4GKZB

Ha1.7, a mhc class ii restricted tcr specific for haemagglutinin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha chain of Class II TCR
publication title Minimal conformational plasticity enables TCR cross-reactivity to different MHC class II heterodimers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB02
4YBQC 3CC5A 2E27L 1TTFA 5ICXA 5F6IB 2VXQL 4I4WA 4NWTH 2R0ZL 3VE0B 4XXCC 1NAML 2E6PA 3V6ZA 3IDUA 1QLEL 4HC1H 1EO5A 5J6HA 3HZKB 5KAQF 4HUVB 1YEEH 4G8IA 5T3ZL 3RU8L 1HHGB 2OM5A 1J10A 2FX8L 4OCRL 1CFSB 4LEOA 2VC2L 2G5BA 3DRQB 3VDAA 3C9NB 4JRXB 2P49B 1M71A 1N2RA 1HQRA 2VDKL 5DMYA 1JPGB 7FABL 4MNHB 2GTWB 3H3PH 1NC2B 35C8H 1AJ7L 3LHPH 3BGFB 3VXSD 4L3CA 1OPGL 2V2XB 3ARQA 1HHIA 4ELMF 2HTLD 4GLRI 1UH2A 3DX7A 2A6KB 1DEDA 1FAIL 4UINL 4KJYA 2O61A 4ZTOL 3DHMA 5T1DL 3ROOA 4OIBA 1AGBA 4NNXA 4HQQL 3KPLA 1GGCL 1QOKA 4YE4H 2HN7A 4JZOB 3IRZA 4H88L 5EORH 1I8IA 4HAFA 4NQDA 4WUUD 5F6HJ 5E2TL 1FL6B 5L88H 2PCPB 4U1LA 3RI5K 2P5EB 3CSGA 1S9KC 4M8QA 1BX2A 1KCUH 5B39G 2AXGB 5J9PA 1YA5A 3DMMD 1P7KB 1FNGB 2QQLL 4KQ4L 3U7YH 5I19L 4QNPE 5F9OL 2IBZY 5KVEH 5F3HB 1F4YH 1KJVB 4KXZI 4QRTA 3GJEB 1R5WB 2EDBA 4LVNB 5CZXC 1XGQB 3HI6L 5F6HI 2BJMH 4LFHD 1EUTA 4Z7UB 4WI6A 5GRVK 4LSPH 3VXNB 3W9EB 2HFEB 1YECH 1BECA 2FEEI 1QSZA 5KS9A 1X4XA 5BMFL 3WIIL 1KLFA 4QHMA 2ID5A 2R4RL 4NT6A 4Y4FA 4P2QB 1CLZH 3TV3H 4U6XA 4XPFH 3VXOA 2C3GA 2VXVH 4IRSD 1WK0A 4NSKA 4L4TE 4U6TA 1Q9WB 5E6ID 3RL2B 5EZJB 4Z76A 3G04B 2HKHL 2D9QB 2MQ0A 5K9JL 2Z35B 2FEDC 3NPSC 4PIRF 5ALCL 3C5ZB 1KCVH 2AERT 5IMOB 1MAML 5EUOB 2K1MA 1CDJA 4EVNB 3SKNB 4ZS7H 1J0IA 4F58L 2FX9H 3HNSH 2IQAA 2KKQA 2Y36L 1CWVA 1OGAB 3GRWL 1WBXB 2MTPA 3BKML 3EAKA 4RISH 5JHDB 2AEQH 4NM4H 5C09D 1N3NB 3KPSA 2F9BT 4PRHD 3EKCA 3GHEH 3WEXA 5L2KE 2WQ8A 5A2JH 4AM0B 3VI4E 2EYRA 3SGJC 5E2JA 1F42A 4OUUA 5FV2A 4XPHL 1W0WA 1MH5B 3T0DA 3G6AA 5I1JH 5DVKA 3GSWB 3O2DH 5HVHC 3UO1L 5IB2A 1G7MA 1NCCH 1TJHH 4XHJC 2HKHH 4YGAB 2NZ9C 4K7PL 3S36H 4EQ3A 5D1QA 3IS1X 2A6DB 2D7TH 2BFVL 2FR4A 1CFTA 2VXTH 3DLQR 1Q9LA 4KGJA 2GUOB 2PXYC 1F02I 3SKMA 4IJ3B 3KWWB 4WUKL 4N0CD 1FJ1B 3SE9L 3DV6B 1JFQH 2OL3A 1OGTB 4XX1E 4K9EC 2CRZA 1RJYB 4JFPA 2WP3T 1JTOA 4MS8C 3QO1A 4IMLA 1FNAA 2BRQA 1PVHA 1G9NH 4S10A 4YXHH 4DKFL 4IHOA 3KPOA 3BZFA 2I9LB 1PX4A 2E7HA 1K4DA 2RAMA 2DAVA 3QUML 2W65A 3Q1SH 3LEYH 1YN6B 1GYAA 4WUUA 4JQVC 2XFXB 1GL4B 3O8XA 3ESVF 3L95B 2NW3A 1IEAB 1Z9SA 3TH4T 4EXKA 2EEAA 4ZSOA 2UUDH 2F54D 3TJHD 2ED9A 2P8LB 2B5IC 5F7LB 2JB5L 4MJIE 5MENA 1I3GL 4AEHL 4ODXA 5KSVB 5FECB 1INEL 3MODH 4KRNA 5J11B 2MMXA 2BNQE 4RX4A 4F57L 2DMBA 2F8VA 5HHNB 3H7BB 5DDHA 4QRQA 4PRNA 4TULH 3BEWB 2NY7H 3QRGL 4GG6B 4TSAL 1JZ3A 3SDXB 2ZKHH 3P11H 4CMHC 1VADA 3P0GB 5DJDA 3T2OA 2O5YL 4MB5A 5FYLH 2D31B 3QFJB 3B9EA 4UMGA 4H8WL 3PWVB 3HMWL 4IRSA 4KHXL 3REVA 1S9VB 2XA3A 3H9ZA 5E6IA 1PZUB 2ZCHH 5T33H 4PYGA 1P4LB 1R3HB 5I8KL 2FGWL 1ZA3B 1MF2L 1ORSB 3S36X 1CQYA 1U95B 1CK0H 5DZOA 3UC0L 2VDQL 1KULA 1CDGA 1GGTA 2Y9RT 3MYZA 1SM3H 2JJTA 4OZGF 3QDJA 1OAZL 4D9RE 1BIIB 3E6HA 1MCCA 4GMTH 4O58L 2NY4C 3GSXA 5DJ2A 5HHPB 5GGTA 5F7DA 3QEQA 5AZ2L 1G9MC 5JR1L 5C86A 4XVSL 3BZEA 1IC1A 1S3KL 1T80A 4I4WB 4OLUL 5J1TC 3FQWA 1I7TA 3DNKA 4X99A 3TC9A 4PRHA 2W9EH 4PJBB 5E4EB 2CKNA 3NTCL 5D7KD 3ZE2F 5HHMD 3VH8G 5D2NB 3QH3B 5I1HH 4R4NC 3OGOE 3FN3A 4ODVL 4PJDB 3QUZC 1IKNA 4NP4H 3W0WB 5CGYD 1RMFH 2PNDA 1NCWL 3V79C 2IFFH 5I18H 3FOMA 2K7PA 4Y88A 5IGXL 4MCZB 5EU4B 3TBVA 2VTFA 3WFBL 1M71B 3WIHA 3QYCA 3L5JA 1JNNL 5CJQL 1FGVH 1N2RB 1HQRB 4NQVB 4AIZA 4S2SA 5EB9A 3V7AE 1UVQA 2DMKA 3MUZ1 4YDLC 1YMMA 3SKOA 4KZEH 4PJ9B 1YYML 1F58L 2VSDA 4G6KH 4DOHE 5LXGH 2BCKA 2XKNA 4JN2A 1PFCA 2WIMA 4OSUH 4EBQH 2WZPD 1AKJD 1E6JH 4MAYC 5F1IA 2ESVD 1R3KA 1X6LA 4LEXL 1E4KC 2YD2A 1MEXH 1MCHA 1CFVL 1T7XA 4ENED 1HWHB 5KS9F 5LWYL 3IETB 2CDGA 4PJAA 5FYJD 4ZAKC 3RZCB 1A1NA 1SVZA 3OXSA 2X9WA 1KCLA 3RWDA 3KYOA 5CZVH 3V4PH 3GM8A 3M1BA 4JFOA 3OQ3B 3CFCH 5ANMB 1JGEB 4JO2H 4PREA 1A4KB 3TBTA 4QRTB 3QHZH 3QCVH 5C8JA 4PGZA 3E3QE 3LVEA 4OFIA 1BD2B 1D9KD 3UTSE 3DSNA 4JY5H 2HAZA 2FO4B 3FAXA 5C0DA 1YNLL 4PJIB 1CXLA 1AQDB 4JFEE 4RBPH 5IBLC 3STBA 4LHUA 4QCIA 1F4XH 4X98A 5E7BA 3CZFB 4JREC 3IYLW 5E00B 3FB7A 5JXED 3U0PB 1TPXC 2N7BA 5TJWK 5HPOA 3SDAC 4J3WA 2BDNL 1NCAL 3INUL 1H3WM 3MV8D 3ILQC 4QHUB 4ODTL 1QBBA 3MBXL 4K9EH 5DD5H 1ZVSB 4B5EA 4Q0XL 4YHLL 3B2VL 3D85D 2BVOB 3CX5K 1UWGH 5IESL 1YMHA 5DJZA 5I6XC 5D96B 1DE4A 2EH7H 4NJAH 2ITDA 4P49A 5D71L 4D3CL 1KSRA 2PW1B 4C83A 3LRSB 4MVBC 1VFAA 1MCSA 4NRXA 1PKQB 4NGHH 4Y19E 2Y7QA 1FVEB 4PRIE 1YY9C 3P4MA 3OMZA 1KFAH 1QO3B 4FQIL 5C9JA 2H2SC 5ICZA 4HBCL 5E5RB 5FDYA 4JKKA 4XNUH 2O5ZH 3U82B 4WNQB 3OL2A 3OKLB 3CVIH 1AI1H 2HWZH 4OUUB 1R3LB 4OT1H 1MIEH 4B41A 1W0WB 2W0LA 3WKMH 1LO4H 4UOW1 1T89A 5I71B 3MSPA 3V6FA 5KBNC 5FDWA 4M62H 4X0KB 5BRZE 4KI5C 3V4VL 2VH5H 4M6AA 4HHAB 3TA3A 1U41A 1CFTB 1MUJA 3L3IB 5E2VH 5J56B 5BZDA 4OLXH 3MRRA 4JB9L 3BP4A 2W9DH 2HT4D 4JGJA 3BWAB 1J0HA 3EJZD 1H3TA 4OJFL 1B90A 1YEGL 2F5AL 3BIBX 4HXBL 4NM8H 4JFPB 2ATPA 3BGMB 3WIFA 3I2CL 3VXSB 4LLYB 4APQA 3PNWA 3GJFA 5J3HD 5DA0B 3HG1D 4QOKA 3KAAA 1INDL 1QQDA 3FMGH 3LKQA 4DUVA 1CICC 1QSFE 5EC2A 2CRIA 4U1JA 4X6CB 5E4IA 5FK9B 2NXZB 4K7FB 4WUUB 1G7IA 2VERN 3JTSA 1QR1A 4CADB 3HRPA 4MCYB 5CEZH 3GSQB 5J06A 3HRZA 5ACMA 3DMMB 4QO1A 1G9MH 1UWXK 2XWBA 4GW5B 1J1XL 4GS7C 3V5DB 1QFUL 3DGGA 1WIUA 2R2EA 1BOGB 1EUUA 2CLVA 3L9RB 5IVOA 1GXEA 5L2KD 4NKMA 3ETBF 3ARFD 3BKJL 2AJSL 2ARWA 5TF1L 4PRNB 4PTUA 3EFFA 4Q9CA 5DYOB 4F37K 5CSZA 5EZOL 2AAVA 3W9DA 2CKBH 3CXDH 4MNQE 5MERA 1DBML 4U1KA 1MCWW 2ZCLL 1FE8L 3U6RA 43C9B 2UWEE 5D7JC 3QQ9C 3VFTB 4IRSB 3O6MH 4U1HB 4N8VB 3UTQA 4JG0H 1AGDB 3FZUC 3QEUA 4I9WE 2XWTB 1WBYB 4FQJL 5IEKB 4WW1B 5IJVB 3WS6A 1RK0B 4OCSH 5I66B 1W72A 4HZLA 1FL3A 3SHSA 1FFPB 3UYRL 1VPOL 2C26A 5CBAB 3LV3B 3OG4B 1GHFH 1DL7L 2MCG1 7CGTA 4HIIB 4C56E 1NANI 1FGNL 4LASH 4MJ5B 5JZ7C 5C09B 2X6MA 2HVJB 4L9DA 5BXFA 3AY4C 4CBPA 3RWHA 1A2YA 1UYWH 4HPOL 3DX9A 1I8KB 3ULUD 2FIKB 2DJ4A 4H1LH 3DOSA 1MWAH 5HBBA 1BMGA 3HLAA 3CX5J 1TVHA 4Y16A 1AY1L 4UT9L 2HJFB 3MA9H 4OV5A 2J4WH 1KCSL 4DN3L 4MJID 4P9ML 4KTEL 4PJAF 4DZ8B 3FOMB 3QQNA 3MJ7A 3U83A 5E5MB 3MFFA 1RUPL 3MLTB 3QIWA 3W2DH 5ADPH 4S2SB 3KPPA 2R4SH 5FO8B 4OQTH 4XB8A 3MRLA 3SKOB 1ZHKB 2EYTB 4WWKD 4PB0L 3GGWA 2XWJA 4KK5C 4KKLD 3MX0A 1A14L 1WFUA 3ARGA 4FQ2L 3BPLC 4JN2B 1D6VH 3P30L 3RTQC 1JYVA 4I3SL 3HUJB 4MXWH 3DVGA 3TBYB 5JLZB 3IFNL 4YPGA 3GMLB 3OF6D 4L4TA 2DQHL 1T5WB 2R1XB 3FB6B 1T5XA 1YNKL 2BNUA 5HYQB 2VISB 3A6CH 5CJOH 1AHWC 2F19L 2G60L 3VG9B 2OYPA 5E8DH 1S7VA 1OL0A 1KIPB 1U91B 3RWDB 1BQHG 1XCTA 1YPZE 3PABA 2F54B 3PWUB 1HXMB 5HDBE 4LCIL 3C5SA 4NHUA 2BSED 2R56H 3LN5A 2LABA 3N85L 2PETA 5L6YL 3QIUD 2X4RA 1XMWA 3FO0H 5C0DB 3DRTA 5HGGS 4JQXC 5A43C 1RIVH 4LDLB 2CSPA 5HYEA 1MREH 4OF8A 3FQUA 1ORQB 1U8LA 1EEZB 5L2KA 3VFGL 1RIHL 3ARFA 3O6LH 4C59B 4GAJL 4G6MH 2WWKO 1BBDL 2B39A 5DD3H 5I75B 1D5IH 1F2XK 4L8SC 2QQNH 4L4VE 4TUKH 4GW1A 2YD7A 4XH2A 5D2LE 2ADFH 5IW6B 1KPVA 1RJCA 2WAHA 2XG4A 2APVA 2MHAA 3G6JE 2IPUG 4DCQA 3EYQD 5FHAL 3B9AA 3OR6A 5SWSA 1ZGLB 1K4CB 3KPMA 5H94A 2V9TA 3ZE1E 1IM9D 3FCTB 1AR1C 2NMSA 3QUYD 1SBSH 3ARZA 4ZPVB 3ALXA 4YK4C 1YMHB 5HYSB 3WLBB 3MV01 4F33A 4WI9A 4KMTH 1VA9A 1WFTA 4LPYA 3IDNB 2Y23A 4DTGL 3ZDZE 5J6GB 1CN4A 1VKXA 4PJEF 4Y4HD 3S8WA 3UYPA 5C9JB 4KRMB 5TE7L 1WITA 1FCGA 5A2KH 2LFGA 1U3ZA 1MCNA 3MROB 1EO8L 1N59B 4PGJA 1T2XA 2I60L 3TP4A 5BV7B 3WXVL 3RY4A 4L5FH 1NC4D 1EEQA 4H20H 5HHMB 3NZ8A 5C0EB 2QHRL 2G75A 1J87A 4LNVA 1Y18A 3KJ4C 4KDWA 1KTDA 3HAEA 4EI5A 3AGVA 3PGCA 3MOBL 3TPUB 1H5BA 5LBSH 4O2EB 3MZGB 1IFHL 4MYWB 3UTSD 5BZDB 1OAQH 1T1YB 5F89A 1KEGH 1CLYL 3BP4B 1DTUA 2F5BL 4JFED 2BNQA 4PJXE 1J88A 1NGZB 1AXSB 1TMCB 3WXWL 2CUMA 1NCUA 3MXVH 5IB3B 1WJ3A 4KK6D 4AIXA 2R0LL 4KAQL 3VRLE 2ZZUT 1AKJB 3H0TB 3EDKA 1D5MA 1QLFB 4XNXL 1YEIH 2ESVB 1N7ML 4PRAA 3HCVB 2YHGA 4KY1H 4OF3A 2OI9B 4QXUH 1BEYH 3RY5A 2OSLA 1SQ2N 1KJ2L 3OJVC 3MRIA 4FQ1H 2BMKA 3SKJH 4RNRB 4YXKL 3AM8A 4HS3A 3GBNL 5IB5A 3TWCH 4LPXA 1FLTX 1PYWA 1FZKA 2PYEE 3EOTH 5T1MA 3BXNA 4JKPH 3T1WA 4X7TA 5ESQB 4YHML 5FOBB 1KTLA 4Y2OA 1OAYL 4H1LG 3EYOB 1G7PB 1T83A 2R69L 4PRID 5DVMA 3IDIA 1D7FA 1AXTL 2DKUA 3MRFB 5C08E 3O41A 1D9KB 3N9GH 3MGOA 2HA1A 3T0AA 1ROWA 3NFPB 4RFOH 4LGRB 3EFFB 4PBVC 5LAXA 1JGDB 2Q86B 1I7RA 2Z91A 3REWB 3QNYB 3V9FA 1KACB 4M4RA 3C8DA 4YHNB 2R8SH 4WU5B 4NKOA 4LPTA 1AO7E 4XC3L 2H3NB 1IGML 1JWUB 5BRZD 3MBEC 5I76B 3MCG1 4LSVL 1MCEA 5IMKA 3UTQB 3MV8B 3QEUB 4NKDB 1NGPL 1U3YA 5IROA 1YEFH 1E4WL 3QUYA 1X5ZA 3D85B 5FIEA 1T1WA 4MA3B 1OOAA 1Q9KA 4UIMB 5I16B 1A9EA 1C12A 4XP5H 3GEWB 2FBJL 2LTQB 3QHFH 2MPAL 3G5XB 4Z7OF 1MFNA 1ACZA 3WYRA 1DSFH 1N6QH 2OCFD 3EJYD 3PQYE 4Y4HA 5CJXA 3CLFL 1X5IA 5E9DE 5HD8D 2DB8A 2WBJD 5BXFB 4MJ6A 4X4YA 3P9MB 3T2QA 1MRDL 1UB6B 3WE6A 4O5LH 4UDTB 3U79A 1NC4A 4GSDL 5CD5D 5K9KB 4NBXB 2I9TB 2VLKE 2OLDA 5CIPA 4X6DB 5I73B 5H2BA 5FYKH 4YQXL 4Q6IC 4RAVA 1VGKB 3ZL4H 5TF0A 3MV9E 3MLSH 4LSRL 3LCYA 4JFEA 3QWOB 5DRXB 1A7OL 1BZQK 3D25A 3X12B 3TT1H 5I0DA 5IR1A 4PLJD 1A9BB 1TXKA 3QXUA 1J0YA 2X89A 5L8JB 3QUXC 4MZ3A 1T0NB 3ROLB 5F88A 1A3LH 1MY5A 5JHLL 5HVGB 3THMH 3GMQA 1JPFB 2BC4B 1QLRA 3HG1B 3D39E 4LSTL 1ZT7A 3QPXL 4M5YL 2E7CA 3BESR 1AE6H 5ID1B 1T2QH 4EUPB 2A6IA 5EBWA 4D2NA 1MSPA 4CGTA 5KSUB 3VXPB 3WNLA 4PJGE 3PABB 3WLWC 1IAIM 3DYOA 1QSEE 3MLRH 4OTXH 3C5SB 3O2WL 1BP3B 1U8QB 3UPRB 2BRRL 3BX7C 3KPRE 4XTRC 4ZUSB 3W39B 4M48H 3TZVD 1IAIH 4X80L 1HDMA 4Y19A 4X7SL 4C56D 4PRIA 4Z7QE 2C3HA 5CILL 3IU4H 1A7OH 4RFNB 1Z9MA 4J3TA 2D7QA 4PV8B 1X5HA 3GZKA 4OFKA 5L2KB 2P43B 3ARFB 5C0FA 2V7NA 4P2OA 2X7LB 1KB5A 4HFWB 4PUBH 2E6JA 2WV3A 5IHZA 5CS7A 5DJAA 1NAKL 5DQJB 4KDVA 4ODSL 4KKCD 4JHWL 3RWEB 1PEWA 4KRPC 4PJFF 1KPVB 5BRZA 4ELKB 1XR9B 1U3HC 2MHAB 4L9LA 3OR6B 1EO7A 5H94B 2JLLA 2IAMA 4R7DB 4Z7NE 2NX5E 1CI5A 5DMGC 4NZRH 4GXUM 3UBXA 3EYUH 2AQ3A 4GQ9L 3K2UL 4U7SA 5DJXA 4M4PA 5CINL 1FL5B 5L9DL 1U8OA 4G3YL 5DR5H 5CAYB 5IQ7L 5D1XB 1M7IA 1UXSA 4K3DH 3MRGA 5INDA 3SDYL 4DVBA 4XVUD 1QSFA 5D6CB 4E41E 3VGFA 4LSQL 2DKSA 1A7BA 2AJZA 1KEMH 1GGUA 4YHYC 5GRUH 3RWIA 3PHQA 4PV9A 3I9GL 3M8OL 4LVOB 1UT9A 3EOAA 3PGCB 3ZKQD 5GS2D 1F45A 4MJIB 5SV4A 1P7HL 4IDJH 3ECBB 3O3BA 1A22B 1I9JH 4BH8A 1ACYL 4EN3C 1P1ZB 4JFQB 2EDDA 3B4NA 3HNVH 1HNGA 1MFAL 4IIQB 1ZLVK 4UTAH 1YZZA 3BN3B 2H2PD 4HLZH 5JDSB 1CYGA 4GH7B 5FYKU 2OXGA 2EE6A 3ZTNL 5DS8B 1KPUA 3Q5OA 4R26H 4WWKB 3RVTD 1SJHB 4YX2H 4WJ5A 2ADIA 3KLHC 5KOMC 2FH6A 4OBSA 1EZVX 4HJGA 43CAB 1F3JA 3S5LG 3WD5L 4JVPA 2IH1B 3PV6B 3BIKA 1BWWA 4MNQA 4NO5A 2UWEA 1KJMA 1ZANH 2F58H 3BD5A 3ARDD 4JDVB 2BMKB 2FJGB 2DLHA 3SKUD 1RV6X 4HG4K 1A6WL 5E8OB 4LMQI 4G42B 3VGAC 1GZPB 1PYWB 4XCYB 5TDOB 2WIIB 4HS8H 2PO6C 1VHPA 5DJ8A 4NO3B 2A9MH 2YD9A 1CL7I 4RA3A 1MJUH 2B1HL 2Z31A 1GGIH 3QIUB 2MCPH 4C56A 3QPQC 1HH9B 4HH9B 1OW0C 1Y6KR 4NWUH 4RDQG 1EH9A 1V3JA 3BE1H 5CEXB 1TETL 5ADOH 3MC0A 5DC9B 4M1GH 3L7FA 2APFA 4LKXB 4NN5B 4RMTA 3ULVL 5LAXB 1NJ9B 1A7PL 3IDMA 4EOWH 1F6AA 1OTTC 1UACL 3UROR 3FQTA 3RP1A 4O2CA 5F3BB 2W9LA 5AD0B 1RD6A 3U1SH 2ED7A 2AJYL 1VGEL 3UCRA 2VQUA 1UG9A 2DLFL 4L3AA 4DKAA 4H0IA 4FFYL 1EGJH 2HKFL 5EIIB 3L7EA 1IM9B 4UV7H 5EUKB 2Q3AA 1GZQA 1HHHB 1S7RB 3T4YB 4ZUWA 5B38G 4FS0A 4JY4B 1RI8A 1M7DA 1A6VL 1Q9KB 4PGBB 2MKLC 3KDMA 1R6VA 3K0WA 4QHKI 4DK3A 1FFNA 1WISA 2ZSVA 1WAAA 1ND0B 1U6AH 5KVGH 3IJYA 3DV4B 4Y4HB 4OZFB 4PR5B 2UYLB 2I5YH 1TZHA 5FO9B 1A4JB 1CGSH 4HUUB 1BGXL 4U49A 2DQJL 1JYNA 2UZIH 3WE6B 2VAAA 4U3CA 5TDNA 2W92A 5T5FH 1NC4B 1JNHA 1AIFA 1QVOA 2VLLA 1YPZA 4TNWK 3BP6A 4HUKB 4R97B 4M61A 4QRRE 2OL3L 1H3XA 4JDTH 2ZSWA 4QWWC 5C08D 4XBGB 3UTSB 4XPGH 5GJSL 3TFKC 3M45A 5D93B 3VFUB 2CDFA 3NZHH 2Z4QB 1K6QH 1FLRL 1RUQH 3VXTB 3TT3L 4YGVB 3VFRB 4YFLF 4KVNL 3MRHA 3GMOA 5EC1A 1MVUA 5T3ZE 1WICA 3JWOC 4L4VA 4UT7L 3P9WB 5D2LA 4G6JH 1H8NA 5TPWL 5D70H 1T2JA 3QWQB 4Y5XC 3IF1B 1K3IA 3G6JA 1YYLH 2XZCH 4PRBB 5F7EH 5HHOA 2YPLD 1FH5H 3MRDB 2J8HA 5EBWB 1G6RB 2XRAL 1HSAA 2A38A 5EBGA 1KLUA 5DUPL 5I1KH 1ONQA 1EFXA 3PHSA 3C6LA 5BQ7B 2V5TA 1MJ7L 2DL9A 3JTTA 1UH4A 5E99H 2AGJL 4GKNA 1EERB 1HCFX 1LMKA 1OAKH 4PGEB 3FHQA 1WWCA 3TNNA 1L6ZA 3GI9L 1JV5A 2BVQA 5E9DD 3BO8B 3GNMH 2WWKT 1DBJH 4NYLA 4IOFD 1CXFA 4M6ML 1NBVL 5ID0A 3NN8A 1K85A 1XR8B 3U0TB 2XPGA 2V7NB 4EEEA 3WJJC 4HG4J 1KB5B 5JOFB 2EC9U 4G5ZL 5DJAB 3BD3A 4HLZG 4WEMB 1NDGA 3UJIH 1NLBH 2BSTB 5LJYH 1M6OA 1UCBH 5CZKA 2ADJB 4AEIH 1MHPL 3IKCA 3OKYA 4QXWA 4PLKC 3OKKA 5BRZB 1ZOXA 2BSRB 4L9LB 3AREA 1RJZA 1WQVT 2C1PB 3T3MF 15C8H 2QR0A 2R1YA 3CMGA 1QFWL 3MV9D 4YDIH 5TE6L 3IJSB 5D72L 3CK0L 4DFIA 5BJTA 4PJXA 1RFDH 1RK1A 2DTML 2DJSA 2ERJC 1AGFB 5GGRB 1MFDH 4K2UH 5BVJA 1MPAH 1MQKL 4QTIH 4EXPX 3H9SE 2HLAA 4LIQH 4F15C 3MACL 1ZLSH 2IGFH 2ZUQB 3LSOB 4TOYL 4Q9QL 3MTRA 4YWGL 5C6TH 5CCKH 4BELD 4OLYH 3BT2L 2WBJB 5HI3D 2H32B 2NY6D 3O9WC 4NFCA 4K8RC 4Z77A 5GZOD 4GQPH 4TPRH 1HHJA 3MRNB 3OR7B 2PYEA 3IDYB 1TVBB 5DUML 3O3AA 1V7ML 1OCWL 3LKSB 4XBPB 5HGDB 4K3JH 3LOWA 4Q74A 3SE4C 2QADB 4X7CC 2CGRH 3IFPA 5IFAH 3DX6A 3RIFF 1J0ZA 4JJ5B 1U8KB 3G9VA 2AXJA 2IPTL 2YRZA 5C08A 4JM2D 5FUCE 5EFIA 4LQFL 1FO0A 2OR9L 4IS6A 1WZLA 2HT3D 1TENA 4JY6A 2ICEA 5DFVD 3OKEA 2WUBL 3TLRA 1VFMA 5GIRB 1XZ0B 3C2SA 1RZ8B 4IRZL 2MKWA 1NMCC 1XGTB 2DQFB 4QHNB 1AO7A 3TYGL 2UWEB 1QHOA 2E7MA 1TDQA 2OZ4H 1L6XA 1ZT4A 1V3MA 5EU3A 3BEVA 4F7MA 1P5UA 5ISZD 2ZG3A 3AS3A 1UB5A 4ONHB 1TJGL 1Q8MA 1RUKL 4WFGD 3ZDXE 3GB7A 1I4FB 1QRND 2PTVA 2H1PL 5DEGA 2IAND 1GSMA 2VABA 1IT9L 3OHXB 5ESAA 5DD1H 4OZGB 3TZVB 4GRLD 4C56B 3QEGH 1DBAL 3PQYA 3NCJH 4JRYE 5E9DA 1ADQA 3ARSA 4E41D 2YEZA 4P9HC 5FYLE 3U9PH 4XRCB 5HHVL 1WAAF 3C09C 1B4RA 2VDMH 3HPLB 3FQTB 3F6LA 4UBDD 3STLB 3GHBH 5C92A 5KTEL 2VLKA 2RQ8A 1JZ7A 3ZHLA 4QHLA 1HCVA 4LPWA 2QSCH 4ONFL 4MQXD 2DQEH 2RCSH 5I9QB 3JWNC 4RQQB 2DLIA 3S4SG 4PJ8C 1MHCB 5HTSA 1YPZF 4OFYA 1GZQB 4Y5VA 4AQOA 3BAEH 1XCQB 4OD1L 3SJVD 1ES0A 5E03A 5DZNA 1NFDB 4G80A 1AP2B 3S3JA 3VW3L 5HVWA 3JWOH 3TCLB 2OK0L 5GGSY 3MQIA 4UB0H 2EKSA 5JPNB 4G43B 4FABL 5GZND 2YBRB 4YEEA 1CG9A 5BV7L 1KPRB 4FP8L 4RGNE 4X9HA 3FL7A 5AAWA 5D1ZA 3DXAE 4E0RA 3BQUA 4ZXBC 3D39A 3CJJA 4ETQB 1AD9A 1FN4B 2UVEA 1D3CA 3BYYA 3HI1A 4I77H 4QYOA 4S1DC 5F96L 3U46A 2FL5A 2DLGA 1VEOA 3P4NB 5LVEA 1T6VN 4ZS6C 3HC3H 1JNHB 2R0KL 5D2LF 3UJJH 1AIFB 3FB8B 4PJ7A 1FNFA 1S7QA 1QVOB 1BJ1H 2VLLB 4PJGA 1MAKA 2JF1A 3G6JF 1JZ8A 1QSEA 3B8SA 4M61B 3RA7L 2NR6D 4U33A 3KPRA 2DIAA 3GSVB 3N1MC 2ZSWB 4JR9L 5JO5B 3D69A 5J12C 3MV11 3NCBB 3OSKA 4XGZB 5JW3H 3HI5L 1F8TL 1KENH 5L2JB 4BZ2L 4HK0A 4JCLA 4JM2A 4WW2C 3V5HA 1VSCA 5I15L 5JTWA 4B7IA 4Y5YA 1HSBA 3EZJB 1X5YA 1FYHB 4U1GC 5JPMA 5TH2B 5IUSA 2OTPA 3MRHB 4I0PD 3C5JA 1T03H 4B0MM 1Q9OB 3RX8A 5AUMA 3B5GA 5FYJL 3F58L 3PIQA 4D0BB 4MAUL 1I9RH 2AJXL 1C5BH 3LZFH 3CFDB 4RAUB 1BFVH 3PDOB 2HG5B 3ARDB 5MP6H 4X6EA 2VE6A 2J8UE 4D9QE 2NX5A 4E9LA 1KC5H 2BVUA 2GKIA 5KN5B 4MQSB 3T4AB 4AIOA 2GSGB 4W70A 1JPTH 2JB6A 1C5CL 3G5VA 4HDIA 4LP5A 1F3DJ 1NBZA 5E7FA 5F44A 3TN0C 3L3HA 4WO4D 4LLWA 4Z7VE 4BKLB 4K8RH 2FLBT 1HH6B 4HGMA 5C9KA 3NN8B 4HWBH 4O4YL 4Q58C 1PX3A 3QO0B 3V8OA 4H5SA 4GRWH 2VLJA 2ARJA 4G8FA 2VSCA 4X5WB 3MRQA 1HXYB 4JFXA 1DVFA 5IFJB 3OKKB 1OY3B 4OKVB 3QCUL 4XVJH 3UZEA 1UWEH 1F6FB 2NY5L 4KRLB 3IDJA 1LVEA 3BKCH 2VMFA 1DN0A 5JIPA 1RZ7H 1JTTA 2AEPH 4PJXB 3NCMA 1YN7A 4XVTL 1T3FB 1WZ1L 3LKRB 5C71A 3DURA 3UAJC 3MLXH 3IT8D 4YH6A 4YC2B 3RVUD 3GMRB 4PS4H 4J3XA 4P5KB 4XMPH 5GISH 5J13B 3BDYL 3QDAA 3SE8L 5HJ3B 3U4BH 3FTGB 4YFDB 3H3KA 5IB4B 1ED3B 5CD3A 4XP9L 1MRFH 1FIEA 2GIYA 1BF2A 1D5XB 4K7PY 3WL9B 2VDOH 3AMLA 4R9HA 5EOCL 3EGSA 3EBAA 5TQ2L 4C57C 4LBEB 4NJ9L 1ZTXL 4ZUVA 4A6YH 3SCMC 2CDEA 3B83A 4Q6YA 1MJ8L 3VD9A 5DC4B 2EDEA 3DETD 1MY7A 1C08B 1NCTA 1NUFA 3LQMA 1JWSB 3RPIB 3NH7H 2AJVL 4GMSH 1J0KA 1KT2A 5GGUB 2GTZA 3QNXA 1RUAH 4P9HH 1JWMB 3TO4C 3HE6C 4KK8C 1MCKA 2W0PA 1R5VA 4KV5E 4TTGA 3GIVA 1CL7H 3VGHA 4I3RL 1A6ZA 2JCCB 3OKEB 3MLYH 3HZMB 3H9YA 4FFWD 5DD0H 3QEHA 3PXHA 3SPVA 2AKRA 4E5XA 1IEBA 5LQBL 4ZUTA 1XGUB 4P59H 3IXTA 1GOHA 5JNYB 3I02A 1TLKA 3HFMH 1Q94A 3CVHA 4FG6D 5K9QI 3MRCB 4XWOD 1LDSA 1S78C 2DBLH 2PN5A 1XGPA 3LQAH 3QA3B 5DTFB 3O6FD 4OCMC 3U30B 4IMKC 1J18A 4JCMA 3VGEA 3ZZ1A 3BEVB 4ZFZB 2V5RA 2YPLB 2RFXB 3KG5A 3RI5F 3B9KC 1IGFL 4M1DH 2NY2D 4F7CA 3LPGA 2HT2D 2ZJSH 3RDTA 4LLMA 4IRJB 3MLPA 4HFUH 1N4XH 3B8YA 4KK9D 5L7XL 2X4NB 2DDQL 2Y06H 4JPVH 4W4OC 3R0NA 2CUHA 4GAGL 1QD0A 3VD5A 5E9DB 1RZJC 3CSYA 1I9EA 1VENA 3PJSA 2ADGA 3QAZB 4P46A 3JUYA 4D0CA 1FVDB 3B2UD 4QT5B 4EUPH 3T04D 1G7QA 4PP1C 4JFZH 4KVCL 1MCBA 1UA6H 5GS1B 4QHLB 3RNKA 1TQCB 3NIDE 2KH2B 4NZUH 3VFMB 2JK5A 3VRJA 2YPVH 4QRRA 3BW9A 1MCPH 2DQCL 4PJ7F 2WM0A 4PJGF 3MV9B 1DCLA 1JL8A 1DLHA 4ZO7A 3KPTA 5DMKB 2ZUUA 4G80B 5SX5K 2FD6H 1NAMA 1CFNB 1YC7A 1KTRL 2DQUL 3BFOA 1B0WA 4NUGH 3UZVB 4GJTB 4Z7QF 4X5XB 4P4KD 4RMSA 3RQ3A 3MV7E 3R0MA 3V52H 3MOAH 4KTDL 4YUEL 1KN4L 3UTTE 4N0FA 3ULUL 4U1NA 1TCRB 2CRYA 3PL6C 4GUPA 3HI1B 3T2NL 3T2PA 3T8XA 1AC6A 4XWGL 1U8IA 2NY6B 2ZPKL 4YBQD 1RZKL 4WV1A 1WT5C 4LF3A 4AT6B 2A6JA 3DO7A 4QXGH 1A6TA 3E2HC 2YUVA 4JDZA 4FQHA 3C6SA 2Q6WB 4LCUA 5TE4L 3X3GL 3GDBA 1R5IA 3WDIA 2APXA 1GPOL 4ZFFA 4TVPH 3VFVB 4JRYD 5F70A 3RX5A 4M43L 4QY8A 3ILPA 4JM2B 3ARBC 5C0CD 5FYLD 1U8PA 4F9LC 5HY9B 5C0BB 4HJJL 4YDJB 3T0WA 4YDKL 1VFBB 2BVPB 3HE7C 2AK1H 5HGAB 1FORL 3T77A 5HYJE 5DHYB 5AYUL 2J6EL 2PR4H 4JPKH 3H3BC 1NDMA 1FP5A 2IJ0C 5K59E 4XMKL 1W0VB 4Y4KC 3SGKA 4P5TA 3IU3B 2ZCKL 3MJ9H 2FJHB 3F12B 2DI8A 5ISZB 1JNLH 1SYSA 1TQBB 3V2AR 3NGBC 3TBWB 5LCVL 5D5MA 4XBEL 2PKDA 3KXFE 2EDWA 3NFSH 4I5BB 1QRNB 1NUGA 3FO2B 3HKFA 3PHOB 5TE4H 3O6KH 4QRSB 4YHOH 3WFCH 1NEZG 4LCWA 1ZA6A 3HC4L 2IANB 2W0FB 1JGUL 3H9SA 5B39B 1IL1B 1LE9B 3JXAA 3NPZB 3LS5L 4MX7B 4GRLB 4RGND 1ODAA 4XCEA 2PTTA 5IK3A 4D0DA 3O2DA 5GQBA 5IB1A 4E41B 3EYFB 1X3DA 3P4OA 2H6PA 4H5SB 4ZYKA 1HOCB 3TNMA 5E8EA 1XF4A 4DGYH 2ARJB 3S96A 3C60C 3BP7B 5IV2A 2GITB 4FA8A 3EDFA 5D4QA 3K80A 1KJ3L 3QUKA 1K9TA 3X11A 1I7UB 2XTJC 3BSZL 4CN4A 5DJYB 2VKXA 2ZCKH 3WKNA 2MOVA 3D18B 4P48A 4UT6H 2NYYC 4FQQA 3GRWA 5C0IA 1Q72L 4G8EB 4M7LL 3T65B 1DN0B 3ZYIA 1QFWI 5EU7E 1A21A 2CMRH 3SJVB 2FEDD 1IARB 4XC1H 4HGWA 4CW1A 4CVUA 3BRFA 5MI0B 2VIRB 1LEGA 1K5NA 5I74B 4XI5C 1IE5A 2NY1D 1V7NH 2VLMD 3MRJB 4KJQC 4P4KA 1Q0YH 4O02L 4X7FC 4YBLC 4Z95H 5ERWB 4GBXC 3QQ4A 4MD0A 4R8WH 3RAJH 1NBYB 1ZHBB 4X7DC 5IBUG 5GHWH 4YHZH 3LB6C 3KLSA 3QG7H 3T0EE 5DRZA 1OF2B 4FQXC 4D9QD 4Z5RB 1JYWA 4OCWH 1WEJH 5EZIL 4LHJB 3NCYP 2XQBL 4JFYB 4MD4B 1BZ7B 4N5EC 2J5LC 5KG9B 1QYGH 4O9HH 5HGBB 1JBJA 1RZJH 4ORGA 1P7QD 4YPJA 3PWLA 3GI8H 4XHJD 1GIGH 1UKQA 2NZ9D 2CJUH 2VRAA 2GK0A 4JRYA 3KJ6L 4JG1L 4RMRA 4P3DA 4FXGB 4YNYB 1ZEAL 5EG6C 3VDCA 1R0AL 1AGEB 4LCYA 1DBKH 5F1NA 2PXYD 2J2ZA 2OR7A 3QUMA 3S37H 1N0XL 3RGVA 4S1SL 1Z0NA 4I0PB 1A5FH 1LO3H 2B4CC 3CVHB 2WBWB 4XCCL 1ZXQA 4U6VH 4TYUA 5BOPA 1G6RL 4MS8D 4POUB 1XGPB 4OLVL 1PG7H 3V6OC 3SGDI 4DQOL 1JZ6A 2EXWC 4KWUA 1UQSA 3HHRB 5GGVH 5J57B 4XPBL 1TZGL 3WNMA 5EO0A 4LLMB 5DHVB 1W8OA 1E0OB 1P4BH 3ME0A 5JW4R 1UJ3A 4R3SB 4WGVB 3VA6A 1EHLL 2EXYC 3IFOA 1U92A 1KB5L 4WO4B 4JVWA 4M7ZB 1J05A 5JXAL 1BREA 4BFIA 3P2TA 3WFZA 5IEHA 3DXAA 2ADGB 4M7JH 2ZOLA 1ZWIB 1TITA 1JPSL 4YIQA 3MUGB 4PY7B 4LRIA 3U0WL 3EO0B 2QEJA 2V2WB 2GW5A 4F7TA 4JO3L 3GMMB 2ITCA 1H3PL 4ERSL 3NIFE 1KG0B 1NCBH 1OQXA 3FO1B 2A9NH 3VFPB 4Y4FC 2EEDA 2UZXB 3K81A 1DEEA 1FBIL 1UZ6F 3HB3C 4XZUB 1PY4A 1BQUA 5C7XL 4P2QE 2H26A 4J1UA 1E6OH 3BH9B 2B1AL 4ODHL 3OB0H 5JUEH 1DQDL 1OP3H 3HZVA 4ZUUA 3F7YA 1OARL 2FATH 3BPNB 1MFCH 3UJTH 1UFUA 1JRHL 1S9YB 3C8KB 2BHYA 4PJ5D 3D2UD 5IP4A 2NY4D 4KGLA 2HVKA 4GUPB 5CEZD 4M3JA 3T8XB 5GRJH 3VMPA 3L3KB 5HSFA 4DJMA 2AJ3A 5EUOE 3LKPA 4WV1B 2J8UA 3MRPB 5E1HB 5FYKE 4DN4L 2CR3A 1PG7X 4OZIA 3QXTA 3BISA 5EO1A 12E8H 2BK8A 3IGAB 4WIQA 3VH8B 5JHDE 2VJXA 4LCUB 2WINB 4R4ND 2NCMA 2C7UB 1P7QA 3QUZD 3UDWA 3BPOB 3QDGD 1FYTD 5JA9A 5D5MF 2QKIB 4HPYL 4R0LB 1CXHA 4L8BA 3Q5YA 4U2YA 2H41A 4UDUB 4NC1C 4UOJA 5D1QC 1S5IL 3WN5A 5TDPA 3WNOA 4OF6A 3O81A 4U1MA 3MRKB 3F7VB 4GAFB 1MCRA 2YD6A 1K8IB 4Y2DD 4CJ1A 4Y1AD 2X4QB 3OKMA 4MAYD 4M7KL 4HF5L 3X3FH 4JFDD 3O6FB 4PJFB 1TTGA 2APWA 2HTLC 3I75A 3SDDA 3PWJA 4JHAH 1MI5A 2NY2B 4ZG1A 1NFKA 3FONA 1A7QL 2ATKB 3NOIA 3STZA 2EYSB 5IVXA 4FQCL 1CE6A 3CH1A 4M9PA 2VXSH 4YXLH 1IAKA 2HMID 5E8NA 3O8XC 3QZWG 2GAZA 3MLVH 4HZAA 4CVXA 1I3RB 3UTTD 4MD5B 4XCEB 5IK3B 4JM4L 2A1WH 4QRUB 5I1DB 1SVCP 4Z9KB 3GSNB 4GG8A 4OLWH 1S5IH 3P4OB 1T1XA 2LU7A 5I8EA 1MVFA 3PWNB 1F11A 3TNMB 2CIIA 4F37F 2X1QA 1MIML 5CUSH 5K9OA 1NQBA 1U8HB 5MHSE 4I18B 1IM3B 4HLJA 5CP7B 4C4KT 3QJHB 1HILA 1WCBA 1A6UL 3BHBA 4XP6H 5AZEL 2YPKA 4ORZC 3CFIC 9CGTA 1E27A 2ZOKA 4FHBD 5IBTH 4RMWA 1AQKH 1RVFL 1RZGA 3DUUA 1CZ8L 3RWCA 3SDAD 1B0GB 4G9DB 1RQ5A 4PB9H 1CXKA 4NKIH 1XEDA 3LRHA 4CJ0A 3OTTA 4NQCD 3OPZL 5SWZD 1DQLL 1UM6H 1RU9L 4GG6E 5FB8B 1U58A 3NABH 5BOZG 3SQBA 2B4CH 4GW4A 3D0LB 5EOCJ 1JMXA 5E6IC 1FIGH 3OKOA 4XPTH 2CH8A 3QFJE 2X4TB 5H35A 4TSCH 4WCYH 32C2A 3CFBA 4J23A 1KCKA 4UTBL 1FPTH 5HYJD 4CU6A 4OIIH 2BHZA 1YJDL 4XNZC 2JJTC 5EN2B 3S6CA 2BSSB 1RIUL 1TTUA 1N64L 1YY9D 1B3JA 4TUOA 2CR6A 4F7EB 2H2SD 4PTTA 1N5YH 5DRZB 3AC0A 4MXQC 3SO3B 4J3SA 3DVIA 5EWIL 2BY2A 4HEME 4PG2A 3L1OH 4G7YH 1PZ5B 2AW2A 4N9OB 4KQ3H 4HWZB 2VDRH 1UZ8A 1NGWB 3VWJD 1IQWL 3WDHA 4OM0L 1IGIL 1T66D 4HKZA 3MJGX 4ZTPL 5FGCB 4KI5D 1CBVH 3EO9H 3B3IA 3PF2A 4JRYB 1IKNC 3VFSB 2HJKB 5C0CB 1I7ZA 3FRUA 5JW5B 5D2NE 3L3OA 3E6FB 4PJDE 1HIML 2VOTA 5DT1H 1EEYA 2EE3A 3VWKA 3MNVB 4BFEA 3CFEB 1JYXA 3WCYA 3MYJB 1ZLUH 4Y2DA 2V7HB 4KROD 5EOTA 5IM7B 3MA7B 1VCAA 5DQDL 3OG6B 3WUWG 3DI2B 3RGHA 3ZKXC 4MAYA 2VL4A 1LO0H 1LD9A 2WWMC 1H15B 5IF0A 1L7TL 1CICD 2G2RA 2ICWB 3K8MA 1A02N 3OZ9L 4NO0A 2LU3A 3P0VL 3DVNB 3RNQA 2MWCA 3RJDA 4F3FB 1S7SB 1HE7A 5C0JB 3KNBA 1LK2B 1MJJA 1QBLH 2W60B 4YDVA 3MV7A 1D5ZB 5IVZA 2XA8H 2P47B 1SYVB 5DO2C 3CFKB 2BHUA 2AXFB 3UTTA 2A73B 5DRNA 3WFEL 5HHXL 3BUTA 5B8CA 1BQLH 3QIBC 3TM6A 3H42H 5L0QB 1I1AA 2QSTA 4Q9RH 3T0ED 1NUNB 4GOSA 3S88L 4G7VL 3U7WH 4YIQB 3P9LA 5I17B 1LP9B 2YR3A 3F62A 2DJUA 1C7TA 1KN2L 3A0OA 4OQTA 4FFVD 2J8UF 1HZHH 2DI7A 4ZO6A 4Z7WE 1QEWA 2IQ9H 1IGCL 2C3VB 4PJIE 4OZIF 3Q3GA 3QQ9D 1HINH 4N0YH 5DVNA 1GJIA 1IBGH 5I30L 4EDWH 3FZUD 4DGVL 3KYKH 3NPSB 2JIXB 3MNZA 3NACL 5BS0A 1JHLH 4D9LH 3ZYJA 4NKQB 3ULVE 5I1LA 3H6JA 4LDOB 1OSPH 5GS3A 1CLOH 4WHTA 5I1CH 5JQHC 4OGZA 5D8JH 1NGXB 3BVNA 4NOBA 5HYJA 2HVKB 3M17B 1T1ZB 3RUGF 4BA8A 3UP1A 1BIHA 1YUHA 1MRCL 3LKPB 2GI7A 4K3GA 5DK0A 4DVRH 1S9WA 3CLEL 4GKZB 5CSGA 2VZVA 3WJLC 3ARPA 1R3IL 5DA4A 1CDBA 4L29B 1DQMH 5CEYB 3O4LD 3BH8A 4RZCA 2X4OA 3KXFA 2EDYA 3IDGB 1XF3B 3ET9F 4FZ8H 5E2WH 1DQQA 3WSQH 1IC4H 2GY5A 2VXUH 1G7HA 3VWJA 5D7IA 4U6HB 5HVHB 3L3DB 1PSKH 1ETZA 4LCCA 2VYRE 4Z7VB 3BDXA 3B43A 4LKCB 1T89C 1X5JA 2X5PA 3P0YL 5IVXF 3TJEL 4QTHB 4K94C 1IQDA 1F5WA 1JVKA 1IGYB 1G7LB 5TDPB 2PXYB 3TA3C 2V17L 4P5MA 3TPKA 2JJSA 1WTLA 2C1OB 4MWFB 3WFHA 1QKZL 4KK5D 2B2XL 1J12A 2I26N 2BVTA 3RTQD 4TRPH 2GK2A 1SMOA 4N9GA 1K2DB 2NW2A 4ZFGH 1BWMA 4OI9A 4WDIA 2R2HB 3OAZH 1ZHNB 3CD4A 4APQC 4LOUD 5CMAA 3FONB 3ORJA 4JKWA 4ZD3H 2VZUA 3L3JA 1CE6B 4RWYH 5F1OB 4PG9B 3CDYA 1ADQL 3HA0A 5FHBL 5K9QG 1RHHB 1BQHB 5IT2L 4P2YA 4P2RE 4D8PB 5E8NB 1S9XA 3VXME 4KV5F 5IIEB 4GRMA 2B5IB 2CIKA 1NSNH 1T7VA 3ARUA 4X6CE 2R0WH 4NO2A 1AD0A 5GGTH 3I6LD 3TVMD 2PYFA 5KSBA 2V2TB 4JPWL 1NL0H 2P4AB 3O0RL 4XNMB 1RJLA 3CSPA 5FYKD 3T0EA 4NN6C 1GGBH 3SY0B 3CFJB 5EBMA 4CNIB 1HILB 1J5OH 5FUOH 1UXWA 1J8HD 4MA7H 3EYSH 3FHAA 4WU7A 5JHDD 2VO5A 1R3JB 3VCLA 2YPKB 1UM4H 3DUUB 1RZGB 4CMHB 1ZGLP 4M5ZH 5DURD 3DBXB 1CFBA 4LIQE 3WIHH 3HZKA 1U58B 3LH2H 3GSUB 4HUVA 1AR1D 4YZFF 5IMMB 1HHGA 3OKOB 3RVWC 2EDRA 3V0WL 3EHBD 1L0QA 2EIBA 4Y8AA 1WTGT 3WS6C 3C9NA 3CFBB 4AEEA 1QHPA 5AWNL 4BYHA 4PJ5B 1FZMB 3D2UB 2FX7L 1I3VA 2NY4B 3SBWA 4TQEL 2AP2A 4MNHA 2GTWA 4XP1H 1MQ8A 3ZO0A 1LO5B 1NC2A 4LRNL 5JORB 3TIEB 4OB5L 2EDHA 1ZMYA 2V2XA 3W11C 3AB0C 5J1SC 3SGDH 2AK4D 2A6KA 4I48A 1RURL 5C09E 2YN3A 4KHTL 2MJWA 5BVPH 3QUZB 3E8UH 3QDGB 1FYTB 1J1PH 4JZOA 4AG4H 2B0SH 2X42A 4Y16C 3FRPA 1VERA 1E4XL 2CKBB 1FL6A 4FQLH 1J0JA 5FUZH 4X6BA 1AGCB 5T1LD 3VI3E 2LVEA 3O11B 3QXAA 3GIZH 4YDLB 2AXGA 3QIWC 1XF2B 5MHSD 4UILL 2X1XR 1P7KA 3IRPX 5FCUH 5F3HA 1KJVA 1F4HA 2H45A 4M02A 4Y1AB 3GJEA 3PV7A 4PGDA 4NRZB 1R5WA 4Z8FH 4PRPE 3ARGC 3S5LA 2EH8L 3OKNB 4MAYB 4OGXH 5D6DA 4Z7UA 4JFDB 3VXNA 3AMKA 3W9EA 2HFEA 3PGFH 1YEJL 1X4ZA 3RPKA 4XAWH 2DYPB 4RGOL 3M07A 2PW2B 5KVFL 1EA9C 2N1KA 4P2QA 1A7NH 4ZAKB 5C0GB 5C2BL 3QI9C 4MZ2A 3HUJE 1S7XB 1N5AB 3QFJD 4YFLI 4AMKL 3LMJL 5JW4M 1MJJB 2IG2H 1Q9WA 4M6NL 4MQTB 3MJ8A 3RL2A 5EZJA 5DXWA 3G04A 4H1LB 1MWAB 3UTTB 5I1IH 5DRNB 5GGQL 3C5ZA 3TVMA 4N68A 3MLZH 4WW2F 4YFEA 5IMOA 3Q6GL 2A77H 5EUOA 4PJCF 4EVNA 2LU4A 3SKNA 4DAGH 2F53E 1C1EL 3QULB 4MDJB 3EO1B 1A0QL 1Z9OA 1N8ZB 5DLML 1OGAA 5LGHL 2R29H 5E08L 1WBXA 3DVFA 2EO1A 3EOBB 5HDOA 1CGTA 1P4IL 1LQSR 5JHDA 3ARFC 5ELIA 1QEWB 5DMIH 1TPXB 1BPVA 1N3NA 1PBYA 2BVEA 4K94H 1U2CA 3MBED 3SDAB 1ITBB 4GXVH 4AM0A 2IFGA 5DVLA 4NQCB 5SWZB 5D7IF 1CGXA 3GSWA 4HEPG 4TTDC 2IBZX 2CO7B 4OI7A 5FKPB 4GKSB 5FGBA 2GJZB 4XP4L 3B6SB 5I1GL 5I6XB 2XN9B 2A6DA 2BZDA 1MCWM 2Q87A 5HYJB 3BUYA 3VG0H 3GJFH 2GUOA 2YOCA 1A1MA 2Q8AH 2CK0H 3DV6A 1OGTA 4ISVB 4HV8B 2XICA 5I1EL 1EPFA 3A6BL 2OQJA 3BD4A 4IBLT 3VWJB 4DW2H 2I9LA 1W0YT 2ILLA 3OAUH 1YN6A 3RZCD 4EI5C 1EX0A 5D7KE 3CVHL 3L95A 1TIUA 2VDPH 4WEBH 4XNYH 5GRWA 3QQ3B 1H5BC 5T1LA 1CIUA 1QBML 3L6FA 4L8DA 1T22B 4LSUL 5DQ9B 2DQIH 4UQ3A 5KSBF 5KSVA 1GC1C 3QUXD 1JP5A 5FECA 4NC0B 5FO7B 4KKLC 4HIHB 3NA9H 4WDIB 4XHQA 4FTVD 2ZUSA 5HHNA 1IC7H 4NWTL 3SOBH 4N1EA 1CICB 3BEWA 4U0RC 4GG6A 1GOFA 1EVTC 3L3JB 4HC1L 1KXTB 3SDXA 1JGVH 2XZAH 5DF0A 1W72H 1A1OA 1YEEL 2ESVE 4N1CA 2D31A 3AM8C 3LD8C 5CKGA 4KKBC 3QFJA 1YQVH 1S9XB 2BNRD 3L5XH 1TZIA 2I07B 3PWVA 4GRMB 1S9VA 4NO2B 3ZTJH 1P4LA 4GS7B 3X17A 2PYFB 3FQRB 2IADB 1ZA3A 4BQ6A 1ORSA 1U95A 4KPHH 1RJLB 1T83C 3T0EB 1T4KB 3H3PL 1B0RA 35C8L 3OAZK 4YHIB 3LHPL 1OQOA 4WU7B 5HHPA 1T04B 5BO1H 5EPMB 4HUWB 4R2GC 5CWSB 4LHUG 3GKWH 4KRPD 5FFLA 1O0VA 5D7JB 1HHKB 4PJBA 1U3HD 2AJUH 4YE4L 3SGEI 2D4FA 2VDLH 1OWRM 5EORL 4JZNA 4W81A 5D2NA 1A6PA 3QH3A 5L88L 5DMGD 2DL2A 1U93B 3SQOH 4PJDA 3UEZA 3EYQC 2VL5B 3W0WA 1KCUL 2G9HB 4J7RA 4ZNEE 2GJ6D 3JV6B 3MV8E 3QUYC 2WNGA 3U7YL 4MCZA 5EU4A 5KVEL 4BFGA 1F4YL 4NQVA 4F8TA 4PY8J 1X5FA 2BJML 3WHXB 2Z8SA 4PJ9A 4R90H 4LSPL 4UIKH 2RIKA 4OCLC 1YECL 3QT2A 5B3JE 4MA1C 1LDPH 4TNWF 3O4LB 5CJXC 3B9VA 3WO4B 1QA9B 4OBRA 4I0KA 3K4AA 3NIFF 4Z7UF 1CLZL 5TFSH 4I48B 1SEQH 3TV3L 4P2RD 4XPFL 3VXMD 3Q6FB 2AABH 5EBLB 2VXVL 3IETA 3KLDA 3K1DA 2QSVA 2NXZD 5JMOC 2FO1A 4EN3D 4OIAA 3RZCA 1BHGA 1CXEA 4X6BB 1WSST 3QXAB 3O4OC 1KCVL 4HIXH 5KVDH 4WHCA 3JV4B 1H0DB 4XPAH 2YD3A 2YUWA 4X6DE 4ZS7L 5ANMA 1LGVA 1JGEA 3KLHD 2FX9L 3HNSL 5ITFB 1A4KA 2DLEA 4LLVA 5EU6B 4PGDB 3MRBB 5EUOF 4HJ0D 3RTQB 3S5LB 1BD2A 4HIEA 4RISL 1OHQA 4Z7WA 4HKXB 2FO4A 2AEQL 4PJIA 4NM4L 4HGKC 1AQDA 4KK6C 5EZLB 1XAUA 3BWUC 4FZEH 1G7JA 3GHEL 4CMMB 3CZFA 1PKOA 5E00A 1AHWB 1UGNA 2HJLB 3U0PA 5I1JL 3LRGA 1OAUH 3C08H 4MB3A 3O2DL 1NGYB 3HG1E 5CHNB 5KJRH 1L0XA 4BQ9A 4GAYB 3MJ8B 2L7UA 1JI1A 1NCCL 1TJHL 4DZBB 5C3TA 3S36L 4QHUA 2D7TL 1ZVSA 3TVMB 1EMTH 4X7EC 2VXTL 5LGJB 5GS0C 2AV7B 4ZDHB 2BVOA 3QPQD 3RWFB 3X14B 5IW3A 1XIWC 3KR3H 1JFQL 1BLNA 2PW1A 4U2ZA 4FFZH 3LRSA 1J8HB 3UMTA 1PKQA 5EDXA 3K7UA 4F2MB 1FVEA 4EZMA 4JKMA 1QO3A 4JAMB 1FV1B 4P2OC 1G9NL 3HAEH 3O3DB 4YXHL 3R1GL 4L3EE 4L8SB 3NAAH 1MCDA 2L0DA 1KB9K 4WNQA 3OKLA 5DURB 3WFDH 2K3TA 4LGPB 2IF7A 3Q1SL 3LEYL 1R3LA 4M93C 3T1FB 1HKLH 2DN7A 5IFHH 3GSNH 1P6FA 3V4UH 5EOQH 1XGRB 1GC1H 1VACB 3RIAF 2GSIB 2IAMC 1HYSC 3VU2A 3QCTH 5B38B 1G0XA 4YK4B 4X0KA 4G6FD 4HHAA 3BUYB 4LP4A 4PRPD 3L3IA 1A1MB 4MSWA 1IAOB 1WZMA 5CJBA 3MODL 1RZIB 1MCFA 3BWAA 4RGMC 1OAXH 3ZTJG 2XNAA 1JF5A 1D5BB 5SWQB 5ETUA 3BGMA 2J3SA 3EJYC 3VXSA 4TULL 2NY7L 1FNLA 4LLYA 2OQJB 4TVPE 3LKOB 5HD8C 2AK4B 3V6BR 3K46A 3QB7C 3R1GH 2ZKHL 3UXFA 3P11L 2PTUA 2VQ1B 3KJ4B 5FYLL 4IEFB 3PWPD 2NY0D 4X6CA 3SDXF 5FK9A 3FFCE 4BM7A 2DQGH 4K7FA 2ZCHL 5CD5C 5T33L 1J1OH 3ULUE 1JHKH 4QWWD 4CADA 3TFKD 2NXYD 5T1LB 1C16B 4ONGH 1F4AA 2P8MB 1CK0L 4MCYA 3GSQA 4JRWA 5GJTH 3VGGA 2F53D 3L6FB 4L8DB 3DMMA 1SM3L 4YO0A 4UQ3B 4GW5A 3GBMH 2VR4A 3IXAB 4MA8H 3V5DA 1A3RH 2ENSA 4GMTL 2VQTA 1MLCA 4JN1H 2W91A 1BOGA 2BVYA 3L9RA 3VFNB 4MLIA 1Q0XH 1HN1A 2W9EL 5EU5B 5DYOA 1OM3H 4LLDB 1DANU 2EDKA 1A1OB 1NMAH 4DGIH 2W59A 1FFOA 5I1HL 1XF1A 4G9FE 3HR6A 43C9A 4PJBF 5F7KC 4OGYH 3VFTA 1TZIB 4NP4L 3ES6B 3U9UB 4U1HA 2CXKA 1RMFL 3LEVH 4N8VA 2CPCA 2IFFL 5I18L 1F4WH 1AGDA 1II4E 2GJJA 2XWTA 1WBYA 5IEKA 5FAAA 4GXUN 4WW1A 5IJVA 4MNGB 4PJDF 1RK0A 1FGVL 5I66A 3OX8A 2X4UB 1FFPA 1KLGA 1OW0A 2Z31C 5CLWA 1B0RB 4KZEL 5CBAA 4G6KL 3LV3A 1ZVHA 5LXGL 5J0BA 4OSUL 4EBQL 4HIIA 1HI6B 1E6JL 1B6DA 2GCYA 1MHHB 5IG7B 2BXZA 4PGCB 4MJ5A 5C09A 5MEOB 5CIPH 1MEXL 2XQYG 2FSEA 2HVJA 4Y89A 4PLOB 4PLKD 1EJOH 3MBEB 2YS4A 3QG6B 5F9JB 4JZNB 1I8KA 1JN6A 3ZE0F 2FIKA 3HMXH 3FQNB 2A0LC 2MQCA 1KELH 2QQKL 2HJFA 4S1RH 1U8MB 3V4PL 5CZVL 5ENWB 4DZ8A 2VITA 1GAFH 1SY6H 5E5MA 1BVLA 3CFCL 3MLTA 3ELAT 4JO2L 3QNZB 4MHHG 3QHZL 3QCVL 4XX1G 3S35H 4CDGC 5FO8A 1ZHKA 2EYTA 4PRDB 1KB9J 4OM1H 4JY5L 5D9SB 3U4EB 1EXUB 5TQ0H 5DEFB 1P69B 1U8NB 4KUCF 5TGBB 3HR5B 1F4XL 1MFBH 4ZO8A 4K8RD 4P57B 1NCDH 3HUJA 3TEUA 3Q5TA 3TBYA 5JLZA 4K71C 4ELME 4HS6B 3G6DH 3GMLA 1PY9A 1T5WA 2R1XA 2FHBA 3FB6A 5GS0H 1WZKA 5HYQA 4WI4A 2VISA 1FNHA 4HSQA 4Q6IB 2HFFB 3ZYZA 1V5JA 2BY3A 3HAEG 1REIA 4K9EL 2QQKH 5DD5L 1KIPA 3ULVF 1U91A 4KZDH 3D48R 4BSVB 2F54A 3PWUA 1HXMA 5A3IC 1UWGL 5FXCH 5IWLA 2F53A 1ZK9A 2EH7L 4NJAL 1DANT 4LLVB 5HPMA 5KSAC 1N6VA 5C07E 1MNUH 25C8H 1V8HA 3QUXB 3FQXB 3P40A 4HIEB 3ZYOA 4NGHL 1H8SA 4Z7WB 1SEBB 1KFAL 3BZDA 3HTLX 1ORQA 4XNUL 1EEZA 4FTVB 5I1AB 1G7JB 2O5ZL 3CDFA 4HXAH 3CVIL 1AI1L 3KS0H 2HWZL 1RULH 4P4RB 3G08B 4OT1L 1MIEL 4FOMA 2Z8WC 3WKML 1LO4L 4I13B 1J9CT 5IW6A 3GO1H 2ZUTA 1QNZH 2BNRB 4M62L 3QFDA 4OLZH 2YK1H 1CGUA 1ZGLA 1K4CA 1YC8A 2E5EA 2VH5L 2D4DA 1CF8H 4POYA 3FCTA 4FNLH 3C6LC 4O00A 4JHBA 5E2VL 2CUIA 4ZPVA 1YEDB 4OLXL 5E24E 5HYSA 3WLBA 2W9DL 1BLNB 3IDNA 1NFIA 4NM8L 5HI5C 1MELA 2GYSA 3JWDC 4LAQH 5J6GA 3CAFA 4OZ4B 8FABA 1I8MA 5ITBH 4KRPB 3FMGL 3DSFH 3MROA 2M26A 1WGOA 4F7PB 3VD4A 2XIDA 1N59A 1U3HB 3MMEA 2GT9B 3S4SB 4TVSa 4PJ8D 5CP3A 5C0EA 3AREC 1ZLWH 2HFGH 1S7TB 5CEZL 2YMXH 4X6CF 2A2QT 4JGUA 4NNYB 4Q9BA 2P5WE 3TPUA 3V7AG 1G9ML 2GJ6B 4O2EA 4KUZH 4KC3B 4MSWB 2NNAB 1L9NA 1T1YA 3JV0A 4L1DA 2MNUA 3C87A 2XNAB 1NGZA 1AXSA 3QXDB 4ZXBD 1S5HB 2VAJA 4S1DD 5ETUB 3ZHKA 5J13C 3ZKSD 2YSSB 5IB3A 3GMPB 3VXQA 6FABH 4ZS6D 4YHYB 1AKJA 3H0TA 1L7IH 1QLFA 2ESVA 5B4MC 4HWBA 2CKBL 3GK8H 3HCVA 4P2RB 3CXDL 3VXMB 2YKLH 2YA1A 2X10A 4NN7C 3O6ML 4RNRA 2XTJE 3A67H 4QF1B 5C0RH 4JG0L 2HRPH 4XCFH 4EN3B 3MXWH 1U42A 4OCSL 1A47A 5ABDE 1I85A 3FOLB 5ESQA 5FOBA 4YO0B 2EDTA 3NCCB 2C9AA 3EYOA 4ZOBA 1G7PA 4PP2A 1MLCB 3BJLA 4HCRH 1GHFL 3MRFA 1D9KA 3LN4B 4L3ED 5I8CB 2EDLA 4JPIB 2BY0A 4LASL 2SEBA 5E6ZA 3MJ6A 1KCRH 3L5IA 3NFPA 3UYOD 5DK2B 2X4SA 4JE4B 3QDMD 5F1KC 3QJFB 1JGDA 2Q86A 2O26U 2QHLA 1UYWL 3REWA 3GUTB 3QNYA 5BW7A 3N1FC 2DBJA 4NHCH 2V6HA 1FFOB 1MWAL 4LSSH 4OCYH 4WU5A 4YHNA 5JXEA 3VGAB 1OP5H 5JMRA 2H3NA 1JWUA 2BOCB 2PO6B 2DM2A 1T0MB 1YEKH 4KMLB 5I76A 2IH3A 3MA9L 3S3SA 2WQRA 2J4WL 3SGEH 2UUDK 5J1AB 4AENB 2DD8H 2Z92B 3MV8A 1K8DB 3VI3F 1NEZA 4NKDA 1IZKA 2EZ0C 4NQSB 3TN0D 3FN0H 3W2DL 4DWHA 3OX8B 5ADPL 2R4SL 3D85A 4OQTL 3C2AH 2DWEB 3W5NA 3O45B 1KLGB 4MA3A 2L7JA 1JI2A 2ICCA 1DBBH 4UIMA 5I16A 3I50H 5D1XD 5ILTH 2ZNXA 3G5XA 4TVPD 3IJHB 1IC5H 4OZGE 1D6VL 2IWGA 4R4FH 1CVRA 2GCYB 5EO9A 4MGXA 4D94A 4MXWL 8CGTA 2ORBH 1BJMA 2FSEB 4GT7A 2EO9A 3CUPA 5MEQB 3P9MA 4XNQA 3FFCD 3IDXH 1KIRB 4GLRH 1UB6A 3V6OE 2OJZH 1JN6B 2X41A 3CMOH 4EIZC 1GGYA 1CU4H 3A6CL 2OTUA 2D7NA 3BPCB 4UDTA 5CJOL 1YY8B 5DJ0B 5E8DL 1CD0A 5KW9H 1FAKT 4QRPD 3ZE2E 1DFBH 2E9JA 3AFLA 4ZPTB 5K9KA 2I9TA 4X6DA 4WTZA 2VITB 4U1SB 4G6FB 4Y5VC 1BVLB 3FT3A 3UAJD 1YEHH 2R56L 4S1QH 4BZ1H 3UBXG 1KYOK 2VUYA 4PRPB 4NQDE 4J4PD 2VLRE 1VGKA 3FO0L 2EE9A 1RUMH 5H8DA 1MCOH 2E9WA 5DRXA 3QWOA 1NFDE 1RIVL 4OQ1A 5CKAA 3X12A 1FNSH 1MREL 1YNTB 4KXZH 1IJ9A 5FM5O 3PGDB 1A9BA 3O6LL 3ROLA 1T0NA 5D1ZC 3BQUC 4HMCA 1BZ9B 2OJEA 3MUY1 4G9FD 4G6ML 3SCMD 3HZYB 1PAMA 1JPFA 1FVCB 5DD3L 2BC4A 5HI3C 3HG1A 1D5IL 2UZYB 2QQNL 4IOIB 4TUKL 2ADFL 3ULSB 3PWPB 5HDQH 2NY0B 4NRYB 2IMNA 5ID1A 4U7MA 4HUXA 4EUPA 4WFFE 3TO4D 3LS4H 4OAWB 3HE6D 1DUZB 4KK8D 5KSUA 1WC7A 3VXPA 5IW1B 1SBSL 3JWDH 2NXYB 4HT1H 3MCLH 2F53B 4UV4H 1U8QA 3UPRA 1CR9H 2E9IA 2HH0H 3W39A 4KMTL 2FIRT 4ZUSA 5HPMB 2O5XH 4JM2C 4U1IB 3MLWH 4YHPB 2C3WA 1BFTA 4NZTH 4Y5YC 1CGWA 1GVIA 4BK5A 4PV8A 1KBGH 2FBOJ 3TH2T 4QXTB 4Y5XB 2X7LA 4HFWA 3W82A 5CJ5A 5DQJA 1OTUC 3B9KD 4L5FL 2VR9A 4H20L 3RWEA 1C5DB 5FM8A 1NEUA 2Z93A 3DWTA 3S34H 1JTPA 4NQTA 4ELKA 1XR9A 1MFEH 3MR9B 1CFQB 3QFDB 4WI3A 5DUBB 3IVKB 2FZ3B 2GY7B 3KYMB 5LBSL 5T5NF 4R7DA 1TJIH 4NCC2 3AS2A 4Z0BH 1SMAA 1OAQL 1KEGL 1M4KA 3OAYH 4ZFOB 3AAZA 1FL5A 4RBPK 3ESUF 1NFIB 6CGTA 4JHZA 2FB4H 2RHEA 3MXVL 4NC1E 5D1XA 1FRGH 1JJUA 1NGQH 1LEKB 1PLGH 8FABB 1I8MB 5DD6B 1YEIL 4PP1D 3D9AH 4KY1L 5D6CA 4QXUL 1BEYL 2V9QA 1KV3A 2D9CA 2FLRT 3MMEB 1DVFC 4FQ1L 3SKJL 3KPQB 3HNTH 4H25B 1EBAA 3TWCL 5MEPB 3OGCB 4DKEH 1MHEB 4MQXC 3CXHK 4P23D 3EOTL 4JKPL 4MJIA 2ERJB 2DOCA 4QGTA 3ECBA 3MJ9A 5C07D 4U31A 5IOPB 4R6UA 1P1ZA 4X8JB 4JFQA 4PPTA 1W8NA 5JQ6H 4F15B 4J4PA 4IIQA 1M1SA 1S8DB 1F90H 5JDSA 1NMBH 5DS8A 4ZSOE 4WWKA 3N9GL 1SJHA 2A74B 3PL6D 4P3CH 3R06A 4RFOL 4NUJB 4ODUB 3JVGA 4Q7DA 5MENE 3H9HA 3VXQB 43CAA 3IKKA 2IH1A 3PV6A 3V5KB 4G9FA 2R8SL 4YAQB 3CH8A 4W68A 3OF6A 1BM3H 2Q76B 4GRWB 4JDVA 1KYOJ 4HIJA 5CBEB 2P42B 2FJGA 2ICWJ 1B4JH 4OD3H 4V1DD 3MREB 5E8OA 3MNWB 4G42A 1GZPA 2J6EA 4XCYA 5TDOA 2WIIA 4G8GE 1T20B 1YEFL 4NO3A 3TESA 1AR2A 3NCEB 3S3PA 1CGVA 1MLBB 2HYMA 4PP2B 4XP5L 1CDIA 3QHFL 3VFWB 3QIUA 4J6RH 1IGTA 2IPUK 1KXQE 4YLQT 1DSFL 1NMCB 2JELH 1HH9A 3PP4H 4HH9A 1N6QL 4PJHB 3BP5B 1E28B 2CO6B 1B2WH 2SEBB 5CEXA 1OTSC 4LARH 2JCCE 5DWUH 2KZWA 5A1AA 2X4SB 4LKXA 3QDJE 4BH7B 3GBLA 2VWEE 1NJ9A 4Y4KD 4AL8H 3VD7A 4O5LL 5F3BA 5AD0A 3QEQE 1SHMA 2IH3B 1HYRC 5JOPE 2P5WD 3HPJB 1A7RH 4JQIH 2E7BA 1Q1JH 2P46B 1AFVH 4LU5H 5FYKL 1FDLH 1NEZB 3RDTC 5EIIA 2QBWA 4TUJB 4A6YB 2MSPA 2XXCB 4WENB 2YPLE 4K55A 1IM9A 1EEUA 3O2VH 5EUKA 1LNUB 5DHXB 3ZL4L 1HHHA 3RVVD 3RWJB 4X6DF 1S7RA 3T4YA 3MLSL 4QNPF 4JY4A 3AU1B 1NLDH 4PGBA 5IHUH 1JGLH 3TT1L 4NQXB 3C09B 4U6YA 4U05A 4Z78B 2XZQH 1ND0A 5EO9B 4YR6B 3DV4A 1A3LL 3JZ7A 4P46C 5I8OH 4OZFA 4PR5A 4MQ7A 3THML 2UYLA 4OZHB 1FFQA 1YMME 5FO9A 1A4JA 1HKFA 3CUPB 4XNQB 4HUUA 2XTJD 5DI8B 1X4YA 3P4LA 1AE6L 5F7MC 2OTUB 1T2QL 2H9GB 4PJ8B 4CRPA 1BVKB 4LPVA 4K3EH 4NDMB 3G5ZB 4P23A 2QADD 3MLRL 5E8PB 4EJ1C 4OTXL 3FT3B 4UUJB 2WLZA 4V2BA 2VZOA 1WBZB 3IFLH 1Z3GH 4XI5D 4M48L 4PJAE 4XB7A 1QPPA 1IAIL 5HHQB 4JO1H 4XBGA 3UTSA 3OXRB 4KJQD 5EA0H 3VFUA 3BKYH 3S9DB 4GBXD 3IU4L 2Z4QA 3LIZH 2P45B 5IBUB 1RZFH 4ZXBB 3VXTA 4YGVA 4RMQA 3EYVB 1OWWA 3LB6D 3TO2B 3VFRA 4PUBL 4FQXD 2OJEB 4UU9B 2Q1EA 2D0HA 3CXHJ 3LPFA 5DSCB 4JO4H 4X6FA 4WV1C 2DLTA 4N5ED 3VI4F 5GRXG 5F9DC 3IF1A 3FKUS 2DQTH 5IJKA 4PRBA 4HUXB 2X70A 3MRMB 2X4PB 3MRDA 5A16B 1G6RA 3I84A 5I2IB 4LLUA 4HX1B 1WC7B 5T1KD 3MCKA 5J12B 4NZRL 2W38A 4G6AC 3EYUL 3RVXC 3BPOC 1DDHB 1D6EB 5BQ7A 3GSRB 1CD1B 2VDNH 3WS3B 4PJCB 1LK3H 3QXWA 4TSBH 1DQTA 4U1GB 5DR5L 5KVMC 4PGEA 4CDHA 3BO8A 4FFWC 4YHKH 4K3DL 4L3EB 2WUCH 1G1CA 2VB5A 4XMLH 1S7WB 1BAFH 1XR8A 3U0TA 5JOFA 4OCXH 3QDMB 4Q2ZA 5C0BE 4CVZA 2BX5A 1FQ9C 1KEML 3LQZB 3OJ2C 5GRUL 2BSTA 3AUVA 2B8OT 5AEAA 2ADJA 1DUYA 2Z93B 1FZOB 1XGYL 3SGKC 3FT4B 4P5TC 2NTSP 3FO9B 1VESA 2BSRA 3L3GB 1I1YB 3G5YB 3ULUF 2C1PA 2Y07H 4IDJL 4M6OH 4NQDD 2EXYD 2VLRD 2DQDH 2FWOA 1I9JL 4KI1A 1LO2H 3IJSA 5ISZE 3MO1A 5EH1A 3TN0B 3HNVL 4UTAL 1WUNT 4WFGE 2Q7YB 3AAZB 4R26L 4WY7H 1AGFA 5GGRA 1QRNE 4N8CH 4YX2L 1JHTB 2ZUVA 1CE1H 4M00A 2IANE 2R2CA 3CCHB 2WLYA 3LSOA 1MCIA 2D03H 3D0VB 2YWZA 1R24B 2YD4A 3AVEA 2FJFB 4PBWD 4TN9A 5F21B 4PJEE 1ZANL 2F58L 2WBJA 2E7LA 3FB5A 5J8OA 1UCTA 1BQSA 2H32A 3MLUH 2F74B 3FFCB 4WFFD 3RWGB 1Z5LA 4Y4FD 3MRNA 1XGYH 3OR7A 4S11A 1TVBA 2DIBA 4HS8L 4QRPB 3LKSA 4KJPC 4XBPA 3HB3D 5HGDA 2J88H 5F9WC 5C0NC 2A9ML 3OAYK 3QBTB 3L5WB 5F93C 1UEMA 4NNPH 5FUCC 4ALAH 1X5KA 3F5WB 1LE5B 4OF0A 1MJUL 2IPKB 4JJ5A 1U8KA 1GGIL 2Q8BH 5D7SH 2MCPL 3J8F7 3SJVE 3DJ9A 4NWUL 1DLFH 3BE1L 4P4KC 2E8YA 4H26B 5ADOL 4K23H 3KPNB 1WWWX 5GIRA 3I3EA 3R06B 4JFHE 4W4NA 1XZ0A 4M1GL 2IBBA 1RZ8A 3H9HB 1UM5H 2VUOA 4EOWL 4HD9A 4HUNB 3DROA 4G9FB 1JE6A 1XGTA 2DQFA 3K1KC 4QHNA 4X8XA 3SCMB 5T3XH 3U1SL 3T08A 3KPSD 2FDBP 3SO3C 3VRIB 4URTB 5FA3B 4HIJB 3EFDH 1EGJL 1ZSDB 4ONHA 3TO4B 3HE6B 4UV7L 4XXDB 1VEMA 5T1KA 3RL1B 1I4FA 2XG5A 1DZBA 4JANB 5DJ6B 4ZOEA 5D1QD 1QP1A 5E2UH 3OHXA 5FCSH 1IKFH 4OZGA 3TZVA 4RIRB 4X4XB 1IGTB 1JF1B 1E4JA 1JUFA 2AI0H 1U6AL 5KVGL 5E95B 3RGVC 3LDBC 4X83A 3OJMB 2I5YL 4UAOB 4XCNB 4XRCA 1ZT1B 1CGSL 3V6OA 4PFEA 5ALBH 2UZIL 2XTLA 3HPLA 3RY6A 1NANH 4B53A 4S0SD 2CLRA 4XT1C 3B9KB 5T5FL 2E27H 3FFDB 3STLA 2VXQH 4WRLA 2R0ZH 5J4MA 2HLFC 1NAMH 1IEHA 4M8VA 5BZWA 2ZWLT 1QLEH 4RQQA 3NA4A 1H3UA 2BOBA 4FMKA 4JDTL 1MHCA 2VLRA 3O8XD 3QZWB 5T3ZH 1UJ3C 3BMVA 3RU8H 4XPGL 1XCQA 2FX8H 2C5DC 5EIQA 4OCRH 1KJ2B 3NZHL 2VC2H 2ZG1A 4DK6A 2AXHA 2I27N 1NFDA 1AP2A 4L4JA 1K6QL 1RUQL 3TCLA 5MEND 1IGJA 4RGNC 4U6YB 2PUQT 4LLQB 5JPNA 3DYMA 1Q38A 4G43A 2VDKH 2YBRA 4H8WC 5L0QC 2P24B 7FABH 5M95B 5DMJB 1KPRA 1WFNA 2IBGA 4MQ7B 4ELMB 2H8PB 1DN2A 4Z7OE 3K3QA 4RX4D 4G6JL 1AJ7H 5D70L 1FN4A 3BOVA 4ETQA 4LRIC 3IAQA 5GSVB 3P4NA 1OPGH 1YYLL 4P0DA 2XXMB 2XZCL 5F7EL 1FH5L 4G8GD 1FAIH 3FB8A 3LEXB 4UINH 4ZTOH 5T1DH 1I8LA 4HQQH 4P23B 1CDCA 1GGCH 5CLTA 5I1KL 1G1YA 2XKUA 4H88H 1U2HA 3OV6A 3GSVA 3D87B 5C07B 5E2TH 5E99L 5JO5A 4HWNA 3VXUB 2X40A 4EI6B 1OAKL 4XGZA 3KYNB 5L2JA 3DIFB 3JUZA 1QPXA 1I1FA 1SJVA 3GNML 1DBJL 1DQJB 2KBGA 3QDJD 2NY1C 2QQLH 4KQ4H 5I19H 3PL6B 5F9OH 2R2BB 5TH2A 5J7CC 4NCDA 4KJWC 4O2FA 4MXQD 1Q9OA 3QEQD 3UJIL 1NLBL 1X5LA 1X7QB 3HI6H 4X6FB 5JOPD 1UCBL 4D0BA 3V0VB 3FAWA 3CFDA 3E2HB 4RAUA 4AEIL 3PDOA 2VKWA 5HVFB 2HG5A 4R96B 3ARDA 1HQ4B 5BMFH 3WIIH 2X70B 2FECL 2R4RH 15C8L 4LSDA 1IILE 4V1DB 4LLUB 4YDIL 1H3GA 4NC2B 4Z18A 3MCKB 4IRJD 2APTA 2KPNA 4ODWB 4DEPC 3TIDA 3UTPD 3UDWC 5E1AB 5KN5A 3ARBB 1RFDL 5FKAA 3T4AA 2K7QA 3H7LA 1J8KA 5JW4Q 2GSGA 1MFDL 4K2UL 1KNOB 4OFPA 1MPAL 5K9JH 4QTIL 5ALCH 5SWSE 3SDCD 2P7TB 4LIQL 1ZLSL 4JFFB 4DFHA 1VEPA 2IGFL 4BKLA 3WN5C 1FZJB 1MAMH 1YMMD 1HH6A 3HE7B 1Z2KA 4F58H 5C6TL 1UWXH 5CCKL 3P77B 3QO0A 4OLYL 1T7WA 2Y36H 3WUWB 4Q2ZB 3GRWH 4CVZB 3BKMH 5INCB 4QKXB 4OUOA 4Y4KB 4X5WA 2WWMD 4TPRL 2RB8A 1HXYA 1DUYB 1OP9A 5IFJA 3ARTA 3NGBB 3R4DA 3CU1A 4OKVA 3SDDC 2P5WB 3DGCR 5B22A 4K3JL 4PJFE 2CGRL 2FWOB 2BERA 5IFAL 4XPHH 3MO1B 1TCMA 4J8RB 5DO2D 3UO1H 2X9XA 1EBPA 2EIZB 1T3FA 4MDIA 3LKRA 3QIBD 4K7PH 3TYFB 3WO3B 2BFVH 2RR3A 3GSOB 3GMRA 4P5KA 2EDOA 3C60B 5HJ3A 5F97E 2X2YA 3FTGA 2ZNWA 4WUKH 1U0QA 5IB4A 1ED3A 3SE9H 1QUNA 3FB5B 1D5XA 2OZ4L 3WL9A 2XTJB 4LHUD 4ZODA 2QTEA 1UJTA 1Z5LB 4LBEA 2UWEF 4G8GA 3ARRA 4DKFH 1C08A 3QUMH 1JWSA 5ACLA 3NFNA 3RPIA 5GGUA 1JWMA 5DD1L 2NY3C 3QEGL 4WI5A 2DWDA 4YBLB 3CDGB 3UTZB 3NCJL 4GBXB 2JCCA 2JB5H 4M3KB 3HZMA 2WK2A 5C0BD 3ZKMD 1I3GH 3NIGE 3U9PL 4AEHH 1FSKC 1XGUA 5ESVB 2VDML 1INEH 4FQXB 5JNYA 3DROB 2FYYB 1MAJA 3MRCA 3CC5B 4F57H 5CJ8A 5ICXB 3GHBL 2J5LB 4PG2C 3QA3A 5DTFA 3QRGH 2QSCL 3V6ZB 2DQEL 2RCSL 4TSAH 4ZFZA 2YPLA 2RFXA 5J6HB 4RRPA 1WF5A 3TF7C 4G8IB 2O5YH 3V0AC 1GCFA 5T1KB 3VD3A 4IRJA 3BAEL 1RY7B 4LEOB 1X6NA 4H8WH 3HMWH 2G5BB 5F71A 4KHXH 1PW3A 2X4NA 3JWOL 3TA3D 5I8KH 1VFOA 2FGWH 3N1QC 4UB0L 1MF2H 5FGCE 1CVSC 1JUFB 4K7PX 3SDCA 3UC0H 1NFDF 2VDQH 2QJDA 1BFOA 4LLAA 3VWKC 5C0CE 1OAZH 4Z6AT 4I77L 4O58H 4Y2DC 4L3CB 1FVDA 1HHIB 3DX7B 2CLRB 4QT5A 4APQD 5AZ2H 3HC3L 3NVQA 5JR1H 3UJJL 4U7KA 4XVSH 4QOKD 1S3KH 4OLUH 4Y7MA 4KJYB 2O61B 3ROOB 5JA8B 1AGBB 4NNXB 5BZWB 5GS1A 5DZLA 4JLRA 3KPLB 3VFMA 4YBHA 1F00I 2HN7B 5F7HA 5FEBA 3NTCH 1QTYT 2BOBB 1I8IB 4ZFOL 4NQDB 2VLRB 5A2IH 5DEZA 4I3GA 3MV9A 5HDBF 5FOJA 1WCQA 3PE9A 4U1LB 4ODVH 5CGMA 5JW3L 4M8QB 5DMKA 1BX2B 1KENL 2A83A 4LVHC 4NQUA 2HMIC 5J9PB 1NCWH 4JFHD 2COQA 3T3PE 1CFNA 4B7LA 3QIBA 1IGJB 5IGXH 4X5XA 3WFBH 4C55A 5CJQH 1JNNH 5B8CC 1I1AC 1T03L 1TCRA 1I9RL 1YYMH 1C5BL 1F58H 3LZFL 1BFVL 5MP6L 1C7SA 5KS9B 4AT6A 3BRGC 4QHMB 1EV2E 1YDPA 3QP3A 4NT6B 4Y4FB 1LP9E 4LEXH 4U6XB 1CFVH 1KC5L 3VXOB 2RBLA 5LWYH 3ZE1F 1G9EA 4NSKB 2Q6WA 2QL1A 3NBNA 3RVWD 1JPTL 3QHTC 4Z76B 4KDTA 2GFBA 3VFVA 1IAII 1I1FB 4K8RL 2JKXA 4HWBL 3ZDZF 3SE3A 5HY9A 5C0BA 2IQAB 4F80A 4YDJA 2OS7A 2Z0BA 4O2FB 2VLME 4PD4K 1VFBA 2BVPA 3WJLA 5HGAA 1YNLH 3W11D 5DHYA 3QDHA 3KHQA 3KPSB 3IB4A 4Q97A 3HS0A 3WEXB 3CIQA 1W0VA 4XVJL 2WANA 2ZP0T 1UWEL 3IU3A 2EYRB 4PLNC 2FJHA 1EJ6A 3F12A 1UC6A 5ISZA 3BKCL 3G6AB 1L4IA 1P53A 3VWJC 4Y16D 3TBWA 3TIDB 5FGRA 1RZ7L 2AEPL 4I5BA 4LCCC 2BDNH 4U3XA 1T66C 5FKAB 1OLZA 1QRNA 2FGZA 5IB2B 1G7MB 3FO2A 3PHOA 1NCAH 3INUH 1VB9A 4QRSA 4ZO9A 2IANA 2W0FA 4ODTH 5D1QB