3OD3A

Cueo at 1.1 a resolution including residues in previously disordered region
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
488
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 143
structure length 488
sequence length 488
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A03
1MG2C 1FWXA 3AG1B 3IEAA 2FT7A 2GHZA 2QDVA 1E67A 1BQ5A 4BDVA 2VM3A 5D4IA 2Q5BA 1AS6A 3FSVA 4AKOA 1J5DA 4ENZA 3EH3B 4A2HA 1NZRA 3S8GB 1JERA 3CDZA 3CZUB 4QLWA 2ZWNA 2MTAA 3IN0A 2LLNA 3NJLA 3SBPA 4A68A 2YAFA 4JKNA 1AQ8A 1V54B 3QJUB 4KNSA 3S3BB 2Y69B 1RZPA 1AANA 2AZAA 1ETJA 1BAWA 1PLAA 2BO0A 4WTQA 1R1CA 1W6WA 3CVDA 3PLYA 1PZCA 1SFDA 4DP5X 1ILUA 2JXMA 2QPDB 4KO7A 1PZAA 5B1AB 4KNUA 4E9YA 3CG8A 1M9WA 1CC3A 1PCSA 5PAZA 1L9SA 1A4CA 1CYXA 2PLTA 2BP8B 3QJRB 1A8ZA 4P5RA 2FT8A 1NWOA 2NRDA 2EIKB 5B1JA 5IY5B 4E9WA 4KO9A 1UATA 2HXAA 1GS6X 2PPAA 2R7EB 2I85A 2GBAA 5F7AA 2FTAA 4KOBA 2VSMB 1CYWA 3OM3B 1A65A 1N68A 3SBQA 3QPKA 3ABKB 4UF7C 1FA4A 4A66A 4GYBA 4K9JA 4DPCX 2IAAC 1NIFA 1SF3A 1J9QA 3SQRA 4Q8BA 5I28A 1L9OA 1JXGA 1PLCA 3WIAA 3WG7B 2ZONA 4YSAA 3H4HA 3NJJA 3HEIB 3NJMA 1WS7A 2FQFA 1PAZA 4N4YB 4HHWA 1NIEA 3UAAA 1JZJA 1PNDA 5D4JA 1NWPA 3NJFA 1ZIAA 2PPFA 4GP8B 5EHFA 2H47C 1PLBA 4YSPA 3FU7A 5PCYA 4WKXA 3NP4A 1E5ZA 4G7SB 3T71A 2BHFA 1RKRA 5D4HA 3GXUB 4F2EA 3PCYA 3UAEA 2J57A 4X4KA 4N8UA 3GYRA 4YSEA 1ET8A 4W1TA 1BQRA 2VW6A 2BWDA 3FU9A 3V9EA 3BVDB 2X88A 1L9TA 2X87A 2YAHA 3FPYA 4YSDA 1BYOA 4A67A 2UX6A 2FQGA 1I53A 1NDTA 2HX7A 4TXVB 4G70B 1JZFA 1J9TA 5E9NA 1BXVA 3AY2A 1OV8A 3S3DB 3NJIA 6PAZA 1AG6A 2VM4A 1OF0A 1GY2A 3QJQB 3PAZA 3WNIA 2PP8A 1JZEA 2I7SA 1DZ0A 2CALA 4L0PB 4CSZA 1KGYE 4F7KA 2J55A 3FQ1A 4BWWA 1X9RA 2UXFA 1W8EA 1SJMA 1RZQA 2IWFA 3N2JA 8PAZA 1DYZA 4AZUA 3ZIYA 3MX0B 3IBOA 3SBRA 1ZDQA 2TSAA 2AZUA 1AAJA 1ASOA 2N0MA 3IN2A 4JHUA 4AKPA 4YSTA 3ABLB 3ERXA 2XV0A 4YVNA 3EH4B 4DPAX 4DP4X 4KNTA 1HFUA 5ANHA 3WKPA 3X1FA 4NAJA 3QJSB 1KYAA 4GP4B 1SNRA 1HAUA 3PAUA 1ZV2A 1AACA 4FAAB 4YSRA 1GSKA 1IBYA 2IDSA 5B1KA 5AFAA 1V55B 4PCYA 2H5UA 1IUZA 2IH8A 5AKRA 1L9PA 1PY0A 3T6ZA 2R7EA 4DP9X 1ET5A 1AZUA 3NT0A 3ABGA 1VLXA 2DY2A 5I6KA 2IWEA 2XUWA 1NIAA 2MRYA 2YARA 3FPXA 2TSBA 4UANA 2A3TA 2YAPA 2UXTA 4GXFA 2EIJB 2BP0B 2CAKA 2XV2A 4G72B 3FS9A 3X1EA 3AG4B 1KCWA 1XMEB 1NTDA 1SF5A 2BZ7A 4KO5A 2FJSA 1GW0A 3AG3B 2B3IA 4HALA 3X2QB 1V10A 2HRGA 2XWZA 1URIA 2W8CA 3X1NA 1MZZA 4EF3A 3NYKA 2DYSB 1MDAA 2QDWA 2JKWA 4HAKA 2VN3A 2HRHA 5I5JA 5B1BB 3FQYA 4E9TA 4DP0X 4HCFA 1PF3A 4MFHA 1EHKB 3FYIB 4BWUA 1J9RA 1B3IA 3FU7B 5LDUA 2CUAA 2YXWA 3NJNA 3IE9A 3OD3A 2BP0A 4KOCA 4A2GA 2CBPA 2BWIA 2BW5A 3FYEB 3DIVA 1A3ZA 2PCYA 2WO3B 1A4BA 1AZCA 2YAOA 3CVBA 3NP3A 4E9SA 3TA4D 4YVUA 1AS7A 2XLLA 3UGEA 5B7FA 3MBWB 3FU8A 4E9VA 1JVOA 3EH5B 1T5KA 2PPEA 2Y1AA 1X9UA 1OE2A 2GI0A 4YSCA 2DWTA 2CCWA 1ZIBA 5I5IA 2CJ3A 1OCRB 4HCGA 2YAMA 1PMYA 5I6NA 1GS7A 1ILSA 3FQ2A 3NSDA 1SDDB 4AKQA 4UAHA 1EZLA 1BEXA 1WA0X 2PPDA 3EHBB 5I6MA 5AZUA 2FT6A 2YQBA 2PP9A 3ABMB 3OMIB 4NERA 4YSOA 1BQKA 2E86A 2HZHA 3FSWA 5F7BA 1QHQA 3H56A 3ZX1A 1OOWA 2FNWA 4KO6A 1AZNA 9PCYA 1AS8A 1RCYA 3JTBA 1XB3A 3T9WA 3TU6A 2XYBA 2HLEB 4M4RB 3AZUA 2HX9A 3U25A 3S3CB 4FA7B 1J5CA 5TK4A 5I5MA 3NSFA 1A4AA 5I26A 1ASPA 1KCBA 1WA2X 3QJVB 2UX7A 4YSUA 3X1BA 4DP7X 3X1GA 2J5WA 1IBZA 1KV7A 4GP5B 1E65A 2IDQA 2GC4C 3TASA 2EINB 3PPSA 4YL4A 2QT6A 3PXLA 2AFNA 3NJKA 1KBVA 3D12B 2DWSA 5B7MA 2BW4A 2OJ1A 2BZCA 3GDCA 3RYMA 3TBCA 2B08A 1GS8A 2OCCB 1N70A 4PAZA 2IH9A 2DYRB 2P80A 1NINA 1TEFA 2XXGA 1IKOP 5I6LA 2PPCA 3DKHA 3DTUB 3OMAB 2I7OA 4JHVA 1YLBB 3HB3B 4HHGA 4DP2X 1AZRA 2YAEA 4AI7A 1ID2A 4NB7A 2W88A 1QNIA 5I6OA 1NPNA 4M3HA 4BK5C 4E9QA 3PAVA 3CDZB 1AIZA 2XX0A 4GY4A 4W9ZA 3TBBA 1OCCB 1M57B 1BXUA 1BXAA 1IC0A 4YSSA 7PAZA 1SFHA 1JZGA 1WS8A 4A2FA 3NSYA 3V9CA 1ET7A 1NIDA 1NICA 1ZPUA 4YSQA 3T6WA 1CUOA 3WNJA 4DPBX 1F56A 1KDIA 1OE1A 2VW7A 3OQRA 1CURA 4HCIA 3L45A 2GIMA 4RH4A 1W6LA 4E9XA 1JZHA 1TEGA 4DP8X 2XV3A 3ZBMA 1SHWA 2RACA 1NIBA 3ASOB 5I6PA 1JOIA 2JFCA 3ASNB 3BQVA 5B1JC 2P80D 3UABA 3UACA 4AX3A 4BDVB 1ADWA 2FWLB 3N55A 4DP6X 3NJHA 1QLEB 1ZDSA 2HX8A 2XU9A 1E5YA 2XVBA 2ZXWB 2AANA 1SDDA 1PNCA 4G7RB 2Q9OA 3T6VA 1MZYA 2EILB 1TU2A 1MG3C 2VSKB 5B7EA 4BXSV 1JVLA 4ZK8A 5TK2A 2GSMB 1OE3A 4BWTA 3NSCA 3H4FA 1JXFA 1E30A 1KBWA 3S8FB 2EIMB 2FQEA 2YXVA 2H3XC 3C75A 6PCYA 4F2FA 4HIPA 1OCOB 1L9RA 1AR1B 1WA1X 2QPEB 7PCYA 3KW8A 2J56A 1AG0A 1GR7A 3OMNB 4HZ1A 2PP7A 4E9RA 3AW5A 2BP8A 1AZBA 1JZIA 2ZOOA 3WI9A 2IDUA 3CVCA 1OCZB 1L9QA 3T6XA 4BXVA 3QQXA 1NPJA 1FFTB 3WKQA 4CSPA 2VMJA 2PCFA 1TKWA 1XB8A 3FSAA 1GYCA 2UXGA 2DV6A 1BYPA 2IWKA 2VW4A 4Q89A 3NJGA 1J9SA 2OV0A 1AOZA 3QJTB 4P5SA 2GC7C 3AG2B 5A7EA 4G7QB 4DP1X 2IDFA 5FC9A 2UXVA 3UADA 1JXDA 1HAWA 3KW7A 3ZDWA 1ASQA 4G71B 1SHXA 3JT2A 2GB2A 4A2DA 5B3SB 2AVFA 2YAQA 3FT0A 3G5WA 1M56B 2XX1A 4A2EA 1WAEA 2WO2B 2FQDA 3EF4A 3FSZA 2XXFA 1PZBA 1KDJA 2IDTA 1GY1A 2WSDA 4QKTA 1XB6A
chains in the Genus database with same CATH superfamily
5JHDB 1ZMYA 3IEAA 1JD9A 4HIHA 3MFFB 1K4CA 4XPAH 3K74B 1TZHA 1FP5A 5D5MB 4ENED 5L4IA 2X4UA 3TIDB 2JV6A 3BZFA 4IOIA 4MQ7B 4YH6A 1UYWH 4XXCC 3SBPA 5M95B 2XYCA 1DVZA 4JG0H 4J39A 2BLFA 4KMTL 5IB2B 3PDGA 2YAFA 3FB5A 3IS1X 4ZMNA 1QFUH 2HFFA 4J3SA 3ZDYF 1DBJL 1UD8A 2XHNA 2FCBA 4B9GA 2BO0A 4LBEA 3TBYB 1SY6L 2JSFA 1UM6H 2DBJA 2YKKA 4PI0A 1ZV9A 4OVVA 1U8QA 3TA3D 4YR6A 3SD2A 3BKYH 5IHUH 4IU3B 5C1MB 5DHVH 3OBAA 4E5XA 1NGPH 3CFDB 3CFEB 4ODVL 4EO5A 3WFBL 1DN0A 4U1IA 3GO1L 4RFEA 1FG2B 4IMKC 4MD5B 2XN2A 1G94A 4HUNB 3P3RA 1TVDA 3MV11 1JGLH 4HETA 5C0CE 1HNFA 2PO6D 1PG7X 3HE6D 3MLWH 4A2MA 2WD0A 2FGWL 4OZFB 4PWIA 2Z91A 1UATA 3GSVA 4QRSA 1IBFA 3OX8B 5IB4A 4L48A 1WT5C 2O5ZL 5DRXB 3VDAA 4IKLA 4C4KT 3ORJA 1IZJA 4G8FB 2YC1B 1YDPB 1U41A 2WB7A 4K9JA 2IAAC 3U0TB 1UCBH 5EWIL 1C9SA 4YE4L 3KLHD 2ZXCA 1UD4A 3QG7L 1N4XL 4U6XB 1JYWA 5GJTH 3EO9L 3AQXA 5BV7H 5AKTA 1BJ8A 4JFUA 1NIEA 5IHUL 1DBMH 3OAUH 3VDBA 3V0WL 1ZIAA 4AEHL 2VC2B 1BF5A 2XG4A 4YSPA 2ITCA 4Z7WA 4OB5H 5BUPA 4K8RH 4XPBL 4XMPH 2YBGA 3NPSB 2CUHA 3QUZA 1UB6A 1RJCA 3QQ9D 3GXFA 1F90L 5E9DB 4CVXB 2OZ4L 4OI8A 3LIZL 3FFCD 3KPLB 4P57B 4FC3E 3MLTA 1F4YL 1BQRA 4Z95H 3ZE1B 4PRNB 3CCHB 4PJHF 3EGSB 1U8KB 1L9TA 4N87A 4A6YL 5TH2B 3PWLB 2PR9A 3VX0A 2J44A 2YRPA 4TSBL 1BJ1J 2ZOKA 1TETH 2KUTA 4TXVB 2AK1L 4PP1D 1JZFA 5CJ5A 2I60H 2IMMA 2O5YH 3EJRA 5FYKU 3ZTEA 2VO8A 5FGCE 3IXAB 1DLFH 5IVOA 5K9KB 1FSKC 3WKMH 2CO3A 2X2YA 2IADA 2ZWKA 4LCIH 2BK8A 4P5MA 4GRMB 2WLZA 2G60L 2JJTA 3ZE2F 4GSDH 2BIMA 3ATEA 2WLIA 4HLZH 2YD1A 3BWAA 4NZRH 5GJSL 1DEDA 1EV2E 4YHPB 5SV4A 1KCUL 4HHAB 1QFWM 5AZEH 4AQ1B 3DV4A 1JZ7A 4XNQB 5DD5H 5D7KD 5IV2B 1U6AL 2PW2B 3GI9H 4NIYE 5GIRA 4JHUA 4TOYH 4FNTA 4P2OC 3AS3A 2ZSVB 4GKNB 2X4SB 3DOSA 4HSQA 4F3FB 4KDWA 4LRNH 5FM8A 4Z3JA 3NFSH 3BMWA 3OXSB 5DZNA 3WEXB 2ZOLA 4PJBE 5KSUA 2I5YL 1L0XA 4FXGA 2ZKXA 4HGKC 2Y1YA 3F8UB 3UZVB 5AB1A 1IQWH 5E8DH 4PJGB 2XWJA 1CTOA 2XVKA 3C08H 3HC0A 4XT1C 1JFQL 4DZBB 3ULUH 3H3BC 4P2QE 1A02N 3BKMH 3SDDD 1IRAY 3CMOH 4L8SB 2IDSA 1IT9H 2NXZC 2PR4H 1U42A 4X7SL 2XBTA 3ROOA 4JRYE 1T04A 2AI0L 3H2QA 4YHOL 4MCNA 1C7TA 3NIFB 1AMYA 1CGYA 3GBNH 3PGDA 1A9EB 4PD4K 3W11C 4KGLA 4Y2DA 1M1SA 3BN9D 2X4TB 2NUPB 1XIWC 1UD3A 1QTYT 2J8UE 4QHLA 4ZBJA 3UTZA 3KMDA 3QQ3A 3QDHA 4AYMC 3VGDA 1IB5A 5AAPA 5F6HI 1XF2B 1IM3A 2NY5L 1NBVL 4YHLL 4IBVA 1PG7H 3DBXA 1OARH 1KEGH 1XSKA 4GBXB 4QHUB 4FE9A 3VFGL 5T1KA 1DZBA 3IU4L 5FHBH 4J3OC 2LR4A 4AGQA 2P8LB 5DVMA 4ETYA 3WTYA 3I50L 1KIPB 5BXFB 2HJFB 2V17H 4OCWL 2OI9C 1Z9MA 3VQLA 3W39A 4PJ8C 2EDHA 4QHPA 4F8QA 1H15B 4POYA 1CF8L 1NBYB 1RVFL 3VRLE 4NKOA 2V9RA 1PSKL 4RSYA 3VXTA 3TLRA 1T0MA 1HESA 3WEXA 1BVKA 3B5GA 3TPKA 2R0WL 4HD9A 2CIIB 2DQJH 5EIIB 4IRSD 3FRPA 4KJQD 1UM4H 3QRGL 3KPNB 4JMXA 4Y5YA 5DSCA 5HI4D 3VFVA 4YVUA 1ADQL 4Q4EA 3UGEA 4U6XA 1MJ7H 4X6EA 4R97C 4ZUTB 3S9DB 1AGEA 3SO5A 1IEAB 2KS0A 3LRSB 3VH8B 5FM5M 3FRPG 1DEEB 3IMBA 3QIUC 3QUXC 5JW3H 3T8XA 4NQXB 4AQZA 5HYJE 4Q9RH 3OPZL 3JWDH 1WAAA 5C0AD 2J7LA 2O30A 2XC8A 1LP9B 1IGTA 1ILSA 5CJBA 1D2OA 3ZL4L 5LCVL 2EZ0C 3ZGHA 5I6MA 4KKAD 2OMNA 1ZLUK 2MOVA 4YDJB 3EBHA 3IJSB 3TWCL 3IETB 1CU4L 2K7PA 4ZS7H 3RNKA 3Q5YA 1A21A 1QHQA 3OV6A 2L7UA 5BW7A 3LQAL 4ZO8A 1RZIB 5HHOD 9PCYA 3HLAA 3EGSA 4I87A 4JFZH 3MVSA 3Q8CA 2QHRH 5I16B 1J0KA 5CEYB 3W38A 2A83A 1ZANL 3LY6A 4NZUL 5I1JL 3CH1A 1HOEA 1X5GA 2BRRH 3RU8L 3I2CL 4O02A 1TLKA 5KBDA 1KTLA 4GXUM 2J8HA 2AJUL 2FB4H 3A22A 3HC3L 3LQZA 2E4FA 3LVTA 5GSRB 3RGVC 4F8NA 3NA9H 2UX7A 1P5UA 1YQVL 3LKRA 3T4YA 4EN3B 1CIUA 1IKNC 3X1GA 2J5WA 3BP7A 3OHMB 4AQ1C 2AKRA 4KKNA 5CSGA 3RWGB 2BVOA 1FFRA 3UIYA 3QT2A 2IGFL 15C8H 4KK9C 5CR1A 1J1PL 2IAMC 4HIIA 2XBZA 3W0WA 5DMIL 2AEQL 2ZUWA 2ZYHA 1TJIL 4RFNB 4OLYH 4XC1H 2WAQA 3P69A 1MQKH 2BW4A 2G75A 1B6DA 3TBCA 1A6WH 5FM4A 3V4VB 1S9WA 4WHCA 1NGQL 2K9UA 1JDCA 2O5NA 4K3DH 4JO2H 3OMAB 4LSTL 3C6LA 3DUHA 4D9RE 2HT4C 3MR9B 5D72L 2QVFB 2WWNA 4F80A 2Z91B 3GSVB 1BLNA 1LMKA 1EO5A 3QS2A 2ICWI 3BW9A 1DLHA 1NPNA 2OK0H 1XCQA 1DDTA 3CBJB 3L1FA 3IMWA 5E4EB 2HP4A 4WK0B 4BD4A 3RTQA 1IL1A 2R0LH 1HHIB 4EI5A 1OCCB 1CXFA 3D33A 1KCVL 1ERNA 4XPGH 4D0BA 4NC0B 4PVBA 2ATPB 1JZGA 1YMME 3TH3T 2PYFB 4TUJB 3NSYA 2BY2A 4X0NA 4M62L 3UO8B 5IM7B 2L0DA 2VLJA 1NICA 3HOGA 1ZPUA 2O1AA 1R33A 4HUXB 2UZXB 1ADQH 1MIEH 4XWGH 3EJUA 5F8RC 3T77B 1KYDA 4UQCA 5IW6B 3AFLA 3TO4B 3WXVL 5BMFH 5E08L 4NM8L 1DVUA 3QI9A 5DJCA 1KGXA 2BIPA 1JZHA 3OGCA 1JWUA 4OGZA 3BO8A 5DR5H 3SJVA 4DP8X 4ZX3A 4G80A 5T1DL 2WINB 1NIBA 4XHQA 1OO2A 1KOAA 1JOIA 3K72B 3W1ZA 5FYKE 4ZX5A 3OXSA 3LKPA 2XFGB 1LILA 4AX3A 4FLSA 3RX8A 3NJHA 1OEZW 3L95B 1KZQA 1YNTB 2Y36L 4IRZA 4XMVA 3MA7B 4L9LA 5FYJL 5D96C 2DTMH 5L2KB 1TU2A 4JQIA 4AG4H 3C09B 2E8ZA 3FTWA 1OAJA 5CIPH 4IJ3B 1XL6A 2I9TB 3P0VL 4HMDA 4JFPA 1T21A 4MJIA 4WCYH 5GHWH 4FQXD 3D52A 2WWKT 3QXAB 4EN2A 2OW7A 5SWZA 4QRPE 4CN1A 4RFNC 2F15A 2OMYA 3L1OH 3IAGC 2YD8A 2H3XC 4OT1H 2WTOA 1PKOA 1J8RA 3MNVB 3WKNA 3U7WH 5HP5A 3OJMB 2ZXGA 4PM1A 3Q05A 1J7VR 2CBTA 1WA1X 3BKCL 4R4BA 4IEFA 4HC1H 4YE0A 5HPOA 3LKSA 1RSFA 3T2QA 5HGGS 3OKOB 2AJXH 2ED7A 3ZU8A 3RGBA 4A04A 3CWGA 2A77H 3TCTA 1NUFA 1EHAA 1WUNT 4LLDB 4ODHL 2ZYSA 3JWOL 2VRQA 2B1HH 5K59F 4P3CH 3HR5A 2MNUA 5HHQA 1XB8A 3BWUC 5JOFB 4ODXB 2OMWA 2BS71 4F2MB 1S9VB 4L3CA 4X9FA 3QXTA 5C0BA 5C6WH 4WQOA 3ARDC 4ODXA 1TDQA 3GJFH 4XMLL 4NQQA 5JQ6H 3GSRA 1BMWA 2GAZA 3QNZA 3RFZC 4PGZA 4JBSA 4PN6A 2LOEA 4Z7OE 1Q9WA 1MEXL 3T0EA 2WVVB 2Y7OA 5FUZL 1BQHB 1L6ZA 2KPNA 4XCNA 1XR8A 2DM7A 1AFVL 1E7VA 1H6UA 2Z6FA 4L8SC 4J3XA 4GAGL 4XP6L 3AQDA 3TFKC 3L81A 1MCJA 4AYFB 1W2KT 3RA7H 1KYUA 2AVFA 3MUHL 1OT1A 5IJCC 3CDYA 2HT4D 4OBRA 5DWUH 1JGEB 4G6JH 3FH7A 4FXKC 5MEOA 1QW8A 3U4KA 4TM9A 5GZOC 1CF1A 6PCYA 3MRMB 4QXTA 3V0HA 4JKPH 1M1XB 3KCPA 4H88L 1KV3A 2DKSA 3ZXAC 1Q0EA 3QH3B 4PGBB 2OMTA 3MCKA 4N20A 4ZTEA 5A2JH 1QZNA 1JHLL 3RIKA 2QQLL 5ALBL 4WEUD 5IKCB 2IQ9H 4JANA 5GRZA 1U36A 4L9LB 5F21B 5I18L 1IGCL 3WIIL 4B60A 2JKRM 4X0KB 4IIQC 1IE5A 4WJ5A 2QPFA 3VGFA 2CKBB 4X8JB 1OTSD 3HZMB 4X6CE 3S8GB 1TF4A 3S48A 4OCNC 4PV8B 4HEME 4HF5H 2CIKB 1U8HB 3EKCA 1KJ2B 3LZFH 3PUUA 4TVUA 3D48R 4RIRA 3B2UD 1AANA 1OLZA 1KTDB 1NCWL 4PJFF 4RSVA 5T1KD 3ET9F 3QDGA 1I8IB 2FJGB 4JPWH 1JNNL 4HGWA 1MFDL 1O7DE 3FN0H 2LLLA 4LVHB 3O4LE 3IU3A 2JXMA 2E7BA 4XP1H 4XPAL 3RL2B 5F3BA 4MNGB 3D2UA 4R9HA 1BAGA 3QEUA 1DVYA 2CG9X 4F5CE 2VDKB 1EUTA 4MCMA 5HI5D 3L5JA 4Y5YC 3RFZB 5KS9B 2OR9H 4IBZA 3ZTNL 4QJ5B 4OKVB 4WF7A 1YMMB 4FHKA 4HIHB 2W59A 4M29A 1ZLWH 5DZOA 5HDRA 1E4XL 2R4SH 4DCQB 3PXHA 3IDIA 2DQEL 4TRPL 2QKIC 4DKFH 3P11H 3TV3L 1GTFA 2XQYK 4QF1B 1R75A 3ARED 1ONQA 3L4ZA 1LEKA 4AJYV 1KPUB 4JN1L 2Q0ZX 5AVWB 3JTSB 1G6RA 4PVMA 3WDJA 4DPCX 3GMOA 4Q8BA 3MN8A 3CHPA 3ULSA 3WJJC 1X5JA 1D6VH 1YEWA 1OSYA 5IVXB 3EFOA 3WMQA 3D39E 2X89D 2OZNA 5GS2H 1A7RH 3GMRB 5FKPA 3X3FH 1ZSHA 4HHWA 1SQMA 5AB9A 5DC4B 2OMZB 2GITA 4QRBA 4X6BA 1JZJA 4C54A 3OVUB 5E8NB 2VUYA 1T83A 2PMZA 4HU2A 3HTLX 1QI4A 5DA0B 1XFPA 1EZVY 2ERJB 3IDXH 5IB5A 2VJ0A 3N9GL 1QWNA 4W4OC 1OWWA 2JF1A 5EOQL 4G1EA 1IVLA 3FHAA 5GSRA 2LAGB 3SGDI 1UEYA 1ORSB 5CILH 4HGWB 4X5WA 1W16A 3CFMA 4IIZA 3WE1A 5E0FA 1VPOH 1ZTXH 1V3KA 3ARWA 3WUZA 5E6YA 2NYYD 4OIAA 5IBTL 2VOTA 2VW6A 2A83B 4MB3A 2NY3C 3RBGA 4AVJA 4JPSA 7CGTA 1B4TA 3F5WB 4G1MA 3DV6A 5GGSB 1MPAL 3SJVD 2Y5TA 4KWUA 1H3XA 1NAML 2X0VA 2G3XA 1CB4A 2DQFA 3WAJA 3C60C 1QD0A 4C56B 3LS4H 3AT9A 2YOAA 4FFWC 1ZE3H 3VUAA 1K4DA 3ZDZE 1TZIA 4G8GE 3WUWB 1R24A 1X4XA 3IFPA 3MLYL 2LT9A 3KDPB 3SYCA 3WGVB 1TNNA 3A23A 2XXMB 4MNQD 2J20A 1OPGL 4Y88A 3ULVD 2LABA 3SD5A 3I84A 3UTQA 1RFDL 2OQJA 4MYPA 5B8CA 1AKJA 1XGQA 3F7RA 3BEWA 1FO0H 4FGMA 4BCZA 2KI6A 5KJRL 1A7BA 5BRQA 3TBTB 4B9IA 3KEDA 4TYUA 3ABLB 3BAXA 2PTVA 3FQNB 4ADGA 3DROA 1M7DB 4LP8A 3WDIA 1X7QA 4L4TD 3BXNB 3MAWA 4PPTA 4M03A 4OZFG 5E2JA 3TYGL 2FL5B 3NZHL 3WKPA 3V5DA 3AQZA 3QJSB 3ZTJH 3BDXA 1FVCB 1X5IA 3NCBB 3TO2A 5IVZA 1NAMH 4L4JA 4NX0A 5FLVA 3O9WC 3QXVA 1XSOA 1UH4A 4RFOH 5J56B 1OW0A 2ZNXA 2Q3XA 4PCYA 1BOGB 2EABA 2IH8A 3DO3A 3IS0X 4ODTL 1L5GA 5EH1A 5INCB 4NO0B 3QE5A 3WLWC 4S1DC 1ZVYA 5C09B 4DP9X 2P49B 4RCAA 1DO5A 2VZTA 5I8CB 4BFKA 2JKXA 4CKVX 2DQDL 3AAZB 1U0QA 2VDNB 2X1OA 4DN4H 5M94B 4HUUA 1AP2B 3ARBC 4EZMA 4QHNB 1RK1A 5F6IC 4BH7A 4XRCB 1R47A 1N8ZA 4GI9A 4OJFL 1Q4NX 4JFFD 3TH4T 1C12A 3I6LD 4GS7B 2F2HA 4IBLT 1QLFA 3NFNA 1X5LA 3P0YL 5I30L 1NAMB 1G4MA 3IMUA 2VZUA 3DYPA 5F1NB 2W8CA 4H5SB 4QRPD 2DYSB 3OF6A 2HT2C 5C0DB 2R4RL 3P73A 4Z0BH 3PL6C 4XO8A 4R7XA 5ISZB 3MREB 4BWUA 2DQCL 2BSSA 1B3IA 2XWBB 1OSPH 2BHZA 4I2XB 5TE7H 1EGJA 3ZYZA 4QRFA 2ITDB 4XBMA 1JGUL 4ZNCD 5BPPA 3QEGH 3K8KA 4MNQE 2JQAA 3BVNB 1F4XH 5FO2A 2W1NA 4GAJL 3O41A 4YLQT 1B2WH 1T5KA 1UUSA 4AM0A 1LQSR 4YHPA 5IG7B 1X9UA 3FOMA 4A7SA 4AQ1A 1BXXA 4YSCA 1AE6L 4M61A 4P46D 5CSZB 4JVWA 4P5MB 2JJSA 4NS0A 4OM0H 4Y4HB 4P5TC 1GS7A 3F7YB 5C7ZA 3NSDA 4MAUL 5E99H 3EYQD 4PJ9B 3P30L 2H1LM 1WPCA 5GGRY 4G6MH 1CE6A 3FUNA 4PYGA 1SMAA 3HNSH 1YECH 1F6AB 1BQSA 1QBBA 4WW2A 1SVCP 1AI1L 1RVFH 1RK1B 4BH7B 5F7BA 4NUJA 1CLYL 4YGAB 2OI9B 5HI4C 1D5BB 2OFQA 3FB8A 1L3NA 3ZRSA 3DIDA 3OB0K 1JGUH 1NM9A 3VI4B 2FX9H 2DQJL 2PN5A 2CLZB 1JMXA 3MCG1 5F8QC 3HFFA 4MX7B 3S3CB 4YXKH 4XVUD 5DD1H 3DURA 4N2OA 1BREA 3MBEC 4JHWH 4JPVH 4OD1H 4Y0GA 5KSVB 3E1F1 4K9EH 4Q6YA 4A6YB 4ZX4A 2WQSA 3AU1B 3S36H 3LZLA 3QJVB 5I23A 3ATBA 2EEXA 1KIQB 2ALWA 2X42A 2NY1C 4QYOB 2MPAH 1FVCA 3HC4L 2EDBA 2GSIA 3WTUA 4AUJA 5I8OH 3OHXA 1A3RL 1M05A 2JB6A 4KMTH 3GBNL 3ZPDA 3U2IA 4EJ1C 3BXNA 4OB5L 3CZFB 3LQMA 4K23L 3E3QE 1KLFB 2EP6A 1AGFB 4CU7A 3RPIB 1AQDB 4ZO6A 4POZD 2BZCA 4MAYC 5DD6A 3OZLA 3QXUA 1TJMA 3LNDA 4NWTL 4N5EC 5FW7A 2PCXA 3PRZA 4HS6A 4H8WL 4G8IA 4PAZA 2DBLL 2IH9A 4WK4B 2JCCE 4K2UH 1YMMD 4XPHL 2GFBB 2X0WA 5DDHA 4O2FA 4PJCA 3VI3A 5TQ0L 4C57C 1BV8A 2DLEA 3EOAB 3LH8A 4AI7A 3X12B 3K2UH 3O2WH 4NN7C 3DX0A 1ZTMA 4AIEA 1DQKA 4K9EL 3Q0HA 3SHSA 3PHOA 1N5YH 4KVCL 3VCLB 5E1AB 3QIWB 4U2YA 3TBVA 1FLRL 3CDZB 4IW4C 4KKLC 5ISZE 3PL6B 1XGTB 5K39B 4MA8H 4XHJD 1DJXA 4MMZA 4XWOD 1I7TB 4YSSA 4QRPA 1E2VA 4OSUH 3ZQXA 5J4MA 2G60H 3PL6D 1WWAX 2IH1A 4HWBH 4Y8AA 3AROA 3QUML 4GG6E 3FB6A 4O2EB 5GGSY 4O4YH 4M3KB 5LB1A 5C70A 3BUYB 3C87A 3IMRA 1P4LB 5DDHB 4KROD 3TEUA 4Z7NE 2KZBA 3EO0B 3UYPB 4FTDA 5F89A 4LE8A 5KANG 4LLUA 3L5XH 4EBQH 4XNZC 4WV1C 3RX9A 4MA8L 4P4RA 4Y16A 2ODIA 2XV3A 4L3AA 1EJOH 3M17B 1Q0XL 2RACA 2LU7A 3RDTB 1T1ZB 4HV8B 1AQKL 2IFFH 4LSSH 3HG1A 3IFLL 4N1HB 5GGTH 4DGIH 3TH2T 4AOFA 1HKLH 2E27L 5H8DA 3I6GA 3MJ7A 3SYAA 3QWRA 2DIAA 2QKIA 5ETUA 3VXSB 2J25A 5GRXG 2Z8SA 1NBYA 1KC5H 2CGYA 3DXAE 3VGBA 3THML 5J3HD 1OT2A 5E2TL 4JE4B 2VAAA 4XMWA 1ETZA 5DMJB 4FA8A 2XN9A 3N91A 3TP4A 3VXNB 4YFLF 1QVOA 3NSCA 3IJYA 3ZZQA 4NUGL 5BS0B 5JPNB 1U8MB 1JDDA 2DEXX 5HHXL 2F7IA 1CI3M 4M9PA 3CFBB 2BOBB 3Q9QA 3W0WD 3V0VA 4GUPB 4WFGD 5SWQB 1SEQL 4NUJB 3WHXB 3OG4B 4ALAC 5F3HB 3SOBL 2R0KH 5ICZB 1MFCH 1SN0A 3B2XA 3MRJA 4FQIH 3EG9A 2QQNL 3CN1A 1BWWA 5LBGA 3BAYA 2JQMA 2WP3T 3Q8AA 5I1GL 2HWZH 4YLCA 1QRNE 3NJGA 3II3A 5SWSA 4D7PA 5L9DH 4M7KH 5D1XE 5FO7A 1HQRB 4Y4HD 4XNYH 1FZJB 2BVTA 4KK5D 3O4LB 4RIRB 2EC9T 4OZFH 3C6SA 5EU4A 4YHYC 3O41B 2XZCL 4PGDA 3L3DA 1CLOH 5DJ2B 3MNWB 1WBYA 1HX0A 3TN0A 5JA9A 3QUXD 3SDYL 1T7WA 1JP5A 4IBWA 2OYPA 2FDBP 4OZIE 4PTUA 3JYCA 2YD3A 4WI3A 5EO1A 2HVKA 2NX5A 2CUIA 5CWSB 2H9GA 3DV4B 3SDXF 4HMEA 4HWEH 1DVFA 3V0EA 2F54B 2OS7A 4H8UA 2J5LB 1TSRA 3RDTD 3ARZA 4WSKA 4NRYB 1MOEA 4YDMA 3UZQA 1OSZA 3WXWL 4PIRF 1CGSH 1A8JH 4GMTL 1BG1A 5AAMC 4FMFA 1KWKA 1DQTA 1P9MA 3UCQA 3QQDB 4IQHA 4NNPL 2B59B 4MJ6A 4JW3A 1WUZA 4AKOA 1I8UA 4OFYD 4Q56A 1H19A 3L3GB 4PB0L 4HUUB 2O6CA 2NY2D 2ZWNA 3UFIA 2YSSA 3QNXA 3VNZA 1MRFH 2IVFC 3KXFA 3IFLH 4FLOA 4P59L 4QHMA 2BFVL 2Z31B 1NGZA 1M42A 1D7FA 5D1XA 2D7NA 3QDMB 4H7VA 5A3IC 1PZCA 4W68A 1WGVA 5AUMA 5JOFA 1AXSB 5ITFA 2A6JB 2AEPH 2OL3B 2X9ZA 1J1PH 3GSOB 3KXFB 4HJUA 4AVHA 2RMNA 4F9PC 4TNEA 3L4YA 5K1NA 1FZMB 5T3XD 5EU7E 1KGWA 3ZGIA 2APTA 2WGXA 2BINA 2PLTA 1YPZF 4KJPC 4JZJB 1KMGA 3WEBA 3MLXH 3L9EA 1XIWA 3TBTA 2DJUA 3E6HA 3CMOL 4K4KA 3CN3A 4Q6IA 2F7RA 3ZE2E 4KJYA 4XVOA 5BV7B 5DEGB 3OJ2C 1XF4A 2IXQB 2WPGA 4NQED 2BIIA 3BVWA 4Y9CA 2B4CL 1MCHA 5F7DB 2JJSC 2CLRB 1UD2A 2DWDA 1OSZB 1PDKB 3T4AC 2P5WB 3BVTA 3SDDA 1U3HC 5IQ9A 5F7MC 3RKDD 3D0AA 2RFXB 4I5BA 4UTBL 5IUSA 3KPMA 1L7TH 5FFGA 1AD0A 1SF3A 3NCYS 4MXVE 5DMGC 3TEYA 4E0RA 1PLCA 5F1IB 2GK0A 1DCEA 2D31B 2WQ8A 3F65A 5E6SB 5ACZA 1W72A 4CJ0A 5L6YH 5CD5D 1HWHB 4MKTA 3ECBB 4W9FC 4XCEB 4ZDHB 3IRPX 5IB1A 2JCWA 2NOYA 2X2IA 3U30C 4WKXA 2L7EA 3CXDL 5SWZE 1IC4L 3R1GH 2OJZL 1RKRA 1UA6H 3JUZA 3HS8A 5D4HA 3OKEB 3U0PA 3KYKH 1QPKA 3HVNA 4G7YL 1RP9A 1Z9LA 4H20H 1UURA 2J57A 4HUXA 4IDLA 2I9LA 5E5MB 3S0PA 3DIFA 5GGUA 1KYFA 4NPKA 2B2XH 2PYFA 3LNHA 5CXPA 1U30A 1HSAB 3FPYA 3L3KA 1J0YA 4KKZA 3U46A 4GUOA 4A67A 3MDJA 4UM9B 1NDTA 4OCSL 3LKOA 4EI5B 4U6YA 4B6ZA 4H13C 5IVXA 1IM9A 4LZKA 3IDNA 4N6RB 1ZHBA 1GY2A 1YEGH 5F2FA 3WE6A 1EAJA 1Q38A 3V7AE 5CFAA 3DETD 1R5IB 2RBLA 5ERWA 2DQMA 3RWCB 2PYEE 1YJDH 3H7LA 4P0DA 5CUSL 3BRGC 4EIZC 2UY6A 2N0MA 1Y07A 4K71B 3T0VA 4KRNA 1KJ3H 3I6GB 3OB0H 2XA8L 4KH9A 2EADA 5HVHC 1RAMA 1W9XA 1KFAH 1N67A 3RFZA 2YMXL 5DK2A 5DMKA 3TZVB 4EIBA 3BP6B 3WEMA 5C0FB 1JBJA 3UTTA 3OTTA 4WU5B 1HAUA 4QAMB 3T8VA 1OPGH 4HUMB 5GS3A 2JKSA 3BEVB 4W81A 3WGUB 2YLKA 3O4OB 1W0WB 2P3YA 2IEPA 2XZCH 3I6LE 1ML0A 3NN8A 4BKSC 4EDWH 5KVGH 4BFFA 1ZK9A 2P1YA 5A40E 2G3ZA 3U1SL 1DUYA 2ADJB 1CN4A 3FB6B 4X7CC 3O6LH 4GLRH 4PWHA 4KTYA 5HGHA 2IWEA 3O3AA 4ZI8A 1NIAA 3TIEB 5LQBL 3D85B 4ELME 3CLWA 4Y4FB 3APCA 3L48A 3QK0A 2IAMD 4POUB 4YXHH 3RNKB 4OCLC 4M1CC 4X6DA 5J12B 4WJ5B 3CD4A 3QIWA 3TBVB 3LHPH 2HKFL 4G72B 1LYQA 5F1IA 1Q9OB 5FUCE 5CBEA 1JF5A 2YIHA 4FNUA 3S35X 1U91B 1EAOA 2CO6A 4KFMA 2H3KA 1I7UA 3L9RA 1XCXA 3T3ME 4OCYH 4JG0L 1AY1H 2VB5A 2WKOF 3R0MA 3LPPA 1RK0B 3BZ4B 4LLAA 2VN3A 3WJMB 1RSYA 3LZPA 5KVEH 4HCFA 1CT8B 3LN5A 4MFHA 1FF5A 4MJID 4HK3N 4YDIH 5LDUA 4XMZA 2DWXA 2M2DA 1YEKH 4NGHH 1AQDA 5EIIA 1MNNA 4JREC 4MCYA 1JS4A 3O6LL 4P59H 2CH8A 1BJMA 1DDHB 5CU5A 4W9GC 4PBDA 1XR8B 2HFGH 2EVIA 1QBMH 3RVUD 3L7FA 1NCGA 1HS6A 1BF2A 3FONA 1DVFD 4NN5C 3V4UL 4DGVH 4NKOB 1GW6A 4I3RH 4HLJA 3VFRB 3QNZB 4LDEB 4ADIA 1W0VB 4LDOB 1KLUA 2CCWA 5J6HB 1ACYH 4RMWA 2HJLB 2VLKA 1UT1A 3B8YA 3STZB 1BAFH 2DMHA 3A6BH 3FQ2A 4QHMB 3K2UL 3O2WL 2ICWB 1DJHA 1FAKT 1GYWA 1YUHB 5DLMH 2WZ0A 1FLTX 2K70A 3MOBH 4L4TA 4NZTL 4B3EA 3T0ED 3W2DH 3IGKA 4UQIM 2OMUA 1OOWA 3FUDA 4LOUD 1A3LH 4M93B 4TNVK 4FCHA 4JRFA 3DX7A 1T6BX 2OA9A 3EGXA 4LL9A 3CMGA 3R18A 2G2PA 4Y2DB 3US1A 2QVTA 3P0VH 2HLEB 4M00A 2Z7YA 5E94A 5KSAB 2FBRA 3UERA 1OTUD 4I9WD 4GUQA 2GYSA 1S7WB 3BP5B 4NHUA 3WNMA 1ORQA 4QCIB 4Z3FA 4G9FA 1DL7L 3W5MA 3Q1SH 4OF8A 1RUPL 3H7BA 4JFFE 4PY8I 1NCBL 1NKRA 3H3PH 3X1BA 4Z7WE 5FDWB 5CWSA 5EF3A 3SPJA 4R2GC 5C0AB 1S6NA 4WHTA 1ZAGA 1IBHA 1KTKE 3STLB 3K3QA 1MY7A 3KH4A 2I07A 3DO4A 3NIGB 4NKMA 4YN3A 2JELL 3B9KB 2OMXA 3ZLQC 2ZOLB 3VXMB 2ROYA 1E9PB 4X80L 3IFOB 1RD6A 4MNHB 4Y16D 3TN0B 1MQKL 4X5XB 4ZOAA 5GIRB 1T20B 3CX5J 4PJEA 4AK1A 1JWUB 2J6EA 4LEXH 1OOAA 4AQEB 3BUPA 4G7VL 5IK3B 4OD2A 5TDNA 4FS0A 1FCCA 4PY7B 3CZLA 2A6IA 4CU8A 5G2NA 4LCWD 2C3XA 3B2MA 5BUGA 3BGAA 2X4QB 3E80A 2BFGA 3MLRL 2O6FA 5DD1L 1IAIM 4IMLA 5C08E 4E9QA 3UBFA 1NEZG 3BKML 4HIJA 5DRWA 3D3VD 4YC2C 1QEXA 1AIZA 5EC1A 5K9OB 1W8OA 3TPUB 1RZGB 3P4MA 2J8UA 1MNUH 5IZ7A 5AOIA 2IQAB 1TVBB 4IDJL 5FS5A 3RTQB 4CSSA 5TF1L 3FTGB 3O8XB 2BOBA 1VCAA 1P1ZA 1UJ3C 3LEVL 5T5FH 3ULUF 3LSOA 3PFQA 4F37K 2AJSL 4XNMB 5BQ7A 2YEVB 1DQQA 1KB5A 2XWEA 5D1XC 2EYTB 5AVZB 4XAKD 3WHE1 5D2LA 5HHVL 2ZKHH 3GJEA 3P4NB 1CGUA 4U3SA 2R1XA 2WNKA 1E5UI 5EWIH 5C09A 3VXNA 3T6WA 2DH3A 3ZYOA 4LEXL 3KBFA 3L3HA 3L16A 4J1UB 4XXDA 5GGVY 4D9QD 1QWUA 1CURA 4HCIA 3L45A 3PP3K 1FLRH 4HWUA 4Z7UF 4H25A 4HJ0D 4AIZA 4E9XA 1BM3H 4LT7A 4S2SA 2IF7A 4XBEL 4KY1H 5I6PA 4QXGL 3FQXA 4FQPA 4PRDB 4FNRA 4AITA 2DDQH 4HF5L 3QYNA 3AGVA 1KGJA 5E8PB 4CC0A 1YEFH 1S8DB 2ADGA 3ARGD 1KJ2L 3MRNA 4UTBA 1ZT4B 3N40F 2BVOB 2F74A 5LAPA 4G42B 2WLLA 3K46A 1Z5YD 1A1NA 2CCLA 2P8MA 2YEZA 2WXQA 1PG7L 1RH8A 3N41B 1CBJA 2BNRD 3MSPA 4G9DB 4NRZA 5EDSA 4BUQA 2X1WL 2Z8VC 5I76B 3IFPB 3LN4B 3Q2NA 5HDQL 3BWZA 1KTRL 2IFFL 5HVFB 2K3TA 3HBQA 2V17L 4K5LA 4FI7A 2IJ0C 1I3RB 1FFPA 2ZNWA 2Z7WA 3Q1SL 1AGCA 4F7TA 2BPBA 3Q6FA 1GGBH 4KJWD 1TMQA 2XZQL 2YGOA 3MXWL 2QPEB 3NIDB 5IMKA 5C0CB 4JDTH 1JTTA 4P2AA 2EDOA 3DVIA 1T1XA 2VXTL 5I0DA 4LCWB 2WJ7A 3MRDB 5E2TH 3V8CA 1GOFA 4P3WA 4HISA 2W91A 3MUY1 2ZCLH 4NO5A 4NXSA 3UTPE 3T09A 1T83C 2VR4A 5AD0B 5JXAL 3ZKXC 1I31A 2VW4A 3UAJC 2J3SA 3SBWA 1KN2H 1F3JA 3DTXB 2V9TA 4FQCL 3VFSA 3SDCA 5T3XL 2F53E 4XBGB 5FC9A 3GZOA 5IB5B 2V5RA 4LU5H 5DZLA 3N42F 5H94B 3SYOA 2G2RA 4Z7NF 2Z1PA 5E8PA 5LCVH 1FORH 1SJHA 5AVYB 4H1LA 3B9DA 4ZAKD 4FYSA 4ORGB 3OHXB 4K94H 3SE4C 5HHMD 3ULSB 4AGNA 4AIZB 1KIQA 1RJZA 3S88L 3B6SA 2TAAA 1FAIL 1SBSL 3MLZL 2JK5B 4KAQL 4A37A 1UD5A 1Z0MA 2KHAA 3W39B 3FTZA 4PG2C 3EJYC 4OF7A 5HI3D 3WU1A 3P30H 2X1PA 2XWTB 4DAGL 3WE6B 4OQTL 5D70H 1FWXA 4LCCC 4NUPA 5T1KB 3IB4A 1SY6H 1OD9A 2K9FB 3TT1L 5BQ7B 1OPOA 1SBBA 2GHZA 4N8CL 4HUWA 1BQ5A 2XDHA 1GIGH 4IOSA 4APXB 3VTMA 2CK0H 4KH2A 3CH8A 3M8OH 3LS4L 1J5DA 3UJIL 4PG9A 4A2HA 1EFXA 3LKQA 3RKDC 2DTSA 2VO5A 2X9XA 3EYFB 2NUPA 3L3KB 3GBML 3F12B 1C08A 2BVQB 5D6DA 1F6LL 4JKNA 5DMGD 4JFFA 3KGSA 3P0GB 5LN8A 3DJZA 4RX4A 5HGBA 3HRPA 3QJHA 2MCMA 1W6WA 1OB0A 3G6DL 3KZ8A 2J8OA 1OW0C 3O2VH 3L3OB 3BESR 4H26B 1A2YB 4C59B 5LXVA 1AXTL 2ESVD 3OF6D 5IK3A 2MHAA 3MRPB 5GZND 1JNJA 2HH0H 3CFCL 3ECBA 4E9YA 1NCCH 4NPYA 5A16A 1PCSA 5KSUB 1L9SA 2CKNA 3HE7C 5D55A 1PVHA 3DVNB 1KNOA 4UZGA 2FT8A 3HRZB 3KPSA 4JZNB 5B38B 3POHA 4XPFH 4ZUVA 4Z76A 2YGPA 2HFEA 4C56E 3FUMA 3MV7E 1QLRA 4GEJA 1YSOA 3CSPA 4Q9RL 1D5IL 4CADA 4Q2ZB 4YNYA 3BRDA 2Y7MA 4OI9A 1BIIB 2LV4A 2V0AA 4U1HA 2WLIB 5EMYA 1JPSH 2CXGA 3L3OC 4HWBL 1FA4A 1OF2B 3BRFA 1MCIA 1V7ML 5I75C 2XT1B 3FT9A 1T7YA 5FV2A 1K3IA 2HMIC 2R23A 3X17A 3QCUH 2J1YA 3VWJB 1JI2A 4XBPA 3I6SA 2B0SL 1BFOB 5BZDA 3V55A 1GTNA 3E6HB 3FQUA 4M5SA 1FO0A 3DI3B 1MF2H 2WLNA 4KJPD 4XNAA 3D3VA 1QZ1A 1YEGL 3UJTH 4PIBA 5C6TH 3WS6A 2ZWYA 4KK6D 2NT0A 1IVTA 4ZMPA 5BRZD 5IBLD 4M56A 4IBSA 4LPUA 4OCWH 3QORA 1DBAH 4I9WE 2X9WA 5C08D 3DUUA 1ZGLA 1YPZE 5GS1C 4AV4A 1U3YA 4L3CB 4DK5A 5C97A 3UIZA 3FO0H 4HOXA 1N6QL 2CO1A 1LE5A 1P5VA 4XAWH 1F86A 1KGCD 3VGEA 3MBXL 2YD5A 1JHLH 1EK3A 4B97A 2XI9A 4L3EB 3BVXA 3ZDZF 1JGVL 1RUKL 3FQNA 1IAKA 2B59A 2DWYA 3GI8L 4G70B 4MJ6B 1JV2A 4J3BA 4OAWB 4X42A 5F0MB 4KX7A 3KLLA 2VM4A 1MCQA 4Z7UA 3VWJA 5E4AA 4X7SH 4HLEA 5DQJB 2P47B 1N7MH 2O5ZH 3U36B 5A2BA 5AW9B 3TX4A 2HUHA 4XAKE 5LO7A 2A2QT 5KSBB 2KMWA 3U0WL 1O6VA 5FW8A 3CLEL 4AIOA 1CXHA 3QO1A 3TCLA 5L8KB 1Z6JT 4CADB 5BO0D 3TEZA 2F6AA 3ZHDA 3NG5A 4Y9EA 3FQWA 5EEZA 3EDEA 4QR7A 2VR3A 5GJTL 5JZ7D 3VRJB 4YHML 3D3VE 5C2BL 2VDQH 1KT2A 5J06A 3C5JA 3QQ4A 1F4WL 4JFXB 3W9DB 1G9EA 3FCTA 4GBXD 5JW5B 5IGXH 2GUOB 1B2YA 4GAGH 4OVUA 1SNRA 3T0EE 4D2NA 5IB2A 2MHAB 5GGRB 1QI3A 2BM3A 2FEEI 2NW2A 3OKNB 5IHZB 3NGBC 4HFUH 2X10A 4NN7B 4TTDD 4JFEB 2G5RA 1I9JL 2GT9A 3SGKA 2FIKB 2MNWA 1BVZA 2G9HB 4HPOH 3VFPB 2N3JA 1IC7H 5H2BB 1NCNA 1P7KA 1WG3A 2EDXA 1AZUA 1KCSL 1YYLL 2WXLA 4G43A 1Z3GH 1RIVH 3CN4A 3CQQA 3IFNL 2Y7QB 5IQ7H 2CDEB 4LVEA 4B7IA 4X4XA 3SGEI 3NH7L 2YAPA 4MAYB 3X14A 1JTPA 4NWTH 1UJ3A 1KBKA 2UXTA 4UUJB 1LO5A 1FZKA 5DJAA 2WLKA 2DJ4A 3BI9X 4PJ5D 3WIIH 1QFWH 1WP6A 2DWEB 2FJHB 3F64A 3V0VB 2E4TA 1EEYB 2YXFA 3BIKB 1RIUH 2CSPA 3HAEH 2LU4A 1Q0YH 1MAJA 4EUPB 2FJSA 4P23D 3KPQA 4U1LA 5IMLB 2HA1A 1G87A 1ETZB 4ISVB 2MMXA 2OXGA 4HD5A 2X70B 1MI5D 4W70A 5B1BB 4E9TA 3ZHKA 4MLSA 5D1ZI 4R7DB 1JPTL 3HCVB 4ODWA 5E4OA 3PWVA 5CCJA 1UVQA 2CNYA 3HIZA 2NY6B 5ETUB 3VXSA 5C9JA 2X5PA 5CCKH 2H1PL 1Y18B 2BW5A 2DZEA 2VXQH 3C6LC 2GVYA 3FYEB 4PVNA 4X50A 5EIQA 5DZPA 3HG1B 1EAPB 2A38A 1H8SA 5J8OA 3C5SB 2Z35B 4LHUG 1AYOA 2FZ3A 2UWEA 2NYKA 4F9PA 1UTDA 3V6OC 4WRLA 5HHOA 1EH9A 3ALXA 2O61A 3FJTA 3S34H 1U58A 3GBDA 3MX0A 4KVPA 5F9JA 4ONGH 1GVIA 3LQZB 1TG8A 4FFZA 1I8IA 2FJGA 4P5TB 1I8MA 2AC0A 3IJEA 2XQBL 3BSZA 3INUH 2VLRA 2ZOUA 3MRKB 5AD0A 5E6IA 5FWQA 1JGDA 2CNZA 1KJ2A 1CR9H 2A9MH 3WFDL 3D5OF 4EZKA 1MCFA 1O6SB 4WENB 4BQCA 4F58H 5GS0C 5HI5C 3T4AA 1I3GH 3GD1C 1J1XL 1KB3A 1YJDL 3P2BA 3QFJB 5KVFH 4I0CC 3QQ4B 2E86A 1CFBA 3BQUA 3ZX1A 5C3IA 5K39A 4IRSB 4IDJH 3GEFA 2YZ8A 1I1AB 5E8EA 3BKYL 3VXUB 2VABB 2FEEL 3BMVA 2JI2A 2ED8A 3NFPA 1AD0B 1I9RL 3KLHC 3CSTA 2IO5A 2A0LC 4O9HL 4OLYL 4M6MH 1IGTB 3SPGA 3TXAA 3VRIA 4AH2A 5C8JA 3WLBB 3CZGA 1A1OA 3V4UH 1YY9D 2FO4A 3HI5H 5I5MA 5JIKA 5AEAA 4XNUL 3T8XB 3C2SA 5F7DA 3TJHC 2P8MB 4TVPH 4BRVA 5F97E 1D2PA 1L6PA 5IFHL 4KKBC 2YUWA 3M8OL 3MRHA 4JZOB 5DUBA 1XH3B 3MOAH 3QS3A 4OLWH 3U2JA 2X41A 4JO8A 1TTAA 2IDQA 1VF5C 4YC2B 2X3AA 2AJYL 3K4AA 5DFVD 1AGFA 5ADPL 4ODHH 1F1AA 2WBJC 4FZ8L 3CV5A 4ANUA 4OQTA 3C9NB 1N0XL 5K9QG 4TQEH 4LLWB 3SQBA 3HI1A 1JJUA 5T5FA 4MMYA 4RQQA 3GMLB 5IQLA 4AQ8C 4NWUL 4JCMA 2FLBT 1T89C 2CBMA 4ZQKA 3SJVE 2XXGA 4YUEH 3QORD 1BM3L 2JJWA 5E24E 3LS5L 2UZIH 4FI8A 5A2FA 1XAKA 3MRQA 4UT7L 3U9UA 5GRUH 3VD3A 5I6OA 3P9LB 1T4KA 4IS6B 3B9KC 5LGYA 2VDMH 4Z7OF 1XF2A 5HDLA 3SZKC 2F61A 3MUGA 4CMMB 3G6JF 3GJFK 3FH8A 4PJBB 1CBVH 3DUSA 4LGPB 4WUUA 4TNWK 1ZK5A 4JZJC 4OSUL 2WMPB 3UG5A 3UEZA 1EGJH 3EHBD 1M7XA 3BPNB 2VDPB 4LF3B 3F04A 4WEEA 5ALCH 3EJPA 5DZVA 1TPXB 4Z77B 4JFPB 4OJEH 2E9IA 3VXSD 1YNKH 1Z5HA 5F7FA 2R15A 2YOCA 4Q6KA 1E4KA 3GWJA 2K8QA 2BC4A 9CGTA 1R9FA 4L0ZA 1PIFA 2L04A 1H5BA 4UQ2A 1NFDB 5D1ZB 1U8CB 4FQLH 4LLVB 4RWYL 2V7NA 3B37A 2DLGA 2OP4H 3NAAH 3ROLA 4FABH 3VXOA 2JFCA 3VXME 3ILDA 4KV5E 2YKLH 4NKMB 4BFIA 4DKEL 2QLVB 5AKVA 2WINA 5T1MA 5DVPA 3LJ3A 1RJYA 1E5YA 5BUAA 1NFDA 4C4KO 2RJMA 1CFTA 1PNCA 2AW2A 5TE6L 3ARFD 1SPDA 4HG4J 3OR7A 4JFHE 3WFEH 4X99B 4NZJA 1PZ5A 2C3HA 3HN5A 3QUYD 4B9FA 1Y1DA 4HUCA 1YPZA 3DJ9A 5F6IB 2AEQH 2W95A 2UZXA 1OVZA 1ZS8A 5EFIB 1YQ2A 4R0LB 3S5LB 1NCAL 1JXFA 1QLFB 2FEDC 5AWNH 2FQEA 3O4OC 4KQ0A 4S1QL 1SYVB 3H9SB 1FV1B 3CFTA 2VDLH 4ZQTA 1BMGA 1AR1B 3KW8A 3IGUA 2J56A 1DQML 4FFYL 5DRZB 1M7UA 1OP5K 1I85A 3AW5A 4DO6A 3MYJB 1UOVA 4NQDA 4HEPG 1AYRA 1KGIA 5KW9L 3GC3A 5IBUB 2YZ1A 3PNRB 3AAZA 1KSRA 2NY7H 3EOTL 3ISWA 1ZJAA 2JB5H 2RR3A 3QO0B 1QASA 1IM3D 4XCCH 2WSKA 3QFDA 2ZD0A 2FX8H 4AMKH 5DQDL 4MXWH 4HWNA 3GGWA 3FU3A 1FO0L 3N43F 3GTVA 3IKCA 4NNXA 5A7EA 4JREB 4PRHD 3EW3B 1ZHKA 4N2BA 4AXWA 4MMYB 4NJ9H 5C0EB 4LHJB 3WN5A 1JXDA 4ODTH 3FONB 4UNIA 1EO7A 4NDMA 2FL5A 4ETQA 5DI8B 3JT2A 4Y1TA 4DGVL 3E2HC 2MKWA 1S3KH 5BMFL 4IU2A 4CVZA 2H8PB 4YGVB 4PJXF 1A7QH 3M17A 5AW2B 2EDWA 2EXSA 3RJQB 1FYTA 4A2EA 4MA3B 2FQDA 5HY9A 4BA0A 1LM8V 3FBKA 1BD2B 4Q0XH 3RWFB 2YK1H 1ICTA 4DH2A 5F88A 1A4JA 3O45A 4UT6H 2E3VA 2TRYA 3KPSD 3UYPA 2EDNA 1RK0A 4GW4B 1AIFA 1A6AA 4J2XA 4LRIA 4XWOC 3L17A 4HYTB 4JK0D 3GNMH 4M7LT 3WIFB 1T2QH 4MXVF 4QRSB 1MCEA 5AOJA 3TA3A 4DN3H 5MEPA 4ZPTA 3C8DA 3SDXA 4OY9A 3U4AA 1RP8A 4ONOA 5D4IA 4ES8A 1I1AA 3RIFK 25C8L 2DQFB 3FSVA 3P2TA 1T03H 5F7UA 4FN0A 2EIDA 1H9VA 5C0CA 1Q0YL 5I30H 3IJSA 2ZXDA 1C16B 4P46B 2MTAA 5F1OB 5B39B 2HMID 4BK4A 5F96L 3GSUA 3VE0A 4L1HA 2H41A 1F2XK 3LN4A 2LFGA 1RHHB 2AZAA 3MRKA 1PLAA 5HI3C 5KYWB 2I26N 2E8YA 3ALWA 3N5AA 1R1CA 4NQCA 2JKIS 2D0FA 3DOIA 2N1TE 3AREC 5KS9F 1UH3A 4LL1A 2F5BH 3D1MC 3HNTL 4ZZKA 7FABL 4LARL 2VLJE 5CU9A 3HB3D 1AO7D 1ND0A 1NC4A 3VYOA 1MHCA 4QOKB 2V6HA 1UZ6F 1ZT4A 5DJ8A 1A4CA 2GITB 5L88L 1KTBA 4CNIB 4JEGB 4HJSA 3IDXL 4G6ML 2OBGA 2X28A 2WXOA 4MD0B 4RBPK 3EFOB 1P69B 4OU3A 3GLEA 4MZ3A 1ACYL 2FO1A 3LXAA 2UY6B 4I48A 4MTMA 3TM6A 1GS6X 1UWYA 1WD9A 2XKSA 5CEZD 1H15A 1UENA 2I85A 3TVMD 2BVPA 4WGWB 2Z93B 3AU1A 1PX8A 3PWNA 2X70A 1QPXA 1X9QA 4LCIL 3OM3B 2JKNA 3FN3A 3NK3A 5JQIB 3EXLA 2PYEA 4UF7C 5BXFA 2QSVA 3PIQB 1XBRA 2YJLA 3WJJA 4HFWA 1OAYH 2D3VA 2GEQA 1ZHBB 3GHPA 4BBWA 3G6DH 5KYNA 1B0RA 2X4PA 3I9AA 4U7MA 4FA6A 5GSVA 2V2XA 3RWDA 3ILPA 4FYRA 1FRGL 5KYXA 4YSAA 3VRLF 2VNCA 1P2CA 1SGKA 1WS7A 3FRUA 3JV4A 1CLOL 4N4YB 4NJAL 4I1PA 1KGCE 4GT7A 5C09D 4UM9A 1EEZA 4PJ8D 3A4DA 1F6AA 4KNQA 4MXQC 4E42A 3I50H 1A6VL 1DL7H 1BVOA 2JLLA 3GS4A 5AAWC 1KXVC 3OB8A 1H8OA 1FFOA 1TQWA 2E46A 2DYPA 4PLJD 4AK2A 3OKEA 1KTDA 4Q6IC 3OMZA 4GRLA 5IJDC 4O58H 1A3RH 4PGEB 4FABL 5F7KC 2P5EB 1OGAD 1TTCA 5IB1B 1YEFL 4X5XA 5D96B 4JO5A 4I0PB 3DGGA 3ZKSD 1EFXD 3ZK0A 3FCTB 4EKJA 2UX6A 1JXJA 1MAKA 1V3MA 4P5KA 4X5RA 5EBWA 5LAXB 4R4ND 2F7QA 3KL5A 5KVFE 1GMEA 4YK4C 1PQZB 2XNAB 5IBLC 4LLVA 4PYHA 3S3DB 3BYTA 1A5FL 3NJIA 3KPPB 1T6WA 3LPOA 4JDVA 1EFQA 2B5IC 3WNIA 2J8UF 5GS1B 3QO1B 3IU4H 5D7EA 2DD8L 1FDLL 4EOWH 4PJ5A 5D9SA 5C0DA 1RIVL 1WC7A 2B9BA 2DQIL 1A6UH 1S46A 1SJMA 1SLWA 2C9AA 2OSLA 2VR9A 5AENA 2KQMA 1RHFA 3E6FA 1M1XA 4ZNEE 1PZUB 1UJTA 4KX8A 3FFCE 3KM1A 2WB1A 1AI1H 1XF4B 3B7SA 1WFOA 3UBXG 3ZUCA 4MHHI 1H3TA 1ZVSB 5D7LB 4W9HC 2YGVA 3Q48A 3CK0H 1MW3A 1CD0A 4PJIE 2XTJC 1N8ZB 4GW5B 3LCYA 3M6DA 2NYZA 3VXQA 4C47A 2ZWZA 2Z4QA 1IAMA 1NKGA 1YAIA 1BQLL 3FW6A 4JZJA 4OGQC 4C83B 3II2A 1ZEAH 2VR7A 1HHHB 4OUOA 5CKAA 5B38G 1J0IA 2F19H 3P9LA 2W0FA 3PAUA 3BE1L 2OAAA 1TT6A 3QULA 5FYJU 1LE5B 4ZS6C 5FFOA 5MHSE 4FKEA 1NC4D 1R3LB 3DHUA 4URTB 2D3NA 1H0DB 3G5ZA 5J6HA 2Y6SD 4GMSL 1ZGLB 2HKHH 1LNUA 2CM5A 2N0KA 5CLYA 1HQ4A 4GSXA 3T6ZA 5FKAA 5TGBA 3IDJB 4OZ4B 4PLOB 2W0FB 1F11A 2LAAA 4X80H 1G43A 4F8OA 5HYJD 2GBUA 3HUJA 1QQDA 1VFAB 4HT1L 4M6NH 2AERT 2P42B 1TQSA 3AGWA 3MO1B 4N22A 3UO1H 1DJWA 2XV2A 2ATKB 1UG9A 2AV1A 4Y1AB 5DJ6A 2EO1A 1E8XA 2W9EL 1I1CA 1OAUH 2IG2H 1EMTH 3LDBB 4UDTB 5GGQL 2V33A 1D9KC 3RB5A 2ZX5A 1IAIL 2GY5A 5E2VL 3RWIA 3H0TA 3Q43A 5IJVA 5B8CB 5JDSA 1FC2D 3FZUC 5LG6A 3U1QA 1T2QL 4FTVE 4HAKA 3LEXA 4FNLL 4U1HB 1RLWA 1JK9B 3KXFE 4UQ3B 2H9GB 1I1YB 5JMRA 3HMXH 3ZMEA 2QHLA 1DUZB 3NSXA 2MWCA 5JHDE 4JUTA 1IFHL 2CBPA 2BWIA 1XSIA 4OZIB 1RU9L 1YO4A 3KLAA 3U1PA 1A4BA 2W60A 3HHSA 4GI8A 2YS4A 3V0GA 4BK8A 4LAJH 5FA4B 3VA6A 3OKYA 3SDYH 2VLKD 4E9VA 3IJHA 3PWPD 3TTYA 5D2NB 5D4QA 4XPBH 1SJEA 1O75A 5C07A 3NACH 3CX2A 2PTTB 4JVUA 5DR5L 4TRPH 3F84A 4G1EB 3V0WH 2AK4B 3BEVA 4HS8H 2E9JA 1QP1A 4JRXB 3Q6GH 3UTTB 2PF6A 4L1SA 3IMSA 2M26A 3OAYK 5IESH 3FDWA 3IDGA 4Z7OB 3RVXD 5I1IH 3BZFB 4IOIB 4MQ7A 4NZ8A 3OMIB 5FLUA 4MDIB 3WS3A 2HLFC 4JHZA 3RI5K 5J6SA 1T0PB 3FSWA 1UWXK 1O7VA 4KRLB 3VX1A 5JW4Q 2HB0A 4XN4A 1TYJA 5EUOE 1EUUA 1YN7B 1F8TH 5FAAA 2LU3A 4APXA 3GBEA 4XPGL 2X4PB 1ZVHA 3BT0A 5CZXC 4HGMA 1DLHB 2UZIL 1BOYA 1AKJD 4M4RB 4HUVB 3AZUA 1QKZH 2AJ3B 5F3FA 3PIQA 4FTVA 5FUOH 3NK4A 5TK4A 5IJKA 4M8RA 5IMLA 2V2TB 2H3NB 4QXWA 3WN5C 3ZT7A 1JWMB 3KR3H 4FEIA 2BSDA 4H0LC 4PQXA 3KE0A 1E3FA 5GS0D 2DQ6A 3QUZC 1FNSL 4WHDA 4P2RD 1OSPL 4QRAA 4YL4A 3DI2B 1HNGA 2QT6A 3BIAX 5IBTH 3ZDYE 3DX6B 4WSJA 3LKOB 3SYQA 2V5TA 3A6CL 5FEBA 2ENQA 2CDGA 1MREH 1JUFB 2OJ1A 2HN7A 2V3EA 3KS0J 3PP3H 2GY7B 4ZFOA 1RUQH 3VD2A 3CBKB 2L3BA 1GS8A 1BBJA 4JFDB 1TEFA 1IGIH 2PPCA 2CE6A 1IQDA 3OR6B 2AAVA 1VADA 3DETC 1RHHA 4HHGA 2ADYA 4W6YB 4UYPA 2K3HA 3C60D 1N0LB 4MAUH 5E99L 5E03A 3FCSA 4PRAB 5CJ8A 4X7TB 5AZ2H 4LHQB 5FFLA 4DVBA 4FQ1H 3KLAB 4U1SB 2DN7A 4N8VB 3TBBA 5J1AB 2NZ1A 1BXUA 4ZUWA 3U6XS 4QRTA 4U4BA 4ANVA 3RWHA 2ZOTA 1WS8A 2AK4D 3V9CA 1I1YA 1MCCA 1WFUA 3KDMA 5IKCA 1C1EH 2DPKA 3EOAA 3C8HA 3AMLA 5IVXF 1PD0A 4JHBA 4MD4A 1CUOA 1OE1A 4M48H 2EKSB 4NSKA 3ZE0B 4MDJB 1P4BL 3MLSH 3VQ2C 2D73A 3T0AA 1NLBH 2CR6A 3RWIB 4RH4A 2KBGA 2WLLB 4C55A 2QV2A 2IMNA 5KANI 1OGTA 4ILDA 4J4PD 4NM4H 5GGVH 5KBMA 4J6RH 4TLSA 4DW2H 2YD6A 2KDYA 2APFA 4UQ9A 1S78D 1SRDA 4XCCL 2B2XL 2AQ2A 1M05B 2IAND 2JB6B 4NKDB 3UACA 5LGKA 4KQ3L 1NCWH 3M46A 1CD1B 2XVBA 4JRWA 4JN2A 3B7YA 4AXWB 4K5OA 4PD4J 5I8OL 2ROXA 3BPCB 2VQ1A 2CO2A 1H0DA 2Y3AA 1NMAH 2HJFA 4N2CA 3KWWB 4UOZA 1IMHC 3HE6B 1WHOA 3MTXA 4EI6A 1OL0A 1MH5B 1HYSD 3TBSB 4OCXL 3VD4A 1NDMB 3CHRA 1BP3B 3HI5L 5C9KA 4I18A 5TDOB 5CP7B 3DX8B 4PJ9C 2JTDA 3ZQWA 3FT1A 5I1CH 1FVDB 3DHPA 5KBLA 1ZA3A 2G4GA 3FMGH 3UTZB 1CLVA 2JJVA 4U1MA 2FWOA 1PD1A 3GRBA 4NAMA 2R8SL 4KFZC 3T6XA 3CZEA 3GBLA 4R2GD 1URLA 2VMJA 1SUHA 1BCIA 4P9ML 1DVXA 1CU4H 4ZS7L 2IWKA 4M6OL 4NQEA 4JKWA 3LRMA 4PJAA 3Q1EA 1MCRA 1OGPA 1TMCB 1PZ5B 1UXWB 5EBLA 5KSAC 1EJFA 1MFMA 5CMAA 2IDFA 4OLUL 2V2WA 3ZKMC 2J71A 1QLRB 3Q8EA 3UADA 4PJHB 2ITFA 5EN2A 2H0EA 3S97C 3Q7JA 1XX9C 3QHFH 4IYKA 1FYTD 3WKML 3MJ8B 3J07A 4JQIH 3SDCD 3LKPB 4Z7QE 5JHDD 1UWEH 1HEJC 3O2DL 5B3SB 4OFYA 5F7WC 3VI4E 5IV2A 1UB5A 3CFKA 1M7IB 5E6ID 5LGJB 3CZNA 3G5YA 5CLTA 4WEMB 5MI0B 2WANA 1VFUA 2AEIT 4QUOA 2UUDH 4V1DE 1UXWA 5KEZA 4ZTPL 3T77A 2YD0A 3QJHB 5AAMA 1SEBB 3T5WA 4Z77A 5ICXA 2AS5M 3ZT5A 2H0FA 4WWKA 1PD6A 3CQPA 2QGDA 3NIFE 3JT0A 2GEEA 3V2AR 4BKLB 3MLUH 2VM3A 4BDVA 5ICZA 4TNFA 3DX7B 2AEPL 3EGXB 3ZZ1A 1EEZB 4HJEA 1EFXB 1TTGA 1ZXKA 1KLGA 3HBPA 1P5UC 2IDCA 3U4EB 4AEEA 3ILPB 4CGUB 4AEHH 2D0HA 3F7LA 3GIZL 3IXTB 5BZWA 3RKPA 4ZTPH 1N8OE 4QY8B 4FFVD 3DO7B 4LP5A 1G84A 2F5AL 3IJYB 2K78A 1MJUH 3JVGA 2MKLC 2VLKB 1ETJA 4J4PA 3NSJA 5KZCB 3QG7H 1S7RA 5J89A 4X5LA 3CVDA 3G6JA 5MP6H 4TL4A 5L2KE 3FO1B 2WQWA 1VPOL 1QSFD 1G9NL 3SY6A 4Z7VE 4DEPB 5KAQG 1XL4A 2F68X 3OLDA 4KNUA 2RAMA 2FYYB 3MJ7B 2QJDA 3MRIA 5DS8B 1F2QA 4YO0A 2VUKA 4NENA 2VN6A 1M7DA 1M71B 1ETA1 1T1ZA 4DVRH 5EBMA 3FFDA 4NNYB 2PYED 3FUKA 1OGTB 1VFBA 2R7EB 2H4EA 1BVLB 3U0TA 3B9KD 3EH1A 4KOBA 3S5YA 1MWAL 1HI6B 3V9FA 3SBQA 3DTXA 1N68A 2EKSA 4N8PA 3QPKA 4KV5F 2ERJC 4CVWA 1YEHH 1T5WA 2WQVA 3CC5B 3BUYA 2VTFA 2BOLA 4LHUB 3U9PH 4IOFC 5CEYA 4P4KC 3WFCH 1UXSA 2VLRD 5I28A 1GZHC 2O4EA 1NMBL 4GUCA 4ZMQA 4XC3L 3WIAA 1YMHA 2CJSA 5L0QB 1KELL 4X6DB 2FQFA 3B56A 5EO0B 5IR1A 3GHEH 3LH9A 3NJFA 4YDJA 4LVNC 4G59C 1FFPB 5C0BD 1DSFH 4TULH 3ZKMD 1UXSB 2XVLA 1E4JA 3T71A 4G7SB 4AJWA 3O3BB 2WKGA 2XWRA 4IKKA 2BIOA 3L7EA 4PW3A 1CFQA 3ARVA 3QIWC 1UCTA 4GRWH 4PBVC 3FT3B 5JUEH 1TUPA 3NEEA 1DEEA 1TQTA 2BNRB 4F1ZA 3T0XA 2QFPA 4FFWD 1VFBB 3PF2A 1S9KC 1FN4A 1RUMH 1FL3A 2X87A 4S1RL 4CVZB 3RTLA 5AB2A 1J05A 1G1KA 2RALA 2QBWA 3FKUS 4LXFA 1MIML 4NDMB 1TZHB 3WFEL 3QG6A 2ICEA 1E4XI 2ZCKL 1LGVA 1UVQB 1KENH 1ZANH 5I1JH 3SKOA 3RWCA 2QQQA 1DZ0A 3BLPX 1DQJA 1S7RB 1ONQB 2AJSH 2XWDA 4U05A 2DQDH 3NPZB 4X9IA 4UQBA 3VG0L 3WY2A 4F58L 4L29A 3F05A 2C1PB 3VGAC 2CGRL 2EYTA 1X6NA 3G9VA 5BZWB 4NI3A 5T3ZH 3C6EA 4OV5A 3I9PA 4J3OD 2HT3D 4JHAH 1N2RB 4RAUB 4PJ7E 5ITBL 1PU0A 4PV1C 4BQBA 5FPIA 4XX5A 1OHQA 4PJCF 4MAYA 3VI3F 3X14B 5IHBA 4KNTA 3RTQD 4M5YH 3QPQC 5M7QA 3FQTB 4DTGH 2B1OA 4ERSH 4GP4B 4CMHB 4UINL 1BFSA 1TIUA 5L8JB 3BGMB 2C4XA 2AMGA 1IBYA 1ZJBA 2G9HA 3SKUD 3VFPA 4X8CA 4C4BA 3HG4A 4PJ8B 4JQXC 4BQ9A 1QNZH 4UV7L 4MSWA 4EZJA 5LGJA 4NGHL 2WM0A 3RP1A 3EDDA 3NT0A 3MV8B 2EEDA 2XUWA 2JJTC 4UDUA 4OZGE 1PYWB 2W60B 4UM8B 1N64H 4JFXA 2YEQA 2Y2YA 1OAZL 2NNXA 3W5NA 2ITDA 2GJRA 4LK4A 4BZ1A 1QAWA 4OV6F 3D06A 5EN2B 2C3WA 3RAJL 1IGJB 1RIUL 3O6FB 1IAOA 3MREA 1MHPL 3ZDXE 1NTDA 1SF5A 5I19H 1TQVA 4N68A 4GQQA 1K2DA 2WN2A 1WFTA 2UV3A 3T3PE 4U1NB 4ZUUB 5A43C 3GKWL 4HKJA 2ICES 2W0KA 2ZUVA 4JR9H 4Y4HC 4AYID 1ES0B 1IKFL 3H0TB 2BCKB 4WW2F 3GSXB 4IHOA 1KBBA 4HS3A 3SE4A 5FYJH 1IE4A 1QBLH 2RB8A 4LLMA 2FWOB 5C0RH 5CGYD 4C8XA 1X7SA 1WBXB 3A4FA 1PEZA 1EMTL 3QUMH 5GGQH 2NW3A 4DGWC 5LLIC 4JN1H 2Z1KA 1FZMA 1JRHL 2NY1B 1AS7A 1ZLSH 5B7FA 3T0EB 3MBWB 3REWA 3B7UX 1U3JA 1MLBA 1PKQB 4BCXA 1FE8H 1NUGA 3ULVF 3KM2A 1JNLH 1S7UB 4ONGL 1ZA6A 2ADIA 1YRKA 3VJ6A 2P45B 1OCRB 2VYRE 5FXCH 2GCYA 5D1XB 4JFQA 3CDCA 4LLWA 4I8DA 1V7MH 3QWNA 4F37F 1J11A 4TMPA 2NZ9D 3WIHL 3DRTB 3VG0H 3VQ1C 3D18B 3QZOA 4KI5E 4BM7A 4RMQA 5IFAH 4PWKA 4YWGL 2ZG1A 2G5BB 1B0GB 3VWKB 1LO0L 4PJDB 2D4DA 2AJVH 2F8IA 5EZPA 4E5XG 2NY2C 4TL5A 2VDQL 4J6IA 1XB3A 4WVRA 4ZTOH 2AABH 1MI5A 4ODBD 2RQEA 5DUPH 1CI5A 5FUZH 5CLWA 1T21B 4MJIB 5EOTA 5A3ID 4G7VH 3KL0A 2DH2A 2WCSA 4GQRA 4Z7VB 5IMOA 5C71A 1E6JL 4RMVA 3ZQ9A 3KWVA 2RD0A 1V05A 3KLDA 2ZUTA 3QIUA 1T1WA 2Q86A 1HXMB 1EZSA 1T3FA 3PABA 4N0CD 4UV4H 5I15H 6FABL 4JZNA 3VXRB 4X4YA 3PPSA 1UQSB 1WT5A 2P9RA 2VXVH 4GAYA 3NJKA 5LBSL 3ZVVA 3IFNH 5HYQA 3BUBA 3OAYH 1XH1A 5CJOH 4GINA 3SPVA 3OWEA 4QDGA 1IFRA 4X9HA 3FFCA 1A6TB 2FWSA 1N70A 4P2RE 4PP2B 2YQ2A 4UCFA 2UVFA 2EC9U 1OARL 1KEGL 4X5WB 4LL4A 4LIQL 1UA7A 1VGEH 5GHWL 2Y06L 3V52L 2NY3B 4XVSH 5JYMA 3T65B 5T33L 3AADB 4M3HA 4UNTA 5IFJB 1VJSA 3MACL 2CDGB 5DC2A 4NKIL 4PRBA 3TZVA 2OKMA 3MOBL 4W6WB 5DD0H 2BHUA 3VSVA 4DETA 4GQZA 1BYNA 5D5MA 1JNHA 4HIXL 5JPMB 5H35A 7PAZA 1DQVA 4WO4D 4ZJ9A 2P24B 1SFHA 1XCQB 1GKOA 3F6LA 3SN6N 1MF2L 1T4WA 1A6UL 1XXFC 3IGAB 3VXMD 5JLZB 2EXYD 4OIBA 3FL7A 4L29B 5IGXL 4BSJA 2R39A 3QCUL 1X5AA 5KYYA 1ZLSL 3WNJA 3IRCA 5DT1H 3SQOH 3IMVA 3IJ9A 4KTEL 1N5YL 3O3DB 3D69B 4QTFA 4YIQA 3Q3GA 4PVLA 5I0VA 3EBIA 1EX0A 3IDMB 4OFQA 3KYOB 1VFMA 4BSWB 4DO4A 2XZAH 5J7CC 4ORGA 1JNHB 1WK0A 2QQNH 3OKKA 4I1NB 4O51A 1EIBA 3BSGA 3UTTE 1RZKC 3DVGB 4LQFL 5CZKA 5F96H 4CNIA 4PMEA 3DDFA 4KX9A 3AWFA 2WVTA 3SZ6A 2DQTL 5FGBA 1MFEH 2X6MA 3PQYB 5DUJA 5C0CD 2JIXA 3NCJH 1SDDA 4JLRB 4P4RB 2I25N 4G7RB 5E5MA 3T6VA 5DGRA 2VDOB 4EI5C 5BO1L 3PDDA 3WTXA 3OLEA 3DVFA 4YDNA 1KTLB 4PSPA 5D7LE 2XKUA 4LQ1A 1A6TA 2XY2A 5GGRA 1N64L 2VLLA 2W07A 2RQ8A 1GJUA 2XTSA 1FORL 1U8NB 2VDKL 3BAIA 1CDCA 1QEWA 4X6CA 1Q94B 1SYSA 1KBGH 2C4FT 2CJUH 3CHOA 3DPBB 3NVQA 5B39A 2B1AH 3D2TA 5JW5A 1ZRUA 2QLYA 4DZ8A 4LSRL 3VACA 1G7JB 5E1GA 2PP7A 2PWDA 4JG9A 4LU5L 4RZKA 1A9BB 5D6CB 3TNMA 3GRGA 5GRJH 1KBPA 1EHNA 5KUKA 4JO3H 2DMBA 2J12B 4JPIA 3QZWG 2F7OA 4JX0A 1ZVNA 5MEPB 4QRRB 4YK4B 4D3CH 4UQ3A 3KPMB 5E1QA 1CG9A 3CN2A 1FFTB 1UACH 2OPCA 1GYCA 3RGVA 2DV6A 3EJYD 1FIGL 2OV0A 3K6DA 4P2RB 4P5SA 2EIEA 2JLPA 4WI8A 5CLZA 4LCUB 3IAQA 5IT2L 1S2EA 1U9KA 2BNUB 4MA3A 3GMNB 3ZKND 2AV1B 2R9HC 4QGYA 2IPUK 2OTWA 4F20A 1JGEA 3LB6C 2ARJA 2BRRL 5J0BA 1SHXA 5T1LA 1PTZA 3VGAB 1CL7H 1QSFA 3ESVF 3NUKA 4FQHB 2E76C 4NT6B 32C2A 3S4SG 3FT4B 2ZXBA 2FYYA 1SXAA 3BDYH 5CIPB 1LEGB 2ID5A 2JCCF 3HFML 3MV7B 1MFDH 3IDJA 3GB7A 1CXLA 1NEZB 4PR5A 3FSZA 3KLKA 4O5LL 4I89A 3S2CA 4W9KC 5BJTB 2CA4A 3D85D 1OKEA 5A2LH 5A1AA 3HHRB 1QA9A 3CDGB 1LQBC 1TJIH 2P8LA 5CHNB 3BAEL 5FYKH 3RUGF 1YEDA 3B1UA 5L9DL 1BZQK 1JL8A 3D9AL 2ESVA 4H8WH 2ZTBA 4GKLA 5IJKC 4KROB 3U4BL 1BQHG 2GHWB 3QARA 1HHKB 1KXQA 43C9B 3ARDA 5TQ2H 3IBEA 4ENZA 1MWOA 1GMIA 5DVKA 5EC1B 4QLWA 1D5XB 3ZTDC 1JZ3A 4OLVL 3IN0A 3W57A 4BKLA 1WCQA 3JTTB 3RVWC 4HZLB 1YVLA 4KNSA 2Y69B 3MRGB 5JHLL 3GRWH 1UA6L 2EUZA 1XF5B 2ZUQC 1YPZB 1RUQL 5ICUA 4NOBA 5I73B 1WC7B 5IUCA 2P8PB 3D9AH 1B4LA 3QWOA 4IRZL 2A9DA 3FAWA 3HG1D 2BNRE 4JDVB 4LEOA 3VSQA 1PZAA 1LDPH 2X6UA 4DZBA 3HE7A 1BF8A 1PQZA 2XNAA 3VFMB 3ZHNA 2XG5B 5IROA 4PJEE 1WO2A 2BP8B 1QR4A 4F91B 4EKXA 5AVTB 1KB5H 4L37A 2VQTA 3MNWA 2V7NB 3CIQA 5B1JA 3GMPA 1WQVT 2FGWH 2FEDD 4PGDB 2HXAA 3EF7A 3QI9B 2EYRA 5DJCB 3ULVE 4EE2A 5IEKA 3L3OA 2JI1A 5F7AA 4ZXBC 2FTAA 4NLHA 4NC1C 5I71C 5JR1L 1A0QL 4UOW1 1A65A 1XGYL 2PWGA 5FGSA 3ABKB 3UP1A 3UTSB 4U0RC 2CHDA 2B1HL 5AW8B 2XPGA 5AZ2L 4XCYB 5I1HH 3L4WA 1UASA 5BNXD 1E42A 4I4WA 4FXKB 1LP9E 1MIMH 2L7JA 4M6OH 4U33A 3EG9B 2VISA 3BP4A 2X40A 3K6IA 1B2WL 5HGAA 3NJJA 2W80C 3UL4A 1PEWA 3HEIB 3NJMA 2LTQB 3FSOA 4CMMA 2QV4A 4OF3A 2E7DA 2WNWA 5ABZA 3QCVH 2ESVB 3D4CA 1T4KB 4IS6A 1PLBA 3QC5X 3CCHA 4FZ8H 2W81C 1BLNB 4F7PA 1G9MH 3TBSA 1JPTH 4JY6B 3PJSA 4JDEA 1D7DA 5JTWA 1UB6B 3UAEA 4CC1A 1A6PA 2Z8RA 2YFNA 3GYRA 3GM8A 2SEBA 3SKOB 4UOJA 1PL3A 4N0YH 4Z7WB 1LEGA 2WJ5A 3W3BA 5EN3A 3TCXA 3C9NA 4ZYKA 3U48A 2E9BA 4FULA 3S2AA 3APDA 2FAUA 1J9TA 5E9NA 4XN2A 3OKMB 1FL3B 5K59E 2YPVA 1MHCB 4QOKA 4X83A 4YHLH 1ULVA 2HKFH 5I1DA 1QHPA 5MI0C 4FQXA 3D6GA 3NCXA 1P5UB 3T4YB 1A1MB 2FATL 2H32H 3L1GA 4EN3A 4HKXA 4PHXA 5HVGB 1Z9OA 1OP9A 3MRBB 3HW7A 1GHFH 3WD5H 2YC1A 3UYOD 3N2JA 1FL5B 4N0YL 2WUBH 3U6RA 1JWSA 1UFUA 2GJ6A 5IESL 1ODAA 1UZ8B 2F1AA 3DSFL 3V79C 1O5PA 3J7HA 4U1GB 5AAWA 5I16A 4RGND 4U31A 4CA4A 1ASOA 3MRDA 2B3RA 2N01B 1UFGA 3GI9L 2VZSA 4KMQA 1YEKL 4MMZB 2JKTM 2XV0A 3I3EA 3T0EC 4N8VA 1TTUA 4H0GA 2Y5TB 5C92A 3JWOC 5E1AA 5B21A 1JRHH 3LMJH 5HGAB 2J2ZA 3BVVA 3GLAA 5FB8A 2NY3D 3HPLA 5IOPB 4M7KL 2R2EB 1X5KA 2BX5A 4MJ5B 3QEHB 4XMKH 5J9PA 1J18A 3SPCA 3EO9H 3NESA 4BZ2A 1BM7A 1GSKA 3AB0C 3L3IB 5D7SL 4NQXA 1NCDL 2AJZA 4JGJA 5GS0H 3D05A 3DRQB 5C0AE 2IPKB 4HWZA 1L9NA 1U58B 4ZD3H 1G5GA 3VSTA 3F7QA 2OTUB 2Q6WA 1XGYH 5HHPA 4HQQH 2F74B 5FYLE 2HN7B 1OAQH 2F58L 1H3GA 5FCUL 2IOOA 1J8SA 4MB1A 2GJPA 4ZXBD