3E2HC

Structure of the m67 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
pubmed rcsb
source organism Mus musculus
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e2hC00
2LE9A 1YNKL 1YY8A 5DUBB 2A77H 1A3LL 3HI1B 3LPFA 5SWZB 5IOPA 2MCPH 1CICA 4DVBA 4MSWA 1FL5B 1KIRA 4PRDA 4I1NB 4ZD3L 4HUWB 4NBYB 3SBWC 3AY4C 3H9ZA 4FQQA 3FO1A 3BPCA 3KXFD 3X12B 5IBUG 4XMLL 4N90E 2YXMA 3SDYH 2J8UA 3GJFA 4NZDA 1S9WA 1L0QA 2X09A 1UXSA 1QR4A 2NX5A 4DUWA 3RNQA 1W72B 4V1DB 1FFPA 5C0JB 1J9CT 2EDFA 4MQSB 5JW4R 5K9OB 4NUGL 3UTSA 1CFSA 4KRPD 3LDBB 4BFIA 2YA1A 2ADIB 3V4UL 2VLMD 3BT2H 2ZUQB 3TH4T 1RZIB 4OLXL 3L7EA 1G9NL 1UQSA 1P1ZA 4NKDB 4CVZB 4D8PA 2AP2A 1AFVH 3TYGH 3VXPA 3DX7B 5FUOH 3PE9A 3L5XL 4E5XA 4U1GB 5E9DA 4U6XB 4PIRF 4KV5F 2Y7QA 2IMNA 3VXRA 2HH0L 2F5AL 1KFAH 3H0TB 5FKAA 2ZUWA 1DQJB 2Y9RT 3HMXH 1KLUA 1LK2A 1GPOH 3HG1E 2XTJC 4KU1A 4NNXA 3ARRA 2OCFD 3WHXA 1PG7W 1BREA 1T4KB 2DQTH 4MA1B 4YQXH 1D5IH 5D7LA 1KB5L 2LTQC 2RAMA 2VXSH 5IB5B 4TSAH 4KK6D 3D39E 3V4VL 4PJ9B 1RZKL 4TPRL 2X4SA 4GG8A 1JPTL 4QRTA 1EAJA 4WGWB 1BD2A 4LBEA 1FH5L 1GH7A 3DARA 3LS5L 4EDWH 5EDXA 3RWIA 4APQD 2A1WH 3NABH 1WF5A 2Y06H 1V3MA 2V9RA 3GSNL 1CR9H 5EBMB 43C9B 4XMPL 1FC2D 2E7CA 1A7PH 3OR7B 4MHHG 5DJCB 3P4NB 4U7SA 5ANMB 4YFDB 5HGHB 2R69H 3JV4B 3TYFB 3TV3L 3EFDH 4GRWH 4DN4L 4QRSA 3DNKA 5IQ9B 4OFPA 2V5TA 5CEYA 5CCKL 2HMIC 1MCPL 1JGVL 1I3GH 3NCCB 2ITCA 4GRWE 3ARUA 5DFTA 3VXUB 2A6DA 1FZMB 1X4XA 1I1AA 3NGBB 2NY6C 5IMOB 3MUY1 3NFSL 3QIBB 2V7NB 5FYJL 3V0WH 1NCWH 3ALPA 4NWTL 1UJ3B 4ZDHB 1OPGL 3RL2A 4HKZB 4UUJB 4WW2F 3NAAL 3RVXC 4MA7H 5LVEA 4K8RH 2VQTA 3NFNA 3RI5F 3FO2A 2I9LB 2GK2A 5TPWH 1RZJC 1YQVL 2A83B 4M48H 4QY8B 2AV7A 2DLTA 4FNLL 4P23A 2XN9A 3AMKA 4LKXA 1UH2A 2BJML 4OZHE 3O4LD 3RBGA 3TJHC 4QHLA 3VD7A 5JHLL 2HLFD 1MLBA 2M1KA 4NYLA 5JOPE 1JP5A 2LVCA 1A6ZB 3MLXH 1FNEB 4J4PD 4ZO7A 4G42A 3K81A 5EZLB 2BVPA 4TVPL 3ARSA 5F9WB 1AI1L 4G9FB 1J5OH 2ICWI 2HRPL 1D6EB 3KJ4C 2HLAB 4X9GA 4YDIL 3UYRH 4LLVA 1R3LA 4DGVL 5GS0D 1UB6A 2J4WH 5C0IA 3ZTJH 4RNRA 4P57B 5SWSA 4H1LB 1DQMH 1JGLH 3W9DB 4R8WH 2XWTB 3CDYA 3ZZ1A 2B4CC 2XKSA 3DVNA 1X5LA 3WMSA 3EDEA 5EIVA 4GRWF 2A6JB 4U1JA 3KXFB 5D1ZD 1FGNH 1EBPA 4G3YH 3NBNA 1JFQH 2VDRL 1I7TA 2H6PA 3P11H 4NP4H 1K9TA 3T2QA 1G7HB 3BKYL 3FFCD 3ARBA 5EZJA 5I16B 3OTTA 1S7WA 3LQAL 5HHQB 4ZUVB 2F53E 2JJUA 1EHAA 1I8KA 2R2EB 4H26B 1FAIH 2YPVL 5KSAD 1XGTB 1ZA6B 4QF1B 1S9XB 3FAXA 1C08A 4OCSL 5KSBA 5DK0A 2Q76A 5JA9A 2GITA 1DBJH 1T2XA 5LXGH 4XPAL 3WIHH 4AENB 4KDWA 1P4BL 3H42L 1SM3H 5EU3B 4ZSOB 3CSPA 1U41A 3O3AB 3WNMA 1RUKH 1OAUH 1FNFA 4ONHB 1WWBX 2HG5A 4H8WH 3V5DB 4EQ2A 3RQ3A 4OCWL 3Q3GA 4S1RH 3S98A 2CRIA 1BVKB 2FWOA 1F3DJ 3UXFA 3QO0B 5IWLA 2D7TH 1SEQL 3TO4C 3WIFA 3QDMA 3L5WB 1OL0A 2ZUUA 5FYKH 2QQKL 5KS9A 5ICXB 4WFEE 1G6RL 3C5ZC 4DN3H 5IJKA 3HE7D 1KULA 1OHQA 4JPIA 1CFQA 5HD8D 2C1PB 2V17H 3LHPL 2A2QT 4RFEA 3RVWC 5FYKE 3RX7A 2BNUA 3X17A 2AXFA 2HT3D 5DQ9B 3TFKD 2FEDC 4NDMA 1S7TB 2CO6B 1FNGA 2ZCKL 3DIFA 4JKKA 4L4VA 4NN5B 3W0WE 3O0RL 3MOBH 5C0AE 4E42A 4NN7C 3H3BC 5JPMB 5DVMA 3JV5A 1MIML 4OGZA 2I60H 4X98A 1C16A 5E6ZA 5B39G 4XB7A 3QH3B 5DD1H 1CVRA 3V0VA 1SBBA 3CVIH 3BUYB 2GUOB 4APQB 3MBXH 4R0LB 4EIZC 4QKXB 4KKBC 2IFFH 1NGPL 2W9EH 1B2WH 5DHYB 1PKQB 1INEH 3MRPB 4KUZH 4G6AC 2ZJSL 3MLSL 3G08A 4XP6L 1QR1B 3MV8E 4DGIH 2X4PB 4X7SH 3QUZA 5FECB 5ISZD 1AGEA 2W07A 4NJAL 2E9IA 2R0LH 1QSFA 4PY8I 5DTFA 4MNGE 4PG9A 4FQPA 5I18L 1KLGA 5B4MD 4YFLF 2EYRA 3GBMH 2IH3A 3FFDA 1YEFH 5T1LD 1QFOA 1RUQL 1KB9K 1KEML 4P5TA 3KLHC 3WN5A 1XIWA 2ZKHL 3ZO0A 2P8LA 2GJ6B 3FB8A 2X7LB 5DJDA 5JOFB 2GT9A 1BBJB 3GSVB 3WFZA 3WE6A 1OTTC 1HOCA 5BZDA 2BVTA 5DHXB 1VKXA 1JRHH 1XZ0B 2EYTA 1JF1A 3F6IA 1N59B 1PW3A 5J06A 1NC2D 1XH3B 4CUCA 4OGXH 1EAPB 5KJRH 3HMWL 3OKDB 4OV5A 1JGEA 4ZPVA 5GGTA 2APVA 5EBLA 4XAWL 4TOYL 1U8HB 4MNQB 4AL8H 4J8RB 3QIUD 3O6LL 4C57C 1NCBL 5HGBB 1JI1A 3EO9H 5JW3L 4FFZL 5J3HC 1JNHB 4NKMB 1P7HL 1DBBH 2OP4L 3BP6A 1GC1H 4ODUB 3DROB 3U1SL 1T2QL 4PRHA 3ULUD 1ZSDA 1JGUL 1MHCA 1AC6A 4N8VB 1XEDA 3QAZC 1WZLA 4O5LL 4UDUB 1TPXB 3VCLA 1TZGH 4HQQH 1A6VH 4HK3J 3CMGA 4AMKH 1KJMB 4ISVB 4XBGA 5EO9A 2ZG1A 3REVB 1OWRM 1JZ5A 3LN4B 3MJ6A 1DP0A 4JO1H 1IGFL 4FQ1L 1KCUL 3MACH 5D1ZB 5HI4C 3VRLE 4F9LA 3ULSA 3B9AA 3TT3H 4JDVB 1EUTA 1BZQK 1FNSL 3V7MA 3M8OL 3QDGE 3FFCB 3F58L 1EXUA 4PJ7A 1CF8H 3D69B 5DHVB 1T7XA 4YE4H 4XTRD 1U95A 3TBVA 4Y2OA 1ZHLA 4XNMA 3TA3B 5KSUB 1MJ8H 1KJVB 1CE1H 3OXRA 3QT2A 1OAYH 2HKHL 5JHDE 5JR1H 4KJQD 1LWRA 5BZWA 3QPXL 3GBNH 3DVFA 5CBEB 3CX5K 1LO3L 5DC9B 4FQLH 4R90L 4Y4KC 4C54A 1KJ2A 1OAXH 3D18B 2APFA 4ZXBA 3ARGC 1KCRL 4YX2L 1OAQH 1Y6MR 3T3PE 3JWDC 3WS3A 4A6YL 4KI5E 3MA9L 4JANA 3PWPA 4NFCA 2NNAB 1U42A 3NCFB 3WNNA 1AE6H 1CGWA 4M7LT 2NTFA 4P5KB 3HE7B 2CDFB 1VERA 1EJOL 5C0DB 4FXLA 4DW2L 3VXTB 2AEPH 4PRID 2VWEE 2EDJA 1ROWA 1FZOB 4I3SL 1HH6A 5MENA 3ARPA 3VRLF 3FRUB 1UWGL 1NLBL 2K7PA 2SEBA 3MREA 1DDHA 3C9NA 5T3ZH 4RQQB 5IEKB 4HGKC 1KC5H 3LS4L 5M95B 3E8UL 3C09C 5DEZA 4QRRA 3LD8B 1VGKA 1VACA 4KKAC 2EH7H 2VR4A 4LSQL 3QHFH 3NCJL 4WDIA 5EA0H 3T2OA 2FSEB 5T3ZE 1TJIL 3WYRA 4HJGA 3SDCA 3HUJF 4MJ6B 5HYQB 3EOAA 1ND0A 4XP1H 2VLRE 1U3JA 1K8DB 3CC5B 1MQKH 2QADD 3N85H 1H0DA 5T1DL 5ISZB 3N1QC 3JV0A 3UTQA 3T0ED 3LKSA 3DX9B 1C7TA 4XWGH 3TH3T 2EDWA 3PG2A 4PGDB 2Y6SD 5C07A 4KI5F 1I4FB 4NT6B 4C58B 5HY9B 5LGHL 5DUBA 4PJXE 4X6DF 4QLRA 5L8KB 1GHFL 2YD4A 3L7FB 5SWZA 3AROA 4ZMAT 5CJBA 4HUWA 3QBTB 3WV0A 3G6JB 3HI5H 3X12A 2FECL 3BEVA 3QUXD 4J6RH 1SQ2N 3DMMC 4N0FB 3V52H 1EEZA 4K23H 3RUGB 4LP5A 1MFDL 3QIUB 1A1OA 3SOBL 4GKNA 1W72A 1FG2B 2H32B 4V1DA 2VZ1A 4KH2A 4O9HL 2B1HL 5C0JA 1IAIH 3B2UD 1VPOH 4JRYE 2X10A 4WHTB 2YD5A 5I74C 1HSBA 3LEVL 3RIAF 3X3GL 3MV7D 1MUJB 5IBLC 1IT9L 3QZWB 4ETQB 4X5LA 1RZIA 3WHE1 4DOHE 4NKDA 4CVZA 3QG7L 3NPSB 4WHYH 5E5RB 4BH7A 3B3IB 1DQLH 4UBDC 4KKCC 3UBXI 3DX7A 1S5IH 4PG2C 4ETYA 4LARL 5I1LB 4ZOEA 1I8MB 1EHNA 4U6XA 3RDTD 1OAZH 2JJVA 4OLYL 1T03H 4Z0XB 3DWTA 4K07A 1QP1A 3VXNA 4YEEA 3H0TA 2B0SL 4PJXF 2PW2B 3QI9D 3V5KA 1LEGA 5EWIL 1T4KA 2YK1H 2FJHA 3IS0X 1A1NB 5IB5A 4OUUB 5E5MB 4UT9L 1CXLA 3BZ4B 4WW2C 3PGFL 4HJ0D 4RGOH 1J05B 2N7BA 3VFNB 4MA8H 2CUIA 5JMOC 2C9AA 2E5EA 4MCZB 3ARVA 1PKOA 1IQWH 5TDPA 2HJFA 4PJAB 2P24B 1MY7A 3IXAB 1WWWX 2APWA 4FZ8H 5H8DA 4JRXE 4X5WB 5EBMA 43C9A 1A6UL 1IAKB 5F1NB 5DJCA 3EDFA 3P4NA 2NY4D 1EA9C 3JV4A 3TYFA 1L0XA 3MUGB 4P9MH 2VITA 1DL7H 4MAUL 4HULB 5IQ9A 1YNKH 5DO2C 5I15L 4KJWD 3GJFH 5BQ7B 1T1ZA 3GEWB 4CMMB 2ICES 3PQYD 2HFGL 4P4KC 3X11B 4ZD3H 3BO8B 5I8OL 2ICWB 3STLA 5IHZB 4LLMB 3EJJX 4YK4B 4B7LA 2W0FA 1YMMD 1ZA3A 2J8UE 4UILH 3U4BH 4YHPB 2XYCA 5IB2B 1CK0H 3TIDB 2I26N 5E2WL 2V7NA 4WU7B 2NX5E 4YR6A 3PV6A 1FSKC 1RJZB 3O8XC 1P53A 4X9FA 2I9LA 1SJEA 3ARDC 3L6FA 4C4KT 5F7EL 4NUGH 3U30C 1CLOH 3V4UH 5FOJA 2LU3A 3GBLA 4W6WB 1J1PL 1G9NH 2N1KA 5J13B 5HPMA 1HCFX 2QADB 5EZLA 2A38A 2R23B 4K8RC 1DLHB 4MX7B 3NVQA 5D9SA 5E9DE 3T0EB 1U2CA 3LEYL 3TPUB 3L5XH 4NNYB 2HLAA 2G5RA 1RQ5A 4LCCA 1CXKA 1JI2A 1GIGH 3ME0A 5LWYL 4WHCA 5HYSG 4P57A 1F4XL 4Z7VA 4H1LA 3H9SB 4EN3C 2H2PC 4ODBD 1MHPL 5DUPL 5GS2D 5BO1L 3UPAA 4R6UA 3MJ8A 1BJ8A 1OGTA 1WV7T 4UV4H 2BRRL 5CKGA 2Q87A 5C2UB 3KXFA 5JQ6L 4QRUA 3QYCA 2HVKA 1NAKH 2X1PA 1G7HA 2DQUL 4Y4HA 2XQBL 2KZWA 1JWMA 2IADA 3KDMB 4JFFE 5I16A 4U1MB 2EDNA 3UAJC 2PTVA 2H2SD 2BNRD 3CX2A 3GJEA 1U3HC 4MCYA 3RTQD 3QQNA 2R2EA 4YHNB 3QJHA 5HI5D 4UV7H 1JCKA 4R97B 2FX9L 1FO0B 3UMTA 3LS5H 4U3XA 1S9XA 1TJGL 4XCNB 1FYTD 4M5YH 3D3VA 4XMPH 2DYPD 4LHUG 3DSFH 1XF2A 1SJVA 1U93B 4JFED 5EU3A 2H8PB 1UWXH 1DR9A 1IAIM 2VISA 4DN4H 3KYKL 4G5ZH 3FTGA 4CGTA 4MAYD 5D1QC 4RISL 4PJEB 4Q2ZB 1MCPH 3C60C 1JGVH 4HGWB 1TETH 3QO0A 2Z91B 1G7LA 3RAJL 1HHIB 3L5WA 3PWUA 1TTGA 5A2LH 3BKML 3QI9B 4G7VH 3RP1A 3I6LD 4H8WC 3GSUA 3QCUH 1E4XH 4NWTH 1WT5C 1OPGH 4ZYKB 3VFGH 3NAAH 3QXVA 4KMLB 3ARZA 4XC3H 3S97C 1NDGB 3MRMB 1EBAA 3BD5A 5DQ9A 4F8QA 4JQIL 2XN9E 4ELMB 1S7TA 3WUWB 4H0GA 4FNLH 5FYJE 2BX5A 3G9AB 4HF5H 3GHEH 3PGCB 2CKNA 4K3JL 4OI9A 4RX4A 1L9NA 5JPMA 5JHLH 2AJYH 1T80A 5HHOB 1OT2A 4JN1L 1MFBH 3W82A 2WBJA 3BP5B 4JM2A 3F65A 3QRGL 4TVPH 4R0LA 3NA9H 1Q0XL 4UIKL 1SHMA 5DHYA 3LSOA 2HRPH 1P7QD 3IXTA 3MRPA 5SWSE 4DGVH 1LO0L 3S88L 2J5LB 3Q2CA 1QR1A 1BF8A 1FFNB 4TVPE 3SKNB 5EOQL 5FECA 3RVTC 4BQBA 1F4HA 4OT1H 3H3PL 4YXHL 2JJSC 2IGFL 4JAMA 3PQYB 1U8JA 4KRLB 4WRLA 5ESAB 3KPQB 1MEXH 2B2XH 2BNQA 3MODH 1YMMB 4LSTL 3GJFK 1RK0B 1PZ5B 5JQHC 1D5XB 2GJ6A 2D4FA 3BKYH 2EEDA 2AQ3A 4NWUL 5E70A 4MQ7B 2IC2A 1VENA 3VWJC 4F9PC 3LQAH 2XTJD 3U82B 1IKNA 2N56A 2BSRB 2YPVH 3OG4B 1XH3A 3QQ3B 1VCAA 4KTYA 5F21B 4I0CC 4XPAH 1U8HA 2CR6A 2JF1A 4MNQA 1P4BH 4J8RA 2F9BT 3SCMC 3IU3B 2Z35B 5HGBA 3DYOA 5GQBA 1U2HA 1RJYA 3MCKB 1A5FH 4OCWH 2ZUYA 1X3DA 3IKCA 3C08L 4F7CB 3DROA 3QNYA 4K3GA 2DQEL 3SDAA 1I75A 4L1HA 3DVIA 4FTVD 1A4KB 2F5BH 3FAWA 4POUB 1SEQH 4HGMA 1HQ4B 5FUZL 4ZS7L 2QQKH 4UDUA 3OHXA 2DIJA 1G6RH 2HJLA 5E2UH 3N1FC 2HMID 4ISVA 2R15A 4YHZL 3ZTNH 3LN4A 4TTDC 2J88L 1GC1C 5D1ZA 1FPTL 3FCTA 1P5UA 3S4SG 1ED3B 3EW3B 5ALCL 2NY6D 4TSCL 3LKNA 1IZJA 5DHVA 3UP1A 4S2SA 5D7KE 3F6LA 5BVPL 3CSYB 5D96B 1RY7B 1J1XL 2BNRB 3TA3A 1MIMH 3RTQB 3RZCC 4JZJB 4Z95L 5F89B 4K71B 4PLJD 1EEYB 7FABL 4YXLH 4PJHA 1DBAL 2D0HA 1AHWB 1XF4A 5FYLL 4UQ3B 1MRCL 2DYPB 3TJHD 2OK0H 1WK0A 3ZE2E 3OL2A 2A9MH 2X4QA 4OFYA 3FN0H 1IILE 3D18A 1RZGB 5I1DA 1QSFE 2CKBL 3BDYL 3RY6A 4WO4C 2R8SL 2MKLC 4NJAH 1J1OH 4WTXA 4QRPE 5HVGB 4OZGB 4M93C 1HEZB 1G7MA 1UWXK 4JB9H 1I85A 3HAEG 3TPKA 5I18H 2ATKA 5L2KA 2CLZA 3OJDB 4NC1C 5FUCE 3UO1L 1RUQH 4KI5C 4ZUWB 5HHXL 5B38G 5EO0B 4P5KA 2CKBA 2XICA 1OSPL 4PJBB 5GGTH 1FAKT 3VXTA 4YC2C 4X4XA 5ESQA 4F2MA 4B50A 3E2HC 1D7FA 4N8CH 3HE6C 2EIZA 1QKZH 3S3PA 4M1GL 3FRUA 1WUNT 5JZ7C 2VWEC 4UQ2A 3QNXA 5MP6L 4HHAA 4WI6A 3HMWH 1FVEB 5DRXB 4XAWH 4G80B 5IESH 4X7FC 1E28A 3GUTB 1U58A 2ZCLL 5SX4H 3LIZL 1NUDA 5DVLA 4LPTA 2P5WE 1RIVL 3QEQB 1KT2A 4L8SA 5JW3H 4X6EB 5FK9B 2FSEA 4FFZH 4Z18A 4XNQB 4QHNB 2W0KA 2VXVL 4MJ6A 5HYQA 2WWKO 5EOCJ 2GW5A 4Z7UA 3U1SH 3S96B 2IBZX 5HYSA 3ZE2F 3S35L 3QUML 1JGUH 3CC5A 4ZUSB 3HR5B 5IVXA 1IGTA 2X4UB 4MXQC 4ODTH 2E6JA 3TGXA 3GI8L 5JIKA 4GG6B 1Q0YL 3DX6B 1IGFH 1KCUH 5HY9A 1UVQB 4Z77A 3N9GL 3O3UN 2F54D 5GGVL 3TO4D 5KVDL 3HPLA 4JR9H 1FNSH 1RD6A 3M8OH 5JPNA 3NIGE 4NCC2 3C5ZD 1PSKL 3JWOL 4X6BA 3VDAA 3UBXB 1F11B 3VDBA 4WFHD 2XTJB 1NBVL 1SEBA 5BW7C 3G6JA 4HX1B 3RVWD 1HHJB 1VFMA 2LTQB 3DJ9A 3L3KA 3MLZL 3CCHB 2WLYA 1OSZA 4MB5A 5KTEH 2HKHH 4XMKL 4EI6B 2CRMA 1K4DA 1PJ9A 1U91A 4LHUA 5ESVA 5F7WC 4CU7A 2IPTL 3BKCL 4NO0D 2DJSA 2VZUA 5IVZA 2H32A 3GMOB 3GRWL 3BP4B 1N2RB 2QQLH 5IT2L 4N1HB 4YX2H 4FQJL 4KKBD 3V6ZB 4D2NA 4ETQA 4YDVB 2PCPA 4QWWC 4FTVB 2I25N 1QNZL 3MA9H 4OQTL 3WNLA 4PJFB 4YHIA 1E4KA 4G6AD 4JFHE 5IFHL 3A6CH 1AXTL 2GTWB 2QEJA 5CUSH 3MPCA 1T1XB 2RBLA 5I1LA 2OQJA 4DW2H 1I8MA 3PUCA 2YUZA 4MZ2A 2YOCA 5MENE 4Z0XA 4GRLC 4I3SH 3AREC 3G6AA 4JM4L 2EXWC 4I77H 4JHZA 1MCQA 5CEZD 3BJLA 2G2RB 3O45A 3KLHD 2NY6B 1U8IB 1E27A 1GSMA 2VAAA 1PG7L 2ZUSA 3NIGF 4JE4B 3C5JA 2A0LD 1OTTD 4I8DA 3LS4H 3IT8D 2EDEA 3G9VA 3VWKA 5E5MA 4L3EB 4LSQH 2DLEA 1EZVX 4R3SB 5TE7L 4KMQA 1BIHA 3LH2H 1QO3B 1E6JL 3FQTB 4HMDA 1MVUA 2IAMC 1FFRA 4MCZA 3GSWB 3QCVL 1UADC 2W60B 2H1PH 2RHEA 1NMAH 4HS6B 1CLZH 3GB7B 5T1DH 3WXWL 1TENA 1JPFA 5DRZB 1TMCB 5C07E 1EHLL 5J3HD 1IAKA 5GRYA 3KJ4B 4JREC 4U1NB 5CILH 2P1YA 4WGVB 5LGHH 1VEMA 4FQXC 1U92A 4MA3B 2GCYB 1CL7L 1A6PA 2XFXA 2DQCL 2HTLC 4PB0H 1C5CH 4LDLB 3ZE0E 4OZFB 3SGEI 3X11A 3ROOB 1HHKB 2ICWA 5IHZA 2OM5A 3I85A 4LLMA 3M1BB 3U9UB 4WI8A 3U7WL 5HI4D 2L0DA 3TIDA 2Z31D 5FAAA 5EUKB 4DTGL 4S1QH 4EOWH 2VLJE 5JUEH 1S5HB 5A2FA 5BRZE 1RJZA 1MFDH 3D6GA 5J12C 4ZO8A 4QGYA 5TGBA 2XXCB 2Z93B 5F6IC 3QXWA 5TH2B 3UPRB 1LDSA 4O9HH 3ULVL 2B1HH 4NQDB 5I1JH 5JXEA 3RGVA 3BD4A 1KTDA 1MJJB 1IT9H 5KAQG 4PV8B 3EOYG 4X7TB 3ZHLA 4U2YA 5DQJB 3LPWA 2PKDA 4Y4KD 1U6AH 1KN2L 4PJDB 3ARGD 3TPUA 4LPXA 3OKNB 2UVFA 3P4MA 2BFVL 2W9DL 4OLYH 1FP5A 1N7ML 3H9SA 2F54B 3TO4B 4HPOH 4GXUM 1G9NC 1OTUC 4OCRL 1OGAD 5EWIH 1NGZB 3C5ZB 4FHBD 3QR2A 4LVHC 1VADB 3D2UD 3ZE0F 2NXZD 2OZ4A 5HVFB 3VW3L 2BHZA 4IM8A 3IAPA 5AD0B 1NC4D 4RSVA 4PRPE 1I1YA 3PGFH 4HBCH 1OM3H 3TNNB 1K2DA 3QJFA 3KDMA 4BK4A 1BZ9A 4U1MA 3MRCA 3EZ8A 3MRKA 4YBQC 5K93A 1B0WA 3OKKB 5DI8A 4NN7B 5K33A 4KUCF 4PP2B 1LO2H 4M7JL 5J56B 5EN2B 3MBED 3NTCL 4KKAD 1KENL 5B22A 4U2ZA 4XCNA 3GFUA 4JPWL 2ZPKL 1KIPB 4LRNH 4R26L 5JO5A 1JNLL 2OJZL 4YFLI 4M6NL 1KGCD 2JCCB 1O5DT 5B38A 4RAHA 4Q2ZA 3S5LG 2AV1A 4Y1AE 1ZGLP 3FQXA 3DUUB 2Y36H 3C8DA 3MRNA 5I8OH 2Z91A 1T6WA 4X4ZA 2FYYB 3MJGX 3QEUB 4NCC1 1X6NA 1CGVA 1I1AC 5DJXB 1JYVA 2HAZA 1I1RA 4HFWB 4CDHA 4EUPG 4LSSH 3STZA 2X4TA 1YEJL 2ENSA 3MRMA 5D7IA 1I3RA 3WFDL 4QO1A 4KHXL 3BZFB 2UZYB 4DQOL 4ELMA 1MWAB 3WUWA 4HIJA 4NZJA 2Q7YA 5F7EH 3DMMD 4P23C 2XZQL 1GZPB 2B1AL 5HHOA 4N90D 1P7KA 4I2XE 2ZCHL 4H1LH 4HWZB 4WJ5B 3L3DB 2N7AA 4KDTA 3VFTB 1K85A 1S7VB 3LEYH 1DEEB 1FFQA 3MRLB 4GRMB 5AZ2H 4D9LL 2WANA 3T2PA 4Z7VE 3F12B 4IRSC 2VZTA 5D5MA 3LN5B 1FFNA 1F4XH 5C6TL 3SKNA 1A21A 3KYMB 4Y5VA 1MHPH 5TQ2H 3QAZB 4TUJA 4GJTB 4M4RA 4UBDD 4KKCD 1P4LA 3HS0B 5BO1H 1AKJD 3GSRB 1I7ZA 3ZKMC 1BM3L 4YDLC 5HXMA 2BRRH 5JQ6H 1RK0A 1K8IB 1PZ5A 4K3EH 1D5XA 3BE1L 1PBYA 3TF7C 4MQ7A 4B41A 5DUML 3T1FA 4Z6AT 1V3KA 4M5ZL 4FXGB 3ARBC 5K9KB 2O93L 1JRHI 2FX9H 4Y16A 3QQ3A 4MQXC 2EDKA 5F7MC 3D3VE 1UM4L 4HH8A 2H9GA 1B4JL 1NBYB 4LPWA 1QPPA 3LQAC 2IH1A 1FGVH 3RHWF 4Y4KB 4R7DB 4RISH 5JNYA 1CGSL 2K9UA 4H0IA 3CUPB 4ZAKD 1ETZB 3DRQB 4PTTB 4PGEA 1A4KA 3IS1X 4Z7VF 3BIKB 1HQ4A 1M05A 3KPRB 4PLKD 4WNQB 3MXWH 3EOTH 3RAJH 1J10A 5IWLC 1HXMA 3IRPX 4KQ3H 1UB5B 1U8LB 4RFOH 5JDJA 1AQDA 5DO2D 1T1WA 4XBPA 3G5ZA 5GGRB 3D2UB 5I76A 5JORB 3B83A 4P4KD 5C9KA 3O6ML 1N26A 1NC4B 4FQCL 1AGFB 4K3JH 3ZT6A 5I17A 5F3BB 4JZJA 4WV1A 3C09B 3JZ7A 1KCVH 1J12A 2AW2A 1S7UB 35C8H 3F7VA 5F89A 2OYPA 3GZKA 3L3OB 4K94L 3UJTL 1MCFA 3BEWB 3QRGH 4PV9A 3ARDD 3ECBB 4Q9QL 4X9IA 4UQ3A 1CVSC 3HZYA 2VDNH 2IPKB 2X42A 4HWBA 5D7SH 1WITA 1CDBA 3MLWL 3G5XB 3O2DL 4IMKA 1T5WA 4HIXL 4X4ME 1QACA 1J18A 3ES6A 3SKMA 1J8KA 2CGRL 4OGAC 5EOQH 1IFHL 3BGFC 4HCRL 1A9BB 1CXEA 5JOPD 4K8RD 3ZKXC 5E8OB 1YQ2A 3QUZC 1PY4A 2IGFH 2XKNB 2BNQE 2IANE 2P43B 5IMLB 5ADOL 4B0MM 4NKOA 2VLKD 4LSTH 4EN3D 3FQUB 2H2PD 4LSUL 3QDHA 4HPYL 1S7QB 3KPSA 1PEWA 1KBGL 4P5TC 4NWUH 4LEXL 3NZHH 1QFUH 5FUCC 1IJ9A 4OF0A 4JG0L 3KYNA 3O6FC 2IQ9L 4UMGA 4P9HL 4UU9B 2AERT 3DUSB 1NGXA 4MVBC 5E08H 2EKJA 5MEQB 1MOEA 4S1SL 2HP4A 4I48B 3BQUA 4Y2DA 2YA0A 1FVEA 3DMMB 5DRXA 4G80A 3U2SB 3LMJL 3EIFA 2G9HB 2ICEB 3UAJD 5GSRB 3I02B 3MJ9A 4X8XA 2X4OB 4JM2F 2EDHA 3VFWB 4JLRB 4ODVL 3QEQA 4JFPB 2VL4A 4JDTL 4X6EA 5FK9A 1PX3A 1X5HA 4XNQA 4QHNA 1S9YA 5I74B 5C0BA 3C08H 3DYMA 5BV7H 5I71C 5KZCB 3C2AL 1UGNA 1HE7A 5F93C 2DQEH 5E8NB 3S96A 2RFXA 1MQ8A 4ZFOL 1U9KA 1GRWA 4ZUSA 5E6YA 4LFHG 5FEBA 5HDOA 1UCTA 5D1QD 6FABL 4J23A 4LASL 1I9IL 3CZJA 1ZS8B 3C60D 2XKUA 4G8GE 5L0QC 4G8FB 3SY0A 3DX6A 1DQDL 1I9JL 2V5RA 1ONQA 1FPTH 3HC0A 5T1MB 4H20L 3VMPA 4OIIH 3V6OE 1HDMB 4F9LC 1KXVC 5BXFA 2P5EE 3FT2A 3UBXA 1F11A 3R8BB 2JLLA 4QHMB 2P48B 3O4OC 4XGZA 1HHJA 1R24A 4RGMB 4WFED 2X4RB 4Z95H 3PHSA 4PJHE 1F97A 3HG1B 2NW2A 4L1DA 4WW2B 1S3KH 4GXUN 2RB8A 3UPCA 4N5EC 5FYKD 1MRCH 2Q86B 3D39B 3BWUC 2COQA 1SYSA 1AY1L 4S11A 5IV2B 3RKDD 1TCRB 3QA3A 3U46A 1KG0A 1N2RA 2AGJL 4QTIL 3CVHL 5INCA 5C0AD 2VABB 3P73B 5FYLE 2CKBH 2R1YB 1EPFA 2FEEL 3BDYH 3S5LA 3UDWA 4ZXBC 2C26A 4P2QA 1N64L 1LDPH 1YYLH 4JFZH 4YDVA 5CP3A 5L2KE 4PJFA 3LVEA 4HW6A 3WIIH 3C6SB 5E8EB 5E8DH 5FYKU 1IGIL 4WUUE 1CDCA 4UDTB 5IW3A 3RVTD 4BELD 4Q9RH 1QRNA 2F74A 4PTUB 1G7PB 4I5BB 2NZ9C 1FN4A 1EFXA 1VA9A 4JY4B 2A74A 2MPAH 3T0XA 4KJPC 5D2NA 2HN7A 2P47B 4M1GH 4OLZH 3KNBA 3DO7A 5HYJE 5HGDA 4GRWB 4XP9H 4NQXB 1IQDB 3FMGL 4M62L 3IDMB 2BOBA 2D9QB 1UJTA 1FSKB 1B0GA 2A9NH 5D2LE 2ZCLH 4L3EA 1P4IL 1WCBA 1MCWM 3O8XB 3ZSTA 4PJHF 4FFWC 4WUKH 2ARJQ 4M6OL 1QO3A 5HDLA 4Z7UE 3UTZB 1DZBA 4LIQH 1G7JB 5C71A 5IW1B 4NUJB 1KNOB 3U30B 2KBGA 3T8XA 2W60A 3S35H 3SCMD 4OZHB 4HS6A 5IVXE 2PW1B 1I7RA 4GW4A 1U8OB 1DANT 1EVUA 1CGXA 1I1FB 3WSQL 4K7FB 1FFOB 4U1NA 3UTOA 3K4ZA 4X7CC 1NFIB 1KCSH 1IM3B 1CTOA 1JV5B 3OF6A 3N9GH 2Z4QA 2DICA 2JKXA 4EN3B 5KVDH 1UENA 5JTWA 4M6MH 4K3HA 4PY7A 3FB6B 2YC1B 5F1OB 1PSKH 1HHKA 5GSVA 3V8CA 1RSFA 3O41B 1H5BB 3IFNL 3MGTB 4J3TA 2H32H 4TTDD 4U1HB 3SKUD 3U9UA 4MMZC 4XNYL 1BQHG 2GY7B 4WI3A 3H9YA 1GOFA 4CW1A 1PQZA 3WEXA 4BKLB 4WY7L 5ACZB 1S5HA 2IPTH 1HQRA 3BKCH 4Z7OF 1U3HB 3TJEL 1A7QH 2DBLL 4HUXB 4RCAA 3RZCD 5TH2A 5D2LF 4NQDA 3Q5OA 2L7UA 4P46D 2F53B 4YAQA 1MJJA 4Z7UF 1KYOK 4PV8A 5HGGS 2ARWA 4AEIL 5JHDD 2EYSA 3SN6N 3JVGA 1CXFA 5EIIA 1A6AB 3TIEB 5IVXF 1OCWH 5IVNA 1F45A 4DVRL 5CSGA 4WO4D 2ESVA 1N6UA 1EO8L 3C60B 3MLVH 3OKNA 1A7OL 5TQ0L 5JXAL 2E8ZA 3MV9D 1NGQH 4JM4H 4NKIH 1UKQA 2VLLA 1ZE3C 4OB5H 3NCBB 4KI5D 1Q94B 1NGZA 1CXHA 1PG7H 2E7HA 1BOGA 1AD9A 4NO2A 5CSZB 5IGXL 3RVVC 5AD0A 1KEGH 1GGCL 3HE6D 1M7IB 5TE7H 2YD7A 1HNGA 2HVJB 5JZ7D 1DQQA 1OLLA 4K55A 1E6JH 4EXKA 3LOWA 3ALWA 4PP2A 1R3IH 4N0UE 3QCVH 4K9EH 1ADQL 1HIMH 4QOKE 3W0WB 4K7PX 3W9EB 1ZVHA 2I5YL 1Y0LB 3IDXL 2VDML 5C0AB 2HT4D 3WXWH 2EXYC 2UWEB 2FD6L 4XPHH 2FX7L 1O7VA 5K9QI 5I1AA 1KPVB 4DGYL 1T5XB 4H25B 4P3WA 4WENB 3EKCA 3OPZL 3UC0L 3MV8B 3T1WA 4MXQD 3VFUB 3VMNA 3P9MA 2FYYA 5I2IB 1GGBL 1MRDH 3PWVA 4GW5B 4NQCE 8CGTA 5DD6B 3W39B 4MNGB 3VFSA 4DAGH 5DK3A 5J4MA 5DJXA 2HFTA 1ZHBB 4ODHL 4MJ5B 5M94B 2WM0A 3T4YB 3VJ6B 3VWJB 1N4XL 2CXKA 1NSNL 5CD3A 3BAEL 3BZFA 1MWAA 1UCBL 4CJ0A 2PETA 4PJ5A 4Q6IC 3BWAB 1AGBB 3TM6A 1GZPA 4AIOA 2BOCB 2VXUL 4RRPG 4NSKB 3VH8G 3E6HA 4AY0A 4KI1A 5DYOA 4UT7L 3SCMB 3ULVE 4Y8AA 3L3DA 4IHOB 3GHBL 3VFTA 1Z5LA 1KN2H 5IQ7H 1S7VA 3VI4E 3BGMA 4GRMA 5F9WC 1WBZB 3WS6C 1H3UA 2W9DH 3EYUH 5D93C 5C92A 4JRYD 1VEOA 4QWWD 3IF1B 4LCCC 3KYMA 3U0TB 5FDYA 1FDLL 1W0VB 4GS7C 5B8CA 1RK1B 4M9OA 3HS0A 5ICYA 1Q9WB 5GHWH 4CVUA 2DM4A 5ITBL 4D9QD 4IMLB 3MCLL 2CLRB 4HG4K 3LKOA 3VW3H 4GRLD 1CLCA 1K8IA 4JJ5B 5D70L 2Y4SA 3ARED 5TF1L 2EXWD 3EO1B 4ONGH 1UYWL 1R3HB 3P9LB 5FXCH 4JKWA 4X6CA 4NQSB 4Y4HC 2EZ0C 3HAEH 2ZOLB 3LEXA 1ZLSL 1VESA 4Q0XH 3H8NA 1RUML 3QDGB 2D7NA 4HXAL 4C56D 3RZCB 5BJTA 1ITBB 4Y5XB 3NTCH 4TRPL 4O02L 4G6JH 4XPTH 4YHKH 4J3OC 4P48A 5CD5C 4JPWH 2ZPKH 2AJXH 4R26H 1NBYA 2IAMD 1JNLH 1XF3B 5EUOA 2PO6C 3DXAA 5JHDB 5CGYD 5GS0L 3ULVF 4M6NH 4Y19D 3G5VB 3RWJB 1Z9SA 4WO4B 5EU7E 3VI4F 3QHZH 3IAQA 5D7JC 4PTTA 4LSVL 1QD0A 1PZUB 4AEHH 3BIKA 4WNQA 3KPRA 4CKVX 4JRXD 3KLSA 2YHGA 5ADPL 1UB5A 1U8LA 1HI6B 2X70A 4FQXD 2A6IB 4B7IA 4JQVA 5GGRA 1CDUA 1QPXA 2OXHA 2HTLD 5D7IE 1AQKH 5JORA 1OARL 1CICD 3NCYS 1YEJH 3E2HB 2ZSWB 2PYEE 3HE6B 4DQOH 4DWHA 1AGFA 2ZSVA 4WIQA 4NN5C 5H2BB 2XZQH 3VFVA 5F3BA 2B1AH 5ABDE 1WBYB 4F15C 4HIHA 2ZCHH 2VXQL 1S7UA 3W5MA 1QEWB 2R0WL 3I75A 3LKRB 2NX5D 3L3OA 3Q6FB 3MUJA 2WBJC 1YEIL 4JM2C 3EYQC 2IPKA 5HDQH 4HKXA 5D5ME 3G5XA 1EO7A 5IP4A 4GAJL 5HDBE 3UTSD 2R29H 4L4TA 5E6IC 1Z9LA 5C6TH 1CZ8H 4NFBA 4OF3A 3IFLL 5K9JL 3L95B 3AU1A 5FV2A 3QDJA 1ZHKB 3EYOA 2VLRB 5DGRA 4HIEA 2YWYA 5EC2B 2YEZB 5C09A 1FBIL 1BM3H 3VD3A 1W0WB 5E9DD 4M7KH 1BQHA 4BUGA 4U1IB 3CU7A 4YHLL 2PYFB 1GGTA 3BE1H 1S7QA 2HFFB 4L5FH 3TCLA 2KZ1B 1WFUA 1F3RB 2YPLE 3VXRD 4RZCB 1PD6A 3JTTB 3THMH 2AI0H 1MCLA 4M5ZH 1OTUD 2PTUA 1R6VA 1DBMH 3F62A 3QFDA 2BY2A 4XXDB 5CHNA 4UU9A 4HWEL 1CD1A 3W11C 3DUSA 2FB4L 5I19L 5MEQA 2UVEA 2V2XA 3PV7A 5D7LD 3OGCB 4JPVL 3RY5A 1UM4H 5AEAA 3TWCL 1EO5A 1AXSB 2BHYA 2XNAA 1UWEH 4WFFE 4IJ3C 3U2SA 2ICEA 4YBQD 1B4JH 5GSRA 1DEDA 5C7XL 2DQFB 4YDKH 3FT4B 3WLWC 1N5YH 1B6UA 2YMXH 4JFPA 1J7VR 3SKJH 1J0JA 1BD2D 1MJ7L 5EU4A 4YIQB 1CGSH 5IG7B 2ERJB 5DT1L 2AAVA 5HDBF 4JRYB 4U6YA 4Y0GA 3WUZA 4H88H 2HKFL 3SDAC 3BI9X 5CZKA 5FGBA 1F4WL 4X80L 2NTSP 2AKRA 2EDLA 3LCYA 1WBXB 5J6HB 4G8FA 4KAQL 5BV7C 3ET9F 1IMHC 5EBWB 3KLAB 4D9RE 4NHCH 3O6MH 1VB9A 3PWLB 2YXFA 2VXTL 1HDMA 1LE9A 2ADGA 3V95A 1FZKB 1KCKA 3HZMA 4NQVB 4HWBH 1I1AD 3V6OC 5CSBA 1IGCL 1QTYT 2AK4E 4MHHI 4QHMA 3WKNA 4UNUA 2D31B 1UEYA 1X5GA 3HZVB 2X4RA 3D25B 1DLFH 3HG1A 1BPVA 5C0CA 4OZ4A 5C0RL 4HKJB 3UJTH 5IKCB 1BZ7A 3CK0L 4D3CL 4Q9QH 3CH1B 3U7YH 3FB7A 3D39A 3MLWH 2GJZB 2IAMB 4P23D 2XN9D 3O2DH 2DLFL 5BS0A 1N5AB 4JKLA 5KBNC 3ULUL 5AWNL 3P73A 2CGRH 3RVUC 2OTWA 5AUMA 4C83B 2R1YA 4HCRH 1BECA 1ZT7A 4OKVB 4BH8A 3RY6C 1WISA 3BN9C 3ARFC 1BX2A 3PXHA 5FA3A 3HFML 4JREB 4GSDL 4JRXB 3S36H 1WEJL 1JGDB 3KPSE 5HTSA 2BSSB 4RWYL 2NY3D 1U3YA 4HPYH 5FKPB 4FQXB 4LAQL 4I3RH 5SWSD 1KOAA 1KBGH 2DI7A 1YY8B 1IAMA 4FS0A 4LEXH 4MJIA 4PTUA 3U4AA 5CLWA 4RMWA 5FYJU 3OMZA 2H41A 5IOPB 2IQ9H 1RVFL 3K0WA 1D3CA 4DVBB 2DWEB 4MSWB 2DKSA 5IMKB 1KIRB 3DV6A 4KK9C 4FQQB 4S1SH 1KPRA 4BSVA 3BPCB 4R4NC 4LRIA 1M7DA 5DJ0B 1CFVH 2DD8L 4NQXA 4X9BA 3V6BR 1IQDA 4L9LB 1IEAB 5F7DA 2C5DC 2J8UB 1ZKAA 2WUCH 4RRPA 3GJFB 5E2TH 3ARBD 1S9WB 4KK8C 5J12B 3O8XA 2Y5TB 2NX5B 5C0BE 4JDTH 3RNQB 3ZHDA 4MQXD 1FFPB 4L8SC 5DVNA 2AJSL 1KNOA 3C2AH 1CCZA 3UTSB 1CFSB 1QYGH 4BFIB 4NNPL 3AS2A 4I3GA 3MXVH 5L8LB 3L7EB 4NZRL 1S9VB 4XNZC 1JZ8A 1U8OA 2C7UA 6FABH 2YZ8A 4LASH 1I9IH 1NGWB 4JZOA 4AQ1B 3EDKA 1I1FA 1ZVYA 4ZOAA 1K3ZA 4YUEH 5D4QA 2OBGA 1FFOA 3VXPB 5A43C 3IVKA 4ZTPL 4R4FL 4E5XB 1DQDH 5E9DB 3NIDF 1JV5A 4NC2B 4GKSA 5J57B 3BHBA 3L3HA 4H20H 4HBQA 4U6HA 2E6QA 2Y7QB 3QDMD 2YC1A 5FKAB 1NEZG 2ZUTA 4LVHB 3WJJC 4PLNC 3R8QA 4HJJH 2IBZY 1YJDL 1KLUB 3O41A 1H5BA 1NJ9A 1PLGH 1F00I 3MGTA 4U1HA 4U33A 3CXHK 2VDKL 2FECI 4UOJA 5HHNA 4KQ4L 3DGCR 5KAQF 1T3FA 4L8BB 1JNNL 2PN5A 4JPKH 1N0LA 2X4SB 4L4VD 5EFIA 1U3HA 4I9WE 4QRTB 1QOKA 1A7RL 4JFFB 4LQFL 2AGJH 1TZIB 4YNYB 3CVHH 4P2QE 1BD2B 3K1KC 2F53A 2GAZB 4JDZB 3TT1L 4EUPH 3FRPG 1N64H 4EJ1C 1RMFL 2XWJB 5BMFL 5I6XC 2B5IC 2FX8L 1A6AA 1NPUA 1F42A 4P5MA 1UM5L 1QRNE 3NPSC 2V2WB 1VFAB 4OGAD 4IDLA 4QRSB 1CWVA 3Q48A 1MF2L 5CEYB 3QUZD 4P3DB 1BFOB 2F15A 3I3BA 4BFEA 5D2NE 2WP3T 1QSFD 3OKLB 1NCNA 4N8PA 4R7NA 3MSPA 4BM7A 2VNCA 5F7LB 1Q94A 4EDXA 3PL6A 3K46A 1I1AB 2FJGA 4P5TD 1SY6A 1D6VL 3DHMA 1XIWD 3FMGH 4LVOC 5L8JB 1KSRA 2O26U 3TLRA 3VI3E 1DFBL 1MIEH 3MRHA 3RL2B 1QBML 1P4IH 3VWKC 5F7NC 1YPZA 2HVJA 5L6YH 2ZWLT 3L1OL 4MVBD 1FO0L 4N68A 1PX4A 4CVXB 5I75C 3NFNB 4MZ3A 2APXA 4P3CH 5FFLA 1WFNA 4P23B 2XN9B 4RA3A 4LKXB 1ZV5A 1OP9A 2GY5A 4P2OC 3W0WA 4PRNB 1MLBB 4NYLB 3QUKA 5KW9L 2XZCL 1YEEH 3OKOA 4E0RA 2YKLH 2CK0L 4G42B 2NY2D 5DD5L 4NZUL 3VXQB 1ZEAL 4ZFFA 2P5WD 3WSQH 5AAWA 4OUOA 5LQBH 4IRSB 4OJFH 1G9MH 1KPVA 1EZVY 4XPFH 5A2KH 5C0NC 4K9EC 4LLVB 1R3LB 4PRHD 1URLA 3P4OB 4RNRB 5EB9A 1MCBA 2ZG3A 5SWSB 5L88L 3FZUC 3BIBX 1K6QL 3CD4A 3DURB 3MV8A 2JJSA 3VFUA 5DWUL 3ZL4L 4YDLB 3DVNB 1E4WL 4GW5A 4XNYH 5DD6A 3W39A 4MNGA 5M7QA 1R3KA 1CFNB 3CDCA 4U1JB 4OD3L 5T3XH 5GZNC 5IW6A 4WY7H 1I7TB 1QRKA 4KY1L 3T4YA 4OF5A 4CAGA 4J3WA 3VWJA 1XGQA 2BVYA 3ARBB 1G7QA 5F1IA 5I0ZA 5FHBL 2NYYC 3U0WL 3TJEH 3VI3F 2DBLH 1D5BB 2FR4B 4G7YL 1NKRA 3C6LA 5T3XE 1I8KB 3MROB 3ZYZA 3BWAA 2J8OA 5JXEC 3KPLA 4P0DA 4ZODA 4F37K 1AGBA 3CDFA 3RGVC 1C08B 4N5ED 2BOCA 3KPPA 2PUQT 4G6ML 4NSKA 5ACLA 2GITB 1I9RH 2R4SH 2RCSH 4PUBH 2WV3A 2G60L 3WNKA 2ESVE 1G6VK 3KWWB 3B5HA 2HG5B 1F3DH 4ZXBD 3O2VL 1EO8H 3ZDXF 4LLDA 4PB9H 5TQ0H 3Q3GB 1R5WB 3CFEA 1ULVA 5IK3B 2NY5L 1TZHB 3PWPD 1RK1A 3NH7L 3WIFB 4BFBD 4Y5YC 3BH8A 4JFHD 2VDOH 1JPSL 1FIEA 2CLRA 3OBAA 4QNPE 3P0YL 4NO3A 5IGXH 2NZ9D 1GGCH 3NIFF 4JJ5A 3MRGB 2JELL 4RFEB 4KJPD 3EO1A 2BNUB 1R3HA 2AXFB 2XT1B 5GIRB 4ERSL 5MEND 4ONOA 1FNGB 3DIFB 4L4VB 1TXKA 1FVCB 1QLFA 1G6RB 4U1LA 3QDGA 4E42B 3HCVB 3VRJA 2I5YH 1FV1B 4X98B 4Y5XA 1C16B 4PYHA 1HHHB 4QRRD 5ALBH 4FFYL 4FFWD 1JYXA 3MA7B 2FX7H 3VFMA 4UI2A 4OM0H 2WINB 2X89D 1XF3A 3VXSA 3SDCD 5J8OA 2YUVA 2CK2A 3HUJA 2XIDA 3G5VA 3RWHB 4XVSH 3RWJA 3G08B 4DK3A 2E9WA 2DTMH 1R0AL 4N5UA 4WO4A 3SDXE 2BDNL 3K3QA 3ZKXB 5K59E 3QUZB 2IWGA 4LDEB 4M6AA 4LOUD 4X6FA 3NN8B 1QSFB 3I50L 5CJQL 5DTFB 5C0EA 1GGBH 1MWAH 1KLGB 4QRPB 5FIEA 5C07D 2WK2A 1HI6A 2EYRB 5D71L 2A6IA 5IBUB 1I8LA 1T7ZA 4JN2A 4P5TB 4I0PA 2XA8L 4X6DA 2P8LB 3FB8B 1N4XH 5DJDB 5SWZD 2GT9B 3ZYIA 3O6FB 4QNPF 1AIFA 12E8H 1A8JH 2PR4L 1U8PB 5DMJB 2VAJA 5DURB 4JFOA 4PJ5E 2VQ1B 1UCBH 1RZ8B 5E00B 2EYTB 3H2WA 3PDGA 1JF1B 2CQVA 4YGVB 3UJJH 1MREL 3CSBA 1EGJA 1SVCP 3GIZL 2CH8A 5H2BA 2D2OA 1JGEB 3WNPA 5DMIL 4GKZA 1UKSA 4UT7H 3X3FL 4WU5A 1QEWA 3LKRA 1QHOA 2VLJD 5A2JH 3GHBH 3Q6FA 5EOCL 5A3IC 4V1DD 4KDTC 3MCG1 4PR5A 1IEHA 25C8L 2X9XA 4EVNB 4URTB 5I71B 2P5WB 1CLYH 1T04A 3HKFA 1F8TL 5DA0B 4Q9CA 2H45A 3SQOH 5E2JA 1FORH 1ZSDB 3ARTA 1MHCB 4Y5VC 2VLRA 3SDXF 1NEZA 1TFHA 4X7EC 5EC2A 5ITBH 2YEZA 5K59F 3VA2C 3MCLH 4XBGB 2AJ3A 5GRVK 1AC0A 1U8KA 5DFWH 5TF1H 4X6CE 1UYWH 4GAYB 3LKQB 1VDGA 4RZCA 1J88A 3JTTA 3ULSB 5I8EA 1LE5B 4PJXA 3MNVA 3KPOA 3U4EB 4O58H 1YC8A 1ZLSH 3D0LB 2DQIH 4HXAH 1RUMH 3O4OB 3RVVD 1UH3A 3TNMA 3TBVB 1CI5A 3Q6GL 4TRPH 4Y16C 3O4LE 5C8JA 3DXAE 2BZDA 2EICA 2HA1A 1P9MA 4LNRB 1IRAY 1RURL 3FT4A 2WMPA 2YPKB 5BZWB 4AQOA 4ODXB 4KVCL 5GS0H 1MCOL 3INUH 1FJ1A 4HZAA 3GO1H 3IDNB 3C8KB 4FMKA 4HIIA 4YIQA 3QWRA 1T1YA 4ZXBB 5CINL 1HHGA 2EXYD 2WBKA 4XPGH 2O61A 2DLGA 5KVEH 1FNLA 3QNZA 3SO3B 3WS3B 3P30H 2K7QA 2KH2B 4JANB 1XGYL 1TQCC 4GLRH 5GISH 1EERB 1WBXA 2FBJH 4PS4L 1RUAH 3O6KH 3UZQA 2X1OA 5EBWA 3PWLA 5IB4A 2VC2H 4Y1AD 1MJUL 2R56H 1HH6B 2RIKA 1FZKA 2X9WA 5MENB 4JY5L 4NQVA 1ES0B 3QQ4A 1MCCA 3ZYOA 4TQEH 5D96C 3MREB 3RKPA 1HH9B 5TJWK 1DDHB 3C9NB 3HZVA 1J87A 1HXYA 3S34L 1H3PL 4JZJC 4WV1C 2R0WH 3SGJA 4HKJA 1INDL 3RX5A 3RPKA 1QFPA 3D0VB 4XHJC 4KXZI 4WDIB 2GJZA 3OAYH 4LU5L 4L4TE 4GAJH 1OQOA 4HJGB 3T77A 4NFDA 3OJVC 3EOAB 3RNKA 1ND0B 1T83A 4C83A 1QFWL 4LGRB 3K8KA 4OKVA 5GRUL 4WEBL 5C09E 1H0DB 3LKSB 2R9HD 3D9AL 4TSBL 4U1SA 4KV5E 4NBXB 3NA4A 2BSSA 4XPBL 5C07B 5D72L 4XT1C 1Z3GL 5FKPA 4FQXA 1PVHA 3T2NL 5J6GB 2VZ3A 5I1IL 3VE0A 1RZFL 4L8CA 1YEHL 2Q8AL 4KMTH 2A6KB 3B9EA 4U6VL 5HHME 4IDJH 2DWEA 3WLBA 5IMKA 4HWEH 3MNWB 4XCCH 2FB4H 2PF6A 1LILA 1PGRB 4HEME 5DJ0A 4KZDH 3BEVB 3ZE1E 3K2UL 4L9LA 1IEAA 1RZJL 3BQUC 4Y4HD 1XT5A 4Y2DC 4U1KA 4AK1A 5IR1A 5DC0A 5J1AA 3BRFA 1EEZB 4ONFH 4UTBL 5TFSL 3TEUA 4NM4L 2VLJB 5CKAA 2Y5TA 1A1OB 4GKNB 1MHEA 5BRZB 5AYUL 3HN3A 5E4EC 5CD5D 3RU8H 1HSBB 1S8DB 4XP4H 4CMHB 4YFEA 2ADJB 5I1HL 1BHGA 1J0ZA 2WQRA 3D3VD 2PO6D 3GNML 2XY2A 1QSEA 4QT5B 1S9VA 2OL3L 2Q8BL 5F6HJ 3TBWA 4PJCE 1UZ8A 3GKWL 3FOLA 2ZOKB 4BH7B 1NGWA 2CIIB 2DLHA 5D7JD 1NMBH 3B8YA 3WL9B 2B4CL 1YEGH 4LP4A 1PYWB 1QG3A 5C0GA 2VXTH 5FGCE 2FIRT 5KANG 2PTTA 5J89A 2OL3A 3CJJA 3HZKB 5I1GL 4PJIE 3VXNB 3QIWA 5A40E 4V2BA 1B3JA 3V5KB 1IGCH 1LEGB 4FP8H 5C0CE 2GYSA 4XNUH 4KC3B 1B6DA 2ARJA 3PNWA 5B39B 2FJHB 1LK3H 1INQA 1JVKA 4NGHH 4JGJA 4OI7A 5IHUL 4L8BA 1BWWA 1HWGB 3ZE1F 5BS0E 8FABB 4PRPB 4M1CC 3QUYB 2DLFH 4RX4D 4JFFA 1TZIA 4YNYA 1F4YL 1OVZA 3V6FA 1KB5A 5AWNH 5TDPB 2GAZA 2HJFB 4JDZA 4LCYB 3SE8L 2JE8A 4NM8L 2WBJD 4JM2D 2V5MA 4FZEL 1RULH 3NZ8B 3EYQD 3UDWC 1NGYA 1TVBB 3WD5L 2XWJA 4FQ2H 5I8KL 4LGPB 4YXKH 1WEJH 4LSRH 1NLDL 1A3RL 1DUZB 4O51A 4RWYH 2V2WA 2QKIB 1VFAA 4MJIE 2IPUG 2VITB 5LAXB 3B6SB 4HT1L 4PJCF 2DM3A 4P3DA 4M02A 1BFOA 2QSTA 1T1ZB 3GSNA 3OKLA 3SGEH 1OB1B 2HRLA 3BXNA 3OKEB 5IB3A 4Y1AB 3STLB 2BNQD 5D2NC 2GSGA 2W0FB 1ZA3B 3A6BH 4HXBL 5E4IA 4ODSL 3BZEA 2DD8H 4JFDA 4PJIF 3FQWA 5DZOA 5T5NG 2GJ6D 4C55A 1DN2A 5FGSA 4MNHA 1T0MB 4JO2H 2R4RL 2VDQL 4YR6B 1SVZA 3PV6B 3K74B 3W11D 5GGUA 4LSPL 5HVHC 3QEGL 3TH2T 4CVXA 3EFFB 1QLRB 2WIMA 1SJEB 1QBBA 4HFUH 3L6FB 4Q6IB 2ZG2A 1S7SA 1JIBA 3DBXA 4U05A 4EIGB 3MOQA 1QSZA 2UZIL 3AMLA 4PRNA 4YEFA 3FO0L 5FOBB 4PJAE 4MNQD 3WLWD 3BPOC 5SWQB 2VL5B 2YN3A 3OAYK 4NZRH 5HPMB 1M6OA 4I2XB 1KTRL 3QXTA 2CPCA 1ZLUH 3VXQA 5D9SB 1LO4L 4TNWF 4QXGL 3L9RA 4IRSA 4ZTPH 4R4FH 5D93B 3ULUF 3SDAD 4LCCB 3TVMA 3P4OA 1V5JA 4Z7VB 2UV3A 4GS7B 5TDNA 1CL7I 2OLDA 2XRAL 3WDJA 5CZVL 1HYSC 1P69B 4LL9A 3DURA 1CU4L 3BYYA 4PRIE 4GXVH 3VG0H 2Z8VC 3OKMA 1Q72L 1BP3B 2NY1B 1A6WL 2VDKH 3MJ8B 4PP1C 4RAVB 1OGTB 5I0DA 1CFNA 1G9MC 3VGGA 1WAAE 3ILQC 5F9OH 1TDQA 4QRUB 1Q1JL 1ODAA 2BVQA 2QTEA 3KYAA 2HVKB 4MXWL 4S0SD 4Y4HB 2CD0A 4J3XA 1JWMB 2IADB 3CIQA 1A7RH 5BOZG 1D5BA 4LQFH 4ZTOL 2FR4A 2W0LA 3GJEB 4MCYB 2R2BA 2DDQL 4YPGB 3TA3D 2J12B 1V8HA 4P59H 1N8ZA 3QJHB 3MROA 1NUFA 4TN9A 2W9LA 1YNTB 3BW9B 5C86A 2UY6A 2AJVH 1MCKA 1XF5A 2QBWA 3WFCH 4P2RA 5LCVH 2PXYA 3D3VB 2PO6B 1XF2B 2FX8H 2O5ZL 4PJAF 3JVGC 3KWWA 1MAMH 4OFYD 4PBWD 3RVUD 1H3WM 2BSTA 2VISB 5E8PB 4BQ8A 3BRGC 3FTGB 1MF2H 2J8HA 1SY6H 3VGDA 3MQIA 5D7JB 4C4KO 3BN9D 1R5WA 3ARFD 4J3UA 1RHHA 4OI8A 3FHQA 1BQUA 5IK3A 3AFLA 1TZHA 2LU4A 3MLRL 1G7LB 5DEFA 5JLZB 4J1UB 1KJ3H 4L3AA 5L2KD 1G7IB 1JTOA 4XB8A 5KOMC 3TN0C 2Q1EA 3PWUB 1A7NL 1D6VH 3W81A 3AAZA 2DI8A 3GSUB 2R2HB 4FMFA 1YPZE 1DFBH 2E7LA 1QBLL 3MRGA 4KK9D 3IJYA 3RI5K 5C70A 2GI7A 5GIRA 1WAAF 4KK5C 5DJ8B 4R4ND 1OP5H 5BCAA 1FVCA 1UC6A 1G6RA 3GK8H 5HYJD 3W2DL 4F15B 3HCVA 3V4PL 1FV1A 5KW9H 4KK8D 1Q38A 3O9WA 1HHHA 2OMNA 2CK0H 2WBJB 1WIPA 4JM2B 4NZUH 3MA7A 3MV7E 3O3DA 4TNWK 5DS8A 2WINA 1RPQA 4KPHL 2X6MA 2RJMA 4N1EA 4UT6L 5T33L 3LSOB 3JWDL 1ZANL 3IXTB 1PFCA 4XBEL 2Z9TA 4YHOL 5E6IB 2HFEA 5GJTH 3RWHA 1GGIH 1R5VB 3D87B 5L88H 1REIA 1K6QH 3G6DH 5KVFH 5ID0A 3IDJA 3NN8A 2AJUL 5DWUH 1UM6L 3B5TA 3IJSA 4K7PY 4LLYA 4JAMB 1U8JB 1E4WH 2NY7H 4QRPA 1NUGA 4XP5H 4YHMH 1A14L 3CMOL 4OQ1A 2BNQB 2LAAA 2ID5A 2IANB 5TDOA 3JXAA 3IDGB 2ADFL 5GGRY 4KY1H 1E4JA 3HTLX 3O6FA 5D6DA 1T66C 3DX8B 5FHBH 1U8PA 1UZ6F 1WGOA 1YPZF 4F33A 2VQ1A 4GQ9H 1RZ8A 5E00A 3STBA 4YGVA 4BSWA 5EPMB 3MLPA 1HKLH 5DR5H 4IJ3B 1BGXH 1WTGT 3KPTA 4KKNA 4LHUD 1ZWIA 2G60H 2E27L 5L2JA 3UYPA 4I18A 3UZEA 4EVNA 4Z78A 1RJYB 2P5WA 4OLUH 4L3CB 4LCWA 3IKCB 2NW3A 4PGZA 5E2VH 4N0YL 3JV6A 3QNYB 5B3NA 1RFDL 3SDAB 1KTLA 4WEMB 1ZLUK 3HNSL 4DEPC 2AABL 2W92A 1NDMA 4XH2B 5FHAH 5B8CC 4WWID 1MFAL 1JHLL 1KPUA 4OM1L 3GSQA 4KVNH 3OHXB 3PQYE 1JPSH 2HJLB 4AH2B 1X5ZA 3P0YH 5BV7B 1T21B 5KVMC 4IRZL 2OJEA 2C1OA 2EH8H 2JELH 4ZFGL 2APTA 4G8GB 4GAYA 2X41A 3LKQA 3FCTB 4C59B 3B9VA 5DLML 1LE5A 2YWZA 4XC3L 3U4EA 3LKNB 3D0LA 4S2SB 4QHKJ 1FHGA 1F4AA 2GHWB 4LEOA 2P5EB 4HK3N 5DD0L 3VWKD 3EO0A 2V5SA 2CLVA 3VXSE 1T0PB 2BMKA 3QWOA 4PJHB 1LVEA 3VA6A 3HUJE 4LNRA 1XF4B 2ZUXA 2YPKA 3T0BA 4ODXA 2P46B 1K5NB 4EI5A 3HLAB 2HWZL 1EVTC 4OF7A 1JPGA 2HLFC 4FQHB 2X4QB 3IDNA 3JUYA 4UINH 2MSPA 1IBGH 2AXHA 3C8KA 1R0AH 4RAUA 1LEIB 5IBTH 2BDNH 5IJVB 4X9HA 5I1DB 1MVFA 4O2FA 2JJWA 4XVTH 3ARFB 4MGXA 1RHFA 3I50H 3BSZH 3LRSA 1G7MB 5CJQH 1DN0B 5KVGL 1RZ7H 5C0ND 2ATKB 4X6DE 5L2KB 5GS0C 2CLZB 1MH5A 1EGJH 3LKPB 4LKCA 1EIBA 3FZUD 3MMEB 4PGCB 3U6RA 2CKBB 4JQVC 4LQ1A 1CFTA 1ZOXA 3P2TA 4WUUB 1AFVL 3TYGL 3GGWB 4X4XB 3PHOB 3JTSA 5DJAB 5ESQB 4A6YA 4F2MB 4JHAH 5FUOL 1Z9OA 1YY9C 2EIZB 4OKDA 3ZKNC 2AQ1A 1ES0A 1MREH 1A6TA 1SBSL 3OXSB 4UQ2B 3QNXB 5GZND 3SPVA 4N9GA 4HHAB 3IYLW 1HH9A 1KFAL 5HYJB 4L4JA 2EC9T 1E28B 2NYYD 3X3FH 1N3NB 2CJUL 2EC8A 3U36A 1U58B 1RIHH 1OP5K 3D0VA 4PFEA 5EOCH 4YQXL 1D5IL 1KT2B 4L8SB 4YH6A 5D2LB 5JXED 5KSAC 1FYTE 2X89A 3HNTL 1HWHB 5HJ3A 3RGVD 4JFEE 1TQBC 5BVJA 5I9QC 4Z7UB 3N1MC 1F8TH 2Y5EA 3OGOE 1G84A 5HYSB 1DE4A 4RBPH 3VGEA 4XNZB 4RMRA 1E6OH 3WFBH 4ESKA 2DQJH 5IVXB 1IGTB 4O4YL 1OTSC 5F97E 3AS1A 2A1WL 2Y06L 2DIBA 3R0NA 1CR9L 1JK8B 4NZTH 1A7PL 5J6GA 3H9SD 4M9PA 4Z77B 2C3GA 2DQDH 3FB5A 1ZLVH 2R69L 3HPLB 2XZAH 4PD4J 4ZFZA 2A6KA 4JG1H 5JPNB 4XCYA 1J0HA 3QDAA 5ID1B 1T0NA 4X6BB 3MNWA 3BMWA 3UJIL 1IKFH 1SEBB 2C3VB 5HD8C 3RWCB 3S6CA 5H94B 4DFIA 3L3KB 3CLFL 3S37H 1RUPL 1F02I 2HT3C 4GUPA 1OSZB 4DCQB 1GL4B 32C2B 1JE6A 4PJ8B 5DSCA 1K4DB 1U91B 1RURH 2QQNH 4M4PA 4LHUB 3ROLA 5ESVB 3QULA 5J1TC 2VLJA 2YRZA 1CIDA 4HAGA 3DO3A 1MCOH 1M71B 2RGSA 3MZGB 1NCWL 3V0WL 3Q1SH 5BRZA 4LCUA 5IVZB 1JHTA 2OR7A 4WWKA 1NCUA 2N4IA 2Z92A 1TVHA 3MYZA 2Y72A 4RIRB 4K8RL 5CINH 1YMHB 3TESA 1S8DA 2ADJA 1FVDA 5F6HI 4M48L 3RJDA 4POYA 2G75B 5I6XB 2B5IB 2PCPB 1YEKH 2E8YA 4QT5A 4YHIB 5F7HA 5FGBC 2ZOKA 2CIIA 3MLXL 2NR6C 4UTAH 1WZKA 4OSUH 4OZGF 3WL9A 4CDGC 2OQJB 1PYWA 5SV3A 1YNLL 3WBDA 4FN0A 1ACYH 3MLTA 1J5OL 2R1WA 4MLSA 5B4MC 3G6AB 3HZKA 3PP4H 3UYRL 4JY5H 4PJBF 3O45B 1E27B 2VAAB 2VJXA 4LVOB 1LNUB 4WI2A 3C5JB 5B39A 4RGMC 3S34H 5IF0A 1H3PH 1Q9LB 2Q20A 3VWKB 1LP9E 1ZT1A 3RA7L 5A1AA 4AIZA 5I75B 1Q9OB 3AB0B 8FABA 4PRPA 3CDGB 1FGNL 2JJTA 3SGKA 3QUYA 5MERA 1JFQL 3P11L 3B9KA 2KL6A 1MVUB 2DS4A 4JVUA 4CNIB 4P2OB 1U8NB 2WSKA 15C8L 5HHOD 4YWGH 4LCYA 3D85A 4JO4H 4U4BA 2FEEI 4HV8A 4N0UB 2I9TB 5GRUH 3NZ8A 4QTHA 4QOKB 4WEBH 1TVBA 1FAIL 1JPFB 1NAML 1AO7A 4KROB 5DMKA 1HN1A 3BD3A 3D9AH 4DKFL 5FA4A 3K4AA 1DUZA 4XPBH 2LV4A 2QKIA 3WIHL 1Z3GH 2YN5A 2CIKB 5LAXA 3B6SA 2E3VA 1H3VA 1RUKL 1U92B 1A3LH 4FXKB 1M1SA 1YEHH 4BZ1L 2XFXB 4H8WL 1M4KA 1OB1A 4GG6F 3OKEA 3PDOA 4Y1AA 1HSAB 4S1RL 2WUBL 2NMSA 4XMLH 1A2YB 2D7TL 4XX1G 4YDJB 4PLOB 4LRIC 4NQCB 5FYKL 1T0MA 4JEGB 1KIQB 2YPLD 4LLWB 3B8SA 4NM4H 4ZQKB 5TGBB 3LN9A 4ZUTA 3EFFA 1MCNA 2V17L 1QLRA 4XVJL 4Y16D 1LP9F 4Q6IA 4U3CA 1C5BL 3RIAK 5MEOB 2W1NA 4QYOA 2Q6WA 3RGVB 1U8MB 1KTDB 4KJQC 1QSEE 5FOBA 3IDYB 5I1HH 3GNMH 3LQZA 5SWQA 3MOBL 2VL5A 4WFFD 4OLXH 2OL3H 4I2XA 5T1KB 2I60L 2R0ZL 5DD1L 3WS6A 1N0XL 3CVIL 3TBTB 4DKAA 3H7BA 3K8LA 4RBPK 1MAJA 4IIQB 4LPCA 4Z5RB 4GW1A 1IM9A 3P4MB 2IFFL 3MRJB 2W9EL 3I84A 2YRLA 4KUZL 1BBDL 3FL7A 5I1GH 3RY4A 1C12B 2HH0H 2F5AH 5FO7B 4Y5YB 1F6LL 3RWDA 2NXYC 3S4SB 2W65B 1F6FB 4RAVA 1H5BC 2R0LL 4HS3A 5AZEL 1KB5H 1ZLVK 1ZXQA 2D7PA 2EDOA 3M07A 1GAFL 3V4VH 1I1YB 4OD1L 1DQTA 5IHUH 4D9RD 3GBML 2I07A 5A2IH 1K2DB 1RZKH 3QJFB 4TPRH 1YEFL 1BZ9B 1AGCA 1JPTH 3MRCB 3MRKB 2QV2A 3RL1A 2YR3A 3UTPD 5DI8B 4YPGA 1YNTA 1FH5H 3SE8H 3BW9A 1BLNB 2AK4D 2DM7A 1YDPB 2MTPA 3EGSA 4FZEH 4XHJD 4H5SB 3WFHB 1IGYB 3WD5H 3OZ9L 4J3SA 5DQDL 3GSNH 2PO6A 4W6XB 3HAEB 4OGXL 4OF6A 5JO5B 4PJGA 1A3RH 3CGTA 4ZG1A 2ORBL 1P84J 3TV3H 3L5HA 4AL8L 5E8PA 3UROR 5B38B 5CCKH 5D7JA 3BISA 2AV1B 1RU9L 3FQXB 4KKLC 2MKWA 1DSFL 3MRNB 4RMVA 1XGRB 5JLZA 4J1UA 4YBLC 4JFDE 1G7IA 3F7QA 5CZXD 1O7SA 4Z8FL 2L4OA 1A9EB 4ODSH 3PL6C 3KPSD 3NFSH 2R2HA 5CIPA 2GJJA 1CYGA 5FYJH 3OX8B 1BIIB 4OCYL 3STZB 2X4TB 1A6VL 1DANU 2AEIT 4AMKL 5D7IB 1I3RB 1H3TA 4M7ZC 4XXCA 1A1MA 5DJ8A 4HIJB 1YQVH 5INDA 2Q7YB 2PYEB 3CXDL 4MWFA 4L9DA 3BQUD 5DDHA 2BJMH 3TT3L 1X7QA 4Y2DD 4DUXA 5CMAB 1KACB 4POZC 4M3JA 1CF8L 1P7KB 2VKWA 4HD9A 3O3EA 1JMXA 3QEQD 3TC9A 1CE1L 4GBXA 2C3WA 3I2CL 1AI1H 1CE6B 4Z7WA 1OAYL 2P49B 5C0BD 5JR1L 1BFSA 2IALA 4YDIH 1D5ZA 5E6IA 5J11B 5E99L 1R5VA 5D5MB 4A2MA 4DZ8B 4LGSB 5L7XL 3GBNL 4X4MA 4NHUA 2VUYA 5CZVH 4Y5VB 3GMNB 4FQLL 4TUJB 1OAXL 1P4LB 3VRIB 4WI9A 1Q72H 3LB6C 1I7ZB 1WTLA 4WCYL 1OAQL 4ELKB 3R06A 5IROA 3CFIC 2IANA 4RGNE 3IDGA 5ETUA 2VDRH 4JFQA 1HZHL 4MXWH 2VRAA 4OLVL 3T1FB 3MZTA 1KLFA 2XQYG 1AE6L 3DX8A 3DVGA 4LHJB 4TYUA 4DFHA 3CFBA 2YPLB 5F44A 2ED9A 2VO5A 1H3XA 2DDQH 3QO1B 2AEPL 3ZHKA 4ALAL 1CTNA 4P2RE 4XAKD 4Y16B 1CDGA 3C6LC 5EPMA 4OCSH 3BIAX 1PY9A 2H9GB 4GMSL 1FNHA 3H42H 5EO1B 2EDQA 3CAFA 4Y7MA 4YPJA 4RMTA 4MLIA 2O5ZH 3VXMA 4B53A 2IH1B 4D0DA 5LKNA 3S35X 4I9WD 2CUHA 5JNYB 1A22B 4L3CA 3QHFL 1MI5A 3C8HA 4P2QD 5EA0L 3OAUL 4D0CB 3H7LA 1JTPA 3MLRH 4PGEB 5C9JA 2WQ8A 1M05B 2NY4C 4XH2A 5C08A 3BP7B 1HXMB 2UUDH 1TQCB 2X4NA 1OWWA 1H15A 1CIUA 3JWNC 1MQKL 1AQDB 1T1WB 4OFKA 4NRXB 4XBPB 4AH2A 3G5ZB 4U6TA 2ED8A 5MEPB 1QRND 3F5WB 1T21A 2M26A 2YUWA 3E3QE 5I76B 3LHPH 1EFXD 4G8GA 4MD0B 4NN6C 2VMFA 2ZCKH 4AM0B 3V6OA 3O0RH 3V4PH 2Y25A 5I17B 2P5EA 3RVXD 1BQLL 4RMSA 4WV1B 2AK4B 4L3ED 4Y5XC 3F7VB 3HI5L 4PV9B 4K2UL 5CBAA 2XWBA 2GSIA 1UA6L 3O3BB 3UEZA 1NGPH 3HZYB 4M8QA 4Y4FA 4UOW0 5T33H 1K5NA 1AR1C 3HLAA 1T5WB 2ZJSH 4FQHA 3V52L 4K23L 3MLSH 1FQ9C 4XP6H 2F58L 2BVEA 1DUYA 1NMCC 1LEIA 4X4YA 5IJVA 3ES6B 3SKMB 3HHRB 3L3JB 3CZFB 3ARFA 1IAIL 2AJUH 2VYRE 1FCGA 1DN0A 5F1SA 1KTKE 1CDHA 1J8HA 1GOHA 2LAGB 1Y6NR 4NKOB 4I4WB 3OF6D 3LKPA 3B2VL 3BZDA 4HH9A 1KEMH 1OGAE 2ADFH 4GLRI 2ZKHH 3MMEA 4PGCA 1HYSD 1I8LC 3KPSB 4UB0L 4I0PC 3SJVA 4WUUA 3GGWA 1XFPA 3PHOA 5DJAA 4W4OA 4KFZC 1PG7X 3KYNB 1IVLA 4PP1D 3RJQB 5J9PB 3DYPA 1UKTA 1NGXB 3OXSA 3T0WA 4RDQF 3BQUB 4Y2DB 5HYJA 4LPYA 4TOYH 1N3NA 3QQ9C 3O6LH 1NCBH 4CADA 1V05A 4LCWE 4NQDD 5D2LA 5E4EB 2BC4B 1S9YB 5C0BB 5T3XD 2OP4H 4N0YH 2AXJA 2CR3A 1RFDH 4MA8L 2RFXB 1T2QH 1J11A 1KGCE 4NQEA 4QXTA 3MRIA 3HNSH 4Q7DA 5JDSB 1IAOA 4O5LH 1IQWL 1MFAH 2FCBA 2LABA 3EAKA 4JCMA 4OM1H 4MAYC 1NEUA 2ESVD 4FZ8L 1S7RA 1DBKL 4IRZH 2BXZA 3ZYJA 4EXPX 1JK8A 1XGPA 3PABB 3SY0B 4FQ1H 4Z7QE 1DTUA 5D1XA 3DGGB 3QUMA 1ONQB 4P4RB 2FRGP 3HC0B 1OF2A 4OZIE 2FH8A 3WJJA 3F58H 4MDJB 1NBZB 5BXFB 5ID1A 3FT2B 2C3HA 3ISWA 4BQ6A 1GYAA 2C3VA 4XGZB 3RWCA 5DD0H 1YN6B 5H94A 5IM7A 1R24B 2NW2B 3VGAC 4HSQA 5CAYB 2FEDD 4DCQA 4PJ8A 32C2A 4KK5D 4ENEC 4UILL 3U4BL 3QPQC 3HB3C 3QPXH 1CK0L 5GS1C 3H3KA 1P9MC 1SYSB 4Q6YA 2HWZH 4XI5C 1M71A 1LO3H 4HLZG 3QA3B 4R90H 3U46B 1ZK9A 3C5SB 3FHAA 1KG0B 2HTKC 3LRHA 5INCB 1W8OA 2CRZA 4RIRA 1KCRH 1YMHA 3S5LB 2ERJC 2XPGB 3PP3H 4P2QB 2G75A 5EU6A 4A6YH 2ITDB 5KVGH 1NCCL 1CLOL 5ENWB 3GRWA 3CVHB 4WFGE 1XCTB 2EDRA 1ORSA 1EJOH 1QRNB 4EUPB 2F74B 2HT2C 3SGDH 3T4AB 1FN4B 1D9KA 1EFXB 4OQTA 2UUDK 3ARYA 2A74B 4Z7QF 1GIGL 5D2NB 5DEGB 2HN7B 1KELL 3TN0D 5J7CC 3VGHA 4QCIB 5JOEA 3KNBB 1UWGH 3DPBA 1SBSH 2EE6A 3DO7B 3OR6A 1NLBH 1IC5L 4IOFC 5HGDB 3ZDZE 4OZIF 1CGUA 4OCLC 1LNUA 5IMMB 4U49A 1T22B 5HHPB 3T04D 2BOBB 1T66D 2CJUH 1Q9LA 3E8UH 3TBSA 1B0GB 1IC4L 5HVHB 5CJ8A 4BA8A 1WCBB 3E6FB 3JBG7 3SGJC 2V6HA 3U0PB 1Q9OA 4UV4L 3NCJH 5AYQA 3CDGA 1DJSA 3HNTH 1TJIH 4PJ5D 2V7HA 3ZT5A 5C3LD 1NAKL 3QWQB 4CNIA 4P2OA 5EU5A 1CQYA 1U8NA 1XGUA 2FHFA 2DQHL 5HHVL 3T8XB 3BUTA 3DSNA 2F8XC 3BPOB 1FRGL 1T83C 2I9TA 4N0UA 4LFHD 4QOKA 1JWUB 2OR9L 1I7RB 4GW4B 4UV7L 3MLUL 2MWCA 2CDGA 4O4YH 2X5PA 5F3HA 3BKJL 4M5YL 2P8MB 1U36A 3DSFL 2CIKA 1WQVT 2QSVA 3UTTA 5ILTL 1IC1A 2Z4QB 5GRJL 5T5NF 1R5IA 4FXKA 1GHFH 4PY7B 3PWNB 1D5MB 4G5ZL 4KGJA 3FO9A 3VFOB 3FQRA 3UJIH 1VGEL 3ETBF 2IG2L 4IRJA 3FONB 1HSAA 5F9JB 1TTUA 3GIVB 5GSVB 4X99A 4ZOCA 2GQHA 1TETL 3B5GA 4JO3L 3CLFH 1A2YA 1RUPH 4EBQL 2MHAA 4CW1B 1KXTB 4YDJA 1PQZB 4NQCA 3WEXB 1NFDA 4L9LC 3X13A 3ZDZF 4G7VL 1KIQA 4LLWA 4ZQKA 1HQRB 3HNVL 3QCUL 3SOBH 1E4XL 3MRQB 2BVOB 2CMRL 3VFGL 1ZMYA 3DRTA 5MEOA 3AM8C 1U8MA 4PLJC 4YAQB 3LEVH 3X3GH 1I8IB 3UYOD 2VZVA 5DVOA 1FIGL 3F7YB 3VGBA 4HF5L 3GHEL 1JL8A 3DXAD 2EYSB 2AJYL 3NCEB 5EIIB 1GXEA 3QG7H 5T1KA 1OD7A 3O81A 4PRBB 5DD3L 1MFBL 1HILA 4L8DA 1ACZA 3TBTA 4LARH 4IEFB 2ESVB 1K4CB 4IIQA 4Z5RA 2ATPA 3NA9L 1YNLH 2DI9A 3MRJA 4WTZG 2VLKE 4XCFL 3KPRD 5JW5A 1C12A 5FO7A 3U83A 2VLLB 2B0SH 4Y5YA 2I27N 3S4SA 3TN0B 2W65A 3CU1A 3QIWC 4Q58C 4IOIB 3LZFL 1BOGB 4OT1L 1AD9B 3TZVA 4NO2B 5IFAL 5JW4N 1L0YA 5E95B 3BYTA 4UT9H 3QRFM 1MEXL 1YY9D 3RA7H 2B2XL 2OSLA 3ZKND 3MODL 2UYLA 1DQQB 4HKBB 2VZOA 4E41A 1ZVSA 3ABZA 2IPUK 3IU4L 15C8H 1BLNA 1YDPA 2FZ3A 4H5SA 1AO7E 3WFHA 1IGYA 4XRCA 3IDIA 4UNVA 4MYWB 2OTUB 3HC3L 1NAMH 2VB5A 2AS5M 3HAEA 1RZKC 1A6UH 4DKFH 1NQBA 2O5XL 1WC7A 2YD9A 4KRPB 5CGTA 1BJ1J 4OZHF 3EHBC 4XC1L 4L4TD 5I1AB 4MAUH 3PP3K 4M7LL 2FBOJ 4R4BB 5I15H 3Q5YA 3QDJD 2BCKA 4BZ1H 3ZLQC 4L29A 1A5FL 4CN4A 1HK6A 1OTSD 3SDXB 3FQNB 2HFGH 3P9MB 1FC1A 1XGRA 5C09D 2WUBH 2GFBB 5FO8B 1A7BA 5EORL 3PWVB 2F5BL 1A9EA 3I6GA 5DRNA 3VFSB 4S1DC 5E2WH 1X5AA 2OR8A 4NPYA 3OX8A 2QJDA 1BIIA 4S10A 5E2UL 1JBJA 1OW0A 5CD3B 3OAZH 2V2TB 3ZTNL 4IOSD 5HHMD 4XVJH 1C5BH 2VE6A 2PYEA 4WEUD 4PJ5B 3K7UA 2VN4A 5CMAA 3BFOA 3SDDA 4MXVE 3E6HB 3QG6A 1J1PH 5DYOB 1FL3B 1R3JB 1SJHA 2UWEE 1Z5LB 1MFCL 2R0ZH 4PPTA 1CE6A 1N0XH 2FO4A 5LGKA 3BGMB 4YXLL 5KZCD 4F57L 5IBLD 3QISA 3S9DB 5LWYH 4DZ8A 2OK0L 1MCDA 3TVMC 4DEPB 3BOVA 3S36X 1F90L 1BBDH 3GMNA 3JSSA 2A9ML 4OBRA 5DUPH 3FN0L 5B8CB 4LLUA 2NR6D 3VRIA 5ICYB 4BZ2L 2OX5A 1J1OL 4ELKA 3RRQA 5AZEH 3LKOB 3T0VA 1BF2A 4JB9L 4MMXC 2FO1A 2QHRL 1GAFH 4OD1H 2DQUH 2XQBH 1FZJB 5CEXA 5HBBA 1SYVA 4RGNC 4X6CB 2FGWL 2YPLA 3QFJA 2P7TB 3LEXB 5GGTL 3QO1A 2A0LC 3HG1D 5BJTB 5C0CD 4RFNC 1AP2A 4N8CL 1Y18B 3GMRB 1QKZL 1TJGH 1SMOA 3OZ9H 4PJGE 3AGVA 1C1EL 4GQPH 5DQDH 4TNVF 3D39D 5EO1A 3O4LB 2XG5A 2PXYC 5EUOB 2JIXA 2ORBH 3DXAB 4MXVF 5BS0D 1TVDA 5IESL 3PGDA 4B5EA 3WNOA 4XCEB 3KYKH 2UWEF 5FDWA 4LHQB 6CGTA 5CIPH 1RU9H 3B43A 4D0CA 1T89A 2YRPA 1DSFH 2Z8RA 4F7PB 1OOAA 4X8JA 3RIFF 3BP7A 3GKZA 4U7KA 1ZHNB 4Z8FH 2BK8A 5GGSB 1V3LA 2DQGL 3BKMH 2X70B 4NRXA 5MEPA 3F5WA 4MJID 3CPLA 1CDJA 1BEYL 4OCYH 4MD0A 4G8EA 2E7LC 4ODTL 3T65A 4Y89A 2IF7A 4JQIH 3GSXA 3IFOA 4N0RA 3E3QC 4Q97A 4AM0A 1TNNA 4H1LG 3CXDH 2ZSVB 3VU2A 2FH6A 4CU8A 2Z31C 4JR9L 1CFBA 3VFVB 5CWSB 4BQCA 5E7FA 4HIHB 4JN1H 2AK4A 3O8XD 3FN9A 3O9WC 3QXAB 1VEPA 3I75B 2EIEA 4Z7WE 3O3BA 1KJ2L 5KSAB 3I2CH 1Q0XH 4UIKH 4HUVA 5KTEL 3P0GB 4PJGF 4HKXB 1NUNB 1TQBB 3N06B 5I9QB 5E99H 1LO0H 4L4TB 3S88H 5L7XH 1KF9B 3L3JA 1NH6A 4PREB 3CZFA 3KAAA 3AU1B 3QDJB 3H3PH 2QQLL 3EYOB 3MV9E 4YXHH 4HIEB 4Z76A 3O2DA 4M8VA 2EDXA 4LF3A 4WCYH 5C09B 3MRRA 5FV1L 4NC1E 1BVZA 4I4WA 2NPLX 1BQHB 2X1QA 1FG9C 1HZHH 4HCRA 3TCLB 3VG9C 3AUVA 3OKYA 4TTGA 3A6CL 2NXYD 2OXGA 4OLVH 4NCDA 5CUSL 4GFTB 3PIQA 4TULL 2JB6A 3QFDB 5D6DC 2ENYA 5CHNB 5J9PA 2NXZC 1CD1B 4WI5A 4JY6A 3KS0J 4F7MA 3GMLA 4ALAH 4PGBA 5HHMB 3LRGA 1ZGLB 2V2XB 2EKSB 5FCUL