1G7LA 5ALBH 4NRYB 2QQKL 1PBYA 2C3GA 3UC0H 1U0QA 4ZO9A 3UTPE 4NM8L 3CUPB 2DQTL 4JG0H 5EU6D 2NX5D 2UUDH 2VDLH 3VFSB 3MXVH 4XI5D 5LG1A 1T20A 4PGDA 5HDQL 4U1JB 3IDYC 4AIXA 4L4TA 4G6KH 1CF8L 3QUZB 4QRUA 3ROOB 3NA4A 4NKQB 4GKNB 1QRNA 1A7QL 1TJIL 4PJBA 1NMBL 1LEKA 1QQDB 1G9ML 1UC6A 5DMGC 2NY3C 1I75A 2P43B 2CIIB 4KJYB 5D1QA 3UTQA 2PYFA 3DX7B 5JMRA 4H20H 3HC0A 2QEJA 4LNVA 3W0WE 1P9MA 1MHCB 4U1NB 5GGSA 1KLGA 4LCCB 2EE2A 5E4EC 2W0FA 3VFWB 4XC3L 1L7TH 3O41A 4GUPB 4JHZA 4J3TA 3PQYD 3BKYH 3MLVL 4YHLH 2CIKB 4ZS7L 1IAMA 3EO0B 5K33A 3GMRB 4IEFB 3KJ4C 1K85A 2MPAH 4NFDA 1T7ZA 1DLHA 4P3DB 2VZSA 4M7LT 4WVRA 4M6OH 1X6LA 2DLIA 2OQJA 3ZKMD 5F6IC 2MHAB 4N9GA 1EJOH 4C55A 1FNSL 2GJZB 4NWUL 4I3RL 5DUPL 4K71B 1A3RH 1BFOB 3LKRA 3DURB 2K7QA 5J57B 1MY7A 1F4XL 2VXVH 2DLFH 1MCPH 3QO0B 3PGFL 2ADJA 4WI5A 5C1MB 2ZUSA 1TQBC 3BPCB 3IJHA 4HS3A 1I1AC 1RHFA 1DL7H 4MAYB 4LBEA 5DD0H 3GRWA 4JDZB 5F7HA 5KTEL 4L8DA 4MCYB 2GJ6A 1B2WL 4PUBH 3RKPA 1WAAF 4E41E 2ICES 1TTUA 1HQRB 2E7MA 1T1WB 1G0YR 4IJ3C 4XPBL 4XB7A 5D1XB 4FQQA 4HUVB 3IS0X 1KIUA 1RIUH 1E4XI 5AD0B 4ZFGH 2Z31B 1T04A 2QJDA 4LLDA 4ZAKA 1NL0L 1I7UA 4PJBF 4AG4H 4NKDB 4QRTA 4JZNA 2VC2L 1KCSL 4D9QE 3WE6B 5C2BH 3O8XD 3E6HA 4BK4A 4NNPH 1IAIH 3IJSB 4I0PC 3RWGA 2NY7L 3ILQC 1MFAH 1YQ2A 3FN0H 2XTJC 4ZG1A 1OGAB 4TNVF 4R9HA 4JRWA 3AVEA 4BFIA 5I71C 4J3OC 4P4KB 5CJQL 3FOLB 4LPXA 4NC1E 4X4YB 3PL6D 3GJFB 5E8DL 2CLVB 1MFBH 2COQA 4KJQD 2VO5A 1PKQA 5IG7A 1T0NA 5TE6L 2ADFL 2ZWLT 4XXDB 2LVEA 2ZUXA 2OYPA 2B5IB 2MWCA 3DYOA 4HUXA 1GOGA 4Y5XC 4U3XA 2J1KA 2MQ0A 2WNGA 4W4OA 3QIWA 2J3SA 3DO7A 3H3KA 4DKFH 3TC9A 3TIEA 2YD9A 1NPUA 4KMTL 3UZQA 1A9BA 3LKQB 5CWSA 2PR4H 5F7UA 3F5WA 5CBEA 3JBG7 3GSNA 3NCCB 4NC2B 4HXAL 5F88B 1IBGL 4O9HL 5D6CA 1UEYA 3RIFK 1FVDA 1QSFA 3PDDA 4JFQB 4AYFA 2XQBH 3W81A 3LPGA 3MX0A 1A7RL 1CXLA 1MQ8A 1UM5H 2BVOA 4Z9KB 2H1PL 5C0DB 1BD2A 2FIRT 5IB5A 4HGWB 4CKVX 1ZVHA 1Q9OA 3MLSH 4YBLC 5SWZB 1TVBA 5BZDB 1JNHA 5FHBL 3E3QE 1Z2KA 1QLEL 1A47A 1G7JA 1Q8MA 4FQHA 3F8UB 1HHJA 1NSNL 4O00A 4G43A 3T04D 1YEHL 4OCSL 5EDXA 3WNNA 5I1IH 3U9UA 3K2MC 2JB5H 5CP7A 3C09C 2ATKA 2CRIA 2DLHA 3BDYL 3F12B 4PGEB 3CGTA 4PS4H 3ROLA 4OQ1A 3UDWC 1F3JA 43CAA 4EN3C 5TH2A 3KYAA 3GMOB 1WITA 2O61B 4RWYL 1FZJA 4UT7H 4TNWF 1MHEB 5FO8A 4X83A 4JRYB 1N2RA 3TH2T 1LNUA 4D0BB 4HWBA 4RDQF 5IBLC 1QSZA 5IM7A 3O3BB 1QBML 4QOKD 4OD1L 4G6JL 5HYJA 4YO0B 5D1XD 4JANA 1U3HB 5I8OL 1DBKH 2Z31D 3DGCR 4IRJC 1A6WL 4LLUA 1OT1A 1J1OH 4CMMB 4WW2C 3VMOA 3IDNB 5DUMH 4DGVH 2ZUVA 3HZYB 3Q48A 5F7FA 3O6KH 3KPSD 1BAFH 4P23C 5E2UL 3QUKA 4YHKL 1UM4L 4KI1A 2DWEB 4YDVB 2GHWB 5EO1A 5GRWA 2GW5A 5L88H 1GC1C 4H8WL 5FM4A 5GSRB 3O11A 4KAQL 3U30C 1XIWB 4JHWH 3HCVB 2WMPA 4KKCC 1FH5H 4HIXH 4I4WB 3HMXH 5FOBA 1OTTC 1V3MA 3VD5A 1BLNB 2JK5B 2FEEL 2GY5A 5FYLH 1K8DA 2R0ZH 4L3EE 3GKZA 1QRKA 3QHTC 5GS1A 3EGSA 1K3IA 2AEWA 3JSSA 2IH1A 5IB4B 5DGRA 1IFHH 4JRXE 2D7TL 1O5DT 2QHRH 2ZCLL 2CR6A 2EIBA 2QQNL 2YD2A 4ETQA 1V5JA 2DM3A 5AEAA 1A7NH 2JJTA 4ZUSA 1IGJB 4PJ9A 1MWAB 3T09A 4X6EB 1RIVH 3VWJC 1D5ZB 3DBXB 1HXYA 1NFDB 2GTWA 3FFDA 1U9KA 4OBRA 3WDIA 1T5WA 3PV6B 3ZSSA 1MFDH 2QLVB 3VRLF 1FL3B 2R15A 2YD8A 2V7NB 3T0DA 1MIML 3CFCH 4JO4L 3F58H 2V5SA 2J12B 4Y5VC 5H37G 2XN9B 4MD0B 4FTVB 1R3JB 1YMMB 4X6DE 4GMSH 3N85L 5BV7H 5GIRB 2ZP0T 5CEXB 4Z95H 4NRZA 2IQ9H 4OZFA 4BJLA 1NCTA 2Y07H 5A3IC 2ICWJ 5C07D 2GFBA 3LQMA 3QULB 3SN6N 3MZGB 4Z6AT 4K3JL 3VXUD 1YNKH 3BPLC 2WBJD 5BXFA 3TT3L 2EC9T 3FT4A 1PLGL 1HKFA 5FKPB 3CMGA 2A74B 1OOAA 1AY1H 5IBTH 3T65B 1S7TA 3RUGB 3QDGD 4M7JH 1WQVT 2NTFB 1AGDB 1AGFA 4OF0A 1WLHA 5HI3C 1P7QB 4QRRB 1A1MB 3I2CL 2PCPB 3MRMB 4ZFOB 4WU5B 1WFTA 4LCUA 4XC1L 4FQ2L 5C0NC 4CUCA 2VN7A 1RUAH 1X5YA 2NLJA 3E0GA 3QRGL 2PTTB 4PJ5D 1VPOL 3T0WA 4XMKL 2APVA 4NIKB 3ZTJH 4KROB 1S7VA 3KWWA 2YUVA 1KIPB 4LVOB 1U6AH 2HLFC 5LGKA 1QSVA 4RBPK 5DEFB 3EYSL 2Y1VA 3BISA 5I19L 1KGCE 1G9MC 2EC8A 3VI3E 1GPOH 2WUBL 2HVJA 1I9JL 5BRZB 5BOPA 1VFAA 3V0AC 3TNNA 1U3HD 4MNHA 1OAYL 3JV6B 1RUML 2R2CA 3D18A 5E2WL 4Q6IA 4IOFC 3HNSH 4KQ3H 1YPZB 4KI5D 5GXBB 1C5DB 1IM3B 3OPZH 5DHYB 5DS8B 3RNKA 2KQMA 3V6ZA 1P4LB 4YDJA 3QJHA 3BAEH 1YNTB 5JO5A 3RIAF 2VE6A 4NP4L 4ZPVB 3P40A 1FVEB 1PEZA 5IJKA 3TA3D 1B4JH 2XZQL 1XIWD 5L2JB 1ND0A 2BERA 2W07A 3MUHL 4W81A 5HGDA 4JO3L 4TTDC 5DJ0A 4PLNC 3RX8A 1NQBA 4RMUA 4HUWA 1OQXA 3SPVB 4JAMB 4PP2A 4PREA 1IGYA 3BJLA 4PJAA 5DK0A 2BSTA 2EDKA 2YBRA 3RY4A 1FNEA 2VOTA 4YXKH 5KBNC 2DYPB 3ARFA 4HLZH 3AU1B 2GUOA 4MCZA 2V5YA 2XICA 2PXYA 5JXEA 3DX6B 3H3PL 4ODXB 1KEGH 1VEPA 2ZKHL 4M7ZC 1HK6A 4X0KB 4P3WA 3G5VB 4N5ED 1ZT4A 3ZDXE 5J1SC 4W4NA 3OKNB 5EC2B 4LSSH 1ZLUH 1ZEAH 1AXTL 5B38G 3F62A 4O2FB 5KSVA 3T0EC 2E9IA 5BMFL 4OCRL 5IHUH 1T83A 4XCCH 2B8OT 2BOBB 4F7TB 4F33B 3TBTB 1TCRA 3ARGD 1UXWA 5IBUB 2E7LC 1NEZB 1OT2A 4TYUA 3DNKA 3CFDB 2UZXB 3GFUA 1UJ3A 3MRDA 2XN9D 4XNUL 3MRBB 1YMMD 3LS4H 3MFGB 4OGAD 4ZQKA 5I1AB 4FQLH 2FR4B 1WIUA 4GXVL 3TYGL 5KSUB 4E42B 3DUUA 1OGAE 1MREL 5EORH 4FNLH 4OF7A 1JPTL 3MJ9L 4FFZL 2B39A 4N8CL 4OQTL 2X4PA 2YSSA 5KVFL 3ARDC 5HHME 1RZFH 3WFEL 1G9EA 2NW3A 1XGQB 2BVUA 2AV7A 3QQNA 1XAUA 2A0LD 3QEGL 4NO3B 3EOBB 4Y4HA 5DRXB 3NCBB 3QUYC 3NFNA 2IMMA 4UIMA 2XKNA 4QRRD 2AABH 1WBYB 3MODH 4RZCA 5I8KH 3QXTA 3FFCD 1P6AB 4YAQB 2G60H 2FJGA 1C12B 1JF1B 1NDGB 4JQVC 3LS5H 2P46B 4PJAF 4PJXA 3EO1A 2JJVA 3DI3B 4DK3A 1FJ1A 4KROD 5EBLA 4Z7WA 2WZPD 4M43H 3VDAA 5CGYC 4F7EA 2XXMB 4M3KB 4O2EA 1I9IH 4KDTA 4TPRL 5DRZA 5BRZD 1T20B 3C2AL 4CADA 2Y25A 4PGDB 3IDIA 2A9ML 4EI6A 4L5FH 2XOTA 4L4TB 3NA9H 2ZCHH 4HKXA 3LEXA 4XNQA 5DVNA 3GIZL 1NCCH 3HI1A 5T5FL 4QRUB 5SWZE 1WEJH 1JGUL 3QCTH 3HE7D 2VISA 1QRNB 4OJFL 2OK0L 4PJBB 1KIRB 1LEKB 5GGQL 1HIMH 1CD0A 4L8SC 4S1QL 5IVXA 5D1QB 1NCAH 4IOSD 2PYFB 3UTQB 4H25A 2WUCL 3QDHA 4PD4J 4XBEH 5JOPD 2OXHA 2MSPA 3HC0B 1SM3L 2BHYA 4KKAC 5FGCB 1KLGB 1M4KA 2P1YA 1H15A 1G9NH 2W0FB 5JMOC 3HPJA 3VGGA 3FN3A 4OLVL 4P2RB 1S5HA 3MPCA 2F74A 5AZEL 3B9KD 4XWGH 3BE1H 3IFNL 1EMTL 2FEDC 1DLHB 3PWLA 4APQA 1RIHL 3ARED 4PTUA 4RWHA 2BNQA 2V9RA 1WZ1L 1YYML 2OQJB 4QGYA 1JGVL 4N9GB 3EJZD 3RDTA 4JRYE 4MJID 3BGAA 1CN4A 3LKRB 1OL0A 4GXUN 1CK0L 5E2VH 1ZMYA 4JFED 1Q0YH 4PJXF 3SDDA 2DQJH 1FYTD 4GKSA 3SE9L 2ADJB 5BVPH 2KPNA 5D8JL 4Z7WF 1RAMA 4MD4B 3IJHB 2AJSL 4HS3B 5FV2A 1OAKH 4M93C 4LBEB 5F9OH 4HHAA 3U7WL 4WI8A 1AHWA 1U91A 4L8DB 2GJ6B 1JGDA 4KK6C 3GMMA 2VRAA 5DVLA 1MCOL 4ESKA 1A5FL 4P59L 4UMGA 1L6XA 2CD0A 1T04B 4RMRA 4LLDB 4ZAKB 1I7UB 2V17L 3I9GL 4QHMA 2CJUH 4Y2OA 3TN0D 4JZNB 4KJWD 3FQXA 5AYQA 2EZ0D 3E6HB 3RWGB 3QI9D 4NDMA 1P4IL 3GEWB 1PSKH 2P24A 4UB0H 1Z5LA 3BPNB 2FL5A 4BFIB 2X1WL 3LN4A 4JB9H 4LRNL 5HVHB 1P5VA 3C08H 4GBXC 4NBXB 4AEEA 1FO0L 3WIHA 3UAJD 5T5NG 1RUPH 1DCLA 1PKQB 5IG7B 1T0NB 3HZKA 3NIGF 1HH6A 3PWNA 4OGYL 4WI3A 4GH7B 4CDHA 4HZLA 1NCWH 1ORSA 2AJ3A 1UXSA 4HUXB 3QIWB 4Y4KC 1DQTA 3TIEB 4OLZL 3G5ZA 1H3GA 5CWSB 2EDBA 2B0SH 2XN9E 4FTVE 2RHEA 4XMPH 5CBEB 4B41A 3GSNB 4OFYD 1NAKL 1U93B 1SEBA 3HNTL 3ORJA 5DO2D 1YA5A 4JLRA 5D6CB 3RPIA 3W2DL 4HPYH 2NY5C 5CD5C 1QFHA 1G0DA 1QSFB 2JJSC 1MCLA 1BQLH 2GSGA 5L6YL 1OQOA 5CIPH 4PJCA 4TN9A 1A6UL 1QSEA 3TPUA 1SJEA 1U8HA 3WN5A 5K9OA 1YEIH 2BVOB 4M6NL 3MRHA 4MB5A 3RWDA 4OCXH 2VDQL 5IB5B 1I7RA 4POZD 5GSVA 5F8QC 3RUGE 2VDMH 3MROA 1Q9OB 1TVBB 1TTGA 2M26A 1JNHB 1CYGA 3UJIH 3DYPA 1G7JB 3LKSA 2DQGL 3U4EA 4PP1D 4FQHB 5ITFA 4P2RD 4P9HL 1HHJB 4OCWH 4OKVA 4G43B 3G08A 4I13B 3BPOC 4KPHH 4MXQD 3U9UB 1INQA 3EHBD 2WIIA 1IKFH 3B2UD 4J4PA 5CP7B 4Z0BH 5JDSA 5L8LB 3H9SE 2ATKB 1F4AA 3QAZC 1NGQL 3EBAA 5LGJA 4WIQA 4R2GB 3D2UA 2A6DA 1VGEH 4JFPA 4PGBA 5DHVA 3ROLB 1F3JB 3UBXI 43CAB 3LQAC 5TH2B 3IXAB 2GSIA 1ZHKA 2P8MA 3F7QA 4LOUC 1LO4L 2EH7H 3VFUA 2HJKA 1FZJB 3IB4A 4Z78A 5KN5A 4DKEH 4P2CG 3MLZL 4KKLD 2O5ZL 3AGVA 3QDJA 5FO8B 1N2RB 4U31A 1LNUB 1NCUA 5CZXD 4PV9A 5EO9B 1ZTXL 3KPPA 4U05A 1XF4A 4XPFL 1EPFA 3WJLA 4BZ2L 3QIUC 4PJIA 5DZLA 1Z3GL 5HYJB 3BD4A 4JANB 2ARJA 2CMRL 1BJ1H 1T21A 1J1XL 3S8WA 4LLUB 4MX7A 1XGYL 2HYMA 2A83A 3TF7C 4PJCF 1VERA 1FNHA 1NUGA 5MP6L 4R4FH 5HI4C 1MLBB 3QUKB 3HNVH 2V2XA 1DP0A 1CIUA 3EDDA 3BGMA 5EO1B 2F19L 3S5LG 2N1KA 3O11B 2YKLL 3HMWL 3BRFA 3V4PL 1WWAX 2HTLD 1KB5B 2AEPL 2X40A 4UILL 5I8CA 4NFCA 1SY6L 4NQVA 2XWJA 1K8DB 3BEVA 2D7PA 1MRDH 3EGSB 5GS1B 2IH1B 4XCYB 4N90E 3QIWD 4XAWL 3O2WH 3UP1A 3LZFH 1OAZH 3AAZA 4YNYA 3RTQB 8FABA 3CFKA 1AI1L 2BSRA 1Z6JT 2Q1EA 2R23A 4G6MH 4N68A 4ETQB 1ACYH 4XVUC 4JN2A 4ZUSB 5DD1H 3LH2H 1BFVL 1KXQE 5ADPL 3VXQA 2JE8A 1UB6A 4NC1C 3ZYOA 3HE6C 1HXYB 2GTWB 2VDPH 1FORH 3FFDB 1T5WB 4NQSA 1T7YA 5ITBH 4MQXC 2ARJQ 4O02H 4PRIA 4HT1H 4WW1A 1TZGL 3QBTB 5IJVB 3R0NA 4GRLC 5IROA 3HR6A 4F3FA 4F7MA 5C8JA 4QHUA 3SQOL 4PJIF 1SEQH 2HN7A 3FMGH 3L3HA 2A77H 4HJJL 5F1KC 1XR9B 3T4YA 3TJHD 4D94A 1CXKA 3DRTA 5SX4I 4OZFB 3DMMC 5T3XD 4G3YL 1IEBA 4PRAA 1KACB 5J12C 1SYVA 1WUNT 3TV3L 1GZPA 2VZ1A 2GFBB 4AEHL 2WSKA 5LWYH 3QHZL 2PW1A 3I6LE 5BXFB 1H3WM 3GK8H 5FYLE 2JELH 1A0QH 3FT4B 1A6AA 2VXTH 3MC0A 2Y06L 4G8EB 3VU2A 3TJEL 1EFXA 1S7TB 2YRPA 3LQZA 1A7PH 2HAZA 1AGFB 1JPSH 1HI6B 4BFBD 4I0KA 5AZ2L 5I9QB 2B7DT 5D2NB 1KUMA 3HFML 3M8OH 4LCUB 5I6XB 1W0YT 4J3UA 2IG2H 4HULB 3UTSD 3NTCL 3VRJA 4HF5H 4HS6A 2Y6SC 2B2XL 2NLJB 5TDNA 2IH3B 5DURB 4MWFA 5L8JB 4L4TE 3AS1A 3MV01 3WNKA 3KWWB 1VFOA 1O0VA 4I9WE 4OI7A 1QRNE 4PJBE 1OWWA 5EZJB 3W39A 2HVJB 3LD8B 5JW4N 5J13B 1VFAB 3QIBA 1JFQH 5HYJD 2EXYC 2R1YA 4G9FD 3TNNB 2ZG3A 4MNHB 1DBBL 5FGCE 3D18B 2XZZA 4Q6IB 1T3FA 1MJJA 2X4NA 2VLKA 2BNUA 5D96B 3RVUD 1T89A 5GRJH 5ALBL 4YPGA 2IFGA 4MS8D 3RNKB 3V6ZB 3CH1A 4YDJB 3UC0L 2HP4A 3RVWC 4QLRA 2C4FT 4HFWA 5JO5B 2VE6B 3SDCC 4JG0L 2VDLL 2OJZH 4RAUA 4KRPC 4ZOBA 3UTTA 1ND0B 3C5SA 4ZUWA 1DVFA 3VXPA 3WIHH 2OR8A 1S5IH 5DJ0B 1J0KA 2JJUA 3LB6D 2CKBA 4HUWB 4PP2B 3OV6A 1MEXH 4PREB 1IGYB 4X6CA 4PJAB 5DK0B 2BSTB 2YBRB 3NN8A 1FNEB 4UT9L 2GUOB 2EC9U 4MCZB 4C4KT 2PXYB 1F90H 5EC1A 3RTQD 4WGVB 4XCNA 3AS2A 3B5HA 4H20L 4MVBD 3FRUA 1ZT4B 5FYJD 4YBQD 2BP3A 3R4DA 2GJ6E 4EQ3A 2JJWA 4RMQA 5ABDE 5KSVB 1L7TL 4IMKC 3WKMH 2GJJA 2IPUG 5DUBA 4YHLL 1AO7D 3FO0H 1TCRB 3ZKXC 1UXWB 2NQCA 1W0WB 3S36X 4L1HA 2MPAL 1UJ3B 3FQNB 3MRDB 3IDGA 4M6OL 4WTZA 3KHOA 5F89A 4HKBA 4ZQKB 4LLMA 3DWTA 4J6RH 3FAXA 2F9BT 5L2KD 1CFVH 3DUUB 2VZOA 3KXFD 3MBED 2XV6B 1Q1JL 1XR8B 2ARWA 1MCPL 1M6OA 2DLFL 2NYYC 4J3XA 2W92A 3DXAA 2IQAB 4P46D 2X4PB 2YSSB 3VXNA 1M05A 1AQDA 2Z35A 4JKPH 4K8RC 1PKQE 2AK1L 4FA8A 2NW3B 2AV7B 3OTTA 4UINH 3MRFA 3RHWK 3EDFA 4JVWA 4MA7L 4Y4HB 5DD0L 1ORQA 5H94A 4PUBL 4UIMB 1UEMA 4TUJB 2P5WA 5DHVH 4RZCB 1F8TH 3BQUC 3L5XL 4DVRH 3WUZA 1RIUL 1VFBA 1EXUA 2GT9B 3FOMA 4ZFGL 5C0IA 4P9MH 5E1HB 3MRIA 3QP3A 4X6CF 4AH2A 4PJXB 2OMBA 3EO1B 3O6FC 1KIQB 4AG4L 4HIJA 4M1DH 1FJ1B 4CVWA 3RIFF 2NXYB 5EBLB 1YC8A 5SX5H 1QSFE 4Z7WB 4NNPL 1REIA 4O2EB 3AC0A 4U1HA 1MCCA 3FN0L 4HK0B 1YN7A 4LDOB 3I02A 4QXGL 3QT2A 2Q76A 4R4BA 2V6HA 4HUUA 3IDIB 1BD2E 4HKXB 3LEXB 4XNQB 4ZFOL 1MFBL 3P9LA 3ETBF 4BM7A 3GI9L 1U3ZA 5E9DD 1Z9LA 2VISB 3JUZA 4Z8FH 4GG8A 4P9HC 5IB2A 3EJJX 4C58B 2LE9A 4O58H 3QUZC 4H25B 5F6HI 4DKFL 1IZKA 3TZVA 4PJ8D 1JN6A 5EB9A 3IAPA 3MUZ1 2PR4L 3BO8A 2EXWD 1BBDH 1H15B 3KDMB 2X42A 3RRQA 5D6DC 3HPJB 4KZDH 2OTPA 5C0GA 3G6JA 1S5HB 4R4NC 4CN6A 2F74B 2OL3A 3STLA 4EUPH 2XQBL 1W8NA 4APQB 4PTUB 2BNQB 1R3HA 3WFCH 3C87A 1UM5L 5EZIH 1MELA 2ED9A 1E28A 3ARVA 3RDTB 3LN5B 1T80A 4A6YA 1EFQA 1D9KD 5T1KD 3R1GL 1Z9MA 3SDDB 2QQQA 4GKSB 3MUGA 2JF1A 2FO1A 4LGPB 4N0UA 4POUB 4X98B 4K71C 4KK8C 1F4HA 1JPST 2YZ1A 1WIOA 1JHKL 5I1IL 1S78C 5L7XL 4HHAB 1IQDB 3U9PH 1AHWB 1U91B 2XPGA 1VFMA 1EERB 1KJ2H 1JGDB 2EIDA 1BM3H 4OM1H 3GMMB 4G6FD 4PS4L 2F8OA 3WFBH 3NFPA 4WV1A 1JZ4A 1T22A 4WY7L 5BW7A 4HWNA 4MAYC 1QR4A 5CCKH 2XYCA 3BVNA 4QHMB 5KOVC 4Z7UA 5IESH 4R26H 3FQXB 3RVTD 1CE1L 4UT7L 1KB9K 3IAGC 5E6IA 1V3KA 3RWFA 3SCMA 1K4CA 4Q6YA 4Y7MA 4UNUA 1KF9B 4NDMB 4S1SL 4S2SA 3EFDH 4Y4HD 4ONGH 2FL5B 3LN4B 3P4LA 4IDJH 3ILPA 2PO6A 4Y4FD 2EDEA 3G6JF 3PP3H 4YFDB 4MZ2A 1DBKL 3LOWA 2H45A 3HZKB 4WI9A 1HH6B 3PWNB 4YHOH 4P4KC 3FQRA 3X12A 2AJ3B 1UXSB 3BDXA 4V2BA 5DUML 4DGVL 4TSAH 5E1AA 1BAFL 1R5VA 1TITA 1I1CA 1YQVH 5JIPA 3MUY1 3G5ZB 1P1ZA 1KV3A 2B5IC 3QPQC 5L88L 2BCKA 2DQIH 3T0BA 4NCC1 1SEBB 4JLRB 3RPIB 1UJTA 3DVFA 5C9JB 4HIXL 3HMXL 3MV8D 4QNPF 4D0DA 2NY6D 5FYLL 1EA9C 1YEKH 1MFCH 2GSGB 2BVTA 3ZKSD 2R0ZL 3UXFA 3QDAA 4PJCB 1QSEB 3TPUB 1SJEB 1U8HB 3DECA 3WN5B 1VA9A 2RFXA 5K9OB 2RAMA 4LEXL 3MRHB 4G8GA 5T3ZD 3PABA 3ULUF 3JTSA 1CWVA 1MCHA 5TGBA 1I7RB 3LV3A 1OW0A 2IPUK 5GSVB 3MROB 5C0AA 5GGSY 1A7NL 4Z7UF 1ZT7A 3LKSB 3U4EB 5ITFB 1RIVL 5EIQA 3GHBH 4HW6A 4RIRA 5E03A 4V1DA 3G08B 4LLVB 2FB4L 3W11C 1MFDL 4RMWA 1INQB 2ERJB 2WIIB 3CFCL 5JDSB 3F58L 1X5AA 1ZXQA 3QXDA 4GMSL 4YEFA 1P84J 4PLJD 4BSWA 1ZLWK 2A6DB 4PGBB 4JFPB 1J11A 2R2HA 3MBXL 4Z95L 3IVKA 2IQ9L 4KQ4H 2GSIB 1ZHKB 2P8MB 1IC5H 3WFZA 1RURH 1P2CA 2Y07L 1HHGB 1JWUA 4P99A 3VFUB 4Q9CA 2HJKB 3B8SA 3BKMH 3TIDA 1GGYA 3HS0A 3OGCA 1YNKL 3QDJB 2HT3D 5JQHC 4PV9B 3KPPB 2B20A 5IBTL 1XF4B 3FRPA 4F57H 4F58H 1JYXA 1GHFH 3KPLA 1KTDA 4M7JL 3BH8A 5C0CD 4PJIB 1UWEH 2BXYA 2ARJB 4HJ0D 4NKMA 1FP5A 3HAEG 5GISH 1T21B 4K55A 1E4KA 4MX7B 2K7PA 1WWCA 4KC3B 2A83B 3V7MA 4DUWA 3PWJA 4KGLA 4GAJL 5IWLA 2YC1A 1U3HC 1S7QB 2P8LA 1F02I 4XNYL 4B53A 2V2XB 1RZKH 2VTFA 2VR4A 3ZLQC 4PJAE 3BGMB 1TJGH 3GRWL 3O9WD 3STZA 4O4YH 1GPOL 3ZYJA 3T2NL 4MHHG 4KK9D 3ZDZE 4YWGH 4NZDA 3GBNH 3SE8H 4G5ZH 4NQVB 5HYIA 1NAMH 5F7WC 2XWJB 3BEVB 3K81A 1HSBA 4UQ2A 3ELAT 3HNSL 2NMSA 1A3QA 4XBPA 3OXRA 3ET9F 3AAZB 8FABB 1CQYA 3RY6C 1DQLH 2DICA 4JY5H 1J8HA 2R23B 3DIFB 5D7JA 4KRLB 3PV7A 4JN2B 5AUMA 1B4JL 4ONOA 1FG9C 1T4KA 3VXQB 5F44A 4QRPD 5EBGA 1UB6B 4L1DA 2Q8BH 3ZE1F 3WSQH 1T0PB 1OP3H 3SKOA 4EQ2A 2Q20A 3S7GA 4LLAA 4CAGA 2X4QA 3I75A 4PRIB 4WW1B 3KPRE 5AWNH 4WO4C 3SJVD 3LHPH 4F3FB 1CLYH 1M71A 2QQLH 4F7MB 5C8JB 5M7QA 4QHUB 5CJXA 4YXKL 4ZTOH 2HN7B 3L3HB 3GO1H 3T4YB 1N26A 1KEGL 3HHRB 1BECA 3DRTB 4Y2DC 5I66B 1DN2A 1IEBB 4PRAB 4POYA 4PJEA 4ERSH 3PGDA 1GZPB 4LSSL 1ZEAL 3GSNL 5DR5H 5IHUL 1Q0XH 3DV4A 5T33H 4XCCL 5BZWB 3FB5A 4P2QA 4IHOA 2PW1B 3WLBA 1OGTA 1A6AB 1D5IL 4LSRH 4PJXE 3QFJA 3CFEA 3V6OA 1EFXB 4J4PD 5CSBA 1MCWM 4ZNCD 2HKHL 4Z7WE 4ZXBA 3VXMA 1DBMH 2BFVH 2R0WH 4FQLL 2NY4B 5IEKA 1INEH 1U41A 4QXUH 3RZCB 4TRPH 2J2ZA 3MNVB 3JWOC 5I16A 4I3GA 3VRJB 4HS6B 4FNLL 1SBBA 3BJ91 5TDNB 3RJDA 3B83A 4WHCA 4U6TA 4MWFB 2DWDA 7FABL 3MXWH 4CJ0A 1UCBH 1RZFL 3IFPA 3PWPA 3JVGC 5TF1H 3QJFA 4S1RH 1RZJC 3HI6H 3OR6B 3W39B 1JZ5A 1JIBA 2YA0A 3C8KA 4DTGH 3QIBB 5IVXE 2KDGA 3ULUH 3KYKH 2R1YB 4AL8H 3MODL 1AD9A 5D5MA 5I8KL 1VGKA 1T3FB 4XNZB 2X4NB 5DSCB 2VLKB 3LS5L 4C59B 5FYKD 2BNUB 4GJTB 4X8XA 3SDAA 5KVMC 5I18L 3SKMA 3I85A 4FFVD 1HHHA 4YPGB 3NMEA 4M43L 1H3PL 4NFBA 5DFTA 2EDHA 3CH1B 3NIGE 1LO0H 1T1YA 4HWBL 4PJEF 4ZS6C 4Q97A 1I9IL 2IEPA 4HFWB 5IT2H 5ID1A 2BNQE 2W0KA 4RAUB 1QZ1A 5CKGA 1B3JA 4F37K 5B3JF 3UTTB 1XGUA 4JPWH 4ZUWB 1DVFB 1JPFA 5D7LA 1FNGA 3NA9L 2ZCHL 3D25A 1P6FA 2CKBB 2YR3A 1RZ7H 1WFNA 1WEJL 4KRNA 3QCTL 4X6CB 3EYUH 1JYNA 3T4AA 4Y16D 3NN8B 4RISH 1HIML 4GQ9H 5EC1B 1NCAL 3OSKA 4XCNB 4XBEL 2AGJH 3FRUB 1K2DA 2AQ3A 1C8PA 2VZTA 5DT1H 5HHQA 4V2CB 4K3DH 1J18A 5TFSH 3U4AA 5HJ3A 5DUBB 1OHQA 1RVFH 2PTVA 1JI1A 3FB7A 2EDNA 1HKLL 4XWGL 1PQZA 3BE1L 4XAKE 4YHNB 3AM8C 5FDYA 3UX9B 4M1GH 2W9DL 3O3UN 4JKKA 3V9FA 4JFZH 3IDGB 1CD8A 1RMFH 2GY7B 5F89B 2SEBA 4HKBB 4LLMB 5F7LB 4YHML 4WNQB 3FO9A 5D5MF 4OZ4A 4TVSa 5ESAA 3LEVH 2JIXD 1M6OB 2ORBH 1Q0YL 1YY9C 2DQJL 3DXAB 2YWYA 3MSPA 3VXNB 1M05B 1AQDB 4NRXA 2ZG1A 4NCC2 2VLRB 3ARXA 1CDBA 5C6PB 4XHQA 3MRFB 3GUTA 4G9DA 1OAKL 1URLA 3QRFM 2EDJA 3BIAX 5B4MD 5H94B 4YDKL 1N64H 1A4JA 3JWDC 3J7HA 2X5PA 2EZ0C 2H9GA 2P5WB 2C4FU 4PBWD 1H8OA 3FB8B 3RZCD 3S98A 3BX7C 5JW3H 1AR1C