3OD3A

Cueo at 1.1 a resolution including residues in previously disordered region
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
488
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
total genus 143
structure length 488
sequence length 488
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A03
1KDJA 3T6ZA 5I26A 3X1GA 3FSAA 4N8UA 1T5KA 2VMJA 2WO3B 1WS8A 1CUOA 3TU6A 5AFAA 2XV0A 1QHQA 2HX8A 3KW7A 1EHKB 1PLCA 2NRDA 4JKNA 1RCYA 2FQDA 2BZCA 3BVDB 4KO5A 1BYPA 1TKWA 1SF5A 3ERXA 3NJKA 2IDUA 2XUWA 1KV7A 2PPDA 3ASNB 1L9OA 4DP7X 1AZRA 1IBZA 3CVDA 1ZDSA 3FU7B 3X1FA 1KCWA 1SFHA 2HZHA 1JVLA 2DV6A 1NINA 2PCYA 1YLBB 7PCYA 1OV8A 2BO0A 1PLBA 2I85A 2IH9A 2XXGA 4M3HA 4E9VA 1IC0A 4E9RA 3WG7B 3S8GB 2DYRB 2FT8A 1L9TA 1KYAA 3AW5A 1GW0A 5I5JA 1L9PA 2PPFA 2XVBA 2XLLA 3WI9A 4DP1X 3PAZA 4F2EA 2YXVA 1SDDB 1PZAA 4HCFA 1BQ5A 1BXUA 5A7EA 2CAKA 3FYIB 2BP8A 3X2QB 4BWUA 2EIMB 3D12B 2J55A 2JKWA 2FTAA 2PPCA 3N2JA 4QKTA 5IY5B 1AG0A 3T6VA 3UADA 4A2EA 2GI0A 4KNSA 4UANA 4ENZA 2H47C 3DIVA 4P5RA 2VW7A 5PCYA 2GB2A 2OCCB 3FPYA 4DP4X 3ABGA 3ZDWA 4F7KA 1SHXA 1NIBA 1CYWA 2N0MA 5FC9A 3AZUA 1A65A 4BWTA 4DPCX 1AS8A 2IH8A 4KNUA 3IEAA 4BXSV 1AAJA 1NIEA 2YAEA 1SJMA 1MDAA 3UABA 1ZPUA 1L9QA 3QQXA 5B1JC 5F7BA 2W8CA 3AG1B 2BWDA 1NIAA 3H4FA 3EHBB 4E9QA 3CVBA 1HAUA 3X1BA 3NSFA 4UF7C 4AZUA 2AANA 2FJSA 4TXVB 2XYBA 1ET8A 3NJMA 1BQKA 1PY0A 1J9QA 3IE9A 3EH5B 9PCYA 1JXGA 3H56A 5D4HA 5I5IA 1ET7A 3FS9A 2CBPA 1BQRA 5F7AA 2EILB 2X88A 2VM3A 5I6NA 3CDZB 2YAOA 2QDVA 5B1AB 1AS6A 1JVOA 1NWPA 3PXLA 3H4HA 2HX9A 2BW4A 1NPNA 1W6WA 2IDTA 5E9NA 2WO2B 3SBRA 2HRHA 1JZGA 4K9JA 1ASPA 3BQVA 1KCBA 2Y1AA 2HXAA 2YAPA 3ABKB 1ASOA 4A67A 2XXFA 1AQ8A 4FA7B 2XU9A 4YVNA 2UXTA 1JXDA 3S3DB 2UXVA 4HCGA 3OMNB 1WS7A 2OJ1A 2YAHA 1CURA 1ILSA 1X9RA 3GYRA 3NJIA 3FU8A 2IDFA 2TSBA 1N68A 3HB3B 2FQEA 1BYOA 3ABLB 4G71B 1HAWA 2WSDA 3FQYA 3UAAA 4F2FA 2GBAA 1XMEB 3WNJA 1OCZB 5B1JA 4E9YA 3PAUA 3JT2A 3CG8A 4AKPA 4QLWA 1AZCA 3SBQA 7PAZA 2MTAA 1UATA 3HEIB 1ET5A 1JZFA 4GP5B 4DP0X 3S3BB 2R7EB 2VSMB 2YAFA 5I6KA 4AKQA 5B1KA 2IDQA 1AZUA 3FU7A 3FPXA 2CUAA 3ZBMA 4KO6A 5ANHA 1NIFA 4BDVB 3EH3B 1E67A 5AZUA 3NJFA 4W1TA 3G5WA 2FWLB 1IBYA 1XB8A 3FQ1A 1B3IA 4Q8BA 3NYKA 2HRGA 1WA0X 2FNWA 2W88A 3QJUB 2TSAA 1ETJA 3UGEA 4G7RB 3TA4D 1AACA 4GY4A 2UX7A 2X87A 3NJGA 5I5MA 1SDDA 3CVCA 1ADWA 1SNRA 2PCFA 4E9XA 1A4BA 3GXUB 5PAZA 1QNIA 2VN3A 3S8FB 2QPEB 5B3SB 5I6MA 2PPAA 1NICA 1JZIA 4KOBA 2AZUA 3T71A 1BEXA 1ZIAA 2RACA 1JZHA 4YL4A 1JERA 4G7SB 3GDCA 3AY2A 4NAJA 4DP8X 4E9TA 1FWXA 1NTDA 3OMAB 4ZK8A 1PNDA 3CZUB 4A2HA 5D4IA 4A2DA 1BXAA 3T6WA 5I6OA 1NZRA 1KDIA 1FA4A 2ZOOA 4BWWA 3X1NA 4EF3A 5D4JA 2YXWA 1PF3A 2BWIA 1XB3A 3AG3B 2GIMA 2EIJB 3NSDA 4A2FA 1FFTB 1URIA 3EH4B 2VW6A 2PP8A 2E86A 4HIPA 1VLXA 3RYMA 3FSVA 2H5UA 5I28A 5B7MA 2CCWA 1W6LA 4A2GA 2I7OA 1AANA 1OOWA 2OV0A 3U25A 2EINB 1L9RA 2XV3A 3PAVA 2VW4A 4HALA 2DYSB 2CALA 2A3TA 3QJVB 2QT6A 4YSPA 4YSRA 1J5CA 2PLTA 2Q9OA 4M4RB 3NSYA 4KO9A 4AI7A 1SFDA 3FT0A 2P80A 3CDZA 2J57A 4YSSA 1AOZA 1EZLA 3V9EA 3L45A 1JZEA 3IN0A 2PP9A 2UXGA 2GC4C 1TEGA 2VSKB 3IBOA 4YSEA 4WTQA 1BAWA 3X1EA 4YSOA 1GYCA 3SQRA 3PCYA 4E9WA 3NSCA 1GY1A 2Y69B 1OCOB 4YSQA 1E65A 2BP0B 3MBWB 2B08A 1MZYA 3AG2B 3T9WA 2AFNA 4HCIA 2J56A 1IKOP 3FQ2A 3FSWA 1JOIA 2FQFA 1I53A 4DP5X 5B7EA 1DZ0A 2BP0A 3OD3A 3OMIB 2IWEA 4GXFA 4HZ1A 4YVUA 3N55A 1PMYA 4KOCA 2AZAA 2LLNA 1A4AA 1E30A 3ZIYA 3TBBA 2VM4A 4YSTA 1L9SA 1GS7A 3WKPA 3NJLA 3JTBA 3NJHA 2ZWNA 4YSAA 2XX1A 3QJRB 4DP6X 2R7EA 4JHUA 2YQBA 4AX3A 4X4KA 1CC3A 4YSCA 5TK4A 4CSZA 1NWOA 1A3ZA 2GHZA 2DWSA 4BXVA 1ZIBA 1WAEA 2DY2A 5TK2A 4BDVA 1V55B 1A8ZA 4E9SA 4GYBA 1DYZA 3WNIA 1M9WA 2AVFA 1J9SA 2GSMB 2GC7C 2UX6A 1OE3A 1PCSA 2IWFA 5B7FA 1E5ZA 2BP8B 2JFCA 2CJ3A 1AS7A 2DWTA 3UAEA 1GY2A 2JXMA 1V54B 2XWZA 2YAQA 4BK5C 2XX0A 4G70B 4FAAB 2ZXWB 4L0PB 4UAHA 4DP2X 4PCYA 4WKXA 3S3CB 1J5DA 1J9TA 5AKRA 4G72B 1WA2X 5I6PA 2FQGA 1ZV2A 1X9UA 4HHGA 4Q89A 1GS8A 1N70A 1AG6A 3NJJA 4PAZA 1J9RA 4HHWA 2YARA 2HX7A 2ZONA 1GSKA 3EF4A 4A66A 4G7QB 4AKOA 1IUZA 3TASA 3DKHA 3QJTB 4NB7A 3ZX1A 4N4YB 2UXFA 1HFUA 1OCRB 3WIAA 2QDWA 2IWKA 1PNCA 2Q5BA 2MRYA 3QJQB 5EHFA 1MG2C 1OCCB 3FU9A 1AR1B 2BHFA 4MFHA 3PLYA 4YSUA 2P80D 1BXVA 2B3IA 4JHVA 1NPJA 1E5YA 4P5SA 1RZQA 6PAZA 1TU2A 1KBVA 1OF0A 3NP3A 1ILUA 2FT7A 2IDSA 2H3XC 1JZJA 3TBCA 1QLEB 2PPEA 1PLAA 1NDTA 2EIKB 1ASQA 2BW5A 3ABMB 1XB6A 3NT0A 2I7SA 1SF3A 3FYEB 4KO7A 1W8EA 3C75A 2YAMA 3KW8A 4RH4A 4GP4B 3QPKA 2BZ7A 2XV2A 3DTUB 1A4CA 1R1CA 1F56A 1PZCA 3NJNA 8PAZA 2QPDB 1TEFA 4NERA 1RKRA 3AG4B 1PZBA 1KGYE 4W9ZA 3V9CA 6PCYA 1V10A 1MZZA 1PAZA 4DPBX 1JXFA 3FSZA 3WKQA 1MG3C 2IAAC 1M57B 4GP8B 3UACA 3OM3B 1ZDQA 4DPAX 1SHWA 3T6XA 2PP7A 1RZPA 1AIZA 1AZNA 5LDUA 2J5WA 4KNTA 1OE1A 1AZBA 1M56B 3ASOB 3MX0B 5B1BB 1OE2A 3QJSB 1ID2A 4A68A 3PPSA 1GR7A 4HAKA 1KBWA 1CYXA 2HLEB 4YSDA 1GS6X 3OQRA 3NP4A 4CSPA 4DP9X 3SBPA 1WA1X 1NIDA 5I6LA 2FT6A 3IN2A
chains in the Genus database with same CATH superfamily
3BDYL 3V6FA 1IFHL 1KDJA 3B2UD 2VLRD 4P8QA 4Q6IB 3C12A 3WL9B 3VGAB 1KXVA 5HSFA 1KIRB 4PYHA 5D8JL 2K7PA 4HMCA 1BYPA 4PP2B 3RY4A 4MQSB 4X8XA 3U1SH 1KYOJ 1WT5A 3GMPA 3QXDB 4IIQB 1A1OB 3ARZA 1U8KB 5DA0B 5I15H 3QAZB 4MHHG 2F8OA 2IIJA 3W9EB 3E1F1 4AEIH 3L6FA 1DVYA 2FGWL 3LRLA 1KCLA 1D5IL 2P8LA 2N0KA 3EO9L 3SO3C 1KFAH 3O6ML 1IT9L 4OQ1A 1RZ8B 1V7NL 5C6PB 1IJ9A 2O6EA 4MJ4A 3WFDL 4WFEE 5ADPL 2W91A 4F7PB 4AYEC 4JFSA 1U8PB 4P07A 3H8NA 4U1GB 1NAMH 3LZQA 5K69A 2UUDK 2Y36L 3UTQA 3VFPA 4M62L 3B5HA 5GGUB 4B9JA 4WQOA 1XSJA 1LMKA 3ETSA 3BI9X 5JXED 1J8KA 2MWCA 4NC1C 1TVBA 2CQVA 5L8JB 3BVUA 2LAGB 1YAZA 2OYLA 2Z6FA 1IM9A 2J55A 3VG0L 2PPCA 4Q9CA 2FIKA 1NLDH 3HLAB 5GGRB 4MAYA 2WZPA 3GXFA 4K94H 4NLHA 3A22A 5KVGH 2GJPA 1CMOA 4MS8D 1ONQB 3Q48A 4JZJB 4P5RA 4D9RE 5IR1B 1FBIL 5KW9L 5IVZB 4K9EH 3FUHA 4MCZA 5E9DB 1QWNA 3UJJL 3GSNH 4FABH 3ABGA 5E1AA 4MNGB 5E99L 4A6YH 2C34A 4HLZH 2P8MA 4U3CA 1JXKA 4MJIA 4NI6A 2CO6B 4IMLA 2O6DA 4ZSOB 4F37F 3ES6A 1A9BB 5E24E 3PP3H 5BS0B 3DO7B 2YA0A 3LNGA 2OZ4A 2BXZA 2J2ZA 4IK7A 3NZHH 4Y1AE 4KAQH 4XODA 1UM6L 3FJTA 4HS3B 2P8PB 1L9QA 1HXYB 3ARGA 5MI0C 4F8OA 3WO4C 3QBTB 2R1YA 1S7QB 3AG1B 1T1XB 3EHBB 3CVBA 4MQXD 4LBEA 4XCEA 4Z7NB 3CFCL 4ODUB 4UF7C 4OJEH 3FT1A 3VYNA 5ADOL 3U0TB 2XYBA 4LSPL 4OJFL 3AXLA 4NUPA 1U2YA 3TF4A 4R97C 4IBUA 2EE9A 3S4SA 4ZMXA 1G7JB 1Y07A 4HG4J 1K3ZA 5TPWL 1H15A 5M94B 5J4MA 1B0WA 2HWZL 4PJCA 5DK0B 1R9FA 1XGTA 3DUSB 4HLJA 4YHMH 1C7SA 3MLUH 5ELIA 4HUCA 1YUKB 4LARH 3VFWA 2EEDA 1T21A 1ZVNA 5J0BA 4FCAA 1XGYH 4GS7C 1E5BA 2DQUH 4NHCL 3FFCA 5BV7B 4PJEB 3H3BC 4K9JA 1CXEA 4Z7WA 2FJFB 2PTTA 4BE6A 4DGVL 5KANI 3AFLA 2GIXA 5EOTA 5D7IF 5FHAH 3K2KA 1R0AL 4C56A 2J6EA 1CU4L 4RZCA 3IFPA 3MV9E 1HKLL 4AIZB 1PIFA 2GY7B 5J6SA 1M7IB 2R2HB 1MDTA 2XN1A 1AZZC 4IKLA 5F7NC 4YHNA 2OW7A 4B9GA 1DN0A 1RZIA 2VDML 1NUNB 3KJ6L 4ZNCD 2J73A 4Z9KB 1VZGA 3D4ZA 4QHNB 3DJ9A 3L81A 2K4AA 4HOWA 4F2FA 5JIDA 3LHPL 5EU6E 1Y1UA 4PGCB 3BEVB 4HSCX 4I9WD 2AEQH 5DHYA 1OCZB 5J1AB 2JI2A 2WXOA 2J7LA 2P5WE 5EF1A 3BJ91 4K7PH 4FXKB 1ZCRA 1U8JA 1BOGA 1GCFA 4RNRB 1OY3B 4YQXL 1T1ZB 1BIHA 2RD0A 4R5VA 3KLSA 1N26A 3GSXB 4FFTA 4ECNA 4HDIB 4P4KA 4XI5C 1IM9D 3MR9B 4G6JL 3IDGB 1BF8A 1QKZH 3ZZSA 4X7TA 2ED8A 1IKFH 1AZUA 3CX5K 3G6AB 4OCWH 2EYRB 2RIKA 1U2HA 1TJGL 4MAYD 3BPNC 1C5BH 2DJMA 4XMKH 5GSRB 1T0MB 5E5UB 2WZPD 3VVWA 3ZQWA 4G6ML 4L8BB 1A3QA 2WXIA 4TVPH 3BQUB 3WN5B 1ZHNA 1MFDL 2WLIA 4JDTH 4KROD 2VH5H 3P4OB 3DECA 3RIAK 4UZGA 3TT3H 2QQKH 3NZ8A 2W88A 4HD5A 3EYQD 2G5UA 3UO1L 4Z18A 1DO6A 1CGVA 4WWNA 1BAFL 1HWWA 3FB8A 4GG6F 4UTBH 4J6RH 1WRFA 1WBXA 3V4PH 2X2UA 4P46A 1NAKL 3A47A 1GL4B 2P44B 2QKIC 4KHTH 5LBSL 3SCMA 2R69A 1QNIA 3ARGD 2VT0A 3B2DC 1UFUA 1R24B 4M93C 1NCOA 2G0LA 4HK0B 3ULVD 1A8JH 1PSKH 3OZLA 1C5CL 4Z0XA 4MVBD 3BAEH 4BFFA 3LVEA 3I02B 4LRIA 4JFDA 1O6TA 3QH3A 1TQTA 2ZJSH 3MU3A 3OMAB 1SDAB 4LOEA 4NRZA 2YD0A 1P7QB 3HUJE 3RGVC 4IW4C 2CJUL 3FU3A 4CVXA 4EUPG 1ZSDB 2JTDA 1D5ZA 2H0PA 5AZ2H 3ZO0A 4FQIH 5IVXA 2L04A 3OLEA 5G55A 1HQ4A 4NKDA 4YBLC 1CGUA 1GJIA 3D52A 5I16B 3P0GB 3JTSA 3WJLC 1DBBL 3VDCA 4M7ZB 3ZDZE 2LOEA 2PR4L 4PJ9D 5DI8A 4BSVA 3WFEH 2FHBA 3IMRA 2WLNA 3JWDH 2X89A 5G2NA 5B7MA 4C56D 1B9KA 2GSGB 4ZUWB 4BH7B 2O5XH 1SHSA 1W6LA 5I17A 2I7OA 1E4WH 3U46A 1W15A 3M86A 5FX3A 2EDTA 2FCBA 3WLBA 5C9JB 3HI6L 4HPYL 4ZFZA 2FEJA 4M43H 1BZ9B 3FH5A 4MASA 4HCRH 4L8CB 4P2QE 3QNZA 1TNNA 4U6XB 4PG2C 1R5IB 3ETTA 5L88H 1A6ZB 4GW1B 4LLYB 5HYQB 2ZCLH 2PLTA 5ALBL 1CN4A 1HI6A 1QWHA 1TEYA 4AQAB 5B3JF 1A7QH 1SFDA 1JI2A 4RRPM 1PZ5B 4L18A 4EPSA 1BQHB 3ET9F 4ICWA 5LG1A 4LF3B 2ZX7A 3EZJB 3KS0H 3M45A 4P05A 2NZIA 3IKCA 4X9GA 3BIAX 5E2UH 5JR1H 4V1DE 1EFXA 1MIML 1YMMA 5DHMC 1E9QA 2Z35A 4X8GA 3QIWB 1I1FA 1A0QH 2WUBH 2AFNA 3GMOB 3ME0A 3ZMRA 3W37A 4IBVA 1YEDB 5E08H 4JPWL 5AYQA 3MBEB 2F74B 4L4TE 1Z7JA 4PJHF 4LL4A 4F7TB 4CN1A 4TN9A 3D48R 4Y4KA 5LBVA 4GXFA 4S1RH 5DGRA 2MJWA 3GDBA 4DK6A 5GQBA 3UYRH 5EF2A 5IGXH 1WAAF 4F1ZA 4M5TA 3M07A 4GINA 4HS8H 4ZUSA 1MEXH 1TJMA 2NYKA 1Q0YH 4G5ZH 3TA3C 4P46D 2AS5M 1E4XI 4LK4A 4HD9A 4YSAA 3N42F 1KELH 3WSQL 1MCBA 2ZKYA 2ZUSA 3P73B 2CM5A 4KK6C 4PJ8A 1TCRB 3DPBB 4X4MA 1F8TH 3SKOB 4M1GL 3GZPA 5C2BL 3L3KB 4Y19E 4U7SA 5KYNA 1A1NB 3ZHLA 4N90D 1IGIL 5FECA 4R5XA 3L2NA 1E42A 1BEYH 3FU5A 5IB2B 1JRHI 2G5BA 1P5UB 1A02N 3HIZA 1J11A 3GJFK 3B7TA 2BJML 1R5VB 3OGOE 1IGTA 4HH8A 5CR1A 5DC0A 4YHOL 3WIFB 4JPSA 3UP6A 3CH1B 3OKDB 3L7EA 4L23A 4HJGA 2JJTC 3LS4L 5T5NF 5ISZA 2HRLA 1HWGB 4H8WH 1H6EA 1N64H 2XX0A 4WEBH 1KN4L 1BIIB 2WUCH 1CTMA 2XVGA 4AEFA 1T2QH 4FAAB 4LSDA 3TURA 1DL7H 3KXFD 3UERA 1S78C 1J5DA 2PN5A 5I6PA 1ZVSA 3A6BL 3AS2A 5AW2B 4U49A 1DUYA 2VDNL 4NJAH 1VHPA 3OGCB 2QVFB 1ZWIA 4YZFE 2V5RA 1S5HB 1REIA 1A4KB 1NDMA 3PDOA 5BW7A 1E9OB 3WMQA 1D7DA 3AQXA 2KL6A 3E6FB 4JGJA 1XAUA 4AMWA 5D7HA 3O3DB 1B90A 3KVQA 1JFQL 1IFHH 3GK8L 3X3GH 3M17A 3TTSA 3HHRB 2H0EA 4BZ1H 1OKEA 3IMSA 5D8JH 4ZX6A 1OAKL 5CCHE 1UWGL 3V52H 1M3JA 3LKPA 2GJRA 3M8OH 4WHCA 1ORSB 2VSCA 3LEXA 4DCQB 1U21A 1FGVL 2IDSA 3KLDA 2UY7B 3KPTA 2APWA 2PPEA 3VWKC 2YPLE 4HJJH 1QG3A 1IGJB 3FRUB 4RDQG 3RWEA 1YMMD 3LV3A 3D0LB 3NT0A 1G1YA 2N56A 3U9PL 1V7NH 2Z93A 3RY6C 2H45A 3CN1A 3K46A 3WTTA 3KH3A 5IMLB 4GKLA 2QPDB 4YZWA 5EORL 2ZOLB 2BSCA 2EUVA 1ZJBA 4KKRA 4TL5A 2CSPA 3V4VA 5TDNB 3D1MC 4Y4KD 2Y36H 5EUOA 3MXVL 1J87A 2H6OA 1JPFA 4M62H 4WHYG 1D2PA 3QDHA 4RGNB 3DX3A 3ZTDC 4NN6B 2VQ4A 1M57B 4CA4A 1HS6A 2PP7A 1E5AA 3C6SA 1SXZA 2J5WA 2MHAB 4ZOCA 5GS1B 5FB8A 5KVFH 3KLAB 4WTZA 3FXIC 3VX1A 3K6DA 3W5NA 4DTGH 4M1CD 4OQTH 8CGTA 3PPSA 1NCJA 2IGFL 1AYOA 5D7IA 3LZLA 4PJ8D 3LMJH 1CFTA 4WUKL 4MQ7A 3GEWB 1COBA 1S7SA 2JKJA 1FBIH 3LAFA 2XY1A 1RK0A 1NFDE 3AY4C 2H26B 3N85L 4OD2A 3M1CA 2WXPA 1OP5H 3UJJH 3BMVA 4HJ1A 4JO1L 4LQFL 1NL0L 2LLGA 2OZ4H 2OQJA 5JUEL 2Z34A 1SGKA 5DDHB 2IPUG 4FS0A 3GLAA 1JNNL 3H9ZA 4IM8A 3KGRA 3OSVA 5C07B 1RUAL 1P6FA 1DBKH 1PLGL 4HIJA 2DL9A 3HN3A 1YN7B 2WSPA 4KZDL 3CC1A 1E2WA 4MD0B 5C0FB 1S9XB 1N5AA 1FNLA 2PMZA 2IDUA 2KT6A 2ZUWA 3ERXA 5ISZD 3ZE0B 7FABH 4AK2A 5JW3L 1E4JA 4QGYA 4WWOA 4F15C 4F7CA 3MOBL 1SFHA 4WUUB 5KSUA 2NXYB 1CXKA 3QHFL 4RISH 5BRZB 3SOBL 5CJOL 4J3OC 1E43A 4BFJA 4JFEA 4OCNC 5DF0A 3VFOA 1I7ZA 3CV5A 5JW4N 2I69A 2ZX5A 2Z0BA 1C16B 3PHQA 4I1RA 4XPTL 4FKEA 4YDJA 5TPWH 4Z3GA 2NT0A 5DJAB 3SKNA 4PGEB 1KTCA 2L7JA 3FFDB 4NZRH 5D7EA 3WEXA 1BBJB 4JO4L 3DX2A 2KC0A 3QUMA 5CMAB 4OZFA 4QOKE 1OAXL 5DMJB 5JOPE 1KXTB 4APQB 2XFXB 4PG9B 2AP2A 4NHCH 3JVGA 4DFHA 3O6FB 2F19L 3BPOB 4GG6A 3L95A 2JJWA 3KPSB 1XZWA 2PETA 2FAUA 4IU3B 4QGTA 5J9PA 1R0AH 4YHYC 2AK4A 4UZSA 3L3GB 2L3BA 3MLRL 3T6VA 3UADA 4A2EA 2F54B 1HKLH 2NR6A 2GI0A 2IXQB 1MRCL 4XXDA 2NXZB 2EVGA 2DS4A 3PNRB 4YHIB 5BJTB 3ALXA 4DP4X 4UM8A 3HFML 2BSBA 4OZ4A 2VDMH 2XBDA 1IC4L 3TFKC 1P5VA 1ANUA 3G6JE 2VLLA 1IILE 1MFVA 2BNQE 3GSWA 3L5WB 4M48H 3ARBC 1AS8A 2DMBA 3RVXD 4BZ2L 1BZ7A 3QFJB 3DOHA 1JK9A 4W6YB 5TQ2L 3QJFB 2FX9L 2YUWA 5TE7L 2OMVA 3ULUC 2ADIB 4K7FA 4J4PC 2A99A 1F90L 1MCHA 4YQXH 2IMMA 1J1PL 5INCA 5B39A 4HUXA 1U93B 4YHPA 5EU5A 4LLMB 3AQDA 3X3FL 4Y5YC 4CW1B 2WLKA 3UDWA 3MZGB 5C0EB 3MACH 1JF5A 4R3SA 4K5OA 3EH5B 2I32A 5AALA 4MA3A 5D4HA 3K6OA 3FS9A 3BGMB 4HBCL 4YBQC 2K78A 5DJ6B 2VDQB 1KTRL 4KTYA 2ZG3A 3U6RA 2VZ3A 5GS2H 1IAIM 2EYTB 3UO1H 3QZBA 3DIFB 4PHXA 2BLFA 3QUYC 2R69H 4GI8A 5KS9B 2CLZB 4JUTA 1I8KB 2W59A 5E9NA 4PLNC 1TVHB 4EE2A 4Y1SA 3BQVA 2W5PA 1NC2A 1SOSA 4PRBB 3BESR 4NC1E 4LL1A 3P3SA 1KCSL 3VTTA 4Z7UB 5I1DB 1MCLA 3S3DB 2UXVA 1C8PA 1J10A 4H5SA 1ILSA 5C0DA 1OD9A 5GGRY 3VU1A 2TSBA 5JPNC 5CWSB 1ZV5A 4JFED 2IBBA 2D3NA 2XG4B 2NZ9C 4Y2NA 1QFWH 3SQBB 3FQXA 2JB6A 3N1GC 2VL5B 1UWEH 5IROD 3AMKA 4Y5XA 3MNVA 2CJUH 4J1UB 1E6JH 1FLRL 2OTUB 1V3JA 3QC6X 4PJHA 3C5JB 1CQYA 3PREA 2XWBA 3IGFA 3JQOB 3MODL 3PL6C 4RWYH 5DMKA 5DUPL 4PRDB 1NJ9A 3B2MA 1ZT4A 3IXAB 2VZ1A 4A55A 5EBLA 4XPHL 4JANB 4HISA 3VFMA 1WAAA 4PV9A 3S3BB 1ZLWH 3ZGIA 1OAQH 2R4SL 1XH0A 3GZQA 3WKML 5I6KA 3SE3A 3II2A 4NDMB 2A0LD 3K2UL 1NM9A 7TAAA 1YEIL 2IDQA 3IJSB 3COOA 3T0WA 2AK4D 1H0DA 1EXUA 4ALAC 4WNQB 4M5YL 2NR6D 2Q3AA 4N0FA 3CBRA 1YNLH 2GYSA 4AE1A 3UTTE 4XXWC 3QSKB 3GI8L 3HI6H 4I88A 1CB4A 4I18A 2KI6A 1XB8A 3DIDA 2BNRB 3NYKA 4PJGE 2MCPL 2JNZA 1UM5H 4G7RB 5E4IA 5HHMB 4JY5L 5ALBH 4IOFC 3US9A 1OALA 1ADWA 3O4LB 4N8PA 4U1HB 5FGRA 4NQCD 1XAKA 4AXWB 5KWYC 1ZMYA 3MLYL 3S8FB 3TH4T 2V2WA 3HUJF 4W81A 5JLZB 5I6MA 1PY9A 2PPAA 3MRHB 3DX1A 3K71A 1AQDA 1H19A 3OAWA 5KUKA 1MIMH 2BINA 4PI0A 3TV8A 5EEYA 2CO4A 1JERA 1AGEB 1VIWA 3GDCA 3FUMA 1AGFB 3H54A 3BP6A 2Z7UA 4XHQA 3VTAA 4MNHB 5D4IA 1WCBA 3ZZ1A 1KJ2H 1OTUC 2GG1A 5FYJD 1KPUA 3ZDZF 1G7HA 5HI4D 3W39A 3TEUA 3LQZB 4OIAA 4NFDA 4BWWA 1PJ9A 3X1NA 4OCYL 1O6VA 2OI9C 5D4JA 1VPOL 5D7KD 4IHOB 4UM9A 3UBXA 3DVGA 1QBBA 1RZKC 4YC2B 4HW6A 2E56A 1FYTE 1KYFA 1WFIA 5FKPA 3WJJA 1WFJA 1NC2D 3WSQH 1YEJL 5C71A 4AZ8A 1ZGLB 2H5UA 4MZ3A 1OARL 1ZT7B 4M1GH 3E8VA 4BFGA 1RPQA 3LS5L 3I6SA 3K72A 4MA1B 5C2BH 3S8WA 3MA7A 1TTUA 3H7BA 1IAIH 2JKTM 3BP5A 3II3A 4CMHC 4WK2B 1TQBC 3ILPB 4PRPE 2HN7B 1CI3M 2Q2LA 1SJXA 2AJUL 3ATFA 4N8VG 3LHAA 5DTFB 5AWNL 2WXRA 3D69A 3INUH 2D7QA 4YHOH 2KKQA 4MSWB 4AI7A 4OW6A 5E94B 3EGSB 4Y2DC 4Y0GA 1Q9LB 4YSSA 5IHBA 5C0CE 3G04A 3LS4H 4N22A 4DKTA 3AU1B 1JZEA 3VUAA 5EIIA 1KN4H 3D4CA 1G6RA 1RPKA 2K3TA 2LTQC 3L3OB 2EP6A 1U3NA 4CN4A 4PJXE 2AABH 3APFA 2WBJC 3NSCA 4F9LA 2AI0L 4P5TB 2Y69B 2ZXBA 1WD9A 4GEIA 4WU7A 5BZWA 3STLB 3DOSB 2VDNH 3PGDA 3VFGL 3ZE2E 2OTWB 4JRXA 3S36X 4WSJA 3BAKA 1IKOP 3FQ2A 4JHAL 1JOIA 3BVNA 5DZNA 2JJSC 4Q6KA 2UY6B 2Q8AL 4P59L 4URKA 3QORB 2Q86A 2JWYA 2P49B 3OHMB 1FNGA 5JMRA 2IWEA 2YIHA 1T66C 3BN3B 3R1GL 4CC1A 1JFQH 3C5ZA 3GK8H 1UJ3B 4DNLA 5AOLA 3F7LA 4UOZA 3PV6A 3RWFB 3O9WC 1TSRA 4EDXB 1UCTA 4PHZA 5LAXB 3WIHA 1OAKH 1W72B 1KACB 3HAEB 4FFZH 5KANG 2XTSA 3VMPA 1K4CB 3NGBB 5I1LB 2BVUA 4XAKD 5ICYB 1FO0A 2PXYC 1AXSA 1FGVH 1B2WH 4KK5C 3QWNA 4LSVH 2EXWC 4NUGH 5F0JB 5FM8A 5TK4A 2NLJB 4R0LA 5CCKL 3KEHA 3C6LB 4LEEA 2BFVL 5C0BA 2B1AL 4HA1A 1WAEA 3MUUA 2UZYB 4PV8A 5IUSA 3U9PH 4I0KA 1VACB 3B9KC 5D1QB 5KYYB 4CBPA 4EIGB 5DQJA 2AV1B 1M9WA 3U2JA 4XVSL 4X5XB 3AREA 3V0VA 4F93B 3LEVL 4KI5C 4JM2C 4GSRA 3GRGA 3EO1B 5FV1L 1GYWA 3MXVH 5IQNA 4JKKA 3JV5A 5JIHA 2XT1B 2CJ3A 2P9RA 3GJEA 4YZFF 1LTXA 3ORJA 3UJIH 5BNXD 2YAQA 1D9KA 4KXZH 4P5MA 3S37L 5KEZA 2JF1A 1H3GA 1HHIA 3PWLB 3QJHA 4OU3A 4NQDE 4XP1L 4AMKL 3VGEA 1PG7X 1YQVL 1YY8B 3BOVA 4Y4FA 5LO7A 5JOFB 3KLHC 5I75B 2AK1H 3H2QA 1YEHH 4R2GC 3LRMA 5L8KB 4OCRL 5DO2D 3GHBH 5JNYB 3G08A 4OCXH 2VMFA 2ZONA 4L3EB 2X5PA 5EPMA 4RQQB 1IUZA 5I19H 3QNXB 4JZOA 4LSUL 4NB7A 1NMAL 5C09E 2VISA 5DMGC 4GBXB 3WY4A 4HOZA 1MH5B 5JUEH 4Z6AT 1IEAB 3QULA 4FXGC 1NFKA 3BSZH 4G9DB 4P57A 1RUAH 5AW6B 1PLGH 4KZDH 1AD9B 2AV7B 4R9HA 1J05A 1MCQA 4Y2OB 3SQOL 2Z91B 3V5HA 2F7IA 5JW3H 2HLFD 2CZNA 3EYVA 1CLZL 1UKQA 4JK0D 5IF0B 3MJ7A 4X9HA 2R59A 5CJOH 1E8XA 1IAKA 1UB6A 1TLKA 1W8EA 1LMIA 5HHOB 2DAVA 5CZXC 5EO9B 3IETA 4JRXD 3UAJC 4HKZA 3SPHA 1PYWB 3OB0H 4HHAB 2BIIA 4IRZL 1UVQA 4P2AA 5HPMB 4KXCA 3AG4B 5JW4Q 1KN2L 2G60L 4JO4H 3FCBA 1SQMA 1K9TA 1V10A 2GFBB 3C5ZD 3PGCA 4QTHB 1RV6X 3ZDYE 1A9EA 4JPKL 3BUPA 3SGKA 1LJMA 4GRMA 3NDYE 3V4LA 2ZKHH 5ENWA 4ANUA 4EJ1C 3IM1A 3MV9A 4FTVA 2D7PA 3Q06A 1NFDF 2HMIC 3FUJA 2X4RB 3T1FA 4BV1A 2EO7A 2DIAA 1EGJL 2WVVB 2R0KL 3OHXC 5DLML 4L3CB 4NCC1 3QIUB 2HG5A 3F04A 4D9QE 1KBWA 5AW5B 2EE6A 3RBGA 1XFPA 4PSPA 5C8JA 3CQFA 2VLKE 3QFGA 4CSPA 1F3RB 5C0BD 2NCEA 3HPJA 2F58L 3IN2A 1IC4H 2ZX9A 2P5WA 1IIKA 1RUPL 1TKWB 3FHQA 1MY7A 3RAJL 1G6VK 1OAYL 3O3EB 5KBPA 2VMJA 4BZ2H 3ZL4L 3ARED 3X11B 4MBOA 1P4LA 4HEPG 4Y8DC 4B9PA 1DBML 3Q3GA 3SYPA 3FTUA 5JPMB 3I6KB 1UWFA 2CNYA 3B9DA 3BKYH 5CINH 5F21B 4B3VA 1JV2B 3U30C 1F90H 4JDVA 5MERB 5DXWA 3MLXL 1KLUA 3FUFA 2ZXGA 4HWUA 2FZ3B 2CRYA 2D03H 4LL9A 5F1IA 4JFHD 4AC4A 1CG9B 3X3FH 4D9RD 4Y89A 2LW3A 1ZVHA 1YLBB 2DM3A 3MRLB 4L1TA 4L37B 4Y4FD 2BO0A 2IH9A 2XXGA 4KKQA 3Q6FB 2RQ8A 4WAFA 5SWSA 4DZ8A 5LQBL 3C8KB 3RTQA 1FYHB 2VB5A 2NUTB 4HBCH 4ZOEA 5IHUL 1A5FH 4EDWL 3GJFA 2KZKA 1S7TA 2B1OA 5E00A 4G1EA 3HOGA 4F2EA 3PAZA 2WXGA 3CE1A 3QZWA 4ZAKC 5CD5C 2EKJA 2JKLA 4XMLL 1K2DA 1Z9NA 2I60H 2WINB 3DX9A 3VFNA 5K59E 3RDJA 4P3CL 2CAKA 2M83A 2BP8A 2I9TB 4HAFA 2QHRL 1LO2L 2MQCA 2NYZA 4LP4A 5EO0A 4AW7A 5H35B 1XVSA 2XWXA 1F58L 1SVCP 3HE6A 3MV8E 2X4SA 3WEBA 1JV5B 1OB1A 3G6JF 4ZZKA 1KCSH 5JOEA 4PLKD 4WWPA 2JQAA 4X98B 4OJCA 5ICXA 3ZIMA 3O8XC 4Y4HB 3HUJA 3FTGB 3GNML 4R4NC 1UXWB 2FJHB 1OTTD 5AVQB 3VXRB 4V33A 5AW3B 4PJ7E 3WELA 4L3FA 2VC2L 1A2YA 5DURB 1IGFL 3TWCL 2ZF9A 2YD1A 1NCUA 2WTRA 4DPCX 2D4DA 4Z3EA 5JMOC 4KNUA 1FLRH 2GITB 2W65B 3MV7E 3RKDC 1GJWA 5CBAB 4ZTPL 1JZ7A 2YAEA 3NEXA 4XRCA 3QGVA 3FO0L 3V0IA 5I0YA 4XE5B 1P4UA 2ZCHL 1WUZA 3DMMD 4ODWA 2R4SH 4WW2B 3QRGL 3MV9D 5FKAB 3WKMH 2YRBA 4FTVD 2YUZA 4XWOC 1UZ8A 3K2UH 3SDAC 3VXUD 1M6OA 1YEIH 5F3FA 4R7XA 4Z76B 1CIDA 4FG2A 3B5GA 4M5YH 2ZYHA 2OSYA 3H3PL 5C3TA 4LKCA 2EUZA 4HWZA 5AVTB 3D0VB 3GI8H 3KPMB 3NEOA 4X6EA 1NAMB 4G9FB 1E40A 2BVPA 2JCWA 5L2KA 2ZUQB 3FH7A 1WIUA 1ZA3B 3HS0B 4Y9GA 2P5WD 3NQIA 1G7LA 3BPLB 1JVOA 2HT3D 3JTTA 5C3IA 4JY5H 2WKLA 5EEZA 1HESA 1WG3A 3AWGA 2BW4A 3R8QA 3JWNC 4IKJA 5I71C 2IDCA 3OQ3B 5J11C 4W9CC 1OK0A 3CLEH 2WWMD 4NUMA 4JY6A 1LE9B 5E23A 4JO8A 4Z7VE 3EYFB 1KCUH 1KCRL 3D8MA 2XXFA 5F3BB 1U42A 3MLYH 1QPPA 3S5ZA 1CDIA 3E2HC 5HHPB 3WD5L 3MQIA 3AABA 3IJ9A 3GSNB 4FFWC 4NFBA 5T8IA 3O6LL 1N68A 4A6YB 2NY6C 2W9LA 4PVLA 4CJ0A 2JSFA 4XN5A 2IJ0C 4NO5B 5DD0L 1HAWA 5SWSD 1F2QA 2VMCA 5FYKH 2Q76B 3RWGA 3VH8A 5EZLB 1EZUA 3RTQD 1XH3A 3QEQB 3RVVD 2JCCB 1QRNE 3NZSA 4APXA 4JW3A 3CG8A 4OCYH 4HK3J 4FFVD 4RFEA 5HHXL 1B4RA 4XOCA 1I1YA 5C0IB 1VKXB 3KWWB 4PRIE 3TYFB 2YAFA 5CGTA 1TMCB 2BCKA 3QB7C 4W4OC 3ULUE 4ZXBC 1HL9A 5IFJA 4ZG1A 1YEJH 3HE6D 1I3VA 4PJGF 3SGDI 5HDQL 3T04D 1DCEA 4K3EL 1OARH 3AS1A 4P9HL 3LS5H 1QO3B 4LCIH 1IKNA 4X7CC 5EF3A 4IRSC 5C0AA 3FOMB 1WA0X 2Y7QA 3DUUA 4NWUL 3QYMA 4FI7A 2X4NB 5CJBA 2XWRA 3CCHB 1XSIA 4IMKA 3UGUA 4WJ5A 4KJPC 2X87A 3W11D 2IOIA 2A7BA 1SNRA 3CZFA 3CDYA 1SVZA 2PCFA 4X7SL 3H85A 1DE4B 3BISA 1AKJB 3RFZA 1JIBA 2XDHA 1KYUA 1SJVA 4C83A 5B8CC 1A6VL 1KTDA 3ILQD 3QK0A 4JO3H 3C9NA 5FUZL 5IJVA 3D51A 5B3SB 1KCKA 1J86A 4S2SA 4KOBA 5GGTH 3ZYOA 5ANMB 5ES4B 1RZJL 2M1KA 1JZHA 1JK8B 3N41F 1UA7A 3FN0L 3HRZB 5E4EC 5LB1A 2WAHA 2WWNA 4WSGA 5D7LE 4UMSA 5I1CH 2HTLD 1MF2L 4X5WB 2Q8AH 2Z0UA 4ZK8A 4P59H 4JPIB 5FYLL 1U8CB 2APSA 5I6OA 3C60A 3DK0A 2EC9U 3LDBB 4FNPA 4G11A 5L2KD 3N40P 4JQVA 4MD5B 5KJRL 3LKNA 1H3UA 3CDFA 5A3IC 1J0YA 1UD3A 2J1YA 2P7TA 3ZQ9A 1FO0H 1I85C 3MOAH 3NIDB 4LEOB 3FO1A 3PABA 1QBAA 1URIA 2YPLA 4PRHD 2OPCA 4ACTA 2E86A 4AQ1A 4MJ6A 4TUUA 1HYSD 4YDNA 4ABUA 4I3SL 2A74C 2AEIT 5CCKH 5ECGA 5D1ZA 2W60A 1GIGH 3FCSB 3VYOA 1H3PH 1QOKA 2BFVH 3IRZA 3MLVH 5CEZE 2B1AH 4MCNA 1PD0A 1TYJA 3IDYC 5K5YA 4GI9A 3Q44A 2A3TA 3KYNA 4XR8C 3F12A 1YEWA 4QHMB 4MKTA 4RAHA 4JCMA 3TFBA 3M46A 1Z32X 3P1VA 5BPPA 2WBXA 4GI6A 3OJ2C 3V4PB 1S4IA 1QSFB 1M7DB 3AGVA 5F6HJ 2KH2B 1CPUA 3CDZA 3UTSE 4GRLB 3ALPA 3BSHA 4D8OA 1MFNA 4HUVB 3ZE2F 4LNRA 4N2BA 1Z9OA 1GYAA 3BD4A 3G5ZB 3WTUA 2APVA 5EO1B 2C7UA 4YSOA 3SY0B 2X1OA 4AMKH 5C1MB 4NHUA 2QGCA 5CD3B 4KFZC 3RX5A 2PKDA 5J13C 4M8RA 2DQDH 2VQUA 4N2CA 2AXGB 2BP0B 2VE6A 4HFUH 1RZ7H 1JZ8A 4OI8A 3DX7A 2B08A 5FOBA 4IEFB 4HCIA 1J0IA 2HKHL 3VGBA 4HWBL 1T89A 2C4XA 3WUWB 5IBLD 4JBSA 3L2MA 4AM0Q 1MI5B 1T20B 3LNDA 4ZPVB 4X6FA 2MQGA 3BWAA 4PB0L 5SWZE 4LSUH 1JZ3A 4OJAA 1IZKA 2IV9A 5IREA 5DS8B 2ZSVB 1PZSA 1F1DA 4HKXB 5C0AD 4OLZL 5EF0A 5JQIB 3TYGH 1UZ6E 4NZFA 1LO4H 5F1KC 3D39E 3GSOA 5LGKA 4L8SA 3BEWB 1KXQA 3UBFA 1NEZA 3ECBB 1BFTA 2NW3A 3B1UA 3SQOH 4OFVA 4WV1A 3QJRB 3SGJA 3GMRB 1BJ1J 1BMZA 2R7EA 4IBLT 5FCUL 3WTSA 1SXNA 4Z0BL 1VGKA 4NQEA 2LLLA 1MHHB 2D31A 2D73A 3MRMA 2VAAA 2A6JA 1W9XA 1CE6B 2GBUA 3UL4A 3OKOB 5KVDE 3BN9D 4QOKA 3VCLA 3FULA 3V0JA 4LOVA 3VFSB 2DYPB 3BUBA 4AQEB 3DTXA 5HD8D 1HILB 2HLAB 3HS9A 2UX6A 1GZPB 5FA4A 1OE3A 3TO4B 2HFFA 3W56A 3C60D 2Y5EA 5B7FA 1IAOA 2X6UA 4YDVA 4DO4A 1EHLL 1XXFC 2LU3A 1ZLUK 4YFLI 3R0NA 4S0TD 5LVEA 3U2SA 4GH7B 1GKOA 4NNYA 4ZX4A 2R1WB 3L4UA 3DXAD 4MNQB 2YPLD 3AJ7A 4JRYB 4NRYA 3VI4E 5MP6L 5AKRA 1XR8A 1ZA6B 3APCA 3JWOC 1EGJH 3REVA 2FQGA 2BY2A 3ZL1A 3KDMB 2DEYX 2HPOA 2PYED 4N26A 4XP6H 2YGPA 2HKAA 3QQ9C 4N28A 3ZKNC 1PG7W 5E8PA 1MJJB 2EIZA 1BFSA 4N68A 2F7OA 4CGUB 2YXMA 1DQLL 3QARA 5ESVB 5GRWA 5BO1L 1NOFA 4XN4A 5GPRA 1P84J 1A7RL 3NAAL 3TN0C 3RAJH 5D55A 4WO4B 4ADJA 2V5YA 3VXPB 5KSAB 4OFYA 3X12B 2IAND 2AERT 2DMGA 3PLYA 3LSOB 3KPPB 1NPJA 6PAZA 2EYSB 5IB1B 3A0OA 1J8RA 1ZS2A 3EOTL 5DJ8A 4ZPTA 3RNKB 1GSMA 2CKBL 5EZJA 3KAAA 2UYLB 3ZDYF 3M1OA 1HQRA 2DN7A 2ZXEB 1OT2A 3F65A 5LKNA 1HHJB 1SOXA 3CSFA 3DTUB 2FRGP 1DQJA 1RIVL 4O2EB 4WEMB 4EDWH 4BH8B 4EI0A 4XNXH 4W9ZA 2OKMA 4C8XA 4JRLA 1T4KA 4W9LC 5HHVH 1PAZA 1U6AH 5IKCA 2CLVA 5IEHB 2XKUA 3DSFH 5IHHA 4KI5E 4UIKL 4G43B 4LLVB 4R8WH 3EGXA 3QRLA 5DMYA 1S7XA 3CFBB 3O3BB 2KLRA 5BQ7B 2O6FA 4H7VA 1UH2A 4CVWA 1F58H 1SYVB 3AROA 3C6EA 1OE2A 3WEOA 2ZAHA 4HKJA 2C9PA 4WEEA 2VLJE 1FV1B 2E9IA 4XMPH 3FF8A 3T0VA 1FHNA 4NQED 2QADB 2X09A 1MNUH 3GNMH 1T6WA 3MBWA 4NKQB 5HY9A 5KVEE 3LB6D 1ZTXE 4XCCL 5ID0A 5CIPA 3QDGE 2FUQA 3IU3A 3A4EA 3PP4H 4QOKD 1WUNT 3CHRA 1YNTF 5JOPD 2Z31D 5M7QA 1PGRB 3P0VL 1J8HE 2X9YA 1EHKB 4OIIL 1KCVL 1SLUA 4BA8A 3L6FB 4BINA 5A2CA 3RUGA 1TOXA 2P8LB 3RVWD 2CIKA 4DQOL 3DX6A 4S1QL 4NNXB 2I26N 1JP5A 4R96B 2PPDA 2ZCHH 4KRNA 1OSZA 4DP7X 2DQFB 2D7NA 3Q2CA 2E46A 4PJIB 3G7TA 3QYNA 1LEIA 3IAQA 1JVLA 1YY9C 2LGNA 3SJVE 4DK5A 1T0NB 5HDOA 15C8L 2CHNA 2EDLA 3CFMA 5I1GH 1EEQA 3UTQB 5K59F 5HYJB 1VFBA 2Y7MA 3NSXA 3AW5A 4ODHL 3VXNB 4S11A 5D7JC 5KZCB 3BVWA 1MWAA 3LD8B 4P3DA 2GAZB 4UCFA 2OJZL 2V8LA 1IM9B 5IBTH 5CEXA 2V33A 4UDTB 1SDDB 3UXFA 2FIKB 4LHUB 4FQXD 4CILA 5LBSA 4JFYA 1MFAL 3FO9B 3RLSA 1CFNB 1H9VA 1QP1A 1KBGL 3FKUS 4OFYD 1BJ1H 3L54A 1S6NA 3QUXC 4PJ7F 3K8MA 1EMTL 4KROB 1KCRH 2C3VB 2XNAA 4H0IA 3SOTA 1HINL 4PMFA 1PAMA 1R3JB 4MJIB 4OLWH 5C6TH 4ZQTA 2NY1C 2X4OB 3ROLA 2H41A 1U9KA 2RCSH 1M1XB 4NKMA 2WLZA 3RVTD 1UH3A 1CGXA 3B34A 3K4DA 4DZBA 5J12B 2HA1A 1AGDA 4G8GA 3ZU8A 1FYTA 4AYBA 4GUOA 3REWA 2K45A 1F4WL 1LK2A 4JE0A 1IGML 4AQ8C 4ATWA 4LBEB 1A3LH 2ATAA 1TITA 3NH7L 2EADA 4UOQA 3UYPB 5F1NB 2KLSA 3FAWA 2EVHA 4OIFA 2BZDA 1AZVA 3KPQA 4ODTL 4J3OF 3S4SB 1BD2B 1I8LC 5CP7B 2HFGH 2UZIH 2J8UE 5CJQL 4G82A 3BPCA 2WIIA 2NY4B 2ODIA 2ATKB 5HDQH 5IHLB 1NCNA 1H6FA 1J9QA 4FA6A 3GXTA 2Q3XA 1BXXA 5I8KL 1MFEH 2ORBL 4JGMA 4P9HH 3VFWB 1DEEB 1XF5A 4OF5A 4GAFB 3KYMB 4O2CA 5A2AA 3MRIA 3FFCB 1MHEA 5TFSH 2DWXA 4Z7VF 3KPRB 5H37H 3ZL2A 1U41A 3MCKB 1TZIA 5EOTB 4DESA 4CUCA 1R19A 5DZJA 4LLAA 4X9FA 4I5BB 2JTYA 2VN7A 1C8QA 4YFDB 2D0HA 2XVLA 5GJTL 4X7SH 2GTZA 2V9UA 4G8EA 2ZWLT 1RH8A 2Y5TA 2CO2A 4L8DB 4BSWA 1RZIB 1H9DA 1DJHA 2FH6A 3GSRA 2X10A 1QFWI 1KJMB 2YAHA 1CURA 2WNXA 3PHOB 3MGTB 2VDMB 2C1PA 3VXMB 4ELKA 3HB3B 3DK2A 3WE6A 3ABLB 3ZE1B 2BH0A 3O3AA 3UCQA 4K7PX 4GAJL 5JIQA 1LP9E 1BOGB 3HI1A 4QIRA 2YN3A 3F7VB 2E47A 3THMH 5HHNB 1A7OL 2EICA 3F2LA 3CVIH 3ULUF 3TVMB 4BD4A 1B88A 2F2HA 1F6LL 1U8OA 4P4KB 1WWBX 3H9SE 2MTAA 1L0QA 3IGUA 1NGYB 3NIFB 2CU9A 3I50H 4KXDA 3IDMB 5JZ7C 4F7MB 2X53A 1HSBB 1BV8A 2COQA 2W95A 4LSRL 1ZVYA 2CHWA 4I3SH 3UZEC 5B38A 2ADFL 3CTTA 1WFMA 3EH3B 1SDYA 1TIUA 3P3TA 4BA0A 3DHUA 1PTZA 3BP4B 5AD0A 2D7MA 4ONFL 1XGZA 4EI5C 1FC1A 3DI2B 4XNZB 43C9A 4KJQD 5CN2A 1HH6A 4FE9A 1BVNP 3CGTA 3SCMB 1SUJA 2VR7A 4RIRA 4GIOA 3L9RB 5E6IC 1PQZB 5HI3C 4G8GD 1KUMA 1FRGL 2NY5H 1KEML 3F05A 5I1IL 5KYXA 1FPTH 5MEOA 4ODXA 2MOVA 5T3XE 2VN3A 4F91B 3JWNE 2F53B 1J5OH 2DQ6A 4JFDB 3QH3B 4TVUA 3SE9L 2IFFL 2FBJL 1MFBH 5F89A 2A1WL 1VFAA 5C09A 5DD3H 2HKHH 3AY2A 3CVHA 3OX8A 4HWBH 2MCAA 2XFGB 3LQAH 1MFCH 3R0MA 1JHTA 4NKDB 5DWUH 4A2HA 5I18H 4I13B 1G5GA 2OR7A 1OQXA 3CUPA 4UBDD 3JTSB 4MKMA 5I74C 3SDDC 4WDIB 5J6GB 5DI8B 3L4VA 4QEGA 3N1FC 1SJEA 1ZHKB 5CBEB 2UVEA 1KTLA 4FNRA 4K5PA 1TVDA 1LEKB 2ZAIA 1SEBB 3MRQB 1BSIA 3HCVA 3KEDA 2A9DA 2EXYD 1WWWX 2QZ5A 2VITB 5FCUH 5FK9A 1XR9A 1IAII 4HLZG 3P2DA 4JHWL 2C9QA 4S1SL 4F2ME 5IHZA 4R7NB 2QGEA 5I28A 4JM4L 4KKCD 3QNZB 4XN2A 4NC2B 4ODSH 3K6SB 4U1IA 3SBWA 4QXTB 1EAPB 1BQUA 1RP8A 1TSHA 3TEYA 3VG9B 3CPLA 2VDKL 3ASWA 2QT6A 3W38A 4YSRA 4DKFL 4AK1A 2N01B 3ZVVA 2DQJH 2BSEA 1PFOA 3GSUA 1VADA 3VXSE 1PZUB 1UM4H 1EFXB 1EHLH 4HPOL 3PU7A 5AVUB 2KHAA 2P5PA 3HZMA 4QRRE 5FYJU 2F7PA 1YQ2A 1RZFL 1JYNA 2VSKB 5CHNA 2WNGA 3ME0B 4KMLB 3PCYA 3VM5A 5E6YA 2Z1PA 2FWSA 3EDFA 2VLKA 4WI0A 5IMKA 3RU8L 2XC8A 4RMBA 1PJWA 5DYFA 2R1XB 1DDTA 4LCYA 1UZ6F 1YMHB 3RG1C 1MW2A 4NP9A 4R90L 5EH1A 1KJ2B 1NBZA 2NQCA 3KH4A 4OT1L 1GZQA 4YO0A 2G4EA 4L5FE 4M6OH 1DQLH 2ITEA 4PWGA 1Q0XL 2ZE0A 5EIQA 5BO1H 1A7RH 4BRVA 1PMYA 2ICEC 5L4IA 1JGEA 4UB0L 5A2LH 3QXAA 1MFUA 1Z2KA 3EKCA 4JG1L 2L7UA 4LU5L 4YSTA 1OGTA 2J4WL 4PJ8B 3UPRA 5JXEC 4K7PY 3SE8L 4W9KC 4N2HA 1YEFH 2DKSA 3FU0A 4WW1A 2BY0A 4EN3A 3C09C 2E9WA 4RAVB 1L7IL 4U1SA 4EZJA 4KHXL 1Z1WA 2FATH 3EOTH 4H1LH 1CC3A 3ZR5A 4C54A 5C0RL 3B3IB 3FT9A 3BWZA 4NXSA 4XNYL 3KPOA 2XWTB 3WHE1 4NO2A 4Y9CA 4MS8C 3M88A 5INDA 1CJYA 5C09D 1GYVA 1NANI 5D6DC 4E9SA 1I7TA 5GHWL 5CCGE 1T83C 4L1BA 5D93C 4AJVA 1J1OH 3UMNA 3ISYA 1KWGA 2GSMB 4KXZI 1N2RB 5HPOA 3RWDA 3TNNB 4PGBA 4AT6B 3IS0X 1NUGA 3VI4F 4GLRH 4OZHE 1KXHA 1AS7A 4J3VA 1ZVSB 1KTJA 1RERA 2E5EA 5AL8A 4JCLA 1ZWIB 4M9OA 3CFDB 4PCYA 4TF4A 3GIZH 2YFNA 4G72B 2VDNB 1QLRB 4EUPH 4PJ7A 4MQXC 3SHSA 5L0QB 2OXGB 4FG6D 4MCYB 5CIPH 4TS6A 4AGOA 1N70A 1KGWA 2R2BB 2XN9A 4MYPA 3CBKB 4PCTA 3VAEA 4EVNA 4GIAA 3P0YH 5DK2B 5BMFH 1L0YA 4PQXA 4HWNA 3ZX1A 5EBMB 2XY2A 4G7YL 1A6TB 4MAZA 3P54A 2Q7YB 4EQ2A 3SZKC 1XCTB 3GMLB 2ZICA 2H6PA 4Q9BA 5I1JL 5C86A 1S3KL 2D8KA 3P0VH 1I8MA 4B5EA 1KCVH 5DO8A 2BY1A 2BSED 1KXVC 4LHQB 2EH8H 1WH0A 4Q56A 5JHDB 1X5GA 3GSVB 3IDXH 4S1QH 2YLHA 2Q6WB 4U0RB 5E1QA 1G0XA 3VD3A 2H3XC 1WT5C 1BOYA 2EDOA 4NZDA 4ODVL 5D6CB 2B3RA 4XBGB 1W8NA 4MJ5A 1HOEA 2I9LA 3C87A 1ASQA 3GGWA 2VLKD 1NBQA 15C8H 3U48A 5B4MD 1HHHA 2RR3A 3C2AH 4P5KB 1JPFB 1QPXA 3MYJA 4KI5F 4JM2F 1XH1A 4ODHH 5DHVA 3LRGA 3E9UA 4NRXB 1EAQA 3IFOA 1C12A 3E6HA 4I48B 3ZSSA 5LGJA 4FGMA 4WCYL 4NUJA 4TSCL 1DJYA 5E4AA 2H1XA 2CBQA 1SJHB 1X5FA 5FB8B 1JZ2A 3FQ4A 1D5BA 5D5MA 5J57B 2EDMA 1T7WA 3CFKB 4DETA 1P6AB 5JXAH 1A1MA 1KB9J 5D7IB 1DLFH 1CFTB 4MQ7B 3LKOB 1YYLL 4HIHB 1OK8A 1S7UA 1Y18A 4I2XE 1XZ0B 4EN3D 4OD2B 2BP5M 4ATTA 1HINH 5T3ZL 1GTNA 5I8CB 2X3AA 1DJZA 2WWKT 3NOIA 4ORZC 3RDTA 4KJYB 3FONA 2O72A 3ZDXB 1QX1A 1JS4A 4LEXH 1TUPA 3I6GB 1GH7A 4AOFA 1TENA 2QPUA 2VQ1A 3CLFL 3LKQA 3W9DA 2CBTA 3AQYA 3NFSL 2HTKC 1CUOA 3EYQC 2J71A 2LU7A 1UXSB 5GISH 3WFBL 4IBSA 4F7CB 4J4PA 5KSVA 5KUMA 4FEMA 5FPIA 3OLGA 1ROCA 2XUWA 1I1AB 2EDYA 3NFPA 5D2NB 3QAQA 2ITCB 4XGZA 1OT4A 1RPUA 3CNKA 4N8CL 4YDJB 3GHPA 3ARGC 2ZOUA 2HVJA 4Y5YA 4F8LA 1MIEL 3SKNB 1RJLA 1PX3A 1TJHL 5CJQH 3QUZB 5IMOA 2EDEA 4BQBA 2MPVA 3MVSA 4E9VA 3ULVC 2OXHB 4AYMC 2XN9D 4MVBC 3GRWA 3T08A 4POYA 1AIFB 5IW1A 4AVIA 4M7KH 2K4WA 1UWXH 1FNEA 1FFRA 1LO5A 2B5IB 3IKKA 5ID1A 5G4NA 5HDBE 5E7BA 3OVUB 4GG6B 1S9YB 5GGSA 3GMMB 4AQOA 4NWTL 5DD6A 1T6VN 5TD4A 2RB8A 1I3GL 2XA8L 4ZI8A 3OAYK 4XXDB 5GJTH 5AG8A 3VSQA 3RWCA 1FL3B 2FTAA 1CDBA 4PCKA 3AT8A 4UM8B 4G8FB 2VR8A 4PJ9C 1HNFA 2E27H 2WJ7A 2ZP0T 5D7LA 1EVTC 1PCXA 3WXWL 1JHKH 4KNSA 2H47C 1ZD6A 2BS71 4IRJB 5KAQG 4RCAA 4UQ3A 1BZ7B 4J3OD 4ZO6A 3RE0A 5FO8B 1JK9B 1KGCE 4MA7L 2WAQA 4K7FB 2HT2D 5E6RB 5C9KA 1ZLDA 2VDRL 5INCB 1S46A 1A7OH 1ZSHA 3PL6A 5EA0L 1VA9A 1WZAA 5EU5B 2J8UF 3KL5A 5DQDL 3UABA 1A22B 3F7YA 3KZ8A 2W8CA 2WMPB 1KC5L 4QO1A 1EFQA 4AH2A 1ND0B 1ZHBB 3W2DH 1TR7A 5SWQB 5BZZA 4JR9L 4K0OA 4AEHL 5LGHL 2GCYA 5DRNA 1QW8A 1N59B 2BDNL 2XG5B 4ZMOA 2ADFH 4R4FL 4WHYH 3D05A 4XBMA 3OXRB 3UEQA 1JD7A 5C7XH 3RDTD 5CSZA 3U7WH 1FFOB 5F7AA 3DRQA 2BSRB 4XWGH 1RD6A 1L9MA 3UTSA 5IVNA 4F24A 3HI5H 3MUHL 1CT8A 3GO1L 5B1AB 4C4KT 3LKRA 1JMXA 1HCYA 1L5GA 1NWPA 3H4HA 1ZY9A 3NG5A 1YPZA 1NPNA 2PW1B 2YD9A 1FRGH 5D72L 2ZOTA 2GUOA 1C08A 2Z3FA 3VD9A 4J4PD 3BRDA 4H5SB 4NKIH 4E9LA 3NCFB 5HGDB 4P46C 3L1OL 1HHGA 3PWPE 3VFUA 1LP9F 1UGNA 4ZMAT 4OVVA 4QRSB 4RRPG 1MHCB 1BQSA 1JXDA 2V2TA 3SE9H 2HFEB 2IFFH 2QQQA 2FBJH 1MUJB 2G3XA 3EYSH 3HZVA 2VJ8A 2Z4QB 5SWZA 2C4FU 2IDFA 3DARA 2A1WH 3R06A 2OW6A 4PJHB 5DMKB 3QQ4A 2Y23A 1CZ8L 1NJ9B 5IIEA 1JE6A 4KTDH 1ZT1A 4TUKH 1INQA 1DQQA 2X4PB 4ETQA 3EDEA 3MJGX 4LRIC 2A6IA 3D39A 2XPGB 3MLZH 5B1JA 2AXJA 4QCIB 1JNHA 2J72A 5DVLA 4RFOH 2VMEA 1JPGA 3N42B 2VSMB 4Q14A 4MAUH 2AMUA 1QRKA 3OKEA 2VLME 4N0FB 5DYOA 3S97C 1TYEB 5GZNA 3SYOA 3RZCB 4GKOA 5I1EL 4S1SH 3FU7A 3IAPA 1F3JA 2CKNA 2CUAA 4NM4H 2DQCH 3EDDA 3RFRA 1OXYA 3RZWA 2BS9A 2JK5A 3RBSA 4XCNB 2WXKA 3AUVA 3D30A 5D1XB 5LCVL 3V7AE 1G7MB 3MA9H 5JDSA 2CDFB 4XZUB 3SEPA 3U7YL 2VDKH 4JJ5B 3AQZA 1K6QL 4JKPH 2Q87A 1AR2A 1X7QB 5T1KB 1ETJA 4DKFH 3TA4D 1CD9B 1U58A 4JQIA 2GK2A 3S4SG 4PTUB 5I5MA 4A7SA 1VEOA 2DLIA 4HPOH 4H26B 1AR1D 2IADA 1RZFH 4PJAA 1OEZW 3GIVB 3R4RA 2XQYG 2V9QA 5DUBA 3QIBA 5HGAA 1AO7B 3QDME 4NI3A 3PWVA 1CGWA 2R4RL 4X99A 3TPUB 4X0NA 1IC1A 1RXLA 2BSSB 1N6QL 1YZZA 1T1YA 4NAJA 2JJSA 4OKDA 1FVDB 3DURA 3FFOA 2OR9H 2G2RA 4PY7A 4OT1H 4UM9B 2IBGA 2VDLL 2NX5E 4U1JB 7CGTA 1Q0XH 4RDBA 3X14A 1AFVL 5F44A 1FA4A 1SLXA 4FQPA 3U36A 3KWTA 5DWPA 4Y4KC 2BSTA 3L7FA 3O9WA 4JG1H 4L4VB 3S36L 3IRPX 4U6HB 2BWIA 1CLVA 1LL1A 2GIMA 4BFKA 3KGUA 2H3NB 3G3LA 4QD2E 5CLYA 2HJKA 3EG9B 5K93A 1IQWL 2OA9A 3UC0L 5IEKA 4NFCA 3PIQB 1R75A 1VLXA 3BP5B 4JAMA 4Q4EA 1FDLH 4X5QA 2O61A 5C0RH 3MRGA 2WVSA 4XPAL 5C0JB 3HZKA 4CL7A 2Q10A 4M1CC 1H8LA 2CGRL 5AOMA 4A2GA 1AANA 4XNYH 2AJXL 4FI6A 2Z92A 3W0WA 2BIQA 3B9KA 4GW5B 1E4XL 2DD8L 2VERA 1JD9A 5FO7A 5IFHL 2DYSB 3NUKA 3HMXL 4G7VH 4OCLC 5GHWH 3DDFA 3G04B 4QAMB 2Y2YA 4A39A 5I66A 1TQCB 1KPVA 2F08A 4JM2A 3P77B 5EIIB 2NYYC 3X13A 1Q1JL 3D39D 4XVTL 5T1LA 5L6YL 1R4XA 1NFIA 5G4OA 2B9BA 4LASH 1I9RL 3U4EA 5KVEL 3PGDB 1X5YA 1JRHL 2VLJA 4MMZC 4X8JA 5TE4L 1Z3GL 1RUQH 1M42A 3ARSA 2B15A 4FULA 3X1EA 1LYQA 1E8WA 3SQRA 2B77A 5IQ7L 2J44A 2H6UA 3TLRA 2K9UA 2Q86B 5GZND 3QDGA 3Q1EA 1FH5H 5HGHA 5HYSA 3D3VE 1UFGA 1ZE3C 2J56A 1H8OA 3PDGA 1LEGB 2DLFL 5IMMB 3PV6B 1J8HA 1PDKB 1WFOA 4DT2A 3OD3A 1F4XH 2F5AL 1ZANL 4G7YH 1TYRA 3CMOL 2BVTA 4Y16D 2AQ3A 3V9FA 4FXGA 2CMRL 4E41A 1FO0B 1E30A 4TLKA 5DEGA 3QXUA 2A5UA 1HSAB 3JYCA 2MH4A 4PMEA 1FGNL 3SJVA 4KX9A 2QTEA 4O02A 1I7UA 3D09A 4ANXA 1OTSD 3Q7JA 5E8OA 3P4MB 4IK6A 4MJJA 4ODVH 5ILTL 1AC0A 2FO4B 3FQWB 4J12A 5JHBA 2ENQA 2CHXA 2JELH 2FH8A 2PYFA 3KL3A 3QIBD 1HIML 4P49A 4OZHF 4OFQA 3V8OA 5IW6B 3NTCL 4BGDA 1T7VA 3UYOD 1P2CA 2Y6SD 2GK0A 3GJEB 1QR1A 2EDNA 4P5MB 1D9KB 2GC7C 2AHIA 4UT7L 3BO8A 3S96A 1UQSA 1INDL 1PEZA 1SEQH 4WCYH 3RVXC 4YLBA 1H3TA 4TSCH 3QDJE 3GB7A 3MV01 1OGSA 3HC0A 2NY3D 5C08E 4D0DB 1YJDL 2VLRE 4TLSA 3TM6A 4UAHA 4OKVA 1T4WA 3VWJA 1TTCA 3ZJAA 4N85A 1YYLH 2OYPA 3V10A 2QSTA 3S3CB 3GUTB 2PO6B 1MSPA 3FMGL 4L1LA 3LZNA 5JW4M 5AVSB 4KK5D 8FABB 2VISB 5T3ZH 4Y1AB 2Z9TA 1Q72L 1XF4A 4IU2A 2FX8L 1J9RA 5IFAH 1IQDB 3UTZB 5FM5M 4J39A 1A7PL 4P57B 5F7DA 3W0WD 1CGSL 3B9KD 4LGSB 3U0WL 4GAGL 5IB3A 5HJDA 3R7QA 1QMUA 4Y5VC 3N44F 2MNWA 3ULUH 3LN4A 2Q5BA 4JZNB 2BXYA 4M8QB 1RULH 3D34A 4MNGE 1CVRA 1HEZB 1BZ8A 1JNLL 2BHFA 5T1LD 2C3XA 1IL1A 5F0PB 4D8PA 3A5VA 1U95A 2HJLA 4I0PB 2FO1A 1NGZB 2J8UA 5BS0E 1TU2A 4HIEA 4EZKA 3GTVA 3QPXH 3SDYL 3O2VL 5DRXA 2R29H 3P40A 2VLJD 5G4MA 1AQMA 4FHKA 1QSEB 1G9MC 3U4KA 3WYRA 5FR3A 5I73C 3BGFC 4BBWA 1G1KA 4KY1L 3KLHD 3J7HA 3ZKMD 4R2GD 3FYEB 2EABA 5DC9B 2BOBA 3QDGD 3MRKB 1HE7A 1QTYT 4PUBL 1HVXA 1J1XH 4GP4B 4JCWA 3PRZA 1A9EB 1MAKA 4G1MB 3QZMA 1YEEL 4UV4H 4AVHA 5DVNA 1AXTH 1GAFL 3IFNH 5ENWB 3BZEA 3V6ZA 3SPGA 1MLCB 1ZKAA 3DETD 5IROC 3V9CA 4KITB 1GGTA 3S2AA 1ECYA 3NFNA 5ICZB 5KTEL 2OL3A 3QI9D 4NWTH 4H20L 4UILH 3H0TA 4E41D 2IAAC 4QKXB 2XA8H 3I84A 4U6YB 3I75B 1DJSA 2JVUA 2AQ2A 1TG8A 2DQEL 3ASOB 4LVHC 1RVFL 1D5MA 5EEVA 1NCCL 5EU6B 1DVFB 1YDPB 5LNDA 5CFHA 5D2LE 2RTTA 3S3SA 5CCJA 1J12A 3O8XA 1CGTA 1LP9A 1KSRA 1CS6A 2Z64C 3OQRA 2NR6C 5GIRA 2B1HL 2W9DH 1CE1L 2DQTH 1E65A 4YHKH 1G9HA 2VAJA 4UU9B 4XBPA 2E59A 5CZXD 4TUJB 5I8OH 5DD5H 1M71B 4OLXL 3H9SA 5FGSA 4JDVB 4ZOBA 4A7QA 1WS8A 5DQ9B 1KLUB 1ZLSL 4B9CA 2VDRH 2FYYB 3TL5A 4GQ9L 1CYGA 2YZ8A 5EA0H 2ENJA 2DEXX 3C5SA 4TNWK 5DQDH 5F1IB 2I5YL 3MRNA 3K80A 5CEZH 1I3RA 3BZFB 2BVYA 4GIPD 4HFWB 3ZKQD 1JDCA 1CFBA 5AZEH 3SDAA 3VWJD 3VXTA 3CVDA 4ALAH 4ZW5A 2CXGA 5TF1H 1KCWA 2J21A 4WLCA 2RJMA 5HDBF 5HJ3B 2JJVA 3Q1SL 3FT4B 5IOKA 1J0KA 5E8EB 4B9KC 5LGHH 4U7KA 1YNKL 2YK1H 3T4YB 3HRPA 4YHZH 4NZTL 4NBXB 4R4FH 4U2ZA 4WWKB 2NDFA 3OR7B 3VFNB 5I5JA 3GMQA 5I30L 5HDLA 2C9AA 3BUYA 4XX1G 3WI9A 4PRAA 3T0ED 5TDPB 2X2IA 5HI4C 1XCQB 3WV0A 5F3HB 3NA4A 3GKWL 3P11L 4W68A 5D72H 4FC3E 3VE0B 4H0LC 5ICXB 4AENA 3HUJB 4N2IA 1AHWB 2VZVA 3NRFA 2JIXB 1L3NA 3LN5B 3VQMA 2Y72A 5I9QC 5GGVH 1F18A 3OZKA 3QPQD 4TOYL 5ERWB 4FD0A 3L1OH 4HS6B 5E8NA 2D4FA 3ESMA 4PREA 1A2YB 4TQ8A 5BUPA 4FDWA 35C8H 4BQ9A 1BVNT 5IG7A 4FLHA 4OGAD 3VFVA 4LXFA 1AP2A 4D0BA 1M1SA 3VYPA 2OCCB 2XRAH 4F7KA 3ZDWA 1B6DA 4Z7QE 3ZDZB 1CYWA 1FC2D 3KR3L 5F97E 3ZTJH 3MBXL 3ZT6A 3N40F 3PWUB 4XRCB 5ABZA 2N0MA 1G0DA 1F4YL 4X5PA 4PBXA 2AGJL 1K8IB 2TAAA 2IH8A 1BM7A 5I23A 1RZKH 4ODWB 4BXSV 3CC5A 2Y6TE 3IJEA 4LNVA 1MW0A 2H3KA 4Y5XC 5KN5A 1M6OB 3FB7A 1ADQL 3FC8A 3GXNA 2DLTA 5KVDH 1SHMA 4F2MA 1X6LA 4WI7A 4X4YB 4NN5C 4K71B 3QISA 4P2QB 4W4OA 5GSVB 5FA3B 3NGBC 4OB5L 3NIGE 4OTXL 4Z8FL 4LKCB 3TBSB 3N9GL 4X6EB 3V7MA 2BVPB 3SE3C 1HCFX 1RMFH 2A4EA 3FQNB 2CJSA 4N6RB 4QTFA 1M7UA 4YDKL 3O8XD 5C2UB 4IKIA 3JTTB 1ET7A 2BVOA 1IEBA 2JJUA 2CDGA 4IRSA 3ULVE 3E8UH 4Z7OE 4V1DB 3U7YH 2OMXB 2YR3A 2YA2A 3MUGA 1AGBA 4I18C 5FO2A 4QRRA 3VM7A 1T3FB 1EEUA 2K6YA 3CN4A 2IG2H 3FB5A 5DGQA 5FW6A 2ILLA 3RY5A 5A2KH 1XGQB 4XPFH 2KYIA 4L4TB 2NDGA 4PJCE 1IC7L 5DJYA 4N0UE 2NPLX 4CVZA 4XPGL 5B8CA 2AAVA 3UZVA 5AYUH 3QA3A 4OZFG 2ZIDA 4KRPB 4XWOD 3UIZA 4AYFA 4LFHD 1WS7A 3B7SA 4HPHA 3PNWA 2R4RH 3VH8B 4HC1A 1SYSA 1TLMA 4N2OA 1M6UA 3F8UB 1SN2A 2DQGH 2DWEA 4XOBA 1N6QH 2ZSWB 4TLUA 4Z7WE 1NCAH 4HXAL 1R17A 4LSSL 4ZX5A 1N0LA 1F11A 3QHZL 1IC5L 2VDLH 4WU5A 4CADB 2P1YA 3BH9A 4RETB 1I1YB 1LILA 2B59A 4UIMB 3JV6A 1AFVH 4EI6B 2BCKB 4TULL 5A40E 4Y19B 3HKFA 4WK4B 5D1ZI 2WQSA 5IFJB 5E1HB 4ANKA 4RFNC 1VFOA 1JPST 1U8QA 2IO5A 1IQWH 2J5LC 3UC0H 4N1EA 1O7SA 3TGXA 4J8RA 4QI3A 3LNEA 2RQEA 3ARFB 5AB9A 4R26H 5K9OA 3BW9A 5DEZA 3WJJC 4I85A 2Y7QB 4BDVB 2IF7A 2CGRH 3NJFA 4QXWA 3KBPA 5B39G 4U1MA 4ABQA 1JYVA 1AGCA 1KG0B 5DO2C 4KTEL 5FYLD 4I4WA 1E4XH 1FL5A 2YC1B 2DD8H 4KDWA 1V7ML 4CNIA 5IFHH 3HMXH 4M5ZL 4UT6L 3WEMA 1Q94B 4QUOA 2A9AA 2PCFB 3BRGC 2CGYA 1HOCA 2BIOA 3ARDB 3RFZB 4F33B 2X40A 3DV4A 5AW9B 1KTDB 3F5WB 1ZPLA 4XVTH 4PEEA 5IJVB 1XIWB 3GSQB 2YGNA 4S2SB 5L6YH 2AVGA 3RWJA 1JCVA 3H2PA 5KVEH 3TO2A 1QACA 1ZS8A 1ZTXH 4JDEB 4U3SB 2E9BA 4KY2A 1FF5A 4J3SA 4M61A 5DJ2B 3LNFA 2YUXA 3UJTH 5IQ7H 2OTPA 4DSYA 2XPYA 2NY2D 4UTAA 3NCYP 2HLFC 4K8RL 4ORGA 3KM2A 5IJDC 4YR6A 1KENL 2B0SH 2ITDA 2ZYSA 1CFQB 3IS1X 1OANA 1FZKA 3GKZA 1NTDA 1CICB 3HHSA 2P7TB 4UT9H 4UNVA 3D85A 3B4NA 1BBDL 1ZANH 2BVEA 1KB5L 3U9WA 5MEQA 1CL7H 4IRSD 1A6AA 4Z7IA 1U33A 2YPLB 1PPIA 3HZYA 4JFZL 2RMNA 3MNDA 3HG5A 4ZO7A 4UQBA 4NQSA 1U8LB 2CMRH 3TIEB 3BKCL 4UINH 1PF3A 4QRRD 5F0MB 1Z9SB 4MDIA 3T4AB 2IOMA 2EIJB 5JPMC 1BDYA 3NSDA 4JG9A 3ABZA 5GS0L 3EH4B 5D1ZB 4FZ8L 4UV7L 1UJTA 4Q2ZB 5IVXE 4Y7OC 2BX5A 5EZIH 5GRVL 1MNNA 2CCWA 4ZD3L 5F9OL 1O6SA 1U30A 4CGTA 1QVOB 4MB3A 4P2RD 2XBTA 1HIMH 3KXFE 4PVMA 1E90A 4TLTA 1R5WA 3KVPA 2OV0A 3M7FB 4KC3B 4LCCB 4QRPB 2IAMD 2XV3A 3CAFA 4R0LC 3NTCH 3UPCA 4HUUB 1Z5LA 4PJFA 4L48A 4XC3L 3RWIB 4DVBB 3VNZA 2YQGA 2APBA 2Q2EB 5KYUA 1KEGH 3BT2L 5L2JA 1E3XA 2ZTBA 1E27A 1QI5A 4UT7H 4O51B 3TJEH 3ZKXB 2WLHA 5JW4R 3AREC 3D7PA 2ZCKL 4ZFOL 2W07A 3MFFA 1FSKC 3QYCA 5AOIA 3V9EA 1NFDB 1YJDH 4LCWA 4PPTA 1ACZA 2ZWZA 3S35L 5I6XB 1T1WA 1IGCH 3CZKA 1QD0A 3T3MB 1YUHA 1U92B 4OCSH 2XA3A 4X6DA 1KNOA 1H6UA 1OCOB 4LAQL 1FNSH 2OMZA 4MB1A 2VIRB 4HJEA 3HE7C 1OGAA 1A14L 4Y4FC 4AL8C 4ZYKA 4IJ3B 1N8ZA 2AAAA 1UB5B 3PWNB 1F4HA 1QASA 4C59B 5T5NG 4PD4J 3TV3L 5EIVA 4F7EA 4YXLL 4JRFA 2YPVA 2Q0ZX 1YMME 4GUCA 4TNWF 1CIUA 3HVDA 1NMBL 5AOKA 2EKSB 2G75A 4WV1B 1MLBB 3QRFM 2IMNA 1F3DH 1OB0A 3MKGA 5CGBA 1VGKB 2XPZA 5KBLA 1X6NA 3EJSA 2WCSA 3BLPX 4J8QA 2XX1A 4WFHE 4Z1PA 5C07E 2D9CA 1RIHL 3US0A 3SDYH 3O2VH 1RURL 1U8IA 4PJDE 5ACZB 3OC5A 3QO1A 1OCWL 4P23B 2L7QA 3U4AA 1G4RA 1WTGT 4PLKC 4XB7A 2DWSA 3BE1H 3ZE0E 2HFFB 4NIYE 3VNYA 4X0KB 4GLRI 1OTTC 2A9MH 2JI1A 2K3HA 2XYCA 3KGSA 3OJDB 4PUBH 1U4FA 4QXGH 4TNVK 3EYOA 4DF9A 5I0XA 4L29B 4AGMA 1YEEH 2AVFA 1GAFH 2GVYA 5EU4B 4X4ME 2Z7YA 3U2SB 2X4TA 3DGGA 2GT9A 2P42B 3GMNA 3FCTB 4WEUD 1J5IA 1PKQE 2X7LB 1LXMA 2N3JA 1XR8B 4H20H 4L05A 1V54B 4P2OB 1ACCA 4NENA 4P06A 3S0PA 4DKEL 4KZEH 4BKLA 2EJ1A 3MNWA 5DJDB 3WS6A 2DQIH 3IJHB 3G6JB 2YEVB 2BNQB 4RSYA 2DQEH 2EIZB 2XZCL 4LCUA 2QQNH 3DMMC 1EERB 1NCCH 4K94C 3HVNA 2FJGB 2UVFA 2NY7H 5JDJA 3G6DL 5ISZE 4A2MA 1QNZH 2CR0A 2Y5QA 5HHQA 3MLPA 12E8L 5EIIG 1QZNA 1A9VA 2BNUB 1P4IL 2VCOA 1JTPA 4MWFA 3QZLA 3QQNA 1HL4A 4YIQA 5I76A 1CE1H 1ZLVK 3D87B 2Y7LA 1FJ1B 3KE0A 2W80C 5A2JH 2R8SH 2E0PA 1PNCA 3MRRA 4RGMC 4E5XA 1CF8H 2Y3AA 4PIRF 3B43A 4GQ9H 3F84A 4LZKA 4OI9A 4JHVA 3AACA 5T1DL 3SO3B 2WW8A 3VRLE 2GJ6B 1PIGA 4H8UA 4LCWD 1OF0A 3U1SL 2FT7A 1W80A 4H1LB 2X0UA 5IW3A 1NEPA 4RBPH 5CKGA 2AJZA 3CHPA 4E68A 2CIIB 1DQJB 4OD1L 3AU0A 1AD0A 4OAWB 3IDIA 1UYWH 5IV2A 3Q5YA 3IK2A 3SGEI 4QXUL 1YNKH 2YSSB 3C75A 4UAOC 3K6FA 3CSYA 1OGAD 4U1NA 1T4KB 3QQ9D 2X70B 1KFAL 5D7JA 5IKCB 3QS3A 4LCVA 2CLVB 5T3XH 1PZCA 1A6WH 3NABL 5TGBA 5AW1B 1OLLA 4WSKA 1GGYA 2Z8SA 2BHUA 1G7PA 3JWNH 4HUKB 3EGXB 3N50A 3RTQC 3RPIA 2EIEA 3RVVC 3A3YB 5D2LF 3OL2A 5E4OA 4GKNB 2UWEA 5H8DA 3EXLA 3RL2A 4KX7A 1KJVA 1R3LB 2HKFL 3UACA 4AITA 4LIQE 3P11H 3AM8C 4XMVA 3Q8FA 1BZEA 4FFVC 3FH8A 3CXDH 1RZPA 1U2CA 3QUXA 4KNTA 1OE1A 1E2ZA 5BOPA 1AHMA 2N7SA 3CXHJ 4O2FA 4EUPB 5HY9B 5L4JA 4NAMA 3D0AA 1IGYB 5EUOE 2M8XA 5ID0B 5KS9E 1TPXC 2W94A 5CIPB 3A67H 3L1EA 5TDOA 3Q2VA 1WBYA 2FK9A 4FP8H 4GSQA 3HE6C 4OCMC 3B7RL 4ONOA 3DV6A 4IBZA 4MX7A 1FCGA 3VVVA 4K9EL 4G42A 1MFMA 3KR3H 4FABL 2KMWA 1LLAA 3FSAA 1MJ7L 1U3HB 3DX6B 3QUHA 4Y1TA 5MI0B 1F4YH 3WO4B 3TU6A 4F3FA 2Y1VA 2IALB 3KW7A 43CAB 2NRDA 2F61A 4XVJL 4AQ8A 1IM3D 3FHEA 2FQDA 3T1WA 5C0GA 4KO5A 2ICWJ 3UTTB 1FVCA 1UEYA 3W11C 1ADQH 1GHFL 4FYQA 4OUUB 4KAQL 2LVCA 4LOUD 3BYTA 3CSTA 4P0DA 4R97B 5AENA 5C0NC 3FCGA 4H25A 4PJGB 4TV3A 3T0DA 2IVFC 5DEFA 3TCLB 1AZRA 1I8LA 1MW3A 4GUPA 4KH9A 4JJHA 4B60A 4D0CA 4JLRB 1ZXQA 3N9GH 1NINA 4ISVA 3MO1A 1M2VA 3B7YA 3S8GB 4YK4C 4JNXA 4XH2B 3IF1A 3RHWF 1L9TA 1NBVH 3BFWA 5TE6L 4XP5H 3ZOAA 3AB0C 3BWSA 1I9JH 4GS7B 4JFYB 2HTLC 5C3LD 4HJSA 4MA8L 3P9LA 1G7QA 4GW4B 5SV4A 1R3KA 3L3IB 4OZGA 1BXUA 1M7XA 1UT2A 1HJBC 1QHPA 4YHML 3MLUL 5JW5B 3ZRCC 3N0PB 4LARL 2BNRE 3TZVA 3D9AL 2WANA 4JDZA 1G84A 3ROLB 2NY0C 1IC7H 2X41A 1QFHA 2ZKMX 3JUYA 4MMXA 1SXCA 4L1SA 4L5FH 4NOBA 2A83B 4HC1H 4Z7QF 1TJIH 4KK9D 3TT1H 5E5RB 3N41B 3O4LE 1HYSC 4ZS6D 5FHAL 3AT9A 4IOIA 4ENZA 5DFAA 4HU8A 4XPBH 1YY9D 3HR6A 1R3IH 4EO5A 1FYTB 1MAJA 3CHXA 4HXAH 1A66A 3LKSA 4X6BA 2AK4E 5D7JD 1RHHB 3QHZH 1IC5H 1WWAX 1XF3A 4BWTA 3S88L 3LNIA 4DVRH 1E9PB 3NIGF 4XCYB 5HGBA 4FQLH 3HG1A 4JFQA 1KIUA 3D25A 3DHJA 1HH9A 1GC1C 3BAYA 3CFUA 3VXOA 4JO2H 4K07A 2AEQL 4EAEA 2ADGA 3ZHKA 1UXMA 3QQXA 5E1IA 3E7JA 1BLNA 3FL7A 3BPNB 2X42A 1DLHA 4PRPB 3F6IA 4XNQB 3SDCA 4F27A 5MENB 2V3DA 1A25A 3QUXD 3LIZA 3ULVF 3HBQA 3DVNA 4BFIA 2CH8A 4Z7OF 3UZEA 1HEHC 4NOFA 2FJSA 4TXVB 1DQVA 2GSIA 3B1TA 4NQCE 1QKZL 4HWEL 4MXWH 5C0CB 3E1ZA 3IGLA 4H88H 1IKFL 2YEZB 2NY1D 3QCTH 5LHDA 5I5IA 4RMVA 1C5BL 3EBHA 4ZQKA 2OMTA 3K81A 5IBLC 4PJCF 1V7MH 4PJXB 4U3HA 2EDWA 4JDTL 1RY7B 2QKIB 3PQYA 1MCPH 4UT6H 5FO9A 3S34L 5J6HA 3FT2B 1H3VA 1IKNC 3IVKB 2I07B 3PAYA 2QFPA 1EDYA 5E6IA 4G8EB 3L1FA 2QQKL 2ARJA 3ZE2B 3L13A 4BSWB 3G5YA 4C47A 3STZB 3TESA 1IBDA 3QWOB 3DPDA 4M93B 3SBRA 2QL1A 4UTBL 2VLMD 5FYJE 1DEDA 3DBXA 4LP5A 3V4PL 2QVMA 4IMKC 3P9MA 5AEAA 2VXQL 4Z7WF 1ITBB 1WGOA 3M1BB 1ASOA 3D3VA 3QZWG 4ELKB 5D7KE 1R3HB 1CD1B 3OMNB 3RGVB 1DO5A 5E95B 1WISA 3V6BR 2GEQA 3GYRA 2Y9RT 2PW2A 4R7DA 3HJEA 5MEPA 1OO2A 2R51A <