4GKOA

Crystal structure of the calcium2+-bound human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
209
Chain Sequence
b'GVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig epsilon chain C region
publication title Ca2+-dependent Structural Changes in the B-cell Receptor CD23 Increase Its Affinity for Human Immunoglobulin E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA02
2W0LA 4L4VA 3IFPA 3R06A 3QIWB 2WP3O 1TETL 3DROA 3D69A 5DHVB 5E8DL 5J13C 3VI4F 2B0SL 4XBEL 5I19L 1HKLL 1G9MH 4PRNA 3IFPB 5DT1L 2J8UA 1AGCA 3WHE1 3W0WA 1NKRA 3DROB 3QRFM 2O61A 3L3IA 5IBTH 4MNHB 4NJ9L 4PRNB 3GZKA 4LLDB 3RKPA 3RVTC 4PP1C 4U1KA 3W0WB 1MCOH 5DWUH 4QTIL 3RVXD 4IHOA 1BQLH 3STLB 2PF6A 2AABL 5HDBE 3L3IB 3C5SA 3D18B 3PP4L 2R39A 4YPGB 3QG7L 2YSSA 1XF5A 3WHE0 4BUGA 4I18C 4W81A 4LVNC 4U1KB 4N0RA 1K85A 1CFSA 3RL1B 2Q8BH 3C5SB 1BIIA 1X5ZA 2UZIH 3QCVL 4GBXC 1MPAH 1LO2H 5EZLA 1UWGH 1BEYH 4NKIH 4CBPA 4U31A 3GM0A 5EOTB 5EA0H 2Q20A 4O2FA 4OFDA 2BZDA 1S8DA 1TIUA 3SHSA 1CGXA 2E9JA 4XP1L 4OZHF 1WZKA 3U1SH 2JF1A 3RUGF 4OM0L 1QZ1A 1A7NH 5DQDL 3NAAL 2ZWLT 1S8DB 2CD0A 3N06B 4KUCF 1OHQA 4N0YL 2QQNH 2F53B 2ZG2A 3GSNA 4ZPVA 2RAMA 2CIKB 5B3JE 1JPST 3ZKNC 4R8WH 4ZUVB 3PWPB 4YX2H 1WBYB 3RGHA 4IEFB 1KGCD 1LMKA 3GSNB 4LDOB 3CSGA 4AIZB 1BBDL 3DUHA 2HLAB 2HT4C 2PXYA 4ODSL 4EUPH 5CCKH 5DD6A 4F15B 1G1CA 1X5LA 3OXSA 4XPFH 3PL6B 3QI9C 3OKMA 4IM8A 5KOVC 3UDWA 4L8DA 3EHBD 4ALAL 2B1HH 5IMMB 1S7WB 1XIWD 4PRPB 5EOCJ 1U93A 4IRJA 3MLTB 4FFVC 5GJSH 4MXQD 5CBAA 1VESA 2UZYB 3OKMB 5C2BL 5J1AB 1XR8A 4L8DB 4X5WA 5I17A 2WBJA 2F5BH 4F7PA 1KF9B 3V2AR 4HJJH 1J8HB 1SQ2N 4IRJB 4QY8A 1T2QL 4Z7VB 5B39A 5CBAB 4YC2B 2Q7YB 2VNCA 3MMEB 3SDAC 4YHOH 2FEEL 3A6BH 1XR8B 1HNGA 4X5WB 5JW5A 2WBJB 4P23B 3QUMB 1AHWC 1S9WA 2H3NB 5BOPA 3QWRA 2HMID 5HVWA 1TVDA 3NPZB 3QIUC 4XB7A 2X1PA 5KVMC 3MV7E 4PG2A 3TZVA 5LVEA 4KTEL 5DD1L 3ARBA 4ERSH 5C0JA 2ATPA 4Z7NF 2W60A 4G8IA 3H9YA 5H8DA 2B4CL 1IM3A 2WUCH 2YRPA 1U3HA 4IBLT 5F7MC 4M7ZB 4EQ2A 5JW4N 2X4PA 5KVGH 2VDOL 4X80H 1U8NB 1KEGL 3VA2C 4TSAL 3O45A 1IM3B 3HNTL 1CQYA 1AQKH 4RA0C 5TF1H 4JHZA 5F21B 5B4MD 3G5YA 5TGBB 1YEGL 2BHZA 4Y1AA 5HHNB 4LBEA 3PXJA 4TVSa 3LPGA 2VDMH 3ZTNH 2NTFB 3CLFL 1UVQA 3KPMB 4Z8FH 3G5YB 5EWIH 1FL6A 2KQNA 4P59H 5AWNH 1FGVH 3BZDA 3QIBD 4JB9H 4M5YL 4QRPA 3KXFD 4XMLL 1AO7E 3W9DB 2FJGA 4J6RH 4GXUM 3GMOA 5BZDA 4QNPE 1U41A 1KCLA 1FL6B 3S36X 5I73C 4XXDB 3L7EA 5FA4A 5ISZB 3G9AB 4GSDH 1F4YH 4QRPB 4BKLA 3LS5H 1CDYA 5D7LD 3GMOB 5DTFB 5JQHC 5KS9A 5T3XE 5JIHA 4RX4D 1FZJA 3VXMD 1ZKAA 4QO1A 3Q6GL 1BD2D 2C9AA 4BKLB 5GS0H 3TO2B 5FFLA 2AJVH 3UAJD 2NX5D 2MCPL 4Q9QH 4OFKA 4CRPA 1FLRL 4O2CA 1NPUA 4NZRL 3KGRA 1NFIA 4Z7UB 3LQMA 2CGRH 3FQWB 4M48L 2PNDA 2BSRA 4UT7H 3BKYH 5J6HB 3V7AG 4PJDF 2P5EE 4M9OA 2QTEA 2H45A 1AGEA 3V6ZA 1JFQL 2PYEB 3FOMA 5FYKU 4N8CL 3KPQB 4D0CA 4KJPD 1H15B 3UTTE 4DKAA 2FBJH 4DFIA 5B38B 1QFWI 5CGYC 2ZSVB 1AGEB 1RIUL 1YN7A 5DVOA 1FIEA 3FOMB 1ULVA 2A6KA 8FABB 1OP9A 2IH3A 3GI9H 4ELKB 5A2LH 1ZK9A 2UY7A 4AH2A 1VEOA 1KIQA 3D3VB 3RI5F 1Q0YL 1T83C 1YN7B 3CH8A 3W2DH 4P48A 3QEQE 5I8OH 3ZT6A 3N1QC 3AC0A 1GJIA 3SGKA 4LPVA 4X4ZA 5E4EB 1MIEH 5JO5B 4L29B 3FTGB 2X9YA 3LS4L 4P9HL 1CFTB 2R2BB 1N64L 3PWVB 3CLEH 4HWBH 4DUXA 5FDYA 2GAZB 1B6DA 3K2UH 1MCFA 4DKFH 5IVXA 3H9SE 2EKSB 4NRZA 3GKWL 5GXBB 5B39G 1QFWH 3QWQB 1FYTD 3DGGB 2HA1A 5DK3A 4LP5A 1HHGB 1LDSA 4ONOA 4NC0B 4P46C 1DUYB 1K3ZA 4NRZB 2FX7H 1OTTC 4M43L 4YQXH 2XN9B 4M1GL 1DQTA 3B8SA 2WIIB 4PTTA 2BNRA 5IB1A 1A6AB 3UJJH 5ENWA 5DQJA 3UXFA 1S3KL 2EDXA 3SDYL 1FGNL 4XVSH 1E4WH 2OTWA 1V8HA 4ZAKD 3GJEA 2QADB 4JE4B 4JFZH 2IAMD 4LL9A 5F3HA 3U7WH 1FZMA 3QDJD 5I1DB 3O2VH 5IB1B 3GHEH 4M6NL 4Y16A 4Z18A 1LP9A 4QHUA 4F3FA 5JHLL 5DD0L 4IRSC 1JN6A 3J7HA 2YRZA 1U58B 4YGAB 2FATL 4OF0A 1BVLA 2YD4A 4X5LA 1NL0L 4WI3A 4I4WA 2P44B 4F3FB 3SO3C 3PWPD 3DUSA 3HMWH 2CDEA 1ZANH 4OIIL 5EIIA 5C0BA 1RUKL 5BQ7B 4UI2A 3WS3B 5IESH 4QYOA 1QR1B 3KDMA 2DLFH 4XBGA 1PFCA 4X4XA 4UNUA 3VFMA 5C07D 4ZFGL 5LGHH 5HDQH 3UJIL 3LKNA 3FN0H 5DJDB 4PRHD 3MACL 4XBGB 1D6EB 3W0WE 1N0XL 1U8HA 5J13B 4TTDD 4XH2B 3THMH 5FUZH 4PJGF 1RJYA 1RIHH 2GSGA 3KAAA 1IGCH 2ICES 1TLKA 4MX7A 4S0TD 3RWCA 4P3DA 3WEXA 3V4VL 3BW9B 4YHZL 1SEBB 3MCLH 4ODTH 3IU3A 3O6KH 3QUKA 3QXAA 4I18A 5GRXG 1TVHB 4MX7B 4DFHA 3F8UB 3AXLA 1YEHL 4OLYH 4OFYD 3FHAA 3PWUB 2R8SH 5JOFA 4UT9L 1ZWIA 3IU3B 1WAAA 3QUKB 3EJZC 4N5ED 1A1NB 3W5MA 2Y9RT 4I18B 4GKSA 1D5XB 4LVNB 5SX4I 3AXLB 5I8EB 4UILL 5JOFB 1U42A 1JP5A 4GBXB 4WFGD 1ZWIB 4E41A 2D0FA 3V7AE 3D85A 4OUUA 1CE6B 5C70A 4PLOB 5E2VL 3V52L 1WT5C 5D2LA 4JM2C 3L5XL 5HBBA 2RJMA 5FCUL 1DQJA 4E41B 4HXAH 2CK0L 4PRBA 4AL8L 5CGMA 2EYTA 1YMMA 3D85B 4OUUB 5TFSH 3MC0A 5CIPA 3BPOC 4XPAL 5F7HA 4NKQB 2FJFA 4BK5A 4DGIH 1NFKA 3GSXA 1CL7H 2G9HA 4QRQB 1JZ2A 2IFFH 3VXUD 4WUKH 1YMMB 2CKBB 2DMBA 5CIPB 2FJFB 3OKKA 4HXBH 2C3HA 4G3YH 1AD0A 1ZLSL 3FRPG 4PRIB 3CX5J 1FH5L 4RWYH 4J8RB 3VW3H 5EFIB 3U7AA 4RAUB 3FMGL 4MXWH 4UMGA 5IW6B 4HK3J 2EE3A 5K59E 3HAEB 3MLZL 3L3KB 3VD9A 4F33A 1HH9B 2YC1A 2I07B 4I3RL 1EHLH 3ZHKA 1OB1B 4LCWB 2EH8H 5A2FA 5JXED 5I16A 2R4SH 3QI9B 5F1OB 4CN4A 1T0PB 2GTZB 5E2JA 2YC1B 5MP6L 3OQ3B 5I16B 3OKNB 3V9FA 2D2OA 4UNTA 4FZ8H 1F6AA 3SDAA 1J87A 3BZ4A 3MJ8A 1OP5H 5GZOC 3GIZL 3NACL 3MLRL 1NCDL 3K8LA 1X5GA 1IGMH 4LAQL 2XRAL 3GM8A 3IDYC 3EO0B 3V6OE 1WZMA 3PHSA 4FTVA 4PJXA 1OWWA 1J1PL 3TJEH 3SDAB 5ID1A 5K9OA 4ODUA 1UB5A 1WEJL 3A6CL 2W0FA 3H3PH 3TA3A 2VDKH 1UCBH 2F5AL 4WEUD 1AHWB 1XGRA 4JO4L 1SMOA 1CDHA 3BT2L 1YJDH 4R90L 3C5ZC 3QIUB 3GBLA 5E9DB 4PJXB 4CU8A 2CDGA 3MO1A 1NCAL 4ODUB 4TTGA 1UB5B 4P5MB 2PYED 3HZMB 5F6HI 5JORA 4HDIA 5GGRA 4FABH 4YHKL 1W0VB 1CR9L 1I9JH 4PGEB 1CK0L 2SEBB 3HC0A 3MO1B 1T22B 4TNWF 5HI3C 4UAOC 4D0DA 1U8OA 4D3CL 4G80B 5C0EA 2RIKA 4C56D 1UM4H 3OAUH 5IK3B 4H8WC 3QISA 4Y1AE 3HI5L 2BOCA 2Y72A 4D9RE 1KG0A 1WBZB 1ZA6A 2ZNXA 5E6IA 5FYLH 4UIKL 4WNQB 5C0EB 4WHTB 4JO2H 4QRRA 3SY0B 3ARGC 2WMPA 1IC1A 4LQFL 4M1CD 4ZFZB 5ISZE 2BOCB 4QRPE 3OJMB 4ELMF 5I30H 3HNVH 3RZWA 1KG0B 3V5DB 1ZA6B 3U46A 5CJOH 1BAFH 4PB0L 4BQ6A 4QRRB 3BZEA 5IB2A 2X7LA 2Z92A 4DAGL 3IJSA 3GFUA 2G75B 4MAYD 5KS9E 5I73B 6CGTA 3EOTH 2X7LB 1QFPA 2VLJA 1JGDA 3BN9D 4Z7UE 5D6CA 2C5DC 3RWIA 1WK0A 1I85C 2CLVA 1RHHB 3EYFA 1P69B 3MGTA 3MXWL 5I1IL 4XMPL 2ESVD 1F11A 1IC4H 5D93C 1OTUD 3ZKSD 3RWIB 1OY3B 1SJVA 2NW2A 2GITA 2NXYC 3MJ9L 1K2DB 1F4AA 4OFPA 1F11B 2BFVH 5JXAH 5GGTH 5HYJA 3HR6A 4APQD 1NFDF 3MLYL 5FGCE 4LHUD 3NZHH 15C8L 4UQ2A 4ZNCD 5HDLA 5HJ3A 1AKJA 3D3VE 2AXFB 2FSEB 4XCFL 4NUJB 5EBMA 4IOIB 5DMIL 3PWNB 3QPXL 1I7ZB 1RURL 4UQ2B 1JHKH 2DQCH 1ZHBA 5HJ3B 5IROC 3H3KA 1AC6A 2XZCH 1XGQA 4XC3H 4ZDHB 3HAEG 4TPRL 3EO9H 2GI7A 4QWWD 4KVCL 2HH0H 4OLEA 1OP5K 4LSSL 2YD1A 3T0WA 1ZHBB 4QOKB 3ETBF 2XTLA 5D2NA 1YY8B 5FUCE 4OQTA 2XWBA 4Q9CA 3QEHA 1A4JB 5ECJE 3SKNB 1F6LL 4NHCL 3GNMH 2ARJA 2BVEA 1ETZB 1WICA 1DSFH 4A6YL 4JR9L 1R3KB 1FVCA 4EQ3A 3QEHB 2AGJL 2H32A 3FQNA 4L1DA 2EIZB 5K9JH 1G0DA 3CVHA 5HHOA 1A3RH 1KUMA 2OJZH 3MXVL 4XP5H 2XN9E 2P5WA 1AIFB 4WFHE 3MA9L 3UYPA 2LTQC 4IRZL 4MCZA 3X3FL 1S9VB 2ARWA 2H32B 2EDJA 1GXEA 4P46A 3CVHB 3UEZA 5F71A 4DN4L 2FGWL 5L6YH 5T3ZL 4CDHA 2P5WB 4JHAL 4I0PA 1EEZA 2BNRE 4J4PD 2IG2H 4L3EB 4MWFB 3LN9A 1TZGH 1JF5A 1MCRA 5FUOH 5LGJA 5T33H 3V0WL 4ZO7A 4UV4H 1GGUA 4A6YA 1L4IA 3ES6B 4QEGA 4YHYC 2RFXA 4NZDA 4YAQA 3ZDZE 1T21A 2VLKA 1Q0XL 4IRSA 1QSEB 1MJJA 1UKTA 2HFGH 1QA9B 3M8OL 1G6VK 1MRDH 1DN2A 1GZPB 3F7RA 5AUMA 4YHNA 2IALB 1KLUB 1B90A 1IBGH 3L3GB 3FQUB 1UFUA 1T21B 5DQ9B 3KYOA 4O02H 4IRSB 1ADQL 3HMXA 1UZ6F 2MQ0A 2IH1B 1G7MA 4K71C 3SO5A 1JMXA 2VSDA 4YHNB 4K7PH 2KZ1B 2EE2A 2DKSA 4HUNB 3SO3B 3DMMC 1S7RB 4Z9KB 4XMKL 4URTB 1JNNL 1G7MB 2HG5A 4KMTH 3FFDA 3VXRD 3GSWA 4M93C 1G1YA 2MQCA 3REVA 3SQOH 4X8JA 5HPOA 3MJ7A 3IAPA 1DE4A 3FT4A 1MH5A 3VE0B 4FZEL 1JTPA 4WW1A 3FFDB 1QRND 3C08H 1QD0A 4J3TA 4PY8J 4RIRA 4QRSB 4JQVA 1OCWL 4O4YL 3INUL 1AY1L 5CWSB 1IL1A 3F7VA 1MH5B 4NQVB 3U36A 3L95A 3GI8H 2OXGA 4JANA 3NH7H 4WW1B 5C7XL 2IBZX 5GS0D 2HLFD 4JPWH 3KPRA 1I8KA 3LB6D 4S1RL 3WIIH 3F7VB 1WAAE 3L95B 1EJOL 4X7EC 1NBZA 4LSUL 4NPYB 4E5XA 1UCTA 4JANB 4Z0BL 1RULH 1BFOA 1PLGH 1R3LB 2BRQA 3R1GL 4FQXC 1N0LA 5D1ZC 5HHVL 4W4OA 3KPRB 4E41E 4OZGB 1NBZB 2MSPA 4E5XB 1BFOB 1QBLH 1IZKA 4XWOD 3WKMH 1IM9D 3IJYA 5HI4D 3OKOB 5GPRA 1YMME 1KB5H 5GS1C 1J9CT 2QBWA 5TQ0H 1MLBA 1KXQE 4JM2B 3MRJA 3BP4B 1G7PB 1MEXL 3GMRA 2IF7A 2BVOB 4PRIE 3AMLA 3IJYB 4B7LA 4Z95L 1HINL 1C5CH 5FYKH 3BPOB 1K9TA 1MI5B 2GK0B 4UDTB 1Z9LA 5F8RC 1P4BH 3UYRL 5JPMA 2V5RA 1IAKB 1ZVSB 5GRYA 4LCWE 1W0YT 2EZ0D 2XZAL 2AK4D 2F19L 1VCAA 4ENEC 5JPMB 2BSTA 1WTLA 3QCTL 1KCRH 3WFHA 3ULUF 3BXNA 4DVBB 3WO4C 1TETH 2B0SH 5ALCL 4XBEH 5I19H 1HKLH 1JCKA 4Y88A 3NCEB 3MLSL 2O5XL 5DT1H 4Y4KC 3CC5A 4N9GA 1CGWA 3ROOA 3IGAA 5I1AA 3B9KB 1FRGL 1NCUA 2Z8SA 5DRWA 1U3YA 3NIGF 4NJ9H 3IAGC 4OZHA 5E9DE 4PJXE 4FTVE 3RUGA 2IMMA 4GRLD 4QTIH 3RPKA 4GW1A 4ZD3L 4LQ1A 2AABH 1TZHA 3PP4H 1SEQL 3IDYB 3QG7H 4LLWA 4P2QA 4UDUA 3MOBL 3RA7L 3B3IA 3RUGB 4GW1B 1RUPL 5F44A 3L3OB 1IGTB 1REIA 3QCVH 4LLWB 5EBLA 1X4ZA 4WGVB 3C5ZB 4P2QB 2QQKL 2VKXA 1EK3A 1JE6A 1S7QB 4CADA 1EO7A 1ZXQA 1YEFL 3ZE0E 5IJVB 1I9RL 3S3JA 2DICA 2X40A 5EBLB 1MCKA 4XP1H 2WV3A 4HWZA 5DQDH 3NAAH 4LEXL 4UAOB 1S7VA 3S3SA 4U1LA 2K7PA 1HWGB 2FEEI 4N0YH 3ARGA 4QRRE 3RY4A 1MCEA 4HWZB 3DGCR 2VISB 4NFCA 3BAEL 4UIMA 4OZIB 3ARWA 3C8DA 4JG1L 3BWAA 4JFDD 4U1LB 2BC4B 2PO6C 1BBDH 5SX5H 3WDJA 3QDGD 4HX1A 4ODSH 3D0VA 1R24A 1EFXA 1X6NA 3LD8C 3WLWD 5JZ7C 3TV3L 1I7RA 2X4TB 3B2UD 1FQ9C 2FIKA 3BD3A 4K55A 2NZ9C 5CP7B 2XXMB 3DJ9A 4HX1B 3KVQA 2VLJE 4OD3L 4ALAH 3O8XA 5KSUA 4KDVA 3GBNL 1SYSB 1I85A 2C7UA 1Y6NR 4P4RA 3WN5A 4NQCA 4K9EL 4PRAA 4HIXL 1IAMA 4AK1A 5KSUB 4LKXA 4H26B 4L3CA 3UTOA 4CGTA 1T2QH 3U2SA 1I75A 4EEEA 5LJYH 4NQCB 4PRAB 3GSOA 1AD9B 3AAZB 3FOLA 1V5JA 5D93B 4LKXB 2C3XA 3FO1B 4JN1L 1FNFA 2GCYA 4Y2DC 3SGJA 3GMQB 5EOQL 4MAUL 2QL1A 3U2SB 3MODL 2NXYB 1LO3L 1UJ3C 4KTEH 5DD1H 3L5WA 4LCCC 3JV4A 4LSQL 1HHIB 4WO4B 1A6UL 4JRXD 5HGDA 4Y5XB 1KJ2B 3DIFB 4L8SC 3SE3C 1C5BL 5MEPB 4ZXBD 4GXVL 2DJ4A 1T3FA 2B4CH 4UINL 3JV4B 3MRCA 1P7QB 1GL4B 4NO0B 3W11C 4DVRL 2VDOH 2ZCHL 2BY0A 1VA9A 5LBSL 3T2OA 1KEGH 4PY7B 1T3FB 4TSAH 2H2PC 3HNTH 5D2NE 4HGWB 3MRCB 3WD5L 4WV1C 3BSZL 1OTSD 1DUZA 5DJAA 5GZNC 3ZKXC 5MENA 5C92A 1YEGH 3UTQA 4JFED 3QPQC 4J3OC 3OG4B 5GRZA 3CLFH 1X44A 2Z91B 3DWTA 3KLSA 4PIRF 3QNZB 3PIQB 4M5YH 4QRTB 1AC0A 4MQ7A 4NQDD 5HHOE 4RQQB 4Y4HD 5JIIA 4XMLH 5MHSD 2P5WE 3VXSB 3U0PB 2DB8A 3FN9A 3N1FC 1F2XK 5CBEA 1RZJC 1OD9A 3PF2A 1NUGA 1BREA 4L3EE 4PJDA 1ERNA 4MQ7B 3IJHA 2Q1EA 2LTQB 5CSGA 1ITCA 1RZFL 5DGQA 3T4YB 1YPZB 1EX0A 4YGVB 3Q6GH 1MCPH 1VGEL 1QSEE 3IJHB 3T77A 3WXVL 4F8QA 2ADIA 2MCPH 4NDMA 4QHMB 1FLRH 3LQZA 5DA4A 2GUOB 2VLKE 4NZRH 3RZCA 3RWDA 3RWJB 2BNQA 1PG7X 4M48H 5BJTA 1KB5B 4YHYB 1FV1A 1JHTA 1T03L 3I6KA 4NDMB 3B2VL 1SJHB 4WDIA 4R4ND 4PYGA 5SWSB 2ZUWA 5FO8B 3OKLB 3NA9L 4PV8A 1JFQH 4IDLA 4N8CH 4FQPA 3GO1L 3IT8D 4YXLL 1DCLA 3QUYB 1JHTB 4WW2F 3EOBA 4P4KD 4D0BB 3NTCL 4WDIB 3EOAA 5FYLD 1RIUH 2R0ZL 4K3EL 3LIZL 4K71B 1EBPA 3W81A 2FRGP 5E1AA 1D5MA 2K3TA 1MQKL 1KSRA 4F8TA 3M1BA 3DMMB 1Q9OA 5JDSB 1Q0YH 1RZKC 4JRYA 1FL3A 3U6RA 3GB7A 4M93B 3VWKB 1J0ZA 3CFIC 1D5MB 1ZLUH 3TH3T 2BJML 2BK8A 3M1BB 5FDWA 4BQ8A 2ATKB 3VRJA 4PTUA 1R3JB 4CMHC 2QSCL 3LS4H 3BP6A 4P9HH 3RGVD 4JKKA 2C4FU 3SKUD 3B9KD 1N64H 4D9QE 3KPRE 3MCKB 1KNOA 1JPFB 1WIOA 4OZGE 5DJCA 2YN5A 4P5TD 1VENA 3P9MA 5D1ZA 1AQDA 1YEEL 5FIEA 2YPLB 1F3RB 3GKWH 3O3UN 4U6YA 2J12B 5L2JB 2KQMA 3OAYK 3FT3A 5GRUL 2DF3A 3RDTC 3JTTA 1F8TL 3IDGB 4HS3A 3JWNC 5D1ZB 4FQXB 5IF0A 3KLHC 3QDMD 2IEPA 4G5ZL 4M43H 2FO4A 3DUUA 4EI5A 1BLNB 4TVPE 3FT3B 2I24N 4X7SL 5HYQA 1MI5E 1S3KH 3FJTA 3SDYH 1FGNH 5IF0B 1H3GA 4WTZG 2BVYA 5DI8A 3BISA 4XNUL 5HHQA 2P46B 3VI4E 3ULVL 43CAA 2XFXA 3DUUB 2I9TA 2A0LD 3PNWB 3I3EA 3BPLC 3A67H 1Y18A 4GRMB 4M62L 1MHCA 1JF1B 5GS1B 2OSLB 4M6NH 2Y36L 1MRCL 1KFAL 1FZOB 5JHLH 2RQ8A 4HUXA 4PJGA 2XFXB 5DD0H 4NKOB 2I9TB 3RPIA 1OAKL 1CDJA 4QGYA 1MHCB 2FATH 3SCMA 5TE6L 3QCUL 2DIBA 1NL0H 2YZ8A 3QSKB 1JUFB 2BP3A 4GLRH 4CNIA 5AG8A 4OIIH 1RUKH 1R3HA 2H8PA 1NAKL 4NT6B 4Y5YC 1SY6A 3LCYA 2Q6WB 2AKRA 3BQUD 5ITBL 3TJHC 4ZFGH 4JG0L 3RX8A 3UJIH 4Y4KA 3JUYA 1LO4L 3WO4B 3MACH 2XTJD 2MQ3A 3VMPA 2OLDA 1N0XH 1E27A 3ISWA 2ZUYA 4HAGA 5T1KB 4POZD 3I3DA 2P5ED 3LAFA 1J05B 4Y4KB 3RUGE 5F3BB 1MFAL 3UTTD 3V4VH 1E27B 4YHZH 1WTGT 2B7DT 4MZ3A 5E4IA 4XRCA 4JDZA 3MV01 2A74A 2E9BA 1BF2A 2V5YA 3MUY1 4P2QE 4S1DD 2C26A 4N8PA 4POUB 1OPGL 4XC1L 4XZUA 1YEHH 5C0IB 5IFJA 2AJUL 1WF5A 3CMOL 5INDB 4UT9H 3RVVD 4MA1C 5JA9A 3UC0L 2A74B 4XAWL 1CFBA 3QEQD 5C3LD 4UILH 3TN0C 2WIMA 2HVKB 1P53A 2IWGA 4WO4D 5DO2D 3VGFA 3PQYD 3O0RL 1ZLUK 2UYLA 3M45A 4HV8B 2EH7L 2O5YL 5E2VH 1CFQB 1FORL 1WVZA 4WGWB 3V52H 4PJFB 4OZIE 2NY5L 3L5XH 3UPAA 4IOSD 5FCUH 1VKXB 1P7QD 3IKCB 4KKNA 4PD4K 2CK0H 4AL8H 4N5UA 4XPAH 4FQIL 2UYLB 3SDCC 3MFFA 3BYTA 3C60C 3I6GA 3I3BA 5HHPA 1NEZB 1CICC 3H9SD 5C6PB 1IVLA 1QKZL 3PGCA 3J8F7 1UT9A 5I75C 3I6GB 4LVOC 1NKOA 4M6AA 1ZLSH 4OM1L 1EHNA 2YD3A 3P0GB 3U30C 2PO6B 3PGCB 5B21A 1FH5H 3BP5B 4LMQE 1ZOXA 4X0KA 3QUZC 4ODXA 4AIXA 3FMGH 1OGAB 4HEME 3WKNA 3MLZH 3EIFA 3LD8B 4I3RH 1T66C 3LN4A 1F4XL 3IXTB 4ZMAT 3WIFB 5IQ9A 4MJID 3WV0A 1GC1C 4NQCE 1N5AA 2FX9L 4KJYA 3MFGB 5MP6H 2X10A 4NO5B 3TVMD 1CTNA 1J8KA 2FL5A 1AXTL 1JNHB 3ZE2F 5BZWA 3IDJA 1LK2B 4R7NA 5C71A 1C7SA 5DJ6A 4JZNA 1N5AB 4NM4L 2OMBA 4KJYB 3GIZH 1OLZA 3NACH 3MLRH 1NCDH 4Y2DA 3SE4C 5EIQA 4LAQH 2XRAH 4GW4B 1V7NL 2FWOA 1YN6A 3TWCL 4DQOL 5BV7L 1J1PH 3N1GC 4L4VD 4RCAA 2C1OA 1NC2D 1T1YA 1UJ3A 2B5IC 3CD4A 1WEJH 3A6CH 4OSUH 3ROLA 2A83A 2F5AH 4HUUA 4Y2DB 4JO4H 3BT2H 3X14B 3G5VA 4R90H 1YN6B 1YEJL 3SE3A 2Q76A 2C1OB 1NCAH 3VGDA 4LCCB 5FYKD 4ELMA 2A83B 1QEWB 3HTLX 2XY1A 4HUUB 4IOFC 1QSVA 2R2CA 3QUYD 1T2XA 4YHKH 3I2CL 1CR9H 4NYLA 2YKLL 3WUWB 4DN3L 4L8SB 2VOTA 1CK0H 4KZDL 2JCCB 2WP3T 3ZL4H 2AXHA 2VZTA 4P99A 4JKWA 4WV1A 5CAYB 4XCNA 4QLRA 3MUJA 4D3CH 3HE6B 4NYLB 1Q8MA 1TTGA 1EPFA 1NJ9A 1A47A 2DMCA 2K9UA 3HI5H 4HK3N 4KKBD 3GUTA 1NAML 3HPJA 1MY5A 5C2UB 4WV1B 1RY7B 4ZOCA 3BGMA 3VXSE 3OMZA 4XCNB 3VWKD 5EU3B 3ZKXB 4OLXL 4UIKH 4U1HA 3DYMA 4TUOA 4AEIL 5E70A 1NJ9B 4LQFH 1YQVL 2HT3D 3IS1X 5K9KA 3PJSA 5DC4B 4FG6D 3CSYB 4Q2ZA 4YHIA 2BVUA 5T1LA 4H5SB 4PB0H 3MV8A 3MRRA 1JBJA 1X5XA 1YPZE 2VKWA 1AH1A 1IEBA 4HJ0D 4PJDE 5J11C 1GAFL 4DAGH 1ODAA 2LQRA 3CVIL 1OSZB 2FECL 5T1LB 2VAAA 4YEEA 4N8VB 3MV8B 1S7SB 3KYKL 5J57B 1INDL 1U3ZA 3WJLC 1KYOJ 5ETUA 1ES0A 1V3JA 2IBBA 4HUVA 2FZ3B 3BUYA 3MLVL 2NY4D 2ZOLB 4U2YA 5CEZE 1QFWM 2D0GA 1ES0B 3MXWH 4LGPB 5SWSE 5I1IH 1H3WM 4GW5B 4KRPD 4XMPH 1UM5L 4M7KL 2PXYD 2BNQE 4HC1L 3G08B 5KVEL 3GSRA 1Z9MA 1I9IL 2DYPB 4KQ4L 3QFJA 4JY5L 3MROA 1CFVL 4O2EB 2ZNWA 1A9BB 5IM7A 1H8NA 3MJ9H 4XVJL 3HG1A 5DJXA 3VFUB 4OFVA 5T5FL 3T0DA 4NFBA 1IC7L 2DWDA 3FL7A 4QTHA 1NEZG 3MLYH 3RY5A 1OL0A 1F00I 5F7EL 1N6UA 4DGVL 15C8H 3VI3F 1UKQA 2KDGA 2PYFA 4XCFH 4DCQB 4KMLB 3LQAC 5DMIH 1RJLB 5EZOL 1I8LA 3QPXH 1RURH 1RK1A 2XA8L 5DHYA 3WNKA 5D7KD 1D5IL 4HEPG 3HC4L 2F15A 1C12A 2PYFB 4X8XA 3UYOD 4DEPC 2VH5L 2N56A 4FQHA 4JRYE 4TPRH 1NGZA 3RAJL 1J11A 1IFHL 3C09C 3P77A 1XGPB 3QWRD 4KVCH 1D6VL 4LSSH 2IANA 4NQEA 1CGSL 2J88L 3TZVD 4FQHB 4F7EB 1ACYL 2UWEF 3TM6A 2K1MA 4G7VL 1G7HA 1A2YA 5BS0A 3ARBD 4NHCH 4DOHB 3AS3A 5A3IC 2YPLE 5T1KD 1F02I 2XNAA 4JGJA 4CMHB 3QEUA 4KU1A 4A6YH 4JR9H 3PUCA 3DNKA 1JWSA 2AGJH 4OQ1A 1G7HB 1KJMA 1U3HD 2DI8A 3PHOA 3ELAT 1EZVX 2VN7A 3MXVH 3LN5A 3MA9H 5IB4A 5D72L 4IRZH 3KWWB 3X3FH 4AEFA 5D1XC 4F37K 4FFZL 2BVQA 3F62A 3AFLA 1KB9K 2AJ3A 5L0QB 4DN4H 2FGWH 4OZ4B 4Y1AD 5T3ZH 4XB8A 4JHAH 1DANU 2AJSL 3RDTB 3WBDA 5IKCB 4LCIL 3SPVA 4YLQT 5HXMA 3WUWG 3X13A 4C83B 3O3DB 2BXYA 5EO1A 1WUNT 4HIHA 3V0WH 3EYQD 1U8LA 4HIJB 3QG6A 4YHML 3SDXB 4Y89A 1Q0XH 4PJGE 5FM4A 3M8OH 4HIHB 1IGYB 5I9QC 4WWKC 1LO5A 2OL3B 4JFHD 4P57A 4ZFFA 2X4OA 3F12B 4JFFA 1PSKL 1ADQH 4MS8D 3MA7A 1ZGLA 2FJHA 4Y5YA 4GG8A 4YR6A 1AJ7L 1MCLA 1HSAA 4P57B 5DEFA 3JWOC 4WIQA 1KIPA 2G2RA 3MRFA 5CHNA 4XMKH 1JNNH 1MRFL 3MA7B 4YDVA 2FJHB 4GG8B 1BZ7A 12E8L 1M05B 4QCIB 3K8KA 1HSAB 3DRTB 3ZKMC 5DEFB 4NKDA 5ICXA 4PJ8C 2G2RB 3WHXB 1QLFB 3MRFB 3VXQA 4FZEH 5CKAA 2Z4QB 3ZYIA 1BZ7B 1ZHLA 4DK3A 4OI9A 1TTFA 3DTXA 4O4YH 1OCWH 4RGNE 4LFHG 3INUH 5HHMB 1AY1H 5FO9A 3ULUL 2HJFA 2IC2A 5C7XH 4HKBB 5FKPA 5GJTL 1UM6L 2WWMD 3DTXB 3K3QA 3P4NA 2NY6D 2KKQA 4S1RH 1FJ1B 3AS1A 1EJOH 4OCXH 2HJFB 4LSUH 3N1MC 4Z0BH 2EICA 1EH9A 3R1GH 2OM5A 3IFLL 4L4TA 1D5BA 5F7YC 5HHVH 3TN0A 4POYA 3P4NB 4PJFE 1YYML 3QQ9D 1FFPA 4MA1B 3QFDB 2X6MA 4FXGA 2VQTA 5H37H 3HB3C 4MNQD 5JNYA 4JN2B 2P7TB 4L4TB 3TN0B 1KTDA 2VDLL 2EYSA 4AM0A 4ORZC 3ARUA 4NN7C 4DGYL 4FXGB 4XP4L 3SJVB 3SDCA 5CMAA 2H6PA 4GUPB 4MXVE 1MEXH 3D48R 4NNPL 3HE6D 2MHAA 1HINH 4X6CB 3TBWA 3SDCB 1OGAE 5CMAB 1AP2A 3C60B 3UYRH 1CICB 3TYFA 5EG6C 1ORQB 3OR6B 5KN5B 1U9KA 2XZAH 2XWTA 3QUZA 2MHAB 5C0ND 1HOCA 2F19H 5I75B 1KENL 4K3GA 2X1WL 1HDMB 1G7IA 2C1PB 4Y19A 4U7SA 2BNRD 5F1IA 1H0DB 1YECL 3TYFB 3GMLA 4ZTOL 3U30B 3K1KC 5HD8C 3QCTH 3WSQL 5HY9A 2XWTB 5I1GL 3G6AB 3QUZB 3WYRA 1HOCB 4XPBL 5F7WC 1Z2KA 2NYYC 3ZSSA 4UBDC 4YXKL 5IHUL 1CIUA 1D9KD 3CCHB 4Y16D 5ALCH 3KPLA 1I1YA 5ADOL 3MLSH 2O5XH 3Q6FA 2VR9A 4ZFOL 4LLQA 4L1HA 2WNGA 2VITA 5D5MA 5IBUB 4OZFA 3NZ8A 4XNQA 1FRGH 3SE4A 3SKMB 2KPNA 2H9GB 3Q6FB 3D1MC 1E6JL 1FC1A 5C0BD 2VITB 3MV9B 5D5MB 1B4JL 1DDHA 4ZD3H 4OZFB 3M17A 1SEQH 3MOBH 3ESVF 3OF6A 4X9FA 3RA7H 3PWLA 4ZUWB 2B5IB 1WFOA 3OKEA 3QXDA 2JCCE 4U6HA 1RUPH 4ELME 4QNPF 3D2UB 1BFSA 1MCIA 2VZSA 3KPSD 3M17B 1NGWB 2QQKH 3T3ME 1V05A 1S9YA 3VH8A 3KG5A 1YEFH 2ICWA 1P5UA 4MVBC 3GEWB 4I2XB 1WJ3A 1I9RH 5EO9A 5KJRL 4G6FD 1EEUA 2F54B 2HT2D 4KK5D 5ICYA 2DD8L 4N0UB 2YWYA 1S9YB 4ZOAA 3DX9A 3VH8B 4IMKC 1EIBA 1EGJA 1HXMB 3H8NA 4LEXH 4LHJB 5EO9B 5C09D 3QXTA 1PKQA 1OAYL 4K8RC 4Q9BA 4HUWA 4X6EB 5ICYB 4JFQA 3STBA 4QRUB 3MRMA 3BAEH 5KSBF 1WIUA 4JG1H 3DSFL 4NQTA 2OMNA 1M71A 1HQ4A 3ZHDA 3MV8E 4HUWB 4YXHL 2YD6A 1NDGA 1F45A 4JRWA 4PJ9C 3BRFA 5DSCB 3MRMB 3TBSA 3TV3H 5HVHC 5F88A 4Z7QF 5LAXA 3DVIA 1NDGB 1HEZA 3WJLA 2AV7A 3T2PA 4KK9C 4OD3H 4HS8L 3TBSB 3GBNH 3VFWA 1M7DA 4WENB 1RUAL 3P9WB 2AV7B 3Q48A 1YEKL 4K9EH 1PJ9A 3GSQB 2JLLA 4HIXH 3PG2A 5FYJL 1LK3L 4KTDL 3VFWB 3MQIA 4XVUD 1J10A 5JQ6L 2CSPA 5EDXA 7CGTA 1CF8L 4GQPH 4FXKA 3HG1E 1U8MB 5F89A 4JN1H 5EOQH 4MAUH 3VGBA 3MODH 1GOGA 1CTOA 3S5LA 1LO3H 5DMKB 5TDNB 3CFJA 3MNWA 4LSQH 1I7TA 2YPKA 1A6UH 5IB5A 1SYVB 2X42A 2VL5B 1C5BH 5C0CB 4GXVH 4UINH 2DI9A 3ARVA 1I7TB 2ADJB 4JDVB 4DVRH 1ZT1B 5IB5B 2ZCHH 4DOHE 3O3BB 2Q7NA 1BZ9A 2IANE 4FTVD 4NQEE 5LBSH 1JYNA 4PB9L 3MOAL 4DEPB 2XY2A 3TA3D 1EVUA 3DXAB 3WD5H 3BSZH 1JJUA 3ZT5A 3D39A 4PPTA 2KL6A 5EU5A 2RHEA 3C09B 5BS0E 5HTSA 3LEVL 3MYJB 1FDLL 5CS7A 2JIXA 5CJ8A 5IBUG 4O00A 4WI8A 4NJAL 1E28A 2BVPB 4AIOA 5KTEL 3ZYOA 3QEGL 1Q94B 4OZFG 5GRJL 2CRYA 4NBXB 3U7YL 3U9UB 4PP2B 4XCEB 4U2ZA 3BE1L 1JYWA 5FF6B 5HYSB 4O5LL 5A2KH 2A73B 1RZFH 5D1XB 4WW2A 1EDQA 5E6ID 5J89A 1YEIL 1NC4A 2XZZA 3RWGB 1VGEH 3WXVH 1MHPL 4R2GC 2CPCA 3S36L 3KYAA 3VFGL 4FN0A 2F58L 2Y5TA 4WHYG 3RWHA 1INEL 1ZVYA 3FO9B 3Q1SL 1BX2A 4YDJA 1U8KA 1SMAA 3VH8G 4WWKA 3OR7A 2FR4A 3EYOB 2A9NL 4JPVL 1T03H 3B2VH 1MCQA 1H3UA 1G7LB 4LCUA 1BX2B 4U1MB 4YFLI 5JHDD 3DI2B 1HHJA 1U8KB 2IBZY 4JFFE 3NA9H 4MJ4A 5I9QB 4WWKB 2VLJD 3P2TA 3GO1H 5CD3A 2Z35B 4YXLH 2W91A 5GHWL 4LOUC 1MFCL 4X98B 4J3SA 1N8ZA 3NTCH 4K7PX 4LCUB 2X4SA 1HHJB 2R0ZH 4K3EH 3RVWC 1CD9B 3LIZH 5E5MB 5GSRB 5DMGD 3HR5A 1WWAX 1MQKH 3IXAB 2CJUL 2X4SB 5HHME 1JWMA 4X9IA 4LEOA 1KEML 1OVZA 4WTXA 5KSVB 4LLMB 4LKCA 3UTSB 2GTWB 1ZT7A 4PYHA 3UTPE 4X6FA 4RFEA 5HYJD 2BJMH 4C54A 4PJ8B 2WINB 1W72A 5DD5L 4UOJA 4M3KB 4LEOB 5HDOA 2AV1A 3TBYA 5CD5D 1AKJD 1I1AC 2QSCH 5L8LB 4R3SA 4RFEB 1BP3B 1HXYA 5GGVL 4CMMB 4GKNA 1W72B 3ZDYE 4ISVA 3TBYB 4J3VA 4LLUB 3VWJD 1YEEH 4L4TE 5MERA 1HXYB 2QLVB 1S7UB 4HLZH 1NMBL 4BZYA 3P0YL 3X17A 2VQUA 2D4DA 1U92B 5GRUH 3VCLB 3SJVE 1F8TH 3C6SA 4S10A 5FV1L 3WFZA 1JL8A 5MERB 4LU5L 4JGUA 3TPKA 2DL2A 3R0MA 1MFDL 4I0CC 4G5ZH 2APFA 4Z7VF 1J5OL 1QHPA 1KXTB 3KR3L 4X7SH 5CEYA 5DRNA 1NBQA 5HSFA 3ULUE 1TZIA 4MHHI 4MQXD 3O9WD 4XNUH 3TH2T 4E0RA 2FLBT 3ULVH 1JZ5A 5HHOD 4M62H 5CEYB 5I15L 3MPCA 2Y36H 1MRCH 2EIBA 1KFAH 5EOCL 4NKMB 5SWQB 4ZUTA 5ESQB 2Q3ZA 2ZCKL 2A9ML 1GGYA 3NIGE 1SJXA 3K7UA 4ZO9A 3AS2A 4I0PD 5TE6H 3QCUH 4Y19E 4ONGL 1FNEA 2Z31A 4KMQA 5I1LB 3GBML 1UXSB 5IEHA 1T0NA 2VXQL 1FFQA 5E8PB 3VFRB 4KAQL 1NAKH 1Q72L 1X5IA 3QHFL 4M7JL 4PJBB 4KRMB 1FNEB 5D7SL 1QBML 3DETD 3STZB 2X9WA 4BSWB 3HS0A 2GKIA 5ITBH 2UUDH 1RJZA 4JG0H 4EXPX 1JF6A 2APTA 1LO4H 4PR5A 3NFPA 1OQOA 5D5ME 5HYSG 5FO7A 4HAFA 2ZG1A 3HE7D 5C08B 3VG0L 1ZV5A 4HUMB 2VDRL 1G9NC 4ZNEA 1TCRA 4PR5B 3RVXC 5T3ZD 4HWNA 4P2OA 5TE4L 1MFAH 5FYJU 5D4QA 2OQJA 3VFNA 3S7GA 1JNLL 2NY2D 1JTOA 1GZQA 1V3MA 1AXSA 1FVEA 1VFMA 1OPGH 4XC1H 3EJYD 4AENA 4PGBB 2AJUH 3CMOH 4JJ5A 3UPCA 3IETA 3V5KA 1HH6B 4XP9L 2A6DB 2OQJB 3VFNB 3FAXA 1VFBB 1Z9OA 3UC0H 2ZG3A 1K3IA 4XAWH 1HK6A 3D5OF 4KFZC 1TVBA 4LF3A 3OV6A 4JJ5B 1KCKA 5FGSA 3SBWA 3IETB 3MYZA 4XCYB 3O0RH 1FLTX 4Z7UF 4G6KL 4IMKA 2IQ9L 5HYFA 2EH7H 2O5YH 2V7NA 5C0CD 2FH8A 1FORH 2NY5H 4LF3B 3CDGA 4YH6A 1PKQE 4HGMA 2V5MA 1MCNA 1L0XA 4FQIH 1FNGA 1CD1A 4FMKA 2W9LA 1X9QA 3B83A 3DXAD 3CDGB 1QKZH 4MJ5B 4OV6F 3SKOB 3WIHL 1S9KC 4PJ9A 1FNGB 1CD1B 4U7MA 1BPVA 3C2AL 4OM1H 4RISL 1JZ8A 3LHPL 4LRNL 2AJZB 1A7OL 3U0WL 1XAUA 2PW2B 1P1ZB 3EHBC 5AAWA 4XXCC 1XF4A 5HVHB 1XIWC 1F4XH 3BX7C 1FG2B 4MXQC 1HHKA 4LIQL 1A5FL 1PQZA 1CS6A 4CU7A 1B0WA 4QXUL 1WBXA 2FX9H 2NNAB 1DLFL 4NSKA 1KT2A 1P84J 1AXTH 1CGVA 5BRZA 3JWDC 1HHKB 2RGSA 2V9RA 1SJEA 4HW6A 2UY6A 1KBGL 4OKVB 5MI0C 1WBXB 3P4MB 4NM4H 3ARFC 3Q0HA 3TT3L 3QT2A 3RWFB 1A4KA 4JQXC 5HVGB 2HMIC 5BRZB 5IOPA 1M6OA 3TWCH 2YBRB 4DQOH 5BV7H 3MUGA 3JVGA 5DMJB 2LU7A 3OHXA 2HN7B 3BEVA 1A6ZA 2H41A 4U3CA 2E7BA 4X4ME 5HHXL 4M6ML 1XGUB 2JE8A 1A4KB 1OP3H 5IOPB 1T6VN 2EDQA 1PY4A 3MUGB 1YEJH 2X4RA 1DBAL 2FECI 2OTUA 3QDHA 3HFML 3V6BR 2D4FA 2UUDK 4Y0GA 1A6ZB 4UUJB 4ODWB 3DHMA 1FL5A 1FFNA 4GAGL 3MR9A 3I2CH 4DN3H 2YKLH 1F97A 1I7UB 2X4RB 4KZDH 4K7FB 1MNUL 2C3VB 3G5ZB 1EEYA 5B4MC 1LHZA 1T4KB 3MR9B 3D39E 5GISL 1ROWA 3L5JA 1A9EB 5K9QI 4UOW1 1NMCB 5ACMA 2A38A 1NAMH 1LEGB 3ZDZF 1NANH 4P2RA 1XF3A 4OLXH 2VLME 4G7YL 1A1MA 3DV6B 3QIBC 2FLRT 2YA2A 4AEIH 4DKEL 1T04B 3O3AA 1YQVH 1KPUB 2ENSA 3WUZA 5L2KD 3MREA 4P2RB 1HILA 1F58L 4UOW0 4ZUUA 4CN1A 4HPYL 4G9FA 5DDHA 3TIDA 3CNKA 3MRKA 1GAFH 4U6TA 3OJ2C 1SBSL 3CVIH 3MREB 4BH8B 3BVNB 5E94A 3KYKH 2MWCA 2ZUTA 1INDH 3IS0X 3TIDB 3OB0K 4MSWA 2E7LC 1DR9A 4G8GD 2D7TL 1HQRB 2GJ6B 3UAJC 3H7LA 3MRDA 1W0WB 4X5XB 4NWTL 2VIRA 1L9NA 3MLVH 1JI1A 4LPTA 5BMFL 4LPWA 5IJKC 4KROD 3OXRA 1P4LB 1UM5H 3QA3B 4M7KH 4HC1H 4R2GB 1EFXD 3ABZA 4K94C 2XV6B 5KVEH 2E6QA 4KQ4H 1I9IH 3LKSB 4JY5H 1CFVH 4A2MA 4OGYL 4XPTL 5JOPE 4XVJH 3OXRB 1FN4A 1WC7A 2GJZA 5T5FH 3QNYB 3U0TB 4KJPC 1IC7H 3O8XD 2FCBA 2UWEA 5I66B 5F7EH 3NMEA 5DEGA 1IKNC 4DGVH 4GKOA 2RB8A 2WBWB 5JIKA 4XBPA 1MCWM 2P43B 2I9LA 3RRQA 3BKJL 2CLZA 5EZOH 5EU6A 3FRUA 3L6FA 4KRNA 2XA8H 3I85A 3I84A 5DEGB 1FFOA 1D5IH 4K3DL 3HC4H 1ZTXL 3O4LA 4JY6B 2EYRA 3FFCA 3K8MA 1T80A 1RAMA 2VH5H 4HK0A 1VDGA 3KPPB 3L6FB 5IB3A 3RAJH 1PDKA 3V0VA 1IFHH 5ELIA 2R29H 1D6VH 4RAVA 1KCSL 3O4LB 3VRLF 3REWB 1CGSH 5E8OA 2J88H 4HK0B 3E1F1 1KPVA 3OJVC 3MJ6A 1ACYH 5IB3B 5HGBA 4G7VH 5DD3L 2IJ0C 1CDGA 4NZUL 3H7BA 5IMLA 1UGNA 3S96B 1I1AB 2OJEA 2JB6B 3ALWA 2XKNB 4R4FL 4FA8A 5IHZB 3BHBA 3H7BB 5IMLB 4YFDB 1ZHKA 3FB8B 4PJ5B 5C6WH 2OJEB 3FZUD 2HRLA 3IDNB 5D72H 1PZUB 1PG7W 2X89A 4C59B 4FFZH 3BIAX 1YNLL 2X4QB 5MEND 4CDGC 4XT1C 3S4SA 1X4XA 1ZHKB 3KPOB 1S5HB 2AJSH 3CDFA 4JZOA 5DMYA 3P11L 4M9PA 4LCIH 4PRDA 3ZTJH 2ZOKB 2IAMC 3MBEA 1VSCA 2N4IA 2HVJA 5JW4Q 4LPXA 4J1UB 1MCHA 1FG9C 5F96L 4OD2A 4I48A 3EUUA 2KUTA 4YHMH 4CL7A 4MDIA 1IGJA 4PJXF 3CSBA 2VZUA 4OLUL 2HVJB 4OD2B 4PJBE 2OZ4L 4PGZA 3C87A 1PSKH 4XHJD 3F7QA 5DJ2B 1MWAL 5KANG 1AJ7H 25C8L 4JVUA 3LRSB 2Y23A 4TUJB 3FO2A 5BXFB 3G6JA 4KGLA 2F74B 2WZPD 2FX8L 3RZCD 2N7BA 1TMCB 1MRFH 3ZE0F 2QHRL 4NCDA 2BNQD 12E8H 3NCMA 2APBA 4TTDC 1Z3GL 1IEAB 3G6JB 3BDBA 3WJJA 3V4PL 1IT9L 4PLNC 1TNNA 4ZNEE 2GT9A 4KK6D 1KTLB 4R7DA 4KPHL 4NQSA 5BW7A 5H94B 4MD4B 4MQSB 5TH2B 1DBKL 1RZGB 1MQ8A 2X41A 3QULA 2OZ4A 1TJGL 5DLML 1NCBH 1XEDA 4PLKD 1T20A 3ULUH 1CT8B 2D9CA 5F9WB 4N90D 1MWAA 4D94A 2ED9A 4U3HA 3OX8A 1B0GB 5BCAA 4NQSB 5GJTH 1UM6H 3LKPA 4N5EC 4NC2B 4P3WA 1QFUL 4BQ9A 3GMMA 4JRYD 1T7ZA 3NIFE 4R4BA 5C2BH 5I1JL 3IFLH 2HFFA 1T7WA 3U4EB 1YYMH 2EDLA 1X5KA 2V9TA 3OWEA 3TGXA 3E3QC 3MRGB 3T1WA 3MV7A 4G6ML 9CGTA 1PX3A 1QACA 3QQ3A 4H1LB 1O7VA 5EC2B 4R4BB 2ICWJ 4NOBA 2M26A 2VDLH 4DGYH 1PYWB 3RTQA 4YHPA 4XP4H 1MCBA 3NFSL 4XWGL 4HWUA 4LLVB 2VLRD 2EE9A 4U3XA 1P9MC 3VXNA 3CFEA 4NNPH 1K5NB 3SGDH 2CLRB 4K3HA 3PV7A 2ADGA 5T3XL 4YJZL 4S1SL 2JJUA 3VXNB 3PHQB 5TF0A 3E6HA 4MHHG 1KENH 2H2SD 4EI5D 1R5IB 1R5WB 3HRZA 4L8BB 1EJ6A 4WUUA 2ADGB 3VFOA 3EGSA 5CLTA 1YECH 4N1EA 1XIWA 4ZTOH 5JXEC 3TH4T 1IGFL 4JFXA 3WSQH 5I1GH 4XPBH 1S7XA 1QFOA 3HRZB 3EGSB 1GPOL 2Z8VC 5IHUH 4YXKH 4GJTB 1NCNA 1FVDA 1XIWB 4XNXL 5C0GB 4JFXB 2XZQL 5ADOH 4Q6YA 5BRZE 3LZFL 4ETQB 4W68A 1WFUA 4PG9A 2J6EL 3SCMD 3ARFA 5D6DC 3LKRB 5MEQA 2RCSL 4W70A 5I8CA 4Z76B 4JQXA 4YPJA 4YO0A 2GY5A 4MDJB 4EOWL 1E6JH 3S4SG 4IS6A 5MI0B 4PJAF 1B4JH 4HIIB 2NW3B 4YNYA 2EDTA 3EKCA 4YO0B 1D5ZA 4IS6B 2JELL 4QXWA 3ULVD 4LIQE 4CVZB 2RBLA 3CFCL 5KSBA 2JK5A 4YNYB 3L9RB 4XTRD 1N2RA 4H25A 5FECB 1D5ZB 3CXHK 4PJEF 4AT6A 5HGHB 3WFEL 3NIDE 2JK5B 3TIEA 4X4YA 4OT1L 5KJRH 4Z5RA 4RGND 1LD9B 3T2QA 5J7CC 4LSRL 2DD8H 4IIQB 4LGSB 4QHKI 1CBVL 2VR5A 1U2CA 1JK8A 1OF2A 2X9XA 2FDBP 3JTSB 4R9HA 5D7IF 4E42B 4R0LC 3VFPB 4RRPA 4P2RE 1XZ0B 2HJLA 1OAYH 5ESAA 4WI5A 3RQ3A 1QSFD 3QIBA 4M1CC 5INCB 1G9MC 1JK8B 4FQQB 4X7TB 1BFTA 3VJ6B 2BDNL 5DRZA 4RSVA 3DSFH 4R96B 1YDPA 2HJLB 3MRBA 4M7LL 1ZA3B 4YXHH 1DVFB 1DQLL 4BSVB 1AGFB 3DX8B 3KXFB 4I5BA 5CJBA 4MD5A 1WZLA 3L3DB 5DRZB 4EIZC 2GJ6E 4MAYC 5IV2A 4PJIB 4RX4A 3VXMA 2DTML 4I5BB 3BN9C 3P30L 2E7LA 5JOEA 4HS8H 1U95A 5D7LB 2NX5A 3T0EA 3D25B 2IFGA 4FFYL 1XGTA 5I2IA 4I13B 1JMZA 3VXMB 1RUAH 3JUZA 4NFDA 5EN2B 1BD2B 5IJKA 1YEKH 1QLRB 1BVKB 3EYVA 3KLAA 2OXHA 4H1LG 5FYJH 1OTUC 1LK3H 2NX5B 4KTDH 4Q6IA 4C4KO 4F9LA 5I2IB 2K7QA 4PREA 5FK9A 4N0FA 3CAFA 2E7HA 5JQ6H 4KZEL 5H35B 1Q9WA 1CF8H 3DVNA 4ZQKB 4APQC 3MNZA 2VWEC 4FNLL 4KQ3L 4PREB 2UWEE 5FK9B 1IKNA 2CR3A 4N0FB 4OZGF 3G6DL 5C0AD 1L7TL 4ZO6A 1TJIL 4X6DB 2PW1A 3MNZB 5IMKB 5CSZA 5EU6E 2B2XL 5DFTA 1EZVY 5TDOB 4Q74A 3O4LE 3DO7A 3QIWA 2KBGA 2XICA 4JM2F 5DHVA 3U4AA 4QWWC 2W0PA 3B5GA 4F7TB 4A2LA 2VMFA 4PB9H 3MOAH 2LE9A 3DO7B 5CKGA 1GIGL 3K4ZA 4PUBL 2J5LC 4EI6B 3MSPA 4AMKL 4MNHA 3LEVH 4P9ML 1FDLH 3EDFA 4LLDA 5IEKB 2O26U 2MTPA 1FO0A 5F1NB 3TNNB 1YC7A 1PKOA 1G7QA 3STLA 4NJAH 3BEWB 3GK8L 3ZYJA 3D18A 1NLBL 3BYYA 4YPGA 1FYTA 1L0QA 2ICEB 5KTEH 1FO0B 4C57C 5K9QG 3QEGH 1G7QB 3HZKA 3MRHA 5GRJH 1I3RB 5IBLD 2VB5A 3RL1A 3U7YH 3GSNL 3CUPB 1I8MA 2QEJA 4KHXL 1FYTB 2NY0D 2AEIT 5EOTA 1KTRL 3BE1H 4J4PC 4O5LH 3HZKB 3MRHB 1G6RB 4HWEL 4QXTA 2AXGA 5GGQL 1YEIH 1CVRA 1BMGA 1UH4A 4DKDC 1CD8A 3KJ6L 4MMXC 1I8MB 1G0XA 2YPVL 1DEEB 1MHPH 3S36H 3VFGH 4ZAKB 2F58H 1Z5LB 1JRHL 1INEH 4QXTB 2AXGB 3Q1SH 3RIAK 2IAMB 3PGDB 3H0TB 3QDJB 2F53A 5SWZB 1MVUB 2CIKA 3NFNA 5KVDL 3FQRB 5DA0B 2WW8A 5LGKA 2A9NH 5E8NB 4ZUVA 4JPVH 4NQUA 1FZKA 3PWPA 1PBYA 1WBYA 5CP3A 2YA1A 1LE9B 4AIZA 3S3PA 2DKUA 3NFNB 2HLAA 3EZJB 3KNBB 3QUML 5GHWH 1FZKB 4RRPG 1MFCH 1WIPA 1LDPL 4GAFB 4H88L 4JM4L 3G6JE 1MY7A 3PL6A 1LWRA 1WGOA 5C07B 1RZIA 1P7KA 5B8CB 5IMMA 5KSAD 2I60L 4JQIL 1S7WA 4PRPA 3QFJD 1DP0A 2CJUH 3MLTA 1CFNB 3BH8A 1SVCP 1KEMH 4PRHB 3HG1D 2HKFL 5J1AA 4OZIF 1RZIB 1P7KB 3RJQB 3F7YA 5LCVL 3T08A 2HFEA 1J8HA 4NO2B 3B43A 4Y2OA 2VLLB 4LDEB 5DD5H 5EU4A 3BH8B 4Z7VA 5C3TA 2Q7YA 3U9PL 3MMEA 1B6UA 2IPUK 5GS0C 4L5FL 4OFYA 4ZTPL 1MUJB 2HLFC 4P23A 2A2QT 3QUMA 3LB6C 3F7YB 4YBQD 5GGVH 2H3NA 2HFEB 1B88A 5EU4B 2APXA 2GEEA 3MCG1 5JDJA 4Y5VB 5HI5D 1ED3B 4F57L 3HPLB 2VXSL 5DUML 5CEXB 4EDXB 2V2TB 1NMBH 3V6OA 3FB7B 3P0YH 2IAND 4NQED 32C2A 2I5YL 3ESUF 5IHLB 2ZUXA 4UTBL 4XWOC 5F1KC 2P4AB 3MRPB 3NCJL 4FQJL 4LU5H 5HI4C 5BS0D 1MFDH 5TQ2L 2DI7A 1J5OH 3GMNB 3ZT7A 4FFWD 3KR3H 1U8NA 32C2B 1J18A 2FGZA 1NQBA 3WFDL 1R0AL 2DQGL 3BWUC 3VXUA 1J0IA 5TGBA 1T5WB 4Y4FB 2EECA 1KGCE 5I1HL 3FQTB 5HHNA 2NY3D 5I15H 1D7FA 2NTFA 4NC1C 5EOCH 3P4LA 3VXUB 3KPMA 2EZ0C 2D03L 4M4PA 2ZCKH 1Z6JT 2A9MH 4U4BA 2X4NB 5ICZB 4ONGH 4WUUE 4ETYA 1RSFA 3W9DA 2F9BT 3GBMH 1OARL 3O81A 2VXQH 4XXDA 3ZKQD 2E6PA 4KAQH 1DVFD 1VACA 4UQ3A 5ISZA 3UCRA 1JPSL 4FP8L 1Q72H 4M7JH 3QHFH 1MJ7L 5D7SH 5ITFA 1QBMH 5DTFA 4TYUA 5CZVL 3QWOB 4LRIA 2ILLA 1VACB 4KKAD 4UQ3B 5CJXC 3TO2A 5E5RB 4PJHB 2Z93A 1DQQA 5ITFB 2EDBA 3I6LE 4HCRL 4F58L 3VG0H 3KLDA 2H26B 3WNPA 1P7HL 5D8JL 2VDRH 2DQIL 1XF2B 4JFFD 4Z7UA 4GRLC 2Z93B 1DQQB 3FQWA 2D31A 5TE4H 2W07A 3EDJA 1UYWL 4PFEA 5J6HA 5KG9B 7FABL 1JNLH 4PBXA 4JVPA 1C5DA 4ZO8A 3WS6C 5J6GA 3E0GA 2PYEA 4RNRB 4WFED 3KPQA 2AI0L 2DAVA 2D31B 5KSBE 3IFNL 1C8PA 1H15A 1OM3L 5DHXB 1YY9D 4XP9H 1J0JA 1YPZF 3BI9X 5B38A 1C5DB 2ZSVA 5J6GB 1F13A 1RI8A 2NR6D 1U8IB 3QBTB 8FABA 4HCRA 3MLPA 1BJMA 4C56A 4ELKA 3VFVA 3CFDB 4Z7QE 3TFKD 3LEXA 2P8MB 1IC5L 3D3VA 2EDDA 2IQ9H 2WLZA 4R0LA 5ILTL 2D3VA 5GGUA 4C56B 3VFVB 5DUPL 5JO5A 3LEXB 1BEYL 4L29A 3FTGA 5C8JB 3KXFE 6FABL 3DARA 4R0LB 1LE5B 3FRPA 5GGUB 3L5IA 2VXTL 1CFTA 4LNVA 2R2BA 3PWVA 3WIHH 3QXWA 1CD0A 4M61A 3GGWB 2GW5A 5T1MB 2P24B 2GAZA 3HCVA 3WLWC 4GRWH 3C2AH 3B2UC 5DJYB 3IRPX 2EXWD 2EKSA 3LHPH 3VXME 4M61B 4LRNH 1XGYL 3X12B 3U4BL 1A7OH 3U0WH 3HCVB 3ULUD 3DGGA 3GMPB 2EDNA 4KY1L 4MAYB 2NX5E 1HHGA 3S35L 3T0EE 5M7QA 1DUYA 4LIQH 3LH2L 2XN9A 4QXUH 2WIIA 3N9GL 1A6AA 2FIRT 1BWMA 1DLFH 5FAAA 4LSTL 4X99B 2C3WA 3ET9F 2IPKA 2ESVB 1KBGH 5I1DA 4Y19D 3TT3H 5EBWA 4HKXB 2CQVA 3F6LA 4TUKL 3SDDD 2IPKB 4DWHA 5SWZD 3HZYB 4M5ZL 1U58A 4APQB 5HHXH 2HRPL 5EBWB 4LHUB 4M6MH 5DXWA 5ANMA 1DBAH 4ZXBC 5HPMB 3HFMH 5BQ7A 4ZS6D 3WS3A 3TPUA 1AGBA 4EUPA 4LK4A 1QR1A 3K0WA 4P5KB 1KIUA 3QXVA 2R15A 4GAGH 5ANMB 4BZ2H 1XCQB 3FO0L 1MNUH 3Q3GA 5DJDA 5D7JD 3TPUB 1AGBB 4EUPB 2DJUA 1D6EA 3WNNA 1VPOL 3P4OB 5DJ8B 4XH2A 1RMFL 2GSIB 5GISH 2W9EL 2L4OA 3OF6D 3Q3GB 3BO8A 3IDXL 4V2CB 3VGEA 2XKUA 2J5LB 3BW9A 5I6XC 3KPNB 1SEBA 4G7YH 4DKEH 1DTUA 1CL7I 1UXWB 4Y4HC 3BO8B 1TVHA 1BECA 1FYTE 2VZ1A 4NO3B 4TNVK 5DGRA 1C1EL 3JSSA 3CU1A 3PWUA 1F58H 1V7ML 4HPYH 3QO1A 2CKBL 1KN4L 4MB5A 5D1QB 1A1NA 1D5XA 3CX2A 1SBSH 4L4JA 3D0LA 2QR0B 4W6WB 2PTVA 4K7PY 5I8EA 5AAMA 4GBXA 1P4IL 2ED8A 2IPUG 3ILPB 3QO1B 4F7CB 1YJDC 3QDJE 1CE6A 2JJSC 4KKLD 2D7TH 3D0LB 4NWTH 4OF7A 5BMFH 5E56A 5B38G 3HZVB 2F53E 3ALXA 3BKCL 3T1FB 5EUOF 5JW4M 3PDDA 5FKAA 3QP3A 4QRQA 4R4NC 3PWPE 4OGYH 4OFIA 4P0DA 4XPTH 4Y4FD 4B50A 1UEYA 2CKBA 3O2WL 4QKXB 1K4DB 4P4KC 5FKAB 3V6FB 4PRIA 2JJTC 4ZSOB 2JJWA 5JA8B 4J8RA 2YRLA 2EO1A 1JIBA 5EFIA 5ESVB 1EAPA 4RAUA 2V7HA 5IW6A 2X09A 3BKJH 3HAEA 3L3KA 2W0KA 3RNKB 1HH9A 4PJFF 4XI5D 2I07A 3VD5A 2AEPL 3T04D 1EFQA 1OB1A 4LCWA 5FHAL 2DOCA 4PRPE 4K3DH 1ZTXH 1EAPB 3QI9A 4JFOA 2V7HB 3VXRB 5IMOB 4R97C 4ZOEA 2GTZA 1X5HA 4ACPA 2M8XA 1CDBA 1J7VR 3T65B 1J8HE 3OKNA 1KCSH 1TQBC 1H3VA 4Z7VE 3VXPA 5JMRA 4AG4L 4JFOB 2AQ3A 1QRNB 1F3JA 4MXVF 4MB3A 4P49A 3RGVC 1NBVL 2E9WA 3B9KC 5DD3H 3T09A 1YA5A 5A2JH 4NZUH 5F9AC 3EO0A 1F90L 1CN4A 3DO3A 4P5TC 3VXPB 3O6ML 1DL7L 1F3JB 3KJ4C 2YN3A 4R4FH 1AHWA 5FYJD 1MIML 1JPGA 1XMWA 4WFGE 4OLVL 4OI7A 3E3QE 3FHQA 3QIUA 5E9DA 1ONQA 4HD9A 4KXZH 2R1WA 4P5MA 3BJLA 1IJ9A 1IM9A 1S78D 3DX7B 1IQWL 3HZMA 4LHUG 1JPGB 1YNLH 3D39D 1W0VA 1ONQB 4PGEA 2SEBA 3HNSL 1T22A 2R1WB 2FB4L 2JIXD 1IM9B 3P11H 1BQSA 2EXYD 3VXUE 1BQUA 2V2XB 4G80A 2A0LC 2R2HA 2ZKHL 2A1WL 5IK3A 2M2DA 3LSOA 4R26L 4B5EA 2Q87A 4PBWD 2QHLA 5F96H 2HYMA 4EUPG 4I1NB 1WBZA 1N59A 4XVTL 4G8FB 4WNQA 4WHTA 2W38A 2AK4A 4U49A 35C8L 3SY0A 2R2HB 3EFDL 4OLUH 3VDBA 3LSOB 1S9XA 3MGOB 4ZFZA 1CQKA 4OIAA 5J3HD 1CGUA 3V5DA 4K07A 1N59B 4X7FC 3QH3A 2OZ4H 2AK4B 1NC4D 4HWBA 1MWAH 1F4WL 1S9XB 2JCCF 4MA8L 3X11A 4PJHE 1BJ8A 25C8H 4GRWB 3BQUC 3MBXL 3QH3B 4WFFE 4RFOL 2G75A 3QQ4B 4FQCH 3T3MF 2FX8H 4UB0L 1L0YA 3EO1A 5CJXA 2XTJC 2ADFL 2QHRH 5GRVK 4GKZB 3X11B 2YD7A 1VEMA 1L6XA 4JPIB 4POZC 5E6ZA 2CO6B 4B41A 1QLEL 1RHHA 3V4PH 3EO1B 1IT9H 1FPTL 2R4RL 4GRLA 4KPHH 1BHGA 1DBKH 1NCTA 5F72S 1LNUB 1TJGH 5DLMH 3FN0L 4S1DC 3WS6A 1K2DA 4GRLB 2PYEE 5FXCH 2NLJA 3VMOA 5I1CL 3PDOA 3ZKMD 3RVVC 3CZFA 2WK2A 5EPMB 4DZBA 4Z7OF 4BUHA 2AXFA 2FSEA 4TOYL 4NUJA 1P2CA 4IOIA 4OQTL 5I1JH 4V1DD 4XNMB 2NLJB 3PWNA 2WWKO 3PDOB 1I7ZA 1ZLVH 4WO4C 5DO2C 4Y5XC 4C56E 4G6MH 3CZFB 4DZBB 1OT1A 4UU9A 4ZS7L 5F97E 1P2CB 2D7PA 4ZDHA 3CVHL 2UZXB 4Y8AA 5DJZB 1DLHB 1T83A 3NFSH 2VABB 4QOKA 4UU9B 1NUFA 4XWGH 5I76A 5I0DA 1YY8A 5GSVA 1A4JA 3SKNA 1X4YA 1DJSA 5TPWL 1ZSDB 4LPUA 1ETZA 1UWXH 5I76B 5GSVB 5SV4A 4JFDB 1R3KA 3PXHA 5T3XH 3UBXI 1QBAA 4S1SH 3BH9A 4KDTC 5GIRB 2EIZA 3ARRA 1K4CB 5DYOA 4X9HA 1BOYA 3QDGB 1AIFA 4RWHA 5DURD 4PJAA 1NGXA 1S9VA 2J8HA 3BH9B 1IGFH 5DYOB 1H5BC 4M3JA 3CX5K 3VRIB 1A6TA 5DS8A 4U0RC 5ACZB 5DFVC 5D1QD 1H3PL 1GPOH 4PJAB 2NTSP 2Q86B 3TVMC 1NGXB 4OCSL 3K74B 2WQRA 3RIFK 4XNXH 5C0DB 2W65B 5IQ7L 4L3EA 4MWFA 2XZQH 1GGTA 3LZFH 4MD0A 1A6TB 5DS8B 3HMXL 4PJEA 1GGCL 4OCNC 1JGVL 2J6EH 3QNXB 1K8IA 2WSKA 2RCSH 3ES6A 2R2EB 2Z31D 5C6TL 2VWEE 5C0FA 5FB8A 1I1RA 1T1WB 3WFCL 3GIVB 3AGVA 4MNGB 4MD0B 4EOWH 1DZBA 1OAZL 1QSEA 4PJEB 1VERA 1QA9A 1GZPA 1K8IB 2ZSWB 3LPWA 3LV3B 2IALA 5D7IA 1KLUA 5FB8B 5C0FB 3L3GA 4I77L 3FQUA 5DQ9A 3RU8L 4G8EA 5ANME 4ZXBA 2YS4A 2JELH 1MFEL 2B39A 5EORL 3QAZC 2IH1A 4HBCL 1KELL 1HN1A 3CFCH 2IADA 5D7IB 4JRXB 3QUYC 1XFPA 4IMLA 3H42L 1R6VA 4G8EB 1S7RA 4ZXBB 1V3KA 2OR7A 2IADB 3KYNB 4OT1H 4HH9B 2DLIA 4P2OD 3CXHJ 4IMLB 1KCUL 4KKCD 3SDXF 4M03A 4JFEA 1W2KT 2F8OA 4KKBC 4MLIA 3VE0A 1CBVH 1RZ8A 1X7QB 2E9IA 3OJDB 1I4FA 1TNMA 3VWKC 4CW1A 4QRSA 4JFEB 5CWSA 2HT3C 4NQVA 5IT2L 4NQDA 1RZ8B 4FG6C 4KRLB 1DQDL 3L7FB 1I4FB 2BDNH 3TO4D 3T4AB 4CW1B 5I6XB 4PY8I 1NLDL 4M7LH 4MJ6B 4HJ0C 5KZCD 1DQLH 1HI6A 4TVPL 4NQDB 4Y4HB 5FA3B 4NPYA 1ZLVK 4JO1L 1URLA 1FAIL 1CXLA 1R3LA 2DM4A 1F3DJ 1C08B 1JV5B 3DVFA 1HI6B 4OZGA 2OBGA 2DTMH 3P30H 2JJSA 1BGXL 3GJFH 2Z8WC 4FFYH 2HKHL 1MCSA 5TE7L 4X7CC 2NY4C 3VXTA 3OKOA 4KRPC 1WZ1L 2PXYC 1N4XL 1ZT4B 3WLBB 5DHVH 5E7FA 1WT5A 5F1SA 4JM2A 1VADB 3BP4A 1G7PA 3VXTB 2BVOA 4ZSOE 5D70L 3RHWK 4KZEH 1GHFL 5IG7B 1OAUL 5FM8A 4QT5A 3VRLE 1MI5A 3RX7A 2GK0A 4UDTA 3BGFC 3S88L 1VFAA 1KJVB 5E0QA 4FNLH 4KQ3H 4RBPH 1IAKA 1ZVSA 1NEUA 4GMTL 3ZDYF 4I9WD 3FQXA 3ARDD 3G6DH 4QT5B 1L7TH 1TJIH 2VDQL 4P4KB 1VFAB 2B2XH 2YXFA 4QHLA 3FQXB 4F37F 2QKIA 4DVBA 1G7JB 5J12B 4NRYB 5GQBA 1KIRB 1T7XA 3DRQB 4QHLB 3GHBL 4X6CF 3MNVA 2QKIB 3TZVC 4R97B 1JRHI 1GIGH 4PUBH 3ARBC 3B9KA 1JWUA 5E8DH 1C16B 4NIKB 4AMKH 1PZ5B 3OG6B 2D9QB 1TQBB 3K4AA 3RVUD 1RHFA 1AR1D 3MNVB 4OB5L 4P9MH 3E8UL 4RDQG 2Q3AA 3RGVB 1U3HC 1RK0B 4XCCL 1VGKB 1JWUB 1QQDA 3GK8H 1NLBH 5J0BA 2CO7B 4H8WL 3C6LD 2NY7L 4P5TB 3EZ8A 2J7LA 1INQA 1RFDL 4CVWA 2P8LB 1CLZL 3KJ4B 2WBKA 1A8JH 2HTLD 3L3OA 4HKZB 3QDMA 1QQDB 3CMGA 5CP3H 3CPLB 1IGTA 4HG4K 3GSNH 4EIGB 3C5ZA 1NCCL 1INQB 4KHXH 1OGTB 1ACZA 1S7QA 4LARL 3P73A 1DSFL 3UZEA 2VQ1A 5IJVA 2P47B 4HUKB 1CGTA 1HHHB 5F8QC 3C8KA 3QDMB 5K33A 4HWEH 5GGQH 4ZPTB 3KJ6H 4Z0XB 4XGZB 3EYQC 3P73B 5D5MF 2YPVH 2B4CC 2VQ1B 3L3JA 4HS6B 5EUKB 4L8CB 3C8KB 1JRHH 4LP4A 4EVNB 1PY9A 2AK4E 4G9FD 3SGEH 1AO7B 4OM0H 2VISA 5KVDH 3ZE1F 3L3JB 4OZIA 4DTGL 3F65A 1YMHB 2X05A 2BC4A 1YUHA 5CJQL 4MS8C 4J3UA 3KS0J 3QUMH 2B8OT 4I0KA 2X4TA 1LDPH 4H88H 2GQHA 4JM4H 3EFFB 5CP7A 4JFYB 1YUHB 3GJFK 4KI5D 1ORSB 2Y6SD 1MRDL 4OAWA 3BQUB 2I60H 1SYSA 3IF1B 1KJ2L 4JQIH 4KJQD 2CUHA 1A6PA 2VR4A 3NPSB 3O6LL 3QJHB 4BZ1L 2XTJB 1OOAA 2HKFH 1X5FA 1IILE 4LLAA 4OAWB 1I1FA 4H26A 2WANA 1WWBX 5LCVH 5MEOB 4QHKJ 2P5EB 2XG4A 4JY4A 3U9PH 1Q1JL 2LVEA 5EZIL 1AD9A 1I1FB 4L5FH 3AAZA 4ZTPH 3UTTB 4OGAD 2WWMC 1Q38A 5EU6D 2YXMA 3FO1A 5K93A 2NY6C 3GMQA 3DVGB 4LAJH 4JY4B 3FFCD 2ZUVA 4RAHA 4F57H 2VXSH 5DUMH 2QSQA 1HHIA 3QQ9C 4WO4A 3SGKC 3PQYA 3WFBL 4Y5XA 1KJ2A 3UBXB 3DIFA 5MEPA 2I5YH 5A40E 4UTBH 1C7TA 1PEWA 3QEQB 1T2JA 3NCJH 1P7QA 4NO0A 4WTZA 4FQJH 1LEIB 3PQYB 2DQHL 5TQ2H 4WU5B 4NHUB 4GXUN 5DVNA 3V0AC 5IW1A 2J8OA 2NY1D 5IROA 4PY7A 4LNRB 4M6OL 4QOKE 5EC1B 4HGWA 1R0AH 2DQGH 4ZUSB 4JFDE 3HE6C 5I1HH 2IGFL 2BOBB 2DLEA 3CK0L 5IW1B 3QDGE 5DEZA 2R1YB 1L9MA 3RNQB 4JDTL 3H9SB 4MGXA 4J23A 1ZS8A 2JTDA 2Z91A 2X89D 4KDTA 1GYAA 2D03H 5C0NC 3QNZA 3PIQA 5E7BA 4QRTA 4RQQA 3VXSA 3U0PA 1ZS8B 4PJAE 4P9HC 1OARH 5CEZL 3MBED 1ITBB 1JPSH 4FP8H 1D9KC 1MJ7H 4HIEA 4Y16C 3B5TA 3QUXD 2AXJA 3QZWA 4NNYB 3T4YA 1YPZA 1H5BB 5CZVH 4MJIB 4YGVA 4MNGE 4U0RB 2EC8A 3K4DA 1FAKT 3I02A 4PJEE 3PWJB 4OLWL 4HCRH 4HIEB 3TVMB 4F58H 4XPGL 3QZWB 1UQSB 4QHMA 4LASL 2GUOA 5D8JH 2DQIH 1NC2A 3RWJA 3I02B 4JEGB 2BNUB 1T5XB 3LEYL 2BHUA 1KB5A 3V8CA 2LFGA 5BVPL 5D7IE 2DQTL 1UYWH 4JRXE 3OPZL 1SJHA 5EU7C 7FABH 4L4VB 5E2TL 2ENYA 3R06B 1NC2B 5SWSA 5FO8A 3OKLA 3ARED 4OCYL 4TSCL 2YD5A 2AI0H 3D69B 3IFNH 3QUYA 4HZLA 1OM3H 5SX5K 3UO1L 5D96B 1TITA 4D0BA 4RGOL 2J8UB 1AGCB 1J0KA 3QAZB 2CRZA 3F58L 4HZLB 3B6SA 3CH1A 4QGTA 2O61B 2HT2C 3LOWA 4KK5C 1JGLL 3DMMA 4JFEE 5JDSA 1IC5H 1QNZL 4IHOB 3VWKA 5ILTH 3B6SB 3CH1B 2YSSB 5DUPH 1XF5B 2ATKA 2E27L 4MZ2A 2DIAA 4NQDE 1R3JA 5MHSE 6FABH 1CFSB 1F4HA 2VXTH 1BIIB 3HI6L 4J3XA 5EZLB 3MCKA 3ILQD 3MV7D 1JPFA 4AQOA 1MJUL 2X1XR 2DKMA 4U1GC 4O2FB 4HT1L 5CJ5A 1OQXA 5AEAA 3H3BC 1OAQL 2VDPL 4OF5A 4BFEA 2YPLA 4S2SA 3RTQD 5JTWA 1XGYH 3U4BH 1EAJA 5L2JA 3LPFA 4ODHL 3IDGA 4FQXA 4KY1H 4GLRI 3S35H 3QJFA 4S2SB 4ZPVB 3LH2H 3S34L 4AEHL 3UBXG 5L0QC 1UH2A 1BLNA 3SE9L 3OGCA 1FC2D 2EE6A 3N9GH 4RMQA 2X1OA 3S97C 4LSTH 2NY4B 2VSCA 4XVUC 2J1KA 1MJ8L 3GDBA 3QJFB 1MHEA 4KRPB 4FQ2L 4BFGA 3PNWA 4M1GH 2PXYB 3OGCB 4GRMA 1SY6L 1JF1A 4WUUD 5GS1A 2OSLA 5DD6B 1A22B 1NGPL 2Y07L 1FZOA 1NDMA 4TUKH 1MHEB 5FYLE 3OXSB 3NCCB 4NKOA 4GS7B 2H1PL 4M5ZH 5IUSA 5JW4R 1AO7D 3BGFB 1KJ3L 3O3EA 2HRPH 3R8BB 2E7CA 1JUFA 1U93B 4DUVA 1NDMB 3F7PC 2YZ1A 5I17B 4NT6A 3O3EB 3ARFD 2R23A 3I6LD 4F7PB 2Q6WA 1CE1L 1KLFA 5I71C 5T3XD 3EOYG 3V4UL 5L8KB 4QY8B 5B39B 3FO0H 4KJWD 3UX9B 3BRGC 3TA3C 5JW5B 2R23B 1VPOH 1S9WB 4YE4L 1RMFH 3BESR 1Z0NA 5T1KA 2W9EH 1Y6KR 1T89C 3TZVB 1J05A 3IDXH 1FNAA 4K2UL 5F3BA 4Z6AT 3ARBB 1WWWX 5C0JB 2ATPB 3QZWG 4OJFL 5IHBA 2W60B 3R4DA 3OBAA 4G8IB 4I8DA 3AMKA 4PJBF 5EUOA 1U3HB 1RD6A 5C0IA 1C1EH 4HH8A 3QDME 2X4PB 5INDA 1V7MH 4EN3D 5FV2A 2CKBH 1KN4H 1UWEL 5CIPH 4XNZB 2EDWA 3O45B 4GMSL 1QR4A 4YWGL 5EUOB 3O6FD 5E6IC 5F7FA 3N50A 3RKDD 1CDIA 1P4IH 2HVKA 5IVNA 4Y1AB 4LBEB 5J56B 1N6QL 3HAEH 4HV8A 2PTTA 1UVQB 1W8NA 1CFQA 5TDPA 4PJFA 1NMAL 3DBXA 1IARB 1VKXA 2QJDA 4F2MA 3IKCA 4XAKE 2XG5A 1XF1A 4D8PA 2YA0A 5F7LB 5LG1A 4UTAL 5ALBL 3BKCH 3DI3B 2PTTB 2IMNA 4LLYA 2FJGB 2P8PA 5TDPB 1NEZA 5BZDB 3B5HA 3DBXB 3R8QA 2CDFA 3ZZ1A 4F2MB 1CXIA 2KZWA 3L7EB 3P40A 5FEBA 5FA4B 4D8PB 1EA9C 1MCPL 3LKQA 2CRMA 1IAIL 3O2WH 4YEFA 4LLYB 2P8PB 3T0ED 5KS9B 2CDFB 4HHAA 3IDUA 2PO6A 1FZJB 1KN2L 1FCGA 3BP5A 4BELD 3LKQB 1OGAA 3NIFF 5DMGC 3UROR 2XTJE 3RP1A 1E6OL 1U8JA 1M7XA 2AEPH 4HHAB 5FHAH 2GJJA 3IXTA 4NCC1 4O2CB 3WIFA 4OI8A 1NFIB 4FRWA 3PP3H 1FNLA 1U8JB 4HKJA 5DF0A 5T5NF 2BSRB 4NO5A 4LVHC 3VU2A 1JNHA 1FIGL 4Q9RL 1LK2A 1I3UA 3V6ZB 5CD5C 4AG4H 4LSVL 4D0CB 2B1AL 4C4KT 4HKJB 5FGCB 1HNFA 1GGIL 1NBVH 4GW4A 1F90H 2XXCB 1TENA 3O6MH 1DL7H 4PLJD 3VWJC 5F6IB 2A6KB 3QIWD 2VO5A 4G6AD 2IH3B 2NY6B 1MIMH 1SBBA 4OLVH 8CGTA 3X14A 4AH2B 3PQYE 3MX0A 1KIQB 4MNQA 2P1YA 5D2NC 3VXOA 4LCCA 1QEWA 1IQWH 1H3TA 3DLQR 1WLHA 3WUWA 4N1CA 3EDDA 4HMEA 4L8SA 4MNQB 3HNSH 1EUTA 2JCCA 2FB4H 5CZXD 3VXOB 3QQNA 2ZPKL 4MQXC 1PEZA 3O9WC 3W0WD 1RZJL 4EJ1C 2IQAA 4OLZL 3G9VA 3HE6A 3CDCA 2ZKHH 2A1WH 1A64A 4R26H 5IVXB 4G43A 3KPTA 5DRXA 2COQA 4NQXA 4XVTH 1MCDA 5EU3A 2IQAB 3L3HA 35C8H 3EFDH 3VD7A 2OX5A 2AQ1A 4I0PC 1DBML 4G43B 5DRXB 5T1DL 4PGCA 3CSYA 4NQXB 4H5SA 5C9JA 3L3HB 3UMTA 4MJIE 1F4WH 3A67L 4X9BA 4PTTB 2BNRB 4AYFA 4MA8H 5ENWB 5DQJB 1D9KA 2ED7A 4PGCB 3DETC 4F9PC 1QPXA 1OSZA 2OTWB 3MBXH 4N8VA 1ZLWH 4CN6A 5C9JB 4RFOH 3GJEB 1S7SA 4UB0H 5LKNA 5F3HB 1S5IL 1FZMB 2F53D 2NXZB 3NIDF 2ADFH 4JAMA 1D9KB 2Z9TA 4Y16B 1IAOA 2FZ3A 3HE7C 1LP9B 4QHUB 1YZZA 5E99L 1VHPA 5ADPL 2HTKD 2ZOLA 5DZNA 1QLEH 1JN6B 4L4VE 1FPTH 5DFWH 2R4RH 2DLGA 4GW5A 4JAMB 1P5VA 1BVLB 4CUCA 1MAKA 3B8YA 5KBNC 1IAOB 3G08A 4I4WB 3AS0A 2DYPA 4RGMB 3DUSB 2CDEB 2X1QA 3CDYA 2NY2C 4O2EA 1A9BA 1RZKL 3B9VA 3OZ9L 5EIIB 5C0BB 2J8UE 3VFUA 3PL6D 3VG9C 4QYOB 3EJYC 3KDMB 4YFLF 2AK1L 5FYKE 3VGHA 4Q97A 4X4XB 3VFMB 3KPSA 5L7XL 1U0QA 4RMVA 5I1CH 4XNYL 1EO8L 4PRPD 3LKNB 5KAQG 2YR3A 4I3GA 4TOYH 4DCQA 3L1OL 4OQTH 1RJLA 3KPSB 1U8HB 4B53A 4JQVC 3PP3K 1J8HD 1NGYA 1RVFL 1RZ7L 4Y7MA 1RJYB 4IRJD 4OCWL 2GSGB 2DL9A 2ICCA 4ZS7H 3RWCB 4P3DB 1ZEAL 5C09A 3WEXB 4G6FB 2H32H 2W92A 2WBJD 4P23D 2MFNA 5CUSL 3CVHH 1NGYB 3ULVF 1XGPA 3QXAB 2VYRE 3IVKA 5C09B 1AGDA 1JNJA 4F7EA 2GIYA 4W4OC 4LDLB 2GK2A 4PBVC 5TPWH 1J1OL 5CLWA 4GKSB 1XCTA 3IVKB 4U05A 2FEDD 4KGJA 1AGDB 4PJ7F 4G6JL 1MFNA 3NVQA 4HFUL 2VRAA 4U1GB 1XCTB 2OL3L