4GKOA

Crystal structure of the calcium2+-bound human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
209
Chain Sequence
GVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ca2+-dependent Structural Changes in the B-cell Receptor CD23 Increase Its Affinity for Human Immunoglobulin E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 37
structure length 209
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA02
3V7MA 3MCG1 4WV1C 1U8HA 3NABH 4BJLA 1DBJL 3V2AR 5EN2B 1NBZA 5EUKB 5GGTL 4HEME 4S1DC 1YJDH 3IDNA 3EJZC 3MLUL 1J1OL 4HDIB 1QRNA 1FNEA 4PJ9B 4DVBB 5DJYA 3TIEB 3RGVC 4YXHH 3UTQB 5EA0H 1IAKB 3HG1B 1J1XL 2ZCKL 5GGQL 3UTSE 2FBOJ 3LKOB 4FN0A 5ID0A 1KSRA 4R2GC 1B6UA 5ADOL 3CXHK 1UG9A 2GT9B 1X5ZA 5AG9A 5MENE 3QIWC 4GT7A 1FYTB 1VFOA 4Q6IA 5I1KH 1R6VA 5FA3A 2VB5A 1X6NA 4AIZA 1SJEB 4PV8A 3IAPA 4HFUH 3O9WA 5JIKA 2F58H 3CSGA 5HYSG 1YY9C 2XXCB 2ZG3A 4EUPB 4OUUA 4X80H 3UC0H 5HI4C 5CSGA 5KTEH 2BCKB 3QDME 5KSBB 1DLFH 5GGSB 2BSSA 4RIRA 4LSPL 3BYYA 1PX3A 4LRIC 4X4YB 4HFWA 4M7JH 2FWOB 4GBXA 2IFFH 2Y4SA 5ENWB 4FZ8L 4PRIE 4Y4HC 1RZIA 1KGCE 1UZ6F 4ODWA 4CU8A 1NMCC 1EFXA 5HYSB 4YXHL 4U3XA 1N6QL 1P6AB 3L95A 5I75B 1W0VB 4HC1H 3X11B 3BD4A 1JFQL 1YEIL 3PWLB 4KV5F 3QQ4B 4I0KA 5TDOB 4Y89A 4J6RH 5GJTH 1RJZB 2EC9U 1TNMA 3NFNA 2QADC 2AK4B 2H26B 4FP8L 4OCSL 4LCWA 2DMKA 4A6YL 4LIQL 4WWKB 4ZUWB 5IQ7L 4JFFB 1M7DB 4WI3A 1TTFA 1RHHA 2X4SA 3C60C 1MCDA 4YLQT 1QVOA 2W0FA 5EPMA 3ZKSD 3A67L 2NY3B 4RDQG 1N26A 1ITBB 4PJ5B 1IM9B 2OP4H 3PQYA 3U0WH 5DR5H 3QEHB 1C16A 3STLA 4BSWA 5F8RC 1KPRA 1LP9F 3I6KB 2X1XR 4I4WA 4QF1B 1NCTA 3CDCA 2XICA 1U9KA 1YEDA 3FB7B 3ALXA 3VDBA 4DTGL 3TJEL 3UJIL 3KPNA 4P59L 1T1ZB 3OR7B 4UNVA 1BVLA 3IJHB 4FMKA 3WIHL 4IJ3C 4P2RE 4QOKE 4HKZB 5T3ZL 3RQ3A 4HS3B 1W8OA 4P5KB 5KOVC 4YJZL 2FATH 3BUYA 3T0EC 4ODUB 1FG2A 4BM7A 2HMIC 2NLJB 1T2QH 1QFWH 1TVDA 5E6YA 2A6DB 3C60D 3IDMB 3RL1A 1U8PB 1S7SA 5I19L 1W72A 2RAMA 4LCWD 2Q8BH 2R0KH 4OLYH 5HHXH 1AR1C 1J5OH 1NDMA 4UBDC 3MRPA 1AGEB 2MCPH 3L5XL 1EO8H 4MB3A 2VXVH 3CVIL 1JZ6A 3RVVD 3LAFA 4JRXE 5FYLD 1B4JL 3RIFF 3ESVF 3EZJB 3LH2L 5IHZA 4OF0A 5EU6A 1S9VB 1OGAE 3CFIC 3LPWA 3DARA 4G6FD 3LEVH 3G6JA 1AKJD 3PWJA 2EKSB 3U82B 2AK1H 1MFEH 3Q6FA 2Q8AL 2YPKB 4XTRD 1NMBL 4O58H 3TYGH 2YD7A 3TVMC 1CFSB 1L6XA 4Y16B 5JORB 5IMKA 3MLXH 4PFEA 3BPOC 3IKKA 3TNNB 4AMKH 3QP3A 2AAVA 3L3GB 1I9RH 5SWSA 3RI5K 1EHAA 1BVKA 1CFNA 4UDUB 4G8GE 3K80A 3WJJC 3HE7D 2R1WA 2PW2B 4XAKD 2HJLA 4LF3A 1DN0A 1WZ1L 1BEYL 5I71B 3D2UB 1BQLL 4UT7L 3VG0H 1DQML 3HMXL 4OF3A 1VGKB 3WNMA 2BVOA 2VDNH 5AG8A 3AVEA 2V9RA 1WIOA 2OQJB 4HAFA 3ORJA 2EDTA 4MJ2A 4PRPD 4B53A 1UT9A 4I0PC 1I8LA 1VGEH 1X7QB 4FXLA 3WHXA 3P0VH 3VE0A 4QRPA 3U46A 1WT5A 3T77A 4KQ3H 2FD6H 1ZTXL 4LCCB 4I18B 5EU3B 4PRHB 1HZHL 5HPOA 1TMCB 1LE5B 2HTLC 2DMCA 4L8SA 3MA7B 4PJEE 4PYHA 5IHUL 2A77H 5ENWA 1M71A 4H25A 5E0QA 3VJ6A 3O2WH 3QXVA 4NNXA 4QTIL 1AC6A 2YUXA 5CEXB 2FHBA 1EMTH 1KCUH 1D9KC 3C8DA 3M07A 3LB6D 4FXGB 1U3HB 1G9NC 1PEWA 4BSJA 3QJHB 1T4KB 3BEVA 1NAML 4MD0B 2VL5A 4ZS7L 2ESVD 4EBQH 4R7NB 5IW6B 2ID5A 4HV8B 5JHDE 4AY0A 2NXYD 4ONGL 1GGUA 5DXWA 2J6EH 1M6OB 3SGKA 3G5XB 5B8CA 5HGAB 2R2BA 5EO1A 1YUHA 2YD4A 5ID0B 4NQSA 4OTXH 1ZLVH 5FGRA 4BH8A 3EDJA 3KHOA 3DXAD 4PJCE 2P8PA 1SY6L 3TF7C 1XGQB 3IFPB 1MEXL 4IMKC 3F7YB 5JHLH 4X5WB 1Q0YL 1NANH 4MD5A 1Q1JH 3PHOB 4JZJA 4ZUUA 4Q97A 3BAEH 1DFBL 3DYPA 4WHYG 4LOUC 2F5AL 1MI5D 1S5IL 2YWYA 3NPZB 2QQQA 1CGXA 1CGSH 4K3EH 4FTVE 2RQ8A 4HSQA 1UQSB 4KI5F 2G75A 3LS5L 4R8WL 4TUJA 5HHOD 1MHPL 1Q94B 3MXWL 1DVFC 5GHWL 3WJJA 3BSZH 3V5DB 3GMQB 5GS0D 3BQUC 2B0SH 3QFDA 2BXZA 1J05B 3UBXB 3SJVD 2AK4E 2FO4A 3B9KB 1WAAA 4LFHG 2K1MA 4C4KT 4S1SL 4DZ8A 4HCRA 1JRHI 3L3IB 1TVBA 4PB9L 1MFNA 3QIBB 3DO3A 4OSUH 5D7KD 3B8SA 4HUNB 4EDXA 3HLAB 4HWZB 2J4WH 3TGXA 1A5FL 4FQJH 2LU3A 1Q8MA 2WINB 3RUGF 2W0FB 5EPMB 5C1MB 4LVHC 2BHYA 3RAJL 1IM9A 3PQYB 4YNYB 4HK3J 3D3VB 1P7QB 3LMJL 4XNMB 1IQDB 1H3PH 2IPUK 4PJGF 1H15B 3SN6N 4Z7NF 3RNQA 3I84A 5DJ6A 2F19L 1V7MH 3QA3B 4MD4B 4KFZC 3UBXG 5JW3H 5D5MF 1ZLSL 2HTKC 2WUBL 4RGNE 4HLJA 4K8RL 2ZUTA 2O5ZH 2YHGA 4L3CA 5ALBH 4AENA 3V52L 4JM4H 1HKLH 5CBEA 1EJOL 2ATPB 3AY4A 1IAOB 3IS1X 2J8HA 1CDJA 3MLYH 1IGCH 4MA7L 3MRDA 1A6PA 1L7TL 5DVKA 4DKFH 3D0VA 2IGFL 1H3VA 3S5LB 1CLZL 3DURA 2WUBH 3UO1L 2O5YH 4JANA 2FLRT 3E6FB 3WKMH 3CCHA 2VZTA 2YD9A 4XPTH 4OM1H 3CFCH 2HH0L 3MLVL 4G8FA 4X98B 5IB5B 4Z0XA 5HVHC 2YXFA 2MJWA 4M4PA 4XAKE 5FO7B 1PKQB 4HGWB 4ONHA 2Z31A 4LLAA 3RPIA 2F5BL 4M48H 3S96A 4F9PA 3VXRD 4TRPL 2JCCA 3GHEH 1DDHA 5I76A 1K8IA 1J1PH 5H37G 1QLFB 3SDXF 1JV5B 3R1GH 4YO0B 5FO8B 4KQ4H 5CEXA 1KBGH 5SX5H 4MDIA 5HPMB 1C1EL 1SM3L 2KZ1B 3OG4B 3SDDC 1VKXB 2ZPKH 3P73B 4KZDH 4KDVA 4ZO8A 4P2QA 4XNYH 3GKZA 2A9MH 4P2QE 5JA8B 2J12B 3CAFA 4M7KH 5C7XH 2WWMC 5IT2L 4WY7L 3FOMB 5T1LA 4B50A 1CG9B 4DKDC 1U2HA 1F3DH 4QXGH 4XHJC 3MBXH 1GAFH 4UIKH 2CIKB 1JYXA 4S1DD 3T3MF 3L6FA 4R8WH 3ES6A 3TM6A 5DYOB 2WIMA 4YE4L 4DOHE 3P4OA 2OQJA 3EDDA 4HKBA 1I7ZA 2ZUQB 1CGSL 1XF3A 4R97C 4XCCH 1A7NL 4YFEA 4G80B 1LO5A 3ILQD 4PGCB 4U1MA 4C57C 5C0DB 1JWUA 4HW6A 1GZPB 3BAEL 1NKOA 1BD2D 5IMOB 5D2NA 5TE6L 2CMRH 4NZTH 3BPNC 3RY6C 4NZJA 2ADJB 5DMGC 2EDXA 1JGDB 1H8NA 5D4QA 3DVNA 2GAZB 3KPMA 4YBHA 4QYOB 4XGZA 2AEQH 3QDGD 3QUZA 5GXBB 4E5XA 4NO3A 5I1LA 3L3JB 3MREB 1MQ8A 5CP7A 3UYOD 4CVXB 4OZHB 2DQEL 4MNQD 4WDIA 1T1XB 1MCCA 4RAUA 1S7RA 3QULB 2XQYG 3FO9A 2Z8SA 1F8TL 3DSFH 2H2SD 3G9VA 5IK3A 4IIQB 1O7SA 5EU7E 3ARWA 1UZ6E 2BNUB 4BZ1L 5KSAD 2XRAH 5CIPB 1BVZA 5DT1L 2R2BB 1A3LH 3O4OB 2B1HH 1ADQH 3MRQA 4W81A 1RUQH 1G1YA 3O2DL 1TPXC 5HHOA 2HFFB 2OL3L 5GSVB 1AJ7L 5D72H 4O9HL 5E2UL 5LBSH 3CK0H 4LLWA 3X14B 2RGSA 3SJVA 1XH3A 3OX8B 3Q6GH 1NBYA 4JAMA 1OAQH 3CVHB 4N5ED 4HULB 4MA3A 2QBWA 2NNAA 5J1AA 1P7KA 1CF8L 1PD6A 4ZAKA 3U36B 3FQWA 2EYSA 2VDQL 4P2RA 5DHYA 4TSAH 4I0PD 5F7LB 4MB5A 4U6XA 4EUPG 1B88A 1ZGLM 1URLA 4XBEL 1HXMB 4JPWH 1A64A 3FB8A 5HI5C 4FFYH 4TVSa 3CSYB 5KSAC 4XVUD 2A0LC 4FQ2H 5C0FB 4HXAL 4LBEB 1ZGLA 4NO5A 1FBIH 3FFDA 1S78D 5KVMC 2D7TL 3UBXA 4JM2C 4UILH 1KB5H 5DA0B 4LNRB 2QEJA 2YPVL 3KPOB 2HFTA 1C5CL 3WJLC 4WI2A 3IDYB 4ODXA 2QHRH 2DYPA 4QHMB 4QXTA 4JKLA 3KPRB 1CLCA 2AJXH 5FHBL 4PJ7F 1P69B 2BXYA 1XT5A 1I9JH 4PJ8C 2IWGA 3DUSA 3QCTL 4R0LA 1U8MA 2H2PD 1DEEB 1FZOA 3FN0L 4JJ5A 4JZOB 4U31A 5FO8A 1XIWB 4Z76A 2QSCL 3EYSL 1EUUA 1Z9LA 4APQB 4KTDL 3V6OE 4QNPE 4EOWH 3L5XH 2MCPL 1G1CA 3HPLA 5CINL 4X9BA 4WU5B 5DUBB 2H2SC 2CXGA 1I1YA 5F1KC 3BZ4B 5E6ID 1TZIB 3HRPA 3ZKQD 5H35A 5KSBF 3ARBA 3MV8A 2VXUH 1TJHH 4X9IA 5EDXA 3K8LA 5T1LB 1E0OB 3B9EA 1F6AA 3SE4C 1GSMA 3QT2A 3UPRB 2DAVA 1T2QL 4FQ1L 1A02N 5L6YL 1BX2B 3LVEA 1EGJA 3TIEA 3C09C 1CR9H 4GLRH 2IALB 4FA8A 2F53E 4QGYA 1HYSC 1HYSD 2PW1A 5GIRA 2P45B 4LSQH 3CUPA 1A9BA 2YZ8A 5EOCH 4APQC 2Z8RA 4GAJH 1UXSB 3F62A 4XH2B 5D2NE 2XOTA 1QQDA 5JR1H 1VADB 4QRSB 1CD0A 3CH1B 1AHWB 4OZIE 3UJIH 2VQUA 1NC4B 1PKQE 1E28B 3QDJA 1DQJA 4PBVC 1HHIB 3OGCB 4I3RH 4X6DB 3RWIA 3O3UN 5DUML 3NZHH 4LQ1A 5F96L 3LIZH 3O0RL 3VH8A 1BAFL 4PJDE 4G8IA 5IEHA 4U1LA 2H41A 3SDAD 3FJTA 2NQCA 3INUL 5I1IH 3MROB 1FP5A 3M45A 5C6PB 2HLFC 4XX1G 2E7BA 3SKNB 4OIIH 3BGFC 4PS4H 3P11H 4HH8A 1JGVH 5BXFA 3KYOA 3QFJB 4PPTA 2E6QA 3T0DA 2X89D 4YDIH 5FGBA 1BREA 2QQNL 4Z6AT 2Y07H 1S7VA 1N59A 5JHDD 2JB5H 5CSBA 2PF6A 5EFIA 3PL6B 2AXFA 5E6IA 3VXSD 3QNZA 4TTDD 2Q7YA 2Q76A 1MVUB 2BOCA 2NY5H 1T89C 3JWNC 4LCUB 4ODSH 4R90H 1MHHB 4U2YA 1S3KH 3T1FA 5IVOA 4MS8D 2VLJD 5KZCB 3MRJB 3MV9B 3MLZL 3BWAA 4JO1H 4WWID 3FRUA 3T1WA 2B4CL 3UPAA 4AIZB 1RI8A 1FFOA 3L6FB 1I1AB 5E9DE 3HUJB 5FDWB 1CE6A 1BJ1H 1CGWA 2Y6SC 4FZ8H 2RJMA 1F58H 4FHBD 5ICYA 3GRWA 4M7JL 5F7DB 4Y5VA 2V9QA 4F80A 2GCYA 4RDQF 5LXGL 1LE9B 3QR2A 1LD9A 4U1MB 3GSVA 3VXUD 1DLFL 2XTJB 4LDLB 2NY6D 3C5JB 4WTZA 5FYKE 5C07B 4XMKL 2EDYA 2M1KA 4LHUD 5DMKB 1ZHBB 4PJCF 4HKJA 4KKBD 3DRTA 5DHVB 5J1SC 5T5FL 4KUCF 5GS3A 1F6FB 4WFFE 2Y36L 3O8XA 3QUZB 2OLDA 1R24A 3QRGH 4NP4L 3QXAA 2B8OT 3BH9B 2P42B 4XWGL 1GHFL 1EZVX 4CMHB 2OMNA 4XVSL 3K1KC 3C8HA 2CD0A 4U1JA 4ZSOB 3VG9C 3VGDA 3QH3B 5J11B 4TVPH 1I4FB 1I75A 3JUZA 3QUZC 5KSUA 3GSNH 1EXUB 3VXMB 2O93L 4PLKD 3OJDB 1CI5A 3NFSL 2GT9A 2GTZA 3MGTB 4J3OC 1WVZA 3D0LA 2BX5A 1MCEA 4M43L 4XCFH 1QFWM 1IE5A 3S3JA 1YZZA 3VFTB 5C9JA 3WXWH 3KYKH 5T3ZE 4KK5D 3BPNB 1IAIH 2V17H 1XEDA 3MYJA 2VWEC 1YQVL 1CDIA 5AZEL 1OP9A 5EZJA 4M7ZC 1PQZA 4JFOA 4LCIL 1AXTL 4XVTL 1YEHH 1E6OH 1KNOB 2Q6WA 1PX4A 1FRGL 3IJSB 1MQKH 3OKKB 1EGJH 5HVGB 3CVHL 3BO8A 3MRFA 2BNQE 2YPLA 3U9UB 1AGFA 3O6FB 2GK2A 3LIZL 3O0RH 2IPKB 5FDYA 3O3BA 3SGKC 2DRUA 3KYNB 5GRXG 1BM3H 1I8KB 1OGAB 1WTLA 1WZLA 2GJZB 2NY4C 4OM0L 1S7WA 2NY0B 4LIQE 3SKUD 3HN3A 3RWDA 1NGPL 2PO6D 3RWEA 1CBVL 3E1F1 3DOSA 5SWSB 2BNQA 1OAZH 3O4LD 3MRPB 1RZ7H 2IALA 1A7QL 1J12A 4V1DD 5DC4B 3LQAH 5C6TL 5I8OH 1JTOA 3IRPX 1A1OA 4WO4C 1YYLH 4NFCA 2APBA 2E5EA 1VACB 3CH1A 1A0QL 3P77B 5DI8B 1TVHA 4FXKA 4HIEB 3LKPB 1LP9A 1AD0B 2OJEB 3V0VA 4POZC 5LAXB 1NGQH 4HF5L 1WGOA 4LHJB 4WV1B 4Y16A 4DFHA 5E7BA 1W0WA 2HT2D 4N8PA 4MJIB 3BW9B 1ZA6A 4HKZA 3S88H 2V5MA 5GS1A 3OR6B 3MTRA 4MQ7A 3L3OB 4KXZH 1GOGA 3VXPB 1OPGL 3OJMB 3FN0H 2EKJA 1GL4B 4JRYA 1UM4H 3RWJA 1I1FB 1PLGL 4JJHA 3TT3H 4K7FB 2JELL 3IF1B 1JGLH 4L29A 4H8WL 5C6TH 3BMVA 4NNXB 2VITA 3DX7A 3LPFA 5C0IA 3EOYG 2YRPA 4GRMA 5E08H 2XNAB 5E8OA 2EZ0D 4LFHD 3SDYH 3SDXE 1U95B 3MLSL 4FQCH 3QG7H 3TIDA 1I7RB 4LU5H 3NOIA 5D96C 4MAYA 4M93C 5ANMA 1LEIB 4XBGA 3SDAA 5I1JL 4OI7A 4XCEB 2J2ZA 4HV8A 1I1AA 3MBEC 1R3IL 5IB4B 4NZUL 1C5CH 1DQDL 2K9UA 2I27N 5ICYB 2PW1B 5EUOF 4ESKA 1KB5L 1QPPA 3C6LD 4LVEA 3KPPA 4JQXC 4OBRA 4Y2DA 2QQNH 5D2LF 4WI8A 4XHJD 2EIBA 1K3IA 3PGDB 2Q20A 4PS4L 5MEPB 5DMIH 3VXSA 4QHUB 2ESVA 1KLGB 2CDGB 3BZFA 1YN6B 2V7NA 3CZFB 4Y4FC 5I1DB 2IFGA 3VRIB 2WLZA 4Z78A 3MSPA 1U8IA 4NJAH 3WIIL 3U4BL 2AEIT 2V5YA 5I1IL 3OJVC 4GAGH 3AB0B 2QHLA 2A9NH 4GMTH 1QA9A 4WHDA 3RZCC 2VE6A 5AAWA 1R3HB 2VDQH 4UIMA 4YHML 1QRND 1FVEA 2XKNB 3WXWL 2AEWA 4MQXC 4PR5A 4U7KA 3KXFD 2YD2A 3FFCE 3SGDH 4XCFL 4JFYA 4N1HB 4PJFF 5BCAA 4JM2B 5DRXA 3GSNB 4XAWL 2EYTB 3QXAB 1MRCL 1GGBH 4O2CB 1MLCA 1NCCL 1TQBB 3FRPG 5EORL 1CR9L 3CPLB 4GW1B 4H8WH 4YHPA 3EGSA 4OLVL 4Z7VF 3C9NA 3PWVB 2GHWB 1RUQL 4ELKB 1DBBH 5A2FA 3MGTA 1DUYB 2DWEA 3K2UL 2YXMA 5FYJE 2DWDA 4LP4A 2VUYA 3BJLA 3MJ9H 4CDHA 3BP6A 3EO1B 4UQ2A 5GJSH 2Y36H 3HTLX 2YBRA 5IJKC 4MCYA 4TULH 5KVEL 1F45A 5CBAB 4Y19E 5D1QC 3L3HB 1JMZA 2OTUA 5F7DA 5EZJB 1C7TA 1NGWB 1RUKL 3T4AB 3BD3A 5HHME 1FE8H 1ERNA 3G6DH 5GZOC 4G43A 2PXYC 2X4QA 5AD0A 3MRCA 4MQSB 4X6DE 4DW2H 2VRAA 1C08B 5DMKA 5EOCJ 4GKZB 3WFEH 3F7VA 5TGBB 3ZLQC 1RJYB 3QFDB 2B2XL 4M6NH 2XXMB 5DS8A 1YNKH 3IDIB 3QG6A 1NGPH 4A6YB 1J8HE 1QBMH 2HKHH 1Q9WB 3BVNA 5F3BA 3FQNA 1NDGB 2V2XA 5GRZA 5T1KD 2YRLA 4O02L 1MJ8H 5DD5L 5DSCB 3G5XA 3FQRA 1MCIA 2ZSVA 2ATPA 1L4IA 3U7WL 1JPGB 3SCMD 1WEJL 4HWZA 2C3VB 2OK0H 1A6TB 4XBPA 3PWUA 5GGRY 4PTTA 3EOBA 4WEBH 2JB5L 1YC8A 4FFYL 1FFPB 1E4XI 3D0LB 1MFCL 4JPWL 1KTLB 4N9GB 3VXRB 1JRHL 3FB5B 4OIIL 3LKPA 5TDPB 2D03L 3TO2B 1IC1A 1RVFL 4Z7NE 2GFBB 2R56H 4D0DA 2VDML 1R0AL 4G9DA 2OS7A 4ODVL 5BO1L 5EBMA 1VHPA 1NC2A 4JZJC 3N06B 1ED3B 1UH3A 4ZUSA 2Q6WB 1FQ9C 3MFGB 2Z0BA 4QOKA 3MRRB 1RK1A 3WN5A 2BDNH 1T21B 1INDH 1RMFH 3CFKB 3C60A 4AEFA 5DJXA 4DCQB 1CGVA 4LSQL 3CC5A 4TVPL 3VD5A 3GMLB 1DJSA 3P3YA 3GMPB 5A16B 1PKOA 4KVNL 2DL9A 4ZDHA 3BPLB 1I7RA 3HAEA 4G8GA 4NUGH 4MDJA 5DT1H 2DJUA 5JOFB 5L6YH 3PQYE 4FQ1H 5ANMB 5JA9A 4BZ1H 5SWZA 1XGUA 2V5RA 5FECB 4QEGA 5TH2A 4JANB 3IDNB 2A6JB 1AQDA 2BVTA 1CFQA 2ATKB 3QNXB 2VC2L 3LQZA 3QIBA 2Y5TB 2VXUL 3FOMA 5DD1L 1G7IB 4HUXA 7FABH 5EO0B 1RFDH 3S36H 5FO7A 2Z31B 3TEUA 2EDHA 2CIKA 5EOQL 1ZWIA 3VFUA 3MV8E 4GMSL 1ZVHA 5DJ8A 1RZ8A 1Z5LB 1MWAA 2YC1B 4GQ9L 4PP1C 2Z8VC 1FZMB 1AD0A 3V0VB 1H15A 1U8LA 4HUVA 1R3HA 4K9EH 1JWUB 1IGJB 4UIMB 1P7QD 5HGGS 3G5VB 3HE6B 3MZGB 3QA3A 4F37F 5AUMA 5IESL 5CKAA 2BNRE 1H3XA 2CRMA 3F6LA 2EDNA 1EO5A 4NQCA 5GS1B 1A7NH 4WUUD 3T0WA 1K85A 5IEKA 5CBEB 5DQJA 5F88A 4F3FA 4AG4H 5HVWA 4JRYB 4QHKJ 5INDB 1I1FA 4XGZB 3CPLA 5DFWH 3V5HA 3K2MC 5HD8D 4JZNB 1EFXB 5HYSA 3PNWB 2GITA 3H9ZA 1A1NB 2HJKA 3O4OC 1AFVL 3X11A 3T3ME 4O2EA 4APQD 3BOVA 4XBGB 4M8QA 2NX5E 2DWEB 4U1NB 5L7XL 5F3HA 3WHE1 4M7KL 4RFOH 4XMLH 5EU5A 3WLBA 2AJUL 1RULL 4UINL 3V4UH 1V3LA 2D4DA 3N9GL 2YUVA 1NEZG 5FYKH 3NZHL 4I3RL 5DF0A 1R5IA 4X4MA 1YEEH 2CLVB 3VGHA 2E3VA 3BSZL 5CMAB 5FM4A 1QO3A 5IW1B 1J1PL 1OAQL 3ZTNL 2EH8H 1E6JL 3WNLA 1JBJA 4WIQA 4PG9A 4L8SC 3B3IB 4DGYH 4P3WA 5CJQL 4MDIB 3BH8B 5HPMA 3L95B 4RRPG 4PJAE 3CVHA 5CIPH 1BFTA 4MXVE 3IKCB 3S36X 2G9HB 3FL7A 3U4EA 1VFAB 2PYED 2QKIA 5D7LD 1EBAA 1UACL 2B1HL 4QTHB 3ULVF 1J7VR 3VRLE 1QLRB 1Q0YH 3V6OA 2FBJH 2CLZB 4I5BA 1JNNL 3RJDA 1KXVC 1E4KC 5IMMB 1JHLL 3MACL 2X44D 1R3JA 4DEPC 4U1KB 4WTXA 4Q9RL 3T0AA 5HYIA 4K3DL 3S37X 3VGAC 5CINH 5DZLA 3SQBA 3QWRA 5DYOA 5KVDL 4JFHE 1HK6A 2HFFA 6CGTA 4ZAKD 2YZ1A 5HYJD 1X6LA 3D85D 1EJOH 2O5ZL 3FO0L 3H6JA 1AXIB 2A73A 3QQ9D 4FTVA 3Q5TA 5MEOA 5D6CA 4ZOCA 1WBZA 1KN2L 1BMGA 5IGXH 1AO7B 1IGFL 3RHWF 4PRDB 4M7LT 3IJHA 4AIXA 1ZLWK 3T0VA 3J8F7 4HFWB 3MRCB 1U8MB 3DYMA 1DEEA 2VLRB 5C86A 5D6DC 4D9RE 1FC2D 5I1LB 1G7QB 2A74B 4GXUN 3B9DA 4GKZA 3WS6A 3ZDYE 4Z76B 3CFBB 3PWLA 3CSPA 3QDGB 3FFCB 4MA1C 5JORA 1LEKB 2HRPH 1HDMB 5EIVA 5C0GB 3D1MC 5IFHL 4CVZA 5HTSA 4JFHD 4NNPL 3BZ4A 4TSCL 4ODXB 2DMBA 2ITDB 3R06B 5J0BA 1VGEL 1YMMB 1EV2E 1EO7A 2CPCA 3ULVC 4KMTH 4H1LB 2ZCLH 4LF3B 1II4E 2VDNL 2XZZA 3OKLB 1V3MA 2W91A 1E4JA 4KZDL 3MV11 1MHPH 2PTUA 5DJAA 5J3HC 5HHOB 4UT7H 5EULV 5I1EL 2EYRA 4R0LB 2VABB 1KTRL 3DV6A 3QUXC 2P5EB 1FNSH 4KKBC 1DVFD 2IBGA 4I4WB 4B7IA 1S5IH 4K71B 4KKLD 5B4MD 1BFSA 1IT9L 3WNKA 4HQQL 2R29H 1P4BL 3BN9D 4MA3B 1VADA 3X3GH 3EYVA 4LDOB 4RQQA 5AUMB 3HMWH 2CUIA 1A3LL 1MLBA 4OI8A 5CEZL 2PCPA 4AQ1B 3ZDZF 4KVCL 4TOYL 4NHUA 4POZD 4G5ZH 2F15A 2ZUYA 4UAOC 1MEXH 3BP4A 4ODUA 3CFCL 3CFKA 2ADGA 2FGWL 4K3JL 2CDEA 3UPRA 5BXFB 5J6HA 1HNFA 3LQMA 5T1MB 1TETL 2AJSH 2EIZA 5IM7B 2NX5D 4L8DB 2DBJA 3BQUB 1T4KA 2DQDH 4E41D 1LNUB 2VXVL 3DGGA 1RAMA 3TVMB 1AQDB 4X7FC 5E4EC 3TLRA 3VE0B 3WLBB 3F7PC 1EFQA 1K5NA 1AGEA 2Q8BL 1MREL 1G6RA 2DLIA 1FAKT 2YS4A 2ENYA 1E28A 1CT8B 2DBLL 4O2FA 4XP9L 4L9LC 3MRJA 3GBNL 1SVZA 3KDMB 1KLUB 4L8BA 5ADPL 1LE5A 5HI5D 2IPTL 1KJ2L 4UB0L 3WFCL 4Y4FD 5CJOH 4XVUC 3WDHA 3ARFB 3W9EB 2FDBP 4PJDF 5DJ8B 5BMFH 3MR9B 1RZGA 1A14H 4P2CG 4BH7B 1S9WA 1S5HB 3NGBB 3WFBH 5EIIB 5LWYH 4LLUB 2IAMB 3VA2C 4RISH 1ZTXH 3FT2A 2KPNA 1YMHA 5IHBA 4JPVL 4FQJL 5DGRA 4YHZL 4EKXA 4BZ2H 1TZIA 3P4MB 1IILE 4ZFOL 5D70H 1KIQB 4JY6B 1J0HA 5J9PB 3K4ZA 1E4WL 1KCVH 3WNOA 4GKNA 2IADB 4HJ0D 2BFVL 1FVDA 3KPSD 3HUJA 3WDJA 2X2YA 2B0SL 2MPAL 3VXQA 2NXYB 3FQUA 3RTQC 3O8XD 1UXSA 4MZ2A 4LLMB 1V05A 1WBZB 3QFJE 1QUNA 1MCWW 4J8RA 3RU8H 3DIFA 3MUGA 4ONOA 5DVMA 4Z7WB 1ZEAL 1CGUA 3SDCC 1RSFA 1ZHBA 2VAAA 5ISZA 1DFBH 3I50L 1DBAH 3DRQB 1CFTB 2E7LA 3OKOA 2AI0L 5ERWB 4OM1L 3SBWA 3VFVB 1HWGB 3RTQB 1GOHA 4MNQA 5C8JB 1IC7L 4TTGA 1CLZH 4RCAA 3H3PL 2IGFH 4K07A 3UTPD 2Q7NA 1S7VB 5M95B 3OAZH 1SBBA 3FQXB 5INCA 3P0GB 2VL5B 4F8QA 3L1OL 3ARZA 4M7ZB 4OF7A 1MI5B 4EVNA 2R8SH 2F58L 1HKLL 2CLZA 3IETA 4I5BB 5C0BD 2CIIA 1OAXL 3VA6A 1T89A 4WI7A 5GISH 3TH4T 4LCYA 1OY3B 5CGTA 4P46B 4L3EB 4QKXB 1B3JA 3EW3B 5K59F 3CLFL 1KJ2B 1AY1L 3V5KB 1JP5A 4RFEB 3I6LD 2IQAB 4KJWC 3ZSTA 4YNYA 3ZL4L 4NKIH 1ZT7A 5E8EB 1AD9A 1QNZL 4WFHD 3MJ9A 5EC2A 1T22B 3EOTH 3KJ4C 4TNWF 1GZQA 1NEZA 5DURD 3GB7A 1CFVH 3HUJF 3MV7E 3W0WB 3BRDA 4P59H 4OZFB 2X1WL 4YHOH 3MJ7A 1KIPA 4S2SB 1J88A 4J4PC 3AU1B 2AXJA 1YPZA 5FUOL 4HKJB 3MRIB 5FIEA 5DEGB 3S35L 5GQBA 4M03A 4KGLA 3V7AE 1N7MH 4HPOL 5C0AB 2P8LA 1OTTC 4LHUB 2WWKO 4Y19D 4MGXA 3OKYA 1AQKH 5TJWK 1UB6A 4PJ5D 2F8VA 1HSBA 4YDLB 2EE6A 4LL9A 1KJMA 5FKPB 1R5WA 5AZ2H 5L2KE 4Y7MA 2J8UB 2NZIA 5FHAH 4WU7B 5BQ7B 1FIGL 4MX7A 4MXWL 3BQUA 1VESA 1EZVY 5IOPA 4H26B 3VFWB 4K2UL 4KI1A 3ME0A 4KAQH 3B9AA 1XGYL 1IGML 3RFZC 3JTSA 4A2MA 1ZS8A 1AP2B 4K3EL 5GGTA 4FNLL 3OZ9L 5FXCH 3HHRB 4LK4A 4ZG1A 1JN6A 1QPXA 2R1XB 3IDXL 4X7CC 1F5WA 1TQCC 2DICA 3AB0C 3P40A 3WD5L 2P5EE 1ES0A 2Z93B 3EYOA 4U6HA 1NMBH 1BQHG 4O58L 4HKBB 2PETA 2WQ8A 3U7YH 3HI1A 4R0LC 1U3HC 1QYGL 2FIKB 3UBXI 4JM2D 3D3VD 1C5DA 4LLUA 2AJZA 3VXOB 2MQCA 3BP7B 3KYAA 1GOFA 3B8YA 1BIHA 1FL6B 2CJUH 2IF7A 3ILQC 3PHQA 2R69H 1QSFA 3H8NA 5CSZB 4PGEB 5JXED 4HFUL 4LKXA 1XIWC 4L4VD 5C0IB 4J2XA 6FABH 2NY1D 3T2OA 4WWKC 2HWZL 4N8VG 2P8MB 5HDBF 4QRQB 3SGJC 2EC8A 1D7FA 1I8KA 3O6MH 3ULUH 3DBXA 3VRJA 2R0KL 4OLYL 2XQBL 2AQ3A 1QHPA 2IAND 2VWEE 3NA9L 2YEZB 5ADOH 4MA1B 2KQNA 4G7YH 4DAGH 4RAVB 1D5ZA 2EDEA 5CZKA 4ZFZB 4ELMA 4LEOA 3ZHDA 1YJDC 1CCZA 1WFNA 5TFSL 2FO1A 2L7UA 4UV4H 4JDVB 4KU1A 5EUOE 1TCRA 1XF5B 4XVJL 4JQVA 1J8HD 3E2HC 5I66A 3U4AA 1A1OB 1FL3B 3RPKA 2I25N 5GGTH 3EYQC 4ZFFA 2QTEA 1F4WL 4YDKH 4OZ4A 2XA8H 3P4NA 3P77A 5H8DA 4Z0XB 3U48A 1CT8A 4O2FB 2MNUA 5T3ZH 2DLEA 3O81A 1X4XA 4UQ2B 3C08L 4QHNA 5FV1L 5GGUB 3TP4A 1I8LC 1FYHB 5HHMD 4EN3C 1IFHH 1OAYL 3QDJE 5IWLA 5I9QB 3NVQA 3OR6A 2Z91B 3UTZA 4OZHA 5I1GH 2OP4L 4F58L 4MJID 1T1WB 5AD0B 4LLDA 5D9SB 5GGVY 4MHHI 1UWGH 5F7FA 4P9HC 2CH8A 5LKNA 2J88H 3VI4E 3P4MA 3HZMA 2JB6A 1FIEA 4LIQH 5IBTH 4JN1H 2FH8A 4PD4J 4P23C 4V1DE 1U41A 3C8KB 2DLFL 5D1XD 3GBLA 4GXVL 2Q1EA 4EZMA 2AXHA 2XT1B 1D5IL 1QFUL 3SDAC 4L5FH 5GJTL 4OCWH 2VSCA 2VLJA 4EQ3A 3GHBL 2EEAA 4HC1L 4D8PA 3KLDA 2VDOH 2DKMA 2YN3A 3OAUH 4OZFH 2X4SB 4JDZA 3NAAL 5FGBC 4F57L 1I3GH 5J06A 4MAUH 4NT6B 4R26L 2BVYA 3VXSB 1YN6A 1S7UB 3BZFB 4HT1H 4U3HA 2DM7A 2X5PA 3ZKND 4ZODA 3I85A 2VLLB 2LAGB 4GG6A 1B4JH 5E00A 5E8DL 1NLDH 3CX2A 1U0QA 1TXKA 1L0YA 5KTEL 3HB3D 3CLEH 4EQ2A 3O6LH 3KWWB 4P57B 5IF0A 3B2VH 2XKNA 4XXDB 4XP6L 4MNHA 4LHUA 3T8XB 3TCLA 1HQRA 4NO3B 3OR7A 4JZOA 4YHNB 4XB8A 4YFLI 1LGVA 1OWWA 1MFDH 4O2CA 5IVXB 2D9QB 3BUYB 3OTTA 4IMKA 4JY4B 4QRUA 4YHPB 4YWGL 5C6WH 2VDKL 5CGYC 3GJFA 1KEML 1IAII 5ACZA 5HHMB 1HHHB 4NRXB 5FA4A 3ZDYF 2FATL 3T0EA 1N8ZA 3VWKD 4HJGB 1AXSA 3TBTA 4ZQKB 5ESQB 3MBEB 3EIFA 4FQIH 4HLZH 4RFEA 3DX8B 2A6JA 3GRWH 4K9EC 3GSWA 4D0DB 1NCAL 1NLBL 3FQTB 3MRLA 4JKPH 3X12A 4WFFD 1DQLL 4ZFGH 1HH9A 2WP3O 4HZAA 5FHAL 5F7EL 5CZVH 3TH2T 4G3YH 1BP3B 3W0WA 4JQIH 3RUGE 1HQ4A 3QI9A 4XNZC 1N6VA 1RZIB 2H32B 4KROD 4P2RB 2YPKA 5D1ZD 2BY0A 4IRJA 1LK2B 3VH8B 5K9JH 1A47A 3RX5A 3TJHD 3RJQB 3W81A 3BEWB 4MDJB 1FVCB 3TNNA 3GSXA 2DN7A 3NFPB 1EHLL 5DJ0B 1Q9WA 2XA3A 3NIDE 5F3BB 4LQFL 3FT3A 1UKQA 1SEQL 4JO4H 5FCSH 3LKNB 2W60B 4D9LL 4TUKL 4M7LH 4E42A 4KTYA 2YPLD 2HT3C 1IGTA 3ZL4H 5DK0B 1JK8B 2G2RA 4RFNB 2XG4A 3QIWB 5H2BB 4JZNA 4YWGH 4ZFFB 5FB8A 2HJKB 4L3EE 1YEGL 3KPRA 2XQBH 4D0BA 1NC4A 4QHKI 4TYUA 3RVUC 1MWAB 2YC1A 3MV9A 1A1MB 1T6VN 1NEUA 1GIGH 4HIHA 1OM3L 4LPVA 1U8QA 1LQSR 3RWHB 4J3XA 3CX5J 2DQHL 4XNUL 1YMMD 1FPTL 4UDTA 1CK0H 2QSVA 2J8UF 3WL9B 4APQA 4L8SB 1JPFA 2WBJB 1UJTA 4HT1L 1MPAH 3N50A 4O51A 1XR8B 4XXCC 1MRDH 3PHQB 4G8EA 5E5MA 2FIRT 2CKBL 2W65A 3WE6A 4EXKA 5I15L 2D0FA 4Z5RA 3VGAB 3GHBH 1NSNL 2JJUA 4PREA 4WW2B 4TSBH 5DZNA 1D5IH 4O00A 1DBJH 4LPXA 1YY8A 4P2OD 4U3CA 2DYPD 2HG5A 2YSSA 3K3QA 5F9WC 1NFIA 5LQBL 1G9MC 1XGYH 4RAVA 4E0RA 3K74B 4OFKA 4KRPB 2R9HC 4J12A 3S34H 4NQXB 1KYOK 4NHCH 3C5ZB 5JTWA 4MXWH 3CDGA 5M7QA 1XCTB 3TBWA 4QRRD 1A7RH 3VFMA 1I8MA 3F7RA 5GZND 1ZWIB 4W6XB 3OV6A 4P5TC 2WBJC 2BFVH 2CR3A 4GG6E 2R39A 3CMOL 1R5VA 2VZSA 1KC5L 2AJYH 5SX4H 1BWMA 2NYYC 2IH1B 1UB5B 2PR4L 3EFFB 4HPOH 4PV9B 4H0IA 5I6XC 3I75B 1BECA 1F3JA 1CFSA 3LN5A 3GRWL 4WNQA 3P30L 3RZCA 3L3GA 4FG6C 4H1LG 2DD8H 4BFIB 2DM3A 1CZ8L 2X41A 1CFNB 3HC4L 4X8JA 3ULVE 4U1SB 1RZFL 2QQLL 1ZVYA 5EG6C 5E9DD 1DN0B 3UCRA 3QNZB 2D4FA 3EDFA 1ZLVK 2XTJC 3GJFB 3TH3T 3WFCH 5JO5A 4HC1A 5JHDB 1FO0B 2HYMA 3PGCB 1MFDL 2Y7QA 4QLRA 4IOSD 4HUMB 4UTAH 4N8CL 3WXVH 4KXZI 1NCBH 1FNGB 1MREH 4DZ8B 3KXFB 3L3IA 3GSRA 3RWEB 3EUUA 3HS0A 4N0CC 3ULUL 4CAGA 1FFNB 4F9LA 5I17A 3MRLB 1OARH 3LZFL 1IEBB 1NCNA 3CFJB 3MLRL 4PJHB 5JW5A 2GCYB 1T7XA 3LV3B 5LCVL 3MUJA 1CU4H 3HG1D 4RMUA 1WC7A 3AREB 2V6HA 3C5JA 1HH6B 3LKRB 3QZWB 1ZHKA 3C2AL 3HFML 3QQNA 5L2KA 1PGRB 1RIVL 1QR4A 1HINL 2EDLA 4XX1E 4PY7A 3CFBA 5FUCC 4IRJB 3LKSB 3GSUA 3LKQA 2YKLH 3P9MB 4RWHA 2EDOA 3QHFL 4RX4A 1KF9B 4TNVF 3HUJE 3RWDB 3MC0A 5H94A 3FT3B 5DMYA 3C5SB 1MCJA 5E6IC 2OTWB 2X1PA 1U8JA 1ZMYA 2DI7A 4JB9L 3QXDA 5T3XL 2F54E 4K94L 4K7PL 4NQCE 5J4MA 1U42A 2X4OA 4QHLB 4YHKH 3RTQD 3VFGH 4J3VA 3IFNL 3MUZ1 3TYFB 1CVRA 3ESUF 4EDWH 4RMTA 5D1XB 3OMZA 2P8PB 4NN5C 3T0EB 2X4PB 4JLRB 1E4WH 3AY4C 3CSBA 4NO0B 4MJ5A 4HS8L 5T1DH 4AEHL 1KUMA 4J4PD 5C2UB 1W0WB 4G8FB 4X98A 4DGIL 2LQRA 3QDGE 3X12B 1QSFE 4H0HB 4WEMB 4HWNA 2X09A 3EBAA 4G6AC 5JW4M 3HZYA 1WZKA 2ILLA 5C2BL 3UROR 4XPFH 3G6AB 1UQSA 2ZG1A 3JWDL 2B20A 2D7NA 1JGEA 3RWJB 2EE9A 3BO8B 3MRFB 4K7FA 3EO9L 2BHZA 4GH7B 4K3HA 2DLTA 4I0CC 5SWZD 1ZV5A 2J5LC 4PJ9D 5A3IC 4KGJA 4NIKB 1LK2A 5I1AB 2VR5A 4Z5RB 4Z7UF 2HKFH 2IAMA 1CDCA 2DBLH 2R2EA 4RMQA 3P73A 3TFKC 2AQ1A 1PYWA 5DMGD 1UXWB 2WWKT 1HNGA 1FLRL 3KLAB 3ARPA 5TPWL 3IXAB 1N3NA 1EAPA 1OAKL 3CX5K 2NXYC 2C5DC 3DI2B 2AERT 3BFOA 4LMQE 4MWFA 2HWZH 3FO0H 5BJTB 4I0PB 2ADFH 2FYYB 4WI5A 1PEZA 5BRZD 1NFDF 1DUZA 1T2XA 3KDMA 2FB4L 2XZAH 4NNYB 3L1OH 2Z35B 3W5MA 4F33A 3ES6B 5KVFH 2FGWH 4NKMA 1P7QA 2IH1A 1XF3B 1CGTA 3VXQB 3FOLB 1GH7A 2DWDB 3DI3B 4CMMB 1W72L 5DFVD 3DO7B 5EIIA 3O9WB 1DE4B 4WW1B 2HMID 4LLMA 4JFDD 3HMWL 2Z8WC 1B2WH 1FO0L 4AT6A 3UTSB 1KB5A 3GI8H 2I24N 2DTMH 4R4FH 2VISB 3TNMB 3L3HA 3SE8L 1KYOJ 5GSRA 2R29L 4JFYB 2JF1A 1U58B 2DJSA 2AV1B 3ROOA 3BP4B 1HHJB 1EEYB 1EUTA 2GK0B 5KOMC 4RGMC 1FNSL 3SEPA 5BV7B 1IAOA 1P2CA 1VEPA 3IF1A 4Y1AE 5CCKL 5L2JA 4H20H 5I1EH 4Y4HD 1RV6X 4YR6A 1RK0B 3OB0H 4MMZC 5E8OB 2DJ4A 4ORGA 5DS8B 2CDFA 4HIXH 2OXGA 1LNUA 3QDMB 3WEXA 1UZ8A 3BIKA 2B5IC 3ECBA 4BQBA 3N9GH 3FCTB 4YEFA 1KN4H 2AK4A 2H26A 3HE6D 2CGRH 4EVNB 5IBLD 5ETUB 1XR9B 1RULH 3CCHB 2FX8H 2LTQC 2DIBA 3V6ZA 4PTUA 1BOGB 3QO1A 4NNPH 3HRZB 4IEFB 1N2RA 5CD5C 1OLLA 3VU2A 2OSLB 5BRZE 3VI4F 5FF6B 4L8BB 3RVTC 5IUSA 4IIQC 2ZUXA 2D7PA 4XC1L 3MLTB 4QHUA 2GJ6A 4IRZL 1CFVL 3ARFA 4X7SL 4ENED 5TF1L 1MF2L 1Z0NA 3QZWA 4KK5C 4QRRB 4WW2C 4DN3H 2VERN 1WQVT 2CXKA 3CXHJ 3X14A 1JZ7A 5IW3A 1A6VL 4Y4FB 1U8KA 2R0WL 1CFBA 3EKCA 3K8MA 1MELA 5DDHA 1Y18B 1SJHA 4PJFE 4ZTOH 4NRYA 3DXAB 4NCC2 4S1QH 1FLTX 1T1YA 1JHKH 3SE9H 5F6HJ 3VGEA 3D25A 5D1XC 5JIHA 1KIQA 3FQRB 2VR9A 4OZHF 2P8LB 3S4SG 5CWSB 3CIQA 4YFDB 5F89B 1BQHB 3SY0A 1A6AA 5A2JH 4GKNB 2NLJA 4WO4B 5DJ2B 3SQOL 3RZWA 1R5WB 3PDOB 4GKOA 2CK2A 2ORBH 1T3FB 2NY3C 3GK8H 4KTEH 2OMBA 1MCPL 1FSKC 1UM5L 3HAEB 4KWUA 5AWNH 1CLYL 4GW5A 4LNRA 2AK4D 1BGXL 5FA3B 2QJDA 4UU9B 4Y2DD 4HWUA 2KQMA 4CNIB 4K3JH 3ZYZA 2C1OA 1GC1L 1S9XB 4KRPC 2ICEA 2BOBA 3MJ6A 4OZFA 4OBSA 5A2KH 1MJUH 4FTVD 3HZVB 4LSUH 1MI5E 3GI9H 1S7TB 2PTVA 1TIUA 4L4VB 2FWOA 3PE9A 5C0AA 3QPXH 4FFVC 5HBBA 3CDFA 2ITCB 4RA0C 3LHPH 5DJDB 3GMPA 3E6HA 1U8NA 4ZUTA 4P5TD 1KV3A 2QQKL 1G9NH 5C0EB 5JOFA 1PY4A 5DJCA 4IRZH 3BP5A 2VDMH 1R0AH 3BVNB 2ICES 3DUUB 4MB4A 4NQCB 1G7JA 1HIMH 3OJ2C 2GKIA 1EAPB 5LVEA 3U7AA 2EDJA 2ZSVB 2FX9L 3MOQA 5AYQA 3VRJB 1S7XA 4M5ZH 5EWIH 4U6YA 1MFAH 4AEIL 4NQDE 1INEL 1DVFA 1X4YA 2VN7A 4NNYA 2VOTA 4OIAA 3A0OA 2E8ZA 1WEJH 4PJ9A 1LP9E 2VXTH 3HI5L 4RGND 5CILH 4DVBA 4PGDA 3D6GA 4TVPE 5F1IA 5GIRB 3U7WH 5DUPL 5HYQA 4G6JH 2EDRA 3C6LC 4YHIA 3TO2A 4HWEL 2WZPD 5BMFL 5CCKH 1DE4A 2D7QA 4MS8C 4FABH 5DRWA 4J3TA 2VZ3A 4X6BB 1GGIH 1V7NL 4P5MA 3MJ7B 2E7LC 1FL6A 5BS0B 1ZK9A 4YHLH 3JV4B 4M6NL 2AJ3A 4K9EL 4ZUSB 5KAQF 2ZOLA 4NQTA 3P9LB 5E5UB 1TLKA 3GI8L 5A40E 3C09B 5KVGL 1J8HA 1IZJA 4ALAL 3FZUC 2EO9A 5FYLH 1M71B 4HD9A 2ZUSA 4EIGB 3MZTA 5CP3H 3G6DL 1RUMH 2BCKA 2J8UA 5GPRA 1FE8L 3BGMA 1MFBH 4OKDA 1PYWB 4M8QB 1NFKA 5E6IB 3WLWD 4QTHA 5D7SL 2IBZX 5B4MC 4XPHL 3BMWA 1NDMB 4MWFB 1J9CT 4OZ4B 2VUOA 3WO4C 1ULVA 3QIBC 4G8GD 2NCMA 4K23L 4MVBD 3DMMC 1P4BH 4BH8B 5TF0A 1JI2A 4NKMB 5SWSD 3G6JB 1AKJA 1KCSH 2VIRA 4LP5A 1TDQA 4YBLB 5E2WH 5D1QD 2E9JA 3DV4A 4Y4FA 2ED7A 4JDZB 1T5WA 1I9EA 1RIHL 1O7VA 5J12C 2EECA 3QHZL 1B0RB 3B5HA 3U4EB 1XF4B 5DWUL 4HMDA 4U1HA 5GS2H 2R4RL 4YX2L 3QZWG 1YPZE 3E3QC 2W1NA 4ODTH 4M1CC 4PRBA 4YHNA 1RY7B 1M1SA 2L4OA 3QIBD 4ZFZA 4GRLC 3IYLW 3ULUF 4LCWE 1KB9J 2H32H 1AFVH 3FN9A 4XXCA 1EA9C 4S0SD 5ELIA 1ZHNA 4U1NA 2DL2A 1T20A 4EI5B 4YGVB 1DQDH 5I1HL 5HHNB 1QRKA 4WGVB 2ESVE 1QKZH 2A73B 4FTVB 4HBQA 1ZANL 4PRAB 4X9FA 4NZRL 4QRPB 1CD1B 4K7PX 3IU4H 1QBML 2HKHL 4FFWD 5IB2A 4K94H 3M1BA 2OSLA 4DJMA 5E70A 3QO0A 3UTTB 4PRHA 1U8PA 2B2XH 5FM5M 3NH7L 4LU5L 1XF1A 2J7LA 3BDYL 1KCLA 4IDJH 4HIJA 1IGFH 5IEHB 4P2RD 1QO3B 4M62L 5IW1A 1H8OA 1FNLA 3FQTA 4GAYB 3DV6B 3GMMA 4UTBH 3TT3L 2P5EA 1WICA 1Y0LB 1QBLH 2B7DT 2NW3B 2PXYA 1U8KB 4F7PB 4Z7OE 3G9AB 4IMLB 3Q0HA 3C2AH 4PJFB 5DC0A 1Q72H 4KJPC 5KVDH 1LEKA 3MCKB 4O5LL 4Y5YC 4R7NA 2C1PB 4X99A 1T04B 3QWOA 1CU4L 4HF5H 1AIFA 3O6FA 2ITDA 4NM8H 1JHLH 1T0MA 1G7JB 4KKAC 2HT2C 2HVKA 4ODHL 5F7YC 3BZEB 2FBJL 2MKLC 3SDCA 3GSXB 3W11C 5GZNC 4MLSA 1CN4A 1FFOB 4UUJB 2V2TA 1G7PB 5JW4N 2R0LH 1BJ1J 5D2LB 4F7MA 1FN4B 1JCKA 3E3QE 4E42B 4DGYL 3O6KL 1F11A 1DP0A 4NSKA 4LDEB 3X3FH 2ZUVA 4PJAB 4P5TA 4UT9L 3OKEB 4IBLT 3TV3H 4MCZA 5HHVH 3ZTNH 1DLHA 3AAZA 4XP1L 2GSIB 2LV4A 2NY7L 2BNRB 1K2DA 5IB5A 5DO2C 3EYVB 4PRDA 4RQQB 2OR7A 2FX7L 5BVJA 1F3RB 5DQ9A 4KJPD 5AEAA 2RCSH 5F70A 4R4NC 1PBYA 2DB8A 3PXHA 5FYKL 3ZTJG 1ACYL 15C8L 2XFXB 3V4UL 5K9KA 1UJ3B 4D3CH 1RZGB 5CZXC 2ADGB 4BZYA 5JLZB 1UWEH 1CDBA 5L7XH 1FV1B 1I7UB 1MQKL 4OQ1A 2EEBA 1JRHH 3RL2B 5FGCE 1M7IB 4PJXB 4XPGH 3N1PC 1MFCH 1FGVH 1ZGLP 4ZSOA 1AXTH 1P4IH 2HAZA 3ARED 1OGTB 1LEGA 2OK0L 1MRFL 1H5BA 3VJ6B 1PZUB 1UA6L 4GRMB 2WLYA 5HYEA 1V3JA 3UXFA 3KPTA 5KBNC 4U7MA 5BZWB 3D85A 3S34L 5J89A 2YMXL 4GS7C 1T0PB 1NGXB 1CG9A 4PJGA 3NIGF 3WHE0 2M8XA 3FMGL 5I18H 5JXAL 3VFTA 4UOW0 2ZOKB 1X5XA 2VDLH 2Q86B 4LLVB 4JGJA 3D3VA 5F7UA 1R3KB 4DVRH 3QRFM 5DTFB 5AYUH 3E0GA 4GRWH 2VJXA 2B39A 2MOVA 2VLKD 1U91A 2ICCA 2VH5L 4OLWH 1P84J 5F1SA 3DV4B 3ARVA 1I8MB 3ZKMC 1QSFD 5TDNA 2FEEL 1CLOL 5C0DA 4HPYH 5MEPA 3I3EA 4OJFL 1LO4L 1JNLL 1MPAL 5DRWB 5KS9B 2XQYK 2O5XL 2QLVB 1YEKL 1YMHB 5KW9H 2EC9T 2Y25A 4L9LA 3G04B 4MJIE 3S36L 5D7JA 3T09A 7FABL 2KL6A 5KG9B 3OHXB 1F3JB 5KVEH 5DD3H 1AGBB 3W39B 3QDJD 4PREB 3ZT6A 5GJSL 1S7WB 3NCMA 3MJ8A 4ZUUB 4U1IB 4FQXD 4HWBH 3NCCB 2BNQB 1WWAX 5D71H 3WUWG 2N7AA 4Y5VC 5FYJL 5F7KC 4YXLH 5DK0A 3FO9B 5BZDA 3UMTA 5EORH 2XN9E 4YXKH 2IEPA 4ELMF 4HIEA 2WUCH 5HGDB 4R4ND 2YK1L 4PV9A 4YPGA 5J7CC 4R90L 2VAAB 3PWPB 2CLRB 5F1NA 4WFGD 3IS0X 5MERB 3W9EA 3PGFL 2QSTA 3GM8A 4GAYA 4MJIA 1MCWM 4GG8A 4L8CB 1NGWA 1BBDL 3QHTC 3RIAF 4Z7QE 2FSEA 3P0YH 2RBLA 4YDIL 1JL8A 3H0TB 3U4BH 5B8CC 1JPFB 3TO4A 5JIPA 3LS4H 3RDTD 4TTDC 3S9DB 4BSVB 1FNAA 4PJEF 3VXUA 4ODWB 1YPZB 4YBQC 15C8H 5TGBA 3ISWA 2BZDA 5HI3D 3JV6A 5I74B 1U95A 5DUMH 1D6VL 4U6XB 3PGCA 3L5JA 2I5YL 3SDCB 4LGPB 3AROA 4X6FB 3NFNB 1L9MA 3U6RA 3UTSD 1KJMB 5C09A 4UQ3A 4FQCL 4P23B 4NDMA 1L9NA 5I8EB 4Y5XA 2PKDA 3ZKMD 3GJFH 1U3ZA 3EO0B 3FZUD 3EJYD 3LY6A 4NP4H 1WC7B 4FQXB 4URTB 3C5ZD 3CZFA 5I1DA 4L1DA 2RIKA 3O3EA 4Z78B 4DGVL 3Q2CA 3DIFB 2WSKA 3MUGB 4P3CL 4D9QE 5IJVA 1ZHKB 4JG0H 1NBQA 5IQ9B 1TTUA 4C56A 5DD3L 4YPJA 1JPTH 3BE1L 5I74C 2B4CC 4NO0A 4TULL 4MJ5B 3DVNB 4OZGE 4ZO6A 3UZVB 1YEDB 4XP6H 4WNQB 4OFVA 4MXQD 3S37L 3VXNA 1NGQL 3MJ9L 1F4HA 4EXPX 4X7TB 5JOPE 4KKCC 4OJFH 5GS0C 2HLAB 2V5TA 1CLOH 3KGRA 5E8DH 4QOKB 5HHQB 3ZE0E 4ZAKC 4WDIB 1N6UA 4JPIB 1DBBL 5FUZH 3Q1SH 1JGEB 3HPLB 4H26A 1HHKA 1JHTB 2PTTA 5I76B 3AGVA 1OTUD 3TA3C 3WBDA 3GMLA 5A16A 1OTUC 3TA3D 2NY5C 3D69A 3D48R 4CMHC 3MRHB 4WFHE 4YK4C 4HX1B 4OCWL 3G5YB 1S3KL 1NMAL 5IMLA 1QFUH 3OKNB 3GSRB 1D5XB 3O6FC 1RZKH 3IXAA 3LDBB 1MHEA 4XMPL 4ETQB 4BELD 3ULSA 1P4IL 3PJSB 4GUPA 4UILL 4YUEH 4PJBF 1OCWL 2ZWLT 3HZYB 2FIKA 3P11L 2GSIA 5I73C 4PGBA 4NPYA 2P49B 1BIIA 2R4SL 3ARDD 1OCWH 4D3CL 3QDJB 5GRJH 1MVFA 4DFIA 3INUH 3ZT5A 4YUEL 1GC1C 4POUB 3G04A 3NZ8A 5B3JE 4JFPA 4J23A 5J1TC 1I7TA 1AGDA 5IP4A 3F8UB 3GJEB 3LN9A 2HP4A 2FX7H 3KYKL 3I2CH 1N64H 5DWUH 3TNMA 3WSQL 3SKNA 4Q9QH 5DC9B 4DK6A 4LBEA 2V2XB 1ZGLB 1IKFL 3MGOA 2VLKE 2LTQB 4OZIB 1WFOA 5D5ME 2BVUA 1TZHA 2ADJA 3U9PL 1BF8A 1FAIL 1OD9A 4JFXB 2APXA 4W4NA 2X4OB 4M3KB 3VFWA 3PL6A 3AUVA 3V5HB 1YDPA 2EDDA 2Y9RT 4Y8DC 2X7LA 1IGYB 2OL3H 1NFDE 2VLRD 3IDUA 3O2DH 1RJLB 3NCJL 3U2SA 2I9TB 4UV4L 4E5XB 4C59B 3SE4A 1F4XL 2ICWI 3OAZK 3RY4A 3F58H 3MRBB 2W0PA 3D2UD 4XWGH 5C0NC 1MCRA 3QAZC 3FB5A 2YUZA 4G6KL 4OD1H 4AH2B 1JN6B 3IU3B 2COQA 2NY0D 3WHXB 5DJZB 3HCVB 2APTA 1BOGA 1CE6B 2ZJSH 3P4LA 2ZSWA 5HJ3A 5T5FH 3QCVH 1BFVL 3UP1A 1U58A 4M61A 3VWKB 5KS9E 2EEDA 3M17A 1QR1A 1A0QH 3MRRA 4Y5YB 1RHHB 2XG5A 2AJZB 2XTLA 4UTBL 4PJ5A 5C0JA 4Y0GA 4UV7L 3VXUB 2A6IB 3CZJA 2EZ0C 2WWMD 1MCOL 1A6WL 1RZ7L 5HDLA 1JTPA 5KJRH 1F58L 4FXGA 4JCMA 4LGRB 3IKCA 3T2PA 2DQJL 3N1QC 2VXQH 4MNHB 5SWZB 1WFUA 3FCTA 2BK8A 3ARGD 2PYFB 3DNKA 1BX2A 3TBYA 5C0ND 3U36A 3FQWB 5BJTA 1IJ9A 1N2RB 4FNLH 4LASL 2HVJA 4Y4HB 3GUTB 4YE4H 3MV7B 1D9KB 1T0NB 5ACZB 4HXAH 3KS0J 2H1PH 2I26N 4OZIF 1QQDB 2AEPL 4JHWH 1FNFA 2X89A 4QRRA 3UAJC 4WFED 5L9DH 4I3SH 1A22B 4DKAA 4E41E 3RWIB 2JTDA 4IRSB 3MNVA 2ED8A 3RA7H 1RUPH 2LAAA 4XHQA 5ISZE 1AQKL 3PGFH 1ZSDA 3GIVA 2ZCHL 1QFOA 1XCQA 1AO7A 2VSDA 4K71C 4I3GA 1MY7A 4GXUM 2C3HA 3S35X 2ZPKL 2QQKH 5EZIH 1T1YB 2FSEB 4JFDB 2HLAA 4DWHA 5JR1L 4D0CB 4HHAA 5E2WL 1OB1B 5LBSL 4F7TA 3KPQA 4JY4A 4QRUB 1GRWA 4OB5L 1MVUA 4TRPH 3SGEI 1FGNH 2HFEB 2ERJB 4YR6B 2YPLB 3U9UA 3PDOA 2F5BH 4N90D 5D1QB 4PIRF 5IFJA 3E6HB 2UZIL 3D69B 4LSUL 1CXIA 2X4TA 3VMNA 4Z7UB 3C8KA 4EEEA 1N8ZB 3QDMA 3WEXB 1HDMA 4GW5B 1XAUA 1FVCA 1JF6A 3QRGL 3W9DB 5I8CB 1MAJA 1KELH 2XTJE 4FFWC 2QADD 4KHXH 5ETUA 5DUBA 2DLGA 4M3JA 1DQQB 1K6QL 4OF5A 2DQGL 3UO1H 1OW0C 4C54A 5GISL 1L7IH 2FL5A 1S7XB 5AWNL 1Q9LA 4KKNA 4XMKH 3EHBC 4X5LA 2MTPA 1YEKH 5K59E 3IFOB 1VGKA 1XZ0B 1VACA 1MCFA 2AEQL 3UTOA 4ALAH 3BPLC 1HQ4B 3QI9B 4NOBA 4DUXA 3MA9L 4NUJB 2VH5H 3ULUC 5DGQA 1ACZA 5DJDA 1BJ8A 1KT2B 4XXDA 1NGZB 1NKRA 3ALPA 5TE6H 3X13B 4LSVH 2XI9A 4LAJH 5BS0A 1V7NH 1MCQA 3NFPA 4M6MH 3K4DA 5J12B 1C8PA 3ZE0F 3BH9A 1U3JA 2OL3B 3ZE2F 2ZZUT 2R0WH 2VZVA 2ZG2A 3IJYB 4EI5C 4KROB 4U1LB 5DURB 1NANI 4POYA 4XCYA 1MOEA 1T3FA 2A0LD 4ZOAA 5HDQH 5HD8C 1GXEA 5GRUL 4EI6A 4OGZA 4RX4D 3BGMB 3F12A 1D9KD 2D7TH 3NTCL 3WFZA 3EHBD 3FHQA 4MAYB 1FL5A 4L4VE 4UU9A 5F1IB 1ETZA 4WY7H 3Q5OA 3IU3A 3G5ZA 5C7XL 5FOBA 2AXFB 5KSAA 5LGHL 4F7CA 4HJJL 3O4LB 4NJ9L 3TVMA 1KCVL 4QT5A 2FX8L 3IFLL 4PJBA 4PJEB 1ZXQA 1P5VA 3ULSB 5B8CB 2JJTC 3B4NA 3HZVA 4XNQB 4BZ2L 2CKNA 4OQTA 4M61B 4OKVB 1IM3B 4NC1C 3VWKA 3BWAB 2VZ1A 5GRUH 3WIHA 2CDGA 1JPST 2V7NB 5H37H 5TE7H 1XR8A 5D7LE 4G8EB 4BH7A 4OGAC 2GI7A 1IMHC 3WFDL 3QWQB 4ORZC 4EN3D 2G5RA 3IFPA 2NXZD 4KPHH 4CU6A 1I7TB 1YQ2A 1VCAA 3BX7C 2DQUH 2KH2B 4MQXD 3MOAH 1F97A 4RMVA 1U8HB 4R4FL 5CHNA 3ROLA 1YY8B 5T33H 1QRNB 2O5YL 5JW4Q 2NY2C 5C08A 4X6CF 4NC1E 2FJFA 3MQIA 2HRLA 3MA9H 4JFEB 1IGTB 4V1DA 4OCXH 4Y16D 4P2YA 5GZOD 3MUHL 1X5JA 3VFNB 2GUOB 1D9KA 1T0NA 4M9OA 3RUGB 3MLYL 1P6FA 5FB8B 4LVNC 3GEWB 1PSKL 2P4AB 1A6ZA 5EBWA 5BRZA 2DQEH 2Y7QB 1DTUA 4RGMB 3RHWK 4JQVC 3ULUD 5JXEC 4WHTA 3TN0D 4DOHB 4K7PY 4IRSA 5HHNA 5IROC 2W0KA 1OAKH 1H3GA 4ONGH 5C0CB 5TPWH 4LSRH 1WWBX 5JW3L 4J8RB 3OJDA 5I17B 2HN7B 4K55A 3T4AA 5A43C 4NZTL 3M17B 1ZHLB 4MQ7B 3C6LA 2BC4B 3WFHB 5C9KA 1BD2B 2WINA 3TBSB 4F15B 2X4QB 5D7JC 3TWCH 3GMMB 3MYJB 3GSQA 3RAJH 2UYLA 1CTNA 1MCNA 3QDHA 1G6RL 3TIDB 3IRZA 4L8DA 5TDOA 2YD6A 5C0BE 2P44B 3ULUE 1E27A 3KVQA 2R0ZL 3BXNA 4WI4A 3MV8D 1YNLL 5LG1A 5J6GB 1VFBA 3P0VL 4P9HH 5H94B 4Q9CA 2ZCLL 2B1AH 3KPRD 2IPKA 3O3BB 4ZUWA 3NIFF 3RA7L 3PUCA 4LGSB 3U79A 3PDDA 2JJSC 4YX2H 1NL0H 4P9HL 1MNUL 2R1YB 4L1HA 4TSCH 4KY1L 4UUJA 5IG7B 3GMRA 4JY5L 3PWUB 3R4DA 1RURL 4HIJB 5IFHH 3OB8A 4EDWL 4KJWD 1WF5A 3IFNH 1NAKL 4GRLA 3TN0A 3Q6GL 2X05A 1VSCA 2DQIL 1S5HA 3RVWD 1T5WB 5TDPA 5BV7L 1NH6A 1KCSL 2LE9A 1ZSDB 1AJ7H 5D72L 3HAEG 3VXMD 1T7ZA 4R6UA 2D2OA 1T7YA 3MCKA 4G9DB 1FDLL 4GO6B 3NA4A 4RBPH 2C9AA 5BVJB 5IFAH 2UY6A 3QHFH 4UAOB 1OD7A 1EAJA 2GIYA 1JTTA 1JWSA 4P5KA 4FQLL 3UJTH 5J56B 1J87A 5JHLL 1NCWH 2HA1A 3KPSE 1SY6H 1MFEL 3KPLA 4F7TB 4OAWA 3PWVA 1ZA6B 3TO4C 5M94B 5I1AA 4Y19B 2A6DA 1L7TH 1ZHNB 5IOPB 2CR6A 2J6EL 1OARL 3NCYP 2WM0A 2J6EA 1J5OL 4OCXL 1SY6A 4QHMA 5ID1B 3FO1A 3MYZA 1XGPB 4JFFE 2JK5B 2P24A 2XNAA 3IT8D 1NAMH 1JNNH 2HT4C 4Z7WA 3JWOC 4KJYB 3LV3A 5JW4R 1NUNB 4YHLL 1KCUL 3OKOB 1UACH 4Y1AD 2XFXA 4LOUD 4CKVX 5C92A 3EO9H 2HJFB 4HWEH 3FOLA 1FAIH 4JR9H 4Y2DB 3UYRL 3LMJH 3U9PH 1AR2A 3OPZL 4I2XB 4PJ8A 4D94A 3GM0A 4A6YA 1MIEH 3WSQH 4H88H 4OUOA 3ZE2E 2Q3AA 1NL0L 4YGAB 2HTKD 1U8JB 3ROOB 4PJHE 2CRYA 1JPGA 4UINH 5F9JA 3BKJH 3TPKA 5GRJL 4LEXL 1DUZB 4XNYL 4XMLL 2EDKA 4PGZA 4PTTB 4KMLB 1UCBH 3CFEA 4BQ6A 5D2LA 4F7MB 1SYVA 2Q86A 4OF6A 4ORGB 1A6ZB 2PNDA 2CO7B 3MO1B 2CUHA 2K7QA 1G6RH 3NTCH 4YHKL 2X40A 1MLCB 5EC2B 5HDQL 3ECBB 2BVEA 3WLWC 1UKTA 3AAZB 1KIRA 4N90E 3TJHC 4Z7VA 4XH2A 5JZ7D 1CDHA 3ZKXC 4V2BA 4J1UB 1QOKA 4PRPB 3ULVL 3GI9L 4S2SA 1YN7B 3GDBA 4OCRL 4JVWA 5GSRB 3WNPA 1VFMA 4OGYH 3K0WA 4NYLA 3MRQB 1UJ3A 5CMAA 2GK0A 2MSPA 2CKBH 2P7TB 4HGKC 5D7LB 1PY9A 4HIIB 3CH8A 4HZLB 4LSRL 4OUUB 1MRDL 1HILA 2YBRB 4DCQA 2DOCA 3ZYIA 5FUZL 4OLXL 1LDPL 4RGOL 1UWXH 2W9EL 5GGRA 3PWPE 3L5WB 4MX7B 1U3HA 5DDHB 5LCVH 5KS9F 4LCCC 5D9SA 4Y1AB 5JIIA 1QTYT 4X6EA 1ZT1A 3BHBB 5EOQH 5DO2D 3JZ7A 3IDJB 2C26A 3S37H 5BZDB 1H5BB 1XR9A 5JQ6L 2RR3A 1RFDL 5DQDH 1CFQB 2ATKA 4NFDA 3HRZA 5BZWA 1HOCA 1XGRA 4UOJA 5K93A 4N8CH 4F7EB 2H6PA 4HUUA 3H9SE 2GW5A 5E2VL 4LAQL 4EBQL 2C4FT 2APWA 2ICWA 3RDTA 4P0DA 3VH8G 5BRZB 4NQCD 4GRLB 1BBJB 1NCDH 4MAYC 2E9IA 1IL1B 1A3RL 2R23B 4MJ6B 3ZHLA 3HI1B 1V8HA 5I16B 5SX4I 3O2WL 3B43A 3JTTA 3MLWH 4FQHA 4X9HA 1MF2H 4NQVA 3GBMH 1CZ8H 4KH2A 2DYPB 3UTSA 1LO3H 1U93A 1Y18A 3FHAA 4IOIB 5IQ9A 2PUQT 3I9GL 2KBGA 43C9B 2F54B 5KG9A 3SOBL 4KQ3L 4D2NA 2A6KA 1HEZB 4K8RC 4NQEB 3DBXB 5ESVB 4OLEA 5F89A 2I07A 4NBZB 4G42B 1T1ZA 4UI2A 3KJ4B 5C09B 3VCLB 4C56D 3ARXA 4OZGB 1BBDH 1RK1B 3WN5B 2AEPH 4JHWL 2YWZA 5I8EA 1KB9K 3Q3GB 5GHWH 3RWFB 4A6YH 5J6GA 3QUYC 2VLRE 3O11B 4LASH 4PRIA 1M7XA 5IJVB 1TCMA 4S11A 5F6IC 4WTZG 4QY8A 1BZ9B 3MRGA 4NKOB 3SE8H 4M6ML 2PXYD 2X9YA 1HN1A 2OR9H 4GRWB 2NW2A 4OZGF 1WBYB 3ARFC 1A6WH 5KJRL 5FYJH 1U8OA 1YYML 4NC2B 3QDAA 1QZ1A 3B3IA 2FEDC 2AKRA 4PLJD 3CUPB 3H0TA 4CGTA 2UWEA 1T1WA 4XZUA 1MJJA 1SJHB 2DQHH 5ILTH 5C0EA 3LRGA 3BP5B 4NKQB 2I9LA 3QEUB 4N0FB 4N0CD 4N0UB 4GW4B 3B2VL 4GBXD 5I6XB 1EVTC 3SCMC 3GIZL 3ZZ1A 5ACMA 1K6QH 3G08B 2F53B 2R2CA 3G5VA 5TQ2L 4KHXL 3SDXA 2O5XH 4QRRE 4G6KH 4OD1L 5J6HB 3V9FA 1I3GL 4Y19A 3SDCD 1SYVB 1A8JH 4WUUE 5HYJA 1GCFA 5IEKB 4M7LL 1V3KA 4NQDB 2GQHA 4O4YL 1J8KA 4OGXL 3S8WA 4U33A 3TA3B 2X7LB 4DVRL 1S9XA 3ARFD 1XGPA 5D5MB 3FMGH 3EYFA 1W2KT 2CKBB 1PG7X 1BPVA 1A6UH 1LK3H 5DI8A 2DLFH 3T1FB 1HZHH 4RZCB 4M9PA 5ECJE 2BSRA 1JF1A 3HNVL 4P57A 4Q9QL 3RPIB 1G7MA 3VMPA 3NPSC 5EU5B 3TJEH 3I2CL 4GJTB 3LSOB 5E03A 2IQ9H 5JOPD 5DVLA 2AGJH 3DJ9A 5FDWA 4X7TA 3V95A 2ITCA 3K81A 4UDTB 4HCRL 5L9DL 1YMME 2VZOA 2I60H 1TZHB 2XZQL 3FFCA 4X83A 1MCKA 1LE9A 3U0PB 2FJGA 3A67H 1DQMH 1CD9B 3HMXH 4P9MH 4JKPL 1Q38A 5FYKD 5FK9A 4YDVA 1P4LB 3LRSA 3KNBA 4ZYKB 1UYWH 3CU7A 3QISA 5IVXE 4F7EA 1CWVA 5T1KA 2G9HA 2QKIB 5L0QC 2DLHA 4YDKL 2BSTB 2N4IA 1N4XH 2DQJH 4J6RL 4NQXA 5D7IF 4G7VL 4GLRI 3TV3L 4KJQD 1AI1H 5FGSA 3UTTE 4KJQC 2BRRH 3PJSA 2VLJE 1RIVH 4PJ9C 4E41A 1WWWX 2X10A 5A3ID 3JVGA 5MI0C 1QR1B 1K4CB 4MA8L 4DZBB 1UM4L 3TFKD 1B0RA 2X4NB 4P5MB 4P4RA 3JWOH 4JO2H 2WQRA 5ALCH 2A6IA 3TT1H 4C58B 1NQBA 3BDBA 2LU7A 6FABL 4ZTPL 4EJ1C 4RA3A 1XGTA 1WT5C 5HHXL 4JO2L 1OSZA 2CRIA 4ZPVB 5C0RL 4JFZH 4BFIA 5DHXB 1IVLA 4F7PA 1JPTL 2AV7A 5E2JA 4I2XE 3MNZB 4MA8H 4NN5B 1HI6A 5DEFA 2VQ1B 3F7QA 3F58L 4WTWA 2NX5A 5DJYB 1SQ2N 5IB3B 3IVKB 4D0CA 1A9EB 5D7JD 3IGAA 5HY9B 2Z92A 3V0WH 5KSBE 1JPSH 1KXQE 5CD3B 5K9QG 1IM9D 2OZ4H 1T0MB 2FZ3B 1AGFB 1QG3A 3H3KA 3IDXH 4HMCA 1EEZB 3OZ9H 2DD8L 2V2TB 4GRWF 2MMXA 1TJIL 4OM0H 3D9AH 4EUPA 1QKZL 1T5XB 3RWHA 4I48A 3WS6C 4QXUL 3CFJA 2ICWJ 4PY8I 4F58H 3HMXA 5KSBA 3SJVB 3JTTB 2XZQH 2AJYL 2X1QA 2VMFA 5DZOA 5AZ2L 1GGCH 2WNGA 4UZGA 5L8JB 1BLNB 2QV2A 1XF4A 4OD3L 5DJAB 3KPQB 3SDDB 3O41B 2ARJA 5E5MB 2IQ9L 1JMXA 3K7UA 3ZDXF 4ZAKB 3RBGA 1E6OL 3RGHA 1A7PH 4KKLC 1KTKE 3HNVH 4ZXBD 5E6ZA 5J57B 4Y2OA 2FR4A 5F6IB 5FUOH 1B0WA 1A6UL 3G08A 2I07B 5MENB 3EYQD 1YEFL 1UB6B 4MXVF 5C09E 1MCLA 1CXKA 4LARL 4LHQB 4X4XA 1NFIB 5C0FA 4ENEC 2C7UB 1NDGA 4Q2ZA 4XVJH 1QSED 2FHFA 4KRLB 4O4YH 3VRLF 1QNZH 1JZ3A 4NSKB 4NQDA 4GSDH 5J3HD 4XBPB 5C09D 4OV5B 1KULA 2HFGH 2IFFL 3KXFE 4W4OA 5C0AE 4G6FB 1PZ5B 1R5VB 3FB6A 4XVSH 3M1BB 4GAFB 4GOSA 4MNGE 5E7FA 5TQ2H 3RI5F 1GHFH 4NQUA 2W9DH 1ETZB 1L0XA 5HHPA 5GS1C 1VENA 4M8VA 5HI3C 4QF1A 3VMOA 2R8SL 1BZ7A 1CICA 1JUFB 2G60L 5D7SH 3ZHKA 5C0BA 3K8KA 4BYHA 1G6RB 4AL8L 1OF2B 4F37K 4BFGA 3BGAA 1RUML 4P3CH 1WBXA 5KS9A 1YYMH 3LEXA 3N0PB 5FYKU 2ESVB 5A2IH 2XN9A 5GGQH 2MWCA 3GO1H 3QNYB 1FO0A 1JJUA 3OHXA 1HHGA 2HVKB 3B2UD 4P46A 1J1OH 2VDLL 1S7SB 1DR9A 1FNGA 2IC2A 4PR5B 5JXAH 1JNHB 1GGIL 3PF2A 2NY1B 3MLZH 4JO1L 3RKDC 3LEYH 3S4SB 1N3NB 1KPUB 1D5ZB 2GYSA 1XFPA 1A3QA 3V8OA 1F11B 1G84A 4JY6A 4JVUA 1U91B 2NY5L 3TA3A 3KHQA 1E4XH 4OFIA 3RBSA 3FO2B 3RWGA 1U92B 2IANE 3EGSB 2OJZL 4PUBL 5EU7C 4J7RA 4WO4D 1K8DA 4P4KC 3P4NB 5EBWB 4Z8FL 2F8XC 1FGVL 1X5LA 2MKWA 3V8CA 4M5ZL 1S9YB 3AU1A 5EO9A 1HHIA 1N5YH 4JFEE 2C3XA 2FX9H 4PD4K 2D7OA 1FG9C 5IKCA 2X6MA 2VKXA 3GSUB 5E5RB 1DL7L 4G8IB 4R7DB 1EEUA 5DLML 1I9IH 2JLLA 2V2WB 4JPVH 4FQIL 1IAIM 3TPUB 5EBGA 2OTWA 3MLWL 5LWYL 4UDUA 3V6BR 1EEYA 4RIRB 1MCBA 3O4LE 4YXKL 3U0PA 3ALWA 4R2GB 1D5BB 3H9SA 3U83A 3HPJB 3OAYK 1A14L 3RIFK 2YRZA 1NCDL 4QYOA 3D2UA 1A4JA 4NN6C 1Q0XH 2UYLB 3N1GC 2GUOA 4YXLL 5CJOL 1VA9A 3TBVA 5CD3A 3QBTB 1YEJL 4G9FD 1I85C 3SO3C 1S7QB 1ZT4B 3LOWA 1MJUL 4YHYC 2BNQD 3QG6B 5FOBB 5KSAB 2BSTA 2UVEA 3PWPA 3QIUC 1ES0B 2IANA 1RZJH 1HSAA 3V6OC 3E8UH 5TQ0H 2VLJB 4PJEA 4YIQA 4ODHH 4P23A 5EB9A 3GKWL 4NM8L 5L8KB 2DQDL 1G9ML 4JFFA 2MHAA 5KW9L 3KPRE 5FKAB 4S0TD 3UYPA 2P5WA 5JDSB 3H42L 1LDPH 1X3DA 2BJMH 3MA7A 4RGOH 2X4NA 1FFQA 3TN0B 1IC7H 4PB0H 2CO6B 3O41A 1QSFB 2ARJB 3MODH 4PJDB 4OLWL 3VXRA 2QSQA 5B3NA 2VLKA 1X5GA 3BGFB 1QBLL 3I6KA 3SKOA 3B83A 1WJ3A 4IHOA 4U6VL 3SE9L 1GZQB 3QCTH 3SGDI 5EUOB 3VXNB 2GTWA 4TPRH 1I9JL 3RKDD 3DROB 4MVBC 1P7KB 4GXVH 1QLRA 3MNZA 5DEFB 1Q9OA 3H7LA 5FHBH 1JYWA 4FFVD 2FNBA 3THML 5SX5K 5I8KH 3UJJL 2MPAH 5CWSA 3MBED 2ZP0T 3AXLB 3I6LE 1MJ7H 1X5KA 5EO1B 3VXMA 3RUGA 5IG7A 3MXVL 4G9FA 4FQXA 1RIUH 1SHMA 2NXZC 4OIBA 3WS3B 5I1GL 3G5YA 3ARUA 3B6SB 2G5BB 3ARDB 4MJ4A 5E9DB 4OCYH 4L4TE 2CLRA 5F1NB 2C1OB 3A6BL 3O45A 4KRNA 5E94A 1D5XA 5ID1A 3CFDB 1IC4H 3STBA 3HNTH 3CD4A 4JZJB 4NWTL 5B39B 2Y5TA 3V4PL 5C0BB 1I3RA 1DSFL 1OT2A 2DTSA 1H8SA 2R1XA 5HHQA 1S7TA 4NBYB 4P4KA 4YC2B 2AJVL 4QGTA 1GPOH 5E8PB 2BP3A 2XN9B 4NM4H 4X0KA 3L3DB 4HG4J 3HZMB 3O6KH 3QEGL 1ZE3C 4NKDA 4R9HA 2DQTH 4HGMA 2FO4B 4XP9H 4JKMA 1OGAA 2GJZA 5DJCB 1UC6A 3SPVB 3NA9H 5GRVK 4K23H 1CQKA 3MRNA 3VXSE 3L9RB 1X5FA 3C87A 4DQOH 3BT2L 1RUAL 4ERSH 4FZEH 2MQ0A 1WFTA 3W2DL 4D8PB 3MV8B 4H1LA 4QRQA 3KJ6H 3U0TA 5F88B 4F3FB 4Z7VE 2D7MA 3TZVA 2APFA 3ZKXB 4XPHH 3L3KB 1IEAA 4KZEH 4DKEH 5HYFA 1A1NA 4M02A 3QIWD 5HHPB 5E1AA 2V7HB 1CE1H 1LO0H 4JDVA 4CN1A 4JG1H 5CEZH 2WW8A 3GJEA 4MD4A 3T8XA 4JRYE 3U46B 3T77B 4FS0A 1ZLUK 1IT9H 3VXTA 3TPUA 3OGCA 4AK1A 4NHUB 4ZD3H 5CUSH 4ISVB 5C07E 5BS0D 4ODBD 4HIIA 4HZLA 1HHKB 1JHTA 2EH8L 1YDPB 4QO1A 4L29B 1AE6H 1GPOL 1KOAA 4YZFF 4G6JL 3IDGA 1QBBA 2Q3ZA 4PG9B 4JY5H 4NRXA 3VGFA 1HHGB 3KYOB 3HI5H 3QFJA 1BZQK 2EIZB 3BESR 3MO1A 1J0YA 3A6CH 3WUWB 4NO2B 3QJHA 2AQ2A 1GAFL 4UIKL 3AS0A 1FZKA 2PYFA 3E6FA 4NCDA 3MLPA 1IC4L 3TBYB 2JK5A 4ODTL 2V9TA 5ICZA 2P24B 1YNLH 3TZVC 1OHQA 5D1ZA 5IIEB 4N0RA 5IT2H 1UFUA 4X6CA 2HVJB 1HOCB 2IMMA 4PJBE 1HIML 3HE7B 5BVPL 1XCTA 3TVMD 1HH9B 3AC0A 3LDBC 3FO2A 3S96B 1P84K 1ORSA 1N0LA 2Z4QB 4MNGB 4PGBB 5EH1A 4WW2F 2NR6D 3NIGE 4NQSB 4PJCB 4RGNB 3VRIA 2JIXA 1RIHH 2XTJD 1DBKH 3TWCL 3I02A 4NN6B 1F02I 1KFAH 3R1GL 4UMGA 5FO9B 5CUSL 3MV9D 3F7YA 1UM6L 4LPYA 4QCIA 1HYRC 1CGYA 1I1AD 4MZ3A 3L5HA 3PHOA 1SYSA 4QRTA 4RBPK 5F93C 4QNPF 1FCCA 1P5UA 4GG6B 1N0XH 2F54A 4WI9A 1AH1A 4JFDA 4U6VH 2K3TA 1LWRA 3EOAB 1HINH 4LPTA 3QUYB 3JWDC 5J9PA 4GQ9H 3RVVC 3HFMH 4HUUB 5HDBE 1MWAH 5T3XD 4GMSH 2G75B 4PB0L 3C9NB 4W68A 2IADA 1WWCA 5J13B 4KZEL 3GNML 3H42H 3OF6A 4J3UA 3S3PA 1UM5H 4NQEE 1GVIA 1A1MA 4XPAH 4U1JB 3GKWH 2WANA 5DFVC 3RWFA 3QH3A 5JNYB 3LZFH 4B5EA 3FQUB 1KPVB 3SQOH 3RY5A 1SJEA 3KXFA 4CU7A 1KIRB 2VC2H 1YNTB 1PG7H 5CJ8A 1GZPA 5EZOL 1AR1D 5ACLA 4JM4L 5CBAA 4XB7A 3OKMB 3SBWC 4BQ9A 1H0DA 3I50H 1JI1A 1G0DA 2ADIB 2FL5B 4HK0B 1ND0A 3T2NH 4U49A 1ZEAH 3MV01 5ISZB 1ZLSH 1K4DA 5CJQH 5ESAB 1OWRM 2HLFD 2IBBA 3QIUA 4D9RD 3WFDH 3HR5A 1V7ML 4RNRA 4O51B 5F7HA 1OB1A 3QUXD 1DCLA 4JFDE 2VL4A 3MMEA 5GGRB 2VXTL 3EYUH 3B9VA 4NKDB 1KNOA 2UWEB 3FQXA 5JZ7C 1NPUA 4X7SH 1EPFA 5KAQG 4NWTH 4P2OA 3P30H 4P46C 2E6PA 1AIFB 4WEUD 3O2DA 4QXWA 3VWJA 2OL3A 5LGHH 5K9OA 3D39B 3NBNA 3BJ91 3FN3A 2H9GB 4XTRC 4J3WA 3VD7A 4QHLA 1N5YL 4XP5H 3GGWA 4YHZH 3BIAX 3SDXB 4GG6F 3OF6D 4Z8FH 2QR0B 2NZ9D 4AZ8A 1AKJB 3A6CL 4HDIA 1KTLA 1FNEB 1MJ7L 3LKNA 3EYUL 4LLWB 4IJ3B 4OFYA 2KKQA 1XIWD 4AG4L