3OD3A

Cueo at 1.1 a resolution including residues in previously disordered region
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
488
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 143
structure length 488
sequence length 488
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A03
3UACA 3OMIB 4KOCA 1ADWA 2BP0B 3WIAA 5I26A 2LLNA 5D4IA 2I7SA 4YSEA 5PCYA 1PLAA 1AOZA 3FYEB 1WS8A 2GBAA 2AFNA 2YXWA 4GYBA 5I6OA 2HXAA 2EIJB 1QNIA 2BW5A 2VM4A 3UGEA 2J55A 3V9EA 2AZAA 4YSOA 3QJSB 3BQVA 1KCBA 1SFDA 1GS6X 2GI0A 1OF0A 4G72B 3NSFA 3PLYA 2I7OA 4RH4A 2BP8B 2ZXWB 1PF3A 4YSCA 1E5ZA 5LDUA 1AR1B 1ASPA 2R7EB 1AZCA 2EILB 3CDZA 3NJMA 1PNCA 7PAZA 1JVOA 3QPKA 4N8UA 1AS6A 3SBRA 2HZHA 3T6XA 1MZYA 4GP4B 4HCGA 4AX3A 2YAEA 4A2GA 1YLBB 2XWZA 2EIMB 1A3ZA 4QLWA 2FQFA 7PCYA 3DTUB 1KGYE 1AZUA 3X2QB 4NAJA 4G71B 1IKOP 3EH4B 1AACA 2B08A 1W8EA 1HFUA 2YAPA 4TXVB 1BQRA 5EHFA 6PCYA 2FQGA 2GB2A 2RACA 3X1FA 3KW8A 4KNSA 2ZONA 1PLBA 4JHUA 4YSAA 3CVCA 4HCFA 1PLCA 3EH3B 2Q5BA 2CALA 4NERA 3T9WA 5B1BB 1I53A 2BZ7A 1W6WA 2IDSA 1JZFA 2H3XC 2BWDA 4A2DA 4X4KA 2TSBA 4ZK8A 4A66A 1ILUA 1A65A 1FFTB 1WA1X 4DP6X 1B3IA 3AG1B 3HB3B 4GP8B 1ILSA 5I5MA 2FJSA 5D4JA 1DYZA 1X9RA 1GY2A 3QJQB 1GS8A 2VMJA 1SDDB 4JKNA 1PZCA 2DWTA 2DYSB 1AG0A 3ABMB 1MG2C 4F7KA 1A8ZA 2IDQA 4G7SB 2DYRB 1XB3A 1M9WA 3FSZA 1NDTA 3G5WA 4M4RB 2BHFA 1JZJA 3FU8A 4PAZA 1FWXA 1NICA 1NPJA 2GHZA 4DP1X 3NJKA 2E86A 4NB7A 1NWPA 2XV2A 1BEXA 2FWLB 1SJMA 4PCYA 1ZIBA 3FU7B 2XUWA 2BW4A 3PAUA 1JXFA 3T71A 4DP2X 4W1TA 4YSSA 1ASOA 3ASOB 4P5SA 4E9YA 5AKRA 2FT7A 3FSVA 4YSUA 2YAOA 3MBWB 4BXSV 2XV3A 3TASA 4N4YB 1L9RA 1NZRA 4UF7C 3S8FB 1AS7A 1A4AA 4WTQA 2GC7C 1KYAA 1RZPA 4DP5X 3OD3A 4K9JA 2PCYA 3QQXA 5I5JA 3S8GB 4CSPA 4YVUA 1E30A 4HHWA 2PP9A 1E67A 3ASNB 3S3BB 2QT6A 4AKOA 4AI7A 3AG4B 3CDZB 1NIEA 1GYCA 4A67A 1BXUA 3EH5B 2UX7A 3KW7A 1N68A 2CBPA 2TSAA 3FSAA 4A2FA 3NJNA 3NSDA 8PAZA 1AG6A 3ZDWA 4AKQA 2OCCB 1ZV2A 3X1BA 2PPEA 1J9RA 2BWIA 3NJJA 5FC9A 5TK2A 1RKRA 1PNDA 1MDAA 1WA0X 2UXVA 3NJHA 4AKPA 4EF3A 1CYXA 4GP5B 3X1GA 1J5CA 4BDVB 3JTBA 4KO5A 1L9PA 1L9TA 2IDTA 4DP9X 3ZX1A 1BQ5A 4UANA 1JZIA 2EIKB 2W8CA 2QDVA 1L9SA 1JERA 3ABGA 5AFAA 1T5KA 1MG3C 2W88A 4YSTA 1NWOA 2GSMB 2VW4A 3N2JA 5I6MA 4E9VA 3WNJA 1EHKB 1E5YA 3H4HA 1ZDSA 1BYOA 4E9QA 2AZUA 4GY4A 2WSDA 1GY1A 3H4FA 3UAEA 1AANA 4E9XA 3QJVB 1JZGA 2PLTA 3PAVA 1V10A 1OE2A 1QHQA 2IDFA 3X1EA 1XB8A 2IWEA 3WI9A 1F56A 2GC4C 2VW6A 3H56A 4KO6A 5B1KA 1M57B 1JVLA 1OOWA 3NJIA 2P80A 1ETJA 4ENZA 3NP3A 3PAZA 3QJUB 5E9NA 1NTDA 3FQ1A 1CC3A 2XX1A 3AG2B 3IN0A 1CUOA 5F7BA 1GS7A 2YAHA 1PAZA 3SBQA 3AZUA 1SHXA 3NJGA 1VLXA 3PXLA 1UATA 1AZBA 4BWTA 4YVNA 2IH8A 4KO9A 2IWKA 4YSPA 1ZPUA 1E65A 1XB6A 2XV0A 3V9CA 4FAAB 2EINB 2UXFA 2QPEB 4E9RA 3AY2A 3CZUB 1KDIA 3OM3B 2J5WA 4KO7A 4DP7X 1CYWA 4P5RA 2IWFA 2JXMA 2PP8A 3CVDA 3GYRA 5ANHA 2OJ1A 2BZCA 2QPDB 5A7EA 2XXFA 1HAWA 4YSRA 2MRYA 1A4CA 3EHBB 4DP0X 1SNRA 3CVBA 1J9SA 4YSDA 2ZOOA 2IAAC 1OE3A 2N0MA 1TKWA 1ET8A 1ID2A 3NP4A 4A2HA 4QKTA 3NJLA 1GSKA 5B1JA 4DPAX 1NIDA 4KNUA 2XYBA 5B3SB 3PPSA 3DIVA 4M3HA 1QLEB 1AZNA 1URIA 1PZBA 2DY2A 2H5UA 2AANA 3FU9A 1IC0A 3RYMA 2ZWNA 4HHGA 3EF4A 4G7QB 3TU6A 4MFHA 1X9UA 1AQ8A 3NYKA 2XLLA 1J9QA 1ET5A 4HIPA 4HAKA 4W9ZA 1NINA 4AZUA 1J5DA 2UXTA 1WS7A 3ABKB 2JFCA 2FNWA 3BVDB 4A68A 4GXFA 4HCIA 2WO3B 1SFHA 4HZ1A 2PPDA 1JXGA 1TEGA 3ZBMA 4DPBX 3FSWA 1L9OA 1KDJA 2H47C 2B3IA 4E9WA 3AW5A 3T6WA 2UX6A 1ET7A 2AVFA 2NRDA 2XVBA 3PCYA 2PP7A 1GR7A 4JHVA 2X87A 3OQRA 3C75A 2HLEB 4A2EA 1RCYA 1FA4A 1OE1A 2IH9A 2A3TA 1AS8A 1JZHA 1AAJA 1PY0A 1AIZA 4G70B 1TEFA 1R1CA 3FT0A 3IE9A 2VW7A 2PPCA 1OCOB 3GXUB 1V54B 3FPXA 2FTAA 2GIMA 3IN2A 3UABA 3WNIA 3MX0B 5B7EA 3ABLB 3HEIB 2BO0A 1OV8A 2HRGA 3AG3B 2PPAA 2WO2B 3T6VA 2BP0A 2I85A 1NIBA 4F2EA 1KCWA 2VSKB 4KNTA 1ZDQA 4BWUA 1NPNA 1MZZA 2CUAA 3IBOA 2J57A 2P80D 3NSYA 2CJ3A 4DP4X 3WKPA 3N55A 1ASQA 2YAMA 2PCFA 5I6LA 2FT6A 2Q9OA 2HX9A 1DZ0A 1L9QA 2XX0A 2QDWA 3WKQA 4BK5C 4UAHA 5B7MA 4DP8X 2YAFA 2XU9A 1W6LA 1J9TA 2DV6A 2YAQA 3OMNB 5B7FA 4FA7B 3FQYA 1A4BA 1BXVA 1IBYA 2Y1AA 3UADA 1TU2A 2VSMB 4G7RB 2YXVA 3FS9A 2BP8A 2XXGA 5I6PA 1PZAA 5B1AB 4BDVA 1JOIA 9PCYA 1AZRA 2R7EA 3S3CB 3FYIB 5B1JC 5PAZA 3S3DB 1OCCB 1NIFA 5D4HA 3SQRA 1KBVA 4Q89A 2FT8A 3T6ZA 2MTAA 3TA4D 2FQEA 1OCZB 1WAEA 2CCWA 1NIAA 1SHWA 2FQDA 1SF5A 3U25A 2CAKA 2PPFA 1PMYA 5I28A 2VN3A 3CG8A 3IEAA 5TK4A 1RZQA 1KBWA 2HX8A 2OV0A 4BXVA 2UXGA 3JT2A 1V55B 1OCRB 2YARA 2IDUA 3QJTB 2HX7A 2X88A 4F2FA 2JKWA 4CSZA 4Q8BA 1BYPA 5IY5B 1JZEA 4WKXA 3TBCA 1HAUA 4E9TA 3UAAA 2VM3A 3WG7B 3X1NA 3TBBA 4L0PB 2YQBA 1IUZA 3D12B 5F7AA 3SBPA 3L45A 6PAZA 1M56B 1WA2X 4HALA 1IBZA 4YL4A 4YSQA 1SDDA 2HRHA 2J56A 5I6KA 1N70A 1BQKA 3FPYA 2DWSA 1CURA 1ZIAA 4E9SA 5AZUA 1SF3A 4BWWA 1BAWA 3NT0A 3DKHA 3ERXA 3NJFA 3OMAB 2Y69B 3FQ2A 3QJRB 1XMEB 4DPCX 1PCSA 1KV7A 1BXAA 1EZLA 3GDCA 5I5IA 3NSCA 3FU7A 5I6NA 4KOBA 1JXDA 1GW0A 3ZIYA
chains in the Genus database with same CATH superfamily
4HEPA 1IGTB 1NGPL 5D1QB 4CVZA 3O6MH 1VGKA 1AGBA 4FQLH 4YN3A 2BVPA 1NBYB 2DTML 4X7FC 3KEDA 1DL7H 3RVVC 1AR2A 3AXHA 4YK4C 1CXFA 3GSXB 4Z8FH 5CJ5A 3B3BA 4YXHL 2VRQA 1X7QB 4TOYL 4XVUD 4LPYA 5GSVA 1SY6L 2G5UA 1S9XA 3FFCE 1QO3B 3TH4T 3MLZL 2MTPA 3TV3L 1THCA 3D2UD 1VADB 1ACCA 5I66A 4NQSA 3VGFA 2EC9U 1AXSB 4ADIA 4JNXA 2DBLH 3OKKB 3ZE1E 1E5BA 1OF0A 4MMZC 4RFOL 1YEKH 1ED3B 2W38A 2MKWA 4WNJA 2CA4A 1PF3A 1VERA 4CJ1A 1OANA 3A21A 3V8OA 1F4XH 2VL5A 5BOJA 5JIPA 4Y88A 4MJHA 2Z35B 2HT4D 1BP3B 4TNGA 4DK3A 4RAVB 1KLUA 4H40A 2AJYL 1CLVA 4RFNB 3CBJB 1X5YA 3ECWA 1LWRA 4ZTPH 2VERA 4NRXB 3SD5A 5C0DB 1D9KB 1YN6A 3RNKB 2F68X 2OX5B 3TA3C 4ETYA 2WAQA 3TEXA 3QCVL 1AGFB 3HC2A 4XN5A 1P5UB 1HHHA 1WE5A 1GZPA 2CM5A 5GGSY 3RDJA 3WUWA 5IQMA 4GKSB 2ZJSH 2XZCL 3Q9QA 2YMOA 2HMIC 1N0XL 1MCWM 1U21A 4OT1L 3DYMA 1T80A 2NY6B 1XGTA 5JW5B 5DD3H 2CD0A 4L8SC 4LL4A 1I53A 1JUFA 5IWLA 4RX4D 2D03L 2YBRA 5EEWA 1MW0A 4PREB 5EU4A 3UERA 2L3BA 3OC8A 4X4KA 5T1DH 1OD7A 3QO0A 4A66A 2XXMB 4MD4A 5J06A 4GUCA 1FGNH 2QMJA 3C87A 5AOKA 4YH6A 1DYZA 1O0VA 2OMWB 3BAYA 2CO6A 3BKCH 3P11H 1SDDB 3UFIA 4MVBC 4CDGC 3U2SA 1E2ZA 1F8TH 2OSXA 2WKOF 4XN7A 1U8LB 4JFPA 4Q7DA 4A04A 4QRRA 4J39A 1NDTA 5LGJA 5D2LB 3CHRA 4QY8B 32C2A 1GGCL 1QVOB 4PP1C 3TNMA 4EUPB 4UTAL 1KJVA 1UACH 2WBJA 1RZJH 3PYCA 1KTBA 1F4WL 3DUSA 4JZNA 4WHTA 4IHBA 2J4WL 5EF0A 3WMPA 3X3GL 1G0XA 2EVFA 3VX0A 3TF4A 2GCYB 3LN4A 5D5MB 1YMMA 1FFNB 4YHLL 5TPWL 3IFNH 2ZF8A 3GXDA 4S1RL 3T4AB 2I9TB 4YR6B 1R3IL 4GRMB 4ZMNA 4YSSA 3T0WA 1AP2B 2WW8A 1MHHB 2QVFB 1CO1A 1CDIA 3IDXL 3ATBA 3EO9H 4P5SA 3OJDB 4WK2B 1A2YA 3EBIA 4WUUE 2IALB 5CSBA 2MIZA 3UROR 5F7EL 3KPOB 3O8XA 4LEBA 3TYGL 3UIZA 4XVOA 2LQRA 1H8SA 2WXKA 5H35A 1JK9A 2XCMC 3FQRA 4IRSB 4O9HL 4ZS6C 2WZPD 4AGLA 4QWWD 1A4KA 3KYOA 1CDHA 3Q8BA 2QHRH 1A25A 2NNCA 3NGBC 1NOLA 4NO2B 2C9VA 1Y18B 3AVEA 2VIRB 4PS3A 3KS0J 1YJDL 3DHJA 2C9QA 1A7NH 2ARJQ 4OFYA 4BZ2H 5BS0A 3WNPA 5B8CB 4FQIL 3SGEH 2UZYB 2F19L 4BQ8A 3FTGA 1KENL 3NIGF 2IADA 1MWAA 1RURH 4S0SD 4JB9H 1ZE3H 3P1VA 2H8PB 3CFEA 1BLNA 4JFTA 1RL1A 3AXLA 3MJ9H 5FKPA 1MCCA 1CGYA 5E1QA 3NJNA 5FM4A 3UEZA 4N0RA 5LDSA 2R2BA 4AKQA 3O3AB 2RQEA 3HKFA 1J9RA 3QIWD 5FC9A 3HAEA 1QLEL 3LEXA 2VZ3A 2JIXB 4E42A 1AFVH 4QUOA 1T7YA 2PMZA 5E6RB 2AV1B 4BH8A 4I77H 1Z5HA 1RH8A 3QI9D 3ILDA 3AU0A 1AYOA 4JKPH 1UB5A 1QW9A 2MNUA 1QFWH 3M8OL 4OV5A 5J6HB 1PSKL 5C71A 2ZCLH 2XRAL 1JFQL 4LCWA 1ZSDB 4ZYKB 2P8LA 4NUJB 4LLUA 1T66C 5BZDB 4LB8A 5DJ8A 4BQ6A 4J3OF 2O61B 4QRPE 5E8NB 2DAVA 2C3WA 4G6AD 4OGYH 3AWFA 2BCKB 2WZAA 4PJFF 3WOVA 4XO4A 3MX0A 2A73B 2P80A 5B38A 3F2LA 3BLPX 4NQDD 1KIUB 4OLVH 5CN1A 3CNKA 2PYFB 5FCUH 5J89A 5IVNA 4N22A 5C8JA 1SYSB 1CD9B 2KBGA 4FQJH 4FX5A 4UDTB 3BD5A 5GQBA 1R3LA 4NKMB 1S7XB 2R2EB 4HP5A 4M6ML 3WFDL 3LKNB 1F90H 3OGCA 3D85A 5D55A 1JYVA 1MEXL 1CN4A 1E2VA 3BESR 4G8EB 1AQKH 3QA3B 3E3QE 2ZX9A 3KDMA 1OARL 1S9YB 4D3CL 5EUOA 4YMPA 3VUAA 1ESOA 1FDLH 1BX2A 1RZ7L 4GI8A 5F96H 3A4FA 3CZUB 1KDIA 4DUVA 4WWOA 2NTSP 4G9FA 4P2RE 4MWFB 3F65A 4FFYH 2IWFA 3D0VA 5HDRA 1A6TB 1B2YA 1GH7A 4FKEA 4A7GA 3VWJD 1KPVA 1D5BB 3L95A 1J0YA 4K94C 2BZCA 1YNTB 2WKOA 4YEEA 3PHQA 3SDDB 2P5EE 4KQ4H 2AERT 4ISVA 3HPLB 1M7IB 2H26B 4UILH 3NH7L 3V0HA 1BHGA 1ET8A 4A2HA 1WUNT 1X4ZA 3S36L 4IW4C 1QAWA 2XN0A 2CBQA 5KSBE 5FFLA 5DYOB 3ZYIA 4N2MA 1XGRA 4LFHG 4B9JA 5A2KH 2WN2A 2HJFB 4PRHB 5F1NB 4MCNA 5H2BA 5G5DA 1G7MA 2V2XA 3DVNB 4P4KB 3DO7A 1OW0A 3BPLB 3QORD 3QZLA 5EBMB 1HINH 2QR0B 1ZVNA 5IF0B 3VA6A 4GXUN 3U1PA 3LN9A 3U0WL 1JDAA 2EE6A 4G7QB 4GSDH 2QKIC 4EO5A 3LH9A 2FBOJ 2JCWA 3PP3H 3V6ZB 5ABZA 3TO4D 3VW3L 3QR2A 3RDTA 4C54A 4XWGH 2ZE0A 3V6FA 4DGVH 5I8OH 5J1AB 3TFKD 1YEIL 2QELA 4S1DC 2E59A 2QTEA 4GSRA 4WVRA 4Z5RA 4YHKL 2VLJE 2XWRA 2VH5L 5E9DB 3ZRCC 3ETTA 3ABKB 4YDKL 1XL4A 2ZUWA 4RESB 3V0FA 2R0KL 3VG0H 4TNWF 4PJ9D 4QXTA 2UY7A 4YIQA 3FSWA 4DGUA 1L9OA 2PW1B 3NMEA 2B3IA 3GXMA 3HI6H 4EI5B 5GZNC 5IBTL 1RUKH 2DYPB 2J8UF 7TAAA 2JV6A 3UTSB 3CVHL 3VXSE 3ZTJG 2DRUA 3GSUA 4AJYV 5KJRL 5GRXG 5EU3A 4WI4A 3VFGH 4DGIH 1B0WA 2G4EA 3TESA 5FOJA 3O6FD 4WTZG 4D8PA 3VRIA 2HFGH 1YQVL 3IMRA 4M9PA 3ZT6A 4XR8C 4IIQA 2DQIH 2AJ3B 2PCXA 1O6SA 3DV6A 3NA9H 2DQEL 4XOBA 3LRGA 3LV3A 3SYPA 1JHTA 2WO2B 5DJXA 4KROD 5AWNH 2X4RB 1QNZH 1G6RB 3P73B 3ISRA 2VSKB 2H1LM 1NDGA 1NKGA 3IBOA 4AL8L 3T2QA 3DDFA 4JVUA 4QHLA 1PZ2A 4FG0A 1ZLVH 2IANA 4NGHH 1B3JA 1U8NB 3QUKA 5JPNC 2QSCL 5MENB 2YXFA 1UOLA 1BMGA 2AJXH 3PWLA 4P5TC 1IO4C 1IGFH 3WDJA 1CTMA 1HESA 1EXGA 2XVLA 5T1KB 2RJMA 4O2EA 2YQ3A 5AUMA 2FR4B 5HY9B 4NJ9L 1KIRB 1X7TA 2YXVA 1RZKL 1WEJL 3MV9E 4ZMQA 1PZAA 5FHAH 1B0RB 2XZZA 3B7UX 4S0HA 4OB5L 4Z18A 1S3KL 1VFBB 2K6WA 5C0GB 3FUNA 4Z0XA 4ZFGH 3QFDA 4BFJA 2YUZA 3OKOA 1MN4A 4CVXA 1WAEA 1W9XA 1FZKA 4ZMPA 3KVDD 2Z31B 1TTCA 1ACXA 2EKSB 5FYKH 5C0BE 5I23A 2D7OA 3IMWA 5I28A 5BQ7B 5TQ0L 4B50A 1O9VA 3D4GA 4X7DC 4FQXA 2V9TA 3OG6B 4V2BA 3GHPA 3QP3A 1RZQA 1BJ1H 1NBVL 1TR7A 5DSCA 4PJGE 1PZ3A 4HIIA 4U7KA 1I3UA 3ZDYF 2VDLH 5E6YA 5IB5A 1RY7B 1E6OL 2DMBA 2QLVB 5F89A 3UAAA 2WV3A 4N68A 3WG7B 2HKFL 1R3JA 3AWGA 1QI5A 4UOQA 4BFEA 1BFVL 4LHUA 4O02A 3RUGE 3ZTCC 3B1UA 3C6EA 1LE5B 5SWSB 4FQ2H 4X4ME 4WKZA 4R4BA 3VGBA 4DNLA 2YIHA 5E94B 4NXSA 4KXZI 2GTQA 1BG9A 2J73A 4PY7B 1ZT1B 1SLVA 4Y16D 3VG9B 2DWSA 2CK2A 2DKSA 3EADA 2RCSH 1E9PB 4DQAA 4ZNEA 2GAZA 4OUUA 5CSGA 3ULVC 1ETZB 4K7PX 5JUEL 3QWQB 1HKLL 1K4CB 2N1KA 3NUKA 3OVUB 4XXDB 5ISZD 3FF8A 4M5SA 5DWUL 2NZIA 2LW3A 4YGVA 1BBJA 3RLSA 1P53A 5D1QC 1A1MB 3MQIA 3A0OA 5I1AA 3N41F 1Q38A 4KOCA 1R24A 5BCAA 5ICZB 3LH2H 4OW6A 1RUAH 1Y0LA 1I1FA 4PGCA 3L9RA 3V5DB 2EYSA 2GJ6A 4LPTA 4LVOC 2J8UA 2BZDA 2ICWA 4PJAB 3MLYL 4YHZH 1PJWA 3BVUA 1ADQA 4YHPB 5JA8B 1J05B 4YLBA 8FABB 1PZDA 3ENEA 3DPBB 3QS2A 5E8DL 4NHUB 4AXWB 4BKTC 1U92B 4N2IA 4TKWA 2L0DA 3N5AA 2D3LA 3LIZH 4MYWB 3KYKL 4IDJL 2DQTH 5D70H 4ZAKB 4NCC2 4MCZA 2A4CA 3ESNA 4OM0H 4I0PD 3W9DB 1CK0L 3QJSB 3O3DB 5C0CB 1HXYB 2Y06H 4DZ8B 3SPJA 1L0PA 3QXWA 2E9WA 5HPMA 5AZ2H 2XC8A 3O0RL 2Q8AH 2IGLA 2C1OA 3JV4B 2X1QA 1NANH 3IDIA 2IPKA 2VAAB 3CDZA 1E7VA 3X3FH 4K3EL 4RFNC 1X5KA 5LGHH 4F7EB 1WAAF 3U46B 1LO4H 1D5IL 4IOFD 3GZOA 4IJTA 5IFJB 1YYCA 3C6SA 1AGCA 2QPFA 4X6DF 1BJMA 3IDUA 5KSAD 1P5UC 4GLRI 5L8LB 5LN4A 4TMPA 1VB9A 3SBWC 5CP7B 5AALA 35C8H 3IDGA 3DX6B 4HGMA 3TJEH 3V5KB 5J9PB 4M00A 4YDVA 4EVNB 1K3ZA 2BOCA 5EHFA 5EZIL 3NOIA 4FP8H 2G60H 2YD9A 2NY6C 4RZCB 4DVBA 4KY1H 5K5YA 4YNYB 1XIWD 2Y9RT 1YZZA 1IGMH 2IH1B 4WO4A 3DROB 3OKNA 4ERSH 1QHOA 3IYLW 3NN8A 4UT9L 3FH5A 3TZVB 3VE0A 2BRRH 4WSJA 3MRLA 3R8BB 1J1OH 2CIKA 1S7SB 4RDQF 4B9KC 5HHQA 3TL5A 5ITBH 1OAXH 4LVHB 1F58L 1FVDB 1YNKH 1B3IA 2WIIB 3HMXA 4NKQB 4R7NB 4U1SA 4WWKD 5MEPA 4QHMB 2EQDA 3HUJB 4ZUVB 2V17H 4W9HC 2X9XA 4JREC 3QEQD 4XNYL 5DLML 2DYSB 4UV4L 4JQIA 1WISA 1A8ZA 1RD6A 4FLSA 3AQDA 3DBXA 3OPUA 4YPGA 3QEUB 4DWHA 5CF3A 4NZTH 4NQVA 4AGPA 1UXSA 4N9OB 2FECL 5CO1A 5A2IH 4I2XE 1BM3L 3VXUA 5I82A 1ODUA 2E7MA 4Z7UF 3T1WA 5IFAL 3Q06A 1LLAA 3MLVL 2BSED 3H42H 1TZIB 4LSVL 3RWIA 4NO5A 3CSYA 3LPFA 5IZ7A 3MNVB 3BVWA 1RPUA 4ETQA 3IE4A 4OJFH 3DTXA 2G5BB 3QT2A 1WVZA 4Q97A 3E6FA 4YGAB 3MFGB 4B9GA 3FSVA 3CU1A 2VLKD 4PRIA 2IPTL 3KVQA 5HHOD 4TSBL 5CAYB 4IRSC 3S8FB 2Q86B 3U7WL 2GEEA 4WTQA 3TX4A 2MKLC 2YZ8A 4IBZA 2G3NA 3QDJD 4ZMTA 1KJMA 2APTA 1HE8A 2OXGB 1G9HA 1AI1H 4PJ7E 3LKPB 3L1OH 1WCBB 4NS0A 1E67A 5FECA 1MF2H 2ZPKL 2XVGA 4PGJA 1EZSA 1MVUB 4FXKB 5BO1H 5C0ND 3L3OC 1JYWA 5L2KA 4Z7WB 1KCRH 4FG4A 2XWBB 4IHOB 4GUPA 3V0WH 2GABA 3M17A 4PJCE 1HQ4A 2O5NA 3B5TA 5LG1A 4I88A 4ANUA 1RUQL 2DLFL 3NSDA 1XEDA 3PNRB 3INOA 2DWEB 1I4FA 2HPOA 1GXEA 4RSVA 2NUTA 3T09A 3HRPA 3LZPA 3R18A 3GMRB 5TK2A 1TU2B 5FYKU 3BAXA 1T6BX 1MCNA 3H9ZA 1D7FA 3PP3K 4MBRA 4Z7QF 1GZQB 3IDJB 4UQ2A 4R2GB 3GXPA 2R4RH 3VXTB 1OGAD 1LYQA 4KO5A 1L9PA 4F7MA 2ZOUA 4P2QA 5TDPB 5IKCA 4DP9X 2J71A 2XN1A 3F7LA 1G7QB 3QIWA 2W8CA 4GAGL 3K46A 4K7PH 1SQMA 3KPSB 4HUMB 2M83A 1HHKA 1EHKB 1VEMA 1JDCA 3H4HA 5KS9B 4NIKB 3CK0H 3CXFA 3BVVA 3QISA 3UH8A 4P05A 4NNPL 1WAAA 3OXRB 4NNYB 1WBXA 5HJGA 3D09A 4AIOA 3SCMB 5DMGC 1JK8A 3G5VA 2IGFL 3MRBA 4PSPA 2PLTA 2F5AH 3QWRA 1KWKA 3H2WA 1OEZW 4HGWA 4IKNA 5BVPH 4X6DA 5T5FL 4OF6A 4KK8D 1K2DB 4KPHL 1T7WA 1YQ2A 2HT2D 1KOAA 3WAKA 4N2OA 1RIVL 3EJYD 5D7LD 3NPSB 4ZG1A 5CGMA 1NDMA 1NTDA 2VKWA 4XPAL 3V4PA 1A9EA 3VQLA 5F7BA 2ZOWA 4UT6L 3WS3B 4PGEA 1GS7A 1QASA 3MLUL 2YAHA 1RJZA 1RJLB 4CMHB 3CIAA 3QZBA 1D6VH 5F9OH 2VDMB 4HLZG 1RFDH 1P2CB 3G6AB 4RISH 5DUJA 4RQQA 2EUZA 2X0UA 3DMMC 4HFWB 1LEGA 3UYPB 4MYPA 5A16A 1NKOA 2ZNWA 4POUB 3U4AA 2PWEA 2XV0A 4S0TD 5DS1A 1C08B 3KGUA 3H9HB 3PABA 4TQEL 3UTQA 3CFBB 3H3BC 4DP7X 1N7MH 2WM0A 3MUGA 1B2WL 5HJ3B 3CVDA 3IJEA 3B6SB 3SDDC 3GEWB 3QYCA 4ONFH 4DZBB 4FLOA 3EDDA 3LZLA 3LEYL 3ECQA 5CILH 1J88A 1G7PB 2GI7A 3MBXH 3INUL 4FLRA 3H9SD 5F9WB 5FDWB 4ZFFB 3VH8G 3NP4A 3QXDA 5KSUB 2WQUA 4XO5A 3ME0A 5FYJL 5I15L 2E8YA 1CT8A 1JNLL 2G4GA 4UWQB 4UQAA 4A39A 2YGNA 4W9IC 1HHIB 2V5SA 2WUBH 4LSQH 3BPLC 3P40A 4WY7L 3IFLL 4Y9BA 3C09B 4XT1C 1DCLA 5DT1H 4LNVA 4MAYC 1N2RA 3WJMB 4HUXA 1OT1A 1N59B 2HN7B 3FU9A 3FXIC 4X2UA 3ARBB 4ELMB 3Q6GH 1MCWW 3LKSB 3VFUB 3AUVA 3IJ9A 3KEHA 5DD6B 1UJ3B 2V3EA 4APXA 1DBBL 3HG5A 3Q2CA 2ADGA 2M26A 2ZP9A 4UINH 2A83B 5F70A 2X6BA 2OR7A 1CDUA 1M2OA 2IPUG 3N9GL 1JPSH 3QE5A 3QFJE 4JR9L 3LZRA 4L1HA 2Y6SC 3CFUA 5DA0B 1MLCA 3T3ME 1WH0A 5KEZA 2EYTB 1AYRA 1IEAB 4JPIA 5EUKA 1NGPH 3OMZA 3F05A 3O4LE 1BWWA 2YMXL 4JRYE 3KBHE 4LBEA 2DTMH 3BFOA 4CU8A 2RR3A 3OR7B 3D0LB 4U7MA 1HJBC 1DUZA 3RL2B 4YXHH 2OJEA 4TOYH 4OD3H 1KPUA 1BOYA 1A6ZA 2Y07H 4M8QB 1SY6H 3BT2H 4MTMA 1N8OE 4FL4B 3FUMA 3MLZH 4KRPD 5D1XE 5AVXB 2VXTL 2AQQA 4QNPF 3TV3H 1AAJA 1GJWA 2EDEA 3QUML 2AQPA 3AREB 3GJEA 1KFAL 1IMHC 3FT0A 2PPCA 3W0WE 1IZKA 2RBLA 1WFMA 3T2OA 1G9NL 2DLGA 3LHAA 4RFOH 3O6FA 4GFTB 2VR3A 4R26L 3BZEA 3RVVD 1HL8A 4L3EE 4F2EA 2R1WA 5F97E 2PWFA 5H37H 1NAMA 2IVFC 3EBGA 2VDLB 3KBFA 2AJYH 4KXAA 1MCDA 2IBZX 2NTFA 3BJLA 4RMRA 5HYEA 3L3JA 4OZHE 5EEUA 4JFXB 1E3ZA 3QCVH 3DXAD 2ADIB 1F11A 3E1ZA 3KXFD 4FOMA 4P4RB 3U36A 3ULUL 5IJKA 2DV6A 5DJAB 4FABL 5D2NB 1I8KA 4HFUL 3EFFA 3EFOA 3I50L 3BRFA 1N0XH 3MMEA 4PLJC 4R8WL 1WGVA 2BNUB 5C07D 1F4HA 4MDJA 4OT1H 4HH8A 3G04B 3JV6B 3QQ4B 1XGYL 1ZHNB 5JW3L 4YZFF 1L7IH 5K1VA 4X0KB 2C7UB 4BDVA 3SPIA 3VFTA 3F7VA 2ZXCA 5E51A 1W0WA 2ITDB 2D03H 3S4SG 3S3DB 3PWPB 4J12A 4KITB 3ASWA 3UJIL 5H8DA 3TA3D 3QIUB 3BN3B 4C4KO 3SKMB 4IRJC 2Z31C 1TDQA 1I1YA 4HWBL 3ZR5A 5CSZA 4H8QA 3FT4A 1SF5A 4W70A 2F5BL 3CPUA 4RBPH 1PDKA 2JCCF 4DERA 4ZSOA 3TM6A 2YJLA 5EN2A 3GINA 1NLBL 1X5MA 1MVFA 1HCZA 3MXWH 4H8PA 5DR5L 3U79A 1C9SA 5EOTB 1Q9OB 2KZKA 3SGJC 4XNMB 4QT5B 3IAQA 3FRPA 5DO8A 4F2FA 2XWCA 4CC1A 1ZT7A 4UTAH 3KPTA 1F4WH 1KTJA 2J4WH 4MZIA 5ICXA 5DHVA 1VACB 1QZNA 2VQ4A 4OAWB 4QRQB 3ZK0A 3AGVA 4HT1L 43CAB 5FGBC 4FFZA 3K6SA 3VXOB 2EDBA 2CMRL 4YHLH 1JTPA 5TPWH 1J1XH 1MCRA 3CC5B 4S1RH 4XBPB 4AQ1B 1R3IH 5FB8B 2CLVB 3ZKXB 3BSZH 3WY4A 5EFIA 2BJML 4XH2A 3PWJB 3VD5A 4CN6A 3IDXH 1S9WB 5KZCD 5EEVA 4MDIB 4Q9CA 2YFOA 3S9DB 4PHZA 4HU2A 4M48L 4Y1AA 3SPVA 3MROA 4PP1D 4JFFA 1ZIAA 4GW1A 2ZOKA 5D7IE 5F7EH 1FL3B 2C5DC 2NY3B 4M93B 2XSKA 4ZPTA 3TYGH 1CZ8L 3RIFF 3O4OB 2DH2A 1MJJB 2H1XA 4HUWA 4L4TB 4MJIE 4O9HH 5JZ7C 4HJGA 3KPLB 5FYJE 4K7FA 4OJCA 3ATEA 5AYTA 3BZ4B 2Y5TB 1YJDH 4GRLA 1I7RA 3GMMA 4XWOC 2A4EA 2GYSA 2F19H 3FB6B 1YUHA 5PCYA 4N2LA 4OZIB 3FYEB 5GZOA 5DC9B 3CXDL 2J12B 2Z91A 1B0GA 2M2DA 4L9DA 3ROOA 3ARVA 1HXKA 3MOAL 4W9JC 4OM1L 2YRZA 2VDPL 3FAXA 2Z65C 4JEGB 1G7HA 1ORSA 5DRNB 3U4EB 4HV8B 4NQQA 1M05A 3UGEA 2F7QA 4GW4B 4ZPVA 2DLEA 3BMWA 2Z92A 1QLEH 5IB1A 4PSRA 2NX5B 1SXCA 4HK3N 4PS7A 2X12A 1NCBL 3OX8B 5CINL 4NI3A 3Q2VA 1KGXA 3VXRD 3BIAX 3VFWA 4UZUA 2XN9E 1S7QB 1CBJA 3A6CH 3M8OH 3ULSA 2R7EB 4HXAL 5HHVH 2NSXA 4GAJH 4W6WB 1ZANH 2A74B 4DT2A 3RZWA 2D31A 4IOSD 4U1KA 4ZI8A 2Y2YA 4X4YB 4P5MA 4IS6A 4JQVC 4BE6A 4J4PA 1CI5A 2BVTA 2MCAA 3X2QB 3RURA 1P7QA 2JK5A 3NDYE 4R5TA 1RK7A 3VMOA 4K3JL 5T1LB 2I24N 1TVBA 2WQAA 5KSVA 2Q2LA 3OQ3B 4KXBA 4PJDF 4FXGB 2C4FU 3WN5B 3MV7D 5IESL 3RAJL 3GMOB 3TH2T 2FBJL 1IJ9A 5J12B 4KMTL 1BQSA 4M6MH 4PJEE 3BHBA 3WFDH 2L7JA 1PLCA 2JTYA 4QMEA 3TZVC 1XCXA 4WFED 3BSGA 1T66D 4QTFA 4BZ1L 4QHNA 4LVHC 1JP5A 1UG9A 5TGBB 5E2TL 3FFCB 1OARH 3MKGA 4HAGA 1EQWA 4Q0XL 3LSOA 4X80L 5EU5B 4AYGA 2R2CA 2YD2A 3D1MC 4D3CH 5AVWB 1RIHL 3A4EA 4QRSB 1P4LB 3HZVA 3ULUE 2ATAA 2XG5A 4TVPL 1FO0L 2ESVE 3AY4C 3ZE1B 1A0QL 1VFAA 2YRLA 3AQYA 3MLWL 2A4ZA 3TC9A 4K9EL 2H0PA 3FO0H 4X6BA 2DWTA 3ABMB 4NYLB 5G4OA 5I17B 3QSKB 4GAAA 4HIEB 2NNAA 4WO0A 2E7CA 4F9LC 2GSGA 2BSSA 3NH7H 4P2OA 3ARGB 3HZYA 5IROD 4FQCH 4LE8A 5FYLD 5F7UA 3U4BL 3MJGX 2A9BA 2O72A 2P5WD 5BZWB 5A40E 1PKQE 1OTUC 3KCPA 4AT6A 1KGIA 5C6TL 1XF4B 1S5HA 2ZYHA 5D96B 4AYMC 4YXLL 5I1LB 4C83B 5LHDA 1Q9LA 3U0WH 4I7ZC 3LX9A 3P4NB 3AMKA 2CSPA 4GO9A 4HXBL 5DEZA 1XHHA 3VW3H 1EO5A 3ATDA 3BP5B 4LSTH 3RZCB 3MYJB 1DJSA 2D7QA 1YEIH 4N2KA 3VFRA 3NCYS 4JQXA 1AS7A 4YHKH 3JVFC 1GOHA 1N8ZB 3ISYA 1MW1A 4YDKH 1RJCA 2PWHA 2Q2EB 2VLKA 4NQDE 1HI6B 2DKMA 1YECH 3L7EA 3PUCA 4ZMOA 4LLMB 3D33A 3QNXA 4ZQTA 3F7RA 4X6EA 1BF8A 2CRZA 1T89A 2DICA 5IBTH 3V95A 4APQB 5HDOA 4AM0B 4QCIB 4D0DA 4PV8B 5HHPB 2WGXA 3CVHH 3R4RA 5C08D 2GUOA 4CA4A 3U9UA 1VZHA 4OQ1A 2XWJB 4LDLB 1T0PB 5E0QA 3B83A 3P4OA 1XH3A 1EWHA 2A6IB 1YQVH 2I60L 4KTYA 2WB1A 4G5ZL 4BV1A 3WFBL 4R2GC 1FCCA 2CIIA 1TYJA 2QGEA 4GMTL 5GZND 1F3DJ 1Y7VA 2Y1ZA 1IAII 2B59B 2ZXQA 4GW5B 4V11A 2UUDH 2VQ1A 1HKFA 5D9SB 2XACC 3C60B 1EEYB 1E90A 1BQ5A 4UANA 1IIKA 2QGBA 4N0YL 4WUUB 5DDHA 4YLCA 1UYWH 4M8VA 4JLRB 2J6WA 3RGVA 4AL8H 3N2JA 2FLRT 2LABA 2DM2A 4C56D 3UTTD 4K3GA 3SCMC 2QSCH 2W9EL 2Y36L 3CZEA 4GG6F 3TBYA 1U8IB 2J1KA 3D7PA 1ZAGA 5DRZB 5C0FB 2RALA 4HF5L 4U1HB 1MFBL 3HE6C 3Q8CA 4WSGA 4JFQB 1JGLL 5GRJL 2D3VA 3BP4A 1CFVL 3NPSC 4BRJA 3OKMB 4CKVX 5DK0A 4GUOA 1CGXA 1E28B 4YDZA 1A7OL 4NNXB 5I1DA 3QBTB 4PJDA 1FSKB 4PJBE 1OPGH 4AVJA 1RZKH 1WEJH 3IMUA 2WO4A 3P30H 5HD8C 1OGSA 1PAMA 1U6AL 4CMHC 5ADOL 3IN0A 1QWNA 4ZXBA 1TETL 2IAMA 4LSSH 4P5TD 4PPTA 1JBJA 3UTOA 1UATA 3OR6B 2W59A 1UH4A 1S3KH 2IH8A 3U6RA 2P3YA 3MGTB 3ARFB 4K23L 2JELL 4LEXH 3SDXB 3RL1B 4X5XA 4N8VG 3IU3B 5F7DA 4BK5A 1EERB 3NFSL 4G1MA 5TQ0H 4TQIA 4Y5YA 5JORA 2W07A 4XP1L 2CR0A 4P46C 4I5BB 3T77B 1NBVH 4OGQC 4UM9B 1W91A 2QPDB 4NKDB 3L4YA 2J2ZA 3V0DA 1NPUA 3PJLA 5F9WC 2IO5A 4AQAB 3QUXB 4YSDA 2IBGA 4M6OL 4LCCB 2VR5A 1OE3A 3V7AG 2X40A 4LQFH 1S7RA 2HKFH 1GSKA 3UBXI 3UBGA 2YUVA 1MNNA 1BFVH 2AEWA 3DBSA 4JDZB 2YN5A 3HG0A 4QRPB 1OGTA 3UAFA 2F1BA 4QHKJ 3DRTA 5J6GB 3EYFB 3EAKA 4FFWC 4GT7A 2GK0B 3VFMB 2IH3B 1DANU 1FYTD 3ARBC 3SKNA 1URIA 1V3LA 4JG0H 3M1BA 1EFXA 1NAKL 3STZB 1JZ4A 3GNML 1AQDB 1XBRA 3Q3GB 5BRZA 4DKTA 5FS5A 3PG2A 1D5ZB 4LKCB 5DHEA 5EBWB 1EMTH 2J1ZA 4RBPK 2JJVA 1LO3L 1HL5A 3QULA 5ECGA 5CM1A 1DQLL 2CLRB 1IIIA 2PYED 4BKLA 3T65A 3IAPA 2M8XA 1MCJA 3MR9B 2UXTA 4KTDL 2WYHA 3IDNA 5DWUH 4E0RB 4P2RB 1P5VB 4P8QA 3H3PH 3SEPA 4K0OA 1SOQA 1EAPA 3MRHB 3GB7B 1NBZB 3VWKD 5CZVL 3E7JA 1IKNC 2XWDA 3P4MB 1MW2A 2H2PC 3LQAL 3PHOB 3GJFH 4Y19E 2NRDA 2VZUA 4IKJA 3WIHL 2P5EB 3HG1A 4PR5A 5LXGL 5MEOB 4JDEB 4P59L 3MLYH 3S2AA 5C70A 3JWDL 2B14A 2VQUA 3QPQC 2X87A 2K9UA 2WNWA 2XTJE 3F64A 4FL4C 4KZ0A 1KLGA 3CZSA 3S3PA 5I1EL 5CLWA 5E8DH 2A6JB 4JFYA 4A7QA 4M43L 1RCYA 2AI0H 3AREC 5KSBB 3VFNA 3VXQA 3KYKH 4IDJH 5JYMA 3HOGA 4N90E 5D1QD 4BK4A 3MI6A 5JMRA 4MHHI 4U1JA 1UWGL 3I9PA 3L5HA 4E5XA 1JV5A 3BOVA 3HI1B 3MNMA 1INQA 5LCVA 4MB5A 2MCPL 3RFRA 3O9WB 2X4NA 4WW2C 1IT9L 5EEYA 4K3EH 3RX5A 1NPNA 5FV2A 5HI4D 4AGNA 1WICA 1CGTA 1JF1A 5B22A 1NEZG 3GUTB 1D5IH 2Q6WB 3RWEA 4KUCF 2EIZA 3DHPA 3WKNA 3MUZ1 4UB0H 1XCQA 4WWPA 2QDWA 1PLGL 1IFHH 3QB7C 4UAHA 3WEBA 4PG2C 4B9FA 2Y2WA 4I1RA 4Q2ZB 1KFGA 3QQ3A 5ANME 1R5VA 2QFPA 3FDWA 2ADJB 3BIKB 1A7BA 5EZIH 4L5FL 1G1OA 2OI9B 4FA7B 1UB6B 4LMQE 2DQUL 1Z66A 1BXVA 2W0FA 3WFZA 4QXGL 1LEKA 4H0HB 2VSMB 4YDJB 3JXAA 2GT9A 4NO0B 5I6PA 3TTSA 3VXSB 4EIZC 2E76C 1QLRA 1WHPA 3DURB 4UT9H 5ISZE 1U3NA 3OJMB 4LNRB 1GTFA 5EBLA 3G5XA 3RWFB 2WLHA 3MRRA 3CSFA 5BV7C 1PD0A 4JDVB 5K9OB 1F58H 3KLLA 3GRBA 5IBLD 2NXZD 3T6ZA 5CCHE 4Q58C 1JDDA 1KNOA 2H1PL 3DJ9A 1L0QA 3BLBA 3GM0A 4HCRL 1E4XL 3E80A 2CR6A 3G9VA 1A1NA 3O2VL 4MNQB 4RCAA 4TLKA 4XNYH 5DLMH 1IBBA 2YD4A 3TA3A 3DK2A 4JANA 2F7OA 4J3XA 4G9DA 5D1ZB 3SGEI 5JNYA 2K45A 4KI5E 1A3QA 3F7PC 4FFVC 3JT2A 4QEGA 3FUIA 2P7TA 3S5YA 4GIPD 3ZSSA 1BYPA 2EECA 4A55A 1FFRA 1BM3H 1I3GL 4L8SA 1W80A 2OCFD 3TBBA 4GQ9L 4L0PB 1QG3A 3SGDI 4F8OA 5IFAH 4AQ1C 6PAZA 5JO5A 3MRMB 1TO4A 3L5XL 3MLVH 3P0YH 4LSVH 3ZKXC 3DRQB 4ATTA 4GKNA 3QCUL 1I7ZB 3WTTA 4L23A 1K5WA 4YSQA 5EO1B 4LOEA 3QH3A 4N26A 4OU3A 3REVB 2VYRE 1YN7B 2W0KA 3BGFB 5DS8B 3MV9B 4NJAL 2NY3C 4M93C 1BQKA 4GKLA 3ZQWA 2UWEE 4PB0L 1CURA 1IM3A 1QFWI 3O4OC 5BOZG 4IBTA 3II3A 5CP3H 3C5JB 4TSBH 5F1SA 2VLRD 1UD6A 3OMAB 5I1HH 4Z6AT 1UTDA 4WNQA 3U7WH 3G08B 3AM8C 3A4DA 1KGJA 1QSEA 1YYLL 4W9FC 2J6EL 2F54D 2FX8L 3FL7A 3FU6A 2XI9A 5C0BB 2QPUA 1T5XA 4ES9A 3IXAB 1WT5C 3MNWA 2ZPKH 2VNCA 3PWUB 1F5WA 1EO8L 1MWOA 3AAZA 4ZTOL 2EXSA 3AB0B 2WYTA 4XODA 5I26A 3RWDB 1QATA 2I7SA 4PJGB 4G80A 4IRZL 3VFSB 4PYGA 4EE2A 2RIKA 3ZMNA 5CD3A 4RDBA 3MBWA 1RUQH 2DLFH 3KL5A 1D7BA 5JOPD 4MNHA 2A6KA 4IIZA 4PLNC 3RUGB 4H25A 3QEQE 4HOWA 5BW7C 1MHCB 4AC4A 3FQUA 4Y9GA 2CXKA 2V9UA 3IFPB 4XPHH 3KWXA 3JYCA 3ZUCA 4FQHB 5KBKA 4RH4A 2IDCA 5FO2A 4GAGH 4GIOA 4UU9A 2A74C 1MAKA 1QTSA 4JM2B 2EH8L 5F7LB 3RPBA 3EO1B 4Z7NE 5JOFB 4NNPH 3VU2A 4LLQB 4JFVA 2IGFH 4X4ZA 3OKDA 1UZ6F 4MNGE 5IVZA 3RWHB 2K6YA 5T5FH 4DEUA 3VD4A 4FXGC 4S1SL 3C08L 1HZHL 4RMBA 2VT0A 3AT9A 1AH1A 1W8EA 1HE7A 4CUCA 1RIVH 3ILQC 5J12C 2RACA 3H7BB 3MNZA 2XZAL 4N85A 4A2LA 4QTHA 5I18L 3MRIA 4XPAH 5HHOE 2XQYA 2A0LD 2DMCA 3GO1L 3W57A 4F8PA 2K7QA 5JPMC 3BQUB 1ZEAL 3FZUC 3EOAA 3MLUH 2AK4A 2DEYX 2HFFB 1FNLA 1W6WA 3QDJE 2UUDK 2IDSA 5DMGD 5GGUA 2XNAA 3X11A 4AZ8A 5HYJD 1GCFA 2CBOA 1U93B 2GPZA 3V7MA 1IM9B 4F5CE 3JBG7 1ZHKB 3LKOA 4GP8B 1HXMB 4LLAA 4TQEH 3V79C 5I5MA 1CFTA 2VM9A 1TZHA 1S78C 5GGQH 2JQZA 1KB5A 4JKNA 2XKNA 1CICD 1B2WH 4I89A 5MERA 4R96A 4PJXE 3CVHB 2FJHA 4PY8J 5HVWA 1QSFA 4IMKA 3LEYH 4ORGB 4M4RB 4NSKB 5BJTB 3DMMD 3US1A 1YUKB 1KT2A 5ETUB 4FNUA 3INUH 1LMIA 2GHZA 1WC7B 2IQ9L 5C9JA 1YC8A 3OV6A 4EDXB 5FYJH 5I15H 3BGMA 1JNLH 1NWPA 3ZMRA 1OGAE 3N42B 4JY4A 3BYTA 2N4IA 5EIVA 3SJVD 1MOEA 4K2UL 5TF1L 1HSAA 5ID0B 3WE1A 4CKQA 3CE1A 3IFLH 3BAEH 3SDDD 3K7UA 1MAMH 4JRWA 4NN5B 4ODTH 4ZW5A 4FTDA 2X3AA 3PV7A 4UIKL 3KPQB 4HC1H 4WUKL 1A7PL 2J1WA 2P5WA 1XSKA 4NQUA 5GPRA 4PLKC 1KACB 2C9SA 4KWUA 2A9AA 3T2NL 5EEZA 3NCCB 1OSZA 1DBBH 4WU7A 4HMDA 5HTSA 1XCTB 3ZTNL 4PRHD 4UF7C 3J07A 3JZ7A 3NFNA 3N9GH 1I8LC 4UIMA 4JR9H 4TLTA 5D7LE 4WIQA 5DHXB 3EJCA 3K6IA 3SDCB 4APQC 4HWZA 3N6YA 2XHNA 2NR6D 4MAYD 2DKUA 3RX9A 2EDLA 4JGNA 2JKXA 4FI8A 4OCYH 3F6IA 2UYLA 3FC8A 3MRPA 3KJ4B 1GYCA 3GSNL 4FZ8L 3EH5B 3GXFA 1J8RA 1S5IL 3MGOB 1S8DA 2TSAA 4GG8B 3DUUB 4JFWA 5IOPA 1EJOH 4I2XB 4YDLC 4YHOL 1AHWC 2Y6SD 3ARSA 1S9VA 2QKIA 2VXTH 2VMFA 2DQDH 3QUMH 2H32A 2CJUL 1QWUA 5C08A 3VB9A 2YGVA 2PPEA 2DYPD 1RKRA 2QVTA 4H26B 4F7CB 1NM9A 1G9NH 3C60C 3EGXA 5DVNA 2HKHH 1SLWA 5E8EB 4AGMA 1JGIA 1JPFA 3N1MC 2NUPB 4R26H 4RRPM 4CRPA 1PZ5A 1NLDL 2OMUB 5E08L 5KYWA 1DN0A 3H9SE 3WELA 4KQ0A 5CHNB 3QZMA 1U58B 3H3KA 3TVMC 5KBPA 1JZ2A 2R1YA 4HDIB 3HR5B 4DCQA 4H13C 1E5YA 4OR1A 1T21B 3MFFA 3HRZA 4YOKA 4G82A 2NSQA 3MTXA 1AE6L 3SE3A 4HOMA 4BXSV 3DIFA 1UM6L 2GTZA 2BY1A 2EYRA 1GY1A 3GJFK 3BFQG 2WLLA 1KXQA 1T6WA 1V7MH 2ERJC 3TT1L 1T1XA 1VKXB 1INDH 1CE1L 4PJ7B 3ULUH 3AS3A 4F9PC 4FABH 2BNQA 4X9IA 4KO6A 3G6JF 3CHXA 4H4NA 4CNIB 3WEMA 4EI6B 1FSKC 3GDBA 4R8WH 5JLZB 1OOWA 4YHYB 1NGWB 4LASL 4UM8B 4PJHF 5AW6B 5IB4A 5MEND 5JW3H 1RJYB 2CHZA 1XDTT 4PJCB 3FB8A 4J1UA 2N3JA 2YD6A 3CDGB 2NT0A 3GUFA 3KL0A 1TITA 3DECA 4G6FB 4G8FB 2WXIA 4KXDA 2O6CA 4ZX4A 1SOKA 3WUWG 4LPWA 1E65A 4HWBH 5DMYA 4C4BA 5JPNA 4QGTA 3OPZL 4F8NA 2DJMA 1CD1B 2F5BH 1P9MC 4LPXA 4PLJD 4XPBL 2J5WA 3B7RL 2PXYB 4H44C 4P5RA 5AVSB 1NUGA 1T20B 1ZLUH 2VJ0A 4MGXA 3WMSA 4YO0B 1KF9B 2MQ0A 1P84K 2EDHA 1KELL 3TWYA 5F1IB 4ZW7A 5ID1B 4WHCA 2OJ1A 4JFEA 4RWYL 4X9HA 5ESQB 4XRCB 3QUXC 4N20A 4QXWA 4LCCC 3LRSB 2ZWSA 2X1PA 2ZKWA 5AVRB 3ZMEA 4IRJD 2Z31D 5F0MB 3IJ7A 4I0KA 4JRXD 4YBLC 4PMEA 3I6KA 1SJVA 1BVNT 4IKIA 3EHBD 2IV9A 2ZCKL 1OP3H 3IM1A 1RHHA 5DFWH 3L7FB 4G7YL 1CR9H 1L0YA 1UVQA 2JJWA 4WI0B 5IEKB 1NGZB 2BJMH 2KDYA 2OSYA 3DGDA 5SX5K 1ZGLM 1ERNA 3ETBF 1A64A 3I2CL 3EW3B 4M48H 2WC7A 2NYKA 1NANI 2P8MA 5D2LF 4AE0A 4O51B 3LNEA 4Z7VE 4X5PA 1QA9A 5GGSA 1T22A 4ZFZA 3DXAE 5SWSD 3O3UN 1WSST 1KLFB 1EEZA 4G42A 4N6RA 5JDSA 5D5MF 5HDWA 4MJ6B 5C07E 3P9MB 1DJWA 3BVDB 3STLB 4PRNB 4A68A 4OJYA 4Q9RL 5FV1L 1TLMA 2X4PA 2WLJA 1QOKA 4ODWB 4U1NB 3N0AA 4KK5C 1I3RA 3BLKA 1I8AA 3FQNA 5IVXE 4FHBD 3CXDH 5EIQA 5TF0A 4N25A 3P9LB 4Q4IA 3MOAH 4Q52A 4IU3B 2VDPH 3FCGA 3SQBB 2FX9L 5JZ7D 1UD8A 1LO2L 2Z7UA 4AVKA 5K9JL 3FO1A 5E1AB 4CVUA 2E4FA 2FJGB 5I8EB 3IJHA 3VI3E 4XWOD 5I16B 2J8OA 5CINH 4HIQA 4I4WA 1X5HA 2NQCA 1SVZA 4U6VL 3FFDB 2AAAA 5TDNA 1IGTA 3AG3B 5KJ7E 2PPAA 4J5VA 5D1QA 1GHFH 1NIBA 4G43B 1LDSA 4O58L 1FZMB 2N7BA 4UTBA 3F58L 1NBYA 5K9KB 3IMBA 5K69A 1NFDE 5EBGA 3LXBA 3HAEG 4GO6B 3WKPA 3ZT5A 3P2BA 3UC2A 3GSXA 1ASQA 2YAMA 5FYJU 5C0CD 5LWYH 4MKMA 1X7QA 3C5SB 3QFJB 4GB9A 1FYHB 2CDEB 2EJ1A 1QO3A 5EOCL 4EQ2A 5B7MA 1NCTA 5GHWL 1HOCB 2OI9C 3T3MB 1VADA 4K3JH 3SKJL 3K8MA 4NZJA 1AXSA 5HYSB 5L4FA 4LAQL 1DSFL 5IESH 3OKKA 3G6JA 1CIDA 3UADA 3O4LB 2FBJH 1VAHA 2FCBA 1JPST 4KMTH 1ED3A 3PFQA 4XMUA 4FE9A 2L04A 3V6BR 1Q9WB 2WAHA 1NKRA 1XL6A 4BZ1H 2Z35A 3BIBX 4ODSL 5L8JB 4L18A 4I1NB 4G6KL 4X98B 1H15A 3IPFA 4RAVA 4YXKL 4X80H 5D1XB 4KTGA 3RP1A 1YJDC 2CCLA 2CRIA 5B38G 4NRXA 5C0DA 2MTAA 2Y72A 1D9KA 3RNKA 4TVPH 1RP8A 1O75A 3W0WB 2OX5A 3CHPA 3LS4H 2GIYA 4KJQC 5JQHC 2FL5B 2PPFA 1AGFA 2OW7A 1PMYA 3QQNA 4HIHB 4K9EH 1P5UA 3EGDB 5EA0L 3V55A 2KKQA 3KLKA 3NRPA 4GKSA 4QDGA 4L3EB 3FONB 4P23B 5KTEL 2OV0A 1PX4A 2IF7A 4NP4L 5EC2B 4LCWE 2F2HA 1R0AL 4ZMYA 4EI0A 2D7TH 5JW5A 3WE6B 4I87A 1S7VB 1Q8MA 3BH4A 3BW9B 4KRNA 2WBKA 4JE0A 3OF6D 4PREA 4OZHB 3S5ZA 3U4BH 3X1NA 4KDWA 2R15A 1LGVA 4PRAB 3C6LD 3VXRE 4XMKL 3QS3A 5C6TH 3GBLA 3I9AA 2KYIA 3U1SL 1TYRA 3BGFC 4UMSA 2OMWA 4YL4A 5K59F 3ROLB 1SDDA 4BIKA 2A77L 4YXLH 3V52H 3BUTA 4EAEA 1A7RL 3BWUF 1YNTF 4TUJB 2RFXB 3FUFA 3WY2A 1U8LA 4PG9B 4DJMA 4HXBH 4U0QB 1OF2B 4HG4J 2Y1YA 5D2LA 3D25B 4QY8A 5C92A 3ERXA 3Q9PA 1QVOA 3QZWB 4O02L 2Y69B 4EUPA 5I8CB 5KG9B 1GCYA 3QJRB 1OTUD 3MV7E 5L0QC 4DAGL 2PR4H 1EZLA 4PTUB 2FWUA 2GCYA 4ILDA 4AWJC 5D5MA 4P07A 1JXDA 2KLTA 1AC6A 5I1JL 3T4AA 4ZO9A 2I9TA 4YR6A 4GRMA 4WFEE 1AP2A 4MA1B 3E8VA 1MHHA 4OLXL 4A7TA 1V8HA 1HEJC 3EOBB 4WTZA 4JKKA 2GBAA 3FULA 3WJJA 4AOFA 4DHLA 3OJDA 3QR0A 3D2UB 3PNWB 5ACLA 4PFEA 3BC9A 5KVGL 2IALA 5GRZA 1II4E 1TQBC 3KPOA 3I6LD 1CG9B 2R9HC 1KSRA 4G5ZH 2ZTBA 4FCHA 2AZAA 2PKDA 4MB1A 3WFBH 4IRSA 4GMTH 5FGCE 1CL7L 1JWUB 4JX0A 1SFDA 1Y6MR 4NO2A 2VIRA 2E8ZA 1BZDA 3I3EA 5B8CA 2ICES 1DQVA 4N0YH 1ADQL 2FWOB 2O5ZL 2UZYA 3KL3A 1E5ZA 1KBPA 2VDOL 5D7IB 2ITCB 4ZOAA 4E9LA 4F37K 3NJMA 5HPOA 3U6XS 1AS6A 2H8PA 2W9EH 2WWNA 2Y36H 4HJJL 4AQZA 1VDGA 5EU6D 3GGWB 4WK0B 4GXVL 4MZRA 1QR1B 3PS6A 4HS3B 4HF5H 1TQCB 5CLTA 3O3AA 4XMLL 4KC3B 1IKOP 5GRJH 2WZ0A 4JM0A 1CFVH 3CFJB 2JIXA 2YAPA 1EGJH 4YFLF 5CXPA 4O00A 4FJ6A 2AV1A 2XA3A 4LF3B 3BQUC 4I3RL 5FWRA 1TJGL 4LCUA 3NIGE 4G7VL 5IT2H 1BJ8A 1U6AH 5ADOH 1VEPA 3CVCA 4MKTA 3SCMD 4HOXA 3LJ3A 1TETH 1BSIA 2G2RB 1R3HB 3QQ9C 4G8IB 5J6HA 2CO1A 2CNYA 3MBED 3K81A 2IOIA 4XMXA 3NIDF 2DI9A 5ICYB 3HE6D 4WV1B 1ZSDA 2JELH 4K23H 4ZYKA 1C7TA 4NUJA 4PP2B 2MOGA 1T4KB 5BZDA 3MRCB 4WAFA 3DHUA 4F7TB 2O61A 3QJQB 5B21A 1C8PA 5E8NA 3MA9L 1A6UH 2OMVB 5HD8D 1BZEA 5EO9B 2BCKA 2P43B 3BDBA 1M53A 1L0XA 2A73A 1MG2C 1ZGLP 1KIUA 2IANE 4KTEL 1DBKL 4XVJL 5FWQA 2H6PB 3L81A 5C3TA 4UDTA 1USQA 3GSOB 3WIIL 2DIEA 4NKMA 1S7XA 2R2EA 2CH8A 4IDLA 1X44A 2DZEA 4M6OH 5EG6C 1E42A 3LKNA 3VNYA 5JHLH 3HMXL 1NCAL 3WEAA 4G8EA 3QUMB 3QA3A 5BVJB 1RIUH 1LXMA 3Q8AA 1S9YA 4L05A 3ZE0E 4AVHA 4PJFE 1E9QB 4NN5C 4P46D 4DO4A 2MPAH 4MWFA 2L7QA 3BPOB 3NVQA 4W1TA 2GITB 1NAKH 4AL8C 3UAJC 3GNMH 1A6TA 3UTTE 4C56E 3WIFB 1GA2A 2WXGA 4PJEB 1D5BA 5MEQB 1F18A 1YNTA 3ATAA 3LVTA 3SGKC 2OL3A 2OULB 4KJPC 3SDDA 2HJLA 4LHUG 1DQLH 4B9ZA 3HPLA 1ZLUK 3TASA 3W5MA 1M7IA 2H26A 3EXJA 4HH9B 5DQDL 2LLLA 1YYML 3B34A 5GGTL 5I1CH 4KJWC 3SDCC 4KTDH 2ESVB 2X7LA 2XOTA 5DYOA 4FMKA 5D7KD 3BP6B 3DX3A 3DO4A 1RZKC 4BZYA 2HJFA 1H3WM 4FI7A 4PRHA 5F1NA 5CZVH 1G7LB 3DVNA 4P4KA 3WIHH 5K9QG 4W4NA 5LXGH 5EBMA 1NL0L 2FH6A 2QR0A 5IF0A 4P59H 3I6SA 3JWDH 2YGQA 4CBZA 2VQTA 1P4IL 2Y1VA 3MRGB 5DMIL 5I19L 4M43H 3V6ZA 3WNNA 1R9FA 3Q1SL 3VSTA 4TVSa 3CN2A 5J1AA 1ZSHA 4HG4K 3C8DA 2RMNA 3QI9B 5KBMA 1PKQB 4FKHA 5IHUH 5E9DA 2QVIA 2IXQB 1NCDL 4PBVC 2YSSA 2H2PD 3QG7H 4KDVA 3UX9B 1XGUA 5FK9B 3HI5L 2MCPH 5GGRB 4EI5A 2PW1A 4A7UA 1IT9H 3HS0B 1WIUA 1MG3C 4MJ5B 3UTSA 5I6MA 1AZVA 1IGYB 5KVGE 3NDZE 3NK4A 4WTXA 3ARED 2LFGA 4CADB 1PYWB 4Y8AA 1N26A 4O4YL 5FYKD 3SSGA 2XN2A 1QWHA 3WFHB 1AANA 4IBYA 2FATL 4NQDB 3ZZ1A 1SQ2N 4FI6A 1FYTE 5HGGS 5DGRA 1O9ZA 3NQKA 3ZOAA 1T1ZB 4U6YB 3F7KA 3O0LA 2ZAIA 4L5FH 3UP1A 4EN3C 2AJ3A 2DQUH 2ILLA 2PETA 3VQ2C 4QXGH 1NCOA 2D8KA 2NXYC 5CR8A 1ETJA 4M56A 3V0VB 4OIIL 4ZZKA 4RGOL 3FQ1A 2X4RA 4M5YL 4G83A 1G6RA 1JNHB 2PYEE 4BFKA 3P73A 2C9PA 2QSQA 4TVUA 3LS5L 4BA0A 4F57L 5IFHL 3PXLA 1U8NA 2AJSL 5JIMA 2QQLL 4YAQB 5DJ6B 5MENA 1GGBL 1OCWL 2H1PH 3VWJB 4HCRH 3HFFA 4QLRA 2PXYC 5DXWA 1E4XH 1JS4A 3H1ZA 1BFOB 3O2VH 3PQYD 5T1KA 4B27A 3L2NA 1U36A 4J3BA 5F3BB 2FR4A 4ZJ9A 5HY9A 5ABAA 1KIRA 5A2FA 3UZVB 4KKNA 3MJ6A 1CGSH 1E8XA 3H54A 3FT3B 2W94A 2DQHL 3G9AB 3IGFA 2G0KA 2G5RA 1B0RA 1FLRL 5KVEE 3WFCL 2IAAC 3V4UL 1I3GH 1TYEB 1PY9A 3QORB 1VFBA 2P5PA 3CX5J 5C0GA 3SHSA 3K0YA 1B0IA 1PG7W 5E4EB 3LQZB 1OSPL 3S88L 3HUJF 3QCUH 1XF3B 3NESA 1OWWA 2FAUA 2Z31A 2EKSA 1OT4A 3STBA 4PJBB 5BQ7A 4FFVD 3TO4B 3TN0D 2R0LL 4RAHA 4AYFB 5EPMB 3JTSB 3I6GB 1ZHLB 1H19A 3KBPA 3EF4A 1HWHB 3HHSB 4UUJB 3SOTA 1QZ1A 3NYKA 2XLLA 1SXNA 2DEWX 5SV3A 3ZJAA 4HX1B 1YYLH 4PJ9B 4RWHA 3WNKA 1IKFL 2J6EH 2YS4A 3T0ED 2FX8H 4JCWA 5GGRY 1MUJB 5JW4R 2K7PA 3QXUA 4WDIB 4HCIA 3GHEL 1JCVA 5DJ0A 1LE5A 1EO8H 4ZMZA 4QRAA 4ZTOH 5JHBA 2NY3D 3GK8L 1KDJA 1CIUA 5E94A 3B5GA 3RIAK 3E6HB 1HCFX 3POHA 4IRZH 1ITCA 3QDGE 1HHJB 1UCTA 2K8QA 4PY7A 4OZGF 3ZDYE 3DV4B 1OP9A 3R0MA 4XHJC 3S34H 1JV2A 2XTLA 3ZTDC 1ETZA 3HNVL 1AIZA 4KUCD 2IQAB 2ZKXA 3B7SA 1K4CA 4XXDA 1H9VA 1KY7A 1IQDB 1NMCC 5GJSL 4AC2A 1V54B 2BVOB 3UABA 4PGBB 1A1MA 4JFDD 3EZ8A 3S7GA 12E8L 4IBSA 2JE8A 2P4AB 2Y7MA 4AYBA 3M1OA 5GS1B 4HPYL 4MZ2A 4Z7WF 3L5WB 3ML9A 2WXOA 3V5DA 2EH8H 1OALA 3E9UA 1X6LA 4M5TA 4PJAA 1T2XA 5E56A 3CQQA 4YDIL 4DP4X 5IR1B 4YHPA 3NA4A 3W2DH 1J05A 1JZ7A 2Q9OA 3BKJL 4PB9L 5C2UB 8FABA 3DPBA 4NHUA 1BPLB 4XVSL 3RG1C 4AXWA 5E24E 1U92A 3ALPA 2QZQA 4DOHE 2YWYA 3C08H 1HZHH 4QTIL 4S1SH 4ZAKA 3KLAA 1KGUA 4V1DA 3W9DA 3O3DA 5C0CA 4H88H 1JI2A 1HXYA 4U33A 1A4BA 2F9BT 4DZ8A 5JDJA 3CSPA 4Y19B 2W5PA 2VLRE 5HHME 1UM4H 5F7MC 3JV4A 3M86A 4W93A 1W72B 3LRHA 3R0NA 4MCYB 3CZNA 2ATKB 4BM7A 2VAAA 2XTJB 1PZUB 4YDMA 5D1XC 2F54E 3GLAA 4F7EA 4XAKD 1IRAY 3U46A 2EXYD 2A9CA 2OK0L 3DI2B 1E2WA 1BIHA 2Z64C 3ZU8A 2FQEA 4JQVA 4AE1A 4KNQA 4NZUL 3ILQD 2Z7YA 5CP7A 5CCJA 2B77A 5EZLB 3DX6A 3V5KA 4XMTA 1QX1A 1D2OA 1KY6A 1U3HD 4P23C 1NCCL 2YA1A 4EVNA 5J9PA 4FQ1L 5C09E 3VDBA 3IEAA 3FZUD 1TSHA 4WI3A 3T3PF 4RZCA 3UTZB 2YARA 3O11B 1WAAE 2IH1A 3DROA 4AMKL 2IDUA 4RDQG 2HX7A 1DO6A 1AXIB 2Q7YB 2IQ9H 4DW2L 2EUWA 4WKXA 3TIEB 1HNYA 4X6FB 3TZVA 4GSXA 4Z3IA 2FK9A 2FIKA 3VNZA 2NNFA 1S7SA 5DS2A 3L45A 5TF1H 5ANMB 4RETB 2Y24A 2YLKA 4R7NA 1XTMA 2CJTA 4Y16B 4K73A 3UPAA 4QHMA 1T1WB 3AABA 2JI1A 1AMYA 1C8QA 3HUJA 4ZUVA 2BWQA 4BZ2A 1NJ9B 3DI3B 3KNBA 4UIKH 1FE8L 3AY4A 3NACL 1HT6A 4WUKH 1A7PH 1RV6X 3MREB 5F7NC 5I6KA 1KBBA 1AVAA 3T2NH 5ISZB 1G1KA 4LSUL 3QEUA 1RP9A 3ZTNH 3MJ9A 4FFZL 4H0GA 3LPPA 5ELIA 1OAKH 4KK9D 1TTAA 5E7BA 4F9LA 5F9DC 3PY9A 1UA3A 4JG5A 3NSCA 4ZMVA 4G8GD 3GT6A 1TZIA 3CX5K 4MA1C 4XVUC 3EGSB 5EF3A 3LPWA 1XGPB 3PXHA 3HC4L 3MNVA 4PLKD 4JPQA 3T08A 4PJIF 5HYJE 5E2JA 5DVKA 4U3SB 5FUZL 1I3VA 1AOZA 4S1QL 3GSNH 1NC4D 2G5BA 4JO3L 2CO7B 2Z8VC 1S5IH 3VFOB 2BSTB 1HEZB 5DFVD 5I6OA 1L5GA 3ZKNC 3JWNG 4YHOH 2YRBA 3PJNA 4OTXL 2GW5A 2IV8A 2Y7NA 4W9GC 5BUAA 4Z7UE 3WNOA 3L08A 2MH4A 2CJUH 1JL8A 4R0LB 2Q86A 2F1AA 4NBYB 1XFPA 3ARDD 4OCSL 4LO9A 3FQ4A 5GS3A 2HT4C 1SJHB 3CDCA 2OXGA 4U2YA 5E9AA 3TNNB 5T33L 3LKPA 4YHIB 3NSFA 3VD7A 4CN1A 1NCUA 5E08H 2BP8B 4XCCL 4ZD3L 4KVCL 3UYRL 2UWEB 1MVUA 4FXKA 3K1DA 2X1WL 2ORBH 4BFRA 3F7YB 4Z7WA 5KSAB 2XWBA 4IHOA 4XZUB 1IC4L 3V6OE 3SJVE 1AE6H 1YAIA 2F7IA 1P7KB 3RPIA 4CVWA 2ZXBA 3HHRB 4AX3A 2OP4L 1KTLB 4PBWD 4OGZA 3OZ9L 5AAWA 4U0RB 3AGWA 3TT1H 3NZSA 2DWEA 1CE1H 2B9AA 3BGAA 4KKRA 4NAJA 1XIWB 1LVEA 2KC0A 3RB7A 1CI3M 2IIJA 3GMRA 4J3WA 4WUUD 2EDRA 4KVNL 1GYWA 3A24A 3M7FB 4FFYA 5J56B 1GZQA 1XX9C 2FQGA 2GB2A 3IDJA 4Y4HB 3VXTA 1KXVA 2R23B 3CZFB 1ECYA 3ARYA 4LASH 4PYHA 1AGEB 3TVMD 5TDPA 4JHUA 1G7QA 4URKA 3EH3B 4WWKB 3T9WA 3KPSA 3I02B 4GQZA 2XQBH 5KS9A 2DI8A 3CHQA 3D3VD 1BM7A 3BH9B 3OXRA 4NNYA 3QEQB 2E47A 3SCMA 4WJ5B 4Z7QE 3OPZH 3S37H 1PG7L 5C6PB 5D4JA 2VR9A 1F6LL 4LLYB 5CJOL 3TPKA 1B6UA 2KQNA 4UAOC 1K2DA 1KELH 4RWYH 3WENA 3HB3D 2OMTB 2ED9A 2AQ3A 3L16A 1K6QH 4NRYB 4WWNA 4XX1G 4ANKA 4PRDB 3WS3A 3QC6X 3QYMA 4Z7NB 1UASA 2R29L 1H8LA 4PAZA 1KXHA 1RJLA 4GAYB 3DSFH 2EE0A 2XWEA 3QIBC 1P2CA 5F8RC 5KBNC 5LBSL 3G6AA 3QAZB 4MNGB 4DTGL 4L8BB 1PCXA 2F61A 2WMPB 4HFWA 4AG4H 1G9NC 5G4MA 5TQ2L 3UYPA 5D93C 2ZCKH 3T2LA 2VZOA 3ARXA 4NWTL 1XF2B 4FNSA 3TP4A 1C08A 3H9HA 1X5AA 5HVHB 3CFBA 3FRPG 4L1SA 2TRHA 2AQ2A 4GLRH 1QFPA 5HHOB 3QUXD 5FW8A 3TCLB 5HJ3A 4Y4FB 3FUDA 3B6SA 4U6HB 2KZWA 4NAMA 4WEUD 1L7TL 1XXFC 4OSUL 4U6XB 4IOIB 3QDJB 2XV3A 4UNTA 1G7PA 3AQXA 1K8DB 3L17A 2EDTA 3ULUC 4ZFFA 5FDWA 5KSUA 1BXXA 4P2CG 1ZA6B 3AS2A 3O3BB 1OTSD 4JPWL 1E4KA 3FU0A 3WKML 1KCUL 5JA9A 1W0VB 4Q9RH 1HHIA 5EIIB 2PP9A 5DRWB 1OPOA 5J13B 2WCSA 1WZ1L 2CBMA 2V5TA 4PJXB 2DQJL 5GGVL 3PL6C 4BFBD 3WJMA 1N59A 3MLXL 2Q76A 3ARBA 4R7LA 4ELMA 2UX7A 3IGAB 2FX9H 2B2XL 3LKSA 3VFUA 4FNTA 5IMOB 1A47A 5K9JH 3MCKB 5DD6A 4LRNL 1UJ3A 5FO8B 1OGAB 4KBPA 2A83A 1KG0B 1OQOA 1IGJB 4HEMA 3VTTA 1WA0X 1UD2A 4LIQL 2P5ED 4KK5D 1G4MA 5INDB 3F5WB 1TJHH 3L9EA 2EYTA 1IEAA 2COQA 3GZQA 1JZ8A 1J5CA 4B96A 1FHNA 3C12A 3BVXA 4OVVA 5AB9A 3HS0C 5DD0L 4OCXL 4O58H 3Q5OA 4A6YB 1U8PB 4XI5C 4TNFA 4JRXE 4N87A 3OR7A 1E6JL 4HS8L 3D0LA 4MXQC 3RL2A 2J88L 2FECI 2JSFA 5KVDL 4A37A 4PCKA 1ZVYA 2AZUA 3UO1H 1SVCP 2YLHA 4M8QA 1HH6B 1IBHA 5EOCH 3K2UL 5D7LB 5GHWH 1FL5B 2EDNA 1TJIL 4JO8A 1ID5I 4HJ0C 3SKJH 3X13B 1UCBL 1J86A 3AREA 3NTCL 3QWOB 5GRVL 5J4MA 4LAQH 1DSFH 1H5BC 2F53D 3FT2B 5AOZA 2BIHA 4IBVA 2FLBT 5ECJE 4ENZA 2DMKA 5DK3A 4HWEL 3AG2B 4L8DB 4AYEC 2VLJD 3ILPB 4P9HL 1X6NA 4AEIL 4ODSH 1RZIA 2BPBA 5IK3A 3MZTA 4F7PB 4LFHD 4J3OH 4YVNA 2WCGA 2CHWA 5F71A 1ZPUA 5ACZB 1WWCA 3B37A 1LD9B 4JFXA 1FL6A 3WKYA 1JIBA 2ADIA 3PGDB 4P4RA 4X5QA 5H94B 3SIKA 5EA0H 5DJAA 2XA8L 2C9AA 5D2NA 5EMYA 2BS9A 2VR6A 2LVEA 4LGRB 4WHYG 3CVIL 3H9SB 5KTEH 1CXHA 1RERA 5LQBL 4NP4H 3RTQC 2XXFA 1KIQB 1QQDB 3G04A 3JV6A 3QQ4A 4KHXL 5FHBL 1A7QH 1EAQA 1ZHNA 1GGTA 4X0KA 1MLBB 2C7UA 1MJ8L 3GD1C 2ITDA 3AJ7A 2WB7A 4N1EA 3PWPA 3BH8B 2WXMA 2YK1L 5IB2A 2VDNL 1EHLL 3MUUA 3QIUA 4XMKH 3SKMA 5LNGA 3ZE1F 2VC2L 5E5MB 5D7SH 2GFBB 3TO4C 3N1PC 2KT6A 2D9QB 1NMAL 2A77H 4P2AA 4P9ML 5DJYB 4ZW8A 4XMPL 2R56L 2HCZX 5EOTA 1Q9OA 2O5XL 3CFKB 4XNMA 4QT5A 2FUQA 3OJ2C 4OLZL 4PJ9C 3LN5B 1J7VR 1J9QA 4O02H 4DKAA 3QCTL 1QHPA 1W16A 3ZL1A 1VACA 3LIZA 4OAWA 4DAGH 4QRQA 5C3LD 43CAA 5E2WL 4JCLA 1LK3H 4OLYL 4X50A 2JCCE 1Q94B 1OSYA 2OW6A 3CC5A 4XBPA 4Q6IC 4IK6A 4AQ1A 5I1JH 5FB8A 3MAWA 4V2CB 4IK7A 2CLVA 3X12B 1JJUA 5CBEB 4OLXH 3PWJA 3PCYA 3QC5X 4J27A 4KRPB 4MDIA 2XIIA 1Z32X 4LEOB 1NBCA 3TWCL 4EOWL 1JWMB 4I48B 4JHVA 5KVGH 4KKAD 1FL3A 3IWVA 5E6ZA 3K72B 5C0BD 3R1GL 2E7LA 2W60B 5SWQB 4JAMB 1OE1A 3FH7A 1IFRA 1MJJA 4L4TA 4AMXA 2E7HA 3KPLA 4K9EC 5IJVB 1CL7H 1T83C 3VD0A 1N4XH 3AM8A 3GM8A 3GXUB 5AOIA 3BZ4A 2MPVA 2OLDA 2GIMA 1I82A 1RSFA 2Y5TA 4L9LC 1ROCA 5CEXB 4F1SA 4OF7A 3FCUB 3Q1EA 5DLLA 1G7JB 5TD4A 1I9IL 3NIFF 1U9KA 1ADQH 2CG9X 2O5ZH 2MNWA 2QMKA 2VDOH 1HYRC 3FB6A 4XC3H 2GG1A 3BZDA 4XB3A 4OZIA 2FEDC 2X9WA 4BWUA 4Z7VB 1MREL 2R9HD 5F8QC 1KYOK 4LLDB 4MMZB 3DXAB 4HJJH 2AQRA 3KXFB 4FTVE 3L6FB 4GXVH 4ZFOB 5DRNA 1I9JL 3OZKA 1DZ0A 3U4EA 2DWDB 2XX0A 1AIFA 2YPVL 2ZAHA 4HV8A 4ZOCA 3KPPB 4QR7A 4XMLH 4GW4A 5C07B 3RGBA 2I26N 4LIQE 1T2JA 4HPOH 1HDMB 1KN4L 1TQWA 5IV2B 1DVFC 1CTNA 5LCVL 2NX5A 2ZXAA 3K2MC 3QHZL 4X5WB 2ZQKA 3OX8A 1C5BL 1QKZH 4I3RH 32C2B 1TJGH 3U7YH 2Z93B 4G7VH 2AF2A 3TXAA 3UP6A 4F58L 3TNMB 5IVXB 2XTJC 3O6LL 3V8CA 1S7QA 4NUQA 4PN6A 3UDWC 1TOXA 2R7EA 3ZXAC 1DQTA 3GXIA 1AOHA 2A74A 5B3NA 4R83A 3FUHA 4NKOA 4X4YA 4NQXB 1V7NL 2QFRA 3VI3B 1FPTH 3MYZA 1JHLL 4FN0A 2VITB 3FMGH 4PUBL 3SODB 3BQUD 2AEQL 3MA9H 1JE6A 5T1LA 3HG3A 2HUHA 2VN3A 3H2PA 4HKZB 5LGKA 2X4TB 1KJ2A 4FXGA 4FEIA 3WN5A 3GMOA 3B2DC 1FNFA 4KTEH 1EA9C 3I6LE 3QQ9D 3GSNB 4XVJH 1HS6A 5E1IA 4DO5A 4CU7A 3WIIH 5DUPH 5I1IL 1NFDB 3K6NA 4CSZA 2I32A 1NCAH 3L4XA 5IY5B 1JZEA 3RVUC 3HBPA 2NSMA 2XPGB 5TGBA 3FFCA 4L1LA 5J57B 4UQDA 5KZCB 1SM3L 3DIDA 5EU5A 3SDXF 3N85H 3D5OF 3B9VA 3NZHL 4PJDE 4HALA 1P4LA 5H4YA 4RIRB 4NT6B 4ZS7L 6FABL 3B8YA 1XD0A 4JPVL 2RH0A 3GSQA 2AXWA 4KKPA 1BLNB 5DC2A 3V0EA 2W1NA 1N5YL 4NYLA 4QO1B 3S48A 5EU6E 5I17A 2ADFL 2CK0H 5CEYB 4L0YA 1ND0B 4GQRA 1VFUA 4HIEA 4WEBL 4K3HA 2PTVA 1I85C 2BFVL 2B39A 1BAWA 4WFGD 4XPTL 1P1VA 5DQDH 3ARGA 3BPCB 1YYMH 4G6ML 5GGTH 3EH1A 1FUNA 2E6JA 4DK5A 1Z9OA 1GGUA 3SPCA 4U2ZA 2DQMA 5BZWA 4KOBA 3UAJD 1UQSB 4GAFB 4KI5C 1HVXA 1FRGL 1XF4A 2WUCL 3PV6B 4DN4L 1NL0H 4YSEA 3IGLA 4IEFB 1WGOA 4R90L 2VLMD 4LCWB 4C83A 4Z23A 5I1LA 1H3TA 2H4EA 3PP4H 5FDYA 2WNGA 2VUYA 3P4NA 4POZC 5EOQL 3BZFA 1IE5A 1P4IH 5DMIH 4D9LH 5I19H 2HXAA 3Q1SH 1U8KB 2BK8A 4TNVF 4KJWD 4R0LC 3BP5A 5FX3A 3RZCA 3MYJA 1IC1A 1IGIL 2QADC 3VXRB 2ZG2A 1WBZB 1N8ZA 1T7VA 4AGQA 2C26A 2I9LB 2GJZB 1NCDH 4Z0BL 1HI6A 5TE6L 3M46A 5DRXB 4YHML 2ALWA 4G72B 1RMFL 4LLMA 3FQTB 3MXVH 2J43A 4PS4L 4QOKD 1G6VK 4APQA 1U2HA 5FO7B 4HKJB 4QCIA 4PV8A 5HHPA 4N6QA 1NCGA 4BFGA 1K5NB 1X5FA 4H20H 3G6DL 3R06B 5A7BA 4UTCA 1Z9NA 1ROWA 4O4YH 1CLYH 2XWJA 3AXIA 2WP3O 1R3KB 4LZKA 4PI0A 4E5XG 3MV7B 3P54A 2FATH 4QLWA 3SE6A 2A6IA 5AKSA 2AJVL 1PU0A 7PCYA 1KGYE 3AADB 3HNTL 4Y4HC 1FZJB 3ETSA 1XSIA 3L9YA 3PHQB 3O2DH 2FSEB 2B59A 2Y7SA 4FLHA 4GW5A 4OIIH 2C34A 4GXUM 4H8WL 5D9SA 5TFSL 3SE4C 3C60A 4M5YH 3OAYH 1H0DB 4WWKC 1EEYA 1H6EA 4R97B 3TT3L 3LS5H 1MHEB 4JLRA 5C0RL 3ALWA 1IQWL 2AJSH 4J7RA 2QQLH 3OXSB 4X5LA 4OQTA 5FKAB 3EXLA 4ADJA 1A65A 1OCWH 1FFTB 1OM3L 5IGXL 3WNMA 1U8IA 5DQJB 4EN3D 3DO7B 5FGCB 1M2VA 5C0FA 3A47A 4U1HA 2BVYA 3PWNB 4F80A 2B9BA 3OAZH 3LQAC 2NXYD 4JFQA 2MQCA 3KBEA 3OKMA 1GJUA 3VVWA 1E28A 1XXDC 3JWDC 4NNXA 1QBBA 4WRLA 2HVJB 2DYRB 1UKSA 1XB3A 1PX8A 1RVFL 2YUWA 2DQHH 2X28A 1A21A 3QAZC 3WFCH 4GG6E 4CW1B 1N5AB 1NPJA 3V4UH 1EIBA 5ACMA 4H1LH 4PRBA 4EZMA 3OR6A 3H0TB 2F7PA 4JO2H 3MGTA 3ARFA 1KB5L 3S88H 1OSPH 4IU2B 2YC1B 4ZOEA 4NWUH 3SDXA 3RL1A 2AJUL 1BZ7B 3IU3A 5E0FA 4Y4FC 1F6AB 2F18A 2NY5L 4UDUB 3NIGB 4J23A 1P9MA 4I5BA 3T77A 5EU3B 1VZGA 5FLUA 4UM9A 1ML0A 3I84A 4NKDA 1MIMH 4AV5A 2YAOA 2X1OA 4XO8A 2ZOLB 4AQAA 3QUXA 1QLFB 1FP5A 1BV8A 3BE1L 2CHNA 2HVKB 1SY6A 4LCCA 1IKFH 4NQCD 3JYBA 2AEPL 3KH4A 5C0NC 4RMUA 3V0IA 4JDZA 4QRPA 5J13C 3GHEH 1UZ8B 1EUUA 5E2UL 3S8GB 4G6JL 4CSPA 4HHWA 4TLUA 3EYFA 2WK2A 5J6GA 1OWRM 2GK0A 3VFMA 5MHSD 4XOAA 2IANB 4PJ8D 3STZA 1DJXA 1UOVA 1AQDA 3Q3GA 3D51A 2NY7L 1D5ZA 5H37A 2I27N 4LKCA 3D2TA 5EBWA 1D5XB 3RNQB 1DBAL 1CXKA 2J5LC 4BJLA 4JKWA 2CLRA 1GL4B 4AJ0A 2VXSL 3PQYE 1AG6A 2CGRL 1J18A 3HNVH 1QFOA 4NIYE 5KWYC 3ZE0B 3MR9A 4LHQB 3EDJA 2YEZA 4PJFB 4LARL 5T3ZL 1TVHA 5C2BL 5CCGE 4IGBD 4E0RA 4P2RA 1P5VA 3RJOA 3CQPA 4GP5B 12E8H 3MRHA 1B6DA 3GB7A 3JTBA 4C56B 5F9AC 3UTTB 1PG7X 2QL1A 4PJGF 4HPYH 4L3FA 4AEHH 4N2AA 3P4MA 5F6HI 4DH2A 4ZMAT 1T0NB 3PHOA 4LSRL 4PWKA 5TDOB 2DMHA 2P5EA 5ALBL 5K1NA 1T03L 5MEOA