3OD3A

Cueo at 1.1 a resolution including residues in previously disordered region
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
488
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 143
structure length 488
sequence length 488
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A03
1YLBB 3FT0A 2YAQA 1AZCA 2WSDA 2ZOOA 3WG7B 2X88A 1BXUA 4DP7X 1OOWA 1KDJA 2Q9OA 1X9UA 3PAUA 2QT6A 2XX1A 4M4RB 1SDDA 2YXVA 4A2EA 1CC3A 4G7QB 3OD3A 1AAJA 3FYEB 2MRYA 2BHFA 1A65A 5I6PA 1TEFA 4NAJA 8PAZA 1KBWA 2AFNA 1AANA 1ASQA 1AS6A 2CJ3A 2YAOA 4F2FA 5EHFA 2IAAC 2DY2A 1V10A 2IWKA 1MZZA 3N55A 1FFTB 3ZIYA 4DP1X 1TKWA 1NIBA 2PCYA 2FNWA 1XB8A 1EZLA 2XWZA 3CZUB 3S3DB 2B3IA 1SHWA 4KOBA 2W8CA 3BQVA 2H3XC 2R7EB 2XV2A 2LLNA 2IDUA 3OQRA 4W1TA 4YSAA 1ZDQA 3X2QB 1N68A 4A2GA 4DP2X 3T6VA 2FQDA 5B7MA 2UXTA 3ABMB 1GS6X 1PLCA 4KO9A 4L0PB 2HXAA 1L9SA 3C75A 2BP0B 1NIDA 2PP9A 4AZUA 2HRGA 2R7EA 4KO7A 4KO5A 5I6MA 3H4HA 3ZDWA 4EF3A 1WA0X 1OV8A 5D4IA 1PCSA 2BW5A 2DV6A 4NERA 4YSTA 1JXFA 1NPNA 3EHBB 1FWXA 2GHZA 2BP0A 1JZEA 2OCCB 3ABLB 1IC0A 3WIAA 2BP8A 1ZIBA 4AKPA 4E9SA 5IY5B 3QPKA 5B1JA 1T5KA 2X87A 1IUZA 4NB7A 2IDTA 1KCBA 2XV3A 1B3IA 2EIMB 3V9EA 2EINB 3IN0A 3FQ2A 2PPFA 4F2EA 1PZCA 4A2HA 5I26A 1F56A 4DP4X 1BQ5A 1E5YA 2VMJA 1JZFA 5PCYA 2VM3A 2FT8A 1CURA 2UXGA 2AZUA 1DZ0A 3NJKA 1EHKB 3WNIA 3DTUB 3EH4B 5D4HA 4HAKA 4GY4A 3WKQA 4G72B 1PNCA 1BYOA 3FS9A 1ADWA 1J9TA 3U25A 6PAZA 3FU8A 1I53A 2YAFA 1ID2A 4FA7B 1MG3C 4N4YB 5A7EA 2IDSA 4DP6X 1RKRA 4HIPA 1GW0A 1XB6A 1N70A 4UANA 3PXLA 2UXFA 4BXVA 1GS8A 2JXMA 1E30A 4F7KA 2AANA 1JXDA 4GXFA 5B1AB 4HCIA 4P5SA 1SJMA 1KDIA 4DP0X 1NDTA 1OE1A 1NICA 1CYXA 2GC4C 4UAHA 4KNTA 3PAZA 2CUAA 3GDCA 1AZNA 3D12B 4G70B 3PCYA 1JZGA 1URIA 2HLEB 4DP5X 3UAAA 2QDVA 4YSDA 3FSWA 4KNUA 1QHQA 3TASA 1NINA 2XVBA 4Q89A 2HX8A 1ET8A 3QJTB 1SHXA 4E9VA 4BK5C 3CVBA 1ILUA 2IDFA 3BVDB 4KOCA 4WKXA 3S8GB 2UX6A 2YARA 4AX3A 3OMIB 3X1GA 1JVOA 3JTBA 1AQ8A 3FPYA 4A2DA 2YAMA 2IH8A 4X4KA 3TBCA 4E9WA 3L45A 5I5MA 1SF5A 1OE2A 3NJNA 5I6LA 1J9SA 1OF0A 4YL4A 2BO0A 4DPCX 5I6OA 1M57B 3FU7B 1KV7A 4K9JA 2IWFA 3UAEA 5TK4A 1AZRA 4E9TA 3OMAB 2YXWA 3H4FA 2VW4A 4M3HA 3CVCA 3PLYA 2A3TA 2VW7A 4HCFA 2CCWA 1OCOB 1W8EA 3GYRA 3T71A 3MX0B 4HZ1A 1V55B 2DYRB 3ASNB 3FU7A 3NJMA 4GP5B 2OJ1A 1SF3A 2B08A 2Y1AA 2QPEB 2QPDB 1XB3A 1R1CA 2GC7C 1PLAA 1M56B 1MDAA 1PNDA 1JZJA 4YSPA 2XU9A 2HRHA 3ABKB 2Y69B 3TBBA 1HAUA 2HX9A 2CBPA 1AG6A 2Q5BA 4BWTA 1ILSA 3KW8A 3PPSA 3SBQA 1HAWA 4E9YA 1RZPA 4MFHA 2YAHA 1PZAA 2VSKB 3UABA 3UGEA 1JERA 3AG4B 1BYPA 4YSUA 5B1JC 4QKTA 5F7BA 1NZRA 2CALA 2HZHA 4DP8X 1QLEB 4G7RB 3AY2A 5ANHA 1IKOP 2I7OA 3GXUB 3WI9A 1SFHA 3X1NA 2HX7A 4HALA 4JHUA 1KBVA 1J5DA 4W9ZA 2XXGA 5F7AA 2WO3B 2GB2A 2FT6A 2GI0A 3TA4D 4HHWA 1AG0A 4FAAB 4YVUA 1GYCA 4DPAX 1CUOA 2PP8A 1SFDA 2IWEA 5TK2A 2PLTA 2YAEA 3CVDA 1GSKA 1WAEA 2W88A 1BEXA 2VSMB 1BQRA 3NSYA 2RACA 3CDZB 3EH3B 1ZPUA 2GIMA 4BDVB 1ZDSA 3NSCA 4YSRA 2I85A 4GP8B 1OCCB 2PCFA 4JHVA 3QJVB 3S3BB 2DYSB 4YSEA 2FQFA 1HFUA 1A8ZA 4YSSA 3S3CB 5E9NA 2XLLA 1IBYA 1BXVA 3NJHA 3NSDA 1OCZB 3T6WA 3CDZA 2N0MA 1JVLA 3NT0A 3DKHA 4BDVA 1NWOA 2BW4A 2IH9A 1WA1X 3X1FA 2FWLB 5B7EA 5PAZA 4QLWA 3ASOB 2TSBA 1BAWA 3NJIA 1BXAA 2XYBA 2EILB 1NTDA 3OM3B 1L9PA 5I28A 4E9XA 1KGYE 1RCYA 1GR7A 2VN3A 2UXVA 4N8UA 3SQRA 3FSAA 2P80D 3FYIB 1DYZA 3HB3B 1TEGA 1RZQA 5AZUA 2GBAA 2VW6A 3FPXA 1BQKA 4BWUA 1PY0A 3ABGA 1ZIAA 3NJLA 2P80A 4BWWA 3QJQB 2J5WA 3FSVA 1PLBA 2XUWA 2DWTA 2ZXWB 4AKOA 3UADA 5AFAA 5B1KA 5B7FA 4HCGA 3ZBMA 1PF3A 3ERXA 1AS8A 3QJUB 3KW7A 3X1BA 1E65A 1NIEA 7PAZA 4YSOA 3NP3A 3QJSB 3IN2A 3QQXA 1ASPA 1NIFA 1V54B 1PZBA 1TU2A 2AVFA 1NPJA 3HEIB 3FSZA 1L9TA 3NJGA 1ET7A 5LDUA 2UX7A 7PCYA 3AZUA 2IDQA 4A68A 2QDWA 1CYWA 3IEAA 3AG1B 3N2JA 2JFCA 1A4AA 1M9WA 1MZYA 1SNRA 3AW5A 2BZ7A 1AS7A 2ZWNA 3X1EA 3OMNB 2AZAA 4A66A 5B3SB 2J56A 2H47C 4PAZA 1ETJA 1JZIA 1W6LA 1J9RA 4DP9X 4P5RA 4KO6A 1IBZA 3H56A 1WA2X 4DPBX 3RYMA 4GYBA 9PCYA 3CG8A 3SBRA 1L9OA 2J57A 1PMYA 4E9RA 2H5UA 2BP8B 4A2FA 1NIAA 2ZONA 4UF7C 1AACA 5B1BB 3T6ZA 4YSCA 1JOIA 4Q8BA 1GS7A 1KYAA 3QJRB 4RH4A 4CSZA 4ZK8A 1ET5A 4YVNA 3WNJA 3DIVA 1E67A 4KNSA 4YSQA 5AKRA 3IBOA 1UATA 2WO2B 1OE3A 3WKPA 1ASOA 3UACA 2PPCA 2BWIA 1JZHA 3T9WA 2FTAA 1WS7A 3MBWB 2XV0A 2I7SA 1JXGA 1VLXA 1GY2A 2BWDA 3AG2B 4AI7A 3SBPA 3JT2A 5I5IA 3IE9A 1W6WA 3NP4A 1MG2C 1ZV2A 1A4CA 3PAVA 3EH5B 4GP4B 1XMEB 1NWPA 2PPDA 3G5WA 3S8FB 2EIKB 1A3ZA 2GSMB 1FA4A 5D4JA 2BZCA 5I6NA 4A67A 2XXFA 1AZBA 5I6KA 3FQYA 2J55A 4CSPA 4JKNA 4G71B 4PCYA 2YQBA 3AG3B 3NSFA 1AIZA 4AKQA 1AOZA 3EF4A 3NYKA 4HHGA 1J5CA 2JKWA 4WTQA 2OV0A 2EIJB 1WS8A 1OCRB 2MTAA 5FC9A 4BXSV 2PPAA 3V9CA 1GY1A 2PPEA 2PP7A 3NJJA 3FU9A 4ENZA 3FQ1A 2DWSA 1AZUA 1PAZA 1J9QA 1A4BA 2CAKA 3NJFA 1X9RA 4TXVB 1QNIA 2VM4A 4E9QA 2E86A 1KCWA 2FT7A 2TSAA 3ZX1A 2XX0A 3T6XA 2YAPA 1AR1B 1L9QA 1SDDB 2FQGA 3TU6A 6PCYA 5I5JA 2NRDA 4G7SB 2FJSA 1E5ZA 2FQEA 1L9RA
chains in the Genus database with same CATH superfamily
5EWIL 5GRWA 1YMMD 2WKGA 5HYSA 2Q6WA 5C2BH 4KZEH 5TQ2L 2D7MA 2ZOOA 1UQSA 2ATPA 4U3SA 4N9GA 1BXUA 3MV9A 4PHZA 3ZQXA 1D2PA 3FTUA 5H35A 3PP4H 3VH8B 2WXKA 1B4JL 1XMWA 2JKNA 3ECWA 4HUXB 1KCLA 4LPXA 3EOAA 2BVQB 3E7JA 2FSEA 2WVVB 2KKQA 1A1MB 2CK0L 1YEJL 3GMMA 1U9KA 4PRPE 2L04A 5BW7A 4DN4H 3RDTA 4HEME 1FGVL 4M1GL 1TKWA 4Z3GA 1T22B 2EDFA 3WDJA 2DQEH 3BEWA 5DFVD 4TOYH 4UIKL 5IVXB 4X6EA 1D5MA 2I32A 5CGBA 3PYCA 5EB9A 4KZDH 1E4KA 2G3NA 5IB4A 3DX0A 2OX5A 1VEPA 1E9PB 1MCFA 4PP2B 1EJ6A 4NIKB 5CU9A 3IETB 1NC4A 5E2VL 1KWKA 3U1SH 4AC4A 4XMLL 1ED3B 4TV3A 3EBGA 4KO5A 3H4HA 4R97B 2BSTB 2RQ8A 2CIKA 3O6FC 1PCSA 3BP7A 2Y6TE 5FW6A 5BOPA 5EZLA 3IMWA 4JG0L 3IMSA 2BP0A 1FZOA 2HJLA 2ENQA 2X4NA 5HD8D 1ZHBB 5EU7C 1K5NA 1PEZA 1QD0A 4XPFH 4DESA 1BJMA 2O30A 3X11B 3C60D 2F6AA 4R3SB 5F1NB 5KOMC 5C6TL 1J0ZA 3VUAA 1ROCA 1P4UA 4UNIA 2CE6A 1Z9PA 2WXMA 3KPRE 2PPFA 3L3OC 1ZJAA 1NFDB 1D7DA 1PZCA 3SY0A 3FRUA 5I26A 2YD6A 3O3BA 4KKLD 3RWDA 1TNNA 4HJJH 4L8CB 4X4ME 1I3GL 2FT8A 4XVTL 4ZFGL 2X7LB 1VFAB 1DLFH 4YX2H 2VLKD 1S7UA 2V3FA 3BKCH 5C0EB 4DKFL 1LK3H 3MA7B 3O4LB 1UGKA 4MCZA 5D4HA 1GHFL 1OAYL 5EEXA 5CMAB 3K4DA 4H1LA 1F3DJ 3FU8A 1XR8B 1ODUA 3IFLH 2OZ4L 4HJIA 1CF8L 1MG3C 4FULA 5IV2A 3CXDH 4Q4IA 5KOVC 1HNYA 3ZJAA 5D7IA 5HGDA 3ECUA 3M8OL 3L9YA 1N70A 4ZS7H 4R7VA 1H8OA 4KK8C 2CO6A 1NM9A 2XFGB 2HRPH 3T6QC 2A4EA 4GXFA 3PABA 5F88B 4P5SA 2CRIA 3D5OF 4X6BB 3K0YA 4ODWB 3RHWF 3BOVA 4ANXA 3MJ8A 1EO8H 3KPLB 4TM9A 4X6DF 2MCMA 2IGFH 1NICA 1RLWA 3W57A 3QDAA 5IFHL 1KLUB 1UZ6F 3TTYA 5FFLA 1IT9L 1IL1A 1WTGT 1BEYH 1QLEH 3GM0A 4YFLF 4U3CA 4OH2A 3IJ9A 5K9OA 4BE5A 5I1AB 2JJWA 3QJTB 1SHXA 4OQTA 2JTYA 4QWWD 2IDFA 1TLKA 4CMMA 1FVDA 2VITA 3GSNL 3WSQH 5TFSH 3ULVL 5GISH 5C0RH 5DZOA 1TQWA 4JCWA 1U92A 2IH8A 4X4KA 4XAKE 3GO1H 1ZLSL 3V0DA 4QXTB 1XBDA 3EJYD 1E27A 4LF3A 2QHLA 3IFPA 3ZZSA 5I6LA 1A6WH 5B8CC 4P2YA 3C6LD 3CLFL 1LO4H 4PD4J 4JZNB 3UO8B 3QCTL 3O6LH 3QZOA 5J1AA 2IAMD 4DEPB 4YPGB 4Z7WF 4XBGB 1BFSA 1D6VL 1XCWA 3LZNA 3VFTA 4JFEE 1Q0XL 5L2KB 2C3HA 4EUPA 1XD1A 2ZPKL 4CDHA 1BBDL 5DEGA 1P7QD 4XXWC 3T71A 3PIQB 5FO7A 5DJDA 3TN0C 4LEEA 4PJGF 3NZ8A 3HCVA 5EO9A 4D0CA 5JHLL 2B2XL 2HJFB 4RFNB 4UV4H 1I3VA 4GSRA 4F7CB 2A9NH 4EVNA 4O2CA 4NAQA 3V6ZA 4GINA 4ES9A 3ECBA 3D3VA 4POZD 2QPEB 4HPOH 4GAJH 4G6AC 3QJXA 4QHKI 2CNZA 4UYPA 4JBSA 3VCLB 1LL1A 2Q86A 1ZGLM 2GC7C 1HH9B 2HKHL 2X1OA 2ROXA 3B9KB 4XVUC 2WBJA 3M1BA 3DMMD 3IJ8A 3LSOB 2YD1A 1BVKA 2YLHA 4ERSH 2BMKA 4U3HA 1QSZA 3HNTH 2O61A 1USQA 4L3CB 4JVWA 3V5KA 1ILSA 1IE4A 4U1KB 1G6RL 4JY5H 2YGPA 3T3PB 1Z2KA 1P6AB 4H88H 5FW8A 2NXZD 2W81C 1HDMB 1OCWH 1PD1A 1PZAA 3ARBA 4MFHA 3UGEA 2GTWB 4JR9L 2Q8AH 3ULUD 4LHUG 1JV2B 2XVGA 5FUZL 3P30H 1K4CB 1GTFA 3HNSL 3RTQD 2OK0H 4KXZI 4N2KA 5DHXB 3CHPA 2P28B 4R7DB 1QLEB 4OLVL 1OKEA 3WUWA 4XPBH 3UO1L 5DS2A 2NYYC 4G8IB 1SFHA 2DYPA 1X9QA 3KYMA 4PRBA 2LU4A 4HJGB 4LEOB 3H9HA 4DAGH 4HU8A 1IRAY 1GKOA 2RHEA 3EO0B 1QBLH 4YSQA 5I30H 4JFDE 3U48A 1MHEB 3GTVA 4BQCA 4Y5VB 1HI6B 3L4ZA 3QZWA 2FGWH 5DUMH 5HGBB 7TAAA 4DZBA 2PP8A 3QUYD 4JPKH 5E6RB 2YAEA 1GJWA 3L95B 2W0PA 5KANI 1A6TB 2J8UB 3HE7B 4LQFL 3VFSA 4C55A 3Q3GA 3T65B 1NBYA 3PWPB 1UADC 3BGAA 5IOPA 2H45A 2IH1A 1NSNH 3B8SA 3BVXA 4KZ0A 4MMYA 4HLJA 2W9DH 2V5MA 5TQ0H 5GHWL 3GJFA 1SXBA 3MVSA 3WFZA 4Z95L 5GGQH 1OAKL 3QHZL 2Z9TA 5D7JD 5HHVL 2YKLH 2YIHA 3MOAH 3OKOB 4W9DC 5C0CD 5JHDE 5AD0B 3ATFA 3SIKA 3S35H 1WFIA 4FQXA 4HKBA 4FFZH 5PAZA 1QKZH 1RK0A 2F53A 2YUZA 3UAJA 2WANA 4OFVA 2P4AB 2VJ0A 2ZWZA 4XVOA 2XYBA 4WTZA 2ZP9A 3LQAL 3QQ9C 2K9UA 4KX7A 2KH2B 3U36A 3VWKB 3T1FA 2K7PA 3ZZQA 4N68A 1KTLB 3F64A 2VXUH 4JMXA 3IAGC 1A9EB 4CW1B 4GAYB 1G7QB 3TZVC 5AZUA 1MWAA 1RK1B 2ZKWA 4IRSB 3CBJB 4XMWA 3WS3B 2AQ2A 1ND0A 3KBFA 2DQIH 4YHIB 4KXAA 2EAEA 2Y25A 2OXHA 2DL9A 2UWEE 2ICWI 3AREB 3MRDB 3SE8L 1RUML 1UZ6E 2R69L 2QFRA 2UY7A 5ADOL 5I15H 3NDYE 3P0YH 5DHVA 4AYFB 4XNQB 2H0EA 3ERXA 1QI3A 2FBJL 2YUXA 3KLQA 1LJMA 2O5ZL 4LCUB 4YSOA 3ARVA 1DSFL 4RCAA 1Z9NA 4EN3B 4U0RB 2IPUK 3VNZA 4MNGB 1QR4A 3MLVL 3N5AA 3HC0A 4ZW5A 2VAAA 5HVHC 4DZ8A 4HK3J 1R3LA 2JQMA 3D9AL 3BUPA 3HRZC 2Z91A 2C9XA 4NWTH 5HDBF 2BP5M 3BQUB 2ZKXA 1U8JA 1KIQB 5E6ZA 1H5BC 1M7IB 3WJJC 1LDPH 4QAWA 4MZ3A 5ANMA 3RZWA 3IS1X 1SJHB 3DV6B 2LAAA 4WU5B 2BNQD 3PL6B 5FYJU 4MNQB 3DBSA 4BQBA 3QIWA 4U1IA 2I60L 1Q72H 1A3LH 3DUUB 4ZUUB 3NRPA 3X1EA 4YBLC 3ZHKA 4Z6AT 3DI2B 1FAIH 4JUTA 1W6LA 4CVZA 5IWLA 2X6BA 2WIIA 4P5RA 4NOBA 4EDXA 5HJBA 4NC1C 3TVMB 3GI9H 5IMOA 4I3SH 3N6YA 1G7PB 4GYBA 5CZVH 1OANA 3DNKA 4PJBA 3OJMB 3UAFA 3GXMA 4U6XA 1KJ3H 4LPYA 5LBSA 5LN8A 2ADIB 2XN2A 3L2MA 5CEYB 2EVJA 1HCVA 3NAAH 4XH2B 5INDB 1J12A 1XF1A 1U93A 1FZKB 4NSKB 1HINL 4EI5D 3BLKA 5FF6A 1JTPA 3GRBA 4W81A 5D93C 1MCJA 3AWFA 3US1A 1KYOK 3EGXB 1WG3A 3ARYA 1VEOA 4LCIL 4IBQA 1KIUA 2N7SA 2JNZA 2WYTA 3INUH 1MIMH 4QGYA 4XP9H 3BPOB 4YE4H 5IBUB 1M6OB 2I07B 3BFWA 3VXSD 3CBKB 1NPUA 4UOJA 1MRCL 2Y1YA 3PU7A 1RHHB 3K2UL 5BS0E 3NP4A 2DW5A 3DXAA 4NLHA 1WVZA 4KV5F 1B0GA 2WKOF 4Y2LA 4BFIB 1H0DB 4N24A 4WJ5A 4F58H 5IHLB 5D1QD 3MRMA 4JHAL 3RWGB 4OV5B 3O6ML 3APDA 1F8TL 3ARTA 4K7PH 3VFRA 3MKKA 4KTEH 4U1LA 3FTVA 5LXVA 1CD1A 3W5MA 3OX8B 2LE9A 1P7KA 3UJTL 4YL9A 4G71B 1CI5A 2JIXB 4PJEE 4PBDA 2LVCA 5D7LD 5HVWA 4OAWA 3JWNH 3KVPA 3CFEA 2FATL 1AH1A 3FB8A 3LH2H 3B3IA 5IMKA 3MRHB 3L4XA 4WI4A 2NX5B 1DJHA 3P0VL 4KRLB 3GMOB 1G0XA 5T33H 3TCLA 5BOZG 3WL9A 2WLJA 1A7PH 4E68A 4AM0Q 4N2HA 4PWKA 3SDCA 2ODHA 1OALA 3J27A 2OMUB 1MHHA 1J88A 5T3XE 2QGBA 3K1KC 3LPPA 3RVVD 5F7KC 4KQ0A 5JDSB 2ZXAA 3S4SA 1Z3RA 4HIEB 4M6OH 1NMCB 2Y7QB 4PJCA 3IJEA 4HJ1A 2F5BL 2TSAA 3G6JF 3L3GB 4YDVA 5EN2A 5CD3B 2R29H 3K5SA 2EVIA 1MDTA 3UIYA 4FADA 1A1NB 3R7RA 2AK4B 5EOCH 1EWHA 1LILA 2YAQA 2V5RA 3BPCA 4UMSA 4P3DA 1WCBB 3Q44A 1O9WA 2NY1D 4LCVA 1FG2A 5BJTA 4MASA 4TF4A 5IQ9A 2OJZL 3RIAK 1MFEH 2ZG2A 3BE1L 4A63A 5DURB 3QULA 4YHLL 5IHUL 1CDGA 1P2CB 3W9DA 5I17A 2JKJA 2WWKT 4OCXH 1MLBA 3O3AB 1PD6A 5I1DA 5A43C 2CJ3A 1URLA 3ZDYB 1YNLL 1IVLA 1V7MH 3PDOB 2XY2A 2FNWA 3WEXB 1SHWA 2W8CA 2E7DA 2WNWA 3EO9H 1FUNA 3VXMA 3WNNA 4TL4A 4K2UH 2JB5L 2VN5A 4M1CD 3S34L 5MHSE 1ZLVK 5ICUA 3WY1A 5I71C 3SQOL 1A0QL 5DD1L 4LVNC 3NABH 4GRMB 4X7FC 1ECZA 1G7IB 5DT1H 4X9YA 4L0PB 1HJCA 3NACH 1FH2A 5CSGA 5JORA 5H94B 4G7VL 2BSRA 2P7TA 4ZAKA 3W0WB 3INOA 2F18A 2DRUA 3LDBC 3A5VA 3KGTA 5HDBE 1KBKA 3MJWA 5DTFB 5EIQA 5CBAB 5T5FL 4L2YA 1MAJA 5ELIA 2OMVA 2OULB 3BXNA 4EBQH 1RZKL 4WSGA 5H2BB 4LFHG 3EO1A 2X2JA 3RNQB 3BCFA 1I9IH 3LB6C 4JO5A 5I1HH 5MERA 1VACA 1YUHB 3HVDA 4AK2A 5F70A 5JZ7C 1P4IH 3QXUA 4LGRB 5B1JA 3LTVA 3T4AA 3DO3A 4I85A 3L7FA 1F13A 3OKKA 3BRGC 4YIQB 5BVPH 1FYTA 1ZA6A 5K9QG 3IN0A 3I75B 3CSYB 2G60H 4LVEA 3TFKC 1KEGL 4GRWF 2HB0A 1QWHA 3M88A 1TO4A 1QA9B 1UG9A 2ZAIA 4AGNA 5KUKA 5C08E 3NIFB 2E9WA 5KSBF 2ZKYA 3DETC 2E4TA 3LKOA 5L6YH 1I8IA 5FCUH 1FAKT 4JM2B 5D7SL 5EMYA 4HLEA 2YC1A 3GSOB 4FZEH 4M8VA 5JPMA 4M7KL 4TMPA 2MJWA 3TBVB 4LLQB 1KN2L 2OYLA 2VDNH 5EF0A 4I4WA 1UM4H 2DS4A 2N1KA 2IDSA 3AS2A 3F01A 4JHWL 2NQ3A 1K4DA 3KL5A 3B9DA 4NKMB 1SYVA 1TXKA 4FQLL 2Z31B 1GS8A 4C56A 2EABA 5DD5L 1OGAB 4HCIA 1SJMA 3SBWC 3BFQG 2F54A 3SYCA 2ZWKA 3FO9A 7FABH 1N6UA 5T1DL 5IB5A 3QR1A 1SM3H 5KS9A 2WXNA 2OAAA 4KV5E 2RCSL 2ZP8A 1M71B 1UD5A 2GJZB 4J3OH 5LGHH 3AQYA 3OB0H 3MRFA 3V7AE 1KCVH 1ITCA 4Y4KC 3AXLA 2SEBA 5E0FA 5KJRH 5J56B 1X7QB 4P9HC 5F7DB 3FONB 1CQYA 1A6VL 2JF1A 1P1VA 3A47A 4NJAL 3BMWA 3RBGA 2WLMA 3NZSA 1U8NA 2FJHB 4LCWB 3VU1A 2D4FA 2IH3A 4UDUA 4UM9D 4FA6A 1IQDA 4DF9A 1C5DB 4UTCA 1XVSA 1CFMA 1AKJB 1IC1A 1NLDH 1ZSDB 2O6PA 3DGDA 4XCCL 3OLIA 4TQ8A 2VERN 2HFFB 3S96B 3SKJH 3WBDA 3QYMA 1IM9B 4HH9A 5IHZB 4CVXA 3AACA 3LS4H 4F5CA 4MD4B 3S9DB 3HS8A 5F1IB 1SOXA 4S11A 1TMQA 4IBZA 1JZ7A 2HT4C 4EZJA 3JV6B 4UUJA 4XPAH 4F3FA 4IGBC 1G1YA 1RZJL 3MKGA 2DQDH 4PRNB 5AW9B 5T3ZD 2DQUL 3AITA 4J2QA 3BX7C 4TNFA 3LPFA 5FOJA 4ADJA 4HWBH 1EUUA 2ZP0T 4JFYB 3GGWB 4XN9A 4NP4L 2R9HD 3TL5A 3ZTDC 2ZOKB 3CVHA 12E8H 3C12A 2YD9A 3HFMH 4MTMA 3AS1A 4K55A 3TO4A 4C4BA 2VDNB 5KVFH 3BZFB 5AQ0A 3KLAA 3HI1B 3KPTA 5BRQA 3BEVB 5HYJD 4KKAD 4PWJA 3EJQA 3UPAA 2KUTA 4XB8A 4MQXD 4QOKD 1GPOL 2Y5TA 4G43A 1CS6A 3BWUF 4E9YA 3TPUB 1B9ZA 3CFBB 3VQ2C 4JLRB 1TVDA 4W9JC 4KDWA 3V4LA 4K94L 2DMKA 4IRZH 2EDLA 2PETA 4HPYL 4Q2ZB 5IROD 1ZGLB 1I9JH 3DRTA 1LK2B 4NHUB 3D34A 4OFQA 5D72L 5ANHA 1WLHA 2W91A 1HHKA 1U3YA 5ACMA 4X4XB 1OTSC 2E9GA 3UTQA 5I1KH 4ODHH 2XKSA 1EFXB 4HSAC 4PJHB 2Z1PA 3AC0A 3R1GH 4ZDHB 1Y6KR 1MUJA 3CV5A 3D85B 3CWGA 4GKZA 4UT7H 1N6VA 3T8VA 2APBA 5GGVH 3K6SA 1D5XA 4UYQA 1QPXA 4Z3IA 1F2QA 2NR6D 4ODSL 5FV2A 5SV3A 3F6LA 3UJJH 4BFGA 3ZE1F 1T04A 1SFDA 2K0RA 5TK2A 1TVBB 4FQ1H 3ZR5A 4NO5B 4Z7UF 4FFWD 4XRCA 4EI6A 5ID0A 2X9WA 4Z3EA 5J6HA 3M17B 4OLXL 3WTVA 2VDRL 2CMRH 4GQQA 2CO1A 2ADFH 4DNLA 2LR4A 3EH3B 1GJUA 2XCMC 4YK4C 4P23C 3C8KA 4PG9A 3ROOB 5F9OL 4MS6A 1J0HA 4GRWE 2YSSB 3PV6B 4ZX5A 3QJVB 1N12A 1TQBC 5KSBE 5MENE 2AJXH 4YSSA 1EFQA 1BXVA 2EE0A 1BVOA 2N0MA 3HMXH 1MFBL 2RFXA 1JVLA 2K78A 5FYJD 1NWOA 2QADB 2FWLB 3UP6A 2XZQL 1WGOA 2MOGA 2GK2A 1FRGL 4PIRF 3L5HA 2KERA 1U8OA 2EYRB 1CF1A 2AJ3A 4JPWL 5E8NA 1L9PA 2W07B 2VXTL 4P2OC 4QCIB 5BQ7B 2VUKA 4TTGA 4U1SA 1DFBH 3VACA 4PV1C 1XCXA 4BK8A 3Q8FA 4ABWA 1H3TA 4AENA 3P4MA 3WFBH 3NJLA 4CNIA 1FNHA 1JWUA 2XUWA 4P0DA 5H4ZA 1MCRA 3GLEA 3ABZA 1KG0A 2DIEA 1KXQE 1RERA 3QJUB 1AS8A 5AW7B 5F3BA 3RLSA 3F58H 5GRUL 3KW7A 1IGTA 1AGFA 3D0VA 3NP3A 4AW4A 3RWIB 3WXWH 1DQDL 3IMBA 3GSWA 1AMXA 2P8PB 3I50H 3GM8A 2BJMH 1AE6H 2FJGB 3DVIA 4E5XA 5EEZA 1AQMA 3LKPB 1HEZA 1LEKA 2W65A 4NNPL 2Q2LA 3NN8A 4U7SA 3OKEB 1VKXA 1DE4B 1T83C 2ZWSA 4AEHL 5IFJA 4ZRGA 4PY8J 5IW1B 2EEBA 4B95C 1EEZA 4KXBA 1FG9C 1P5VA 2IDQA 4LEBA 4HIXH 4UDTA 1O7SA 4FXGA 3QFGA 3D6GA 2DBLL 2DM4A 3OXRB 4JN2B 5JXAL 1T5WB 4ZQKB 4MMXC 1U8QB 4AGLA 3DOSB 4G6KL 3O6FB 2QQLL 1JNLH 2P5WB 2VL4A 3PWNB 2R0WL 4PB0L 5MP6H 2F19L 1SXCA 4Q9CA 3ZGIA 2YGVA 4NUGL 5CSBA 4R83A 3PHQB 4X5XA 2ZIDA 1SVBA 1RJLA 1JN6B 1S9WB 3HJEA 4KHTH 4NYLA 4KH2A 5EA0L 2W9EL 1G1KA 2V5YA 3ZIMA 3U1PA 4FX5A 5ICYB 1GS7A 2NQCA 3CC5A 3QJRB 4QXGH 3ZE2E 4DEWA 1J0JA 2ZX9A 3L3OB 3E1ZA 2VDPH 3V7AG 4ZYKB 1MFVA 3VM5A 3WS6C 1MHCA 1LO0H 4N2OA 3C2AH 1KXHA 1RUPH 5ITFA 4GG8A 1TJIL 4YDJA 4M9PA 5HI4C 2BSSB 3B9EA 1YN6A 1J1XL 2Z8VC 4PJXA 2XACC 1WH0A 1MN4A 3G9VA 3V52L 5MEPA 3MBWB 2DTMH 4K3EH 3U0TA 1GY2A 2SODB 3HG0A 4F37F 2NDGA 4IBWA 3G08A 3IE9A 3D4CA 4Z7QB 1KEML 3BSZH 5KW9L 3PWJA 2ESVE 3IFOA 1H3PH 2V9UA 1INQB 1A9BA 2JKIS 1TQUA 3MMEB 1OB0A 4Z8FL 4MZ2A 1JUFA 1PS3A 2VLRE 5CLTA 4PGJA 5DMYA 3I6KA 2BZCA 3HHRB 3QUZD 3BKYH 1AGDA 1MF2H 4NWUH 5I18H 1CFSA 3CN1A 5GSRA 4JKNA 1D5IL 4FA8A 3SHSA 4OD3L 3RPIB 3VXNB 3SGEH 4YHPB 1YYML 3MLZH 4WY7H 3QFJA 3L81A 2J6EA 1TT6A 4M7LL 2NOYA 1D6EA 3JWDL 1EERB 4KKCC 4ELMA 3DHUA 3EADA 3MO1B 4MJ2A 3W9EB 3RA7L 3U6XS 3OKLA 2AV1B 2BVTA 3G5ZA 4X99A 3MFGB 3MAWA 3L3IA 1KENH 4JDZA 2OMYB 2XZAL 4ENZA 2VXSL 2DQJL 5I0XA 4Z7UE 3PFQA 5GJSH 1NCUA 1WC7B 4HWEL 1BZ7B 2R0LL 1BQLL 4KDVA 4I9XA 1PAZA 2J25A 3P73A 3GEFA 4HUKB 5E4EC 2VM4A 5JLZB 2ALAA 4XP5H 4X7SH 5B8CB 4KMQA 1JGVL 1ZT7A 3S3JA 3QNFA 4R4ND 2A4ZA 4LL4A 4J3VA 4IMKA 5EEUA 2YPKB 4TPRL 3QEHB 2FWOB 4UU9A 1B2WH 3DBXB 2A77H 3QNYA 4LOEA 4PRDB 3IDXL 5FUCE 2O5YH 3SOBL 1ADQH 5DK2A 5GS2H 3VI3A 1JWSA 4QO1B 5DJ2A 3MSPA 3WG7B 3SKMB 1YMMA 3QA3A 3TA3A 4AYSA 1HQRA 3TN0B 3AUWB 3KPQA 3U46B 1MELA 2WQXA 4RSYA 2OW7A 1IARB 3RL2A 2H41A 2VDPB 3FFDA 1AO7B 4NC0B 5I1JH 1QBML 3ZSTA 2G3MA 3TLRA 5MEQA 1E90A 1T4KB 2QKIA 1T7YA 3KVQA 1Q9WB 1Q9LA 2WCPA 2F1AA 1MZZA 5E5MA 5C0JA 3B83A 4NRZB 3VO0A 1CFQA 1U95B 1W0WA 1BIHA 2XFXA 3DTXA 4G8FA 2F74B 4OIIH 4YBQC 5DMIL 3S3DB 2CBOA 4JRWA 3FHEA 4LOUC 1IKNC 1PCXA 4CU6A 2HLAA 5F0MB 4ZFOL 3G6DH 3MJ9A 3CSFA 3CFDB 5E1AB 4FQHB 5TGBB 4OM1L 1MCDA 2FZ3B 3UPCA 4BKSC 4M8QB 5EZOL 1TF4A 4E41E 1CL7I 1UD4A 1XGPB 1PDKA 1KCSH 2J44A 4KO9A 2OP4H 5FECA 5GZND 3BAKA 2ITEA 1KF9B 3C75A 5BVJB 1G9ML 4K3DL 4KZEL 2VUYA 3B2UC 3U30C 4OF3A 3LPGA 2F7OA 5I19H 1G7HB 1R3JA 3DJZA 3OHXA 4EF3A 1WA0X 3UTZA 3VD1A 4WLCA 2CGZA 3FDWA 4HKJB 3VA6A 2VUOA 4JKLA 1NAMH 3ZTEA 1BG9A 3Q8AA 2K3TA 4X5QA 3DX4A 4LHQB 5DS1A 5BPPA 4R6UA 3RWEB 4CGUB 2DJMA 3TIDA 2X87A 2O5XH 2WJ5A 3QIUC 1F86A 2CJUH 2IWGA 3SN6N 2XA8H 2DQEL 3LKQA 2E76C 3C60A 2W60A 3IF1A 4U1HA 5SWZB 3QGVA 4UTAL 1EHLH 3M1OA 4KZDL 2FX7L 5FDWB 3MOQA 4LPWA 1QP1A 3VRJA 1XAKA 2Z35B 2OTUB 3FQNB 1YEGH 4PJ5B 5AW5B 3NIGB 4FXKC 3VFUA 4XNBA 5KSUB 1MNUL 3VD0A 4QRSA 5F7NC 1F4AA 3DTUB 3IDMA 4OD1H 1NL0H 2AI0H 1TSHA 2C4FU 3ES6A 3U1SL 1PNCA 3US9A 3FS9A 5F1OB 2VLKA 4AM0B 1GGIH 1QQDA 2V9RA 4QT5A 4RWYL 3SGJC 4WTWA 5DO2C 2BFVH 2E6JA 4J1UB 5EO1A 3GUFA 1ZV5A 1MLCB 2P42B 1CVRA 3GXPA 4OT1L 4XZUB 5KYXA 1DP0A 1HZKA 4NKDA 1Q94A 2X4UA 3BAXA 3RKDC 4JANB 6FABH 1A7BA 4OZGF 4Y1TA 5FGCB 3TYGL 3RJDA 5B4MC 3NH7L 2BIHA 4L05A 4PS8A 4OZHA 4LLDA 4HXAL 1CYXA 2VLJB 5EZJA 1BX2B 4W9LC 2PKDA 2ICWJ 1AFVH 1YEEL 5FR3A 1UYWH 4JN1H 3CFNA 3S35X 5TD4A 4CJ0A 2XN1A 1DDTA 1K72A 4GG6F 1YEDB 2X4SA 3TZVB 4LCCA 4KNQA 4TQPA 3FT2A 4L8BA 1ET8A 1OP5K 4E9VA 2DLGA 1E7VA 4V1DB 2YD2A 4KOCA 2VR4A 5AZ2H 1HNGA 5G4NA 1LK3L 1DQIA 4H5SA 4OLWL 3K3QA 5KVMC 1F41A 1SMAA 5IK3A 1JPGB 3ALPA 4FC3E 3L9RA 2G3XA 1DBML 3IFLL 2NUPB 2EKSA 2ENYA 4I1NB 2IQAA 4F20A 4G8GD 4HH8A 4ZS7L 4RX4D 5F89A 4HJUA 4TULH 5HVHB 3P9LA 3HRZB 3A23A 2XQBH 2JKLA 3ZGHA 1BYNA 1NAMB 4LE8A 3S5LA 3HI5L 5CZKA 2YXWA 4PMEA 5CUSL 3C6LA 1H5BB 2IGFL 1LTXA 2A0LD 4KQ4H 3NRFA 1SOKA 3IXAB 2P24B 2IAMA 1BMWA 4PWIA 4NPKA 5DMGD 5F7MC 3Q48A 1MJ7L 1HQ4A 4IU2B 1P6FA 1QLEL 1DJXA 1LXMA 1JPFA 4YBLB 3IGFA 1P7QA 5EOTB 3BVUA 2LFGA 4PU2A 1HH6A 1TTBA 4Z7AA 5K9OB 5ETUA 5A16B 3VDBA 3EGDB 1OP5H 3QQNA 5EBWB 4I13B 1QSEE 5JPNA 1AP2B 3L4YA 3MX0A 4HIJB 1HILA 3ZKMD 2J7LA 4IM8A 2AXHA 2GEEA 3G9AB 1L7TH 3H53A 5ECGA 1OTTC 4ODVH 3UZVB 4JE0A 5EUOB 5HHOE 7CGTA 3H55A 5A2AA 4AQAA 3F85A 3PFUA 1A6WL 3DMMA 4PRPB 2Y2YA 5C0AE 3B9KD 5D93B 3BC9A 1G7MA 1LO4L 3CIQA 3R0MA 4M4PA 2KC0A 2Q5BA 3GSNA 1VGEH 3O6LL 4MD5A 5MEOB 3ARPA 3P4NB 5FLUA 2FHBA 1U3JA 1QFWI 3CFMA 3OAWA 4AIXA 4HXBH 2YUVA 4JX0A 2ZNXA 4QJ3B 4YSUA 5LUMA 5G4MA 4F2MA 3L7EB 4FG4A 4OZIB 3EYVB 3IJHA 3I6LE 1MJJB 3WIFA 4CMHC 4CU7A 2OMNA 3RTQA 1VZIA 1KSRA 1AZVA 1OAZH 1Y0LB 4GAJL 2XWJB 1TPXB 1ZTXH 2W0FA 1RZIA 2OL3A 4JHUA 4PUBL 4PRAA 3EYOA 1KTDA 1D9KC 1FORL 5CJ8A 3W3BA 2DIJA 2MNWA 3TCTA 1RZ7L 4K7PX 5D2NE 3JYCA 1OVZA 4G6JH 2YD5A 5GGUA 1RAMA 2WQRA 1HU8A 4UI2A 1F3JA 2AMGA 4H0LC 1NBZA 3QAZC 4PM1A 1GAFH 5E9AA 3MFFB 4YWGH 3T2NH 4JY5L 3QUYA 5ALCL 4H88L 2PCPB 1CGXA 4R8WL 4CN1A 1G4RA 1ZPUA 2MSPA 1XGRB 1TFPA 3MUY1 2I85A 5C0FB 2VN7A 1OCWL 1TYRA 1X5FA 3DGGB 5LAXA 2YPLB 3HE7D 3KPRB 2BPBA 4DSYA 1HHIA 2Q8AL 4KUCF 3C5JB 2IDCA 5C09B 2FR4A 4KVCH 4B7LA 1UXSB 1KMGA 1OP3K 4WFEE 2ZKHH 1WBYA 4HDIB 2IANA 3FO2B 3H3KA 4XPBL 2A9ML 3L3DB 5D7JA 3ZKSD 4K7PY 1IVTA 5IM7B 4CVWA 4GAAA 5C0CA 1RI8A 4N5EC 4OCWH 4F8TA 1M4KA 2OMTB 1JPTH 1WFUA 2CHWA 2VDKH 2Y7LA 5D1XE 2XPGB 5C0DA 5C0ND 4BUHA 4DAGL 1BIIA 1SEBB 5I30L 1C12A 3T04D 4N2IA 5KN5B 4YNYA 1XZ0B 4YHOH 5JYMA 5I28A 1TVHB 1T0OA 1D5RA 2Q6WB 3FSAA 3Q5TA 2OCJA 3GKZA 1UQSB 3S6CA 4JPKL 1E3XA 2UV3A 4OZGE 2FGZA 3ZTJG 4ZXBD 2I27N 3VWKD 2J71A 1CL7L 4JQIL 4BRJA 1K8DA 3JT0A 2FCBA 5D9SA 3ARSA 4QY8A 4Y2OB 3II3A 1OGTB 5B39A 2APSA 4GQ9H 2W9DL 5GJTL 2LU5A 1WFTA 2VR6A 4GSUA 4RVBA 3C5SB 4GKLA 4U7MA 5ACZA 5DD0H 4GG6E 3UBXG 2YRZA 3IAQA 1JF6A 4ELKB 3NFNB 5GGQL 3ARED 1GZPB 3P0GB 5D7IF 1NIFA 5B3JF 2X70B 3LS5H 5ESQB 4P9HH 1MIEL 4PREB 3BEWB 4EN3D 5I71B 3HEIB 3S35L 3RY6C 5LDUA 4MSWA 3VFGL 3CDCA 1MQ8A 4AOFA 4JO3H 3VSUA 5IF0B 3CSTA 3RHWK 3SKNB 2BRQA 5E2UH 4XP1H 1U8IB 4IHOB 1DO6A 1NJ9B 3T3MF 3U4EB 1UVQA 1MZYA 2IALB 3LDBB 1ZV9A 2VXUL 3AW5A 3BQUD 4YO0A 4JFHE 5DVKA 4FFYH 1EJ8A 2O6CA 4Z7VA 5F96H 1FNLA 1T0MA 2BNQA 1I3RB 1CU4H 2DQIL 4H8QA 3RJOA 5FUCC 3HNVH 2ADGA 3JV5A 2PUQT 3PL6D 4MDJB 5D2LB 1DDHA 4EI0A 3VGEA 2DWXA 2BY2A 4MNQD 1WA2X 4HK3N 1J5OH 4DGUA 2E8ZA 3MRGA 1FJ1A 3P0YL 3RYMA 3QNXB 1DJIA 5CJXC 2HJLB 3APMA 4FERA 4FABL 1TTRA 4HEPA 2YEZB 1MFDH 3MRBB 3TVMD 1BQHA 4FCHA 1ZT1B 4WKZB 3OBAA 5JMOC 1XCTA 4YVNA 5KSAB 1E67A 3MCLL 4AL8C 5IJDC 4RIRA 1HCYA 3HLAB 1Z9OA 2X4QB 5FYLH 5I8EA 4EI5A 3N1FC 2QGEA 4ONHA 3F84A 2ZG1A 3MV7D 3FNKA 3UACA 3RFRA 2GI7A 3P3YA 1MHPH 1FV1A 5E6IC 2XWTA 1WS7A 2VDKB 2JJTA 3FB7B 2XV0A 3OAZH 5JHLA 4FNTA 5DQJA 1NFIB 3F7PC 3J2PA 3F04A 3VXSA 1Q72L 1A3LL 4Z0BL 3TOPA 1T5XA 3D39B 1NWPA 5EN3A 1JFQL 2ZCKL 4WWNA 2JK5B 5HGDB 4NUQA 1MJUH 5D1QA 1NCAL 4OLZH 1O7DE 2YPVH 2A6JB 2YMOA 1KJ3L 4L5FE 5HGHB 5JHBA 5ISZE 3NK4A 1QNZL 1CDIA 4Z0XB 5DI8A 4NBYB 4AZ8B 3RNKA 2FX8L 5FGBA 3QIBC 5D6DC 4ZG1A 1A25A 1FFPB 2LLGA 4BZ2L 5FW7A 3FUFA 4Y4KB 4NCC1 4OFDA 3B2VL 1DEEB 2JIXD 5D7LA 1R33A 4WTQA 4XO8A 3ALXA 4KDTC 4OBRA 2DLFL 4JFDB 1MIML 4XP9L 2X4RA 1U21A 1NEZB 1UACL 3DVGB 2HTKD 2NDFA 3ZE0E 4FG2A 2MQCA 4CMMB 4EIZC 4G9FB 4OIBA 3WNPA 1BSIA 3FMGL 4XMUA 4TNEA 5D1ZC 2OSLA 3FQXA 2H8PA 2CAKA 3OGOE 2DIBA 3KWXA 4NS0A 5DS8A 1RZGA 2FLMA 4TSBL 3ZX1A 5DQDL 2KQNA 2IPKA 4KTEL 3TU6A 4DTGH 1EEYA 3LNEA 4YS4A 5CFHA 4FLQA 1OL0A 4GLRI 4XCNA 4YPJA 5EPMB 5E1GA 2Q76A 5C7XL 5J0BA 5J1AB 4KFMA 1NOFA 1DUYB 1UFUA 5JUEH 2B9BA 2BS8A 2D0HA 3LZFL 3NK3A 4OJYA 4Z7NF 25C8L 3Q01A 2AK4D 3ZDZE 4O02A 4YDZA 4IGBB 4TL5A 2IXQB 3VJ6B 1CC3A 4IU3A 4JNXA 1WD8A 1FBIL 3QC6X 1CLYH 3CH8A 5T33L 1JFHA 3KDPB 2NT0A 3BH9A 4M56A 1QFWL 3HKZA 1RURH 5C3TA 3SE4A 2EE6A 2YAOA 5DURD 4HBCH 4F2FA 5L7XH 5JNYA 3G04A 1A7QL 4M4RA 4L3AA 2PCYA 3I2CH 3IWVA 1XB8A 3B1UA 2HUEA 5IKCA 1KJ2H 4LDEB 4JE4B 5HHNB 4RISL 2UWEB 4YSAA 1KT2B 3OQRA 4W1TA 1M1XA 3CMOL 3W5NA 3IGAA 4PR5B 1UM6H 3DWTA 3T6VA 1PG7L 1N5AA 4LIQE 3NA4A 1LEGA 1U3ZA 4GRLC 1XF5A 3V5KB 2XWXA 1ZHLB 3RX5A 3SD5A 5B3JE 3GSVB 4YAQA 3ILDA 3BD3A 4JPIB 1XH0A 1KGXA 3U2SB 3AT0A 3WLBA 2YLKA 2ZCHH 4HUUA 3VDCA 1KB9J 5HBBA 5DWUL 4NUJB 5LB1A 4TVPH 3GMNB 1NPNA 1Y1UA 3SDAC 1AD9A 2R0ZL 1CWVA 2AXGA 5EORL 3W0WD 1JZEA 1T03H 4OCXL 4XC3H 3A6CL 3T3ME 5JXEC 2QSQA 2F15A 3MJ7A 1GZQA 2DI9A 1HHGB 1WRFA 3ULSB 1NCIA 1O0VA 2BVEA 1PKOA 1OB1A 1XTLA 3N43B 4R2GC 1NCCL 4LZKA 1I7RB 2FX9L 4LMQI 3T77A 4YHZL 4L4TB 4NPJA 4MLIA 3OF6D 4K3JH 4F2EA 1JMZA 4K2UL 4WNSA 2NSXA 1TJMA 2EP6A 5LGKA 3IKCA 3GQFA 3WELA 1JZFA 4BCXA 1MPAL 5IBLC 5E70A 2ISDA 2W0LA 1CURA 2X0UA 4O58H 5DR5L 4YK4B 4P23B 3WNIA 4B7IA 5EEVA 3EH4B 4N28A 2ZOUA 2ZSVA 1LQSR 2QKSA 1U42A 1TQBB 1HE7A 1VZHA 3K5RA 2D3JA 4JM2D 3ORJA 3EH2A 43CAA 1IGMH 1PAMA 5FM4A 1R75A 4IOFC 2AQTA 3T0AA 1XB6A 5F0JB 3WO4C 2IBGA 4PGZA 4EBQL 2R4RH 1E30A 2CM5A 4MXVF 1SVCP 4CADA 2CKBA 2HLFC 4JEGB 5I1HL 4PJBF 1YNKH 4NLAA 1PX8A 3BWAA 3F7YA 2Z31D 5EDSA 4QRQA 5GGVY 1OGAD 1URIA 4P2OB 1LP9A 3UAAA 3D3VE 1KBPA 1KJ2B 1XIWC 2C4FT 2FO1A 1IJ9A 4Q89A 1DVYA 5L6YL 1I1CA 2FNBA 1CGUA 1DBKH 2VTFA 4PYGA 5DK3A 3PWUA 8CGTA 1A1OA 4FEMA 2ZCZA 4Q9RH 4PJEB 4QKXB 5I76B 1X4XA 1CDHA 4LKXB 5SX4H 2KHAA 4A2DA 4M61A 1BWWA 5AVXB 2GVYA 2VDNL 2Y36H 1RPKA 3EBAA 4P3CL 3TBCA 1IC5H 3QEGH 4Z23A 5F7WC 4KVPA 5D7KD 1OE2A 1H15A 5HY9B 4BZ1L 4KI5E 4UM9A 2HSIA 3QQ3A 4YLQT 4LCWD 2Z93B 2NW3B 5GSVA 1DBBL 2CHZA 4MJHA 5CD5C 2QQNL 4AQ1A 5FYKH 2VW4A 1WTLA 3LKNA 3KXFE 3AXIA 1AKJD 3KPOA 3QWOB 7FABL 1SM3L 5TDPA 4GXVH 1MW3A 4QRPE 2AQNA 4ZUSA 3TH3T 1IM9D 4MMXB 4QRAA 1RFDH 3V4VL 4I2XE 5D1XC 5HYSG 1I31A 3PDGA 1P53A 3DLQR 4TNWF 5GZOC 3MYJA 4A7GA 2B08A 4LRNL 1MY5A 3HOGA 2VMDA 3CFCL 3Q9PA 2CO7A 2X4PB 4Z7NE 1XB3A 4U1NA 3MGTB 5E9DB 5IQOA 2B1HL 4J3SA 1IAOA 4XVSL 2WN3A 3OHMB 4YEFA 4MB5A 2R2EB 3RRQA 1MDAA 2V7HA 4PJCF 2Y69B 3F7VB 1GGTA 4HMEA 1FCCA 4Y1AE 5ENWA 4ABUA 3V6OA 1NLDL 4ZSOA 4B96A 4NO0D 3MRPA 4HX1A 5B38A 1HHJA 3KW8A 4Z5RB 3ELAT 2DLIA 5J9PB 2G5UA 5HYJA 3MREA 1JAEA 2OPCA 4FG6D 1F6FB 1MVUB 5D7HA 3ULVC 1LMKA 4QOKA 1YDPB 1FH5H 3R18A 4S1DD 1N9PA 2NNAB 3ENEA 4ZNEA 4X5PA 1L3NA 2YQ2A 2CGYA 2L0DA 2R2CA 4HOWA 2EXYD 4XPAL 5LWYH 2GTQA 1OAQL 1UCBH 2BLFA 2F53E 3SGDI 4U6YA 2DQDL 4J8RB 3L6FB 3DX8A 2OSYA 1UD2A 5IROA 4ISVA 4J3OD 4UZGA 1T2QH 2EDEA 3MLWL 5DD3H 43C9B 3A21A 1NDMB 1KBVA 1KPUA 2O4EA 5K9KB 3H7BB 4OKVA 5F7AA 1LE5B 4BV1A 5IQ7H 4HOMA 4W70A 1EFXD 5CJ5A 2TRHA 5KVFL 2H9GA 4ELDA 3MYZA 3BO8A 3D85D 4IRJC 4GEIA 4S1QH 1S7WA 3G5VA 4JFXB 3SE3A 2KL6A 5CM1A 2NR6A 2UZPA 4ETQA 4JQXC 4GT0A 1BQRA 1P69B 4JAMA 2PYFA 1JF1A 3K8MA 1JGLL 4GKSA 1QSVA 1OCCB 2ZUYA 4WW2C 3DECA 1BVLA 3MBXL 5C08B 4YGVB 3PQYB 4ONGH 1U2YA 4MCNA 3UL4A 4YR6A 4IRZL 2YA1A 2R83A 4L3EE 4HK0B 5E4EB 1I9JL 3M1CA 4LVOC 3V5HA 2FO4B 3T6WA 3TNMA 1PLGL 3BDBA 2RA1A 3V4UH 1TZGL 3RBSA 4ODHL 3BGMB 2VXQH 4DK3A 3VTTA 5CP3A 4JB9H 2NYKA 3I3DA 4AIEA 2G2RA 4IYKA 2A6IB 3CXFA 5EN2B 2JB6A 4FTVE 5AWNH 3NJIA 1W72A 4QRTB 1YEWA 3OKDB 5L9DH 2QADD 2ZX5A 5I23A 2ZJSL 3HAEA 1CBVH 2Y06H 3EFFB 2P80D 3HBPA 1LNUB 4JZOB 4WI0A 4FQ1L 4WI6A 2JJSC 5ESAA 2VZVA 1V8HA 4PJBE 4DGIL 2K4AA 1MCOH 4MDRA 1FG2B 5SWSE 3IRPX 5CNHA 3VE0B 1O7DC 3QJQB 1V7NH 3W37A 1XF2A 1C7TA 5HYEA 2VDQH 2ADFL 1G1CA 2DWTA 3NJVA 4GUPA 3I9GH 4LLWA 3UADA 1BG1A 4LSVL 2ATKB 5E94A 1S7XA 5T5NG 3ZN6A 2J1WA 1R24A 3A4DA 2XDHA 4UT6A 4KWUA 2AJXL 4YXKH 5CAYB 2YRPA 3WN5A 4AQOA 1OWRM 3QDJB 4XOAA 4JY4B 1K8IB 2OA9A 3N1PC 1XGUB 4BCZA 2CCVA 5CJQH 1OPGH 1ZTMA 1IFRA 3S88L 3B37A 1ORQB 5CCKH 5GRJH 1C1EL 5CR1A 5EC1A 1M7DA 3U30B 3TH2T 5KYYA 4AEIH 5FB8B 4UQEA 5TDNA 2F5AL 4G3YL 5JOFA 4GW5B 1DFBL 3HUJA 5D4QA 1SBSH 2R1WB 3QO1B 4G9DB 4WJG3 4LK4A 3EDDA 3P54A 3WFBL 5C1MB 1UKSA 5CBEB 4F7EB 2IGTA 1Q4NX 1E8WA 4DP9X 2EDOA 2GTZA 2F8OA 3O6FD 4YFDB 2NY0C 3FQWB 3IRZA 2NXYC 2P5WD 3F58L 3DV4A 3LZLA 3QIUB 2P8MA 1AACA 3WXWL 1KACB 4LLVB 3LQAC 4JFWA 4JG1L 1JWMA 1Z9MA 1ZT4A 2CLRA 3ZXAC 1AJ7H 3KPPB 5E95B 5ERWB 3VXPB 3ESMA 4HGKC 2BSCA 4X9FA 5JR1L 2HFGL 3P9MA 1DN0B 4HF5H 1QZNA 4HIXL 5DCCA 4EPSA 1UWXK 3OQ3B 1W0VB 5D5ME 5DRZB 4RMWA 5I74C 3SBPA 3WEAA 1BECA 1QHOA 1FHGA 3CHRA 5D71L 3RVUC 1W6WA 4H25B 2PTTB 3ZSSA 5D96C 3PAVA 1BZEA 1YPZB 3EYQC 5I1LB 3FO0H 4R7NB 1KPVB 4NEHB 3G5WA 4RBPH 5MP6L 2HUHA 2D0GA 3UTTD 1UJ3C 4DKAA 1WGVA 2J8OA 1X5MA 2J21A 4H2CA 2VDQB 1HSAA 2BSBA 4KK8D 1S7TA 1S9YA 4KHTL 1URZA 3DVNB 3QUZA 4PRID 3OZLA 4FQ2H 2W92A 4TNVK 5KS9B 2NCEA 1YC7A 2VDPL 3OLGA 3ETBJ 3VW3L 1J5CA 1LO0L 1LO2L 3SY6A 3N85H 1BOGA 1GZHA 1OF2A 4XCFL 3I85A 5CZXC 4DVBB 4I3GA 1UWFA 3QZWG 4HS3A 2Z65C 5F0LB 2CSPA 5D6CA 2DTML 1ZPLA 4GS7C 4K3EL 5AW6B 3NJJA 1XD0A 4MVBC 5AVQB 3ZTCC 4QGTA 1IAKB 4F7TB 3VRIB 1H3PL 4OGYH 2BIOA 4FE9A 5A7BA 3AQZA 1GGUA 4N20A 3O3DA 4QYOB 4FQQB 5E08L 2NY5L 3DDGA 4PW3A 5DC4B 3T6XA 2OMWB 2IADA 3QRFM 1LE9B 2OMXA 1N18A 2VXVH 2J1YA 2DWYA 2PP9A 1MF2L 3BKYL 2F68X 1KB5L 3LZRA 3QUMH 3L13A 2CDGA 4JO1H 4MJJA 4YDIL 1DJYA 3KDMB 1DANU 4HQQL 4JKPL 4M1DH 1MFUA 1IKFL 3MLZL 1BCIA 1CD8A 4M48H 2UUDK 2XVLA 1HXMB 3SYQA 1S46A 1SHMA 3VFWA 4UT9L 2XXMB 3V0JA 4A2EA 2CH8A 1FYTE 4WTZG 5I6PA 4LKCB 3TN0D 2VCOA 5E7BA 2R1YB 3N50A 1AO7D 3N55A 3VH8A 3HTLX 4HUXA 5GJSL 4G6AD 5L2JB 2BVQA 3AU1A 5KJ4A 2WVVA 5ES4B 1A1MA 2WBJC 4XP5L 2XV2A 2WXFA 1OD7A 5E7FA 4XVUD 2H0FA 2NNCA 4PLKC 1A21A 3KLAB 2ICCA 5LXGH 1T22A 3DX7B 5F1KC 3IJ7A 3BYYA 4AQ8C 5JHMA 1Z32X 2Y5TB 5GZNA 5IVXA 1R5IB 1IEBB 4C56E 4PWEA 2P43B 3ARDC 5I6MA 4KI5C 2LHAA 4DETA 2F54E 3LPOA 5EOCJ 1E9PA 5I1JL 4CMHB 4ZOCA 1IGYB 1TENA 2J5LC 4PP2A 4OQ1A 2OYKA 3IETA 3V8CA 3CSPA 3NEXA 3WIAA 2G75B 1ED3A 3QG7H 5E6SB 5E5RB 2BSTA 1D9KB 3WNMA 4OIIL 1KIRB 2AJYH 2NYYD 1QYGH 3F6IA 3LZQA 1MH5B 5DC2A 4K7FB 2Q7NA 3FQ2A 3TWCH 5EO0B 2FAUA 1NCBH 3K6SB 2Q3AA 1ZHBA 3QAZB 4Y4HC 1ZLEA 4AE1A 1UUNA 3HIZA 5PCYA 2EE9A 1QRNE 5AENA 4RMQA 3X11A 4R3SA 5F1NA 5J12B 2OP4L 1DZ0A 5J6HB 2R23B 4R4FH 3ZE2B 1QASA 3CTTA 1ADWA 3V0FA 1NFDA 8FABB 4Y8AA 3QJHB 4MNHB 4PJ5D 3WIHL 3QWNA 4AL8H 4ZFOA 1OGSA 4N25A 1YEFL 4L8CA 3GMLA 3MHZA 2X7LA 3OPZL 1VFAA 1NAML 3MV8E 2WD0A 2UXFA 5C0EA 3MA7A 1CICC 5AVYB 3CZLA 3B1TA 3KPNB 2F8VA 4EDWH 5CMAA 1JXDA 2DQHH 3CCHB 1KDIA 2X40A 1VERA 4JJHA 1XR8A 1YVLA 4AMWA 5CCJA 2JSFA 5FFOA 1JXJA 1AZNA 2QTEA 1T2JA 2P5ED 2XA8L 3D12B 5LGYA 1J48A 3OR6B 2QDVA 3MUJA 1EHLL 4WV1C 4KNUA 5KW9H 4FCAA 1NINA 1ONQB 2VLJD 3TASA 5F88A 3QQ9D 2OKMA 1A6ZB 4NQVB 4ODWA 4X6BA 1EDQA 5F6IC 5HDLA 3KPLA 4PJXF 1RZKC 4KUZL 4JO2L 4NQDB 2I9LB 3TZVD 1AY1H 1KLUA 3MRNB 4OD1L 5DJCB 4Q6KA 5CEZL 3WXVL 1GGIL 4FMFA 2IMMA 4V1DD 2BS71 4ACTA 4MMZA 1XL4A 3RU8H 3K2MC 4F37K 5I1AA 3NJNA 1T7XA 5KAQG 2JCCB 4OJDH 4DPCX 4G8GA 2XZCH 4PH8A 6FABL 4APQB 2X4TB 2W65B 2NW2B 4G6ML 4RX4A 2XQ0A 1JI1A 5K9QI 2PTVA 3CVCA 3FCTB 2AGJH 1ZK5A 2N7BA 1MW0A 3ME0B 3DYOA 3JWOC 4QXTA 4TTDD 3RIKA 3W2DL 1VKXB 1VZGA 1KLGB 1TZAA 4J3XA 4LOFA 3S4SG 3TT3L 2GY7B 3KBHE 4EO5A 4JN1L 3V4PH 4BCYA 2AQ1A 3H3BC 2A74C 2AMUA 3DOIA 3V0HA 3FH8A 3WY3A 4JZNA 4UB0H 4J3UA 4ELMF 2O72A 4YPGA 4GI9A 3W38A 4XBGA 4P5TC 1AR2A 4PS7A 4YFLI 3DK2A 5L2KA 3O2VH 2QPDB 3O2DH 3MLXH 3QR0A 1ITBB 1HVXA 1X5IA 1Z0NA 3PIQA 4KXDA 3VG0L 1QEWB 3ISWA 3FN3A 1SYSB 3VXTA 3HHSB 3ZT6A 1XBRA 2HJFA 4LVHC 1JZJA 2R56H 3R06B 3T09A 3WENA 4UQIM 4WTXA 3P4OB 4L4VB 4BHUI 4F7CA 1EO5A 4LP5A 2MCPL 2EIBA 2V17H 2CLZB 3GDBA 1JHLH 1VENA 4OLUL 2ZAGA 2XQBL 5E8OB 3VCLA 5GRVK 5JOEA 4OF0A 3S2CA 1HH9A 5F8QC 4KHXH 5M7QA 3B9KA 4PVNA 4NFBA 5HJGA 3PHSA 5E6IB 1MXGA 4KQ4L 4PRPD 3VI3F 4OCNC 3BJLA 3LSOA 4LU5L 1CFBA 3GKWL 2FEDC 4QKTA 3C2SA 5IB2B 4YE0A 1U3HC 4L3CA 2HZHA 4E41B 1KJVA 3C5XA 1EEQA 4U1KA 3GS4A 2D7OA 4Y9BA 4PN6A 1OY3B 5LNEA 5C9KA 4FN0A 4MAZA 1GXEA 2CQVA 3B2MA 1HDMA 4JRYE 2EZ0C 1YSOA 2EDWA 2GTWA 4N0UE 1A3RH 1JV2A 4GXUM 4XP4L 1AHWC 1K4CA 4PCTA 1CDJA 4QMEA 5DEFB 3JVFC 1CFSB 4R7DA 1HOCB 3N9GL 5IG7B 3QIBB 5IQNA 3EJJX 1H6TA 3OXSB 4G8IA 2VC2L 4PJDB 5CU5A 2PYEB 4HT1H 4HJGA 3QRGL 4LEOA 3ZTNH 1UGNA 1YC8A 3EO0A 4HKZB 1YEIH 1ECYA 1MHEA 3AWEA 4Y5VA 1U8CB 4KJPC 1HI6A 3GHBL 4FP8L 4NO2B 4DOHE 5HGBA 1U8LB 3E9TA 5TQ2H 3F6JA 4RZKA 4X99B 3LVEA 2Y07H 3OJ2C 5D1ZB 2VT0A 1A6TA 2B1OA 2J8UA 2XLLA 3HE7A 3T65A 3HC4H 5IR1B 5EEWA 3UG3A 2YPLD 3KPRD 1NGXB 4P2AA 2MQGA 4N85A 2ATAA 5C09D 4EZKA 4ZMYA 4CKQA 2CK0H 1RVFL 3L9EA 2ZWYA 1IO4C 3QRLA 1U41A 5DRXA 5ID1B 2TSBA 4TNGA 5GS1C 4EIBA 4RDQF 5EIIB 3OJDB 3QNYB 4M1GH 3OKOA 1KGYE 4AJWA 1EQWA 4D9QD 4GEJA 2CWRA 5AD0A 4B5EA 1F4YL 3R7QA 1W0YT 4K94C 1YMMB 3GBDA 4U0QB 2G0KA 3MLSL 3CXHK 4WWPA 4Z77B 3T2NL 1VFBB 1FIEA 4D9RE 3UBFA 4ZXBA 1T80A 3MOBL 3VWKA 3LN4B 1KTLA 1E65A 1A9EA 4CW1A 3H1ZA 3JXAA 1G7QA 4GAYA 4XMLH 4NN5B 4OGQC 1RK1A 3WS3A 3CFJA 4U1JB 4WHTB 4HISA 1XR9B 4YHIA 4MA7H 5AAMC 1A9VA 4OM0H 2ZKHL 1A14L 3MRDA 3AREA 3VYOA 3U6RB 2Q3ZA 4AYFA 4JG0H 4XNQA 4L8DB 2VRKA 4OCWL 2CGRL 4GRLB 4LCUA 4OZHF 4WI3A 4EN3A 1DQQB 2HTLC 5FYKU 3QZBA 4UILL 3ATDA 5AOKA 1E9OB 4XAKD 1KXVC 4CC4A 3MRJB 1JK9B 4HAGA 3BQUA 2HPTA 3SDAB 1KIQA 3CN4A 4L1DA 1M7IA 2IOMA 5DRWB 4JHZA 1I3GH 4XVTH 4YJZL 3QFJE 1SJHA 3ZO0A 3DV6A 4ZQTA 4DKFH 4WU5A 3PL6A 1GHFH 1OAYH 5DD0L 1DVFC 2H5UA 4MNQA 4R2GB 3HZ3A 2C8NA 3DUUA 2ZONA 4ZUUA 4YSCA 4BH8B 3LB6D 2OZ4H 4L48A 1KCUH 3ZDXF 3GXFA 4LRIC 3LS5L 2Q20A 3HJ0A 5JZ7D 1DQLL 5K93A 3M8OH 3TVMA 2FJFB 4PCSA 1WZAA 1QSEB 3VGDA 1IIKA 1G7PA 3TFKD 4V33A 3D08A 2J3SA 2ADIA 1BBJB 2BWIA 4JO3L 5DF0A 5CEYA 4XH2A 5INDA 3DETD 3Q8EA 5E2UL 5HHOB 1FZKA 2I7SA 4NSKA 5DEZA 3MV7A 5E8PB 2HMIC 3EW3B 3LAFA 5IFHH 3CFKB 5C0AB 1IT9H 5GRXG 3X12B 2CHDA 1QABA 3EGXA 1JGDB 2GCYB 2Y2WA 1R46A 4M6NL 1FC2D 5F96L 1PFOA 1V3MA 1CU4L 2XWRA 4OJEH 2HN7B 2EIZB 3VI3E 4HETA 1HL5A 4FFZA 5CLZA 1M6OA 2I07A 4PYHA 2P8LB 1L3WA 4I18C 4H0HB 4YGAB 1KCKA 3QS3A 2DMGA 1DZBA 4FDWA 3ULVH 3D39D 4AJYV 5M95B 5AYUL 4DERA 1RHHA 2WAQA 1MFDL 3KYNB 4NNYB 2B7DT 4NM8L 2YMTA 4PS4L 1ZLSH 4BFIA 4LLDB 1AIZA 3MJ6A 3RWGA 4OV5A 2FO8A 1XIWB 3NYKA 1YAZA 5IT2L 4UTBL 4LT7A 5FYLL 2OV0A 3P3UA 3UGUA 3CLFH 3OX8A 3QCTH 5FC9A 1MHPL 2JIXA 4RWHA 4Y4KD 15C8L 2CJSA 3Q2CA 3CZGA 1BPLB 1D6VH 3U7WL 1ZS8B 1UWEL 4BFEA 2ZPKH 4P46C 2NYZA 1BBDH 3SDXE 4JFDD 4W9IC 1AZUA 3MRHA 2DQGL 3ULUF 2NX5A 3GTTA 4F8NA 3GMOA 3QFDB 3UDWA 4GPVA 1E5UI 4G9FD 4DUXA 2WY3B 4IIZA 1NKOA 3E6FB 2XKNB 2BCMA 2JJUA 2VOTA 5C8JB 2XQYG 4GBXC 4OLZL 1FIGL 2OMUA 4MYPA 4ZO7A 1I1YB 2HKHH 3S36L 2KI6A 5JDSA 2DKMA 1RU9L 5FO8B 2X88A 4HIEA 4GMSH 4WWID 3RG1C 1RIVL 1XGTB 4HA1A 4Y9GA 4F57L 2QGCA 2WQUA 3L3GA 3L4TA 5CXPA 3U82B 5CD3A 3P2BA 4Y5XC 5DLLA 1FZMB 3SSGA 3S7GA 5D1XB 1AAJA 1A1NA 5F9AC 4E36A 4Z7OF 2HT4D 2AK4A 3EJSA 5KVEE 4NAJA 1CIDA 1P7QB 1G6RH 4AVKA 4IBVA 4ABQA 5ETUB 2F7QA 4IGBD 1WCBA 4HGWB 4IKNA 3IK2A 1HN1A 4PGBB 3CZNA 3CDGB 2QSCL 4JR9H 5FYLD 3GS7A 5IEHB 1P2CA 2H1PH 3HNSH 3LN9A 3BQVA 1NMAL 1E8XA 3NEEA 3BKMH 3O3AA 4TSAL 4QRBA 3QZNA 4RLDA 5F21B 4DTGL 1NCOA 3QBTB 1CMOA 2AW2A 2Q7AA 4P48A 3PDOA 4IOIB 3GSNB 4UQAA 3WEXA 2A6DB 1CG9B 4E5XG 3DX3A 4HZLB 1IQWL 1P4LB 2HVKB 4PHXA 1OD9A 2WBXA 3MR9B 1JD9A 5K33A 5INCB 2DV6A 2W59A 3DX1A 1RQ5A 4OZHE 4GRMA 3LNFA 1G7IA 4DGWC 2GHZA 4TQHA 3T08A 4LQFH 1CLYL 5H94A 5I24A 1I1RA 1SJXA 3D25B 4X8JB 5DVLA 4TLUA 1CYGA 3W0WA 1T5KA 4UINL 4PJ6A 1IUZA 1I7ZB 1KWGA 5DTFA 2XV3A 1OTSD 5A2FA 5DFTA 1VDGA 3FN0L 4Z95H 2E74C 2YD8A 4NENA 1XXDC 4AT6A 1OAKH 3QHZH 5HHVH 4UQBA 4IRJB 5H2BA 2DEYX 3RNQA 1E5YA 1YUHA 2VDLH 3OF6A 1UM6L 1XXFC 2VM3A 5DDHB 4L4TD 3ROLB 4OI9A 2G5RA 2TAAA 4YIQA 4OU3A 5LVEA 2D4DA 4M5SA 3FTYA 1NAKL 3ZDXE 3QUYB 3I75A 3CSYA 4WW2B 4J27A 4X7DC 1QA9A 3LQAH 2YAFA 1GKEA 1A6AB 2HCZX 1WAAA 2XI9A 4P23D 5GS3A 1OXYA 4Z7VF 1P5UC 2VSCA 4FKEA 4MWFB 4KGLA 4LVOB 4JM2A 1I8AA 2R29A 1R3KB 3OPUA 1T03L 3N91A 3WMSA 3GSOA 4XC3L 2YGNA 2YBRB 4ZODA 3TBVA 3SE8H 5T3XL 4QTFA 1RUMH 1S8DB 2R69H 1G6RB 3JV4B 3N0PB 4KKRA 4LLQA 4KFZC 5D7JB 2ENPA 2FBJH 3S3PA 5AOLA 1BZ9B 1DJZA 1BAGA 3B2DC 1NA8A 2Y2TA 2LW3A 1DSFH 2I26N 1V27A 2HLEB 4NKMA 5CGMA 4K3JL 1CXHA 2B77A 2MEJB 2Z31A 3MLVH 4GSDH 1OGAA 4DN3L 2IBZX 1FFNB 1MY7A 2V33A 5AVVB 4HZAA 2VN6A 1CZ8L 3D9AH 3CVBA 4P2OD 1Y7VA 3J07A 3JUZA 4QDGA 5ISZB 2WN2A 1T1YB 1M71A 3VXRB 5FA4B 2GJZA 2YA0A 4AXWB 4I0PC 4O2EB 2YAMA 5HHME 3QQ4B 2CDFB 4F27A 3K6OA 4L4JA 2WLNA 1IGML 5HI5C 1H3WM 3EDEA 1X7QA 2O6EA 4H20L 4M7JL 4EQ2A 3QO0B 3B9AA 2GEQA 2I60H 3FTZA 2JKXA 4WJKB 4WFHE 4BUQA 3L08A 4K9JA 1EGJL 3N1MC 3ZE0B 2LVEA 4PB9H 5LG6A 4HCFA 2BVYA 2FJHA 2IBZY 4LCWA 5E08H 1EO7A 1MCHA 4TVPD 1W8EA 2E56A 1C5DA 3A67H 3ELQA 1AKJA 4ONFL 4YUEH 3NA9L 1WK0A 1HINH 4GP5B 4L8SA 2LT9A 3D48R 3I3BA 1Z7JA 2HFFA 3K6NA 3S96A 3NESA 1IM9A 5IHZA 1DBKL 1PSKH 4MD4A 1W9XA 4JCLA 4LCIH 2VDLB 4KKBC 1WE5A 5F1IA 5I0DA 1OW0C 5DFAA 2YZ8A 2K1MA 3M46A 3FRPG 3MUZ1 3Q2LA 4ZX4A 4QJ4B 2NXYB 1F4XL 3I3EA 2R15A 5EU4A 3JV6A 3ZDZB 2Y36L 4HGMA 1MRCH 1IC5L 3EUUA 3PUCA 4PFEA 2N1TE 3K2UH 3N41F 4PRNA 5E9DD 3GMPB 3IDIB 4X80L 2WXQA 2NY4C 5AB0A 3TF4A 1I75A 3PAYA 1XCTB 4JFYA 3GGWA 4TYUA 3O6MH 4K5OA 1F8TH 3OTTA 1CGSL 2ZOKA 4FJYA 3FUEA 1P84J 3HPLB 3KLHC 3UJTH 4B6ZA 2Q0ZX 2HFEB 3FOMB 2VSKB 2IANE 4Q6YA 3BZFA 5I74B 5HI4D 3IMUA 3EDFA 1LO3L 3HI1A 1XTMA 3JSSA 3BEVA 2CALA 4XMPH 4LSUH 2HT2C 2FATH 4LQ1A 5D96B 1UJ3B 3P0VH 5MHSD 4HUMB 3TPUA 4Z7IA 1IB5A 3U0WL 3CFBA 5CLXA 1IEAB 4JLRA 1WFNA 3GJFK 4Q2ZA 5IUCA 3KR3H 3PHOB 1ZGLA 5C0IB 1LK2A 4ZW8A 1VPOH 3SKUD 1NGZB 1HT6A 3VSQA 4F33B 4I89A 4X4XA 1RP8A 3S97C 4PVBA 5F7EL 4Q0XL 1EFXA 4PSPA 4PJHA 3SYOA 2B0SH 2F5BH 2CUMA 4ZDHA 4WUUE 1F42A 5CHNB 4YZFF 3D85A 3NSYA 4RDQG 5FO2A 3CDZB 3S5ZA 4A2LA 5J06A 2MMXA 3IXTB 3D30A 4JGMA 4GS7B 1Z9SB 4KKCD 3WE1A 2EXTA 1FH5L 4YMPA 2MPVA 1TVBA 2QVIA 4NO5A 4Y2NA 3J7HA 3M17A 1ERNA 4Y4FC 4MD0B 4AJVA 5FYKD 1IBYA 4M8RA 3HPJB 4YHLH 3FQXB 3FB5A 1E2WA 5IHUH 1T89C 1MCBA 5C08D 1FPTL 3PQYD 3ROOA 1BFVH 1ACCA 1N67A 4NIYE 3UJIL 2YSSA 3PV6A 3GMQB 4NO3B 4JFPB 2X0VA 3MA9L 4OLEA 1OP9A 1SLWA 1I8LA 2C1OB 1YNLH 3H9YA 3DHPA 2DICA 1OP4A 3A0OA 5CCGE 5BUAA 4LASL 4KXZH 2E7LC 4NN7C 4RA0C 2C7UB 1LGVA 2HVBA 3TA3C 2L7JA 3CFIC 3ABGA 3I6GB 3S34H 2P80A 4EXPX 4HWBA 3SQOH 5E2WH 1O9ZA 2OS7A 4QHLB 2EYRA 3AUVA 5B1KA 5B7FA 1LM8V 2W07A 4LO9A 3HMWL 4QCIA 3TTSA 5BQ7A 1LQBC 4G7VH 4PS3A 3GRWL 3GEWB 3NCYP 4X5RA 1KGCE 1UASA 5G2NA 5EZIL 1OO2A 4EIGB 3LEYL 5JNYB 4JFOB 4K5MA 5T5FH 4Z18A 1JCVA 3LV3B 4O5LL 4YBQD 1IGIL 1RZKH 4CSTA 3WEMA 1ET7A 5J4MA 1G5GA 4LOUD 2C9QA 3QDJD 4JDVB 2F61A 3KGRA 1X6NA 1XSOA 3VXSE 2XN9E 4F7PB 3KPMB 3RWIA 4JKWA 1HXKA 2Y3NA 1D7CA 2P8PA 2EICA 4QNPF 1JJUA 3F12B 4XPGL 4P2RE 2FJGA 4IRZA 3HS0C 1LP9F 1T2XA 1FP5A 1FNEB 3LKPA 3U83A 3ARDB 4FNLL 1U0QA 1KEGH 5D1QE 2ZWNA 3OKEA 4HUWB 1DE4A 3B2UD 1MCOL 4MDIB 5IW1A 3QUKB 2J5LB 3KXFB 1P9MC 3N42B 3RY4A 3I9GL 4N86A 5D7SH 2JQAA 4YLCA 3JWOH 4JN2A 3OXRA 4QRPB 1ZLUK 1T5WA 5GRZA 4ZQKA 4NRYB 3Q06A 4M7KH 1U8QA 4ENEC 5D7LE 3DOSA 4YXKL 3O6FA 3NTCH 1YECL 1KN2H 2DTSA 2P5WA 4I2XB 3PWNA 3H54A 1ET5A 3WNJA 3QIUD 1J10A 2R2HB 3AT9A 3KEHA 5FOBB 4Y4HB 3AROA 4MXQC 4FQLH 3WKPA 2ITDB 1ZVSB 1S9WA 3MZGB 5GRJL 2IPUG 4L1LA 2FTAA 5ICYA 5MI0C 5T1DH 3K0WA 1EHAA 3D18B 3L3OA 2RCSH 3PV7A 4APXB 4ZYKA 3BUBA 1QOKA 2E27L 4Y1AB 1T4WA 1HK6A 5EUKB 3DROB 3HMXA 2C9VA 4F8PA 2BSSA 3NGBC 1F02I 4AY0A 1C9SA 1CICB 3DIDA 1N59B 3HE6C 4A7GF 5DO2D 3MBWA 1A6VH 3UBXI 3PP3H 4TNWK 4NJAH 1ZANH 2JKRM 3U4AA 1GMIA 2ZNWA 4C83B 3B5GA 4Q9QL 3UTTA 2Z0BA 2WP3T 4QPEA 1PX3A 3RKDD 1INQA 5AL8A 3MMEA 1RIUL 1E28B 5FHBH 5B4MD 4OF6A 4WV1B 4QRQB 4PRIA 3ZYIA 3RY5A 3FT3B 4XXCC 4W4OC 1TZOA 5F6IB 1GYAA 4XCCH 4HF5L 2CRMA 5JQHC 4OGAC 2Z6FA 3RPIA 3VXNA 3VXUE 2XG5B 3LIZH 4YHPA 1K9TA 3MRRB 2QVFB 4Y16C 3MUUA 1J05B 3KS0H 4BK4A 3KCWA 3ETSA 4KK5C 1D7FA 2DWSA 1J9QA 4YZFE 1ZEAL 5AAWC 3MO1A 3W9EA 3FO0L 1X5JA 2DZEA 2AV1A 3I74A 4AG4L 4NI6A 3VYNA 4XO5A 3EG9B 3LRKA 1DBAH 1XCQB 1WC7A 1Z1WA 1BZ7A 3IM1A 4NP4H 3ESVF 5J6GB 1IBGH 2V3EA 5KWYC 3CAFA 3RUGB 5JLZA 4KGJA 4K9EC 5B8CA 4QTHB 4UQ2B 1JVKA 2A74B 2ZTBA 4IS6B 5DHEA 4MJ5B 1MRFH 1QEXA 2QPSA 2YPKA 3N85L 3QEHA 2FWOA 3DBXA 3AXHA 4BA0A 4PRDA 2BHFA 4JFQA 3H6JA 4FTVB 4P5TB 4DPRA 2BOCB 2APXA 4M3KB 8PAZA 2ICWB 2XICA 4QO1A 2VQ4A 1A5FH 1GPOH 1EAJA 3P77B 4I3RH 4J4PC 1QACA 4XXWA 3SKMA 3ZY7A 4XE0A 3TN0A 3U46A 1D7BA 1U2CA 4X6CA 1BVNT 4GH7B 4LVHB 4K5LA 4OGYL 1AO7A 1I85C 3BKJL 4KC3B 2BINA 1SRDA 5SWSB 4K94H 4UNVA 1T4KA 2HPOA 3LHPH 2H3XC 2R7EB 1B0RB 5B39G 2OR7A 5D72H 2IGLA 4JDTL 1Q9WA 1OTTD 9CGTA 3QG6B 4F9LC 2UXTA 3DX9B 3ECQA 4NRZA 2DLEA 3DUSA 1U95A 1WIOA 3AU0A 2F74A 4AVJA 5ESVA 3QUML 5K1JA 2K8MA 1MAML 3IYLW 4GKNA 4AZUA 4FNUA 3UZEC 4M1DL 3BSZA 5HYJB 2A7BA 2HRGA 3MREB 5E1AA 1MWOA 3CFDA 4FQHA 5TGBA 3WU1A 2FZ3A 4ODSH 4M8QA 4ZUVB 3BMVA 1XGPA 4MAYC 3LH8A 1FWXA 2DLTA 3IPFA 1ZXQA 2WWKO 4QD2E 5AZEL 4OLXH 5E23A 4QNPE 2OCCB 2VDRH 1DL7H 3B7TA 2GITB 3T0BA 5F9OH 1AHWB 1G7HA 2ZXBA 2XZZA 2L7UA 2C9RA 3M6DA 5AW4B 4LARL 3OJVC 4WF7A 4HKJA 2EIMB 4CL7A 2BHUA 2X53A 1I82A 4BH7B 4N8CL 2BNUB 4GSQA 1D9KD 4ZX3A 3OLDA 1BV8A 2V4LA 3RWEA 1MFBH 2HVJB 1EEUA 4KMTL 4M5TA 3NIDF 5FXCH 1C5BL 1UEYA 3KGSA 3P3RA 4LBAA 4N2BA 4KTGA 3T2QA 1FRGH 3LKSB 4GY4A 3IDNB 3WKQA 1NGWB 2QTVA 2DEXX 3KYKL 2DN7A 5SWZA 4FJ6A 3VAEA 6PAZA 4UOZA 3VQMA 5KZCB 3E38A 4JPWH 4FZ8H 4PJIE 2K9FB 2VXTH 3HUJF 4Y1SA 5C0BB 5FDWA 2EIEA 4HIPA 5F72S 3TH4T 4ZMAT 2OTUA 3FQNA 4PJ5A 4C4KT 1UD3A 5KSUA 1X5YA 3IGLA 1ZXKA 4NQXB 4F7KA 3KWWA 3CU7A 3QG7L 5D5MB 1ADQA 2DD8L 4AM0A 1CXLA 3C5ZC 2ZCLH 3FSOA 5I82A 5GS1B 1GOHA 2JLLA 3FH5A 4J1UA 4R7LA 4BKTC 1QYGL 1OSYA 4LSPL 1MLCA 1JZGA 3PCYA 4XZUA 3TWCL 4N5ED 2GUYA 2CBQA 1DQDH 4DP5X 1OSPL 1NCBL 2WUBL 3HG3A 2B1AL 1S5IH 4JANA 5T3ZE 4HWNA 4NNPH 3CH1B 3BVDB 2Z3FA 2VLJA 4NZ8A 1OQXA 1BX2A 4WGKA 5A6IA 3I9AA 1NCTA 4LLWB 2FUTA 3V6OE 1QFHA 1YEDA 2FEJA 3OZKA 4JRFA 4ZSOE 2H3NB 3TZVA 3EXLA 3WOVA 2UZIH 4DKDC 4RAUB 3SPIA 4G6KH 3MRCB 4V1DA 4KK9C 2B16A 1SY6H 1KGWA 3KYOB 2GJJA 1HC1A 4MKMA 3Q5YA 2R0WH 3FU7B 4KX9A 2J73A 4PB0H 4QOKE 2EACA 2XJKA 1T7WA 1JPGA 2F19H 3RGVC 3PWVB 1WT5C 2E9IA 2VDRB 4KRPC 4XNUL 2NUPA 1KBBA 5GQBA 1UOLA 3Q9QA 3B8YA 5F2FA 1Q9KB 4KTYA 5EA0H 2W9EH 3S37H 4DO6A 4XVJH 5E51A 3HRZA 1QSFE 1NAMA 1TJXA 2WC7A 4S0SD 5JTWA 3X14B 1H5BA 4WCYL 3WJJA 2EC9T 2VRAA 3UOAB 2EVGA 1TJIH 4NC2B 3IDYC 3IXAA 2P24A 1PW3A 1YN7B 3FOLB 4NN6C 4PIBA 3V0AC 4FNQA 1FVEB 3V52H 4IU2A 4FG0A 4PD4K 1DVFB 4M7ZC 2PR4L 1MVYA 4YSPA 4DQAA 4S10A 4NQSB 5A16A 4PJAB 3EGDA 4RGOL 3IGKA 4EOWL 6TAAA 1I9RL 5EBWA 3QWRD 1AP2A 5HTSA 4DCQB 2CLRB 4HIJA 4L4VD 3FQ4A 3PPSA 1KLFB 1OAXL 1SDAB 1U8HB 1U8KB 4JUSA 4P2QE 3LH9A 3UZVA 3GD1C 3WNKA 5EUOA 1EZVX 3LXAA 3UABA 1D5IH 1UKQA 1WD9A 5FK9B 1DVXA 2Y0SA 3STLB 1MEXH 5K1VA 1BYPA 2WOBA 3V4PL 4OD3H 3M45A 4PRPA 1YYMH 5E6ID 2AAVA 4UB0L 1DVUA 4TS6A 5HPMB 4HEMA 1N3NB 5FYJE 3TBWB 2DEWX 4JFZH 5MEOA 5TPWH 3P4NA 4HMDA 1YO4A 3TEZA 4I18B