4GKZB

Ha1.7, a mhc class ii restricted tcr specific for haemagglutinin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha chain of Class II TCR
publication title Minimal conformational plasticity enables TCR cross-reactivity to different MHC class II heterodimers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzB02
3TIEB 4HPYH 3S36L 1AQDB 1JPGB 1WLHA 3FCTB 4PB0L 3C6SA 1ES0A 2UWEA 3IJSB 1R5IB 1KTRL 2IALB 1IEAB 5GRUH 3KLDA 1QD0A 4FXKA 4M7JL 5BRZE 2W91A 2C3GA 2Q6WB 4L8SB 3VJ6A 3TBTA 1HILA 5E6IB 3D0LB 3NIFF 4F9LC 3MV11 4LQFH 1RIHL 2AJVL 2X4RA 3V6OE 3QCVH 3H7BB 4Z7NF 4OZGA 3THMH 5HVFB 4YFLI 2GY7B 4LSQH 4ZS7L 1EMTH 1A7QH 1J8HB 4APQA 1EO8H 1M05B 2BC4A 2CLRA 2G75A 5LXGL 2DQFA 4WW1B 1JE6A 4HK0B 1UM4H 3CFIC 1U93A 3DECA 3MLSL 5L2KA 3W82A 1DQJB 4UIKH 2NR6C 1TPXB 3SCMD 5GSVB 3X17A 2JJTA 3WL9A 3OMZA 1B6UA 4U6HB 1R3HA 3HC0A 1UXSA 4XH2A 1N2RB 4X99A 1R0AL 4PJGE 4Q97A 4GG6A 5EZLB 4RAVA 5EOCH 2W0PA 1QRND 1E6OH 4ENEC 3FT2A 2X4NB 3RU8L 3KPMA 2X4OB 1OW0A 5I15L 2EECA 3KPOB 1S7UA 9CGTA 5D5ME 2F19L 2XG5A 3GO1H 4X98B 3DROB 4M1GL 3L3IA 4UU9B 1R3LA 5IJKA 2DKSA 12E8H 1GOFA 4JJ5A 1EUTA 3P0YH 1AGBB 2DQTL 2GK2A 3FQTB 5DHVH 2XICA 3AROA 1MLBB 1QSEE 1NSNH 3VWJB 1XIWD 2W60A 3DGCR 4OQTA 1CTOA 2KQMA 3VG0L 3CZFA 3OJ2C 5E1HB 1NMBL 5IMMB 4NSKB 3I85A 1I9JH 2MHAA 4I0CC 1A1NA 1WTLA 3VXUA 2QEJA 1D5XA 4NZDA 2B1HL 2EC9U 2FJHB 4H5SB 1MCKA 2C3WA 2VISB 3MBEA 4GSDH 4WUKL 5FEBA 5D72H 1QBBA 3S36H 1TVHA 5EO1B 2V5TA 2A6IA 3NCMA 2AQ1A 4P46C 3GI8L 4PB0H 4O58L 4PJ9D 4G8GD 3E2HB 1CGVA 5H37H 3SJVD 4BZ2L 4M7JH 43C9B 5TDPB 2VLRD 2GT9B 3ZE1E 4OFYD 3TFKD 1L7IL 1FCGA 4NGHL 5FOBB 2NY7H 2MJWA 3BN3B 2R0ZL 1J05A 3O4LD 4OGYL 2APFA 1T6VN 4NO0A 1RIHH 5IK3A 2AJVH 1TTUA 3UJIL 3K2MC 1W0VA 1AGCA 5H35A 1NUDA 4ZS7H 3PNWA 1OP5H 3R06B 1FO0L 2VSDA 5GZOD 1HH9B 2BMKA 1ZGLP 1A7BA 3MLSH 3Q6GL 4QXUL 1E4JA 3KWWB 5KSBF 2WBWB 2P43B 3P40A 4MJIE 3CFBA 2BSSB 2XY1A 4YIQB 2DBJA 3I2CL 5ESQA 3BQUD 3V6BR 3L3JA 5EO9A 3RX7A 1H5BA 2AV1A 1W72B 3BDYL 3GSNL 3VGDA 2F9BT 1R0AH 5A2KH 4J3XA 3OHXB 1VGKA 2FJGB 4ZPVA 3RU8H 2XTJD 4NDMB 2MSPA 5I15H 3Q6FB 5EZJB 1TIUA 3FOMB 2OZ4L 4WFED 1P9MA 4QXGL 2F19H 3DGGB 4FQ1L 1T1WA 4Z7WF 3LSOA 4ZUSA 4M1GH 4LBEA 2XQYG 4W6WB 1TFHA 2HKFL 5F6HJ 1VFAA 4H0HB 2EIZB 4MQTB 2BERA 5F6IC 4LIQL 4IJ3C 3FO2B 2DQTH 1RUPL 3VFMB 3U79A 4KDVA 3RTQD 4PFEA 1YEDA 4IOIB 5FYLE 1T5WB 1PBYA 1ZV5A 4Y89A 3LD8C 4M6NL 4Q74A 1UM5L 3VG0H 3ARTA 2YZ1A 3MRQA 4QRTB 1NMBH 1I85A 3QUXA 5CD5C 1F13A 4IRSB 4NN6C 5E8PA 4YXLL 1FG2B 3QT2A 4YE4L 4HUVB 4ZOBA 4M8QB 1IRAY 3LQAL 2B1HH 3HG1B 5LAXB 4TVPL 2A6JB 1QEWA 3N1MC 1JZ8A 4WUKH 4PB9L 4PJ5E 3ULSA 3CH1A 3GI8H 3MJ6A 1FRGL 1NLDL 1T83A 4O58H 3T4YA 5J1SC 4R7NB 1FYTB 2PO6D 2EDOA 4RQQB 4BZ2H 1H3WM 2X89A 4WO4B 2ZNWA 2FSEA 1L7IH 4NGHH 3CFJA 1JNLL 2R0ZH 4HGWB 3PWUB 5IVXB 4OGYH 2H9GA 1GZPA 1DUYB 3HMXL 3CX2A 4MMXC 4RMWA 3UJIH 4E5XB 1S7SA 1UQSB 5E1AB 3UBXG 1T7VA 2WWMC 1A6AA 5KSBA 3RP1A 3OWEA 1FO0H 1NPUA 3W5NA 1JGEA 2D31B 4OLUL 2H32H 4HD9A 1HNFA 3Q6GH 4QXUH 4HKZA 4ZAKC 2JJSA 5F1NB 4WV1C 1U8IA 4OF0A 5JXED 3ULVC 3SGDI 5KSAB 4NPYA 2FHBA 4P2RA 3I2CH 2K1MA 2VLJA 1DVFB 5CWSB 1ZTXL 3AUVA 5EO0A 3SGDH 3GSNH 5H37G 4NNYB 2BX5A 3G5VA 2JK5B 5F3HB 4MYWB 3IF1A 4FQPA 4R4BB 1YNLL 2FR4A 4Z7WA 3B3IB 5I73B 4QEGA 4XXCC 3ZSSA 3EYOA 4Z5RB 2XA8L 2OZ4H 4H8WL 4QXGH 4ODWB 3FQUB 4FQ1H 1I8KB 4G42B 2IANE 3AREB 4F9PA 3BVNB 5DVOA 2HKFH 2X6MA 1SJXA 1NUFA 2RCSL 3CLEL 5CUSL 2N56A 4X7DC 3K0WA 4LIQH 2VXTL 2O5YL 1O7VA 1T2QL 2IC2A 5K9OA 3VFNA 4NN7C 3VMOA 1A6PA 3BX7C 4M6NH 3O6FD 5J57B 3MV7A 4G6KL 4TYUA 3WO4B 1UM5H 1J88A 1FN4A 3B2UD 3WFDL 3QIWB 2DYPB 2MNUA 3U0PA 4K2UL 4FTVB 1C7SA 4OCNC 3S34L 4JFFE 4YXLH 1QO3A 3HE6A 3V5HA 1C5CL 3DURA 4YE4H 3FO9B 1JCKA 2LAAA 4BH8A 1EFQA 1QLRB 4TVPH 5ENWB 1HXYA 4CNIB 3D39E 1S9WB 4PB9H 1B2WL 4ZFGH 3BP4B 4LSRL 3L3GA 5C3TA 1NAMB 3SE9L 3EYQC 1FRGH 1B4RA 3T2NL 4RNRA 1BFVL 2NY4D 4J7RA 4UINL 1X5HA 3L5WB 2CPCA 2H26B 5GJSL 1JNLH 3T3PE 3TVMB 4I4WB 4E41A 3QWOB 4R96B 2AJSL 3IS0X 4Z78B 3HMXH 4PGDB 4JZJC 5GGVL 1P5UA 3VH8B 3VFUA 1MAML 5DJ0A 5BV7H 3SKMA 4JFDE 5AYQA 5ISZB 3MJ9A 3SE8L 4RRPA 5DYOA 15C8H 4DCQA 4HZLB 3KYAA 1II4E 4QYOA 2FIKB 1KT2B 3S37L 2NY6D 1IGML 4RFOL 1ERNA 4OIBA 1S7XB 2BSTA 3ZYOA 1YNKL 4GKSB 1EV2E 5BS0D 4M48L 4G80A 1ZTXH 5JORA 4XZUB 3EGSB 2VXSL 5EFIA 4EN3C 5TQ2H 1RZKL 3MRDA 5MEQA 1LDSA 1NFIB 3IXAA 5T5NF 4HAGA 4G3YL 3OJDA 2V2WA 2YRLA 3NABL 1R5VB 4A2LA 3NIGE 4LAJH 4X4XA 1KGCD 1N59B 3QA3B 5IESL 1U8LB 4K8RC 2DMCA 5KZCB 4JEGB 2XA8H 3WLBB 4H8WH 4Y5YA 5HGDA 4CKVX 1JZ3A 3K2UL 2FWOA 2JCCF 4JPVL 4G43A 4NCC1 1UENA 3C5ZC 4DVBB 4GMTL 3CLEH 5DMGD 5CUSH 3PE9A 2VXTH 5H2BB 1BQUA 2O5YH 2WIIB 1DEEA 1Z9MA 1TCRA 1T2QH 4GBXD 2EXWC 5L8LB 1CE1L 4NQDA 3SE3A 4I48B 1P7QB 4G6KH 1FG9C 1S7QB 2IG2L 1MRDL 3WFDH 1Q9WB 3L3KB 1TVBB 4K2UH 3S34H 4P3WA 4G6ML 2OXGA 3E6FB 3H0TB 1KLUA 4JFEB 3T77A 1C5CH 5DJDB 1ZHLB 1AQDA 3QI9D 1QFWM 2AQ2A 3FCTA 1LO0L 3IJSA 1QRNE 1R5IA 3RWFB 2D7QA 2IALA 1IEAA 3BD4A 4NKOB 5F71A 2PR4L 2ZSWB 3KPSD 1B2WH 4OFVA 4LSRH 5KVGL 2VLLB 2ARJQ 4IMKC 1UA6L 3SE9H 2WNGA 1EFXD 2Q6WA 3T2NH 1BFVH 1PSKL 4K7PY 3UAJD 4UINH 3TC9A 4Z8FL 5E6IA 3D0LA 1GRWA 4HH8A 4R2GD 1PEZA 1JNHB 5CBEB 1SQ2N 5CINL 5GJSH 3H7BA 5IEKA 5FYKL 1I1RA 3KPLB 4LSDA 4HCRA 2I25N 1ZHKA 2AJSH 1J8HA 2ITDB 1M05A 3DETC 5GGVH 5DA0B 1A6VL 1N8ZB 1Z6JT 4WW1A 4CN1A 4HK0A 4LL9A 1VACB 1MAMH 3PF2A 1DQJA 4EIZC 5SWZD 1AO7D 5DRNB 2MQ3A 5GSVA 3MUY1 2ZOLB 3BZDA 3BKJL 2GQHA 3SE8H 4OV5B 3WLWC 1FFPB 4HF5L 4U6HA 2Z31D 3HZYB 4OZFB 4XTRD 3S37H 4C83B 1BJMA 1N2RA 1IGMH 4RFOH 3VGEA 3VFVB 5EZOL 1YNKH 2DM7A 5EZLA 3U9UB 3O9WD 4M48H 1U95B 2Y36L 4G8GE 3VXRB 3TO4C 2X4NA 2VXSH 3SJVE 5KG9B 2X4OA 4PG9B 1RZKH 4LCUB 3KPOA 4JO4L 4P46B 3OAUH 2APTA 4G3YH 5GGUB 1LE9B 2VLRE 3ES6B 2FEEI 5FYKD 3QR2A 3J8F7 3NABH 3DROA 4X98A 1WCQA 5IESH 1KB5L 4OF7A 2EEBA 4UU9A 3O4LE 4OAWB 4U1NB 2R0WL 2AV7B 3K2UH 3WSQL 4JPVH 2ED9A 1AGBA 3FQTA 4LK4A 3B8YA 3O2DL 3EZ8A 4GMTH 4UDTA 3LEYL 1YEFL 3LKSB 4PGBB 4WFGD 1E4KC 4BUGA 5ITBL 2V5RA 3QFJB 3QG6B 3VWJA 1ONQB 2J8UF 4GH7B 1HKFA 1Q8MA 1HOCA 1CLCA 5ID1B 5CEXB 1XR9B 1CE1H 2QR0B 4NSKA 5IMMA 1WQVT 1QTYT 3RWEA 1IKFL 5LVEA 3LN9A 4Y4KC 5HGBB 1Q1JL 4HBQA 2IPUG 5EU7E 2IG2H 1MRDH 4XHJC 4XPGL 3ME0A 4G6MH 2FJHA 4H5SA 2VISA 2VR9A 4WFHD 2DICA 4M3KB 3ETBF 5EO1A 3VD7A 4X7TB 5FB8B 1LO0H 5JHLL 2H1PL 1JZ7A 5T3XD 3TBSB 2VLMD 3SO3C 2PR4H 2XTJE 3ZT7A 5KVGH 1T66C 1UA6H 2OJZL 5TDPA 2GT9A 43C9A 4BSVB 4D0CB 1PSKH 2Z0BA 5FOBA 3QULB 4KKBC 4Z8FH 2J7LA 1J0HA 3GM8A 3O3BB 1W2KT 5CINH 2NXYC 4Q9CA 5J0BA 5FYKH 1MI5D 5IVXF 3UZQA 4M1CC 5F6IB 1HZHL 1I7UB 3R06A 4IJ3B 1HH9A 1A6VH 2APVA 1BQSA 3HPLB 1J87A 3T0XA 5C2BL 3LD8B 3KWWA 3MGTB 2R29L 1FL6B 3LB6C 2BSSA 5C0GB 4YIQA 3BKJH 3OV6A 4NN6B 4HF5H 1V05A 2WQ8A 4PJ7B 4EI5D 1W72A 5F1OB 1RSFA 5EZOH 2BNQD 3OHXA 5A3ID 2Y36H 4OGXL 1IZKA 3JXAA 5DJZB 3GZKA 4MX7B 3Q6FA 4JO4H 4LIQE 3NBNA 1OVZA 5EZJA 3X13B 3FOMA 3ZYZA 4PTUB 3DGGA 2PYED 4TUOB 1AY1L 2P8LB 4P4KD 4P49A 2D7NA 3N1QC 3P0VH 1KB5H 3V6OC 4PJFE 4PJAF 4PJIF 4KRNA 4NNPL 2QADD 3LKRB 2EIZA 4DKFL 2R0WH 4GAFB 3WSQH 4LRIC 3FO2A 3VFMA 5I30L 4ZUTB 3OJVC 3LEYH 1YEFH 5D1ZD 3WKML 4IOIA 1T5WA 2W38A 1WAAE 2YA0A 1EDQA 4PJHE 2VLKD 4AL8L 1U8OB 3IJHB 1CU4L 4QRTA 5CEZL 4IRSA 3RDTD 3UX9B 3ZKMD 1IKFH 3UYPA 3W39B 1SMOA 1Q1JH 4L4VD 1J86A 4MWFB 4ZAKB 2Y1VA 4HUVA 4M8QA 4WV1B 3HG1A 4XPGH 3S35X 3BGFC 2A6JA 1I9EA 1OAYL 3EFDL 5DEGB 5HGAB 5C0AD 1JWSB 2MFNA 3MRJB 4KJWD 1F3DH 4MB4A 4KKCC 4F8QA 5D1XC 5JHLH 2H1PH 4MA8L 4LU5L 5E6ZA 1JNNL 2C3XA 4KGJA 2JB5L 3RVXC 4R7NA 1FYTA 5FUZL 4RQQA 2HTLD 1CICC 4WO4A 2X1WL 5IVOA 5CMAB 4HGWA 3PWUA 3B9AA 5IVXA 1X3DA 1FBIL 4K3DL 2NW2B 3UO1L 1DUYA 1GPOL 4MA1C 4OD2A 1CIUA 4JJHA 5FM5O 3MRHB 5CEZD 1KJ3L 1UQSA 2Q20A 5E1AA 2E9JA 1BQHG 1G7HB 1HZHH 3RPKA 5DXWA 2D31A 1YYLL 4NN7B 5C2BH 2R29H 1IM9D 5F1NA 4G9FD 1XR8B 2FEDD 5JW4R 1YEHL 4QGTA 3WFCL 2HH0L 3NMEA 3TA3B 5KSAA 1DQML 1E27B 4LSUL 1DVFA 4KKNA 5CWSA 4RDQF 1UC6A 4NNYA 1N3NB 4KJYB 1VEPA 1JGVL 1YUHB 2JK5A 5F3HA 4EXPX 1IL1B 4R4BA 4OGXH 3B3IA 4LVHC 3IFNL 2VQ1B 2JIXD 3P3YA 1EH9A 4Z5RA 4BQ9A 1KPVB 4ODWA 3FQUA 1I8KA 3AREA 3MA9H 4KMTL 4CN6A 3BVNA 3F62A 2GJZB 4NNPH 4NRYB 4DKFH 1RK0A 2WWKO 3WIFB 5I30H 4F2MB 4JZJB 3WKMH 4Z7OE 1Q9KB 4KRMB 4QHLB 4QOKB 5I1GL 5ILTL 1U3YA 3T2OA 4Z76B 1WTGT 4AL8H 3QIWA 4XPFL 2DYPA 4N8VG 3FFCD 3MX0A 4FTVA 5CEZH 2LFGA 1FPTL 4WI9A 3FO9A 4YAQB 1QLRA 3DSFL 2R56L 5BS0E 3WUZA 5ENWA 4CNIA 3MRNB 1OAYH 3EFDH 1S9WA 4F7EB 3BP4A 3DX7B 2DS4A 1NAMA 4Q58C 2DI8A 4MA8H 1R5WB 4LU5H 1JNNH 4RFNC 4EN3B 1KGCE 2JB5H 4BM7A 1I75A 5FUZH 3L5WA 1ZSDB 4MVBC 2H26A 3TVMA 4I4WA 3ARGD 2NY5L 3QWOA 2R9HD 4R96A 4UV7L 4QHKI 1FBIH 4K3DH 1KULA 3UO1H 4Z78A 1GPOH 4PGDA 3C5ZB 3VH8A 5JW4Q 2CDFB 1KJ3H 1XH3B 4KKLC 3BKCL 3SGKA 2GUOB 4OSUL 4RISL 3RI5K 3KR3L 3V4VL 5ISZA 1YYLH 2GSIB 3FQNB 2GTZB 4HZLA 2WLZA 2FIKA 1KT2A 5HJ3B 1YEHH 5D7IF 3WFCH 1Q9OB 2HH0H 1S7XA 1DQMH 4OI8A 1K8IB 2P46B 1LVEA 4LSUH 4GKSA 1EEQA 4FZEH 4RMSA 1YY9C 3QUKB 4XZUA 4OTXL 3EGSA 3KPSE 3HPJB 1K2DB 1FFOB 1NFIA 4NN5C 2VR4A 5J89A 1JGVH 5AYUL 2CUHA 2YD2A 1R5VA 2ZCLL 3IFNH 4FMKA 1N59A 3QA3A 1U8LA 5FCSH 3HI6L 3WLBA 2ZPKL 1LGVA 4P57B 5HI5C 4KMTH 3AC0A 4F9LA 5DUML 1ZGLM 1PKQB 3ZDYE 4YZFE 4DVBA 2EEDA 5GRVK 3ARBC 4M5YL 2DL2A 4WHYH 5FOJA 3HFML 2M1KA 1GHFL 5H2BA 2WIIA 4DAGL 4JN2B 4RMUA 5D7LB 1AO7E 1TQCC 5DJYB 5F9JB 4I48A 1P7QA 4KROB 5A1AA 3DHJA 1S7QA 5I1GH 5ILTH 1UZ8B 5IB4B 4L4TB 4LDLB 4PIRF 4Y19B 1JI2A 4XPFH 1Q9WA 5EUKB 2X70B 4B50A 3L3KA 1TVBA 3ZE0E 5IMLB 3PWPB 1FPTH 2CKNA 3E6FA 3H0TA 4JFEA 5DJDA 4EUPB 3ARDC 1KCSL 1ZHLA 3DSFH 2R56H 1RMFL 1MFEL 4R90L 3RWFA 1PX4A 4NKOA 2ZSWA 2WMPA 1ZLVK 2VLLA 4MD0B 5B22A 5FYKE 3TO4B 5TF1L 4ELMB 4BZYA 5ID0B 1J0ZA 1KCUH 4JE4B 5A2JH 4OFKA 3VXPB 5C9JB 4G7VL 4CADA 1JNHA 3OSKA 5CBEA 4KKAD 1JZ6A 2K7PA 2F5AL 4LLDB 2NY5H 3KPLA 2ZP0T 4XNZC 4NHCL 4U3HA 4UV7H 2CR6A 4EBQL 4WFGE 2ITDA 1N8ZA 2YUXA 4CVWA 1VACA 1I4FB 3C8DA 1VESA 2LV4A 3BKCH 5EU3B 5KSUB 4OSUH 5BCAA 4RISH 5DRNA 3RIAF 1FL3B 3KR3H 5D1QC 4PBXA 3V4VH 2ZOLA 1WFTA 2JB6B 5HYFA 5GGVY 2GJ6D 4OV5A 3BN9C 3OB0K 4FXLA 1FFPA 1JPTL 3EYSL 2NY3C 3HZYA 4Y4KB 4OZFA 4C83A 1N6QL 3LY6A 2GKIA 3W11D 1KFAH 4RGNC 2D7MA 3Q0HA 4WFHE 1BZQK 4GRMB 3VFVA 1ZGLB 4UUJB 1BOGB 4OI9A 4DKAA 3U9UA 3AVEA 1F45A 3CMOL 5F8QC 2KZWA 5T3XE 4PJ7F 1U95A 3VXRA 4NCDA 4OTXH 1EBAA 4EI6B 5KG9A 4PG9A 4LCUA 4LSSL 4P46A 3HB3C 2MMXA 5GGUA 3SO3B 5AYUH 1LE9A 3ES6A 4DGIL 4QHUB 2ZCLH 4ZTOL 3RWCB 3EKCA 3HI6H 4U1NA 2ZPKH 3RUGE 3Q3GB 1X4ZA 2AV7A 4P2RD 1VKXB 2VLJD 4Y2DC 5DUMH 1MI5E 3HUJE 3QCUH 3M45A 3LKSA 5DLML 4PGBA 4M5YH 3ET9F 2NXYB 1YQVL 3HFMH 3QFJA 3QG6A 3QO0B 1GHFH 1ONQA 5B4MC 2ICEB 2YWZA 4DAGH 5ID1A 5CEXA 1WWBX 1XR9A 5DK3A 2YUZA 5I8EB 2QR0A 4KTEL 5CHNB 1A0QL 2IFFL 3UPCA 1KPRB 5T3ZL 5HGBA 1Z0NA 1UXWB 1U2CA 2Y5TB 4R7DB 3QQ3B 4UTBL 3SOBL 1KCSH 4X7TA 5IQ9B 2BNQE 3O6ML 5IVZB 5FB8A 1RMFH 3ULVF 3TBSA 1MFEH 4FS0A 4R90H 2VIRB 1NBQA 3STLB 4N1EA 1A4KB 5C0BD 5K9JL 1D3CA 1P84J 2VDRL 4N0UE 5BRZB 4BSVA 4D0CA 3WNPA 2PYEE 4I9WE 5TF1H 4PRHD 4YX2L 3QULA 4HDIB 1VSCA 3WUWB 3HE6D 3DYOA 1VCAA 4G7VH 4WHYG 2OMNA 3O3BA 7FABL 3MUHL 4PP1D 1JPFB 2F5AH 2D7OA 2ADGB 4NHCH 4EBQH 4U0RC 1JF1B 4R97C 1I7UA 1PW3A 4K3EL 1TNNA 4YXKL 3SCMC 1OTTD 3HPLA 1ZVSB 2VLKE 4ORGB 1BGXL 3MGTA 1FL6A 3T0AA 3ZYIA 5C0GA 3U0WH 4L4VE 4HMCA 4TNWF 2DLIA 3WXVL 1JPTH 3S4SB 2AJ3B 1BECA 1N6QH 4PJ7A 3G6JE 5C0AE 1BMGA 3AFLA 4FQJL 3BGFB 4PJGB 3ULUD 2AKRB 3CMOH 4D94A 1OGTB 1RI8A 5EIIB 1F4AA 5DJZA 4MX7A 4PRBB 4LSSH 5D1XB 1GGBL 2ADIB 4JGMA 1L4IA 3X13A 2WAHA 5I1AB 4PTUA 1PY4A 4DGIH 4TUOA 2P8LA 4ZTOH 2D7PA 1CICB 1XFPA 1N6UA 3LKRA 2G9HB 4Q9QL 4MNHB 1XIWC 4ZUTA 5CEZE 1B0WA 4MA1B 1P53A 1KCVL 5DLMH 1YQVH 4GKOA 4G9DB 1N64H 1U8OA 1MWAL 3IJHA 1JN6B 3VI3E 3I9GL 4M00A 4XPHL 5ELIA 4G9FE 4KTEH 5BZWB 4EZMA 2VZTA 1A0QH 2IFFH 3W39A 3PL6D 5F7UA 3G6DL 3OKOB 1WIOA 2VKXA 4MWFA 4PJXE 5D8JL 4ZAKA 3JUZA 4MXVE 4WV1A 4HULB 1F00I 4RAHA 5HHMD 5AZEL 3NACL 1SYSA 5DEGA 5HGAA 4UTBH 2CKBB 5GIRB 3SOBH 4PJ9C 4P4RB 5JW3L 4EDXB 1JWSA 3TV3L 3MRJA 1T2JA 3O6MH 3TP4A 1MELA 1SEQL 3TFKC 4YHYC 2I60L 5J4MA 5C08D 3BD5A 5K9JH 2QSQA 2VDRH 2YEZB 4LVHB 4XXCA 4YX2H 5CMAA 1RJCA 4MNGE 2NW2A 5B3JF 3LOWA 7FABH 1T89C 5L6YL 1R6VA 5GZOC 4H25B 5HYEA 4HUNB 1FNLA 3MRHA 5KVEL 1G7HA 3AS0A 3DXAD 2E27L 3V8OA 3MNZB 2KL6A 4K3EH 5TPWL 1OAXL 3MROB 1U9KA 4YXKH 1UGNA 3QNYB 4Z9KB 4HT1L 3VFSB 1YEGL 3H9ZA 1BGXH 3FFCE 5IBUB 2FZ3B 3RKPA 3BQUC 1XR8A 4MJIB 4X83A 1CDUA 1PY9A 3BDBA 3TA3A 4JZOB 3WXVH 1KSRA 3WV0A 1IC1A 3B9DA 3K3QA 5BOPA 2EDQA 1KJMA 1N3NA 2V9TA 4KJYA 4FQJH 4HFUH 5HYIA 1DCLA 2XTJC 1YUHA 1CVSC 3QDJB 4JKKA 3V0VB 1MCDA 4Q6YA 1IL1A 3ARQA 2VQ1A 1GGBH 4WI8A 4RFNB 3VFOB 1KPVA 5FGRA 5JPMB 4FQQB 4YC2C 4G6FD 3EDKA 3UDWC 2GJZA 3RTQC 2G5BB 4NRYA 1T4KB 1Q0XH 2IPTL 4Q9QH 3WIFA 2ZZUT 2I27N 3NIDE 4F2MA 4DUVA 4JZJA 1KCVH 3MLZL 2VE6B 1DQQB 1Q9KA 4QHLA 4QOKA 5D2LE 4Z76A 1MWAH 4X6CF 3I9GH 4XPHH 1U0QA 1OWWA 4CVUA 1DZBA 4YAQA 4ZYKB 4WI5A 1BIIB 4LVOC 2DMKA 3MRNA 3NACH 5AZEH 1LEIB 4F7EA 4PJ5B 1UB5B 3DX7A 4C54A 1WISA 5JW3H 2HA1A 3TV3H 2PO6C 4NQTA 1F42A 3MJGX 1R5WA 2CXKA 5DA4A 2J2ZA 2AK4D 4EN3A 1U92A 1SEQH 4NN5B 3MJ7B 2I60H 3S8WA 4X7SL 5CJBA 1ZSDA 3ZKSD 4ELMF 4ODSL 1HWGB 2DLGA 2Y72A 2E8YA 1MFBL 3QNZB 3VFGL 3G5YB 2X41A 3C5ZA 5L6YH 3MFFB 5DVNA 3MC0A 3ARBB 2CDFA 1XH3A 5KVEH 2MOVA 2ADJB 1HYRC 2E27H 3BW9B 1XAUA 2GUOA 5TPWH 4DUXA 4RX4D 1OAXH 4X4ME 5JXEC 4HT1H 2GSIA 4ISVB 3FQNA 1XGUB 2GTZA 1TQCB 4HFWB 2H41A 5CBAB 3MYJB 3GSQB 4OF5A 4AENB 5HJ3A 3F58L 1Q9OA 3OXRB 1K8IA 4KDWA 1CDIA 5ADPH 4TTDD 4AIXA 4XVJL 3RPIB 3ARDB 1T7WA 1I8IB 3QUKA 3HPJA 5I76B 1K2DA 1FFOA 4Z0BL 4CU6A 2PN5A 4CU8A 3DX8B 1YJDL 2ICES 5BV7C 3OF6A 5J11C 4IMKA 1PVHA 3WXWH 3HKFA 4P57A 4YXHL 5E8EB 2IANB 1T0MB 3BP7B 5JOPD 4P5TB 1PKQA 1A3QA 4RRPG 1ZLUH 3M8OL 1J10A 5AZ2L 2IPTH 5IHUL 3O6FC 4XNZB 4Y1AD 1CG9B 4JN2A 4KZEL 5D7LA 3B2UC 3MLZH 2YD8A 5DJYA 5F9JA 1CK0L 2R1XB 3U4AA 2IADB 4LPTA 1UZ8A 5IB4A 2B0SL 4L4TA 4Y19A 3WNNA 1Y18B 2LAGB 2GJ6E 4NJ9L 5EUKA 2X70A 3DRQB 2F53B 5IMLA 5BZDB 2X1XR 2FO1A 3PWPA 4JFFB 5D1QB 4LSTH 4EUPA 1FGNL 1JGLL 2HWZL 4H8WC 4RGNB 3D39B 5F9OL 2BCKB 2NY4C 1G7IB 3C9NB 4OFPA 1QPPA 4MD0A 3TO4A 3AMKA 4QRUB 35C8H 5HHPB 4ELMA 5ID0A 1NUGA 4ZD3L 4D8PA 5D93B 3I3BA 2HT4D 2E9BA 3VXPA 5C9JA 4XP6L 4X7SH 1PX3A 4P2RE 3L6FB 3KYKL 1A21A 1D5IL 3BMWA 2R0KL 1BJ1H 4ODSH 3FB8B 2VLJE 4LLDA 3QXVA 4UMGA 4X7EC 1MFBH 5B3NA 3FHAA 3VFGH 1WJ3A 1MQ8A 4Y2DB 2IF7A 1P69B 1DE4B 1V8HA 2ICCA 5C2UB 1I4FA 2BVPB 1E4KA 3F5WB 5L9DL 2ATKB 5EU3A 5KSUA 1LWRA 4JFDB 1FL3A 1HQ4B 3MLRL 2JB6A 3ESVF 4P2CG 2D0HA 2NY6C 2P8PB 3PUCA 1QBLL 5JZ7D 1TITA 3QDHA 4Y4KA 1P7KB 8CGTA 4BSJA 5GS3A 4R4FL 3F58H 4FABL 4Y7MA 1S8DB 4GRMA 1ZGLA 4U1GC 4UUJA 1BOGA 2ZNXA 5HBBA 2OR7A 4K94H 4XVJH 3DV4B 1EAJA 4EI6A 5TE6L 5C0BE 1LD9B 4PJGF 4Q6IB 4A2MA 5DHVB 4QHUA 6FABL 5J12C 1IMHC 5HHVL 1YJDH 3RWCA 2AJYL 3MODL 2VYRE 5DRZB 5L8JB 5D5MF 5DMGC 3SKUD 4YXHH 3Q3GA 1VKXA 4M4RA 1DVFD 1FZOB 1K9TA 5C0IB 5LG1A 5DUPL 3M8OH 2V5YA 1MCIA 4R9HA 4GBXC 4DZ8B 5AZ2H 4HLJA 3QO0A 5IHUH 2ICEA 2FBOJ 4FQIL 2WK2A 4U0RB 1L9NA 4R97B 1CDCA 3D18B 3M07A 4TNVF 4KZEH 5T5NG 5I8EA 4WGWB 5CHNA 3SCMB 1OGAD 1CK0H 2I5YL 4L9DA 1KPRA 3LS4L 1RUAL 3IXTB 1RZKC 2B0SH 3S5LB 4KK8D 4QNPE 4LASL 1UXWA 1TXKA 4NJ9H 1NAML 2A6KB 1RQ5A 3QI9C 4Z18A 2Y5TA 4R7DA 3QQ3A 5IVNA 4F7MB 1FGNH 3KJ6H 2BP3A 1JGLH 4ZUWA 3LH2L 5E24E 2HWZH 5IQ9A 3AY4A 4DKEL 5IVZA 1WEJL 2YWYA 1QRNB 2VIRA 2CIKB 1S7WB 4RA3A 3STLA 3UAJC 5F9OH 1A4KA 3WN5C 3ZMRA 1IGJB 5BRZA 2EE9A 4R2GC 1WCBB 3QIWD 2NTFB 1FZJB 3FZUD 4HDIA 3GDBA 3WUWA 4J3WA 1KB9J 2CK0L 4XP6H 3ZE1F 3KYKH 1D5IH 3V6OA 1WSST 2R0KH 3BPNC 1JPFA 1K3ZA 2ADGA 3JZ7A 2EKJA 1JF1A 4LRIA 2HLFD 2VDKL 2XOTA 1XIWB 3C2AL 2PKDA 1EZVY 1ZVSA 2DQEL 3P9LB 4CGTA 4ORGA 3MZGB 5L9DH 1BJ8A 3U30C 2Z31C 4XTRC 3MLRH 5GRVL 3CK0L 3V0AC 4LRNL 4FP8L 1QBLH 2Y5EA 3SY0B 3S4SA 5HHME 2AJ3A 2LTQC 3O9WC 4R4FH 4FABH 3BKYL 4NFDA 5D71L 4M9OA 3QO1B 4PJGA 4MHHI 2AKRA 4Z0XB 4PJ9B 2NQCA 1OGTA 5EIIA 3KPTA 3CLFL 3JV4B 4LSPL 3SJVB 4PRBA 5TE6H 5C08E 5D1XA 3M17B 2ADIA 1J9CT 5ISZD 1YMMD 1L6XA 5I1AA 2VLRB 4P5MB 5SWQB 3KVQA 6FABH 1MNUL 3L7EB 3FMGL 5HHVH 2AJYH 1DP0A 3MODH 1CICA 3CD4A 5C09D 5E8NB 3O4LB 1TLKA 3QEQD 1NGPL 4TUJB 4TQEL 3IU3B 2G9HA 4NIKB 3MUGB 1FLTX 2D0GA 4HIIB 4MNHA 5GS2D 5HPOA 5DUPH 5HVWA 1TMCB 4QY8B 3DXAE 4ORZC 5DVKA 4JHBA 3O4OC 3P30L 4G9DA 3VXOA 2PNDA 4PRDB 3KXFD 2XZCL 1JN6A 4UOW0 4ODVL 5KZCD 3UZEA 3B9VA 5BZWA 3MLPA 5J7CC 2V17L 3LS4H 5GRZA 3OKOA 4K23L 1Z0MA 4LASH 2EE2A 1NAMH 1RAMA 4NWUL 1KUMA 2CKBA 4K71C 5GIRA 3NPSC 4P4RA 1T0PB 4ODHL 4EDXA 1DLFL 1ZT7B 3LH2H 4DKEH 3LKPB 1WEJH 4S1DD 5ESAB 2IH1B 5AAMA 5FKPA 4GW1B 1WGOA 2XTJB 3PQYD 3U83A 4KJQD 5HD8C 4K3JL 3OKMB 3N06B 2YEZA 1JZ4A 1EIBA 1F3DJ 3GIZL 1I8LC 1FO0B 2EEAA 2CK0H 2C4XA 2H32B 2NZ9D 3BHBB 3QXAB 4XBEL 2NY2D 4YC2B 4H25A 3RTQB 5KS9E 3MNZA 2JJWA 2NY1C 2VDKH 5I1CL 3C2AH 3N1GC 3MROA 4YR6B 1ORQA 2VZUA 3QNYA 2DQEH 3VFSA 1NCBL 1F02I 3L95B 5GS2H 2FZ3A 4LQ1A 2AP2A 3MCKB 5F21B 3GSNB 3VRJB 4MJIA 3WHE1 5BW7C 2YPLD 2ICWJ 3CK0H 4JZOA 2L4OA 4LRNH 4WI2A 3UJJL 4FP8H 4EI5C 4YHPB 3GJFA 3UC0L 3S88L 3U7WL 1MJ8L 5A3IC 3BKYH 4M8VA 4MD5B 5D71H 2VMFA 1NC4D 4LVOB 1N0LA 4P3CL 5AEAA 3QDJA 3V0VA 2AK4E 1E6JL 1O0VA 2DJSA 4MQSB 3CLFH 4LSPH 1D5ZB 2PO6B 4P4KC 1QFWL 2K9UA 2C3HA 1YMHB 5DFVD 5JPMA 2APBA 4FQQA 2AS5M 2QADC 2N4IA 1MNUH 3FMGH 3VA2C 4X6FB 4PJFB 2G5BA 1NGPH 2WP3O 5D1ZC 3CX5J 4TQEH 3U46B 5CJ8A 5AG8A 1T4KA 1ZLVH 3ABZA 2W07A 3L3DB 1MREL 3WS6C 2VE6A 1DQQA 3P30H 2DLEA 4G8FB 2JKXA 3RDTC 4PJHB 3HMWL 2XZCH 3ZKMC 3QEHB 1N5YL 4R8WL 2BNUB 4U1MB 4ODVH 4M61B 2V17H 1CD1B 4K23H 4I2XB 1BD2D 4CW1B 4V2CB 3C5JB 4ZYKA 1BIIA 3PXJA 4NWUH 4KJWC 3IDGB 1LEIA 1VHPA 3CAFA 4LLUB 2E8ZA 4PJ5A 4UBDD 1UB5A 3ZL4H 4ODHH 4MHHG 1DLFH 4GW5B 2HTLC 1DSFL 1G6VK 4KU1A 5EH1A 3MJ7A 1OL0A 4K3JH 2NX5D 3E0GA 3RVWD 5BV7B 3G08B 5J11B 5JOPE 3GIZH 5HDBE 2WUCL 1U8JB 4ZMAT 3QNZA 3G5YA 4YFLF 3RJQB 1MCPL 2UUDH 3T3PF 3MFFA 1RUKL 4Y1AE 5CS7A 3ARBA 2A38A 1MAJA 4FG6D 2ADJA 3BW9A 5K9KB 4OZFH 3O6FB 1OF2B 3OZ9L 5I1CH 2D7TL 3JV0A 2FEDC 2ZUWA 4PGCB 3SDCD 4FQ2L 4ISVA 1AC6A 1XGUA 4HFWA 4WTWA 1NCBH 5CBAA 3MYJA 3GSQA 1IZJA 1KJVB 2R2HA 4QHKJ 3T0WA 3DUHA 4LCCC 4M02A 4Y0GA 4AENA 1MFCL 3OXRA 3UJJH 5IP4A 5E4EC 3UC0H 3S88H 1JPSL 2O61B 4NM8L 3RPIA 3U7WH 1MJ8H 1MCBA 1I8IA 3ARDA 3IFLL 5I76A 4P3CH 4NC0B 4KUCF 1QFWI 5GHWL 2VRAA 3VH8G 1FNGB 3HRZB 3MZTA 3DX8A 2NY4B 1UWEL 1QFWH 5E6YA 1F4HA 2V6HA 1GOHA 1GJIA 4XX1G 5E8EA 2IANA 1T0MA 3BP7A 2Q7NA 3NIGF 4LVEA 2HVKB 4V1DD 3ARXA 4X9IA 3O3EB 1CG9A 1IJ9A 3LN4B 1MREH 1R3IL 3GJEB 1FYTE 2R1XA 3CPLB 1A22B 4N5UA 2IADA 4POUB 3HMWH 4G8EB 2BK8A 1N5YH 3JTSB 4R8WH 1Y18A 5IJKC 5A2IH 1GZQB 3DRQA 2F53A 3OX8B 4QT5B 5CJXC 5BZDA 4JFFA 5D1QA 4JO1L 2NY6B 1J0KA 4ZQKB 2X4SB 3BRFA 1BWMA 2M26A 1FC2D 5JDJA 5BS0B 5J9PB 2QSCL 4ZO7A 4U1GB 3D39A 5LWYL 2KUTA 1K85A 4YJZL 3BMVA 2BCKA 1G7IA 3C9NA 1MOEA 5EDXA 4JG0L 4QRUA 5D96C 1DSFH 1H3UA 4L4JA 5IUSA 5HHPA 4RZCB 3ARGC 2XXCB 1CWVA 1RPQA 5I75C 2R9HC 5J12B 4BK5A 1MSPA 3L6FA 1V7ML 3QHTC 5FV2A 4CL7A 3FB8A 2WUBL 2WUCH 4OF6A 5F6HI 3QSKB 1NFDE 5DD1L 1C8PA 1MCPH 4Y2DA 1DE4A 1RUKH 4P59L 1FDLL 2BVPA 4GBXB 3F5WA 3L5IA 4R26L 4YGVB 1OGAE 2ATKA 3VGBA 4JFDA 1HQ4A 2D7TH 2P4AB 5B8CB 4FQ2H 2P8PA 4B41A 3NTCL 4NM4L 1P7KA 1MFCH 1MPAL 1VEOA 2HVJB 1A5FL 1S8DA 3IDUA 4HUXB 3E3QE 1IKNC 3QI9B 1S9XB 2EICA 1JPSH 4WGVB 4AMKL 4NM8H 3DV4A 3KPSB 3IFLH 3HI5L 1LD9A 5DHVA 2G5RA 5GHWH 3O2VL 1JGUL 3KLHD 2R1YB 4N0YL 3WN5B 2X1QA 5DRZA 5ETUB 4R2GB 4A6YL 3TA3D 3ZKND 1FZOA 2HRPL 5C0IA 4DWHA 1I7RB 1BIHA 4OZFG 4DZ8A 3BPNB 2ID5A 1FJ1B 1Y0LB 4XNQB 3D18A 4KK6D 1BREA 1EHLL 5SWZB 1AO7B 2CH8A 2BY2A 3SCMA 3E6HB 5ADOL 4DKDC 2R23B 3IXTA 5IB2B 3S5LA 3LAFA 1CFQB 1M4KA 3U30B 3VDBA 2A6KA 2Z31B 3ZDXE 1MCCA 4EXKA 3KNBB 4JO1H 4WWID 1TZGL 1EVUA 3CGTA 4F7MA 5I74C 4XVTL 2LTQB 2BOBB 3O9WB 1QRNA 2HJKB 2QSCH 4K8RL 4HS6B 1CT8B 2CIKA 1S7WA 5LWYH 1P84K 4UNUA 1DR9A 5L0QC 2PETA 5BXFB 2XACC 5ISZE 1YMME 2VQUA 1IGJA 4JG0H 3DSNA 4J3TA 5TQ0L 2O93L 1WCBA 2NTFA 4KKAC 1FZJA 5DD3L 5C09E 1I7TB 4OZ4B 3V7AG 3QEQE 4JM2D 4QXTB 1F11B 4GRWB 1V7MH 1K8DB 1CR9L 2WUBH 4M4PA 3SKJL 1AGDB 5DD1H 1AHWC 1XIWA 1DQTA 5FUOL 3KXFE 1A3LL 1FDLH 4JO3L 4P59H 3P9LA 3O4OB 5DJ2B 1OP5K 3WIHL 3BZEA 4W70A 1U3JA 4R26H 1D6EB 2BY0A 3W11C 4FQXD 2JLLA 3NTCH 2V2XB 3SY0A 4NM4H 2DRUA 3OB8A 5DD5L 3L5HA 3MNWB 1MPAH 1BZ9B 1A5FH 1XGTB 5CD3B 2FIRT 2J8HA 3QO1A 4HMEA 3BEWB 4ACPA 4OZHB 4TULL 4Z0XA 4AMKH 4K71B 1KB5B 3NPSB 4PJ9A 2OTPA 4G8GA 3O2WL 3JV4A 3SJVA 4LDOB 3KJ4B 3HI5H 3M17A 2VLRA 4OFYA 3O2VH 1NCTA 4P5MA 5SWQA 1JGUH 2BOCB 3RY4A 4N0YH 3K4DA 43CAB 5E00B 3AMLA 5E8NA 3O4LA 4A6YH 1PGRB 4TUJA 3IU3A 1S3KL 3MUGA 4HIIA 3CDGA 2P45B 1JBJA 4FN0A 3GMOB 4WEUD 1MI5B 4PJFF 3NZ8B 1BFTA 4QY8A 1T89A 3CSPA 4BQCA 4IDLA 5B38B 4PRDA 4NO5B 2MQCA 3IGAB 4M5ZL 1SHMA 1KN2L 5F97E 5TE7L 2NY1B 2PXYD 2IPKB 5C07D 3SDAD 1WAAF 5ADOH 3EOTL 2YPLE 3V4PL 2WIMA 4M9PA 2XI9A 4N0FB 3IKCB 4HWEH 1OT2A 3FJTA 4EI5B 1TZGH 1PJ9A 1G9NL 2RR3A 1KNOB 4XVTH 1ZT7A 4PREB 4CMMB 1ADQA 3V5KB 2BNQB 3LKPA 3RWDB 5FM4A 2IH1A 4K8RH 4M7LT 4GW1A 5FFLA 2M8XA 3OKMA 4KROD 3WDHA 4L4TD 4Y19D 5TQ0H 3HE6C 2R1WB 1YC7A 2PYEB 4PLJD 1CZ8L 4P4KB 3B6SB 4PP1C 1FO0A 5L7XL 5F9WC 2DWDB 1CXLA 2H32A 2QADB 1CFBA 4BELD 1HEZB 3UDWA 3RTQA 4JRXD 1CR9H 1OTTC 1RJLB 5D1ZB 5T1DL 3SKJH 1X5IA 5FUOH 4YR6A 1UH2A 4Y4HD 2VLKB 1A3LH 4JO3H 4LMQI 3B9KD 2KQNA 5EU6D 2H3NB 4F3FB 3WIHH 3L95A 4M93C 2OI9C 1H3VA 3MCKA 4LAQL 3S96B 3GSNA 3RDTB 3VRJA 4L4VB 4WI4A 4DJMA 2HLAB 2H2SD 4YHPA 3ULUC 5DD5H 1CGSL 1X6NA 3G6JB 4MD5A 2OZ4A 3QFJE 1VFBA 3HR6A 2E7HA 2QV2A 4TULH 3VD4A 3O6KL 1L0XA 4YQXL 1T1XB 2W0KA 3V7AE 3OBAA 3O2WH 3TNMB 5E9DD 1D5ZA 3MOAL 2CRIA 2HRLA 2PO6A 1PG7W 1U8NB 1YMHA 3GSWB 2C1PB 2W9LA 4LHUD 2BHYA 4Y2OA 3BUTA 4HH9B 4E42B 3SGEH 2YD3A 3UJTL 1ED3A 4X6FA 2OCFD 4PJFA 4JDVB 3SKOB 3MMEB 3TYFB 3U46A 3T08A 1S3KH 5C0EB 1QFOA 2RIKA 3L3DA 1OLZA 1UJ3C 4G8FA 1WAAA 1F90L 3WBDA 4GJTB 4EUPH 4M5ZH 4PJHA 4ZNCD 3QEHA 3PL6C 2BNUA 1CN4A 3CFEB 1X5KA 4DUWA 3PDDA 3D85D 2JJUA 4U1MA 4Z7OF 1IM9B 2VTFA 4G9FB 4M61A 3O11B 5HI3D 2L7JA 3EOTH 4I2XA 4CW1A 4PJXB 1KENL 3C5JA 4LCCB 5I8KL 4JQVC 4OLZL 3IDGA 4JRWA 5D2NC 4FFVD 4LLUA 5E4EB 3D69B 5FA3B 1G9NH 3NCCB 1KYOK 3H42L 4GW5A 5HY9B 3N9GL 2NYYD 3EYUL 4WU5B 2JIXB 2X9WA 2NY0D 2Z9TA 2VJXA 5J6HB 1CZ8H 1ULVA 2VABB 3G08A 1QKZL 2OBGA 5FO7B 5L7XH 3GSVB 1U8JA 3I3DA 4MNGB 5FGBC 3Q2CA 4V1DE 3TBVB 1PQZB 1CFNB 4LPWA 5T1DH 1ZS8B 4L8SC 3UYRL 5K9KA 3O6FA 4P9HH 1MAKA 1OF2A 5E8OB 4PGCA 2R2EB 1WFNA 1VA9A 2B5IC 3ZE2E 4I13B 1KJVA 3FFCB 4P2YA 3H2WA 4LAQH 3RIFK 2ZUTA 4HJGB 1DANU 5FM8A 4C4KT 2VB5A 1JYXA 1Z9SA 3OR6B 2VAJA 2O61A 1CGSH 1OOAA 1UJTA 1G0DA 4X4ZA 1UZ6E 1HK6A 3S37X 5K59E 1QOKA 3O6KH 4YQXH 2EH8L 3DV6B 1FNGA 3HRZA 1INQB 3I6GB 1I1AD 1OB1B 3MOAH 4ZS6D 4RAUB 4C59B 3HLAB 1ZHBB 3GUTB 1AP2A 3PJSB 1RVFL 3ARGB 1OAUL 3UJTH 3WFZA 5I75B 2VUYA 1UWXH 5DO2D 3VWKB 2HVKA 6CGTA 4M62L 1XZ0B 1IBGL 2P1YA 3HN3A 3NIFE 1IEHA 3ZDYF 4YZFF 3O3EA 4LCWD 1NEUA 3LN4A 3GJEA 1WT5C 5AD0B 3CPLA 1F90H 2YN3A 5D2LB 2X4PB 2F74B 1L0YA 4G8EA 3JTSA 2L7UA 1GZQA 2YXMA 3HI1B 3OX8A 3WD5L 3CXDL 1TTFA 2YHGA 4MB5A 4ZQKA 2X4SA 1KENH 2DLFL 2VZOA 3PP4L 3ZE0F 5I8KH 5BS0A 4OM1L 5J9PA 5J8OA 4OLZH 3IRPX 4PY7B 3MRPB 4YUEL 1C16B 4XGZB 3DX9B 1I3RA 4TSAL 5IB3B 3H42H 3N9GH 3EYUH 1S9YB 4NJAL 2DM2A 2YK1L 4RZCA 3IDMB 1A4JB 2XKSA 4XHQA 4HKJA 1H3XA 3BFOA 4L8DB 5CJOL 1Q9LB 3CZJA 4CU7A 4PJDB 4TVSa 1QKZH 2ZUSA 2I9LB 2H2PD 2P49B 4PYHA 4U2ZA 2Q8BL 2FLRT 2P5WD 4EUPG 5E03A 5FAAA 4GBXA 4AQOA 3GHEL 3UYRH 4CVZB 5CKAA 4YGVA 1SJVA 1CD8A 4IDJL 2KBGA 2DLTA 3WNLA 4QCIB 3QEUA 1GXEA 4JQXC 4TTDC 4GKZB 4PRPB 5FA4B 4HUXA 4MB3A 3ZDZE 3QI9A 3F7PC 1S9XA 1F5WA 5I74B 1WK0A 2J6EL 3KPSA 4HIJB 5LQBL 3Q1SL 5AUMB 1EFXA 2EH8H 3BZFB 2R1YA 4W4OC 5L0QB 3WN5A 1TTGA 1T22B 1EVTC 5ETUA 3VA6A 4MLSA 1SJEB 1QACA 4RBPK 5IFJB 1AH1A 1BM3L 4PR5B 1RVFH 4I1NB 4F8TA 1OAUH 2H8PA 2HP4A 1I7RA 2CK2A 5J6GB 3UTOA 1BF2A 3RUGF 3V2AR 1WC7B 4NT6B 3JWOL 3FN0L 4MNQB 4M62H 1Y6KR 3QDJD 1IBGH 3QEGL 4QF1B 3HUJF 1FJ1A 1Y0LA 4XNQA 5E70A 3BRDA 2YUWA 1UKSA 5HDQL 1AHWB 2EZ0D 1AO7A 5SWZA 1EJOL 4K94C 3E6HA 2R23A 5IB2A 4UQ2B 2GJ6B 1CFQA 1JP5A 4PJCB 2Z31A 3WD5H 3CXDH 3KNBA 4LLWB 4AQ1B 1YJDC 4WNQB 4O00A 2M2DA 2XKNB 3UZVB 2DLFH 3PP4H 4GUPB 3MRRB 4JB9L 1QSFD 4OCSL 3O9WA 4YPGB 4OM1H 5EU4B 2HJKA 2XYCA 4YUEH 4HS6A 2VERN 4CRPA 2BVTA 5BQ7B 2R4SL 4TSAH 5TF0A 5BXFA 4NBXB 4OLXL 2HT4C 4ZOAA 5FV1L 1FL5B 1G9MC 1X5FA 2X9YA 3T3ME 4NJAH 3U6RB 1JF6A 3MRCB 1KB9K 4OZ4A 2MTPA 3J7HA 1TVDA 1UACL 2JELH 4QXTA 3EDJA 4W81A 5CJOH 1F11A 2FJFB 1K8DA 5JA8B 5AWNH 4WTZA 1RZGB 3RVVD 1AGDA 4U2YA 4LMQE 1NFKA 4U6TA 3DO7B 2Q8BH 3NA9L 5C0CD 4N8VA 2EDYA 1IAIM 5GS1C 3I6KB 3OAYH 5DJ2A 3SDXF 2PTTB 3GHEH 5C07E 3L7FA 3CXHJ 5JZ7C 4HUWB 1D6EA 1G7PB 2OM5A 5GZND 4IDJH 3LEXB 4WU7B 2V2XA 3OKNB 5BO1L 1JUFB 4O2CB 3MNWA 1BZ9A 2CRZA 1XGTA 1EAPB 1JTTA 3WUWG 5CD3A 4M3JA 3BEWA 1NC2D 4XP5L 4OZHA 3S35L 1KB5A 3G6JF 2J6EH 5D7LE 3GGWB 4WW2F 3RZWA 5T1KD 5C0BB 5E4IA 3LRGA 5LQBH 3Q1SH 4L4TE 4Y19E 1OY3B 2W0LA 2BOCA 4PRHB 4ZFFB 1I9RL 1CYGA 4WHDA 3RNKB 1WFUA 5E00A 43CAA 3QQ9D 3LVEA 1DTUA 3A67L 3MV8D 1CFSB 1I8LA 5LJYH 1YEKL 3OKKB 1BM3H 3BIBX 4K7PL 1DBML 4U6YB 3GMOA 4C56D 1MI5A 3NZ8A 2RHEA 3S4SG 2XRAL 3BO8B 2OTWB 3GMMB 3JWOH 3FN0H 5B38A 4NO5A 1XF1A 3IGAA 3QEGH 1Q72L 2V7NB 5EU6E 1N7ML 4POYA 5HDQH 1ITCA 2XZAL 4KK8C 2IPKA 1EJOH 1NJ9B 4OCXL 4HV8B 5LGJB 4M93B 1ZLWK 2OI9B 4N0FA 3VI3F 3IKCA 5BW7A 3E3QC 1KEGL 2EDEA 4P5TD 1A7NL 1J8KA 3PGCB 4HJ0D 3ZTNL 4EI5A 4OJFL 4H20L 2B39A 5GRXG 4MXVF 4PREA 1AD9B 4JB9H 1KCRL 4OCSH 3V5KA 2BNQA 4CMMA 1JMXA 3WO4C 1CLOL 5E9DE 1ORSB 2R4SH 3FZUC 4OLXH 5DMJB 4U6VH 2R1WA 2PYEA 3TBYA 4P4KA 1JL8A 2F53D 1LQSR 3B6SA 4XNYL 3IAQA 2DWDA 1UACH 4X9HA 3MLUL 2HLFC 5F1KC 4D9QD 3IVKB 4JRYD 4HAFA 2EDDA 1RJLA 5D1ZA 5MI0C 4NO2B 3LPWA 4OUUB 5GGSY 2WQRA 3UTQB 1KTKE 3NA9H 4QTIL 1LO3L 4S11A 2VLKA 2EDXA 3WS6A 1O7SA 4ELKB 2H3NA 4F3FA 1UJ3B 4H1LB 4LDEB 3GM0A 3S96A 3RDTA 5JTWA 2WW8A 3DVIA 3PL6B 4KRLB 4L4VA 3V79C 5CCKL 5TDOB 2EDHA 3P0YL 1CIDA 5B21A 5BO1H 5HHMB 1F4YL 3G6JA 1UH4A 2E5EA 2PW1B 2MCPL 3V9FA 4NC2B 4OUOA 4Y2DD 3IDYC 3HZMB 5D2NB 3S35H 1T1XA 5CSGA 3TNMA 2AXFB 4QRRD 3CMGA 3CUPB 5C08B 1LO4L 5E94B 1CXEA 1U8NA 3GSWA 2C1PA 2I24N 4HH9A 4E42A 2IQAB 3NVQA 1I9RH 1IC7L 3CX5K 4GSDL 4JDVA 4Y5XC 5IBUG 3SKOA 3A67H 3MMEA 3TYFA 3KLAB 3VFPB 1MWAB 1YEKH 4GKNB 4OD1L 4K7PH 2NW3B 1DBMH 5C0EA 4YHNB 4L3EB 2ESVD 3D0VB 3DXAB 2XRAH 1RZJC 4LPCA 2PW2B 1XGPB 2YRPA 4JVUA 2ZG1A 4NUGL 1Q72H 3NIDF 4MCZB 3CFEA 1MUJB 1N7MH 1SM3L 2XZAH 3MFGB 2G60L 1IM9A 2NY7L 4G9FA 4OCXH 3O11A 1F4WL 4YWGL 2QHRL 4GRLD 2IQ9L 2WINB 5D2LF 1RV6X 2B5IB 4PJXA 4LCCA 3PWNB 1KEGH 2XN9D 2LABA 1A7NH 3ZTNH 4S1DC 4OJFH 4H20H 2Y25A 5J3HD 3D69A 5FA3A 3DPBA 5JHDD 4KJQC 4LLYB 5F7EL 5HY9A 1KCRH 2HFFB 2DKUA 4BKLA 5MEPB 1CLOH 2X40A 4C58B 4MS8D 1QYGL 5I16A 4WU5A 4RMTA 2HYMA 4WCYL 2JIXA 1RIUL 3G5XB 1MJ7L 1KN4L 3CJJA 1EEUA 4O2FB 4K3GA 5J6HA 2NZ9C 3H9SB 2VABA 2NY2C 2WSKA 4G6FB 4XNYH 1OAKL 5FO7A 3GSVA 2AXGB 4MNGA 3GMQB 3H6JA 3FN9A 5CZXD 3MLUH 3TBVA 4LCWE 3WHE0 1PQZA 1CFNA 4DTGL 5KS9B 1HIML 1ZS8A 4U1SB 2JCCE 5E8OA 5IMOB 4QTIH 2R4RH 1LO3H 5B39A 1P6FA 2R2EA 3F7YB 3OQ3B 4HX1B 5DSCB 2UZYB 5C7XL 3FFCA 5FIEA 3BPOC 4HJGA 4XPBL 5CCKH 2ITCB 1XGQB 4OCWL 5CJXA 3OR6A 1F4YH 2MCPH 1DL7L 5I0ZA 4I3GA 2VZVA 3STZB 2BZDA 4IS6B 3EOAB 1GVIA 2AK4B 3DV6A 3MJ8B 5DFVC 3I6GA 1INQA 4OKDA 1OB1A 1U42A 3WFBL 1FVCB 1LO4H 1S78D 3U1SL 2ED8A 3B2VL 5MEOB 4RAUA 3HLAA 1ZHBA 3GUTA 2F15A 1PFCA 1MHHB 3PJSA 4NKIL 3ARGA 1IC7H 4PJEE 5HYJB 3RZCD 3VWKA 1MY5A 3AB0C 2JTDA 5JMOC 1FP5A 4AZ8A 1XZ0A 4OD1H 3P4MB 1PZ5B 1GC1L 5AD0A 5EBWB 5D2LA 2X4PA 5FYJL 2V9RA 3LIZL 4NUGH 2BVOB 1SM3H 5H94B 1ADQL 3HI1A 2G60H 4JY6B 2DQIL 4CAGA 3I02B 1F4WH 4JY4B 1NCDL 4YWGH 2QHRH 3BIAX 2IQ9H 4HIXL 4OLEA 1M71B 4UBDC 1NCUA 4P99A 1HHIB 4ESKA 2HTKD 5F7DB 4PY7A 3MRPA 1NCWL 1IKNA 2YPVL 4UQ3B 1JVKA 4JN1L 1C16A 4XGZA 5E56A 3DX9A 3LN5B 3CDFA 5FYKU 5IB3A 3W2DL 3PHOB 5F7EH 4KRPB 2GY5A 3K4ZA 2X05A 4MZ3A 5HVHB 3BJLA 1QYGH 4N8CL 3RVWC 4WCYH 3IDMA 1RIUH 1A4JA 3VXMD 5FO9B 1OSZB 1MJ7H 4O51B 4DN3L 3EJYD 1KN4H 1Q9LA 4NQSB 1WITA 4PJDA 1OAZL 4ALAL 1OAKH 5E5RB 4Q9BA 2I9LA 4G5ZL 5FYJD 3B5HA 4FG6C 4UNVA 4OGAD 3QDJE 3FHQA 4Y1AB 5F3BB 3SDCC 3H9HB 4DTGH 1HIMH 4CVZA 1D9KD 5MERB 5E5MB 2AEQL 4X4MA 3FKUS 5C7XH 3IDIB 4QGYA 2J8UE 3IDNB 3HHRB 1LP9B 3GBNL 4GKZA 4LGSB 4XPBH 1P2CB 4PRPA 5FA4A 4I18B 4OCWH 3BP6B 3NCJL 1GH7A 4QRPD 5FHBL 1PG7L 3WDIA 1DL7H 2A83B 4HIJA 4IOFD 5F1SA 5C71A 5IFHH 1TJHL 3FAXA 5EOTB 5AUMA 4TSBL 4U1HB 5E2JA 3BZFA 3FL7A 2J4WL 5M95B 1JNJA 4PLKD 2OMBA 3QQ4B 3WFBH 1T22A 2VDPL 4F7CB 3U1SH 1SJEA 3T4AB 3B2VH 5DVLA 4EDWL 5IFJA 2IAMD 5I6XC 3I50L 4PR5A 1UVQB 2OP4L 4NKIH 2GITB 3C6LD 5J6GA 4ZFGL 1WC7A 4NT6A 1BP3B 4TRPL 5JW5B 4MNQA 2YR3A 3A6BL 4QF1A 1GC1H 1MCQA 1EEZB 1AHWA 4WUUD 5GS1B 4U1IB 5FYJH 3MRLB 3LIZH 3SHSA 3ZT6A 4UQ2A 2GJ6A 1ADQH 4PJCA 2DQIH 1NCDH 4UIMB 4WNQA 4HIXH 5MEND 4QNPF 5GGRY 2XKNA 4GUPA 3MRRA 5EU4A 1W0YT 5BV7L 1F2XK 1NCWH 2YPVH 4JN1H 4KFZC 5BQ7A 2JJVA 3W2DH 1AR1D 4RGOL 3QXDB 2YA2A 1FL5A 2YD1A 2Z4QB 1HWHB 4ZO6A 3TZVD 1BQLL 1JHLL 15C8L 4N8CH 1EHXA 4WI6A 3U6RA 3MRCA 3VMPA 5JLZB 4ODXB 4DN3H 1LEGB 3MV8E 1MFAL 2FJFA 2R2CA 4TPRL 4DGVL 1EGJL 1OAZH 2D0FA 4QWWD 3NN8B 3S5LG 4ALAH 4C56E 2VITB 5IR1B 1RZGA 3KYNB 1ZANL 4G5ZH 1NFDB 2FDBP 5TQ2L 3DO7A 4RMQA 2BSRB 2JE8A 1AKJD 1I3GL 3I6KA 3TGXA 1IARB 5E08L 4JZNB 2CQVA 2PTTA 4PGZA 1OGAB 2AEQH 1E4XL 4HUWA 1SEBA 5DEFB 1G7PA 4HLZH 1HE7A 4WWKD 3LEXA 4WU7A 4JPKL 3OKNA 4KMLB 1JUFA 4O2CA 3GBNH 4LGRB 1EAPA 1JF5A 3EIFA 3NCJH 3D1MC 5FHBH 4KTYA 1PG7H 1NDMB 1AC0A 3JWDC 3CVIL 3KLHC 3GGWA 5C0BA 3PGDB 5DGQA 5CGMA 1TJHH 4TSBH 4PRHA 2J4WH 3TA3C 3ZKNC 1QHOA 1WV7T 2F53E 3KG5A 4ZFFA 1UCTA 3FAWA 3RNKA 3TYGH 3U36B 4YEEA 2VDPH 3O81A 3MREB 1QUNA 4F58L 4EOWL 4EDWH 1CFSA 2ZCKL 2BY3A 3MXWL 3OKKA 3GFUA 5HHNB 3I50H 2GCYB 3U48A 2OP4H 1YZZA 4U6YA 2YPKB 4JRYE 4D9QE 4RGNE 3S98A 2XQBL 4LKXB 5CJQL 2P44B 3BO8A 5C3LD 4NZUL 2OTWA 4KK6C 4PJBE 2PYFB 4TRPH 2ZG2A 2ZUYA 3EOYG 3A6BH 5MI0B 2YSSB 2V7NA 2HFTA 4RGMC 1NJ9A 4HKXA 2YA1A 4HV8A 5LGJA 3QIUD 5CKGA 4GS7B 1ACYL 1G0XA 1G9EA 1ZHNB 2RJMA 3PGCA 4X6DE 3DLQR 2Q87A 5I8CB 2QJDA 1AD9A 4WRLA 1YYML 1RUMH 4HS3B 3QB7C 4Q7DA 3SKNB 5IKCB 1ORSA 4QRRE 3IDYB 3U4EB 4RGOH 1YMMB 1D7FA 3RL1B 4JM2C 1BQLH 1JHLH 4ZO9A 3WNMA 3PABB 5C09B 3QEQB 3NCBB 4JREB 2XPGB 3RHWK 1MFAH 3FTGB 3R8QA 4TPRH 4DGVH 1H15B 1EGJH 1N26A 4QHNB 3IVKA 4Y5XB 2ESVE 1BHGA 1ZANH 4NO2A 4EKXA 3ARRA 3PDGA 4OUUA 3DJ9A 3P9MB 3UTQA 1CLZL 5INDB 4QLRA 3SDYL 3QZWB 3OAUL 4N8PA 1E4XI 3KXFB 1I3GH 5C92A 5KS9F 4ELKA 5E08H 4FQXC 1UJ3A 4H1LA 4KK5D 4M6ML 4OQ1A 3FQWB 4IHOB 1E4XH 3PL6A 2FEEL 4WIQA 5TDOA 5ICYB 3BISA 3W0WD 4JPKH 3AU1B 2XN9E 4XXDB 1ZT4B 3RL2B 3VXSD 5DI8B 2PW1A 5CZVL 4J3SA 1GIGL 2C4FT 4JKPL 4JQVA 5JHDE 3S3PA 3HZMA 5D2NA 2GEEA 3G6AB 3PQYB 3CVIH 2AXFA 5F72S 3CUPA 3CC5B 5C08A 5E94A 5F7NC 4IOSD 4CMHC 2E7BA 1HHKB 2IQAA 5I19L 4KV5E 1I7ZB 3KPNB 4DN4L 3NCEB 3RNQB 5I0DA 4F58H 4EOWH 3KLAA 2NY2B 2ZCKH 3TIEA 1MWAA 3MXWH 1JPGA 4GKNA 2CDGB 5DURD 2NW3A 4YHNA 5FGBA 2XQBH 3D0VA 5CJQH 2XWTB 1FNSL 3DXAA 3MSPA 1X5LA 4NZUH 4Z7VE 2PW2A 1XGPA 2PXYC 5C0DB 1TZIB 3SDAC 1H3GA 4MCZA 4L8SA 4FQLL 1BFOB 1MUJA 5KJRL 1OLLA 2VXUL 3KS0J 2Y9RT 2YPLB 4XAKD 2WINA 1ACYH 3K8MA 1IGTB 1HH6B 3UTTD 4NUJB 3BPOB 3TN0D 3PWNA 3QP3A 1H9VA 2VNCA 1A1OB 3RX8A 2YD6A 4KY1L 1NC4B 1FYHB 1NGXB 4LLYA 1YYMH 4ETQB 2HFFA 3LKQB 4KROC 3QCTL 1MQKL 5D7IE 2BXYA 5TGBB 2BRQA 5MEPA 3QFDB 1KIRB 4PLJC 2DQHL 5GRYA 1JYVA 4OD3L 3G5XA 3S7GA 1OQXA 3GBML 4NRXB 4P23D 4GLRI 4O2FA 1NDGB 3H9SA 3TESA 3WDJA 5I8OL 1X4XA 2DTML 2AXGA 2FHCA 3GMQA 4GLRH 4XCNB 1MEXL 1VFOA 2HKHL 3VXQB 1U8KB 5I1JL 5HDBF 1JHKL 2AXJA 3FB6B 3RVUC 2VXQL 4ZDHB 3GI9L 3AB0B 4Y4HC 4AK1A 5GS0D 5KS9A 3B9KC 3OGCB 3M1BB 4U1SA 3W5MA 5FECB 1CLZH 3SDYH 2BDNL 5IMOA 5HYSB 1G9NC 3I6LD 3F7YA 1T5XB 4HX1A 5KAQF 5DSCA 4RBPH 1WT5A 2H2SC 5T3XL 1X9QA 5C0JB 4M6MH 3P0VL 5HDOA 2DI7A 1NCCL 5CGYD 3QIBD 1BD2B 2ITCA 1XGQA 2C26A 4KTDL 3I84A 4X6EB 5IGXL 2F8VA 2MWCA 4WHCA 5IBTL 3QDMD 1MLBA 3MOQA 5CZVH 1AIFB 1GIGH 4JKPH 3STZA 3GNML 2A77H 4IS6A 3HNVL 4NQED 3QNXB 4Z7UE 2AK4A 3MJ8A 1UADC 1BPVA 1TNMA 4KGLA 1FVCA 1VFMA 3VXME 2NX5B 3MACL 4P9HC 3SQOL 1AXIB 2ZUVA 1V3KA 1UG9A 5MEOA 5I19H 1MHHA 5HYJA 1EHAA 4DN4H 1ROWA 4UOW1 5FYJE 2AEPL 4B5EA 4CBPA 3P4MA 1PZ5A 1ZLUK 4XMKL 3IB4A 1FNSH 4ODUB 4F33B 2F58L 2AI0L 4RA0C 4RX4A 5FK9B 5EBWA 5HI3C 3SDCB 4WFEE 2BVOA 5AG9A 3OKEB 4FQLH 5HD8D 5H94A 4S0SD 4J3OC 3BKML 4JY6A 5KJRH 1AQKL 2X4RB 3I02A 4JY4A 2VXUH 1M71A 4FFVC 4OIIL 1HHIA 4JQXA 5F7DA 1VADB 4UDUB 4QRPE 3KPQB 2NYYC 2D9QB 4LPXA 5D7KD 4KY1H 3I75B 5L2KB 4ERSL 3LN5A 1U8HB 3PHOA 2YD9A 4K7FB 1X5ZA 2NY0C 1X44A 3QDGD 4GRWH 3QCTH 1MQKH 2QL1A 3LKNB 1MF2L 2NY1D 1E0OB 2DQHH 5F9AC 4OD3H 2CD0A 5FO9A 1OSZA 4O51A 1EXUB 4HPOL 3GBMH 1C7TA 4L29B 4JG1L 4W4OA 4NQSA 5I8OH 3AY4C 3QH3B 2DTMH 3OAZK 4JPWL 1MEXH 1T80A 5I6XB 5FUCE 2HKHH 3N0PB 4V1DB 1ZE3C 5DC4B 5I1JH 4P2QB 1JHKH 1ACZA 4Y1AA 5FXCH 5F3BA 2VXQH 3GI9H 3H9HA 2IBBA 2FJGA 3W81A 3KYOB 5LKNA 4WUUE 1NFDF 4NDMA 5GRJL 5MERA 5E5MA 3PDOB 2BDNH 3L3IB 1SVCP 1AGEB 3D2UD 4DZBB 3MA9L 1ETZB 3IDIA 1P4LB 1UKTA 5T3XH 4UAOC 3IDNA 3OJMB 3PWLB 1LP9A 1NCCH 5MENE 1P2CA 1SY6A 5HVGB 2C7UB 4I18A 4KTDH 3BP6A 3P2TA 3VU2A 5IGXH 5IBTH 5CSZB 1O5DT 1MVUB 2A83A 25C8L 5FCUL 1I1AC 1XF2B 2R2BB 3GNMH 4ZS6C 2DJ4A 3X11B 5EOTA 3HNVH 4U1HA 1PKOA 2E9IA 3PP3K 1ZLWH 1G7LB 3QQ4A 1M7XA 4F7CA 1FG2A 3MACH 4I2XE 5DO2C 4ZSOB 3SQOH 3T4AA 3VD3A 3P9WB 4HWZB 4GT7A 5ECJE 1UVQA 5LAXA 2GITA 1SJHB 2VC2L 4MQXD 2B4CL 3T0EB 3TWCL 1KJ2L 1OTUD 2AEPH 2X9XA 3GHBL 4FA8A 5JW5A 4PJ8B 1F6AB 4XMKH 1EEZA 2F58H 2AI0H 5GS1A 4U1IA 1FFNB 3BKMH 2BXZA 1AQKH 3K8LA 5DK0B 3CSGA 4POZD 3GSOB 2AGJL 4UIMA 1HCFX 3RI5F 4D3CH 1FORL 5ANME 3K8KA 4YHKH 3PNWB 1AGFB 1QSED 4OIIH 2ICWI 4E5XA 1T2XA 4I3SL 3ZDXF 4J8RB 1MCFA 3ARFD 1GGUA 4ERSH 1IEBB 4FHBD 4PRID 5SX5H 3JTTB 3CU7A 2Z4QA 3K81A 4F7PB 3OKLB 1MF2H 1HDMB 2F54D 5ABDE 5JLZA 4ODXA 4HPOH 1LEGA 4CVXB 1BZ7B 4JG1H 1A9EB 2H2PC 4YFEA 3NN8A 2VITA 4KMQA 4FZEL 1UKQA 3KYNA 5IR1A 4LFHD 4JPWH 5I1LB 1NFDA 1FFRA 1BBDL 2LVCA 1BVZA 2BSRA 3MUJA 5CLTA 3CXHK 4JZNA 5C6WH 5TFSL 3X3GL 5GRJH 1OGAA 4LLMB 2FBJL 5I1IL 4RGMB 4G42A 1T1ZB 4XPTL 4YDKL 3UP1A 5FHAH 4LEXL 5ALCL 1J0YA 1YEDB 3ALWA 3CFCL 3F6IA 5I18L 3B83A 1MRCL 4EQ2A 4DK6A 1NDMA 4A6YB 2IBZX 25C8H 5FCUH 4WTZG 3DUSB 3PGDA 3RGVB 2HAZA 1P4BL 3BYYA 2ZJSL 2X44D 3U36A 2ORBL 4BJLA 3MREA 4JM2B 1A3RL 1QFPA 3GKWL 4JFOB 4MSWB 5HHNA 3ULSB 2GCYA 2YPKA 4LKXA 2VC2H 2B4CH 3TWCH 1KJ2H 3GHBH 1A02N 2N7BA 1AD0B 2PYFA 2EZ0C 2YSSA 1MFNA 3JSSA 1T7YA 2XA3A 1A6WL 1MCSA 3LDBC 1KCUL 3NZHL 5JA9A 4ZPTB 4J1UB 5ICXB 4D9RD 4FQXB 2AJXL 1MVFA 3MGOB 1ZHNA 4NC1E 3B43A 2AGJH 3VWKD 2IGFL 4YDLC 1FORH 3UXFA 5I8CA 5FYLD 4I3SH 4HS3A 5GGSB 1QR1B 3SKNA 5IKCA 3TF7C 5EPMB 4PD4J 1UB6B 3U4EA 1NGWB 1YMMA 3JWOC 1RZ8B 3RL1A 5B38G 5DUBB 3ROOB 2R15A 3PABA 2IFGA 3HZVB 5C09A 3V8CA 3MUZ1 1KFAL 3QEQA 4YHZH 4CMHB 2XPGA 1A9BB 3E1F1 4QXWA 3RVVC 2OL3L 3FTGA 1H15A 3WKNA 4QHNA 5DZLA 5EBGA 4Y5XA 1FVDB 4QO1A 3VG9B 3P9MA 1BBDH 5INDA 5F93C 3QZWA 1FC1A 2DIJA 3KXFA 3SGJC 5IHLB 5GZNC 4IIQC 5TFSH 1I1CA 3NA4A 2PXYB 3X3GH 4DEPC 4NNXB 5C07B 3SDAB 3FQWA 4CN4A 4IHOA 4XAKE 4UT9L 2FBJH 3UTTE 5ICYA 5I1IH 1LK2B 4M03A 4XPTH 4YDKH 4XXDA 3RL2A 1ZT4A 3VRIB 2VXVL 1OD9A 5DI8A 3QCUL 4LEXH 3RGHA 5ALCH 4MA3B 2LVEA 4X6CE 2APXA 3CFCH 2OYPA 5K9OB 5I18H 4XVSL 1A1MB 2ZSVB 1CFVL 5IB5B 1MRCH 2VDML 4QTHB 5EWIL 3G6AA 4QRQB 3PQYA 5SWZE 5JOEA 1AI1L 3INUL 4F37K 3VD5A 1P4BH 3MGAA 2X4QB 3QQ9C 5EBMB 1HHKA 1JJUA 1R24B 2ZJSH 4BH8B 1I7ZA 3KPNA 2ORBH 3RNQA 4NBZB 4Z7QE 4PRPD 1A3RH 3GKWH 4K07A 5M94B 3FONB 4XB7A 2CDGA 2HG5B 5DHYB 3P4NB 4JRXB 2XWTA 1UEYA 4WEBL 4X4YB 5C0DA 1TZIA 1ZWIB 3I6LE 2V7HB 4Y4HB 3B9KB 3RVTD 1HI6B 1GCFA 5EU6B 1BFOA 1H0DB 5I17B 4HC1L 1A6WH 3NZHH 1U36A 5DMKB 4P5TC 2YPLA 3QUYD 4YFDB 4HJ0C 5E2UL 1IGTA 1HH6A 4NUJA 4GRWE 2AJXH 4AEFA 2EE3A 3QDME 1A1OA 1QBML 4Q0XL 2IGFH 3O8XB 1NC4A 4MNQD 1NGXA 3O3DB 4NKMB 4ETQA 4NQEE 3LKQA 5HI4D 5TGBA 3QFDA 1KIRA 4UZGA 5E9DB 4PRNB 3U0WL 1FZMB 4NRXA 4LHUB 3GSXB 1NDGA 3TNNB 5T33L 1EX0A 4MDJB 5SWSD 4XCNA 1GGIL 5CZKA 3GRWL 2OL3H 3VXQA 1U8KA 1JWUB 4N90D 5EFIB 1FLRL 4OZHE 4WJ5B 3FB6A 2DQDL 5DR5L 2VLME 4ZDHA 1NCNA 3OGCA 3M1BA 4LFHG 5BVJB 1Z3GL 2UUDK 4RWHA 5FECA 2R69L 5D93C 5HYSA 1T5XA 5CP3A 4WI3A 4XCFL 3D85B 2QBWA 3MRKB 5C0JA 2D2OA 4OAWA 4UT9H 1BEYL 1BD2A 3EYFB 5EUOE 2AERT 1J18A 4X6EA 3W9EB 1K3IA 3ILQD 2VXVH 4JCMA 5D7KE 4HQQL 1A6TB 1AIFA 4PUBH 1B4JL 1N64L 2DM4A 4ZOEA 4XVSH 3B9EA 1CFVH 3RAJH 3QNXA 2VDMH 5EWIH 4LF3B 1UZ6F 2NY0B 3KDMB 1AI1H 5K59F 2NX5A 3INUH 2P5ED 2NLJB 2DBLL 5B39G 1XGRB 4KUCD 1DJSA 4NKDB 3TH4T 1HSAB 5FGCB 5GSRB 5ERWB 4LSVL 4EEEA 4Q6IC 2F8XC 4L1DA 4ODUA 4OBRA 1IGIL 4WEBH 4F33A 4Y4FD 5FK9A 3VCLB 3SDCA 5T1MB 3OKEA 4GRLC 3ULUL 4HC1H 5IEKB 4NO3B 5E2UH 1IAIL 1ZHKB 4PRAB 1V3MA 4UAOB 5J3HC 1B0GB 2FATL 1IAOB 1VADA 1YECL 4UDUA 1QBMH 1VFUA 3KPQA 4Q0XH 4ZO8A 3TBWB 2WANA 3I75A 4MS8C 5C0RL 4AG4L 5SV4A 2W65B 3GMRB 1U8HA 4U33A 3SN6N 4K7FA 5F44A 4ZXBD 5IBLD 2J8OA 3RJDA 5KVMC 3MO1B 3LKNA 2EYRB 1I1AB 2GIYA 4LOUD 5IW1B 4XNMB 4ZUVB 2DQCL 4TSCL 1EXUA 4R3SB 3HE7D 4L29A 2CR3A 2IBGA 3H3KA 5I1KL 5CZXC 5T33H 4U7KA 3QH3A 5H8DA 3EDEA 1WIPA 1GGIH 3GRWH 4HFUL 3LQZB 4V1DA 5FO8B 5IHBA 1LE5B 5DJ6A 3DWTA 1FLRH 4P2QA 1JGDB 3D9AL 2FECL 2DTSA 2DQDH 5DR5H 4LCWB 1P1ZB 5GGTA 3KYOA 4I0PD 5LBSL 2JCCB 1Z3GH 3PDOA 2R69H 3EJJX 3P77B 3LEVL 1AGEA 4XCFH 4DZBA 4AEIL 3JV5A 1ETZA 1P4LA 3NCYP 3VRLE 4P2OD 4XB8A 3PWLA 3MCLL 4NOFA 1G0YR 1BEYH 1CGWA 4UDTB 2C7UA 1Q0XL 3UBXI 4MXWH 5CSZA 3IFPB 5T5FL 4HQQH 3CSYB 4U49A 1C12B 1HOCB 1MVUA 5C70A 3ZDZF 1M7IB 1WZMA 1XF2A 1B4JH 2R2BA 4PRIE 3X11A 3RWEB 1S78C 4HWBA 5F7KC 3WHXB 3IAPA 2E9WA 2F54E 2XIDA 2GW5A 1G7LA 3RY6C 2VL4A 1TJGL 1WFOA 1YEEL 4ZSOA 3RZCC 4HWZA 1T03L 2DBLH 1S5IL 3BE1L 1CDJA 4X5XB 4YHIB 4PJEB 1U8PB 2J88L 1SJHA 3T0EA 5GGRB 4J4PD 4JM2F 4LARL 2CXGA 1IAKB 2OS7A 2P5WB 4PJ8A 1F6AA 3ARUA 3UTZB 1UEMA 4LSVH 1IGIH 1NEZB 1C5BL 1G7JB 1FFNA 1MJJB 3BAEL 4Y16D 3MLWL 3ULUH 1IAII 4YHLL 2ENYA 3MYZA 5DK0A 3GSOA 1YY8B 2XXMB 2HTKC 4OBSA 5GPRA 4JDZB 1SVZA 1IAIH 2DWEB 1AGFA 5DZNA 5GQBA 2FATH 4J3VA 1YECH 2MQ0A 4L3ED 5LXGH 1J0JA 4J8RA 3ECBB 3MRBB 5C0RH 4UB0L 3BYTA 3V4UL 4AG4H 3VW3L 4JFXB 1IEBA 1NH6A 3JTTA 5C0ND 2ARJB 2Q1EA 3V52L 4F7PA 3EJYC 3OKLA 1CD0A 2MKWA 1HDMA 1GC1C 4PP2B 2DQCH 1ZT1B 2BVEA 4TSCH 5BJTB 5L88L 2VO5A 4CVXA 1BZ7A 4HS8L 5CEYB 4OT1L 1A9EA 5DFTA 1E27A 3T3MF 2YOCA 5ADPL 1FAIL 5I1KH 1Z9LA 4OGAC 2FECI 4H1LH 1AXTL 3GMNB 2EO9A 5I1LA 5IMKB 1D9KC 2E3VA 3D9AH 2Z92B 4GG8B 3BGMB 1FVEB 3LQMA 5LBSH 4LLMA 4F15C 3OR7B 2GFBB 4D9RE 4YEFA 4XBPB 3WXWL 1KOAA 3LEVH 4DK3A 4KXZI 3LDBB 4AEIH 1T1ZA 3H9SD 1MY7A 3D3VD 4PV8B 2J8UB 2XT1B 3HCVB 3QUZC 4M6OL 4DGYL 3MCLH 2VUOA 3CVHL 4KXZH 3BH9B 1LILA 2L0DA 1QSFB 4IOFC 4W6XB 4YDLB 5T5FH 4A6YA 4NQCD 3DUSA 3IT8D 3QBTB 4PBWD 4PLKC 5C8JB 4J6RL 2BVQB 3RGVA 2BHZA 2B20A 1MIML 2IAMC 3CNKA 3FOLB 4N9GB 4LSTL 5JDSB 1TJGH 4JM2A 1YEEH 2Z8VC 3C6LC 1T03H 1S5IH 4JFOA 4MSWA 3BE1H 5FUCC 2J88H 4LARH 4YHML 1AD0A 1IT9L 2C1OB 5C0CB 1N5AB 35C8L 1SBBA 2YD4A 4ZPTA 4J1UA 1J0IA 4G8IB 5ICXA 1C5BH 4M6AA 1CL7L 3BAEH 4FQXA 4IIQB 3MLWH 4IRJD 4DEPB 3MGOA 4O5LL 4YHLH 4PJDE 3MLVL 1HINL 4OD2B 5HYJD 2FYYB 1QP1A 1BAFL 4CJ0A 3REVB 1X5XA 1NC2B 4OIAA 4L3AA 5GGSA 1AR1C 1K5NB 1QR1A 4XPAL 3VDCA 4TVPD 3TZVC 5EPMA 1X6LA 4UB0H 5T1KB 3V4UH 3VW3H 4EQ3A 1UB6A 1NGWA 4JKLA 2J12B 3V52H 4W4NA 1RZ8A 2OTUB 3N1FC 1G1YA 5DUBA 3ROOA 3BP5B 3HZVA 4QWWC 5L88H 4IBLT 1A9BA 1LO5B 4PRPE 3MV8B 2QHLA 4HS8H 4OT1H 3TPKA 2QQLL 3BDYH 3F8UB 1X4YA 3WIHA 1FAIH 5IW6B 4C56B 2N7AA 1FVDA 1F58L 4K94L 1AXTH 3PV6B 4X9FA 1CS6A 1XF5B 2KZ1B 4KRPD 1SY6L 4PJAB 3DIFB 4PJIB 4MCYB 5CIPB 3SO5A 3V7MA 4J2XA 1N6VA 1VGEL 2X09A 4WWKC 3WJLC 2PXYA 3ZKXC 2UZXB 4NNXA 5C07A 3SDAA 2AJUL 4OCRL 5FKAB 1U6AL 1U3HD 1LK2A 4P3DB 2J3SA 1RK0B 3VRIA 1RUPH 4NBYB 4M6OH 1H3PL 4DGYH 4U3CA 4MA3A 3CVHH 4S0TD 5ACMA 4ZNEE 1WZ1L 1G9ML 4MNQE 1A1MA 5D6DC 2ZSVA 5IB5A 4QTHA 4MD4B 1EK3A 2UY7A 1HHJB 4QRQA 5HGHB 5HYQB 4J6RH 4KHTL 2DI9A 1JFQL 2X4QA 1A2YB 5EBMA 4PJCE 1R24A 1MIMH 2D3VA 1I9IL 1DBAL 3LQAH 5CGTA 4H1LG 5SWSE 1ODAA 2WV3A 3KJ6L 1YEJL 3FONA 4HIEB 4RSVA 2HT3D 1MCJA 2GHWB 4N90E 2HG5A 4JGJA 5DHYA 3P4NA 2VDOL 4JRYB 1C5DB 3K1DA 4JRXA 2A1WL 3FT4B 1J7VR 1NLDH 4YHMH 4F57L 4PJBB 4X4YA 1IT9H 3DYMA 1ZWIA 1FH5L 2V7HA 4Y4HA 2Z35B 1CL7I 3B9KA 1HI6A 3QIUC 5EU6A 5I17A 1H0DA 1A14L 1PD6A 2KPNA 3WE6B 5DMKA 3EO1B 3OAZH 1CL7H 1CQYA 1T1YB 5EORL 3JWNC 4LLAA 2LU3A 4O5LH 3MLVH 1HINH 2AK1L 1XF3B 3V0WL 4XMLL 1BAFH 2YZ8A 4X6DB 3O8XA 5J1TC 1W0WB 2RAMA 3O3DA 4NKMA 3IYLW 3KHQA 4OLUH 1BBJB 4XPAH 1ITBB 5DWUL 3O41B 4BQBA 5E9DA 4PRNA 4I5BB 4QRRB 2Y6SD 1FZMA 3KPRD 1U41A 3L5XL 2P5EE 4LHUA 3GSXA 2Q86B 3TNNA 4CJ1A 2RFXB 2X1PA 4MDJA 4MZ2A 2GI7A 3K4AA 3OKYA 2QQLH 2R8SL 3VD9A 1JWUA 4WJ5A 2KKQA 2ESVB 1F58H 4XWGL 5ICZB 3PP3H 3SPVB 1YNLH 5BVJA 4IMLB 4ZODA 4KK5C 3BZ4B 1SY6H 4C57C 3PHSA 4PRHE 1VGEH 3D85A 3UYOD