4GKOA

Crystal structure of the calcium2+-bound human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
209
Chain Sequence
GVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig epsilon chain C region
publication title Ca2+-dependent Structural Changes in the B-cell Receptor CD23 Increase Its Affinity for Human Immunoglobulin E.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 209
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA02
3DBXA 1CVRA 4Y1AD 2IAND 1ZGLP 4O2FA 5E5UB 5ESQB 1S7SB 2WUBL 1KEML 3UTQA 1XF2B 3ZE1E 4XRCB 1LP9E 4L9LA 5F9AC 2GJ6D 1TZGL 4KRPB 4AMKH 1OSZB 1MUJA 3CLFH 3CGTA 4HUNB 3BZ4B 4YNYA 1KXTB 1NMAH 2BNQB 4JFED 1ZE3C 2FO4B 1LEIB 1XIWB 4UTAL 4EEEA 1UG9A 3J8F7 4MX7A 3GKZA 2NY5L 5JOFB 2ZUTA 4L3ED 1IGIH 2DQTH 4YDVB 3G5VB 5C07B 3SKJH 2C9AA 4J4PD 4JO4H 3UTSB 2FJHA 4NQVB 3OWEA 4MAYC 2WLYA 3R1GH 2EYSB 2QADC 1IRAY 5CZXC 4Z7OE 5SWSE 4TUJB 3CK0L 2NY2C 3NZHH 4PJ8C 4I48B 4CRPA 2BHZA 2XZCL 1U8LB 1IGTB 3WJLA 1OVZA 3FFDB 1S9YA 2E7LA 1HHHA 5B21A 2F53E 2G60L 3FHQA 1QSFA 2DWEB 2X4QA 4JN2A 5F72S 1QPPA 2DQHH 1ACYL 3A6CH 5IFAL 3BPOB 4JFDB 2QKIA 1FJ1B 5IBLD 3MFGB 2DLIA 3EGSB 5BS0E 3O9WC 1CE6A 1GOGA 4GW1A 4JVWA 2GQHA 1NDGB 4ZAKB 1MIEH 2ATKB 3EDKA 1YQVH 5I1EL 2Z93B 1VADA 4HG4K 3GJFK 3AMKA 2FECI 1NFKA 3KPRD 1SEBB 5C0CE 3LS4L 5ANMA 3GBLA 2AV1B 1X5YA 2YC1B 3RWCA 1KCRH 4MZ3A 3RTQD 3TBWA 3IF1B 5H35A 5IOPB 1V3KA 4FQIL 3MCG1 5A16A 4AENA 1OD9A 4RDQF 3D1MC 4TRPH 4UDTA 2IBZY 4JREB 2R29L 2AGJL 1LEKB 4ODTH 2CLZA 4P2RA 1XGUB 1MH5A 2A83A 3QNXA 4WU5A 5JHLH 3BQUC 5KJRH 4FFYH 5LXGL 5SWZE 3GSRB 5T3ZL 1ZT4B 1JYVA 2DI8A 4HIIA 2K7PA 1J11A 4RMVA 4F2MB 1NBYB 2LU3A 3C5ZD 4AT6B 5C0EB 3CFKA 4Z77A 1INQA 5BXFB 1QUNA 2PYEE 5C71A 1OGTB 2OQJA 3LN5B 1A5FH 2OR9H 1G9NL 4PRPE 3I6KA 1DSFH 1GGTA 3N50A 4PJ5B 2CLRA 2DWDB 3K1KC 4DFHA 1JYNA 3IFNL 3OHXA 1P53A 1N7ML 3ARFD 1ZTXH 3SDAC 3QJFA 1G7HB 1T66D 5T5FH 1FVDB 4KVCH 5GRVL 4JKLA 1MLCB 3PP4L 5E94B 2YPLB 5T3XH 2P8PA 2DMKA 3GRWH 3H3KA 2JIXD 5JTWA 4JEGB 4GG8A 4FTVB 4JFFE 1WBXB 4JGJA 4ELKB 5I8CB 4LQ1A 4MD4B 1NMBL 3O4LD 1JPFB 4H20L 4PRHB 4V1DB 3F7VB 5C2UB 2V2XB 1CDUA 3B2UD 4U1SA 4JY6A 2M8XA 5IR1A 1F2QA 1JFQH 5E2WH 2XV6B 4X0KA 3GMLB 3WXWL 4X6EB 1RUAH 4OSUL 2VC2H 4JM2F 4U1JB 1XGYL 1LO3L 2HRPH 4D0DB 5TFSL 2C3VB 5HYJA 5J6GB 1P1ZB 4RZCB 4NRXB 4RAUA 2FCBA 4M43H 2X9XA 5IQ7L 4F7TB 5DRZA 4ZPVA 1JPGB 3RUGB 4K23H 4NDMB 5DI8A 4A6YB 1K8DB 4G6KH 4FXGA 1PZ5B 4B0MM 5BOZG 2XRAH 5JA8B 2DDQL 1BF2A 2IAMC 1E4WH 1G7LA 3OGOE 3V0VA 2MJWA 1E4XH 4P9MH 1X9QA 1A14L 4H1LB 3DX7A 2ZSWB 4NCDA 5IBTL 5CLWA 2HTKC 2GEEA 4U7KA 2OM5A 1WV7T 2YD7A 5SV4A 1EGJA 2EICA 1ZKAA 5F7MC 1PD6A 1SQ2N 5K9OB 3DBXB 5KANI 1RHFA 1H3WM 4IRJA 4K3DL 4FA8A 1V3MA 4FQCH 3ILQD 1YUHB 4M9OA 4ZO8A 4CN1A 1NCCL 1S5IH 1NGXB 3UTQB 1ITCA 1LILA 4L9LB 1I9EA 5DK3A 4QF1A 4XAKD 4DJMA 4HSQA 4OZIF 1MUJB 2R4SH 4HFWA 5FYLH 3PJSA 2HWZL 4YNYB 5C09A 2BVEA 4LL9A 5DJDA 4JJHA 5M7QA 2EDRA 4GXUN 4CUCA 1TPXB 4J7RA 3MYJA 1LQSR 2I60L 4MX7B 4G9FD 3RVXD 3FJTA 2VR4A 3NA9L 1EZVX 4W4OA 3TJHC 4ZNEA 1IKFH 4WY7H 1KV3A 1QLFA 3U7YL 4FABL 2X9WA 4QRUA 4JHWL 3KPSA 4U7MA 1FCGA 2FJHB 2VLKE 1CU4H 4GAGL 4YFDB 5C0NC 4W6WB 1RHHA 2IWGA 4P46D 6FABL 5EO1A 1FIGL 5D1ZA 1Z5LB 2FATH 4MCYB 3W5MA 1QLRA 3GKWH 5DRWA 7CGTA 4RGND 4XP9L 1MIMH 1S9YB 3LKOA 4JCLA 1HHHB 1MJJB 4JN2B 1RMFH 2X4QB 1IZKA 3VI4E 3GM8A 1VACA 1CE1L 4I0PD 2QKIB 1Q72H 1VFUA 3IRPX 4CJ1A 2YSSB 2LAAA 4G9DA 4PGDA 4R90L 1R3IH 3LKQA 2OTWA 3KJ4B 2X89D 5D7SL 2NZ9D 1BJ1J 3T0EE 4GW1B 1JGDA 2XA3A 1IC5L 2EIBA 4RFOH 1WT5C 7FABH 2R1XB 3QIWA 1I9JL 3WUZA 3EYQD 1VADB 5GS0D 1KIRA 5LCVL 1AC6A 1FAKT 5FB8A 2W1NA 1IJ9A 5BVJA 2V9TA 1NC4A 1A0QL 3JUZA 5JA9A 3GIVA 5ANMB 1DLFH 1YEEL 2I9TA 3RWCB 3TBWB 5H35B 5B39G 1T89C 1DBJH 1QKZL 4BSWA 4L4TE 3L5XH 4I77H 5A16B 3QDJE 4HKJA 1YY8A 4AENB 1ORQA 2FD6L 2YUXA 4F58H 5ISZD 3QIUC 3RVUD 3S6CA 5E0QA 4JZOA 3MV8E 4RBPH 3T0WA 2CLZB 4P2RB 5DD5H 1MH5B 2A83B 4KJQD 3QNXB 4WU5B 4LMQI 1V7ML 3IDIA 4MNQD 1R0AL 4HIIB 5SX5H 3VW3H 3ZDXF 4GW5A 4LSQL 5EU7C 3D18A 1RJLA 3G08B 3SQBA 3AU1A 1WC7A 3CFKB 4Z77B 5GZNC 1DANT 1INQB 1QFUL 2DKUA 2YPVH 1F00I 1R3LA 4WDIA 1U8QA 2Q6WA 3L95A 4ODBD 5HHOE 1PQZB 3JTSA 3WNLA 3HC3L 5FXCH 1NAMH 2CLRB 2AXGA 3DI3B 3OHXB 1IC1A 4HS8L 2J5LB 4JG1L 4KTEL 1J5OL 4MJ5B 2XTJD 5DFWH 4KRNA 5L2KA 4U0RB 4YHML 1GGUA 4AEFA 1Q9KA 1NJ9A 4XVUC 2Y5TA 3ZDYF 1BOGA 5MEQA 1MVFA 4QLRA 2P8PB 4QO1A 3ORJA 4YHZH 3LRSA 4GG8B 2QHRH 4ALAL 4BK4A 3N1FC 2R23A 4JDZA 4M00A 3OPZL 4CVUA 3MRBA 4YK4C 1X5JA 3K2MC 2BVYA 5IR1B 4X0KB 5DQDL 1J1PH 1MCOH 3I85A 5DLML 3BPCA 1RVFL 4O5LL 4WEBL 3JXAA 5HYJB 3TEUA 3IT8D 5AZEL 5HPMA 1H8SA 1MFDL 5DRZB 3HG1D 4ZPVB 2JF1A 5IM7A 1F45A 4YJZL 3QDHA 4JB9L 1KELH 5DI8B 4P2OA 2HFTA 4M5ZH 4FXGB 4L1DA 1KN2L 1RZKH 1WEJL 4LGRB 4RGOL 4APQA 3QXUA 5IESL 1G7LB 1DL7H 3V0AC 4DWHA 5KSAC 2H9GA 3KS0H 1ZVHA 3DX7B 4R26H 4KUZL 4U0QB 1C5BH 1FLTX 1ZS8B 1UJTA 3V4VH 1FZMA 3I50H 3VXRD 4UV4H 3QUKA 1JZ3A 4KC3B 1F90L 1IC4L 4IRJB 4JKKA 4OFYA 2SEBA 4OM0H 1CICA 5DA0B 4EBQH 4MDIA 5FGCB 5C6WH 4AJ0A 1JTTA 1QBLH 1EV2E 3EYUH 4HFWB 3PJSB 1FAIH 2IPTL 4M1GH 5C09B 5MENA 2XQBL 4YE4L 1AY1H 1V8HA 4OCYH 1EO5A 4FOMA 1VPOH 5DJDB 3WV0A 3KR3L 2VKWA 3VI3F 4R4FL 4MJ4A 2ADIA 5DFVD 1D9KC 3MYJB 3V6OA 4B41A 4G6MH 4X5WA 4TSBL 2VIRA 3LPGA 5EOCJ 1A4KA 1FGNH 5CSZA 5EULV 3VGAC 3OKDA 1BOYA 3TBYA 1U8JB 2EEAA 1FYTE 1QLFB 4QRUB 4YHYC 4OCWL 3SN6N 4BFEA 4XCEA 2X5PA 2CKNA 1RHHB 2VQUA 4MXWH 5EO1B 5D1ZB 1I7RA 1MFEL 3K4DA 4LCCA 4LMQE 3KXFA 3ULVL 1M7DA 2OJZH 1DBMH 3H3PL 1QLRB 1OCWH 4M48H 5DRWB 4IRZH 4Q7DA 2CK0H 3MRGA 4GRWE 3LKOB 2VLME 3KLHC 5GHWH 3SPVA 5A43C 5B39A 3VRLE 5B3NA 3HE7A 1AO7E 1VACB 4RIRA 3L7FA 2DD8L 2DJ4A 3D3VE 4LRIC 4TOYH 4G9DB 2EDYA 4PGDB 3MLSH 2OTWB 5DD0H 4KKNA 4OFVA 5GGUA 1JGDB 1J8HA 4I9WD 4PLKC 2GFBA 2PO6D 1BD2D 2EE2A 3QIWB 5DUBA 1IVLA 1UM4L 2Y07H 1MRDL 3LH2H 3L5WA 1OPGL 4OLVH 2HN7A 2Y06L 1KIRB 1NPUA 2E27L 4K94L 3GRWA 1GYAA 4NT6A 3HC0B 3OKKA 5IQ9A 5BVJB 1NC4B 2YWZA 4I4WB 3GIVB 2UY7A 5C0JA 1IAKA 5CJXC 3VFUA 1L0QA 3PWUA 3HUJB 3OF6D 1ADQH 4L3AA 2I9TB 1I85C 4QHUA 2EDQA 4LRNH 4D3CL 3OB8A 1JGUL 4HKJB 1YY8B 4K2UH 1D6EB 5IW6A 4OZFH 1CDHA 4X9IA 1ORQB 4GT7A 5D2LE 1HEZA 2AKRA 4JZOB 2DQGH 2EDJA 3C60A 4X6DF 4AIXA 1FO0L 2VDPL 1CGTA 4JQVA 3ZKQD 5KSUB 1A6ZB 3IDIB 2F8XC 2JJSC 2KZWA 3JV6A 4HS3A 3SCMC 4YBQD 3ARZA 1PSKL 1YMMD 3D18B 1RJLB 4R4ND 3QRFM 2MHAA 1DCLA 2NR6C 3A67H 4NHCH 2VH5H 3O0RL 5BCAA 4WDIB 4XTRD 5K9JL 1U8QB 2Q6WB 3L95B 3WFZA 3FHAA 3QIBD 3JTSB 1BM3H 1BREA 4MZ2A 3W0WB 1MEXH 4LEXH 3TNMB 3IKKA 1A64A 2AXGB 3VJ6A 5AD0B 1BEYH 5E95B 4XVJH 4XP4L 1ITBB 2X1QA 4X5XA 3UJIH 2OTUA 5L2KB 4W4NA 5I76A 3HLAA 1Q9KB 1NJ9B 2AEIT 1BOGB 5MEQB 5F7EH 4PRID 4Q6IC 4EIGB 4JVUA 1UWGL 4F9LA 5HJ3A 3LRSB 4UTBH 3BX7C 2YWYA 2R23B 4JDZB 4RWYL 5E7BA 5J12B 2ZPKL 3HNVL 3MRBB 4FZ8H 1KGCE 2RBLA 4QRRD 4K3EL 3UBXI 1VGEL 2HAZA 3C09B 2NY6C 4R2GB 4LDEB 2UY6A 2ZOKB 4P57A 3S35L 3UDWC 3QBTB 3B9KC 5BRZE 4OFKA 4OFPA 3BYTA 3JWOL 4LSVL 2AK4E 2P5WD 2R69H 4XCCH 3HMWH 3I3EA 3QEUA 5HDQH 2APXA 1YJDL 5CKAA 4FQ2L 4OZHE 4NQEE 1IFHH 1W8OA 5IM7B 5EORH 4M7KL 2BY0A 4HJ0D 4KDWA 2J4WH 4P2OB 4YXHH 2H2SD 1GZQA 3PHSA 1CLCA 1C16B 1NLDH 4APQB 3WIFA 1F4WH 3RI5F 4RMWA 2B4CC 2H9GB 4Z95H 2PKDA 3G6JE 5K59E 3BPNB 3GBNH 4JG0L 1FZMB 4WHYH 2VN7A 1O0VA 3QUKB 3ARSA 2CQVA 1RULH 4Y5VA 1AXTH 1MF2L 4ELME 2SEBB 3SDYL 3FB7A 1CICB 3MV7D 1WFOA 2ITCB 4MDIB 5JQ6H 4OCNC 2MPAL 5CLTA 3MOBH 2Z31D 3VXUD 3NOIA 1KCSH 3T08A 1L7IH 1S7VA 5C7XH 2NY4D 1RFDH 4NKMA 2DKSA 4JHAH 3WKML 3MRPA 1XCTA 1GGBL 2VLRA 3OKOA 4NZRL 5MENB 5F3BB 2N7BA 3IDNA 4NM8L 2CDEA 4Y4KD 1LO2H 1A7PL 1XF3A 4LCIL 1MHEA 5GPRA 2FLRT 4X83A 4WFGD 3WDIA 3QFJD 1MPAL 2ZG1A 3VA2C 5FK9A 4ODVL 1P4LA 2LAGB 2VIRB 1A4KB 4YGVA 2MWCA 4XPBH 4DVRL 2ZUQB 3QQ9D 1T04A 3K4AA 5AG8A 4HC1L 5DJ6A 2Q20A 1YEGL 5LGJA 2GJZA 4XP6L 3AB0B 1A6PA 1JNLL 5B4MC 4F7MA 3ZKND 4I18C 4BA8A 4U6XB 2DQEL 4LCCB 3KXFB 1M7DB 3MRGB 4N8PA 3SPVB 5B39B 4X9GA 3HE7B 1JWMA 4RIRB 3L7FB 3U1SL 4LAQL 2EXWD 5CGYD 3Q5OA 4MA3A 5FYJL 5JPNA 5DJXA 4WCYL 5FO7A 5GGUB 1J8HB 1GRWA 3K0WA 1DBBH 1WCBA 2GFBB 2VXVL 5DUBB 2OCFD 2CKBH 3L5WB 2XFXA 2HN7B 3CAFA 2DQCL 4OUUA 3UZQA 1CFTB 3FMGL 4N8VG 4RQQA 3EKCA 5E1HB 1DUZA 4U1HA 3OKKB 4AEEA 3PGDA 4MNGA 5IQ9B 3LKPA 3FQRA 4GH7B 5GRXG 5C0JB 5FHAL 3IDUA 1IAKB 1OW0A 1UA6L 5TE7L 3VFUB 2DRUA 1SVCP 1D5XA 3OR7A 2WWMD 2QV2A 2DQIL 3KPMA 4JRXA 5D5MB 5CCKH 1YEFH 5T1DH 5IW6B 1K8IA 3ULUC 2D03L 3TVMD 8FABB 1XGRB 1HQ4A 1HEZB 3GIZL 2AKRB 4MLSA 3LMJH 1SM3H 1T3FB 4HEPG 3FRUA 2D7NA 3C60B 3X14A 3BMVA 4AYFA 1GH7A 4DN3H 3BEVB 5JW4Q 3CDCA 1HYSC 3BGMA 3JV6B 4H25B 5HD8C 5FYKL 3SO3B 5E56A 12E8H 2MQ3A 3DOSA 1YYLH 4LOUC 1LK2A 3T2NH 3Q3GB 5HSFA 4U2ZA 1LDPH 3S37L 3MLZH 4M5YL 4L4JA 4KTDL 4Y1AE 4O58H 5BV7C 1IM9D 2IANE 1XGPA 3VJ6B 2CRYA 5J3HC 1HIML 5IGXL 4MA1C 2ZUYA 4X5XB 5CKGA 3WFHA 3KPNB 2OTUB 2Q86A 2NY7H 4IMLB 1D7FA 5D7JD 2GJ6E 5I76B 1JZ8A 4RGMB 1QBMH 3DRTB 5ECJE 1OT1A 3BZEA 1OP3H 2VNCA 3BW9A 4M6OL 4JO2L 3BD5A 3RY6C 3VXSD 3SDXA 3MA7A 4XBEL 3QPXH 3LV3A 4HXAL 2WW8A 5EIQA 3WDHA 3EYOA 1U2CA 3CVHH 3TV3L 4HH9A 3MLXL 4LPTA 3FT3A 3HHRB 1M7XA 4U6TA 2Z8WC 5HTSA 3TPKA 1GGCH 4P57B 1J8KA 4JANA 4OF5A 4P23D 3RGVD 3K3QA 4KV5F 1FRGL 4D2NA 2A38A 4NO3A 2YOCA 4X7CC 5JLZA 4KGLA 1RUKH 3QUXC 5I0ZA 3QEUB 4Y2DC 1EAPA 5I8OL 4WWKC 4YX2H 1X5HA 1CDJA 3EO0A 5MP6H 3NH7H 1KB5H 4L4VD 1GZQB 5F44A 4LSTL 1BJ1H 3KYKH 2BVTA 3WIFB 1RAMA 5KTEH 2RQ8A 2PR4L 4AM0A 4P2QE 5K93A 4LFHG 3WSQH 3VFOA 5EUKA 3BP7A 1F97A 4EI5A 4QXUH 3QQ3B 4M02A 2V2TA 5I30H 3CVIL 4K8RH 1LO0H 4HK3J 3GMRA 3PDDA 4J4PC 4KDTA 4Y5VB 3BGFB 2JTDA 5DMGD 2WBKA 5CJQH 3SY0A 3FB7B 4LNRA 1MLBA 1WWBX 5F1SA 4UT7H 1KT2A 2BDNL 3K81A 5DJCA 4OLWH 5EU6A 4ZSOE 4DW2L 3KPRE 4NQCD 5DMIH 1S7VB 2BERA 4NKMB 3U30B 3PWVB 2VZ3A 4GBXA 4D9LL 5EZLA 1BWWA 1XCTB 2Q8BL 3MRPB 2VLRB 3SE8H 2WMPA 2YMXL 3IDNB 4HCRH 2CDEB 3WFCL 3V7AG 1XF3B 2Q3ZA 1MHEB 5DFTA 2QEJA 4H0IA 2HFEB 5D7LA 4EQ3A 1IM3A 5I71B 3MRRA 5FK9B 2XN9D 5I6XB 1P4LB 5TGBA 4RFNB 4YGVB 2R0ZL 1KC5L 3RQ3A 1T04B 2O26U 2FX8L 4F8QA 3JWDC 3JTTA 4UV7H 2R2BB 1CLOH 5LGJB 5D96B 2N56A 2GJZB 3P40A 4PJHB 4PYHA 4HUXA 4LHQB 2WIMA 3HZKA 4GO6B 4F7MB 2Z8SA 3QZWG 4N8VA 3RNKA 4HUVA 3EDFA 4PJEA 3RUGF 3T3ME 1GPOL 5E70A 1AGBA 1EO8H 4OLUL 4ZXBA 1OARH 4MXVF 2QQKL 1T2XA 4XX1E 2XNAA 4YGAB 2RR3A 3TC9A 1JWMB 1L0YA 1A6AA 4FQ1L 4HBQA 2EIEA 2XYCA 1EFXD 4MA3B 4ODHH 5E2JA 3SGKA 5DJXB 3OAZK 5JPNB 4XAWL 4Z7WE 3RWGA 5FO7B 5DZOA 5EBMA 4EZMA 4M7ZC 4OCSH 3EYFA 3OJDA 1HKLL 2DLEA 2XFXB 2R0WL 4OUUB 1NMCC 2MCPL 2ED7A 3VFTA 1DUZB 2BOBA 3K1DA 4U1HB 3VE0A 3PGDB 1WITA 4MNGB 2VXUH 3FQRB 3OXSA 1QACA 1BFVL 1H3PL 3OR7B 3ARFC 3KPMB 4JRXB 1FO0A 1KJ2L 3IETA 5LJYH 1OAQL 1OAKH 1A3LL 4XHJD 1K8IB 4K9EC 2VO5A 4PJDA 5GS1C 3V7MA 5DMKA 2I27N 2P8LA 4ORGA 1HQ4B 4OJFL 5CZVL 1HYRC 2B5IB 3GO1L 4IOFC 3FRUB 1H9VA 1OAXH 4HIJA 3X14B 2QQNH 3S34L 5D7IE 1WBZA 1GAFL 3TT3H 3DUUA 5HY9A 1X6NA 4N5ED 2P5EB 3TYFA 3MACH 2I25N 4FFWD 5KW9L 2OR8A 4I3RH 2P1YA 2UZXB 1KCUL 4LVHB 1QFHA 1LK2B 4R96A 1KENH 4NN5C 4NZJA 3RIFF 3PL6D 2DI9A 1KTLA 2R2EA 3HI1B 4PJGF 5I9QB 1XGPB 2DQFA 3MXVH 5IFJA 3B5GA 1OTSC 2EE6A 4FNLL 4OZGA 4IIQC 1RI8A 4EXPX 4NBZB 3WFHB 2NY3B 4XB8A 4N0YH 3QXWA 1HNGA 1QP1A 1UM5L 4LCWA 4XAKE 4PJFE 3ZMRA 3BZEB 3BW9B 1OT2A 2WNGA 5EOCH 4FQXC 3NCCB 3SDXB 3BUTA 3MA7B 3S35X 3LV3B 1QFWL 4JO3L 2DICA 3EYOB 3P0GB 1UXWA 5E8DL 2ZUSA 1U8HB 4HH9B 3SGEI 3FT3B 3ARGA 1WWAX 4G9FE 3QR2A 5F9OL 3RDTC 2X1XR 1S7WB 2Z8VC 4G8EA 5JPMA 5BZDA 4ZD3L 1Y6NR 1XEDA 2W9EL 3U36A 3WKNA 3INUH 1U58A 43CAA 4NO3B 3G6DH 3DVIA 1DBKL 5I1CH 5JLZB 4J3XA 3KLAB 3ME0A 2VERN 5FA3A 1EAPB 1FZJA 3WE6B 3VXTA 5I15H 4ZTOL 4NM4H 1W72H 3ARUA 4NN7B 3EO0B 2P45B 3N0PB 1BGXH 5B8CC 4HUUB 2XWTA 3MLWH 1IGML 3MOAL 3RL2B 3DHJA 4RGNE 2IPUG 3D39A 2KQMA 4AM0B 4P5TD 5HI5C 1KCKA 3VFOB 5D1XD 5EUKB 3BP7B 3QDAA 2OLDA 3UJJL 5C0DA 5CAYB 2EC9U 2EKSA 3MJ7A 4ZFFA 4KHXL 3W2DH 2J8UA 3X13A 3GMRB 3WN5C 4AH2A 2W0KA 1PY4A 3IAGC 3SY0B 1YC7A 4LNRB 1MLBB 1KT2B 4FFZL 5DJCB 3QDMA 2R0LL 3LS5H 1UJ3C 4I8DA 2UWEA 1L6ZA 4GBXB 43C9B 5EZLB 2ATPA 3BKJL 1FLRL 5J1AA 2DOCA 5AWNL 3QZWA 1LP9A 4NRZA 5ALCL 5D7LB 1CQYA 4HC1A 1SJEA 1IM3B 4MAYA 2N1KA 5ISZE 3HMXL 1T20A 3MRRB 2CIKA 1T22A 5TGBB 3FO1A 1EJOL 2OL3H 4JQXC 4U1MA 3ZE2E 5GS0C 3NABH 4HKXA 1CR9H 3JTTB 4ZUVA 3PF2A 3AREB 2DJSA 5GGVY 3FQWA 5F9DC 1BFSA 5F96L 1EZVY 2PXYD 4HUXB 4GRLA 3C8HA 4DKFH 3HZKB 1IC7H 1S3KL 4YEEA 4N8VB 4C4KO 3MBED 3RNKB 1PEZA 5T1KD 3O9WA 3QEQD 4PJEB 4ZXBB 1T4KA 5I17A 4BQ9A 1VCAA 3KDMA 2XNAB 1Y6MR 4KJQC 5SWSA 1A6AB 2EDLA 3ISWA 2C3GA 3GSVA 2XTJE 3ARBA 4KPHH 3MV9D 2PYFB 3RWGB 1BWMA 5FUOL 3QH3A 1RU9L 4YHKL 1A6TA 1LO5B 3EYFB 3OJDB 3QUYA 4X7FC 1CFVL 1QYGH 3VFTB 1TJGL 2BOBB 3VE0B 3QJHA 5CMAA 5FYLD 4WU7A 5F89A 1S9XA 1AE6H 4O9HL 3RWJB 5LVEA 5I1LA 4KAQH 3OXSB 3IU4H 5DJ0A 3BQUA 3CVHA 4WV1A 5IB4A 1CFQA 1FO0B 3IETB 1RUPL 5C0CA 5BMFH 1I3UA 3EHBD 3LVEA 4PJDB 1G9EA 2X4RB 3KYNA 1X44A 5DMKB 2P8LB 4ORGB 2LU7A 4JY5H 4XH2B 4TTGA 3EFFA 3VDAA 5D72L 3HG1E 1WBZB 3DUUB 5IB2A 3TYFB 3IKCA 1BQHB 1VEMA 3S37X 3NGBB 3FTGA 2G9HA 1U3YA 1ND0B 4KROB 5SWZA 1AD0A 1JL8A 4S1DC 5L88L 5ADPH 4HDIA 1JZ7A 4K7FB 4M3KB 1RK1A 1KTLB 2AJSH 3VXRE 2R2EB 1A6VL 4F57H 4MB3A 2DQFB 4RAVB 3D0VA 5IFJB 5D2NE 4GRWH 1A7OH 3H9YA 3OV6A 5KS9E 1YNTA 5E5MA 4UT6H 3W9EA 3W5NA 2IC2A 2D0FA 2JB6B 1EHLH 4PGBA 4HUMB 5GJTL 2D4FA 4AL8L 1OAZH 5GXBB 4K3DH 1TENA 4J8RA 4GSDH 5DJAA 1N6QL 1HCVA 1KF9B 2VLJD 5ESVA 2XZQH 1M05A 1UXWB 4XVSH 3BPOC 3EBAA 4WFED 5EBGA 5I1KH 3TH3T 3ARGB 1CQKA 2BK8A 1ZEAL 2AEPH 4BZ2H 4IDJL 4G8EB 1BZQK 5I1JH 3HPJA 5JPMB 5BZDB 2VUYA 3UTOA 1S7XA 2A0LD 3HUJF 3U36B 4DGIL 2KBGA 1U58B 3B2VH 43CAB 2IAMA 2XKUA 3P4MA 4C56A 2B7DT 3F65A 5EU5A 5FA3B 4YDKL 1FZJB 4X9HA 4JPVL 4M7LT 3ZE0E 1QBBA 3RI5K 1KPUA 1MCHA 3WUWG 5KANG 5DFVC 2B4CL 2XWTB 5KSBF 1OTUD 4DTGH 1X5IA 3KAAA 5IW3A 2ZUWA 4AIOA 3D39B 2WM0A 5FOBA 2YA0A 2FHBA 5DGQA 4L8DA 3DX6A 5HYQB 5C0DB 2OJEA 2EKSB 4WEUD 3K2UH 3MJ7B 1I1FA 5IFHL 3HI5L 5DHVA 4ZFFB 2J8UB 2FB4H 4U6YA 4AH2B 5FHBL 1DFBL 4I9WE 4AG4H 1BD2E 3STZB 3QDMB 4P4KC 3KHQA 3SGDH 2UWEB 2D0HA 2NY0C 2VXQL 3Q6GH 2Z8RA 4DGVL 5I18H 2HKHL 1ORSA 2ATPB 4ZS7H 5J1AB 1UH3A 3QZWB 1TZIA 1DQML 4LHUD 2VDQL 1JHLL 1LP9B 4NRZB 4IRSD 1G0DA 5ID0A 4U4BA 2ZNWA 2RFXA 1FBIL 3ZHKA 5EUOF 2BRQA 1SJEB 4MAYB 5IVOA 5ACZB 1LK3H 1T20B 4FQPA 4HPOL 1T22B 3NPSC 3OAYK 3FO1B 3QI9A 2QADB 4ODXB 4XBGA 4U1MB 4KJPC 3MSPA 3P77A 2XWBA 2W0PA 5C0GA 3OXRB 4HKXB 4MS8D 2QSTA 5DXWA 2VMFA 1MRCH 4ZUVB 2YRZA 3FQWB 4HQQL 4X6FA 4FXKA 4ONFH 4UDUA 2G75A 1YMME 3MRNA 2Z0BA 4GRLB 4LU5L 4OCRH 2FEEI 5KOVC 2J6EL 4U6VL 4E5XA 2E7HA 2QLVB 4NC0B 4XVTL 3O9WB 4O51A 2FWOA 2VLKA 4G6FB 4WFHD 1XIWD 1OGAA 2DQDL 5FFLA 5EA0L 1T21A 1T4KB 3B9VA 4LQFL 5I17B 1QTYT 3KDMB 5SWSB 2E9JA 5JMOC 3BKCH 1WQVT 5GJSL 5A3IC 3ARBB 3EDEA 3SJVA 4KI5F 1TNNA 2A6DA 2HT2D 5C07D 2LV4A 3TNNA 4U3HA 5D1QD 1TQBC 3MUGA 5JR1H 3QH3B 4PRIE 1T89A 1A6TB 4R4NC 1QPXA 5HHXH 3LB6D 3QUYB 2YD3A 1KJ2A 3QIUA 3W9DA 3QJHB 5CMAB 4Z7NF 1KG0A 2FHFA 4QRRE 1S9XB 3FFCD 3AY4A 3WFEL 1OAUH 4ZFGL 5I1LB 2YR3A 1MAJA 5DJ0B 3BQUB 3U9PH 1WBYA 5IB4B 1CFQB 1KULA 4JFDD 5C0CB 2XZAH 3N1QC 4YDJA 1CT8A 2DF3A 2O5ZL 4R9HA 4NCC1 4PJCA 1KJ3L 1T7XA 1F42A 1C5CL 2P5WE 4EN3D 3MA9L 2H41A 4C54A 1EMTH 1EX0A 4ZAKD 1J1XL 2F5BH 3QDJA 4OI9A 3H2WA 5HI4C 4JQIL 4EKXA 5IB2B 1OAYL 3TESA 4WO4C 3KLDA 2FJGA 1YC8A 3K80A 3FTGB 2NTFA 2G9HB 1NFDA 2F58H 1AD0B 5BV7L 2BVOA 2VZTA 1N0LA 1NEUA 4KQ3L 5B22A 3WXVL 5EZIL 1F4HA 3GNML 1FORH 3D0VB 1NCBL 2OSLA 3MV7E 1H5BA 2NNAA 3O2VH 2MTPA 2A6JA 1YNTB 2ESVA 4IOIA 4Y4FA 5E5MB 4GKNA 3VXUE 1OWRM 4UIKH 4KUZH 1Y0LA 4KFZC 4PGBB 1J1OL 4NP4L 2QL1A 2OP4L 3NCJH 2YPKA 2WBJC 3MNVB 3D9AL 1A6UL 1C1EH 4MJ6A 2VB5A 3WJLC 4J8RB 1F3RB 4MSWA 5I73C 5J6HA 1NGQL 5DJAB 5ESVB 5HGAA 3WUWA 5JIKA 4M1DH 1M05B 4WFGE 2HG5A 3QFJE 5GGTH 1ZGLM 4YWGH 4PJ5D 1RZ7H 4M7LH 3P4NA 3HPJB 2BZDA 2CDGA 1NC2A 1S7XB 1MFCH 2YHGA 5GGSB 3IXTA 2IAMB 3I3DA 1WVZA 3A6BL 3P4MB 4PG2A 5ELIA 4C56B 5D5MF 2HA1A 4FG6C 5KSAA 1T1WB 2YPLD 5EU5B 4PR5A 5IVXF 3OAUL 5F8RC 5E00A 4PY7A 4V1DD 1KPUB 4S1SL 4OTXH 4YUEL 1DQDL 1KXVC 5TE6L 3W11C 2EH8H 1OSPL 5FOBB 4UB0L 1QBAA 1J9CT 4L8DB 4OCXH 3DX6B 1CL7H 1Q94A 2OJEB 3BFOA 3QWRA 1V7NH 1HN1A 3RWIA 3OKNA 1I1FB 5DHVB 5F7HA 5KOMC 4FFVD 4U6YB 4UILH 4NQDD 2NLJA 4HAFA 3OG6B 1SEQL 5JXEA 3FN9A 1G7IB 4OLEA 1JPSH 2PW1A 1ERNA 1D9KA 1INDL 1NANI 3HAEG 1I1AD 3JV0A 3D85D 4NKDA 3T0AA 1ES0A 3I9GL 3HMXA 4GMSL 1ORSB 5CWSA 5FUZH 4MAUL 3PE9A 3MLRL 1TZIB 2XQYG 5ID0B 4FQQA 2RFXB 3DLQR 5E2VH 2EDHA 1KN4H 4JZJA 3VXQB 4LGSB 1HH9A 1U9KA 3SDCA 3E6FA 3JWDL 4XBGB 4JM4L 3P77B 2XWBB 5C0GB 4JHZA 4L8BA 5J89A 1L0XA 2GY5A 4U7SA 3D2UA 4MA7L 1FYHB 2H26A 1AR1C 4HZAA 4XBPA 4X6FB 4FXKB 2JK5A 3GJFH 5E4IA 4UDUB 3MRNB 4E5XB 4EDWH 4CL7A 1QVOA 3MZGB 1FYTA 2ZKHL 4KQ4H 3RIAF 3TFKD 1FGVH 4O51B 2FWOB 1J12A 4EXKA 5D70L 2VLKB 4S1RH 5E4EC 5DUML 1OGAB 3GB7A 2OZ4L 3U79A 1FE8L 4J3VA 1T21B 2FGZA 2ICWI 2QSCH 1RD6A 1NUFA 6CGTA 5HGHA 1CK0H 4Z76A 4KMTH 3SJVB 3SQOH 4MVBD 1CLYL 1HE7A 2A6DB 1EUTA 3I2CH 3MLPA 1CD0A 3O2DH 3TNNB 5CJXA 3RWHA 3MUGB 3QPQD 3NIFF 1S8DA 1CGSL 4QTIL 3D3VA 3UP1A 4YQXH 4KZDH 2BSRA 4LSPH 3VXSE 1T7VA 2VZOA 1ZSDA 4J3UA 3V4PH 5E6ID 1KJ2B 4P3CH 3RHWF 3QIUB 5CEZD 4MJIA 2WLZA 4P2CG 3W9DB 1UADC 2P7TA 5C08D 1SJHA 1FG2A 4Q74A 1MAKA 4CKVX 5E03A 3L6FA 1MQ8A 1WBYB 3X3GH 4OZIE 4YDJB 1CT8B 3SCMA 4PJCB 3X12A 3VD4A 2AJVH 2FX9H 5KVEL 4WI2A 2KH2B 5C6TL 1GOHA 4L4VE 1K6QL 2FJGB 2YD9A 3RIFK 2NTFB 2J8HA 2P4AB 1XGTA 1HH6A 1NFDB 1N3NA 1IT9L 1OB1A 4PJHF 3MCLH 4O02H 5I1AA 5IVNA 1JMZA 4IBLT 3RGVC 3CFCH 4N8CL 1MELA 2BVOB 1CF8L 4W4OC 4Q6IA 1CS6A 2B1AL 1D5MA 3MRFA 2HT3D 1NGPL 5L6YH 3RL1A 1YNLH 4OQTL 1FPTL 2PTUA 2OSLB 4U33A 1H5BB 2NNAB 4NO0A 5KBNC 4B53A 2A6JB 2ESVB 4YK4B 4IOIB 1ONQA 4Y4FB 4GKNB 5BW7C 1LO4L 4OI8A 5T1LD 4LF3A 4NO2B 2HT4D 4NQCE 4OB5H 2Q8AH 4JFQA 1Y0LB 5TF1L 5D1ZC 2YPKB 1PDKA 5EOQL 3TA3A 2EO1A 1ZMYA 3UDWA 2Q7NA 1YYMH 4MJ6B 3B9KA 3RGHA 4MSWB 5J6HB 4J2XA 3SDYH 2AJXL 4QXTA 1NCWH 3BKMH 3P30L 4G8GA 5HGAB 3ZDZE 5CBAA 2HG5B 3NPZB 1AD9B 5SX4I 4O4YH 5HDOA 5DMGC 4X7DC 2XN9E 3NAAL 3QXVA 3AGVA 3P4NB 3U0PA 5LGHL 3VWJA 4X8XA 3BVNA 5DJYA 3MUHL 4XMLH 1U3HA 5DJZA 1AFVL 3GSOA 4RFEB 2CDGB 3QIWC 3EYSL 1NC2B 1SYVB 2CSPA 4ISVA 1B4JL 4JY4A 3FCTA 2VABA 5KSAB 1CGVA 3VFNA 3BN9D 4LSUH 4PR5B 4OGYL 4I2XE 2JJUA 3JUYA 2PTVA 4MQTB 5E00B 1ZLSH 4D0BA 1MCSA 2VDRL 4PY7B 2ICCA 2QSQA 2Y23A 3ARXA 3HAEA 1A22B 3CMOL 3WCYA 1NKOA 4NQEA 1W0VA 4JDTL 2BCKA 3LEYL 5IF0B 3TO4A 5I1GL 5F1IA 2A9NH 3F12A 1Q94B 3DV4A 3ZDXE 4ACPA 3RWIB 4NFCA 3OKNB 5J9PB 1FNGA 2DQEH 1SBSL 2UVFA 4BZYA 2NLJB 4KMLB 4XMKL 3WO4B 4BQ6A 5DT1H 1II4E 4HMDA 2O5XH 2PW1B 1AH1A 3UTTD 5J13C 1D9KB 3QNZB 3I84A 1IBGH 4NKDB 5BS0D 1HHGA 1ES0B 4PBWD 1JE6A 2EYRA 4JPIB 5CWSB 3MLTA 3QEGL 4PP1D 1U3JA 4ZOEA 4EDXA 4OIAA 3C5SA 2AXHA 4FQQB 4QT5A 3B9EA 4YHYB 5D6DC 3N9GL 5L8LB 4NC1C 3ULSB 2G5BA 2DQCH 4P59H 1T5WA 4JZJB 4U1NA 1HH9B 4LPYA 4NC2B 4URTB 5GS0L 1AKJA 1B2WH 2W92A 3E6FB 4XWGH 5F7LB 4GG6E 2J6EA 1QRNB 1G9MH 4L8BB 4X4ME 2DTSA 1R24A 3HE6A 2H26B 4PJXA 5C9KA 3VG0H 2X1WL 1KYOJ 4XBPB 4CW1A 1YEDA 4NNPL 4LDOB 5GRJH 3BDXA 3CSGA 1C8PA 1QHOA 5GSVA 4WI3A 3AAZB 2A73A 1E6JL 4IOSD 1QVOB 4LKCB 1FYTB 1TJHH 5HYSG 2EEBA 4XHJC 2X4OA 3ROLA 1GIGH 1U91B 2EE9A 3GB7B 5E6YA 2NYYC 4TUKL 2AJUH 3TO2B 4FQHA 1LVEA 1G1CA 3U0WL 5HGHB 1MJUL 4XI5C 4Z76B 4E0RA 2BSTA 4UNTA 4UBDD 2VDLH 1N4XL 1P4IL 5E9DD 1IL1A 4WI9A 4FFWC 3MMEA 1QHPA 2EDFA 1S8DB 4DK3A 32C2A 1U8NA 3MRLA 4N68A 2BJMH 1UYWL 2L7UA 4APQC 2BSRB 2X4UA 4GG6F 4LCYA 3WNNA 1ZSDB 1S7RA 4YHOL 1YN7A 4MJIB 1P69B 4OLXL 2YBRA 2P7TB 1SJHB 1H8NA 1FG2B 3RY4A 1GGIH 3L6FB 4OT1L 4JFXA 1PYWA 1PJ9A 4DZ8A 3CDFA 5AZ2H 1CICC 3CX5K 3SCMB 1KCVH 1MJ8L 3N85H 1LD9A 5IMKA 1JGLH 3NN8B 3F6IA 4XX1G 4X80H 1MHPL 3X12B 2AQ3A 2ED8A 5A2JH 3I6LD 2WUCL 4DKAA 4PB9H 1CBVH 3MROB 1KPRA 3GJEA 1TTFA 2DL9A 3RZCA 4Y16D 5D9SA 2GTZB 5EWIL 4YBHA 1XGTB 1HH6B 3ULVF 3BP6B 2CIIA 3Q6FA 1N3NB 3V6OC 4AEHL 2LE9A 5B38G 5I1AB 4U2YA 3REVA 5FEBA 3QHFH 4Q9RH 2GCYA 3LRHA 4DN4H 4Z0BL 4Q6IB 1WZKA 3ARDA 1D5MB 3SDDA 1SHMA 3MRFB 4PJEF 1B0WA 1UM6H 3RL1B 3BT2H 1SY6H 1BQLL 3BWAA 2IG2H 3AB0C 2JB5H 4NO0B 1YEJL 1ONQB 2AJYH 2LU4A 4Y1AA 4LF3B 2IANA 2DLTA 4G42A 4JFQB 3WIHL 2E9IA 4LCCC 2F15A 3CVIH 4PJ7A 3TA3B 4NN6C 3DSFL 3B9KB 1OOAA 1MFBH 1QLEL 4K7PH 2GJ6A 2ORBH 3PWNA 4R0LC 4HGMA 3MREA 4QXTB 4DUVA 2DQUL 4G8GB 3HE7C 2BDNH 4EOWL 5E8EA 5CBAB 4MMZC 5ADOH 3W0WD 5L7XH 1YEIH 3B9DA 4NGHL 3U0PB 4DZBA 2IH1A 1JGVH 3BVNB 5DJYB 3NFSL 5DJZB 1U3HB 2A77L 3GSOB 4JFEA 4J3TA 2I9LA 2AQ1A 2UZIL 4YDIL 4EI6A 2ICWJ 3M1BB 4TVSa 3K4ZA 4JY4B 2X6MA 2PN5A 3FCTB 2VABB 4HF5H 3VFNB 1AIFA 4PJDF 3K8LA 4L3EA 5KVDH 1NGWA 1K3ZA 4D0BB 4CADA 4I1NB 2DBLH 3E0GA 1E4KC 3HAEB 3QEQE 4J4PA 5DO2D 1QSZA 1O5DT 2CK2A 2YXFA 2GT9A 3VRIB 3T09A 2P44B 4NQEB 1RURH 4TVPD 3ZYZA 3HNSH 1W0VB 2BCKB 2VUOA 4E41A 2DB8A 3TO4B 5F1IB 2YEZA 4HWEH 2XOTA 4OKVA 3F12B 1MFAH 3DV4B 5FCUL 3QG6B 3MV9E 3UPRA 2DTMH 4JQVC 2Q76A 1FNGB 3NFNA 4X6CA 3NIDF 2O93L 4TSCL 4F80A 5HHPA 4DAGH 5FA4A 5DVMA 1Q9WA 4X7TA 3RY5A 1GSMA 3F58H 4LLQA 3QSKB 4P2OD 3IGAA 5IT2H 4PUBH 5FYLE 1HHGB 2EYRB 3IFLL 1U6AH 3MLTB 3GHBH 2HLFD 4ZSOA 1HHIA 4KI5D 4NPYA 4EDXB 3KPRA 2VDOL 3C5SB 4U3XA 3IDMA 5HYSA 1A7RH 4QT5B 3S36L 5EU3A 4V2BA 2G5BB 1RJCA 1WZLA 1T5WB 4XC1L 4U1NB 1MVUA 2E5EA 3IJHA 2AAVA 3RTQA 4I13B 2H1PH 1AKJB 2X4PA 3LIZL 4NKIL 3STBA 2XXMB 3LZFH 1N8ZA 1F4YL 1FHGA 2FEDD 4F9LC 1R24B 2PETA 3S88H 3N06B 4R8WL 3FZUD 4PJXB 3SOBH 4YHIA 5BQ7A 3WS3A 1K9TA 4CW1B 2OZ4A 3MV8D 5GSVB 3EDDA 5MI0C 2A73B 4ERSH 4RMSA 2FGWL 2X4OB 3ROLB 3WNKA 1G6VK 4POZC 1FFOA 5MEPA 4GW4A 3C6LD 1MCDA 4QXGH 4FQHB 3HR6A 2YD8A 4E42A 5C1MB 4MCZA 3DMMD 1T7ZA 3O4OC 4KVNL 4GMTL 4E0RB 2BSTB 3WLWC 3TYGL 5CSBA 4Z78A 1IL1B 5HHOD 3MMEB 2ADGA 5KSVA 3M8OH 2EC8A 3P9MA 4YLQT 3U7WH 5MEOA 1ZHKA 2HFFA 2ILLA 32C2B 3ARFA 1U8NB 4JE4B 5KN5A 1VSCA 3MRLB 2J8UF 2X4UB 1LMKA 4UUJA 4BZ1H 4LCYB 1S7RB 1VFOA 1YN7B 5I19L 3T0XA 2NY1B 2VLJE 3KXFD 2VOTA 1PGRB 2YBRB 5D71L 4WFEE 2JIXA 3C87A 3U2SA 2JJTC 3PV7A 3VFRB 4M93C 2UWEF 1AI1H 4JFXB 3O4LA 5B38A 2CRMA 1PYWB 3BGFC 4KUCF 4IS6A 2NXZB 1FH5H 1HQRA 3RJDA 3ES6A 5EO0A 25C8H 1I1YA 4DK6A 3TBTA 2ZCKH 5IG7A 1LD9B 3HFML 1T0PB 5IMKB 1J8HD 1VESA 1YY9C 1QOKA 2J12B 1VB9A 1JNNL 4DKEL 2VDML 3U30C 5KZCB 3H42H 3CCHA 1AHWC 5IMLA 4MHHG 2IGFH 5IWLC 3GJEB 4RISL 5LBSH 4LSRL 5BV7B 3RZCB 3V52L 5T1MA 2BRRH 5D9SB 2J1KA 5D7IA 4MA8H 3PQYE 3GSNH 4IIQA 2CIIB 2V7HA 4JKWA 1BX2A 4OQTA 4Q58C 3REVB 4DVBA 4RFNC 2GCYB 2A0LC 2C7UA 5FUCC 5E2TH 5HI3D 1KEGL 1JZ6A 3MBXL 5J11C 2Q87A 2ARWA 2KPNA 5TH2A 2VZ1A 3SDDB 3ARVA 4KHTH 5TDNA 4YHPA 4NWUL 1MCPH 3C60D 1I3GL 2LTQC 1NSNL 4F7EA 1B0RA 5GRUH 2FX7L 5HYEA 1MREL 4Z7OF 2IANB 3OX8B 4G42B 1WGOA 4XP1H 3Q1SL 3HA0A 1FL5A 2C4XA 4PJ7B 5CINL 4LIQE 2H45A 3LKNB 1LGVA 3VXMD 3FN3A 4EUPG 1DDHA 1HK6A 5FECA 2GJ6B 5DEZA 2ADFH 5EG6C 3PWNB 4Z8FH 4N1EA 3MREB 2QQQA 2F19L 4TTDD 5DD1H 5E8EB 2D0GA 3TJEL 3SKMA 2VXSL 5LKNA 3L5HA 2XWJA 5LWYL 1N59A 3E2HB 4DZBB 1M6OA 2IH1B 4XGZA 3TT1L 1MSPA 5B8CA 5IIEB 4JFEB 1KLGA 5CFHA 2I9LB 3QG7H 3TLRA 1QD0A 5J06A 4G9FA 4M6NH 2E9BA 1A7QL 4JGMA 4KKLC 1F6FB 3QHTC 5SV3A 1AIFB 4JFPA 1FFNA 1NL0L 3T1WA 4L3EB 1NGWB 4PJ9C 4U1KB 4H88H 5C6PB 1OW0C 5GGSY 1IAII 4NWTH 2BNQE 3WN5A 1HDMA 4M62L 1HHJA 2N7AA 5T5NG 2GT9B 4Z7VB 1AJ7H 3AROA 1JUFA 2B8OT 4JPWL 3RWDB 4YXLL 1T2QL 4GOSA 5CP3A 4PJIB 5I16A 1P6FA 3QUML 3B3IA 4JKPL 1TIUA 2IFGA 4E41B 1UJ3A 5ILTH 2B20A 2B5IC 2OXGA 2NW3B 3HN3A 1H0DA 2YEZB 4P9HH 3QUZC 4CNIA 3UPRB 4DCQA 5C07E 2HMID 1OD7A 3WS6C 3NFNB 4X6CB 1CGYA 2GYSA 5GRZA 4KH2A 5HHPB 4I0PA 1Q9WB 4KKBD 4X7TB 1AO7D 4LLQB 3EOTH 1RZKC 2X89A 2JE8A 3IGAB 1VEOA 4LVHC 1UACL 3ALPA 3FFCE 3FN0L 2FEEL 4YC2B 2IMMA 4ZSOB 4NPYB 3KPRB 3E1F1 4XNZC 5I9QC 3IDMB 2YKLL 4JFDE 3SO5A 1I3VA 4GUPA 5L9DH 1N5AA 1P4BH 4OM1L 1VFBA 4J1UA 4FS0A 2V5YA 1DZBA 5D1QC 4OQ1A 1MVUB 3IJHB 3RTQB 5H37G 3V5HA 3RAJH 2L4OA 1BPVA 2X4PB 1WZMA 4LPWA 4M1CC 5GRYA 3HB3D 4KDVA 1EERB 5ISZA 1VHPA 2EXYD 4RMTA 5DD3L 4FQLH 3BUYA 3RIAK 4D8PA 4YHIB 4X7EC 5BQ7B 3WS3B 3H9SD 3MXWL 4HV8A 2VLRD 5ALBL 4KV5E 3UZVB 1CD1A 1NLBH 3ESUF 5I1HL 2DLFH 1A9EA 1AC0A 4MNQA 4WHCA 5IW1A 3E6HA 3CD4A 2V5MA 1GHFL 1FFOB 4BUHA 5MEPB 3MYZA 4M7ZB 4GW4B 1ZV5A 5F3HA 2X10A 4E42B 1MCLA 4MCZB 1NMCB 4JFZL 1L7TL 1X5FA 4PGEA 3RNQA 1KIUA 3RX7A 1B6UA 2B0SH 4ETQB 4Z78B 2CR6A 2VRAA 4LVEA 2ADGB 4NN7C 3MTRA 3NA4A 3P9MB 3CXDH 3RHWK 3PDGA 1ZHKB 3ARFB 5KN5B 3MJ9H 2BVUA 4LARH 1NCDL 3P11L 4G6JL 1FDLL 1FFPA 1U8OA 3RU8H 1YDPA 1O7SA 4HXBH 1FV1A 2NXYC 4EI5C 1EAJA 4F3FA 1CXIA 1HILA 3U2SB 1TETH 4S1QL 3ARWA 4PJ5E 2FBJH 3HCVA 1S9WA 1MWAL 1UCBL 3F7RA 2EDNA 4UINH 5GJTH 3O4LB 5B38B 3HNTH 4IS6B 3GBMH 1HQRB 3LQAH 4R7NA 4C58B 5EO0B 1I1YB 4U05A 4OLYH 5IG7B 3TBTB 1D5BA 1T03L 2IEPA 4HGKC 2IFFL 2YPLE 3N1PC 2Y7QA 3WFDH 4NN5B 1X5ZA 1F4XH 3CCHB 5IMLB 2XKSA 4Y89A 5TPWH 4ZQKA 4V1DE 1D6VH 1CG9A 4X7SH 2AABH 3PWPA 1E27A 5EFIA 1S78D 5T1MB 3HG1A 4C55A 1E6OH 3G5YA 3TN0C 4ZTPH 4IIQB 5TDOA 2V7HB 4EUPA 1BX2B 4JRXD 2BXZA 2HKFL 3EOYG 2C7UB 2EDXA 4OBSA 4ZODA 4JPVH 5TH2B 3SBWC 3WIHA 1KBGL 4FQXB 5TDNB 4KJWD 4NQDE 5A2KH 1N0XL 4OLZH 2DQJH 1DQLL 3RUGE 1B0RB 4OGAC 2P5ED 1ETZA 4N1CA 4MXVE 5K9QI 3RRQA 4NNXA 1QR1A 2DN7A 2Y9RT 4K3GA 2ZCHH 1FL5B 1RIVH 3SE4C 3VGDA 4PLJD 5KS9A 3REWA 4HH8A 4HJJL 4NUGL 4PJBA 1P6AB 4ZUWA 1DDHB 3THML 5FECB 3QXAB 1RPQA 3DYOA 3WIIL 3O6ML 5GZOD 4ZG1A 3NACH 3QCUH 4RSVA 3SKMB 5GS3A 5IB3A 1YZZA 4WW2A 2XWJB 2IJ0C 1M6OB 4XGZB 5B8CB 1CXFA 1T0MA 1KLGB 1N5YL 4S0TD 4G7YH 3CSYA 1PG7H 4TPRL 2NY3D 4G9FB 4M6ML 3TZVD 3VMOA 4TYUA 4NO5A 2X4TA 5DWUH 4RNRA 1A6WL 3MJGX 3QWQB 4PJCF 4JFPB 1FFNB 3U4BL 3UZEA 4OGXH 4O2CA 1FNEA 3WN5B 1HDMB 1R3KA 3EJZC 1HHJB 4XPTL 3MNZA 1JUFB 3BGAA 2FSEA 3S9DB 5I16B 4O00A 3B3IB 2V7NA 5C0RH 3EYVB 3SE9L 1UJ3B 2EYTA 1G6RL 3ROOA 1XR9A 4RX4D 1ZANH 5EO9A 1H0DB 1F58L 1GXEA 4HUWA 4CNIB 1NFDF 3MZTA 4OBRA 4RGNB 4DCQB 4TULL 1BIIB 2ZJSH 4NZTL 3WL9A 3NGBC 4I0PB 2VKXA 3C8KA 1OF2A 4DOHE 3RBSA 3CFDA 1Z9LA 1F3JA 4QHNA 3D25A 5CEZE 1G0XA 4PJGE 4PV8A 4KRLB 1DEDA 3S36X 2PO6A 1BD2A 1IAMA 3LRGA 5H8DA 5CJOL 4BELD 2DIAA 4NSKA 2ARJQ 3T8XA 4RDQG 1MCWM 1X4YA 2W0FA 2CGRH 4X4YA 2JELH 1D5IH 4GUPB 1N5AB 1A4JA 1VFBB 4J1UB 3IRZA 3ZKSD 1AXIB 3V5HB 1QO3A 2VQTA 4IM8A 1WTGT 4FMKA 4KZEH 2R9HC 4AMKL 4A2MA 3WFBH 3BDYH 3CLFL 4JAMA 5ACLA 3OAZH 5ISZB 4YFLF 1NMAL 1FSKC 3ULUH 3BUYB 2NX5D 4D8PB 2PUQT 4GBXD 3JVGA 4HV8B 1CZ8H 2AERT 1CD1B 3ARGC 2FZ3A 1A9EB 4MNQB 5IW1B 4HPYH 3T1FA 3O41A 3E6HB 2E7MA 1YMMA 2EECA 4WI7A 5FGRA 1IGIL 2DQTL 5F3HB 3SKJL 4KWUA 5DF0A 1K85A 3PIQA 1FN4B 4JO4L 4NJ9H 4G5ZH 5FF6A 4PGEB 3MQIA 3R1GL 3RNQB 1DBAH 3QIBA 2DMCA 5MHSD 5E8OB 2BY1A 4Z7QF 2CMRH 3ARED 1A7BA 1F8TH 3ULVD 2GAZA 4M61A 2BVQA 5BO1H 3NZHL 2AEQH 3FRPG 1EH9A 2XTJB 2UUDK 1U8OB 4ZNCD 4G6AD 4BH8A 3PG2A 2DQHL 4PRIA 3A6CL 3VD5A 3O45A 1FL6A 4F3FB 1HILB 4XMPH 1G7PA 3HCVB 1S9WB 2PF6A 4PGCA 2JJVA 5DTFB 3WD5H 4WO4A 1JZ5A 4QRRA 1MIEL 2D7PA 2CRIA 1YQVL 4R7NB 5A2FA 2BSSA 3ALWA 5I0DA 1JGEA 2EEDA 1D5BB 2ID5A 3BRFA 1I4FA 1T7WA 2Y7QB 3DETC 2P42B 3OTTA 4KK5C 1CDCA 1Z3GH 1FNSH 4ZQKB 2C3HA 1KCRL 2IBBA 1CG9B 1FNLA 2P5WA 4HBCH 3PWPB 1E27B 5EFIB 1ZT1A 3HG1B 2J88H 35C8H 4TNWF 2D7OA 2WQ8A 4TRPL 3KPOA 5TDOB 4EUPB 3EJYD 4ODTL 1L9NA 5JHLL 2WBJA 5KJRL 4FFYL 2XACC 3G04A 3ZTNH 1IGCH 3O6FD 3MCKA 5JZ7D 1CDBA 3HR5B 4UIMA 3R8BB 1H15A 1UWEH 4P2QD 5CJ5A 5HVWA 3EIFA 2AK1H 2WP3T 3VXOB 2VWEE 1EVTC 2EH7H 4GRLC 1T7YA 3UTTE 1ETZB 1QR1B 3C5JA 3MV7A 2AI0H 1A5FL 2OR9L 3REWB 2BP3A 4KROD 5IHUH 3WHE1 4PJBB 2H32A 3VRLF 3RVWD 2Z31A 1DSFL 4ZUWB 5AAMA 1CN4A 2CJUH 1BFTA 4ZFOL 4QRTA 1ZTXL 4YFEA 3ARBC 3CXHK 4FP8H 5IB3B 4Y4KA 2XA8H 2YZ1A 5T5FL 5I8KH 1BQSA 4J3WA 4WW2B 2W9DH 2FO1A 4KVCL 1JV5A 4KKCC 3HC4H 1T0MB 5FGCE 5T3XL 4Z5RA 1DN0A 3GRWL 1X5KA 1J7VR 3QFJA 4DEPC 3CSYB 3QUYC 5BVPH 3GK8H 4YXKH 4HLZH 1KFAH 3BMWA 3GI8H 2X4TB 4RNRB 3QUMA 4KK6D 4TSAH 5SX4H 5E2WL 1JFQL 2D7QA 1FNEB 1RUAL 4WV1C 1R3KB 2VC2L 5E8NA 2I5YH 2A1WH 2XKNA 2FSEB 5CIPA 2HRPL 4AQOA 4WUKH 1REIA 4P4KB 4UOW0 5H94A 5JW4R 2V7NB 4M43L 4XC3H 2EYTB 3ROOB 1XR9B 5EO9B 2NY0B 1A8JH 4HUWB 1M71A 2V17H 3UAJC 4ZNEE 5C3TA 4K23L 5E9DE 4OD2A 4K3JH 3T77A 2BMKB 4G6KL 5ERWA 5E6ZA 4L9DA 3WL9B 1FL3A 2XRAL 4DQOH 3C8KB 5GGRA 1OF2B 4LLMA 1I8LC 1E4WL 3CFDB 1E4XL 1F3JB 2EKJA 4QHNB 2ZCLH 3D25B 1RUML 4PV8B 3O6LH 3NPSB 4J3SA 1DTUA 1BD2B 4K07A 5C0IA 2OR7A 1T5XA 3CPLA 3GM0A 1CXLA 4NSKB 3T8XB 2VDKH 2W0FB 3LCYA 4FQCL 4X4YB 4K8RC 4HIXH 4UBDC 3R4DA 1A4JB 4Q9QH 1MAMH 1QO3B 1FVCB 3R06A 4FQJH 2W91A 3I6LE 2R4SL 4JAMB 3QQNA 5FYLL 4GAJH 1MY7A 4ENEC 2COQA 3TVMA 4K9EH 5FO8B 1JHKH 4MQXC 4P0DA 5IJVA 4KUCD 5FKAA 3FRPA 3QRGH 2EO9A 3HUJE 2MMXA 4OF8A 5ICXA 2FZ3B 3I75A 4G80A 3I3BA 2N4IA 2JCCF 1TQBB 3T1FB 4PS4H 1YMMB 3CLEH 1XF5A 1IKFL 4WY7L 5F7YC 1JRHH 2QADD 3PIQB 4XNUH 4B7IA 5DEFA 2NY2D 1CU4L 5CGTA 4PJ8D 4HT1H 3QIBB 5KSBE 4ONGH 3C08H 3AVEA 1PAMA 5E2UL 3DNKA 1IM9A 2BHUA 1DR9A 4M61B 2FJFA 2BVQB 4KK8C 2FATL 4O2FB 5DS8A 1BBJA 5CEYA 1MWAA 1WFNA 1JTOA 1MIML 4M7JH 4OIBA 3VFWA 5C0BA 4NQXA 3CUPA 4JRYD 2PCPA 5D7JA 1W2KT 4BH8B 5K59F 3NBNA 3O9WD 1RMFL 3T0VA 4PRIB 4G6FD 1U8IA 1U41A 2Y72A 5FYJD 2Z35A 1FL6B 3W0WE 1H3XA 3UEZA 1Q72L 3VXNA 3VXSA 3TH2T 1G7PB 1R3IL 1PZUB 4DKDC 2A9MH 1KIPA 7FABL 4WO4B 4RFOL 1JF1A 5GIRA 2BSSB 4WI4A 4FZEH 1JGEB 1QNZH 4JFOA 3DO3A 1I4FB 3DGGA 1TCMA 3VFSA 3RGVA 3ZKMC 4OZIA 5EUOE 1DLFL 1RZFH 1HI6A 2P5WB 1DBJL 3V0WH 3L5XL 4I77L 1ZT1B 3AS3A 3KG5A 4TVPE 4F58L 3UYRH 3BQUD 4PJXF 3KPOB 2YD1A 5BW7A 1WTLA 4QRSA 3QI9C 1IEBA 3HZVA 4WHDA 3TM6A 4R6UA 5DD5L 3DXAD 2WBJB 1RIUH 3F8UB 5DVNA 3MNWA 4CVZA 1M1SA 3G04B 4WNQA 3MCKB 5FYKD 1R5VA 3TH4T 4UIMB 5I73B 5JQHC 3VW3L 1QFPA 1WAAE 1QSFB 2GSIA 3BEWA 2HH0H 4LAJH 2YPVL 3C5JB 1CE6B 5IHBA 4LLAA 3CX5J 2C4FU 2H32B 3SDAD 2Z31B 3MRJA 4KI5E 1NAML 2BX5A 5IB5A 4HFUH 4NZUH 2QSVA 3LN4A 1KTDA 4OIIH 4QRTB 3ULUF 1HXMA 5DGRA 4Y4KB 2F5AH 2V2WA 2C1PA 1JV5B 4YIQA 4LHJB 3ZTJH 4Z7NE 4Z5RB 1DN0B 4HWBH 2GTWA 1MQKH 4ZUUA 4YHZL 3BZDA 4MMXC 3FB8A 1JYWA 3L3KA 1RZJH 1AGFA 2QHRL 2Y36H 5F9WC 2XN9A 1I9IH 4UDTB 3T0EC 2F54D 4JN1H 2WSKA 3G6AA 4I3SH 2EZ0C 4IDLA 5FM5M 3QUMB 3VGHA 3AY4C 3NCYS 1MNUH 3MFFA 3QDGD 1G6RA 1J1PL 1MCOL 3NIGE 2FR4A 3RX5A 5E8NB 3PV6A 4ODSH 1RSFA 3LY6A 1IAIM 2XKNB 4IMKA 4J23A 2CRZA 3MLUH 5CIPB 5C2BH 2ZUVA 2ARJA 1PKQA 3IDJA 5H94B 3GI9H 3TWCH 4NRYA 4EJ1C 1H3UA 3UJTH 1M71B 1NUNB 1CGUA 4FMFA 4BFIA 2OQJB 2IAMD 3OAYH 4F15B 4OD2B 4C56D 2VLLA 3T77B 1KELL 5DQ9A 5D8JH 3S3SA 3B8YA 3I6KB 4M5ZL 5FOJA 2HTKD 1FL3B 1RZKL 3CH1A 1CXEA 1RUQH 5GGRB 4OGZA 4LLMB 5D6DA 1EFXA 15C8H 2R0KH 4UT9H 1DL7L 4J6RH 2MSPA 4CMMA 3QJFB 5IEHA 3KXFE 2WINA 4R26L 3U0WH 5E99H 3MR9A 3KPQA 1C5BL 2JLLA 5JW3H 3ELAT 3V4VL 3I50L 5C0IB 1T5XB 3CPLB 2C5DC 4YZFF 4UV4L 3DMMC 2IQ9H 4PJ7F 4LIQH 3L1OL 4OM0L 4CBPA 1H5BC 3J7HA 4EBQL 1R3HA 4Y4FC 4U1SB 5C0AA 4JY6B 1QBLL 1J8HE 1Y18A 3R06B 1N64H 5J1SC 4XCFH 3SKOA 3EYUL 1EEYA 1FAIL 1J0ZA 4M1GL 4Y19D 5E4EB 3TVMB 1AY1L 4OCYL 5IJVB 1IMHC 1VPOL 3DTXA 1LE9A 1DE4A 4G8FA 4RAUB 5FKAB 3TJHD 5TQ0H 4X4MA 3W81A 2WZPD 4G6ML 5ICXB 3I75B 4MLIA 4G80B 5KVFH 1OM3H 5D5ME 1FGNL 3MO1A 2IH3A 5IVXE 2YN5A 2W9LA 5HXMA 5C0ND 3LEVH 4C57C 4PG2C 2CD0A 4Z7VF 3V0VB 4Y5YA 1VENA 4ODUA 3SGDI 2VZSA 4MWFA 4PJIF 5DEFB 1URLA 5F7WC 2G2RA 1IM9B 4WFFD 2FJFB 5DS8B 2OJZL 1BBJB 1DBML 3L3JA 3RKDC 5CEYB 1OCWL 4M48L 4QRQA 4ZS6C 1YEHH 4CU6A 1MWAB 4IRZL 4X6CF 2CK0L 5C70A 5E08H 1UEMA 3VXME 3VFWB 5C0BB 1J87A 3CUPB 1GOFA 2PCPB 2YK1H 4NQXB 5D7JB 5F6HJ 5GHWL 1OQXA 3BKYH 4CN4A 1WFTA 3LD8C 3LOWA 1HZHH 5DDHA 1BBDH 4QF1B 5IROA 3E8UH 1Z9MA 3RVVC 4TOYL 3VXNB 3VXSB 2FIRT 3MLSL 5DD0L 3ZL4H 1KIPB 3QCTH 5JXEC 3WO4C 5DHYA 4HGWA 2Y07L 4OD1H 1JF1B 5GIRB 3LH2L 3SJVD 4OLVL 3NCEB 4JFOB 3VRJA 2AXJA 3DGGB 5EN2A 2D7MA 3VFSB 1GJIA 3RGVB 4OZIB 2H2PC 3VA6A 3V79C 3BDBA 3DECA 3QIUD 1ADQL 5KVGH 1HI6B 1S7TA 3ZYIA 1RZ8A 3RP1A 1T80A 4LRNL 4ZUSA 1IGJA 4K2UL 2LFGA 5FO9A 3KPSB 3UPCA 3QT2A 2Y25A 4JO1H 1ZA3A 1BHGA 1G7MA 4JZJC 2V6HA 2ZG2A 5CD5D 2DQGL 3SDCC 5H2BA 1IEBB 3HZVB 4PTUA 1F2XK 2DYPA 4X8JA 4P5TA 4CVZB 2K1MA 4WNQB 3F7YA 5D1XA 3DUHA 4D0CA 1R5VB 4R0LA 3BEWB 2H6PA 4OCMC 3A67L 4NHCL 2VH5L 4ZFOA 3LKQB 5CS7A 3KLSA 1BM3L 1MEXL 3MRJB 4LEXL 1FFRA 5IB5B 2VYRE 1BEYL 1A7NH 4XPFH 3NIFE 4LLWA 3LN4B 4XVUD 5FB8B 1KTDB 5LQBH 1NCAH 1HINH 1HXMB 3UJIL 3SGJC 1MI5D 4LSSH 2PTTA 2V2WB 3DROA 2GITA 2C1PB 4S11A 1DVFD 3ZHDA 4YIQB 1E4KA 5F7EL 2ESVD 4Q6YA 5GGQH 4BSWB 4ZUUB 1NCNA 4GFTB 4PD4K 3FB8B 4UTBL 1AGFB 3L7EA 2VDOH 3DHMA 3UXFA 3OG4B 4Y4HC 2W07A 2XN9B 3IFOA 2QR0A 3BP4A 2A6KA 3H9SE 4FZ8L 5ITBH 2VLRE 3G6AB 3VMNA 5JXAH 3MFFB 2IPKA 1G6RB 3QISA 4YAQA 1OTTC 4NJAH 5F88A 2FR4B 3PV6B 3NTCH 3QHZH 2AJZA 1U8KA 2ARJB 4GW5B 3IDXH 1PKQB 3IDJB 4XPHH 4TUOA 3MBEA 4XCCL 1XAUA 2R69L 5T1KA 3AU1B 3HMWL 5J13B 1WC7B 4L29A 3PABA 4NRYB 2APTA 1IFHL 1BJ8A 1R3LB 4BFIB 2OK0H 5EORL 4M03A 4WGVB 2ICEA 2VLLB 1OHQA 2VXTH 5KSAD 5DQ9B 1N6UA 5DUPH 1IAIH 2J4WL 4OD3H 4YXHL 4PJHE 5IMOA 1NLDL 3CH1B 4X4ZA 2VDNH 1F4WL 5EPMA 2LVEA 1EFXB 5ICYA 1KACB 4N9GA 4Z95L 4CMMB 5IEHB 4HWZA 3MR9B 1CCZA 5LGKA 3WJJA 3GBNL 2OTPA 4A6YH 2Y5TB 4WI6A 4X9BA 1RULL 2D9QB 2R2CA 3P0YH 1AXTL 5I1IH 3GGWA 2R8SH 2R56H 4LPCA 3A6OA 3QWRD 4H1LH 5CILH 5JQ6L 3MOBL 4UOJA 5C0AB 1AP2A 1KCSL 5T33H 1L7IL 5DURD 1Y18B 5C7XL 3SKOB 4JHAL 5HHNA 1SJXA 4TNVF 3TA3C 1BQUA 3BPCB 5HHVH 4H8WH 4Q97A 1D9KD 4NFBA 1LO2L 1ZAGA 1LE9B 3DTXB 1DE4B 2DM3A 4G8FB 5HPMB 1P9MC 1CL7I 1GCFA 3QCVH 2VR5A 3V4UH 3NCFB 4JRXE 1YNKH 4G3YH 4XPBL 3VWJC 1FVEA 3VGGA 3G9AB 1U3HC 3MO1B 3G5XA 4Y5YB 4ODUB 4PGJA 3PNWA 5IB1A 3RVTC 1QRND 3V2AR 3L9RA 4QOKD 2P5EE 2BVPA 4JZNA 3ARQA 2JJTA 3FOMA 2G2RB 3VD9A 5I74C 3C2AH 3KLHD 3BI9X 3VWKC 3EO9H 3L3JB 3X11A 4QRQB 1NAKH 4KY1H 3K7UA 5L8JB 2L0DA 1RZGA 4N1HB 3TO4C 4PLKD 4XPAH 5DDHB 3O3UN 5CEZH 4HAGA 3M45A 1AHWA 3BIAX 2VLJA 5IWLA 1CFNA 1DBBL 3CFEA 1ZWIA 4HGWB 3B4NA 2CKBL 4DGYH 2ADIB 3O8XC 5TQ2H 3VRJB 3BXNA 5KAQG 3D69A 3UPAA 3LQZA 4X5WB 5EN2B 4G7VH 2QQLH 3FB6A 2Y6SC 4LP5A 4TNWK 4Y8DC 5CSZB 5C86A 1WIOA 3BIBX 1A9BA 1P2CA 3OKDB 4MJID 1MCJA 3GSWA 3TBYB 1S7TB 4C4KT 4PYGA 1RZ8B 4LNVA 5CCKL 1YEFL 1IGJB 5T1DL 5FO9B 4QYOA 5TJWK 3BSZH 4QRPA 3X3FH 1ZA3B 1G7MB 4H26A 3BD3A 4XCEB 3LMJL 1SM3L 1OLZA 4JR9H 5H2BB 4PTUB 4Y2OA 4KKAC 1I7RB 3SCMD 1PLGH 2XT1B 4DN3L 3TZVC 2DYPB 4NN6B 4GQ9H 1F6AA 4P5TB 2Y5EA 4YHLH 1HNFA 1Z0MA 2NR6D 3F7YB 3H7BA 3HE6C 5D1XB 4D0CB 4U1LA 3MLYH 1VKXA 1Q0XL 4OZFG 1QA9A 4R0LB 1PX3A 3QO1A 2H6PB 12E8L 1SMAA 1NAMA 3ESVF 2XTLA 3M07A 1YYLL 4ZFOB 2XY2A 2WWKT 3O3BA 3T2NL 1DLHA 1LDPL 4OV6F 2P49B 3MLZL 5JW5A 4O58L 5I8EA 1WZ1H 1T1XA 4NT6B 4LLWB 1IQWH 1I9RH 3WNOA 2NY7L 3P9LA 1J10A 4LHUA 4PJ9A 2PTTB 4Q0XH 3UO1H 3DROB 5CD3A 4IRSA 5F7UA 2GITB 2MKWA 3PWUB 3FN0H 1QBML 3H9ZA 4QHUB 3OJMB 3MX0A 1NBVH 4GXVH 3L7EB 5IV2A 2X2YA 3VFGH 1CFSA 2NX5E 1IARB 2NY6D 1WUNT 2QR0B 2C4FT 3BP4B 3QPXL 2NY1C 2A6KB 5ESQA 1JI2A 1VA9A 3CVHL 2RCSH 3B9KD 2HTLC 3FO2A 1TXKA 3QUZA 4XRCA 1NGYA 2IPKB 4YAQB 1YEKH 2XIDA 3WS6A 1GGCL 3FO0H 5D7LE 4U6HA 2NXZC 3BZ4A 4MXQC 1U8KB 4HS3B 1EHXA 2CO6B 1IGFH 4JM2D 4GKSA 4H1LG 4TUOB 3P0VH 5AYUH 5T1KB 5DSCA 1RUKL 2MHAB 3S96A 1F13A 1MJ7H 3PABB 4L29B 2E8YA 4YX2L 1XIWA 5GS2D 3M17A 4XWOC 5MHSE 1E28A 2ICEB 3ULVE 5MP6L 3NH7L 1KB5L 4BKLA 2D4DA 3RZCC 1B90A 5IMOB 3KYKL 5EPMB 2KZ1B 5KTEL 5ICYB 5ENWA 4H0HB 3TIEA 4N9GB 5D1QA 1NUGA 3QP3A 4PJEE 1L9MA 4HWZB 2C3WA 2ZWLT 4QXUL 3JSSA 3HLAB 5I30L 2FH8A 3VDCA 4K8RL 2GUOA 1X5GA 4WEMB 3ARDC 1LO0L 3T65A 3SDDC 3NFPA 5HJ3B 1L6XA 3GSQA 3GGWB 4QWWD 1INEH 5CJQL 1C5DA 1TVBA 1X5XA 3FFCA 4LLVA 4PJBF 4UT7L 5DC9B 5HGBA 4WW1A 4OLWL 3O2WH 1TJIH 2BNRA 5F1NA 4DUWA 2DWEA 3OZ9H 1EGJH 5T5NF 5MI0B 5DMIL 3E3QE 2K9UA 5CBEA 3CDYA 1FJ1A 3U7AA 4WHYG 4HIEA 5HHNB 3ZO0A 3SE8L 1CLZH 5D93C 4CMHB 2AP2A 4HCRL 4EN3A 1QFOA 3GSXA 2UVEA 3MRCA 4ZAKA 3TIDA 5GISH 3B83A 2Z93A 1X6LA 5DMJB 3O4OB 3WLBA 1BIHA 4E9LA 2MQ0A 2HFGH 5IJKA 3E2HC 1H3TA 1FVEB 1Q0YH 4N0UA 5EC2A 4PJDE 3NCMA 4HEME 3T4YA 5B4MD 2A6IA 1AKJD 4UV7L 1CLOL 1DQJA 3PNWB 5GGVH 5IB1B 1KYOK 3WEXA 3L9RB 1X4XA 3AS1A 2BVPB 4JZNB 5JIPA 4QNPF 5EZOH 4M93B 4WTZG 5F7DA 1LEKA 1ZLUK 1X5LA 4F33A 4I3GA 2BFVH 1EO8L 3EFDH 2B1HH 5HHMD 3X11B 1NCUA 3GSRA 1OARL 4HKBA 3EJYC 3NIDE 3VU2A 1GC1H 1RZGB 2VZVA 4OFIA 5C0EA 4ODHL 1AHWB 1UQSA 1ACZA 1NCTA 3OKOB 3LN5A 5CUSH 1CFNB 3CFEB 4OCSL 1ZWIB 4PB0H 4D9RD 5IBLC 1PFCA 3AS2A 4HW6A 1ADQA 4PJ5A 3TN0A 3BXNB 3D69B 4OF0A 3LQZB 4HZLA 1JPTH 4OZFA 2YRPA 3BE1H 2VXUL 3FB6B 4YC2C 1RK0A 3KJ6H 3ULUD 5J11B 2X42A 1P2CB 3SBWA 3GSWB 1MLCA 5DJ6B 3BAEH 1JBJA 1OAKL 3KPTA 2LTQB 4HWNA 3K74B 4TPRH 4QYOB 4QRPB 4ELKA 5I8CA 3CU1A 5AAWA 4H26B 5F1OB 5INCA 2FECL 3RTQC 1HYSD 4P49A 1CIUA 1NDMA 1OAXL 2QQNL 2QJDA 5HD8D 5K9QG 1ZLVK 3TT3L 4AEIH 3SE4A 4X6EA 1F6AB 1EVUA 4Y0GA 3H7BB 3MACL 4XNYH 4LOUD 1VKXB 4YEFA 3WDJA 1QA9B 2VSCA 2VTFA 3MODH 4QEGA 1TTGA 2R4RH 1NAMB 4I3RL 4RZCA 4JPKH 4UAOC 2CH8A 1S5HA 2WV3A 4NQDA 1M4KA 4MD0A 3O3BB 1DLHB 1KENL 3HI6H 2WANA 3D39E 2J7LA 3QWOA 4TULH 5JW5B 1WCBB 3VGBA 4NDMA 3C5ZC 3V7AE 5I8EB 1I1AA 1T1XB 3D85A 2DM4A 4RQQB 1T1ZA 1AQKH 1QRKA 3LKPB 2WK2A 4H1LA 2ZSWA 3P9LB 5CD3B 4PJ9B 5TE4H 4N0YL 2O5YH 3GHEH 1MRFH 1D5XB 4IJ3C 1IEAA 5EOCL 1FQ9C 5IV2B 1ED3A 2UWEE 1T66C 3NCYP 3OMZA 1CFSB 5JDSA 4L1HA 4TQEH 1YUHA 1YQ2A 1NGXA 3C6SA 3O6KH 3FO2B 3QUZB 5DVOA 2KKQA 3K8MA 1NGYB 4ONOA 2ZUUA 1MCBA 3KWWA 1A3RH 3K46A 3QUXD 4U6HB 4Y2DD 4YDLC 4WWKD 3BGMB 4OV5A 3B2UC 3INUL 1ZHBA 1IILE 3HZMA 4GKSB 4Z7UA 3G6DL 5I1CL 5DSCB 1EO7A 3S96B 4TVPH 3PGFH 5F7NC 5I15L 3M17B 2B2XH 4NM4L 1W72L 1E28B 4XNXH 1BGXL 4BKLB 4QHMA 4XNZB 4XP5H 2P48B 2HJKA 3MLWL 1VGKA 1BAFH 1KLUA 1QSEA 4X99A 5ENWB 1K4DA 3DRQA 3CXHJ 4JRYE 2DL2A 3TIEB 5D1QB 2D7TH 3UC0H 2Q86B 5B3JF 5FYJE 2GUOB 5GGRY 1Q1JH 4PJAE 4L5FH 5ACMA 3T65B 2LQRA 3W2DL 3NFPB 5E6IA 4E41D 4PJGA 1DQQA 3GSQB 3OB0K 1Z5LA 4MCYA 1C5DB 1TVBB 1K4CA 3FFCB 4LLVB 5C08A 1YPZE 5HGBB 1LWRA 4WW1B 2F8VA 2YD6A 5J8OA 4KU1A 1MJJA 2BNRB 2WUBH 1KEMH 3LS5L 5F1NB 5K9KA 3S4SG 4HK3N 5CBEB 1TZGH 3ILQC 4HIEB 2YSSA 4FHBD 4JANB 4QGTA 4WTZA 4EN3B 3MRCB 3GSXB 3TIDB 2R1XA 5JOEA 1TZHA 3WYRA 3UYPA 3WLBB 4UTAH 2OL3L 5DYOA 3DXAE 4N0UB 5EC2B 2NY5H 1X3DA 5ID1A 3NABL 3T4YB 1CR9L 3H8NA 1XZ0A 2A6IB 4R4BA 5FYKE 4UNVA 1G9MC 3RVXC 5CSGA 1DQJB 2NXYB 3WEXB 4EI5B 5BZWA 2E6PA 4DKFL 2V2TB 1IC7L 3S7GA 3FONA 5F7DB 4F33B 1CDGA 4A2LA 3CK0H 2YD5A 1I3RA 3IYLW 4HKBB 5T1LA 2XZCH 1A02N 2W65A 4P46C 1DJSA 5EU6B 2G60H 2V5RA 5FYJU 2CKBA 1ACYH 5IFAH 5JHDD 4KPHL 3G08A 4WHTA 4RGNC 1EPFA 3G5ZA 1UQSB 1CFBA 4L8SA 4OF7A 1BP3B 1Q38A 1PQZA 3FOLA 4I0PC 3C8DA 4R97B 5I1EH 4LEOA 1QYGL 3TN0B 2Z9TA 1JVKA 2NZ9C 2F54E 5KVMC 4MJ5A 4HZLB 4OZFB 4LKXA 1AE6L 3PGCA 4KAQL 3EYQC 3LS4H 1RK0B 3IU4L 2RJMA 4ZFZA 3QDGE 4WUUD 1P7QD 5J57B 3EUUA 3DIFA 4IOFD 5BMFL 3IB4A 4FQIH 4MJ2A 2YA2A 1WIUA 5INCB 4JY5L 4IHOA 2R29H 3DX8A 1NDMB 2YRLA 2AGJH 4M4RA 4HUVB 3EZJB 3PP3K 4N90D 2LVCA 4GS7C 4XCNA 4C56E 1AGBB 4P48A 3RVUC 5LXGH 1WFUA 5FYKU 5T3ZH 2P43B 4Y5XC 2FHCA 3CMGA 5ESAA 4B7LA 3MLVL 1S5HB 4NQDB 2XICA 3O3DA 3U46A 4MD0B 5ADPL 2F53A 2AJSL 1OTSD 2R15A 3D87B 5EBMB 3QWOB 2WQRA 1BECA 1G9NH 3UTTA 4F57L 1B88A 3C2SA 1I1AB 4CGTA 3D85B 3IFNH 5BS0A 3QQ4A 3ZZ1A 1QFWI 1A7OL 1T1ZB 1N7MH 1LEGA 1J05A 4FQXD 4UT6L 1RUMH 1MHCA 1EHLL 1ZS8A 2CLVA 3PP4H 1OAZL 3GMOA 1IEAB 4Y19E 2XTJC 1ZA6A 3BO8A 1ED3B 4GSDL 5JDSB 3RDTD 2DLGA 1NMBH 4H20H 1U8MA 2XZQL 4QTHA 4XVSL 4YFLI 3C6SB 1MCEA 5I1KL 4HIJB 3CX2A 4JRWA 2AEPL 5HY9B 4BZ2L 3KWWB 3WXWH 1ZK9A 5F97E 3AC0A 4OSUH 5I1JL 4XXCC 4OV5B 1XGYH 1LO3H 5DJ2A 1KB5A 1ZHBB 1I8LA 3B2VL 3HZMB 4Z7UB 5TFSH 4X98A 3U4EA 5IQ7H 4BQ8A 3VXPA 1JCKA 4R96B 5I1DA 4DUXA 4NUJA 4WFFE 3S4SA 1R5WA 5HI5D 5HDBF 4ZO9A 4CN6A 3D0LA 4QHMB 2HJKB 2PYEA 1VGKB 4DTGL 2DDQH 1KLUB 1NBQA 1QSEB 1U8JA 2X09A 2PNDA 3MJ8A 4X99B 5E9DA 3RWFA 4OZGB 1K4DB 3DRQB 5DC0A 3DYPA 1A14H 4PRPA 3HZYA 5IBTH 3PXJA 1HCFX 1OGAE 2JJWA 4LCWB 3K2UL 4DOHB 5E2UH 3Q2CA 5I75C 5E6IB 3OKMA 2FB4L 4PJGB 4AG4L 1DQQB 2VE6A 1FSKB 1K3IA 2GK0A 1K4CB 4JGUA 3P3YA 5C08B 3SJVE 1EA9C 4LVNC 4TNVK 4HCRA 1IZJA 2O61A 1NCCH 4YBLB 5K9KB 4JFFA 5D2NC 3Q6GL 2X4SA 4NKQB 5I18L 4ORZC 4ZS7L 1MFNA 1CDYA 2HWZH 3ZDZF 3S5LG 5J7CC 4M4PA 1LE5A 1TZHB 3L3IA 1JWSA 1LK3L 3HC0A 3VXTB 2I60H 3RJQB 4WW2C 4I4WA 5DYOB 2DKMA 4Y16A 3MRQA 1Q9OA 1TLKA 3NA9H 5ID1B 2CUHA 2IALA 3EZ8A 3GZKA 4OZ4A 4PJCE 5EU7E 5IEKA 3HUJA 1MRCL 1XZ0B 4R4BB 3PQYD 3U7YH 4FABH 1RJZA 4JHWH 1D6EA 4ONFL 3TBSA 5BZWB 5JOPD 4OCRL 4GAGH 2ICES 1WIPA 4G8IA 3BZFA 3FONB 5JIIA 4RWHA 1B6DA 6FABH 3X13B 1FIGH 1BZ9A 4M3JA 1I3RB 5DVLA 5KSUA 5KSBA 1NFDE 1A6ZA 5T1LB 5CD5C 4QHLA 3VD7A 4XP9H 2W65B 1ZVSA 1HOCA 2CKBB 3DPBA 3BKCL 1CE1H 4WHTB 1MI5E 4R90H 3G5ZB 5TF0A 4L8SB 5D7SH 5JR1L 2YS4A 2APBA 3KPPA 1IC5H 2ESVE 5HHXL 1A2YA 1AXSA 3FOLB 3W0WA 1I9JH 3TNMA 5F71A 4LEOB 1UCTA 3DJ9A 1JPST 5LCVH 5AD0A 5AYQA 5CJ8A 2CIKB 4HMEA 3QXTA 5IMMA 4LKXB 2PO6C 3ZKXC 3PGCB 1OAUL 1A0QH 1P5VA 1WWCA 3CJJA 1ROWA 4ZFZB 3D5OF 1YEEH 3U9PL 3DIFB 1QKZH 3MC0A 5E24E 2XZAL 4KRPD 3GMNA 5EUOA 4BQBA 4RA0C 5AUMA 5IVZA 2FD6H 1FNAA 1DVFC 4IHOB 3RKPA 1OWWA 5DA4A 1EMTL 3DX8B 2F5BL 2BNQD 2FLBT 4JJ5A 5MERA 1H8OA 4XCNB 2EDDA 1EK3A 1V7MH 2ZOKA 4KMQA 4GXUM 3RA7L 1R0AH 4S1DD 3JVGC 5ESAB 2ERJB 4LSQH 5A40E 2EDTA 3GSVB 2F58L 1M7IA 3PWPD 2HVJA </