3OD3A

Cueo at 1.1 a resolution including residues in previously disordered region
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
488
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 143
structure length 488
sequence length 488
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3od3A03
2DWTA 4QKTA 2CCWA 2CUAA 2BZCA 3N55A 3CG8A 3WI9A 4MFHA 4YSOA 1QHQA 1A4AA 1XB3A 1KGYE 2IDTA 1PNCA 2HRGA 4PCYA 3FSZA 8PAZA 3CDZA 2PPAA 2OV0A 2YAPA 2VM4A 1MG2C 4HZ1A 1PCSA 2VW4A 3PAVA 4A2FA 1HFUA 3S8FB 1FA4A 3FPXA 4YL4A 1ASOA 3MX0B 5I6LA 3IE9A 5PCYA 1ET7A 1E5YA 1CYXA 2QT6A 1OV8A 5I28A 4DPAX 4BK5C 1SF5A 1GYCA 4E9XA 5D4JA 3BQVA 4KNTA 4AI7A 1NWOA 5AFAA 1A8ZA 1SDDB 2OJ1A 4BWTA 1AZNA 2IDQA 3NJGA 1J5DA 1RZQA 3IBOA 3NJMA 3AG3B 1ET5A 4DP2X 2IWKA 1FWXA 4BDVA 4GYBA 2VSMB 1NIDA 4X4KA 1BQKA 1WS8A 1ET8A 1PZCA 1KV7A 4KO5A 2GBAA 4WTQA 1NINA 2XXGA 5F7AA 2BP8B 2TSBA 4A68A 3TU6A 3AW5A 2HZHA 2DYRB 1E67A 4HHWA 4DPBX 2FNWA 4FAAB 3NJIA 2XX1A 3FQ2A 3SBRA 3FS9A 4JHUA 4E9WA 2MRYA 3X1BA 4UANA 1SF3A 2UXGA 1UATA 2HX9A 3AG2B 4GXFA 4E9SA 2PPFA 1JZIA 4GY4A 4YSUA 1OE2A 1DYZA 2PCFA 1GW0A 3FYIB 2GC4C 2X87A 2XLLA 1ZIBA 2PLTA 1GS6X 3FU9A 1RCYA 3CVBA 3FYEB 4P5RA 1AS6A 1ETJA 2BZ7A 2GIMA 2VW7A 1XB8A 2I85A 3T6WA 1QLEB 1XB6A 2QDWA 3AY2A 1T5KA 2Q5BA 3RYMA 1FFTB 2W88A 3BVDB 1OF0A 3QJUB 4KOBA 1W8EA 4L0PB 1OE3A 9PCYA 2VN3A 2IWEA 1JZGA 3FSVA 1J9TA 3AZUA 3QJVB 2GI0A 1ILSA 1BQRA 4M4RB 2XX0A 4KOCA 3V9CA 3H4HA 1JVLA 1WA0X 1AZRA 1W6LA 3NJNA 1A4CA 4DP1X 1ZDSA 2DYSB 3NYKA 1AZBA 4EF3A 1JVOA 3EF4A 4A2GA 3T6ZA 4YSRA 4G7RB 1PLAA 1AIZA 1PMYA 1BXAA 1BAWA 1JXDA 2PCYA 4GP8B 1AACA 2PPDA 1OCOB 1JXFA 4KO9A 1TEFA 1AZUA 1L9TA 3NJLA 5TK2A 3L45A 2QPEB 4HCIA 3SBPA 1A3ZA 1AANA 2LLNA 1YLBB 1NDTA 2HRHA 3CVCA 3NP4A 3OQRA 1SNRA 3KW8A 2IAAC 3WIAA 1AR1B 4Q8BA 4AZUA 3QPKA 4AKOA 1NTDA 1ZDQA 2BW5A 3WKQA 2R7EA 1OOWA 2FTAA 1KBWA 4BWUA 3GXUB 3ABKB 2AFNA 4DP8X 2PPEA 1L9PA 3NP3A 4W1TA 4HHGA 1E30A 4P5SA 5AZUA 1JERA 4GP5B 4E9YA 3SBQA 1OE1A 1BXUA 3PXLA 4GP4B 4HALA 4YVUA 2HLEB 2VW6A 4E9VA 1DZ0A 2JKWA 2H5UA 2YAFA 2BWDA 1PAZA 2X88A 4AKQA 2PP7A 3TASA 2PP8A 1M57B 4CSPA 3S8GB 1R1CA 2AZUA 2ZONA 3FT0A 2FQEA 1OCCB 2Y69B 4PAZA 3U25A 1KCWA 3TBCA 1HAUA 1GS7A 2UX7A 1KBVA 4FA7B 2VSKB 1WA2X 2QPDB 3IN0A 2JFCA 2XV3A 1KYAA 2TSAA 5IY5B 3AG4B 5F7BA 3IN2A 1SFHA 2P80A 2YAEA 4N8UA 2IWFA 4AX3A 2BP0A 2J5WA 2BWIA 5AKRA 3NSFA 1URIA 4G70B 4E9RA 4NAJA 2RACA 1MZZA 2XVBA 1L9OA 3ZIYA 3T9WA 1ILUA 2B3IA 2EINB 1WAEA 1J9QA 2XU9A 2ZOOA 1SDDA 5I5IA 1KDJA 1TU2A 3X1NA 4A2DA 2XXFA 3WNJA 1JZEA 3UGEA 1KDIA 2NRDA 2YXVA 3HEIB 1E5ZA 4KO6A 1BQ5A 1MDAA 1GSKA 2CBPA 3ABMB 1ZPUA 2DWSA 2R7EB 1I53A 3NJJA 3CZUB 4BDVB 4WKXA 1A4BA 1JZJA 3QQXA 5B7EA 1V54B 2XYBA 4YVNA 4HIPA 2YAMA 1F56A 4E9TA 4YSAA 5I5MA 1RZPA 3DKHA 2IH8A 2FQFA 3HB3B 2UX6A 3DIVA 3NJKA 3ASNB 4RH4A 3S3CB 1KCBA 2P80D 1AS8A 4TXVB 3OM3B 3UACA 2XUWA 2YXWA 4JHVA 1M9WA 2B08A 2IDSA 5B1JA 3PAZA 3AG1B 1EHKB 4KO7A 1PZBA 1N70A 1AG6A 1JZFA 4KNSA 1NICA 2CALA 4DP4X 2DY2A 2AANA 1L9RA 3FU7B 1ASQA 1NPJA 2YQBA 7PAZA 1V10A 7PCYA 4JKNA 4DP6X 1SHWA 5D4HA 1NIFA 2E86A 3OMNB 4YSTA 2AVFA 4HCGA 1PLCA 4G7SB 1JOIA 1AOZA 1V55B 2FT8A 3V9EA 2IDUA 4G7QB 3EH5B 2DV6A 3GDCA 4W9ZA 4YSEA 3FPYA 4DP5X 2XV0A 1IBZA 1J9RA 2FT7A 3SQRA 5I26A 3OMIB 2J56A 3PLYA 2JXMA 4UF7C 5I6OA 1IBYA 3DTUB 2XV2A 2A3TA 3CVDA 4UAHA 1SJMA 1CUOA 2BP0B 6PCYA 2HX7A 1B3IA 2I7SA 5B1JC 3ASOB 1MG3C 1PLBA 3FQYA 5I6PA 5B1KA 5LDUA 1L9QA 1CURA 1AS7A 3D12B 1IC0A 4AKPA 1AAJA 3UAEA 2QDVA 1M56B 4CSZA 3GYRA 2H47C 1IUZA 2BP8A 2EILB 1GS8A 2IDFA 1GR7A 4DPCX 4QLWA 1ID2A 2EIMB 1HAWA 3NSCA 3QJRB 3FQ1A 3NJFA 3WKPA 4ENZA 5B3SB 1BXVA 3UADA 2GSMB 2UXTA 2AZAA 4BXSV 3EH3B 5I5JA 2J57A 1J5CA 5D4IA 2FQDA 2Y1AA 2MTAA 2YAHA 2PP9A 4ZK8A 4A67A 1L9SA 1W6WA 2WO2B 4BXVA 3ZX1A 3WG7B 3WNIA 4KNUA 3QJSB 4DP7X 1N68A 1AG0A 4G72B 2CAKA 3FU8A 4YSSA 4DP9X 2ZXWB 3T6XA 4DP0X 3FU7A 1XMEB 1TKWA 3QJTB 2IH9A 3X1GA 1GY1A 1WS7A 1ZIAA 6PAZA 2VMJA 4N4YB 3CDZB 1A65A 3KW7A 1OCZB 3C75A 3X1FA 4YSQA 4NB7A 1MZYA 1EZLA 1AQ8A 1QNIA 3MBWB 4Q89A 1NIAA 5TK4A 4A2EA 2YAOA 3OMAB 5B7MA 1PZAA 1NIEA 3PPSA 3ABGA 4K9JA 3TA4D 1JXGA 4BWWA 3NJHA 4F2FA 5E9NA 2FJSA 3FSAA 1ADWA 2EIKB 5FC9A 1PF3A 1PNDA 3PCYA 4YSDA 2XWZA 1X9UA 1WA1X 4A2HA 3JT2A 3EHBB 1NZRA 2CJ3A 1BEXA 3NSDA 3H56A 5PAZA 5I6KA 1NIBA 3EH4B 2GB2A 2UXFA 3S3DB 4A66A 3S3BB 1NWPA 1IKOP 2BO0A 3QJQB 1BYPA 2FWLB 1CC3A 2GHZA 1ZV2A 3X2QB 3ZBMA 3H4FA 4YSCA 4E9QA 1J9SA 1SFDA 3IEAA 3NT0A 2ZWNA 1X9RA 3PAUA 2FQGA 1OCRB 3UABA 1TEGA 3G5WA 2BHFA 5I6MA 3ZDWA 2VM3A 1CYWA 3FSWA 2WSDA 3T71A 2W8CA 3OD3A 4M3HA 3NSYA 1NPNA 1RKRA 3JTBA 3UAAA 5B7FA 3X1EA 2YARA 2J55A 2WO3B 3N2JA 2UXVA 4G71B 5EHFA 5A7EA 4F7KA 2HXAA 5B1BB 3TBBA 4YSPA 1ASPA 1E65A 2OCCB 2I7OA 1VLXA 1JZHA 2EIJB 1PY0A 2Q9OA 1BYOA 1AZCA 2YAQA 3ABLB 4HAKA 3T6VA 5ANHA 3ERXA 2H3XC 2PPCA 4NERA 1GY2A 2HX8A 4HCFA 2FT6A 2BW4A 2N0MA 2GC7C 4F2EA 1SHXA 5B1AB 5I6NA
chains in the Genus database with same CATH superfamily
3FOLB 4LPCA 4ADGA 4EIBA 4FG2A 4NQVB 3DX9A 4PQXA 1MCWW 2GEEA 1EANA 3GMRB 4IBWA 1T4KA 4D8PA 2AV7A 3RILA 2IQ9H 4G6AD 3CDGA 5E08H 2X1XR 2JV6A 3J8F7 4NKOA 4ODHL 2OV0A 3KYKH 5E8NA 5E2VH 2YD1A 5T1DL 1MG2C 4G8EA 3PAVA 3GHEL 1YEIL 4PJGA 1I3RB 1NOFA 5JHDE 1W0WB 3N04A 5C09D 2L7JA 3IJYB 2DQJH 5CKAA 5I28A 1EGJH 2NYZA 4Y2NA 1J0KA 2L3BA 3RDJA 4R84A 4NLHA 4WI7A 3QFDA 3VXSB 4CGUB 4S1DC 4ERSL 4MXQC 1OAQL 5AFAA 3N42F 5BO1H 5I24A 3AMKA 1Q0EA 1AZNA 4X7EC 4W9FC 3W9EB 4DT2A 2WUCL 1FZJB 1FWXA 4GKZA 1NAML 1FNEB 4NO3B 5D7JC 2CO1A 4H1LH 4XNUL 4CSTA 1YEGL 2OX5B 3VACA 1OTSC 1I1FA 4Y1AA 1I7TB 2JSFA 4ONHB 3PQYD 3GPSA 2KHAA 4R97B 5C2UB 3BVXA 4NUMA 5DJ2A 3PWPA 1NEPA 3PWPD 1JN6A 2A0LD 4A38A 2BIQA 5TE4L 2QADD 2ZNXA 2C3HA 3ZE2E 4EO5A 5AAPA 5BV7B 4G6FD 5JHBA 2JQMA 4NHUB 1JPST 1AHWB 3QNFA 4PJ9A 5AZ2L 2YGNA 1JE6A 4AJYV 2W92A 1DE4B 1VPOL 3VFNA 1SEQH 4ZUVA 1HH6B 1LO4H 1N6VA 4L0YA 4WTWA 2EVFA 1OE2A 3D33A 3C08H 2HFTA 3NIGE 2XTJB 2E59A 3COOA 4O02A 4BFEA 5F7HA 4U05A 3U9PH 2CO6A 4EOWH 2KMWA 2A38A 2APTA 4PWHA 1XGPB 1JBJA 4Q74A 1XSKA 1JPGA 1MELA 3O0RL 1NUNB 4RWYH 5DJXB 1ES0B 1SJHA 4L18A 1GYAA 3LKQB 1MFDL 3EOYG 2CJSA 5KEZA 3RWDB 3NFNB 4Q9RH 3NGBC 1JVLA 3IVKA 1DLHB 1X9LA 4YHZH 1WZMA 5EWIH 1MCPL 3WHXB 4LVHC 5CWSB 4YGAB 5FO7B 4MVBD 4QXUL 3IPFA 5KN5B 1EHXA 1M2VB 3Q8EA 5DYOB 4HSQA 43CAB 1HWGB 1XR9A 4OQTL 4MJJA 3FQXA 5HHPB 2X1WL 4CGTA 5D5MA 5D93C 1MJUL 5D6DA 4HU8A 2GIYA 2B59A 1FGNH 3K8MA 1NDTA 2X44D 2B3RA 3CVCA 2Y24A 4U7KA 3G5VA 3DETC 4H8HA 2KS0A 3QJFB 3WE6A 4P59H 1FRGL 4A37A 4P04A 1WFTA 4Y19D 4UAOB 4RCAA 1ZDQA 2XNAA 5AD0A 5C6WH 5KSBE 1RSYA 1T1WB 4OF6A 1L6ZA 2Q7AA 1BYNA 3QNYA 4FNPA 1YYML 1EHLH 1AE6L 3P9LB 4NGHL 4XAKE 2I69A 4WFGE 4KXCA 3HC2A 4BWUA 4M1CD 1S9YB 2H0FA 5FYJE 1CICA 1L9PA 4W1TA 3BUBA 4E9YA 4L4VA 5TDNA 3PXLA 3SBQA 1SLVA 3D2UA 4PYGA 2YAFA 1CFTA 4R26L 3BC9A 3RWJB 1QRNA 1YPZE 2X28A 2Y2WA 4TQIA 3TASA 1B4RA 5DURB 4Z7NF 4ZUUB 2CHWA 2ZOKB 3W81A 4BRVA 3D06A 4KDWA 5EBWB 2HN7B 4XBEH 4JPKL 4NCC1 4ZQTA 4H88L 2FEEL 3SE8L 1CDGA 2QPDB 3GLAA 2OJEB 2QKIB 3QO0B 4KJYA 2Z0BA 3S0PA 5K9QG 2JB5L 1G9ML 1MRCL 4XNZB 2K9FB 5F7EH 3AG4B 4RAUB 2Y7MA 5GS0D 4R6UA 2BZDA 2FHBA 5D7SL 5E8PB 4ZW6A 5KYXB 3DA0A 4FXGA 3KPTA 3PWPB 4OCRH 2C9UA 5HBBA 4WO0A 3MRFA 1MF2L 5CM1A 1VZHA 2YPKA 4KJWD 4JFTA 4LVHB 2BH0A 3K6NA 2Y07L 4F92B 1A7RH 3ALPA 4E0RA 3D4CA 2VISA 3HAEA 5KSBF 5D1XD 5J6SA 1KJ2A 3WD5H 2ZSVB 3ECQA 4HHAA 3S36L 4IRSC 2J43A 1YAZA 5BS0A 5IMMA 3QRBA 4FLSA 5GGTA 1ZCRA 4J6RH 3VXRB 2DLHA 4HF5H 3FTZA 1CGWA 1JFQH 1XIWA 3MFFA 4ODWA 4QR7A 2OZ4A 1NGYB 5T3ZL 2R2EA 2G5UA 1JZEA 3MMEA 3IMUA 1WFUA 2W81C 1J0IA 3CDCA 1MDAA 4MCYB 1IEBA 3BGMB 4UAOC 4B9PA 4FHBD 5DD1H 3QUML 4X6CA 1UEMA 3C5ZD 4IS6A 3WTUA 3OX8A 1JZJA 1KT2A 2Y07H 1E5CA 5FFOA 5HYSG 1MEXL 2QGCA 3CHXA 5IQ9A 1XXFC 5I5MA 3NFNA 1ZGLA 4MAYA 4ICWA 1IEAB 3IDNB 1WLHA 4Y8AA 3K2KA 1MCCA 5IJBC 3G9AB 1JPSH 1IAKB 3GMNB 4JW3A 4QRAA 4AGQA 1RUQL 3MXVH 4BH7A 3H1ZA 1ZTXE 4KMTL 4XR8C 1LQBC 5LXGL 5K9OA 4C55A 3IDJB 2APBA 4ANKA 5EBLB 1QEWA 4A2MA 4JCWA 1J8HA 4J3OG 2HFGH 5AW0B 5L2KB 2H4EA 3RIKA 1BFOB 5IOPB 4R96B 2CLRB 1QI4A 1D9KD 4QGTA 2OULB 1J10A 2Z8VC 4YXLH 5HYSA 1FV1B 3L48A 4HIIB 3WTSA 4M6NH 3BLKA 3FFOA 5EIQA 1FP5A 3ELAT 5FV2A 3VWJD 5KW9L 4NEHB 1GMEA 1N0LA 1RULH 5EC1B 1BMZA 2ROYA 4Y19A 3SQBB 4AG4H 7FABH 3OXSB 1TQVA 2YZ1A 3NZUA 4HAFA 2F1BA 1WZAA 3S5LB 3IMBA 2NLJB 4PJHB 1O5DT 3BPOC 3MV8D 2BMKA 3OKDA 4R83A 3ATFA 3RUGF 2XV2A 2OCJA 4TSAL 3BH4A 3FBQA 4AW4A 3PDOA 2R2BA 2YEQA 4MS8D 2QTEA 4UAHA 4OLVH 5HJGA 4L3AA 3VFRB 2V7HB 5IWLC 5KYWB 1G5AA 3WJLC 1JRHH 5AW6B 3PV6B 1I1YB 3ASOB 2WQWA 2IPUK 4L3CB 2HT3C 3R4RA 3CFNA 3HS9A 3FHQA 5KS9B 4K55A 3O2DA 3F7LA 2V4LA 1RIVL 1L9QA 5KVEH 4RX4A 5LGYA 4AGPA 2Y6SC 4I88A 1W8OA 5DS8A 3TPUB 1F3JB 2AXGB 2F53E 2IALB 3HRZA 4MA1C 4TLTA 1T1YA 4XP9H 3ULVD 4QHMA 4ZTOL 2MQ0A 4QLWA 2A9AA 4DPCX 1ID2A 4PJBA 1DSFH 1Z7JA 2W65B 3QJRB 1ZHKA 1JSYA 2CR0A 2VH5H 3EYFB 4Y5XA 4YPGA 3BGFC 2FQDA 3FOMB 1J7VR 2HPOA 1K2DB 4P2QE 3V6FA 1FFNB 2XOTA 4IMLA 3VFTA 2GJ6A 2CLZA 2X4RB 5AW4B 4R5TA 6FABL 4AIOA 3TO4C 4IMKC 2N1TE 4PS7A 1QNZH 3BEWB 5GRUH 5K33A 4LCUB 2OMYB 3DO7A 5JPMB 5B22A 1A1MB 4IOIB 4FFVD 4MMZB 1L3WA 5F6HI 3H6JA 5T1MA 1TVDA 3S5LG 3VG9B 4HIJB 4X2UA 5FA4A 2ZYHA 5BZDB 4AUYA 3GXNA 3FO2A 1Q1JL 1M05A 1WS7A 3ZL1A 2V2WA 3GZQA 1N8ZA 3VD0A 1RIUH 4KI5C 4PSPA 3L9YA 4FI6A 3H7BB 4WFGD 4GW5B 3K80A 2NZIA 4PJFB 1GH7A 3WXWL 3U6XA 2YUWA 1F4WH 5FYJD 3WFDL 1TTCA 4CVZA 1AQ8A 1U41A 4ZMAT 5DZJA 1S7TB 2RFXB 4F15C 5ICZA 1IEAA 2F58H 1D9KC 1QABA 3KL0A 4Z7OB 2YFOA 1D7FA 1NAMH 4XMZA 2LFGA 1H5BA 3DOHA 4PJEA 3RZCC 3SPJA 3QEQD 1E27A 4N90D 4C56D 5D7IF 2OMVA 2CR3A 1QBML 2VR3A 4XOEA 4NIKB 4Y5YC 1FUNA 3DDFA 3MLXL 4NZTL 3ULUH 2BCMA 1ZV5A 4HKJA 4IQHA 5E5MA 2D7NA 4WV1C 3GXFA 2CZNA 2Q76B 1UGKA 5BRZD 1SM3H 2NY2C 1LP9E 4PCTA 1NBZB 4MAUH 3MACL 4XHQA 2C7UA 1N10A 4QI3A 3NH7H 1KEML 3E8UL 3MBWA 4ZS6D 3IFNH 1C16B 2JJSA 2VDOB 2GY7B 4I3SL 1T04B 4X4XA 4Z3TA 1GGCL 4R7DA 5C0AA 4EKJA 2G5BA 3IMWA 1TYJA 2CNZA 4X5WA 1S7WB 1FC1A 1QYGL 4JAMA 1E4WL 3VFMA 3ETBF 4JRXA 1DN0A 4OBRA 3QNXB 1SBSL 5FM4A 5CILH 2ZSWA 5CBEA 4R7NA 3LNDA 5IWLA 5HYEA 1FSKB 4PLJD 3EGXB 2ORBL 1EH9A 1PKQB 1IT9L 1B0WA 4HULB 4G71B 3SKOA 3LRMA 4L1LA 4UQIM 5DK2A 2BDNL 3LH8A 3H85A 2JKIS 3JSSA 3V6BR 1EFQA 3FTXA 3X14B 1SDAB 4Y9BA 1U8JB 2Q9OA 5AVRB 1RQ5A 2BS71 1K6QL 2F54D 5HGAA 5ICUA 2YPVL 3ERXA 3MBEA 4AEEA 2R4SH 4QTFA 1N59B 3GRWH 3MFGB 1FNLA 4F37F 1OY3B 3OL2A 4HJJH 2F61A 4ONOA 5DLMH 1J86A 1BOGA 1QSVA 2YUXA 1P2CA 3GMQB 3LN4A 3SZKC 3TIEA 4A7QA 1JZ7A 1IGTA 1ZVNA 3DX6B 5IM7A 4APQB 3HZKA 4JM2A 4HJGA 2E74C 5CEXA 3I9GL 2G2NA 4KUCF 2W65A 1MI5E 1NLDL 4N5EC 1MCQA 4YSOA 1IE4A 2C3VA 1NKOA 3C6LC 4EBQL 3EYUH 3VRJB 4HIHA 2OL3A 2PPAA 1N3NB 3PGDB 5MHSD 4JRXD 3W5MA 3OBAA 1PCSA 1PPIA 4HUVB 4IBTA 5AB0A 1TNMA 2NY3C 4Z6AT 1FH5L 2P7TB 3G5YA 3L7EA 3O3UN 2X4RA 3D85B 1IC5L 5BRPA 4X99B 1QHPA 3AS3A 2ZUTA 3QUGA 4KDVA 4N6RA 3A4EA 5I15H 5DJDB 3ZE0F 1QTSA 1BMGA 3W2DH 5CIPH 1QR1B 3N41F 3GSOB 1IBGL 2AABH 4M8VA 1MUJA 3DTDA 3MGOA 1HKLL 3ULAB 3WN5B 2ZUXA 3S3PA 1VFBB 4LCCC 1NIDA 4I5BA 2HYMA 4F1SA 3O2VH 5D1ZI 1ZSDB 4KO5A 1OAYL 4M1GL 1P4LB 1PGRB 3U9WA 3LKPA 2DMHA 2NNFA 3CSYB 3GK8H 2HZHA 2JKTM 1F3RB 3CBKB 2A6DB 1EGJL 2CO4A 2P8MA 5CIPB 3IDJA 5HPOA 4OD1H 2H6PB 4B95C 5IB2A 5LN8A 1J8HB 1G1YA 5CHNB 5L2KA 3DBXB 1SXAA 3HPJA 2VDPL 3BEVA 4KY2A 4GY4A 5ANMB 3N0PB 1KTBA 3HZMA 1CK0L 2NXZB 3QEQB 3E80A 5EU7C 1OM3H 3N50A 4QRRD 1XGRB 3FYIB 5G4MA 1T5WB 3D0LB 4HS6B 2FO4B 4AJWA 4IKKA 3V0VB 3ZXAC 3WLWD 3OG4B 4KK9C 1J1XL 3CVBA 4P5RA 4TSCL 1DANU 4YHMH 1YPZF 3KWUA 1AFVL 2AEPL 5ALBH 4QTHA 2JE8A 3VXMA 2I85A 3HCVB 2Q86B 2ZOLA 2Z91A 1WBXA 1NCUA 1QLEB 2H0JA 2NY7L 1TJMA 2F5BL 1TJHL 4RMUA 4XZUB 5J9PB 3EYQC 1OF0A 1A6ZA 3FCGA 3PL6C 1OE3A 3BVNA 4LOEA 2F74B 2X3BA 3O4LE 1S9VB 5A2AA 1ORSB 5FCSH 4HG4J 1F5WA 3MHZA 5I8CA 4P5TA 4OCRL 4QRPE 2PYEA 2R23A 3ZJAA 2X9WA 1JZ4A 1OD9A 2OTUB 3FRPG 2AKRA 4U1HA 5ISZA 5D5MF 1KEGH 5T1JA 3B2UD 1OW0C 2UZXB 3N42B 2ROXA 3Q2LA 4ZX4A 2XKNB 3T65A 2XPGB 4I0PA 1K72A 3CH8A 4LCWA 4M7JL 4M5YL 3ETSA 3HI5H 3KBHE 4HMDA 4LDLB 4M6AA 2OMXA 2X4NB 4KO9A 2J71A 4MJIE 3UG5A 2WQRA 4HH9B 4ZOAA 1CBVH 3O0RH 4ZJ9A 5C0GA 4QHMB 4Q2ZA 4QRSA 4PFEA 3UTZB 3I3BA 5IG7B 4LP8A 1I85A 4PJ8C 3GMLB 4JL1A 1DANT 3GLEA 3RGBA 1TTFA 5J5EA 4B7LA 4F33A 3BPLB 5JDSB 2AV7B 4LSUH 1IGJA 2DWDB 4I8DA 1T83A 1UD8A 5DZNA 4CILA 1XF3A 3B7RL 1HEZA 5SX5H 1JERA 2VAJA 3X17A 5IJVB 2WB7A 5CLZA 1CR9H 5FM5M 1A1MA 1Q1PA 3GBNL 4D7BA 1SXZA 2H5UA 5D1QA 4Z8FH 3BPLC 3GXMA 4L8SB 3MRNB 2F8OA 3NCCB 1LEKB 4Z3IA 1ZA3B 5KS9A 4GKLA 5BQ7B 1NGXB 4NOBA 1K4CA 3D52A 4V11A 4FNRA 5D1ZB 2FATL 3BESR 4KKCC 4KX7A 4Y4KB 2MOGA 2EDRA 4YHKL 2BVQB 1NGPL 2E9JA 5IB3B 5JIIA 1DQLL 3HRZB 4JFEA 5J1AA 4MZRA 3BZFA 4Y8DC 1O9WA 3DVNB 1KZQA 3ZRSA 3NCEB 3RPIA 4G6KL 3GBDA 3N0AA 5DQDL 5DQDH 4PRDB 2Y5EA 2J5LC 3KPOB 3BP5A 4PVLA 1YZZA 4OAWA 1H19A 4AQAB 3PJLA 5FUZH 3T3PF 4X6FB 5EU3A 3NFSH 1EEYA 3KZ8A 3W37A 3QUXA 2FHFA 1V3MA 3QUMB 3AROA 5DJ0B 2WXOA 5K39B 3SOBH 1ZVSB 1L9MA 1D5RA 1MZZA 2XC8A 3T8XB 1NANH 2Y6SD 4IHOB 3T9WA 3W9DA 1MJ8H 1EZUA 4OZIF 4XBGB 2WAHA 4XMTA 4ATTA 4HOXA 2XN2A 2R56H 1GL4B 1G7MB 3HFMH 1MI5D 4Y9GA 1IJNA 4WU5A 3IRCA 3CX2A 1Z66A 2I25N 1NEZG 1OP4A 2EEFA 4ZQKB 3RNKA 3Q6GL 3GZKA 1ZJBA 2VXQH 1UM6L 2ODIA 3GB7B 1FBIH 1HHKA 3V6OC 2OMNA 4NI3A 2XIIA 3O2WH 4U3HA 5B7EA 2XYBA 2YAMA 1VCAA 1KCRL 1KCRH 5BOJA 5I8CB 1OP3K 2O26U 1IGCH 5IBTH 3UERA 1AR1D 2LLGA 2A77L 4UMSA 1PQZB 2OA9A 5K9OB 1BVNT 5C07E 3AG1B 4NUPA 3BUYB 5FYLH 1QEWB 3NJVA 4A7VA 2EO9A 3DVIA 4YXKH 2XKNA 4BKTC 4M5ZL 4M03A 3ZLQC 1PEWA 4OVUA 1Z0MA 5HGHB 2EE3A 4LNVA 5EDXA 3QULB 1NGQH 2E86A 3D48R 2F7RA 3HRZC 2X0UA 1FF5A 2EEDA 4A55A 3RWFA 5INDB 3DO3A 1JOIA 4XNYH 1CL7H 3EYQD 4WZ9A 2PO6B 3T2NH 1EHNA 4L4VD 3MV01 2P45B 5I76B 2DV6A 5ES4B 3V55A 1YEIH 4LDOB 4NQVA 2PYFA 2HP4A 4N26A 5BXFB 4R7NB 4JN2B 2NY7H 4O02H 3MSPA 3ZKMD 5L2KE 3VYOA 3D4ZA 1G9MH 5CP3A 4WFFE 2E8ZA 4RX4D 3UPCA 5IHWA 3ROOA 4RWHA 1BQHG 2I9LB 3B2UC 2WNGA 3M45A 4M7ZC 4UV4L 4H20L 5D1XA 1SJMA 3Q8FA 4MS6A 2HH0H 1WV7T 5GZNA 4B60A 4Y5YA 3ARYA 3ULSA 4B7IA 3K5RA 2ENYA 2VDQB 5I23A 1MJ7H 4LL1A 3IJYA 4ELMB 1KG0A 5T5NF 4L5FE 4JMNA 2VZTA 1OANA 2DS4A 2NXYC 3FT4A 1TZIB 3FQYA 4LLAA 3RKDD 4N3UA 3FTSA 4PY7B 1MHCA 4N1CA 2XETA 1U6AL 4NT6A 1KLUA 4DVRH 3CGTA 4DVRL 1WD8A 3S35X 2OYLA 5LBSA 3KYOB 1FNEA 3OAUL 4U1SA 4WSGA 3G6JF 2WMPA 4BSVB 1ADQL 4D9LL 3B3IB 3F6JA 2VN6A 2XBDA 4HKBB 1HAWA 2BERA 3FQ1A 3EYFA 4TULH 4BFJA 4XODA 3PWJB 5FF6B 1CLOL 5HGGS 2ZOUA 3NQIA 5C3TA 1T03L 1CGSL 3B37A 4JB9H 3N1FC 4BQ6A 3C60A 3OLGA 2WVTA 5DJ6A 3D2UD 5CCJA 1IM9A 4AV4A 1UWEH 1FLRH 3HPLB 5DK3A 5MEPA 3RIFK 4G72B 4XBGA 4M7JH 2NX5E 3B9KB 3D09A 3SDDC 5DQJB 1K5WA 1G7MA 2WXJA 1MI5A 2VL5A 3QQ4A 2ZWLT 3KDMA 4U2YA 1KJ3H 3KE0A 4WHYG 4LOFA 3RVVC 4JANA 4TVPD 3X1GA 4Z7NB 4BINA 5I0ZA 1YPZA 1OGAD 5EEVA 4K07A 3HZVA 4PB9L 5TD4A 1T2JA 4HEME 2RBLA 3MU3A 3KW7A 2JMRA 2YOCA 3MLTA 4AOFA 4AL8H 5LNGA 2BHUA 5I82A 2H32B 1DBBH 1QNIA 4A7TA 1QKZL 4PCSA 3WXVH 5AVWB 4U3XA 1JPGB 3P02A 1CI3M 4LLQA 2BSRA 4GFXA 2VDRL 4YIQB 4F9PA 1U0QA 1KIUA 1DDHA 5IMOB 1MNUH 4ZNCD 3QNZB 2WAQA 3FN0L 4MYWB 1HZLA 4WW2A 1ICTA 1ERNA 1IQDA 2C3WA 2JXMB 5D70L 1BAFL 3VXPA 4J3VA 2ZCHH 2VDLH 4XAWL 1AH1A 4KTYA 2MQGA 4GKOA 4HKXB 3IK2A 4U6VL 3VNZA 2XZQL 4IU2B 5E5LA 1Z9MA 1DUZA 3CVHL 3DIFB 1Q72H 2VLKB 3WDHA 3D30A 4MDJA 2Z1PA 4NKIH 1IKOP 2MCPH 2M2DA 1SOXA 4N2AA 1BYPA 5F0LB 2Q8AH 2GHZA 2WD0A 4HBCL 4X0NA 2NW3A 4BM7A 3QWOA 4NBXB 3EDKA 4JLRB 3B56A 3OAZH 3VFMB 3E7JA 4D9QD 5I19L 1QSEB 4YJZL 1FV1A 1HINL 2FGZA 1QNZL 4NPKA 5GRUL 1TEGA 4HV8A 3EDJA 3L5IA 4B0MB 4PLKD 2R8SL 3Q9QA 4WJ5B 4FA6A 2E4TA 5E56A 3ZY7A 4PRPA 4N2KA 1PKQA 2VM9A 4C4UA 1VADB 1CVRA 2EAEA 2XWTB 2MQCA 2WYTA 3Q13A 3ZDXF 4AK2A 3PHOB 4UZUA 3FAWA 1DVXA 1ZPLA 2HKHH 1NGZB 3HS0A 3OTTA 4ZS7H 3CXHK 3MR9A 4DEWA 2Z6FA 1HQRA 2LU4A 5D1ZA 3TH2T 3T2LA 1FJ1A 1S2EA 4C59B 2X4SA 3OAZK 5E1AB 4QAWA 5JUEL 2HLAA 3BO8B 4TQEL 4BK5A 1I7TA 5E2WH 1R3JA 3KPSE 4GAFB 3DGGB 1IKFL 3DJRA 4HUCA 4XN7A 3LH2H 5KSVA 1AZVA 3BI9X 2G9HA 1CT8A 4OCXH 1LE5B 2Y1ZA 1FI8C 3V5DA 4HKBA 1CG9A 2X4PB 3QHZL 5FWRA 3TBWA 3U4KA 4TUKL 3WDIA 3VXUB 3DX9B 1PNCA 4AIZB 1VESA 1PSKL 5IKCB 5GRWA 5IJKA 1RIUL 1BG1A 2EXYD 5DEFA 4JFQB 2VT0A 2VDKB 4Y19E 3F8UB 4J27A 4WU7A 2XSKA 1JTOA 3EO0A 4PIRF 25C8H 4PMFA 2Z92B 3ZU8A 5IREA 3FT2B 3F84A 4UT7L 3PHSA 4RMTA 5EBMA 4YN3A 3S37L 5ID0A 1QLFB 4PS3A 1YNLL 3FFCD 3O9WD 4P46B 3ZMRA 3FFCA 5AKSA 1J8SA 3IETB 4NYLB 1BV8A 2B2XH 3QIWD 5D4JA 1SN2A 3LKRA 1UASA 4GKSA 4KKZA 2CLZB 3OAYH 4K94L 1NGQL 5JIMA 5HVWA 2IVFC 3QUZC 4WJKB 2DQMA 3VE0A 2P5WE 1QX1A 3O11B 3IBOA 4JZJB 1VFAA 2ID5A 1GOHA 3MMEB 5AW1B 1JGLH 4L5FL 3ULVH 3B9KD 2D3JA 1UJ3C 2P8LA 5EEWA 4OIFA 4R8WH 3OWRA 3T4AA 4PJCF 1URZA 4LIQH 2GAZA 4E41D 4KKAC 4QRQA 1TMQA 4H1LB 2VR4A 2B4CL 5F9OH 3SDYH 3B7UX 3IKKA 5DEJA 3SY0A 4A68A 4BD4A 2UUDH 4UQ2B 3LRGA 3TU6A 3ZKXC 2AQ2A 1MCPH 5LCVH 2P8MB 2K1MA 3F58L 2AJ3B 2XX1A 2B2XL 5GIRB 3LS5L 3FS9A 5CEZL 4QXVA 1M71A 1ZVSA 4X4YB 1CBJA 2NNAA 3LMJH 3UBGA 2OSLA 4E9SA 2VMCA 2DBLL 2PPFA 1YEKH 4DO4A 4YX2H 1TSRA 1JRHL 1DEDA 2DM2A 2WBJB 3QJZA 4K71B 2PCFA 1GW0A 5BS0E 2H6UA 3R1GH 2XHNA 5E08L 3VQMA 1T6BX 2C34A 3E6FB 3EIFA 4GRMA 1ND0B 3VFOB 4K3DL 2GIMA 2VDMH 3DJSA 3IJ9A 3QWOB 3VXQA 3MV9B 1NAMA 4NM4L 2C9AA 1CIUA 3DMMC 4WWOA 2GW5A 3T6WA 1UZ6F 1VACA 2YKKA 4FXKB 1ADQH 4PI2A 4YH6A 2W88A 3BVDB 4AYGA 5C8JA 1UWYA 1AYRA 1NFDA 2XZCL 4KOBA 4M5TA 3UG3A 3WTWA 3ATBA 4MKMA 1JZGA 5F9WC 4U1GB 2YBRB 1U8NB 1U36A 3US0A 3UC0H 2UY6A 4KOCA 1G0YR 1H15B 1ZJAA 5AYUH 2VDPH 3NYKA 4N2BA 4OW6A 2RHEA 1JI1A 3HNTL 4IU3A 2BS9A 2HT3D 3MLYH 3BLBA 3NZHL 1TUPA 4LCWB 3DX4A 4K9EH 1MLBA 5SV4A 5KZCB 1Q9OB 2EXYC 3L5WA 1YEGH 2YMOA 2A74A 3B1UA 3OKMB 4PBVC 4UDUA 2PPDA 1HYSD 4W81A 1KGXA 3NJLA 4L3CA 3LXBA 4HCIA 5KBKA 1P1ZA 4NZ8A 5DRXB 1A7PL 1JCKA 3IXTA 4TMPA 1ZLEA 2HRHA 1JPEA 4L9LC 4XXCA 5FS5A 3MBEB 2AVGA 1R5WA 4Q9BA 1U3ZA 3ES6B 5AYTA 1OAXH 1AP2B 2VH5L 3W2DL 4YK4C 2IFGA 1O9VA 3WIAA 3WUZA 4DNLA 2IIJA 5IB4B 3L8QA 4XVOA 1KIQB 1E4KA 3BPOB 4F7MB 1CL7L 2DQFB 43C9B 4YUEL 5DJ6B 1BX2A 4KXZH 3JVFC 2HLFD 2LOEA 4RMSA 1VJSA 2A6IB 4FXGC 5E2VL 1Y6KR 1NQBA 5MEPB 3V8OA 1Y6NR 3WMQA 4K3JH 5F9AC 2ZCHL 3C5JA 1F4HA 3WEOA 4B3VA 3ZZLA 3H2QA 1JNLH 3D9AL 4NUQA 3ARDA 1UT9A 4G8FA 4C56E 5LXGH 2PP8A 1AOHA 2X3CA 1PW3A 3SGKC 4JFOB 4Y7MA 2H26B 1IM3D 3AT0A 1BP3B 3H9SA 2AZUA 3PWLA 2OR7A 4X7SH 1MNNA 5T33H 4P2RD 4Y16D 4AQ8C 3SDAD 2FQEA 3Q3GB 4CBZA 1LMIA 1JXKA 1MW0A 2ZOKA 1EJOL 4FULA 3QWRD 1OGPA 2GTZA 1WA2X 1FZOB 3CFEB 2XVKA 5T1KB 2CIKA 3I3EA 4N2GA 1TZHA 5EOCH 2QGEA 4PVBA 5I17B 4CMMA 5C08D 2UZPA 2EVIA 2W1NA 7FABL 4KH2A 3KPPB 4MNHA 1O0VA 3HG1B 4AX3A 2HT2C 3CFBB 3EUDA 4R4ND 4YHNA 2J5WA 3KLHD 4NZUL 3NSFA 4F9PC 1EZSA 3ARSA 4G8AC 3KYMA 3UEZA 2X4QB 3V0IA 4F7CB 4WWKA 3KPSD 25C8L 5JXAL 1D7BA 1L7IL 5JOPD 2WPGA 2ZUYA 1HXMB 1JS4A 2DIEA 1T03H 1DBBL 2P24A 4HH8A 4DKAA 2BNRB 4PUBL 1QVOB 3A6OA 2FX8L 4LOUC 3GQFA 4U0RB 5B8CB 4W9EC 3T0ED 5IVOA 2EKSB 3WFBL 4PJHE 5JHLH 3WL9B 2BVOB 1GZPB 1HOCA 2EYRA 1S8DA 5LB1A 4YR6A 3FCTA 2F54E 3U6RB 2P4AB 4J1UB 4NJAL 1OXYA 3KCPB 4HW6A 1GYUA 3OHMB 4MWFB 1XVSA 4PM1A 4F2MB 1H3VA 3CFIC 4RNRA 4JN1H 4XH2A 3MV7A 4C4KO 1P4IH 5CP7B 4GPVA 4QTIL 1H15A 5L4JA 4YHKH 4IDJL 1INDH 1J1OH 1BZ9A 1CQYA 4M48L 2D2OA 3RQ3A 4EUPH 2P5EB 2V5SA 1IBBA 1JK8A 4G1MB 4W9DC 2AK4D 4KRMB 1FE8H 1Q9OA 2M8XA 4IHBA 1A66A 2RMNA 1ASQA 4OY9A 5F8QC 3UMTA 4RGNC 3OGOE 1UD6A 4ZG1A 1L5GB 2R8SH 2CO7B 3U4EB 2CK0H 3MAWA 3C5XA 5T3ZD 5AYUL 4AYDC 2V17L 1AIFA 4XP9L 2E5EA 1KJMB 2PW2B 4XCNB 2UWEA 3E2HB 1QBLL 4MRBA 2DWEB 3U79A 4MMYA 3S37X 5K59F 3HZKB 1O7DC 3JWNG 3OKNB 3SQBA 5I1GL 3KBPA 3R19A 4YXHH 3OJ2C 2ZX7A 3OMIB 3MODL 1EAPB 1LE9B 2MJWA 3HE7B 3K46A 4H5SA 4KKNA 4F33B 4OQTH 2QZQA 3GBEA 4OZIB 5DU7A 1U8PB 4XVTH 1MAJA 3G5YB 4IKLA 4GIPD 3D50A 5B1JC 2AQ1A 3BP6B 1S6NA 1KELL 3VA2C 3TYFB 2PF6A 2XICA 1MHCB 1I1YA 3G5ZA 1KBKA 1BJ1J 1DVSA 4FERA 3ZZQA 4FN0A 2EH7H 3RL2A 4HIXH 3B5TA 4DGVL 2Y36H 3ZOAA 2F7OA 2CWRA 4AZ8B 1YDPB 4AENA 3NSCA 3NJFA 5J1AB 1PBYA 3WLWC 2Y5TA 4KV5F 2UXTA 5DFVC 3EH3B 1KCKA 2Z92A 4PD4J 2Y4SA 4ILDA 4YHOL 1H8LA 2H1XA 3BIKB 3D8MA 1SYVA 2FECL 3MNVA 2WO2B 1D9KA 5EC2B 5K59E 1TDQA 4B9FA 1GCYA 3WG7B 1GXEA 1D6EA 4UM9B 5I1EL 1NJ9A 2P47B 1J1XH 3RFZB 2AQPA 3N06B 4I0PD 1MFEL 5GJSH 3GSXB 1MJJA 5D2NB 3Q05A 3TIDB 1FHGA 4BZYA 3MFFB 3T6XA 4UU9B 1GTNA 1AKJD 4ZX5A 2HVKB 3FH5A 1TTBA 2EDKA 4IBYA 1O9ZA 5DUBB 1WAAA 3FCTB 3U6RA 5JPMC 1OP5K 1BVLB 3TZVB 3TV8A 2YJQA 3D4YA 3VXMB 3FZUC 5JNYA 3EOTH 3ZTJG 5C2BH 5TK4A 1K5NA 4IS6B 1RK7A 1TJIL 1RUKL 2FJUB 5CP7A 2WNXA 3QHFL 4ENED 1BG9A 1S7XB 5I1KH 4JQIA 5D7IE 2D2CC 1CIDA 3AT9A 2P5ED 8FABA 4MDIA 2IBGA 1MLCB 3AM8A 4BBWA 1YNTA 3BUIA 2VDML 3JT2A 3FU0A 5JHMA 1ZANL 4NP9A 4GRLA 5C1MB 4CL7A 4FMKA 1BFVL 2BY1A 5TQ0H 4UOJA 2CKNA 5BPPA 4L3EE 4CADB 1ZA6A 1VENA 1UA7A 2ZG3A 2MCG1 4Q6IB 5E5RB 1WZLA 4WJG3 3UTTB 3ZYOA 5IJCC 1YQVL 4TNWK 4XI5C 1RZGB 4LDCA 2DQTH 4PGZA 1R3LB 3QULA 4X83A 3NOIA 1B3JA 3QG6B 2H8PA 1R19A 3R4DA 1OLZA 2XKSA 4QKXB 4WLCA 4XMKH 1DTUA 1DEEA 5J11B 3O4OC 4JQIL 5J12C 2X9YA 4F5CE 1ZD6A 2B4CH 3SD2A 1CR9L 3MUGB 1RZJC 1GAFL 1JF1B 3DXAA 3KPRE 1NPNA 1ROCA 4LESA 1CI5A 1M1XB 4I77L 5CUSH 4Z9KB 3X1EA 3VWJA 4D9LH 4WUKH 2QQKH 5C9KA 2DDQL 4NDMB 4E9LA 2HXAA 5CS7A 3QORC 1PJWA 5D2NC 4ODTH 2LABA 2V7HA 5LJYH 1PY0A 4GBXB 3M88A 4M29A 3RIAK 2DN7A 4FLHA 4Q0XH 2VDPB 1U8QA 3SKNB 1TETL 4XVSL 4ZD3H 1HDMB 1IKNC 2X2HA 1FORH 4HCFA 3WIFB 5L0QB 3FN0H 2FT6A 4RFNB 1JPTL 2BW4A 4QOKB 5F6IB 3CSYA 4HSCX 4XN8A 2R1YB 2ZWZA 1F3JA 3GHEH 4ABQA 2Y5QA 1KCVH 3JVGC 4KTDL 2GJJA 4NQCB 1QATA 4AENB 1Y07A 5KAQG 3B2DC 1A21A 3TCXA 2X9XA 4LCCA 2IDTA 4JM2B 2ADFH 3Q44A 5DEGA 4NJ9L 4GG8B 1HSAB 3RDTC 2EC8A 5TGBA 2CSPA 2K8QA 3S4SG 4LFHD 1ZOXA 2VW4A 5E8OA 1OPGL 4I0PC 5L2JB 4PGCB 2DRUA 1OTUD 4XPAL 5AOLA 2EDLA 3O0LA 5FF6A 1OL0A 4YPJA 1PX4A 3A21A 2LU5A 1CYXA 5FW8A 4N2MA 1UT2A 1HZKA 3CMOL 3HPLA 3Q48A 1A6WL 1NWOA 1T80A 2FH8A 1D5XB 1UM6H 2XDHA 3QEHB 1F00I 4ZSOB 1MY7A 3U2SA 1ITCA 1WIOA 3UYPB 2CM5A 5I18H 1UCTA 1NGWA 5E95B 5IVZB 3UTSD 4GYBA 4CN4A 2VKWA 3KR3H 4F8OA 4QRPB 4JFSA 1PZCA 4NNYB 3ULVL 1GGYA 1MAML 3CNKA 5ICXB 2BP8B 4M9OA 2XTLA 3RWDA 1DJZA 2PXYB 3EDDA 5CCKH 1ZVYA 3HC0A 1P4BH 2JIXA 2XWJA 3EGDB 4M62H 2JIXD 3M1BA 3EJSA 1E67A 1M71B 3P0GB 4I3SH 4AJ0A 2ENSA 4MDIB 4YHIB 5E2WL 3LHPH 4LMQI 3AS1A 2NXYB 3G5XA 3O3DA 4QHLB 5D7LA 1B0IA 3W0WA 4ZNEE 2XIBA 1FC2D 3FQ4A 4NWTH 2H0PA 2UXGA 3RI5K 2NZ9D 1T20B 3BAYA 1OP3H 1CGUA 4UIMB 2J88L 3VFWB 1TKWB 3QCVH 5D1ZD 1KTJA 3SDCC 3SPIA 2D9QB 4X0KA 5EF3A 1G7IA 1PSKH 4K3EH 2Y06L 3K6DA 4R97C 3ATDA 3KYNB 4NUJA 5HP5A 4DZBB 2N1KA 3LCYA 4L37B 4MQXD 1Z9PA 1HHIA 4GUCA 1XB8A 3NG5A 4M48H 4E36A 4I48B 4FZEL 3MCYA 4D2NA 1W8EA 5LAXB 2IWEA 2VN3A 3LXAA 3FSVA 2H2PC 4A04A 2F9BT 3OJDA 4MJ5B 4W9KC 2NNXA 1BQRA 3AWFA 2XX0A 1I9JL 3H3PL 4GAGH 4XPGH 1XAUA 1LO5B 2F74A 3KWVA 1EDQA 4PP2A 3FULA 3V4PH 1LD9B 1B90A 3MJ7B 4L4VB 1DJXA 4NO0D 5TDNB 4ABUA 2WXMA 5GGRA 3IDMA 3W38A 2YXMA 4CW1B 5KVFL 4I13B 4KBPA 3W39A 1LYQA 3GI9H 4D3CH 1XCTA 2F19H 4GUPB 3CQFA 1L0YA 5C07D 3SKMA 3HG1D 4JFVA 1AACA 4YBLB 5ID1A 4EI6B 4ESKA 3RL2B 1DHKA 1KG0B 4JO8A 1OGTB 4MXVF 4LLYB 3BP7B 3ARGC 4O2EB 4Y4KC 2L4OA 4NN5C 4HQQH 3ZKMC 3QHTC 2EE6A 3OKKB 5B4MD 4ABVA 2B5IB 4K94H 4WHYH 5FLVA 1H3TA 4G5ZL 4Z76A 5ACMA 4JB9L 3DGGA 4CU6A 2J44A 3P73A 1DVFA 3CSBA 4Y2DA 4LCVA 3H53A 1NTDA 3DSNB 5F96H 3TNNA 2W9EH 1NCBL 3LY6A 1LO0H 3FJTA 4JEGB 2WLZA 5DHMC 1T2QH 1Z9NA 3EO1A 4EUPG 3HE7A 3R8QA 4CDHA 3VUAA 2DQDH 4UM9A 2DJMA 3RKDC 4IMLB 4ONGH 2C8NA 3M1CA 1BXUA 3A6BH 1F58L 2EIEA 3ORJA 4HEPG 4WO4C 4YVUA 4Z18A 3KLHC 1USQA 2K7PA 3RVVD 4MKTA 4TLSA 4CDGC 3P40A 2CHXA 5C08A 4IIQB 5L7XH 2IXQB 4J3UA 4RGNE 5TFSH 1ZHNB 1U2HA 5GS0C 2YQGA 1F45A 4AEFA 1NCDH 1QKZH 1I3GH 4FQ2H 2HMIC 3GSNH 3LPPA 1ZT4A 3SZ6A 2FWUA 2YQ3A 2DLTA 3DJ9A 2EVHA 4YHPA 1YJDL 5IESH 3MJ9H 5D6CA 3O9WB 2XV3A 4P46D 3HZVB 3SDAC 1Z0NA 2Z8SA 3EADA 4K9EL 3KL3A 1MFCL 1YVLA 3DVNA 2P8LB 3BZDA 5DWUL 1PYWB 5I0YA 1OSEA 4U1LB 2IPTH 4JKMA 3IFPB 3CQPA 1IL1A 1HS6A 1U8CB 1XWVA 5DVNA 1UXSA 2BWIA 3ZVVA 3IB4A 2ZKWA 4G3YH 5EU3B 3OC5A 2XN9D 5FW6A 3VMOA 3W1ZA 1GJUA 5FYKE 4XB8A 1L9OA 4NRXB 5IQMA 2XFGB 4NKMB 3VRIB 1M7UA 5SWQA 1KXVC 3OHXB 4KU1A 5KSUA 2NNAB 5IOPA 2P8PB 2X42A 5F6HJ 2VDQL 4W68A 2FLRT 3C09B 4LE8A 2OXGB 3WY2A 12E8L 2NRDA 4JKWA 5H35B 1BQ5A 2V9TA 4H7VA 1E8ZA 4PJ5D 3VTMA 3T77B 4PJ5A 1HILA 3D5OF 4BUHA 4JKLA 5EMYA 3D3VB 3UGXA 2JKSA 1TEYA 1ZANH 2B15A 2JJSC 5C0DB 1F56A 2WKOA 1MXGA 4YDIH 2IH8A 2PWDA 2DQIH 4OFPA 1RERA 5KSAB 4ZS7L 3OM3B 4ZX3A 3GI8H 2WLIB 1YEEH 4M3JA 5IGXH 3TXAA 4IRZA 1WF5A 4R2GB 1UWGL 4G2AA 2VSDA 4G43A 1AG6A 1QZ1A 1NICA 4H0HB 4PRNB 1LDPH 1O7VA 3H8NA 2PKDA 2DQ6A 2QVKA 3T0XA 3SKNA 2UY7B 3G08B 5H37H 2YPLA 3DIDA 1BLIA 1EDHA 1XSIA 3WV0A 4PJ8A 1UJTA 4O2EA 1UH4A 3U46B 4A6YL 1FG9C 2ZAIA 3K71A 1KJ3L 2JK5A 3EYVB 3PWJA 3VA6A 3UAJC 4KKBD 1EJ6A 3CE1A 2VKXA 1XCXA 3FPYA 3VYPA 1OQXA 2I32A 5G5DA 1YMHA 1I1RA 3PWUA 4MAUL 4X9BA 1NPUA 1JZ8A 4NHCL 5E6YA 3M86A 5TH2B 4ZS6C 3BAWA 3GBLA 1JTPA 1N5YL 4PTUB 3VWJB 4ZMVA 2FH6A 4NCC2 5EOCL 4PWKA 3MPCA 3QQDA 3WS3B 6CGTA 3BKJL 2IWGA 1AQDB 4XOBA 3LRSB 3M8OL 1ZKAA 2FLBT 4LEOB 5JW5A 1QFOA 4UTBA 1OARL 3QRFM 3B7YA 1QFWH 1LJMA 2B39A 4G1EB 3T08A 5EN2A 5EBMB 3UBHA 1QI3A 2LAGB 4YDLC 2MEJB 3KS0J 4L29A 3F6IA 2X4OA 3UYPA 3FTVA 1GGBL 4FXKC 1QFUL 3L3IB 3WFZA 4S2SA 4UB0H 4WVRA 1J9CT 4GG6F 2YWYA 4RBPH 4JHAL 4UT6A 4G8FB 4F5CA 3I84A 2DQDL 2X4UA 1R24A 4DKEH 3DPBA 4RA0C 2OX5A 4ODTL 4LPXA 4IRJC 4GW5A 4M93B 3OKEA 4DK3A 5EU6B 1WIUA 2BP8A 4LVEA 4RAUA 1D7CA 1QLRA 3VVVA 1MCHA 1UWXH 2AQRA 1FZOA 1YYCA 1I9JH 2HUHA 3H3PH 1D7DA 2PWFA 3H2WA 4G6FB 2Q87A 2AZAA 3G5XB 4M7LT 2XYCA 3VFGL 1NA8A 2LTQC 2Y1AA 4A67A 1W72H 3FB7A 1QSFB 5EIIA 4XC1L 3DIFA 2W5PA 1B4LA 2GI7A 3D25A 3GHBH 1PX8A 3K72B 1E2WA 5CSZA 3SDXA 1IGMH 1NAKL 1MCRA 4N25A 3SOBL 1N68A 4KPHL 5AZEL 3AB0B 2XTJD 4Z7WE 3FO0L 5F3HB 3KVQA 3S5ZA 1OCWL 1YN7B 4JY4A 3CZJA 2I24N 4R5XA 3QUXD 1PG7L 3Q6FA 2X38A 4IDLA 2EJ1A 2Y25A 3QUYB 4ES8A 3AY4A 5EOTA 4ZYKB 3JQOB 2VMJA 4XZ4A 2IOIA 4X5QA 5INCA 4QNPE 1TQBB 4PJEE 3X1FA 3RNKB 3TYGL 3FU6A 5E24E 3OXRA 1J1PL 3NCWA 2QQLL 3EXLA 5C8JB 2RCSL 3SCMA 3VWJC 3MKGA 4LLVA 4K8RD 1IGML 3PPSA 4AYFB 4K9JA 3TA4D 1QUNB 2XKUA 3VD3A 4IMKA 1KN2L 3ILEA 1HQRB 2VQ1A 1IGCL 1AY1H 4RIRB 2UY6B 3MV7B 2G3MA 4G5AA 1SLWA 1JMXA 3UEQA 2PN5A 1AO7B 4UT9L 3LAFA 5GGSA 5F3BA 3V0DA 4LASH 2WBWB 4MQ7B 3W11C 3CN3A 5PAZA 1R34A 4MCMA 2C3GA 1UUNA 3RGVD 3CHSA 3SDCA 1YMME 4LLUA 4UTBH 4MS8C 5EOQH 1TU2B 1DQML 1XH3B 4GAJL 4R0LC 4R96A 4ZXBD 4HYTB 4PGBA 3X13A 2YD2A 4ERSH 2P43B 4RGOH 4ZODA 1N0XL 4EI5C 1YY8A 4NC1C 4V1DE 4A2LA 3LQAC 1BIHA 1X4ZA 5AALA 3V4UL 2EDTA 4DZ8A 5J4MA 1GOFA 4P4KB 5KBNC 4Z7WF 1QFWM 4HDIB 4M1DL 2ADGB 4F58L 5EC1A 1CC3A 1L5GA 3O3EA 3A3YB 3CSGA 3ZBMA 3T2NL 4MDRA 3V7AG 1QTPA 3I2CH 3RY6C 3S96B 1AIFB 1C7TA 1Y1UA 2BHFA 4Q58C 2FX9H 1D2OA 4GMSH 1A8JH 3NABL 3VXNA 3T71A 2VO5A 4M7KH 4QYOB 1CFQB 1CU4L 2BVEA 3FDWA 3M1OA 3WS6A 3DV6A 3ZMNA 1QWNA 5JW4R 2MPAH 1EUUA 1MWAH 3QDJB 2Z7YA 1GHFH 2VR5A 3H9YA 4DAGL 5A7EA 4Y1AD 1OAQH 4JPQA 3GI8L 2CO3A 1EO5A 1HHJB 1AJ7H 3W5NA 3REVA 1NCCL 1KC5H 2OYMA 4IRJA 3U1SL 4JG0L 4KXDA 5BQ7A 2Y7QA 5C6TL 5HHQA 2F0CA 3CFJA 3CIQA 3AWGA 3L5XL 1TO4A 4X5RA 2VQ4A 2YA1A 1P6FA 1JK9A 4PLKC 1TYEB 5KUKA 5EEUA 3IRPX 2N0MA 2XY1A 1I8MA 3BWUC 5HDQH 3R18A 4JQIH 1T1ZB 4PRID 3RX9A 5AAMC 3KLSA 2ETWA 3CXDH 1DVFB 1VEPA 3OPUA 5EBGA 4H8PA 4YHLL 4GLRI 2A73A 3HE6D 3QORB 2YPKB 1FCGA 2ZAGA 2PR4H 3CDZA 4RVBA 2V2XB 4JG1H 4ZAKD 4TULL 3FK3A 1F90L 4IKJA 5DJCA 3S7GA 2FWOA 5DEZA 2YMXL 3HN3A 5CN1A 1T89C 3LJ3A 2JLLA 4N1HB 1SRDA 1OD7A 5L8KB 3ZPDA 4XE0A 5IB2B 1RFDL 2A9BA 5JORA 3ULUF 5ERWA 2JTDA 4J4PA 4NM8L 5EIVA 2IH3A 2J1WA 5C0CE 2A6KB 5KG9A 3TOPA 3RWGA 5SWSD 2QQNH 1BA9A 3N40F 3RL1B 4B27A 1DVQA 4NQXA 1CN4A 1Y18B 3QUYD 4WI5A 1JCVA 2KYIA 1S5HA 3V6OA 1J5DA 2WLLB 3CDYA 2K3TA 3UGUA 1DBJH 3FBKA 5CUSL 4I77H 3VI4E 2HJLB 1LO2L 2IG2H 5DFTA 1HHGB 5F1KC 2CDFA 5LBSH 5LBSL 1SHSA 2P52A 1P6WA 1G94A 3JWDH 1INDL 1J1OL 1DUYB 5A3ID 2QFRA 3QA3B 3TEYA 5L9DL 3CFKB 5F9WB 3IJHB 1ZEAL 5E9AA 5MP6L 3O3DB 1JVKA 4QHLA 3D87B 3QXDB 4LAQL 1DVZA 1LP9A 3DXAD 4XB3A 3BH9B 3SYAA 3WFHB 2ZIDA 2OI9C 2BNQB 3B6SA 3QNZA 1U3HA 1AO7A 5GGSB 4Y7OC 1CF1A 3CFDB 4MNQD 4N8PA 2UY7A 3G08A 3IS0X 1IQWL 2XQ0A 5C0AE 4ZW7A 1DYZA 2RAMA 1L4IA 4L0ZA 4OCYL 2EYSB 5JZ7D 3PHQB 1NMAL 2B16A 1P84J 1XR9B 2GY5A 3K2UL 5DHYA 1G7JA 4OR1A 1NCDL 2OTPA 2CO7A 3U4EA 4NO5B 2XBTA 3BXNA 1KB5H 1FYHB 1MCOH 4HSAC 4J8RA 2R83A 2E0PA 5D72L 1CK0H 1FFTB 2JH2A 4RZKA 3MN8A 2BINA 2DQCH 4CAGA 2YQ2A 5DRNB 1J9TA 3AZUA 4FQ1H 2VLJE 4KK5D 3FU5A 1NL0H 1ZHLA 3EJRA 3ZDYB 3E6HA 2XTJE 4U6YB 5MENA 1WYJA 4WI0A 3EJUA 4W9GC 2ZPKH 3V4UH 3TN0A 3AXLB 3WHE0 2TRHA 4RAVB 1AZBA 3QNYB 4G43B 3H9HA 3AY4C 5HHVH 3APDA 1WQVT 2Z7ZA 4R4BA 1DQDL 4U1NA 1BXAA 4BK8A 2OR9H 3IDYB 1QMUA 4NENB 1CGXA 1TEFA 5KYUA 2A74B 2OK0H 1QFHA 1A3ZA 2R59A 3UAJA 1QBBA 2YHGA 3NK4A 1CDBA 1U8QB 4UILL 2WXQA 5BVJB 1AGDA 4Y0GA 1MN4A 5ILTH 3KPOA 4KAQL 2WMPB 1AJ7L 5D7KE 4AQ1C 2Z4QB 1FVCB 2OMZB 3KPMB 2BW5A 4B97A 1S5IL 4G6ML 1BW8A 3QCVL 3CZFA 1JDDA 4QDGA 2RB8A 3P0YH 2X05A 4MBOA 5D1QE 5EO9A 3BDYL 1IFHL 1IFHH 2XTSA 5E8EA 5E8PA 35C8L 3VSQA 1I8LA 1G4RA 3B83A 1U8MB 4AMXA 3T8XA 5KZCD 3ARBC 4L8BB 2DTML 3PJSA 5D2LF 2WANA 3D7PA 5ADPL 5B8CA 1MSPA 4DSYA 1KLFA 4N9GB 5E9DD 1JGEA 5FGCB 5AW3B 1QYGH 3FUNA 3SOTA 2UZYB 3LH2L 2GHWB 3SIKA 4L4TD 2OP4L 3JV0A 3EUUA 1S9WA 2C1PB 4PRAA 3NZSA 4XP4H 4PAZA 3W0WD 1KBPA 3GBNH 1NGYA 1TSHA 3O9WA 3ZRFC 2UX7A 1AGFB 3V5KB 5C0JB 4OCSL 5EUOE 5ECGA 1SM3L 4PH8A 3LEVH 2TSAA 35C8H 4N8CL 4XXDB 1EVUA 4JFXA 4PBXA 2YAEA 4S1QL 2CPUA 3P4MA 4JM2C 2ITDB 4DGYH 4F8TA 1BQUA 3V0JA 3P3UA 1M7IA 5ISZE 2TRYA 3VYNA 1IBDA 1HI6A 2F7QA 5I1IL 1I1AD 2IAMA 2QV4A 3MRPB 2PYEE 2Y7SA 4NKQB 4OUOA 3KPRD 2W07A 4WW1B 5A16B 4TQPA 1IGFH 1S3KH 4LNRB 5TDOA 3BT2L 4LSSH 4A2DA 3OR7A 5A43C 4UOW0 3WFEH 5INDA 3SDXE 3JWOC 1U8OB 1OF2B 2VRAA 2WBKA 3G9VA 1SMAA 2B9BA 4GXVL 1KV3A 3RNQB 3A4FA 1JNHB 2WZ6A 4N0YL 4AV5A 1T22A 3BCDA 5ACZA 4N2FA 5IROD 2YC1A 3NAAL 5AYQA 1DQKA 1GYVA 5FLUA 1I53A 1LMKA 5FECA 3D69B 5F1IB 2A77H 5C0DA 3QZBA 3JTTB 4L37A 4JFWA 4YVNA 3UTQB 1W15A 4YLBA 2DM4A 4LPYA 1PVHA 1MVUA 1UENA 3H0TB 4MGXA 4PRPB 3CVHH 5AD0B 1TTRA 4PI0A 3S3CB 3AXLA 3LKQA 1IM3A 3BP6A 1AZZC 1XD0A 4KRNA 1T7YA 2AF2A 3G6AA 4JHVA 3UTPD 1KPUA 2EACA 4AW7A 3PAZA 3CUPB 4BHUA 4EIZC 5HHMB 2GUYA 4UQAA 3NMEA 1TCRA 2P5EE 3PAYA 3W57A 3GSVB 4P5MA 4XPFL 3PGFH 1MLBB 1LXMA 2AANA 5GRYA 2XPYA 4PG9B 3K6FA 5L4IA 1XH2A 4P4KA 1MIEH 3B9DA 2PXYC 3EFFB 1E3ZA 2VDRB 3GS0A 3NA4A 4GJTB 5GGVH 2RIKA 1U93B 1HXKA 4Z3JA 2NY5H 1YC7A 3U0WH 1F6AB 2ZKHL 3EJJX 4M61B 4K3GA 1H5BC 2GSGA 5FO9B 3BJLA 1G9NC 5EC2A 4KUZH 4YSEA 4XAKD 4JJOA 3EJQA 4DF9A 3K0WA 1WCBA 4QYOA 5ESAB 3ISYA 4QY8B 4RDQG 5HYQB 4PHZA 4UF7C 5CJXA 1HKFA 1TNNA 4KY1H 4J12A 4X6DA 1FGVH 2XTJC 4RA3A 3T3MB 3HR5B 4ZXBC 4XC3L 5LN4A 4BSWA 1A7NL 3CVDA 4WFEE 1S7RB 4ZO9A 2VLLB 2QHRL 4RESB 1F2XK 4H5SB 4J6RL 1N5AA 2BSED 4HC1L 3WMPA 2Y23A 2NDGA 4W6XB 4HUWB 2CK2A 1UVQA 4PWEA 5MI0C 5EF1A 3DOIA 2EH8L 3IFOB 2O5XH 5I75B 3VAEA 2J1KA 4YDIL 1R24B 4TUOB 2NUTA 5AWNH 1E8WA 1YPZB 3H9SE 1G7QB 1UA3A 3GO1L 1FO0H 4QXTA 4DW2L 4PB0H 1NCCH 2JF1A 2ATKA 2CJUH 4K15A 5BZWA 4U31A 2WZPA 1HZHL 2B77A 2GAZB 4KDTC 3O6FC 5FIEA 1LDPL 5EFIB 3SKJL 5B3SB 3D3VD 5KYYB 3HC3H 1JD9A 3H7BA 3UG4A 4JM4L 4CNIA 3EG9A 4GAYA 4ONHA 2VLKD 2DW5A 3BLPX 1J5CA 1RUQH 3G6JA 3MXVL 5ACLA 2ZKYA 3DNKA 4ISVA 4CADA 3C6LA 2Z35A 5T5NG 3SE9H 3CV5A 3BZ4B 3QEUB 1ACCA 1WCQA 3HVDA 4U7SA 5A16A 1U3HC 5C07A 1AD9A 4RGMB 1EA9C 3GXPA 3SHSA 5SX4H 2IOOA 2IDCA 3MDJA 4JO1L 3BYTA 2P24B 4HUNB 4IW4C 2R27A 5D7KD 1X5HA 2IH1B 3F58H 3ARBB 1R5IA 1T2XA 4Y4FD 1U8HA 5IROA 1YYMH 3IFLH 4G8GE 1FL5A 5GS0L 1P0SE 2C3XA 2QTVA 2G75B 2BVOA 3HLAB 1FHNA 4P2CG 3SPHA 4L8DB 2E47A 3MBWB 2ICWA 1E7VA 3C2SA 4OI9A 2F54A 3DI2B 2FSEA 3BWAA 4XMXA 1WC7B 3K8LA 5CZRA 3RVXC 2Z31B 1OM9A 4I4WB 1KNOB 2ARJQ 1KN2H 3BVTA 4K94C 1UA6H 2ICEB 1I9RL 4YDVB 1ULVA 3X11B 2C9XA 4K5OA 1YNKH 4I0PB 3L2MA 3WXVL 4KQ0A 1BEXA 4XO3A 3NSDA 4OB5L 1W0VA 1ZGLM 3WU1A 4P9HC 2WWMC 5AL8A 5E7FA 3WIHL 5I6KA 4PS4H 2EDDA 2Y36L 4OQTA 3VFRA 4NGHH 1LEIA 3LMJL 4LSPH 2H41A 4HZAA 5EB9A 1QI5A 4MMXB 2B5IC 1I3GL 1UC6A 3IGAB 5HYJB 2WXGA 3NA9H 3I6LD 5FUOL 1KIPB 5F6IC 3BKML 1AP2A 3LNEA 3M07A 1BPLB 5GRJL 1J9SA 3NT0A 3F62A 2FQGA 4KPHH 4N0YH 5AZEH 3UABA 3LZPA 3BISA 1T1YB 4LSQL 2EICA 2O5YL 3OR6A 1YEHL 2WSDA 2OR8A 4IBLT 3LKSA 1MW1A 1GZHA 1EEUA 4U6HB 5GGTH 4ZZKA 3ZYIA 1JAEA 1IIKA 3P3RA 1TFHA 2D0FA 1YY9C 2DI7A 1FE8L 1P7BA 3A4DA 3MODH 4LRNL 5JUEH 2UXVA 3SJVE 2Q2EB 3PGDA 5EHFA 3NIDF 5HGBB 1FVEB 5DHVB 2NSQA 1ASPA 5FKPB 1RP8A 4B9YA 2X9ZA 1W2KT 3D2UB 4DOHB 2VLRE 4NNYA 5C70A 5IVNA 4JY6B 1RVFL 4JFOA 2XN9E 1OT1A 1QRNB 3AQDA 3IDUA 4OCLC 1ZGLP 3BZEA 1ORQA 3ARED 3INOA 3AACA 3HMWH 3ULVE 3POHA 3QIBC 2EXTA 4HEMA 4U1KB 2J56A 4R4FH 4U1MA 3GSOA 5BVJA 2YRBA 2BZCA 4MD5A 1IAIM 3GJEB 5CU9A 2Z4QA 2R9HD 3WI9A 4J4PD 3QEGH 4MFHA 1QHQA 3U30C 2EADA 5A2IH 2OK0L 4LBEA 1XZ0A 3ET9F 3CZFB 4EJ1C 4YWGH 1PAMA 3SDAA 4RZCA 3SCMD 5C0NC 1NC4A 1WTLA 2XA8L 3VJ6B 2AEQL 4I3RL 4MAZA 3C60B 1G6RA 1E43A 4HUXA 3RPKA 1REIA 4XP1L 5AOZA 4YZFE 1ASOA 2AEOA 5I6LA 1WTGT 4H2CA 3NCXA 1A7RL 2BJMH 1CFVH 4HLJA 1KGWA 4OJFL 2AJSL 4BCZA 3F04A 1E50A 4KHTL 2NY5C 4FP8L 4NFDA 1T3FB 3VQ2C 4JRYE 3PUCA 4PV8B 5E1QA 3CVHB 5JLZB 4ZQKA 4FG4A 5KSUB 2OJ1A 2FJHA 1RMFH 4QRUB 5K9JL 3MNZB 1CE6A 3MRCA 2IWKA 5F1IA 3RB5A 1HOCB 3QNXA 4CC1A 3ZTJH 1MCEA 1OAJA 4TSAH 2WZ0A 4AMWA 4G9FB 4KK6D 2IANB 5FUCE 1IIIA 5CILL 3D2TA 2OAAA 2YO3A 5DD5L 4RMRA 3S34H 4HHWA 4KZ0A 4NI6A 3ZSTA 5E6IA 3FQ2A 3NDZE 3SDDD 5T3XH 4NC1E 1WBZA 4FQXB 4Y5VC 5T3XL 2CDGB 3QWRA 1ODAA 4QJ5B 3JYCA 5FPIA 3GJFH 5HI5C 1A9EB 1SQ2N 5DCCA 1C12B 1PDKA 5F9OL 2FE0A 4B5ZA 1RURH 4MA1B 2P28B 5CJ8A 4YFLF 4HWZA 3ULUC 3T8MA 4JHBA 4M7ZB 1EEZA 3WYRA 1Y6MR 1ETA1 3LRLA 3I85A 4JBSA 5D7JB 3ZO9A 1PG7X 2V9RA 2VW7A 2D7TL 4BA8A 1G87A 1R3LA 1U8LB 3C08L 3T5WA 2Q5BA 5TF1L 3G6JE 4AQOA 1KIQA 3Q2VA 1I3UA 3DVGA 2YLHA 3HZYB 3QG6A 1F4XH 3QVAA 4PJ5E 1KXQA 1TLMA 4TTGA 1G7HB 5E2JA 3K81A 2AQNA 3FO1B 3ISRA 4Y4KD 1YJDC 4W4OA 4FQXC 1LK3L 2DQGL 3GMLA 3KPLA 1UEYA 3AXHA 3HS8A 3MO1A 3NJNA 1RURL 4G8EB 4NSKA 4P2RB 3TZVC 4AH2A 1IQWH 1CXKA 1HYSC 1LO5A 2A99A 3V10A 3BFOA 3EF4A 1RUMH 1QBAA 4PJGF 1P7QD 1SUJA 3FT3B 4J3OD 4GIAA 1N9PA 1H8NA 3TFBA 1K8DB 3N40P 5C0BA 4KKCD 3WE1A 1OIOA 4ZXBA 4FFYL 2CBOA 1JXDA 3BUPA 2E9GA 3BO8A 1PJ9A 5BMFL 5DMKB 2VXUH 3S8WA 3PL6B 2IPKA 5L9DH 1BQLL 2ZUUA 4OGAD 1AANA 5KYNA 2YSSA 4EVNA 4WGWB 1MUJB 5ECJE 1J12A 3NP4A 2PABA 5F72S 1CT8B 2R0WH 5HHQB 2CIKB 2HFEA 4JE4B 4DEUA 4G80B 1KJ2L 4XCCL 2OMZA 2V37A 4AMKH 5EFIA 3VXUD 4K3JL 4Q8BA 2A6DA 3ML9A 1DBJL 1ED3B 4NN7C 1RK0A 5IEKB 2ZZUT 4MAYD 5DO8A 1RVFH 1T1ZA 3ARPA 1RUML 2Y5TB 1OOWA 5FO2A 3M46A 2MCMA 1DSFL 2DDQH 4ZOCA 4BZ2L 4X6DB 3MNWB 3BEVB 3GXUB 4XN4A 2GSIA 3MYJB 3HIZA 4JFFA 4XMLL 2DJUA 2X4QA 3CFCL 4XNZC 4GP4B 3V6FB 4HUWA 1SUHA 1D5IH 3IWUA 1HH6A 3V0WL 2PP7A 2R1WB 5DJ8B 3VXOB 1SXSA 4JPIA 4MJ4A 5JLZA 2ZOLB 3O81A 1R1CA 1E4WH 5FDWA 1J5OL 1G7QA 1G6RL 2NMSA 5J3HD 2YPVA 3IJ8A 1TPXB 2GJRA 4LPWA 3Q1SL 1GS7A 1XGPA 1I1AA 2JQAA 3KR3L 4TOYL 5C09B 1NCAH 5HJDA 4LLQB 2FB4H 1T6VN 1E6JL 1TZ8A 1NDGA 2VZ3A 2J7LA 2F1AA 3LZQA 5IBTL 3SPVB 1EK3A 2CDEA 2CBMA 1SFHA 3D39B 4OFVA 3MV9D 1PKOA 5BO1L 3KH4A 5BVPH 1L0XA 5FOBB 4JFZL 5IOKA 1NEZA 5FGCE 4G42B 4N0FB 1EDYA 3MYZA 1LILA 2EDXA 3CC5A 4GQPH 4GEIA 1XGUA 3L3DB 2ZCKL 3MLVL 1MRFH 4NS0A 4WNQB 4B9IA 3LIZL 3LDBC 4DAGH 4IGBA 2QSTA 3MLSL 2QJDA 3VFUA 5IQ7H 3BH9A 1JWMA 1YYLL 1UYWH 3IGUA 2E6JA 1ACYL 3BH8B 43CAA 2F53A 2B3IA 4YHOH 1QSEE 4JK0D 3L95B 3AJ7A 3NN8B 1UCBH 4MNGA 3X1NA 4WEEA 1T22B 2NY0D 2WTRA 4V2CB 3TN0D 3C5ZB 1TQWA 1CFNB 1HWWA 2CKBH 1ZPUA 1EIBA 3S98A 4AE1A 4FMFA 3NZ8B 2W95A 4NHCH 4Z7OE 2ICCA 3SGDH 2NTFA 3PWNA 1CCZA 1IGJB 2DWDA 2ZCKH 3EGSB 2I60H 3RZCB 1G4MA 2R9HC 2HVBA 3QDAA 4V1DA 4Y5VA 3MUGA 3MRIB 4LLWB 4L29B 1LVEA 2OP4H 2B1AL 1U95B 5KS9E 2AC0A 3QJHB 1XIWC 4RLDA 4FTDA 2LTQB 5B8CC 5T1LD 2APXA 4U4BA 1W72L 1JGLL 4JUSA 4L5FH 4PV9A 1AXIB 3KDPB 3ROOB 4DP4X 1WBYA 2UWEE 3QDGD 5IVXB 3FU7B 3ZT5A 4E2OA 2VZSA 1AR2A 4HXBL 2YD5A 4WI3A 4OLWH 1CXIA 4C8XA 2ESVA 5ICYA 4P8QA 3BHBA 4UQ9A 1F18A 2HN7A 1CPUA 4O9HL 3O6FD 4LLDB 3UTTD 4Z7UF 1OT2A 4PLJC 4G3YL 5IK3B 3WOVA 3VXUA 4S10A 4GRWE 2OI9B 2QL1A 3MCKA 1T4KB 4K5LA 4P3DB 4PY7A 4JFHD 4QF1B 3GJFK 3LOWA 1T21B 2J1ZA 3MRGB 3Q8AA 5GS1C 4PJIB 2YLKA 3LPFA 4XBPA 3LN5A 3KVDD 1VERA 4XC1H 2BS8A 2OW7A 3B3IA 1A5FH 3Q43A 5I1JL 3WO3B 2HTLD 1F4YL 6TAAA 4B3EA 3QP3A 1U3HD 5I8EA 1QSFD 1XTLA 4KQ4L 4O58L 1KJ2B 1MCIA 4AJVA 1GCFA 3UJIH 1W0WA 2IAMD 5D70H 2FO1A 5H2BB 3ILPA 1AQDA 4GKSB 3ZDXB 2GJ6D 1KCVL 1Q0YL 4TUJB 3ZMEA 4MVBC 2IH3B 4HJJL 1HCVA 2VJXA 3RWIA 1E28B 1D5XA 3HKFA 3H2PA 4ZAKB 2ZKHH 4HJSA 3ZDZB 2PNDA 4XP5H 4N9GA 4XOCA 3A4AA 4F93B 3BQUB 3O4LA 4UYQA 1JDCA 1A3LH 1SXNA 4FRWA 3FQUB 1GIGH 4IK6A 4XPAH 2F68X 3L4VA 3HNTH 5I17A 2C1PA 2WTPA 1GS8A 4EKXA 1Z6JT 4ELDA 5T3XE 2GT9B 4XPFH 3LHAA 4A39A 4UOZA 1FN4B 2HT4C 4GW1B 3UADA 5C9JB 5GGUB 5HGDA 4JCLA 4BXSV 1ETZB 2ADIB 2DIBA 4K3HA 5I5JA 8FABB 5L88H 3CBJB 4JJ5A 3HI6L 4J6IA 2PP9A 1DQQB 4GAAA 4M7LH 4PG2C 2DKUA 5I18L 4MXWH 5EORL 4MJID 4QRBA 4HJEA 5E4IA 1C9SA 5KVGE 1QR4A 3UP6A 1ACXA 5KJ4A 1AG0A 3IYLW 3R06B 3ME0B 4AVKA 1R17A 3RX5A 2CAKA 1OKEA 4FCHA 3OG6B 4S1RH 3CVHA 4C4BA 3O6MH 4U1JA 5T1LB 4DN3L 3H3KA 4QOKD 3AMLA 4EN3A 1U8HB 3WKYA 4QRRA 1XMEB 1XGRA 5EF2A 1X44A 3KL5A 3WAKA 4ETQA 1ECZA 2G0KA 2FX8H 3KYKL 4UM9D 2KPNA 3P0VH 5HDBE 1OCZB 3TJEL 4PREB 2FBRA 2OL3H 4YC2B 3WKNA 3JTSA 2WM0A 3TPKA 3QUZA 2QR0A 1FL3B 3VD9A 2BK8A 2VERA 5ABZA 4A6YH 4Y4FB 3MOAH 3GB7A 5FWQA 5LGKA 3NIFE 2EH8H 2YRLA 1XXDC 2WWKT 4F2FA 1L7TH 1I7ZB 1L7TL 3N43F 4S0TD 1USZA 2HG5A 5ESQB 4EZJA 3IVKB 4P5TD 1J88A 1PNDA 3QS2A 4Z7VE 3WFDH 1RZFH 4YSDA 3GTNA 3SYOA 2MIZA 5GZOC 3QYNA 1UWGH 3DXAE 1MRDH 1E5UI 3H56A 4WQOA 5D1QD 1AO7E 3GMPA 3RP1A 5CD5C 1AD0A 3NQKA 3QK0A 3P0VL 5GGQH 4OV5A 1R3HA 3T3PE 1LEGA 1I85C 1ZT7B 3RFRA 4P9HH 2H0EA 3CAFA 1B2YA 5BJTB 3O8XA 2ERJB 3EFOA 1TZGL 1NMBH 3H4FA 4EZLA 3QQ9D 2EIDA 1P84K 1ESOA 3V4VH 3P73B 1BBDH 1SMOA 4LSDA 3ESNA 1JPFB 4XWOD 4HXBH 1CLOH 1E0OB 5TGBB 1JYNA 1H6FA 1ZLSH 2D7TH 1VHPA 5HDBF 4JFFB 4LLMB 3UO1L 3FCUB 1A47A 4S1SL 3ESUF 3VFSB 5JDSA 4JFQA 1RZIA 4X98A 4WEMB 3VTAA 4E41A 4WDIB 3TBBA 3KWWA 3L1OL 3BPNC 3QIUC 3GM0A 2X89A 5EN2B 2DBLH 2EIJB 1BYOA 3GKZA 1CLZH 4ZW3A 1ORQB 2YJLA 3QZMA 5ANHA 2W9EL 2EUXA 4P5KA 4OJDH 1UKTA 3PQYA 4NERA 2YSSB 4M9PA 4EVNB 2C5DC 3FO2B 5AENA 4JHAH 1WIPA 4TNEA 5FA3B 4RFOH 3P2TA 4P59L 3CHOA 1BEYH 3NCJH 4DPRA 1B4JL 2VDKL 4LEXL 3SJVB 4G8IA 3WEMA 4CUCA 2IADA 1OPGH 4P2AA 4BV1A 4JPKH 4BE6A 1OSPL 3BPCB 4M43L 1FYTE 1EFXB 1MHPH 1NUFA 3LS4L 3HG1A 2NY6D 3FSZA 4AGLA 2CRZA 2GK0B 2V6HA 2FGWL 1IAKA 3FH8A 3C5SA 3U83A 4YX2L 2VXTL 3UZVA 5FGRA 3MLUL 1CTNA 3ZGIA 3EG9B 4GAYB 4YDMA 1ET7A 4LHQB 2AXFB 4NQED 3ZQXA 2JCCF 2ALWA 2JKJA 4BK5C 4LU5L 5HDRA 4OUUB 2HJFB 3KCWA 2ED6A 4KVCH 2CHZA 2DEWX 2VL4A 4I9WE 4LHUA 5F89A 4OCWL 5LGHH 3V4VA 4O9HH 1RZQA 5BRQA 1A14L 4OH2A 5DUMH 4PIBA 5E6ID 3SO3C 4AC2A 4AVHA 5M7QA 2VSMB 1M6OB 4EI0A 5CZVL 1KYOJ 4UQ3A 3BUQA 5JR1L 5LAXA 2A2QT 2KBGA 2VITB 4PU2A 2NOYA 2PCPB 3WHE1 4WAFA 1HHKB 1NSNL 1UXLA 2TSBA 5EZJA 5JZ7C 3L3KA 2E6QA 4MA3A 2ENPA 3SYPA 4KKRA 3LX9A 1HT6A 2J88H 4N2EA 3HMWL 3D07A 4FG0A 2VQ1B 4JHUA 4R0LA 5IFAH 4GB9A 4DH2A 1FDLH 1OGAB 2YGQA 1ETB1 3N3EA 3L9BA 2A9DA 5BVPL 1TJXA 3GSWB 3BH8A 5ISZD 2ZE0A 3GMPB 1IJ9A 4OZFB 3L3GB 1HSBB 4GS7C 5AB1A 3V5HB 1G0XA 2C9QA 4I89A 1KJVA 2CHNA 1AGDB 5GXBB 4WO4D 1MWAA 3CFTA 2HVJA 5ABAA 4RISH 4BUQA 5J8OA 2PW2A 3U6XS 3BFWA 2ARWA 4M02A 2M26A 1QBMH 4EQ2A 3FYEB 1I8IB 3IPEA 5C0RL 3VMPA 4OI8A 2GITB 4FQIH 4QWWD 2Z3FA 2VN7A 2ADGA 4PJ7E 3JV4A 3OKNA 4Y2DB 2APVA 1ZWIA 3RZCA 2C3VB 4L0PB 3UCRA 2AJSH 2AK4B 5I1KL 1F6LL 1WE5A 2KI6A 2PR9A 4AXWB 3H9SD 2NYKA 4GUOA 3RUGB 1A6AA 1ZLDA 2GI0A 3GRGA 3MZGB 4FGMA 3MRMB 2R1XA 5GZNC 5IW3A 4MA7L 4OM1L 5D1XC 3ECVA 1NANI 4GI9A 4P9HL 4HUVA 4LXFA 4P2OA 2EC9U 5DRZA 1BGXH 2WVSA 3E6HB 4LT7A 4DKFH 3NPZB 1JZ6A 4PHXA 4OF8A 5D7SH 1VFOA 1BLNB 3PWVA 5GS2H 4J3WA 4AE0A 4YSRA 1Z9SA 4N6RB 3V0AC 3GSQB 1PMYA 1BAWA 4DN3H 3QQ9C 1X7SA 2DYPD 1P5UC 1N4XL 4OJAA 5EU5A 5IBUB 3VXMD 3BSGA 4YAQB 2YUVA 4LPUA 2YD3A 1ZMYA 3FT1A 3DX3A 4JZNA 1A9BB 1AXSA 4XNXH 3DRQB 4M5YH 4MB1A 4B50A 5AB9A 4ODXA 4AKOA 5CBAA 1QHOA 1ETZA 2ADIA 3ARXA 3DMMD 1RIHH 3HBQA 3KYOA 4MD5B 4OU3A 1TQCC 4OBSA 1UJ3A 4UM8B 2ZX9A 1JYWA 2XZQH 5E6UB 3RURA 3KLKA 5DJCB 3MRLB 5HD8C 1IILE 4ODUB 2V33A 3SDDA 2Z4TA 3VO0A 1UM4H 4HHGA 1DZBA 3K72A 3PE9A 4NP4H 3ESOA 3RVXD 5DJ2B 3SDXB 1OE1A 2VO8A 2MMXA 2H1LM 4I1PA 2HLEB 4HFUL 4C58B 1UZ8B 3VXRA 4TUJA 1OSPH 5TE7H 3VXTB 3HPJB 3NIDB 1IC1A 4WFED 3KYMB 4F7CA 4JFFE 5F89B 3ULUE 4V33A 3FTGB 1OARH 2R0KL 4B96A 3DLQR 4M1GH 2ZCLL 2FEEI 4BFIB 1JHLH 2KZKA 1XH1A 2VCOA 2WLLA 3IE4A 3ILQD 3QR0A 5LDSA 2BNRA 5JNYB 2G5BB 5CAYB 2VR8A 3ZDZF 2G2RA 1FNFA 3K5SA 1BM3L 1OTTC 5HVHC 1KPUB 1FO0B 5JPNA 2Q8BL 4OF3A 3WEXB 4KKBC 3VI4F 2ZSWB 3GDBA 3ZL4H 1XGYH 2BIIA 3I6LE 1E9QB 1EGJA 1J87A 3IS1X