4GKOA

Crystal structure of the calcium2+-bound human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
209
Chain Sequence
GVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig epsilon chain C region
publication title Ca2+-dependent Structural Changes in the B-cell Receptor CD23 Increase Its Affinity for Human Immunoglobulin E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkoA02
4N8CH 3QDJE 5IMMA 1B9ZA 4ODSH 3FB7A 4NNXB 5MENA 3QPXL 4N0FB 5IBTH 1UXWB 1U8MB 2PNDA 1KB5B 2DQHH 2IEPA 3KR3L 4IMLB 4PV8A 5LAXB 4CNIB 2X40A 5L8JB 2L7UA 3D0VA 4OI8A 1KJ2A 2FB4H 2GSGA 1EEZB 1YNLH 1A9EA 3HB3D 2R56H 4DFHA 2HFEB 5D7IB 4ODUA 5DQJA 1HINH 3PGFL 4ZQKA 5BRZA 3QXDB 5JPMA 4MJID 2VXQH 1BWWA 2HJFA 4Z0XB 5ID1A 3DV6B 3IDIA 4PGJA 4N9OB 3MXVH 5SWQA 3SDCB 5T3ZL 3NABL 1RZGB 2KDGA 1HZHL 2GIYA 2CMRL 2EIEA 2BCKB 4FQIL 1KFAL 2D0FA 3NACL 2GKIA 3HE7B 2AGJL 1OARL 3IKCA 3SO3C 1DCLA 3DUSA 4XHJC 4HLJA 3OHXB 1SYSA 5CZVH 5DJ8B 4OM0H 4GKZA 1CD9B 1GOFA 3KYNB 5IVNA 4IRSB 3RWHA 5F7YC 5T3XH 2IPKB 2VDPH 5D5MB 1A14L 5E2VH 4DGIH 1QSZA 1B6UA 5CD5C 4XC3L 1GYAA 1IEHA 4YK4B 4R97C 3SDXB 2A6IA 4PB9L 2FCBA 1HHIA 3TA3D 5FF6B 1KN4H 5CFHA 1FDLL 2QSCH 5C86A 4FFVC 4XBGB 1ED3A 5IB5B 3RUGF 4EUPG 1TIUA 3NH7H 1WQVT 4UAOB 4C56A 4JFPB 3NCBB 4GMTL 3MBEB 2FBJH 3FQNB 4H8WH 3CDCA 3MGOA 4JGUA 2RAMA 1F6FB 1B88A 3NBNA 3OKEB 4DW2L 2PTTA 4GXUN 4A2LA 1OTTC 3QDGA 4QHKJ 3ESVF 1NFDA 1DQDL 3W2DH 4YGVA 3RIAF 1IAMA 1MCPL 1OGTB 3O2WL 2XPGB 1LE9A 4UV4L 3V6ZB 4XP9H 2DQUL 3MLXH 5IB3A 1R3KA 2Y07H 1CF8H 2MOVA 3QXAB 4ONGH 4ZS6D 3QG7L 2VLRE 1UACL 2DLIA 1UWXK 4G6FD 3WFEL 2R29L 4LPUA 4XVJL 1QRND 3MRRA 3WO4B 5IJKA 1KNOA 5IW6A 2Z0BA 1BEYH 1A6AB 4NKIH 4J6RL 4NHCL 3RGVA 1F4HA 5F7WC 3D3VA 1FZJB 4OUOA 2B4CL 5C07A 1E4XI 4NKMA 4DUXA 25C8L 4EN3C 4KKLD 1FE8H 4QRPB 3QRFM 3VDCA 2AV7A 5FYLE 5J06A 2F54E 2XWJB 4X4XB 3QEGH 1T0NB 3BKYL 3G6JE 1GSMA 5H8DA 4U33A 4OQTH 3L3KA 2BSTA 1FVEB 2R2BA 3FRPA 3MREB 5IR1A 1CXHA 5AZ2H 2X7LB 2J5LC 3QDJB 4UOW0 2DTML 1WFNA 2E7BA 3M17A 4O9HL 4F7EA 1KTLA 2E27L 3V5DB 3SQOH 3G5XB 4JB9H 4Z78A 3P4LA 4OIIH 5IMKA 1JYVA 1HIML 4JFOA 1WT5A 5ESVB 1F11A 1ZT7B 2JJTC 1ZVHA 5FUZL 3C5ZC 4JR9H 2BVEA 5I8EB 5HXMA 4HS3B 2OQJA 5HDQH 5D7LA 4QXUL 1UWEH 3OR7B 4HPYH 3HLAA 4HIIB 1LO0H 4LLMA 3L95B 3BPCA 3FN0L 3GSUB 1YPZA 3PWUB 5KVDL 4OZIE 4XCEB 4PB0H 2NY6C 2ZG2A 1XF2B 1AD9A 1MREL 4M3KB 4YDJA 1YEHL 4KTDH 1NDGA 3HG1A 4O5LL 2OTPA 4M1DL 4H8WC 3V6FA 1TZIB 5TF0A 4X4MA 3TCLA 2I5YH 1T22B 3MJ9L 4RX4D 3INUL 5ICZA 3W9DA 3CK0L 1VCAA 1I7ZB 1SBSH 3BP6A 4ZUSA 2JTDA 2MQCA 4PGDB 3TBYA 3QZWG 4DQOL 4R26H 3QHFL 1KPUB 4F58H 1H3VA 1KCKA 3ARDC 2FJGA 5C2BL 3UPAA 1BP3B 1AFVL 4NQUA 3PDGA 4XVSL 4PG9A 4MA1B 1Y0LB 1J1OH 5J13B 4F37F 2IFFL 2VMFA 2R0KL 1NMCC 4K7FB 3SDAA 1KEGH 4MXQC 2HLAA 2QSTA 5IK3A 4X6BA 5CD3B 3QUZA 5INDA 4GBXC 3DX6A 5ICYA 1OVZA 1RJZB 3B9KD 3CDYA 2B1HH 1E0OB 1HHHB 2YPLE 3QUXD 3O2VH 4X6CE 3ZO0A 4PJHE 2ATPB 1J0JA 1Y6MR 2DM4A 3QXUA 4HWBL 4K7PL 1JV5B 2SEBB 4XP5H 3OX8B 3QQ3B 2VLRB 3I3EA 2DQCL 1LE5B 1K8IB 4YQXL 3CSPA 4HHAA 1UZ8A 4HZLA 2GY7B 3MJ7B 5I1HH 4UUJB 2EE9A 1FRGH 3C60B 4L8BB 2HFFA 4MDJB 4L29A 4YHYB 2E3VA 1NEZB 2FD6H 1NBYB 3EOTH 1BQSA 5EORH 3UBXI 3ZYJA 2F54B 5KAQF 3G6JB 3RVXC 4MJ6A 1BX2A 1N64L 1NBZB 3BOVA 4XNQB 2Q87A 3E6HB 2GAZA 2WNGA 2BVUA 4P9HH 4Y5YB 3BZDA 4OLXH 4Y16D 5TF1L 3TNNB 2GJ6D 1X6NA 1BOGA 2CIIB 3LN5A 5D7KE 4G6AC 4NQDB 1B4JH 4QRTA 4HUVB 2E9BA 4KJQD 3HI5H 1AE6L 1JNNH 1T66C 5E6YA 2YUWA 5A40E 3T8XA 4NYLA 2CKBH 3IVKB 3C9NB 2EDTA 4IRSD 4NP4H 3VGDA 5I8CA 2VE6B 4JPKL 3STBA 1NFKA 3MPCA 3MRJB 4M6OL 2H6PA 1F6LL 3MMEB 4OZIB 2EDNA 5BV7C 4KPHL 5A43C 4WEUD 3SDDA 4OF7A 1ZLVH 3E3QC 1AGEA 3T0EE 1I1RA 4XVTL 2JIXB 1HH9B 4ZPTB 5GS0D 5BS0A 5IT2L 1YYML 4ORGB 5IJKC 1YYLH 1KN2L 4P2QE 1X3DA 3QDMA 1S7RB 4JQVA 5FO7A 1A1MB 1RFDL 5L8LB 3STZB 3VRIA 2AXGB 3IKKA 3HRPA 1QTYT 2IANE 1M6OB 4KHTH 4PY8J 1RZKH 2PTUA 2F5BH 4PJCE 1INQA 2W60A 2DL9A 3VD7A 4JY5H 1U6AL 2Z92B 1MCHA 5E9DE 1C7TA 4IIQB 5DD6A 2F5AH 3C8KB 1I9JL 3SY0A 4FQ2L 1TTFA 2XQYK 5J1SC 4W6YB 5E03A 1SYVB 4Z7WF 3HPJB 1OSPH 5JOPD 4PRNB 4W6XB 3RRQA 5C0AD 3WSQL 4LVHC 1W0WA 5CSBA 2RQ8A 4HIHA 4QRPD 5JXED 3AROA 4H20L 4P9HC 4I0CC 3GB7B 1W2KT 2YPLB 4TPRH 4X6CB 1RUKH 1OOAA 4PJHB 4U4BA 4K8RH 4A6YA 3FOMA 3R1GL 2Y36L 4K9EL 5C2UB 5GS2H 4Y2DA 1GAFL 4FQXB 3QDJD 5E94B 4E9LA 1CFVL 4U3HA 4NN7C 2FL5B 2BZDA 5B38G 3BYYA 1ZT1B 3BMVA 1IC4H 5IP4A 5I1CL 1JPTL 4PRHD 3MGAA 1NDMA 1R24A 2YD6A 1A6ZA 3S34H 3UDWA 5C7XL 2BK8A 5DD5H 4HUUA 3QFJE 4KI5E 1MI5E 2HG5B 2HWZL 3WLBA 4FTVE 1RMFH 4U1KA 4UU9A 3KHOA 1N59B 3BEVB 1MAMH 2GCYB 3I6GB 3TPUA 2R2HB 4KHXH 5LXGL 2OZ4H 1WAAE 2Q6WA 4UQ3B 4AZ8A 2OK0L 3B9DA 3FQUB 3U79A 3RWIB 2YEZA 1A6WL 1LEKA 2EC8A 2ZUQC 2NY3D 5C09A 4LGPB 3VFTA 3GIZH 5EN2A 2F8VA 1ND0B 1ZTXL 2A74B 2UZXB 3U36A 3TT1H 3MO1B 4U1NB 1N0LA 4BYHA 1XAUA 3ZL4L 1C08B 5BVJA 2C4FT 3O4LA 4YLQT 1KIQA 4QYOA 3AMLA 3H3BC 5I17A 4R4ND 2JCCE 1ZVSA 1RZKC 1F00I 2LAAA 4L4VA 2NY5C 1GOGA 3T65A 5ADPH 1PZ5A 2PYEE 3ROOB 1N7MH 2Y06L 4IM8A 5I1KL 4H1LB 5CUSL 3AREB 4OZFB 4UT7L 4AENA 5I8OL 1KEMH 3DRTA 3MODL 1WGOA 4K23L 4O58H 2PO6A 4P4KC 1DJSA 1NUGA 2I9TB 4ZG1A 3T0EB 4JRXE 1CLZH 1DBBH 4LHUB 2HJLA 2ZWLT 5I18L 4UDUB 2ED9A 4KRPC 4P2QB 1VENA 3OXRB 1IEAA 4OV5A 4Z0BL 3RUGA 1G7IB 3QXVA 4LU5H 2IANB 4HBCH 1Q0XL 2HMID 4I0PB 4EBQL 3JWDH 2N7AA 4B50A 2P8MB 3HE6C 3ARGD 2ITCB 3VFVB 4AG4L 2R2EB 2D03L 4DTGH 5D72L 2BNRA 2EDRA 4BQ9A 2VYRE 5E9DB 5FUOL 4NHUA 3MUGB 1RUQH 1FHGA 1ZHKA 3D2UB 3JV6A 5E99H 3MLWH 3GUTA 3VH8G 3NZHH 3CSBA 1IGYA 4LSSH 5C6TL 5FDWB 1T3FB 4DN4H 4I48B 4OCYH 1OF2B 3EDJA 1XH3A 1RUAH 1WZ1H 3BVNB 2F54D 5FYLD 1R3HB 3MV7A 3TO2A 3BPNC 1U42A 2J6EL 4I77H 3ILQC 2E9WA 1RZ7L 1FL3B 1RZFL 5D9SA 1T83A 4OFDA 5ALCL 1MJJB 1R5VB 1DVFA 5D2NA 1JYNA 4DVRH 3LPFA 4XVUD 3V95A 3VW3L 1LWRA 5DEFB 3NTCL 2X4QB 3ZTJG 2EE2A 4ZO9A 3WO3B 4JZJC 3FO2A 5DGQA 1V3MA 1DQLH 1H5BB 2P46B 1BOYA 4ISVB 3LRSB 2W9DH 1J87A 3QFJB 4F7CA 1NEUA 4X9FA 4IRJC 4JCLA 4PTTB 2W92A 1MI5B 3UTSE 1JPSH 2H9GA 4FTVB 3OG4B 2X70A 4N68A 1P69B 1RIVH 2A6JA 3M8OH 3FO1A 3EYQD 3BZ4B 3UJTH 4WHCA 5JTWA 2J8OA 3VMOA 2X9XA 3F5WA 1XIWD 4P5KB 3FQWB 3L9RA 3NN8A 2X4SB 4KJWC 1FAIH 5HI5C 5I1GH 5KG9B 2OTUA 1QLFA 4XTRD 5D1QC 1ZLUK 4XP6H 3MV01 2VAAA 1I4FB 4HKBA 3S3PA 3U46A 4HQQL 5AZEH 5J11B 3S36X 4GLRH 5A2JH 2IAMD 3MUJA 3RZCB 1P53A 3MRBB 5C0EA 4UBDC 1AJ7H 2JCCB 3H8NA 3MOAH 5F7NC 5I1DA 1S7VB 1MCBA 4KY1H 1KJVB 3D5OF 1NLDL 4HK0B 4H5SA 2Z93B 5B4MC 4I9WE 5EC1B 4LLWA 5TPWH 1UQSB 2LV4A 3KLHC 1UH3A 4JRXB 5LG1A 1CE1H 3P9MB 1DFBH 3MLZH 5T1DH 3PDOB 4AY0A 4PREA 5GGVY 2IPTH 1KCSH 4RNRB 4NWTH 1MH5B 4ZOCA 1D5BB 3PNWA 4G7YH 2ZOKB 1ADQA 3PV6A 2XI9A 1MPAH 1O5DT 1RK1B 2L7JA 4PJGF 3V4VH 4Q9RL 3PWNB 3PGDA 2YPLD 3IT8D 4U1HB 4XPBL 1PKQE 5FB8A 4MQTB 1JZ4A 1TCRA 4HUXA 4G6JH 3B8YA 3SHSA 4FQXD 4KJYB 4D0BA 5KOMC 1KF9B 3ULVH 3KVQA 3KPMB 5F88B 4UV7L 2H2SC 2YKLH 3WFBL 4MQSB 3VFGH 3B4NA 4M03A 1EUUA 3SQBA 4LPWA 3CZFB 1Y6KR 2X4RB 3GRWA 2NY2C 3TYFA 4PJ8A 4G3YH 1Z5LA 5T3XE 4QHKI 1G7JB 4HS8L 3PL6C 4R7NB 2CIKB 3M45A 1NANI 2DYPD 1QFUL 3B5GA 5CILH 1MSPA 1JTPA 4ZUWB 2WWKO 1HN1A 5CSZA 5FUCE 4KXZH 1ZKAA 4JAMA 2DM3A 4XAWH 4FQCH 4FQQA 5CJXC 4I3GA 1MHCA 3GMQA 5D7KD 5BV7L 4M7LT 4ZXBB 2GK2A 3ME0A 5D1ZD 5E2TL 1EGJA 2IQ9L 1TENA 3G5YB 1XMWA 3W11C 2NW3A 4KVNL 3UTSB 3S35H 4FA8A 3HPLA 3KPTA 2VDOL 1T1YB 4PRIA 4LFHD 1J88A 1QFWL 1OP5H 4LLQA 4JM2B 3VFMB 3ARED 1C12A 4NQTA 1KIRB 4D9QE 1WWAX 5CSGA 4D8PA 3S5LB 2DQFB 2HFGL 4UIKL 2HT2D 4WI6A 1FNGA 1GZQA 1Q1JL 3L5JA 3SGJC 3T0ED 1S8DA 3MOBH 5ACZB 5FO9B 4YAQA 2DQJL 5F9OH 4PJBE 2YXMA 4AEIL 3HI6L 1A02N 4P2RA 3LHPH 4P2QD 2BOBA 4L8CA 3DURB 1T6WA 3KPQB 2IAND 4K3JL 4M43H 2DLFL 4QTHA 1K4DB 4LQ1A 4UDTB 3EOTL 3TNMB 4GG6F 5IMLA 3QFDA 4HH9B 3CVHB 2BJML 3WJLC 5I1AA 1KBGH 5E9DD 5FKAB 1T83C 5LQBH 3TO4D 4TRPL 4KROB 3Q5OA 2XV6B 1F6AB 1DVFC 3DX8B 2DJSA 3LKSB 4YHNA 3D2UD 1DDHA 2R69L 4MXWL 1YECH 1CLCA 2QR0B 2YSSA 1PEWA 2PW2B 1A6UH 2MKWA 5DQDL 5FYJH 1TLKA 4JY4A 5HYSA 4RWYH 4MD5B 1OAUL 1E4WL 4KQ4L 2UZIH 4M93B 3HAEG 3C5SB 3FJTA 3HS0B 3MNVB 4JQXA 1PKQB 2ZOLB 4HJJH 3JVGC 4QOKA 4OFKA 4PJ5D 2ZSWB 3VXME 4S1RH 5JIHA 4ZTOH 5IBUG 1RQ5A 1I8LC 2AXFA 3B2VH 5JORA 1JHTA 3QA3A 3FB6A 1CR9L 5FFLA 5B39A 3CSYB 3FQRB 1ZA6A 4P49A 5F7UA 3BRFA 3ES6A 2QV2A 3ARZA 4BH8B 3QFJD 4HXAH 1UG9A 1UFUA 4LHQB 4U6HB 1P4IH 2HVKB 2XA8H 3SKNA 2ID5A 2ZZUT 1MI5D 1KB9J 3WS3B 4GSDL 3VFSA 1BM3L 4HGKC 3VGBA 1VFBA 1AHWA 4ZUVA 5K59F 4JN1L 4L1DA 4U6XB 3BEWB 2XZQH 3GSWA 4PJ7E 2NY6B 2NY5L 3WNMA 2X6MA 2Z8VC 3BIKB 5I19L 5CJ8A 2JB5L 1OM3L 5DDHB 3A6BH 4NRXB 3P0YH 4KZEH 3B5TA 1AKJB 2WIIA 5C3TA 4Q9QL 1ZLSL 1C16A 1E27A 1Q94B 4O2CA 3RZCD 2FATL 2FIRT 5DS8A 5L88H 2B1AH 1GGIL 4CL7A 1W72H 4XCYB 4YO0B 2ZG3A 1RULL 5C8JA 4S0SD 1DUZA 2PYED 3RBGA 4FQJH 2WLZA 3N1MC 4XP4H 5EC2B 2R8SH 4E42A 2EO1A 4YHOH 2R2CA 4RZCA 2Z31B 2DMBA 4PR5B 1U8QA 2X4TB 3RHWF 5J6HB 1J1PL 3T0WA 1BFSA 3CZJA 3O3AB 5DD3L 43CAA 4PJBB 1NMCB 5FGBC 4ELMF 3GSRA 1XGUA 1QBBA 3WFHB 2GT9B 1KPRA 1RHFA 4X7TA 3QI9C 4LSPL 3IS1X 3DETC 3B3IB 3MV9A 4JFZL 3DXAA 1IKFH 3NVQA 5KBNC 3WD5L 4LK4A 1I9IL 2BVPA 1P4BH 3S7GA 5DJCA 5JW5B 4QNPE 5HPMB 2X89A 2VL5B 5BJTA 4KVCL 4Y4KC 4YHZL 4RGMC 1KG0A 4KMLB 1GL4B 1IKNA 4H88L 2DDQH 1P6FA 3O4OC 4B7LA 2EYTA 4K3DL 3OB0H 4F57L 1GC1L 1DBAH 4OD3L 1HHGA 1AO7E 5IHZA 2J8UA 3WKML 2IJ0C 4OTXL 3KYOA 4YHML 5JHLL 1IQWL 1QOKA 3BPLC 2QL1A 3EUUA 5DHVA 5HYJE 1HSBA 2A6DB 2ICWA 4CKVX 3OZ9L 1B0RB 5F21B 3VXQA 4JLRB 2FZ3A 4CMMA 5IFAH 1T7VA 3SCMA 4KI1A 1LP9F 3IETA 2XRAL 3H9SB 4PY8I 4F7TB 1JZ2A 2P8PA 1I7UA 3VXMB 3U0WH 4G6KL 5HHPA 1GGBH 4MAYC 3FONB 2ORBH 3BQUC 2IFGA 2HH0H 2DQEL 5EIQA 1DLFH 1UKQA 1PG7H 1NLBL 2W38A 1CE6B 4RFNB 2AJUL 3D0LA 4JQIL 4TSBL 3RZWA 5DR5H 1OQOA 15C8L 3STLB 4ZXBD 3HRZB 1TXKA 5DD1L 1FZKB 4X83A 2H3NA 1KJMB 2YPKA 4KK8C 3PHSA 4QHLA 1FG9C 3SE4C 2FH6A 3TIEA 1CWVA 4DKDC 1K2DB 5E5MA 5F89B 1FC1A 1Q9OA 3RNKA 4CVUA 5MEOB 3ABZA 1G6RH 2OL3A 4J12A 4JM2D 4FQPA 5CEXA 3DO7B 4LLAA 3GI8L 4JPVH 1A1NA 4PJ7B 2W07A 2PCPB 5J3HD 3EJZC 3PWJA 2O61B 4F15C 4AQOA 3IU3A 3DIFB 2EYRB 4QRUA 4P23B 3QP3A 3WHXB 5D2LB 4A6YL 3VXUA 2ENSA 4PP1C 5SX4H 3MLWL 2P8LB 1RK0B 3LEVH 4WI7A 3RDTA 2Q7NA 3KPRB 5FCUL 3WXWH 3SPVB 3LRHA 1N26A 3O6FD 5DJ2B 5JHDE 4BH7B 1BFVH 5E08L 4G6ML 4MLIA 4P5MA 4U1MA 3KPSA 1L0YA 3MRIB 1L7TH 4Y4HC 5BVPH 5C0GB 3GSXB 2HRPL 1JVKA 2A73B 3MRCB 4TSAL 1JGVH 5F1OB 4Z77B 3OGCB 3HNTH 1AQKL 5L2JA 2JJSA 2CH8A 5ITFA 4EUPH 1I8MA 4EKXA 1AR2A 4WEBL 3DGCR 4ERSL 3G6DL 4RSVA 3WIIH 2R15A 4ODVL 2I9LB 2GUOB 4WO4A 2VXUH 2C7UA 1TZGL 1QLRB 1NCCL 2EDHA 4D0CB 3LKNB 4MD0B 3ARFB 4G8FA 4NCC2 3MLYL 1U3ZA 2AEQL 5KSAC 4H26A 5DI8B 1IC7L 5HGGS 4PBVC 2BNQA 5CIPA 3PGCB 2V5RA 1OCWH 4KV5F 2PR4H 4JM4L 2WUCH 4PJGA 2IGFL 3I3DA 1MHHA 3F7VA 2G2RB 4NN7B 3LN4B 5D7JA 5DSCB 5JXAH 3IDXL 2RHEA 5GISL 3IFOA 5SWSA 4NDMA 4Q6IC 3VFWB 4YDLC 3R0NA 1F42A 5GGSB 5HYJB 5IB1B 1FORH 1SBBA 3MR9A 3U48A 4ALAL 1C1EL 4MQ7B 2XTJC 5HYFA 2QEJA 3QJFA 3CIQA 3C6LC 5T3XD 4PJXB 5CEZE 1B3JA 4JFFA 1UXSB 3GSOB 3EYOA 4Y4FB 3PHOA 5HHOD 3BD4A 3D18A 3D85B 5DA4A 5HD8D 3VXPA 3NFNA 4POUB 3F7RA 2QKIB 4FMKA 1SM3H 4MA7L 5I2IA 3MBXL 1I1YB 1J11A 2ZUQB 4OCRL 1RV6X 4IBLT 2X05A 1MF2H 3SE9L 4IEFB 1U8OB 3PWPE 5F97E 5DEGA 3HFMH 1DBKH 5TQ2H 2UUDH 2P5WA 5EH1A 5IJVA 1AKJD 4YHIB 1UJ3C 3ARSA 1U8NB 3TC9A 1NAMH 5DA0B 3MRGA 5E8DH 3UTZA 1EHLL 3I02A 1H15B 1D9KA 3UYPA 5DUBA 5ANME 5EULV 4ZO8A 5BQ7B 1YJDC 2YC1B 4D9QD 1INDH 2OJEB 2WUBL 2Z31D 4Y1AE 2A38A 4NNPL 5ENWA 1T21B 3TWCL 3T77A 3GJFK 1CVRA 3BDYH 4QCIA 1OP9A 2NY4D 1A9BB 3QCUH 2YD1A 4XC1L 4U1SB 4ZS7H 5ID0A 1DR9A 1VEOA 2HTKD 5GSVB 3TBTB 1X5FA 3HZMB 1HXMA 1NEZG 3LEXB 1GGTA 5AWNL 3LQZB 2JK5A 3CFBA 2UYLA 3CXDL 5DJZA 3GO1L 1A5FH 3KG5A 1EA9C 4M61A 3RWEA 4FP8L 3RX8A 2K7PA 5JHDB 3BIAX 1S7TA 4WHTB 3RWFB 2LTQC 1KJ2H 1NBVL 3HR5B 4BSWA 4U49A 4XP1L 3EDEA 3KLAA 2X41A 1ZSDA 1NCDL 2A9NH 2DM7A 1NGYA 4JFHE 3GMNA 2IADA 4MHHI 4CN4A 1S9YA 1ZS8B 2IH3A 1DLHB 3L7EA 4M6NH 3UPRB 1QFWI 5EU6B 3ET9F 2CDFB 1EJ6A 5HHNB 4PYHA 3RI5F 1DL7H 1D5ZB 1F8TH 3NFSH 3IGAA 3VXRA 1HILB 3JUZA 5KSBE 2GQHA 3TJEL 5JR1H 4IDLA 1FN4A 3O3EB 2EIBA 4YHPA 2AP2A 3IDYC 1KTKE 3VXMD 5K9QG 1EJOH 1R3JB 4APQB 1UYWL 1J0IA 4LPCA 3FB5B 5IVZA 2C3HA 1XFPA 4AIOA 3UAJC 1T7ZA 5GZOC 5HVGB 1F3JB 2ATKA 4EDXA 5KVMC 4NIKB 2ZCKH 3W82A 3RVUC 4XNZC 2EH8H 5IB4A 4JZJB 4YXKL 1U3JA 3GKZA 1JZ3A 1CXLA 4JKKA 1IBGH 1F4XL 3O2DH 3WL9A 2Q8AL 1RHHA 2NLJB 1BJ8A 4G80A 1G84A 4P46C 2OLDA 5D70H 1RIUH 3FFCE 4CU6A 1A7OL 4Z95H 4NPYA 3NFPB 4C58B 1QVOA 2Q3ZA 3E8UL 2XKSA 3KPOB 4Z76A 1NJ9B 4XNXH 4GAYA 1ADQL 5DRZB 1UCBL 3PWPB 1P4LA 3VG0L 3GMLA 1BBJB 2HP4A 2FR4A 4KUCD 4P23D 4Z7UE 3PJSB 4WU5A 5E8EB 1TJHL 3VI3E 4PJAA 1ZXQA 4FHBD 2CDEA 2FGZA 5EPMB 4ZFZB 4RAVA 1OGAA 3EOAB 3UCRA 5BMFH 2DQGH 3DHJA 1HDMA 5ANMB 2ITDB 5BZDB 3OKNB 4OCWL 5B3JE 5IF0B 1D6VL 1CICC 5T1LA 3ZKNC 4Y19A 2DKMA 3L7FB 4L9LA 1IARB 2XKUA 4Y1AB 1NGQL 5FGSA 5B8CA 3QDHA 3GRWL 1B6DA 3S36L 3ULVE 3H0TA 4F7MA 3WEXA 4R7DB 1F3RB 3NIFF 3MRFA 4EZMA 4WHYG 4X7EC 5TH2A 3OR6B 2OM5A 4GAJL 1D7FA 5IQ9B 5EBLB 3QEHA 1Q9KB 4JKPL 3TVMA 4Y5VC 2R1YB 4CVXB 3VG9B 5C0CD 5DRXB 2XA8L 2VISB 3ARFD 1VFOA 2DLEA 4YFEA 5ESAB 12E8H 4NO0A 3K4DA 2LU7A 3L5WA 5DMGD 3RL2A 3PP4L 1QBMH 1JGDA 5HHXL 5DVLA 1CD1B 5D7IF 4F7PA 5MI0C 1OP3H 5E4EC 3L6FA 1AO7D 2EXYD 4GS7B 4LLVA 1NCAH 1U8HB 3X12B 5CHNA 5IFHL 3T1FB 1TVDA 5E2UL 5I75B 3U1SH 4J1UA 4NQCB 4I2XE 4X99B 5KSBB 1X5JA 5IVOA 3S6CA 3GSNA 3RVTC 5H35A 2QSQA 1S5HB 2AK4D 5F96H 4TYUA 5JW4Q 4Y4FD 3DMMC 4U7SA 3EHBC 1JL8A 3SGDH 4LFHG 4WFGE 5IV2A 5DTFB 3PL6B 4H1LG 1MVUA 3TN0D 4OZFG 4NN5C 1TZHA 2ERJB 2CGRH 3TT3H 3BPOC 1LP9A 1TNMA 4YC2C 1WCQA 1O0VA 4TSCH 2PYFB 4G43B 2FX8H 2B5IC 3GBLA 2QQNH 2CJUL 4P5TA 1H3PL 4YEFA 3LD8C 3WLWD 4TUKL 3BSZL 4KKBC 5D5MF 2ADGB 4WUUA 2APTA 1DEDA 4LSDA 4J3WA 3KWWB 2BVTA 3SDXF 1CDUA 1T5XA 3O8XD 4KK9D 4GRMA 4UINH 4HUNB 4PJDE 5I66A 5IUSA 1KIPA 4P57A 5L2KE 4ZAKB 3RY5A 2IPUK 3FFCB 2XQBL 1MIML 4C4KO 3EOBB 4X7CC 1D5MB 2FBOJ 4HT1L 1Z9OA 2XN9B 3OJVC 4KRLB 4WI8A 4Y8AA 3U4EA 3QQNA 1P7KB 5DVOA 2YXFA 3MJ6A 3KNBA 2WW8A 1XF3A 2AEPL 5HHQA 1MRDL 4NWUH 1RUPL 3SDYH 3S88H 4G8EB 1UADC 3FO9A 4Z7UB 4LSVL 4M4PA 3VRLF 2ARJQ 2ICWJ 1IAIL 1A4JA 1FGVL 5CP7A 4AH2B 4LSRL 1U91A 5I1IL 1LK3H 4EI5B 2CLRA 3QUKB 5F71A 4N0CC 2EKSA 2YRZA 2FHFA 4IJ3C 4ZFOA 4ZYKB 1FFRA 1G7HB 3PHQA 1BZ7B 4QWWD 4TVPH 5JHDD 4LLYB 1QD0A 3IFPB 2VC2H 3PF2A 4YHKL 3T4YA 2XXMB 5D7SH 5IW1A 3UJIL 3B2UD 2CR6A 1VPOL 1UB6A 2OTWB 1BJ1H 4KUZL 5DMKB 1MNUL 5GRWA 5LGJA 5BO1L 2JELL 1BBDL 5I74B 3QDAA 3FO0H 5HHVH 4LF3B 1V7ML 3MYJA 4IHOB 1T89A 1ZHBB 3QIUA 1NGWB 4AIXA 2AJVL 4XPGL 3BFOA 2VIRB 3QUYA 4ELKA 1RZIA 3TP4A 5M7QA 3GMMB 3FMGL 4NO5B 4KQ3L 4WTXA 5FYKD 3HTLX 3U0TA 2Y4SA 4APQD 2DIBA 3L3IB 1CGSH 4D3CH 3BGMB 4R8WH 2DD8L 4U0QB 4KZDL 1JWUB 3MRLB 1JJUA 2RCSH 5HVHC 4K2UL 4X6EA 2MSPA 5DQ9B 4H25A 5LWYL 3T4AB 4NSKB 3TV3L 5L9DL 2EKJA 2X5PA 1JF6A 2BMKA 5J1AA 5C9KA 5J0BA 5CEZD 1PFCA 4X0KA 3AFLA 4U7MA 5LBSL 3TCXA 3HR6A 4NM8L 4Q2ZB 4XWGH 1CQYA 1KB9K 3UEZA 1TJGL 4WEMB 1CZ8H 3O3BB 5IEHA 1Z3GH 1JUFA 4L9LC 2GI7A 2A6KB 1S9XA 1JP5A 3PWPD 2W0FA 1L6ZA 4X4ZA 2WWMC 1YJDL 4KAQH 3I50H 1VA9A 5CLTA 4XWOD 2EYSA 4RMTA 1UM6H 5DJYA 3MC0A 3ZTJH 4DZBB 4Q9BA 1ACYH 4S2SB 3VWJA 4IOFC 5E8NB 2AJXH 5KVFH 2VDLL 4JFXB 5I76A 2B0SH 3C87A 1CFSA 5GGRB 1PQZB 3SBWC 4NO2A 4ODXA 4PJDB 1UM4H 2D0HA 3QUML 2FJFB 2EDOA 4Y5XB 4OLZH 2F58H 5L2KB 1LO5B 2G5BB 1WC7B 4K07A 2PTVA 4L1HA 2YK1H 1SVZA 3GIVA 4HUMB 3S96B 3KHQA 4NQEA 3N50A 1B90A 3X3FL 2BSRB 3CFDB 4EIGB 1MJ8L 1V5JA 5CMAB 5EOQH 1KENL 4G8IA 2EC9T 1JWMA 2VLLA 4NJAH 1AC0A 1EO7A 4P4RB 1WBZA 2V5SA 3MGTA 1IGCH 5GS1C 5DZLA 3O9WC 5DUPL 3OQ3B 3RWJA 3QI9B 3C6SB 5C08A 1OPGH 4WWKA 1DSFH 5KSVB 1OLZA 2AJYL 1X5GA 2WQ8A 3T2PA 5C0RL 4XPFH 4OIBA 3MLVH 4WIQA 5C9JB 4OZGE 2YOCA 3BESR 3LRGA 2BC4B 4RGNC 4S0TD 2VDMH 2Z8RA 1P1ZA 2UWEE 3SJVE 4PJ9C 2F53A 4UQ2A 1EO8H 4QRSB 4CVZA 1CGUA 5GRUL 1MCRA 2H8PB 5HGBA 1IEBA 3G6JF 5FGRA 1CTOA 1DE4A 4M8QA 4GRLA 2EICA 4DVBA 4BSJA 4MWFB 2OL3L 1PG7W 4XNUH 5D93C 4DN3H 4FQHB 5JW4R 3DTXB 1MCOH 3H7BA 3FOLA 2EXWC 4J3OC 1A1OA 3JBG7 3IDJB 3W0WE 3BT2H 1Y18B 3OAUH 4POYA 2XYCA 3P11L 1CFTB 2GJJA 5T3ZD 1RU9H 3O3DB 5J9PA 1M7IA 2XKNB 2P5ED 3FCTB 1QFOA 1WUNT 3DVFA 5E2JA 5FA3A 3QNYA 3S5LG 3MLRH 4PJEA 4QT5B 5ADOL 5GIRA 1OWWA 4O4YL 4PY7A 1G9NL 3VFUA 2DQTH 1VEMA 1EV2E 4OZIF 5F7LB 3BP7B 1KPVB 5FEBA 3ZZ1A 1W72B 3MACL 1MJ7L 3L3HA 5F72S 3VXTB 1G7LA 4DAGH 4N8PA 3WUWB 1VADA 4HV8B 4OLUH 4M7ZB 4HS6B 5DT1L 4PRBA 1TQBC 3AS2A 4OAWA 3TEUA 4OJFH 5HDLA 4ZAKD 1HHKB 1NC2B 3QWQB 4CMHB 3VFOA 4L3CB 3DHMA 3DSFL 3VCLB 3IF1A 1Y6NR 4N8VB 2EDJA 3BWAA 1NCBH 2IQAA 3MQIA 4ONFL 1CGVA 4OZ4B 2PXYC 3I6KA 4YR6A 3VRJA 4AIZA 3ECBA 3QPQD 4UTBH 4GW5B 2BSSB 4YWGL 3RIAK 4IMKA 3T2NH 4U1LA 2PUQT 1A3RL 4X5XB 1MEXL 1ORSB 4OLYL 5FHBH 1HEZB 2YD5A 4NRZB 4V1DD 3EKCA 1YN7B 4KDVA 4EI5D 1TVHB 4MJ5B 3QIUC 3EYUH 3KJ4B 4PP2B 4YE4H 4OF5A 1NL0L 4P3DA 4P9MH 2MPAH 4NJ9H 1UENA 4CADB 3QNXA 2J4WH 4M1GL 4X5WA 5EO9B 2YMXH 4R0LB 1U3HB 1V3JA 3F12A 4R96B 2ADIB 4LHJB 1TQCC 3D69A 3BD3A 3VXOB 5JQ6H 3ULVD 4U3XA 3FKUS 1QFWM 2MMXA 5EU4A 3K46A 1RUMH 1TPXB 5JPNB 4X6CF 1LO3H 1JN6B 4PJHF 3QH3B 3DBXA 1AY1L 1QSFB 4K55A 1AXIB 1XGYL 5DK2B 3IU4L 3HB3C 5GJTL 2FLBT 2YBRB 1KTDA 3CUPB 3NCFB 5CJQH 4DZ8A 3NCJL 4J8RA 1FNLA 1T5WA 2CRMA 1N2RA 4OZGB 2DWDB 2LQRA 4JN2A 4K7PY 1YMHB 2B8OT 4ZSOA 2A83B 2P4AB 5E1AB 1WBYA 5I1EH 2ADFL 4BFIB 5I15H 1UXWA 2D9QB 2OJZH 2R0LL 1NGXB 4ZFFB 5KVEL 5LAXA 4CNIA 1TVBB 5K9JH 4Q6IB 1CIUA 2D7OA 5D71H 3W0WB 1IGFH 4L8SC 3QXDA 4AJ0A 1QKZL 3HMXH 1NCWL 2VKWA 3DUUA 1G6RB 1FH5H 3AUVA 3DV6A 2YRPA 3KXFE 1K3ZA 5HGAA 5JW3L 4NCDA 1HCVA 3U83A 4M9PA 3SKOB 2XWTB 2FO1A 3LZFH 3ZT5A 3KYAA 4UNTA 1A7NH 3C08L 5D4QA 5EU5A 3SDCA 2D31A 1EEYB 1G6VK 1CDJA 1RZGA 4P99A 3HUJE 3MRHA 3NCCB 3H3PH 1VSCA 3HE7A 3KGRA 3OSKA 4NQVB 5DFTA 1MCCA 3HI1B 1N3NB 5A16A 4M6ML 1CLOH 5MENE 3OHXA 4XNYL 1HHJB 3FT3B 4OGYL 3VWKA 2V5TA 3V6OA 4F9LA 2EDDA 3QCTL 1NSNL 1UJ3B 1WFOA 1IGTB 4IRSA 3RWCB 4LQFH 4F37K 1EFXB 4AQ1B 2YPVH 3LSOA 5L2KD 1TFHA 1GIGH 3ZHKA 3BZFA 1A7PH 5BRZE 1IC5H 3HC0B 3EJYD 2PW1B 3CFCH 3DRQB 4NFDA 3DYPA 1HWGB 5IB5A 4ZS6C 1BQUA 3R8QA 5A2KH 1IRAY 1YDPA 3MCLL 4JFPA 4LIQH 4P59L 3Q0HA 3MBEA 5F44A 4TTGA 1DN0B 3G08B 3OKOA 1MCEA 2FH8A 4PJCF 2VERN 4MQXD 3KJ6H 3MNWA 2J3SA 1KV3A 2J1KA 2VZUA 4JZOA 4TN9A 2BDNL 4FXLA 3UBXA 3GSVB 2XPGA 4JJ5B 1T1WB 2NY7H 1CK0H 2IWGA 3K8LA 3V6ZA 1CXEA 4MNGA 2NY0B 3OKLA 3QXAA 3OF6D 1I7RA 4XXCC 4JFDA 1OW0A 5KJRL 5HYQB 1BF8A 2ARJB 2EO9A 2YD7A 2J88H 1U8PA 3WFDH 2BSED 4S1QL 1B4RA 3ELAT 1A64A 5DJAB 2EZ0D 3CFJA 2Q7YB 3IFNH 3AY4A 5FM5O 1IFHL 3O6KH 3VMNA 5L0QC 4WJ5A 4C56E 3FQXA 2XWJA 4X4XA 1T0NA 3RTQD 2WBJD 1WITA 1QBLL 1IM9B 5D6DC 1E4JA 1FVEA 1EGJH 5ERWB 3P30L 4RAHA 4Z5RB 4OKVA 5ECJE 3QDGE 1IAII 2VJXA 4RMQA 5EDXA 1CBVH 1BAFL 1FSKC 4L5FL 5L6YH 3LKQB 3RWGB 3G5XA 2EDFA 4KI5F 4M1CD 1CLYH 1IM3A 2ZUUA 5D8JL 3ORJA 5ESVA 2FSEA 3MUZ1 3ZTNL 5L7XL 1HSAA 2CO7B 1WAAF 5I8EA 2P42B 4ODWB 1NAMB 4XNZB 4FQ1L 4E41B 2ESVE 3MXWH 3OR7A 5DK0B 5LKNA 3GI9L 3D3VE 2PETA 4GKSA 3L95A 3WN5B 1QLEH 5C07E 3GSUA 3KXFB 1DBJL 3H9ZA 5E7FA 3GMRB 1OTUC 4XCEA 5E00B 4M62H 2UV3A 3HUJB 3VFRB 2JCCF 5C0IB 2C3VA 2D9CA 2L4OA 3MLUL 5I8KH 2FGWL 1CG9B 1TZIA 3GJFB 2R1WA 2X1OA 3K2UH 1QP1A 1MRCL 4G9FA 3FB7B 4TULL 2D3VA 3OJ2C 5MENB 1T22A 3HC3H 4QRRE 1ZA3A 5GS0H 4PV8B 2VAJA 1J8KA 1FLRH 4OCSH 3D0VB 1KJ2B 4HC1A 5DMJB 2GSGB 3B9KC 5C6WH 1A9EB 1M7DA 5F6HJ 3QUXC 5DQJB 4LSQH 4ZQKB 5BRZB 5C70A 3QAZC 5JPMB 2HJFB 1CICB 5ID1B 3IDIB 3CLFL 3V4PL 4PGEB 2IG2L 4K3HA 4K7FA 3GSNL 1BWMA 3LY6A 3TH2T 3HG1E 5E4IA 2N4IA 5MHSE 4I3RH 3IKCB 2E9IA 4GMSL 4DCQA 1Q72L 1T03L 3DUSB 4Y5VB 5TDNA 1UZ6E 1HHHA 4UOJA 5GGTA 4MDIA 1JZ8A 3UP1A 3QYCA 1FO0H 5EZJA 3G04A 3SJVD 4HF5H 3RWHB 1EMTL 1JV5A 5TE7H 3BYTA 4MD4B 1IT9H 2VLRA 3MA9H 4NZUH 4X80L 3SDCC 2NY1D 2PN5A 2FHCA 2R4RL 1LE5A 1K8IA 1LD9A 5C0JA 4O51A 1JTTA 1Z3GL 3BAEL 1PAMA 1C5BL 4WW2A 5TQ0H 3HE7C 3MJ7A 4L4TA 2YZ8A 3C60A 2IH1A 4L8BA 4MDJA 3T2QA 4J4PA 4KJQC 5GSRB 1AI1L 2ICWI 3GHEH 5GHWL 4DK6A 4C56B 1RIHH 2F54A 4BM7A 3W0WD 4LDEB 5IIEB 4X6FB 4XX1E 4F9LC 2QHLA 3MGOB 1C7SA 1L9NA 2QQLL 5C0FA 4IRSC 2MTPA 2PTTB 2AJXL 2LAGB 2DIAA 3BN3B 4Y5YA 5DK3A 3WS6A 4YGVB 2HN7A 5C1MB 4BFBD 4X8XA 4OF6A 4YK4C 4JFYB 5FK9B 3EBAA 4AL8L 5SX5H 4YDIL 1N8ZB 4DKEL 3QCVH 4ZFOL 5AD0A 1H9VA 3V0WL 2BY0A 5IB3B 4I4WB 4NQDA 2B5IB 4HUVA 4HIEB 4UAOC 1NBQA 5GS0C 3MBEC 4JM2F 3LS5L 1KNOB 2Q8BL 3RP1A 3K8KA 5IW6B 2ESVB 1H8SA 5DUML 3C9NA 1J10A 4M5ZH 2FJHA 3D3VB 1R3LA 1SY6H 5KTEL 5C07B 4NKMB 4NBXB 3MRJA 3BHBA 3MMEA 5GRZA 3QIBB 2P7TA 2AV7B 2B39A 1RJYB 1MIEH 1NC4A 2V17L 4U6VH 1XT5A 2BSTB 2V7HA 2FYYA 5IR1B 1ZHLB 2JIXA 3OWEA 1FFPA 3SEPA 3WO4C 3M17B 4I18C 2NPLX 4DGYL 4Z78B 4QRRB 5IMKB 4JG0H 1A1MA 1BIIA 4JFOB 2J2ZA 1I1FB 1F11B 4ZTPL 4XMKL 3WNKA 5DVMA 1V7NH 1M6OA 4KH2A 3NGBB 1P5VA 4GQ9L 5JXEC 2GFBA 2IMNA 3K8MA 4ORZC 5E6IA 2QBWA 3P77A 4DEPB 1SEQH 2C1OB 4WFHE 4OD1H 3PIQA 2NY0D 4IS6A 1E6JH 3HC4L 2Z92A 3BPCB 4JFEE 1M05B 4MCYB 3EAKA 3PUCA 5AAMA 3SOBH 2GY5A 1NAKH 1AD9B 2EIDA 1JTOA 4D0DB 3HPJA 1BHGA 1G1CA 4PRNA 3HG1B 2HKFH 2JB6A 3NAAL 1ZLWK 1HYSD 2VLJD 3V6FB 4NT6A 4QTIH 5TE4H 2AW2A 3DLQR 5BS0E 1JRHH 3TCLB 4QHUB 3GB7A 2LVCA 5D1XD 1RZJC 5ICZB 1IM9D 3W9DB 3ALWA 3WIHA 3V4UL 3QDME 1JNLL 1FCGA 3BP6B 3AU1A 4W68A 1F2QA 5DXWA 5FYLH 1J9CT 1ZWIA 3TBYB 4RCAA 4M9OA 1J05A 2W0LA 1DEEA 2BX5A 1OB1A 4W81A 1FIEA 4UT6H 2FJGB 2NY3C 1MCDA 5B38B 1D5XB 3ULSA 1ZAGA 3OXSA 2CLZA 1MQKL 1J5OL 4JANA 2AABH 2M1KA 1OAXL 1UWGH 4NO3A 4MB4A 5TE6L 1L7IL 3MA7B 3JV0A 3SDAB 1N6QH 3MRQA 2HLAB 1IGIL 4X6BB 3QUZB 2HG5A 4R4NC 2OR8A 3WHE1 4CJ0A 5JMRA 1N59A 3BWUC 3KXFD 2W0KA 2CR3A 4LKXA 4UQ3A 2QQKL 4UILH 5I71B 1I1AA 1MFBL 4UNUA 3VFNB 2DJUA 4NC2B 2Z4QB 1YNTA 3NCYP 4TQEL 1S7UB 4MA1C 3TBVB 1BFTA 4OFYD 5F1IA 5J13C 1KELL 2APVA 4YFDB 3RNQA 1QPPA 4PGZA 2XZCH 2M2DA 5MEND 2D7TH 4MZ2A 5I1LB 4K7PX 2XIDA 3V52L 1UJTA 1B0WA 1UZ8B 1JBJA 1A4KA 3WXVH 4WNQA 1MCSA 3ROOA 2R0WH 3EO1B 5F7EH 3IXAA 4OZFA 4YXHH 1JI2A 4PJBF 2E8YA 5BRZD 1BX2B 3ARGC 2VR5A 2I9TA 1KUMA 3WJJC 1PD6A 4YUEH 4LSTH 4LHUA 2CK0L 1WICA 3U82B 5BW7A 3TZVA 3DSNA 1JGLH 5C09E 3HNSH 1PSKL 4EDWL 5I16B 3HMWH 5K9KB 1ACZA 4X7DC 3OKKB 1BOGB 1FG2A 2VDNL 4LPTA 4XNMA 5F93C 2G60H 1YQVL 3C60C 1G7IA 3U7WH 4L8DA 4QRTB 3IFLL 1WFUA 1JPST 3BKCL 3O4LE 4I0PA 5IKCA 3Q6GL 1AC6A 5CCKH 4FFZH 1OSZB 3RVXD 1IGFL 2A9ML 4Z18A 3LH2H 2ITCA 3F58H 4MJIE 4L4VE 2JJVA 4H0HB 4WTWA 4LCWA 4XPTH 1LDPH 4JFEB 4PJ9B 4Y5YC 1BIHA 1JE6A 3LZFL 1PY9A 3DO3A 3RKDC 4BZ1L 4RGOH 4FNLL 4NGHL 3SDDB 4XCFL 3N85L 1CXKA 3PXHA 1FPTH 3VE0A 4HEPG 4TUJB 1BF2A 4AMKL 4G6AD 5BZWA 4I48A 1JI1A 4C56D 1OF2A 5BS0B 1S9KC 1GCFA 2VITA 6FABH 1K3IA 1NMAH 3QIWA 1A6TA 2EDQA 4AEFA 1FL3A 3QDGD 4RAUB 4XT1C 5TFSL 1LK2A 3EYQC 5E95B 2AJSH 5IMOA 3P4NA 1U8IA 1MFDH 4TOYH 2O5ZL 1S9VA 3BDBA 1INQB 3GGWB 5EBWA 2W60B 5CJBA 5DEFA 1ZT4B 1BQHG 2BNRE 4QXWA 4XTRC 3UTQB 2DJ4A 1MFCH 4NRYA 2IAMC 4WTZA 3BE1H 4PJ7F 2YD4A 3RGVD 4FTVA 3D3VD 4EVNB 4HX1A 5C07D 2XWBA 3V0VA 1F2XK 1QNZH 1WAAA 4HIHB 4KUCF 4FN0A 3CX5K 2FWOA 1BQLH 1XGRA 4P5KA 1S78D 2X4SA 2YRLA 4OD2A 5KG9A 4KTEL 4A6YB 3FOMB 4H1LH 4LVEA 1A3LL 2XZAH 1KYOJ 3H42H 4N1HB 3GMOA 4IIQC 1WCBA 4NC1E 2DKSA 5D2NE 5GGVH 4QRRD 1AGCA 3W81A 5CS7A 2JCCA 2OXGA 1TDQA 4YBHA 5IQ7H 1R24B 1A6ZB 2I60H 4R90H 1S7VA 1LEIA 4WDIA 4IRZL 4HUUB 4HK0A 3U4AA 1KB5L 5GGQH 4OI7A 2Z93A 5D7LD 3O0RH 1JZ7A 1U95A 1BZQK 1P9MA 1VGEH 4EJ1C 4Q0XH 4U1KB 2MFNA 4UU9B 4WFFE 3G5VA 4P2OA 2QQQA 4AEHH 3TPUB 4JRXA 1N0XH 4FQXC 3P9MA 5EBGA 3DVGA 1MFEL 2YEZB 4O02H 1I85A 4PGBA 2BXZA 1R3IL 2A0LC 5C09B 4RNRA 4R4BA 5DMIL 4H0GA 1MH5A 3HCVB 3HG1D 5HYIA 4QNPF 4X7SH 3U36B 5MHSD 5CLWA 1YEDA 4K94H 1D5BA 3U30B 2MCPH 2ZOKA 4M00A 1F97A 1RK1A 3BI9X 8FABB 3QT2A 1ZANH 1KIQB 4KMTL 4JDTH 4GUPB 1IAIM 3V6BR 3ARBA 4MJIB 4L4VB 2W9EL 2A77L 1IC1A 1A7QL 1PZ5B 1IQDA 1I9RL 4PJIA 2Y9RT 1F45A 3MLSH 5JLZA 2PO6B 3C2AL 4RFOL 4UOW1 2WANA 4QXTA 5D1ZC 3CZFA 2KUTA 1X6LA 2X4RA 5E0QA 3SDAD 2ZKHH 4NBYB 3QUZD 3UTPD 2HRLA 2GEEA 2VSDA 4ETQB 1V3KA 4L8SB 4OCXH 1IEAB 5DD0H 4OV5B 3CFEA 4JY6A 35C8H 4R7NA 1NFIB 4LNRB 5EFIA 4D94A 5DWUL 3I75A 5JUEL 3GKWH 3AREC 4ZUWA 4FZ8L 4M7KH 5I73B 2IBBA 2IBGA 3UJJH 3ZT6A 3NCYS 2VDKH 5MP6H 3GBNL 2HT2C 3TA3B 3T0EC 5LGHL 2BNRB 5EA0H 5BW7C 3SE8H 1MFAL 4QGYA 3LVEA 3G5YA 2APXA 4J7RA 5MEPA 3GUTB 1ZHKB 3PP3H 4MB5A 4KKNA 4OLEA 3U9PL 1IGYB 3UTSA 5H2BA 3RHWK 4YHLH 3KPLA 5AYUL 4ZDHA 2AXJA 5DJDA 1VEPA 1XH3B 4IOIA 1WEJH 3TO2B 2VQ1A 2E5EA 5FO9A 1BLNA 5ACZA 5D9SB 2H32H 3KPPA 3S98A 3DI2B 2QLVB 3EJJX 4G6FB 4HBQA 2BVYA 5T5NF 3RQ3A 1QRNB 3I6LE 5D2NB 5DRWB 1HWHB 1JHKL 1WIUA 1PDKA 4QY8B 4LCIL 1UT9A 3OKMA 4NQSA 1BREA 1QQDA 2ZJSH 5ILTL 1VKXB 1HKLL 4DGVH 1K4DA 4UDTA 1S3KL 4F7CB 3NCMA 2F19L 1DQML 5HDBE 2NXZB 3EFDL 5GGUA 2CQVA 2H9GB 2GITA 5KVGH 3THMH 2X70B 3O6LH 4XXDA 4X4YA 2A6JB 4PRIE 5FKAA 1YEFH 3BJLA 3BKJH 1I8IB 4OFPA 4XBEH 1RZJL 1CU4L 1N5AB 3F5WB 1BGXH 3SDDD 3UZEA 2QTEA 3GSQB 2GJ6E 3NN8B 5FHAL 1P7QA 3FZUD 2OTUB 1JYXA 1H5BC 2GTZB 2FIKA 2O5YL 4LCCC 4HKBB 3H9HB 4MD5A 3WHE0 4EN3A 5BS0D 5L0QB 2R4SH 1W8OA 5DJ0A 3U46B 3D25B 1FFOB 5FOBA 2ZUTA 4P2RE 3C5SA 3HS0A 3OAZH 5ACLA 2XY2A 3QDMD 2ZOLA 1INEH 4FABH 3WUWG 5C0EB 2VXSH 3JSSA 1EHAA 4WY7L 4K3GA 4MZ3A 4KDTC 5F6HI 3Q6FA 3BXNB 5I1DB 1NUNB 1LO2L 2GSIB 4LOUD 2YA0A 4KKCD 4WENB 1FSKB 1MHPH 3BP5A 2VSCA 4N8VG 4YDKL 2RGSA 1GGCH 1YEIL 2C3WA 3G6AA 3PE9A 2YUVA 3HZKB 3BGAA 2OR9L 3IJHA 1PEZA 2ZUWA 4HC1L 2UY6A 4UT9H 2J6EA 4PPTA 2VXVL 1I3GL 2JJTA 3E2HB 3C5ZA 5J11C 4JJHA 1A7RL 5KZCB 1XCQA 3RZCC 5TDOA 4OSUH 2BHYA 2UVEA 5EOCH 3PNWB 4RBPK 4E5XA 3MCKB 2FX7H 1FBIH 1H0DA 5B22A 2FX9L 3PV6B 4WCYL 5GJSL 4X9IA 1B2WH 4LARL 3MUY1 3HN3A 3I2CL 1DANU 1MLBA 3KLHD 4WUKL 1TCRB 2BOCB 2E7CA 5TDPA 4Y2DD 3U4BL 5E8OB 5GGTL 2G9HB 3Q2CA 4D0BB 3V5HA 4KC3B 1LEGA 1Q94A 1E28A 3VGFA 1NGPL 4QRQA 4EQ2A 1EFQA 4RIRB 4YO0A 1K8DB 5C0AE 1FNAA 4GXVH 2A1WH 3RJQB 5F9JA 4JHAH 3B9KB 4PJ8B 2MHAA 3ARDA 1Z5LB 2DQDL 4GAGL 3QAZB 1KCUH 2GW5A 5C6PB 4NZTH 3O3AA 4PJBA 5DLMH 3TBSB 3SKJL 4GOSA 2DLGA 2EDYA 5C09D 5CJOH 3CCHB 1O7VA 1KC5L 4FQQB 4N5ED 2VH5L 3WFHA 1FNHA 3LS4H 1TTUA 4OZHA 4LAQH 1UA6H 4PRHE 1GRWA 1NMBH 3LIZH 3B3IA 5JA9A 5DJ6B 1FVDA 4KGLA 1D6EA 3KS0J 4GBXA 2D7PA 3D48R 3O4LD 3QEUA 4N0UA 1YEKH 1CT8A 3T1WA 2J12B 4ZFGL 2NW3B 4FZEH 2VL5A 4L4VD 2EEDA 3HPLB 4PRIB 4P3WA 5IVXA 3LB6D 4GO6B 3LMJH 3P0VL 5KSBF 2C3XA 4Y16B 4MAUL 5EZLA 3VA2C 2GJ6B 2PO6D 4D8PB 4M48H 1MRFL 5EZIL 3WE6B 4MSWA 3CJJA 3ZYOA 1S8DB 2A6DA 2Y7QA 4YAQB 2OI9B 2DQIL 4ZXBC 3ZKMD 4RA3A 3U2SA 1B0RA 2VRAA 2X4PB 2OYPA 4Q6YA 2V9QA 4XPAH 4P2RB 4L8CB 5FKPA 3W11D 1BVKA 3H9SA 2FO4A 4RMVA 3MV9E 1T2QL 3DXAE 3MZGB 2WV3A 4UB0L 4JM2C 3IDGB 2JKXA 2C9AA 3JZ7A 1F4WH 1QA9A 3SN6N 2BY1A 3QFDB 5J3HC 3HZYA 4LVOC 5E2WH 1HNFA 3TPKA 2BNRD 1L0XA 2LU3A 5LJYH 5HY9A 3STLA 4EEEA 4LSTL 4OGXL 2M26A 1EX0A 4YHNB 4AT6B 2J8UE 4M7LH 1FGNL 3BH8B 4XCCL 2VQUA 1TJIH 2YSSB 5MEOA 4J3TA 5HYSB 1OLLA 3ARUA 3KLSA 4JRWA 4Z7UF 3A6CL 3QR2A 3RVWD 3VI3F 3MV7D 3DO7A 1UB5A 1H3WM 1FJ1B 3H2WA 1S5IL 2N1KA 4PJ7A 43C9A 5MERA 1D5IH 2PCPA 1JWSB 2O61A 5AG8A 4G7VL 1M7XA 3CU1A 3WFCL 1EBAA 2ZCHH 4KROC 4MS8D 3WIHL 1X5KA 3WHXA 5J57B 5D2LA 2VXTH 2DIJA 1DVFD 2ZCLH 5B3JF 4HEME 4NZRL 4I18B 3MROA 1UWXH 1RK0A 1ZA6B 3CPLB 4PJFB 1AXTH 1FZMB 1OAZL 4M3JA 5C0AB 5JIIA 3KPRA 1PYWA 4HIXH 3ULVF 3NCEB 3O6MH 3N9GL 4U6YB 1VGKB 3DGGA 4WVRA 5H94A 4M93C 3IDUA 3FHAA 1FO0B 2HTLD 3RA7L 3SKNB 4NUGL 2NXZD 3MRIA 4OM1H 3H6JA 3GSXA 3VFSB 4WFFD 3AAZA 3T04D 3MRCA 2X44D 1OAQH 2LFGA 3Q3GA 3RI5K 3ULUH 3MV8E 4HPOL 1AHWB 1WZMA 4OB5L 1C8PA 4M7JL 3FQTB 3GK8L 4BQBA 2B2XL 4XMLH 3NOIA 2JJUA 3FL7A 1QYGL 2GUOA 4PRHB 3CVIH 4PD4J 3FFDB 3I9GL 4HUWA 4EXKA 4ZPVA 4DJMA 3VXUE 1C16B 4O2CB 6CGTA 4D0CA 5DS8B 4MD0A 4GXUM 4I1NB 3S4SA 3RWDB 3JWOH 1VERA 1IJ9A 5GRJH 4PRDA 3PGCA 5C8JB 2BFVL 3QHZL 2NMSA 3HZVB 5FUCC 1K6QH 3IDMA 1YNKH 4HXBH 2VR9A 4ZUTB 4I3SH 2NY3B 5DSCA 4PBXA 5I30L 4ZO7A 4RZCB 5ALBH 3OKDA 1U8QB 3UO1L 3VFWA 4LRNH 1MCQA 1HQ4B 3BW9B 5GGSA 5IB1A 5HYJA 3BN9D 2CKBA 4Y88A 1BMGA 1CFNA 5KZCD 3GHBH 2DL2A 43CAB 4PS4L 3B5HA 5EBMA 3GSRB 2C26A 2I07A 3Q48A 4PJXA 1KPRB 4HSQA 4X7TB 1UXSA 3GSOA 1ORQB 3MV9B 3D85A 2Q1EA 2NXYB 3REWB 3IJYA 3QJHB 5IGXH 2QKIA 3S37L 1E4XH 3OAYK 2AI0L 3E0GA 1UM5H 2Z31C 5DJCB 4PLJD 2BNQE 2XFXA 4FFYH 4UI2A 5BJTB 1YEEH 4PJDF 4LGSB 3UYRH 4U1JB 4DKFL 4YHIA 4MXVE 2EYTB 2NY4C 4LCYA 1U8NA 3QEQA 2HJKB 5F1SA 1JHLH 2ZPKH 4ODTL 1DQQA 3ARQA 2HTKC 3KYOB 5SWSE 1ZEAL 2P49B 1FYTA 4JO3H 1C5DA 1H15A 3DETD 1GHFH 4E0RA 4R4FL 4Z7VA 3VXQB 1AH1A 1RY7B 3WNPA 4PJ8D 5IESH 4JFQB 3SCMB 5KN5B 5KW9H 4OCMC 1LHZA 4R2GB 3IETB 4YX2H 2OJEA 4JFFE 4QXGL 3V79C 4P4KA 3ARGB 5DYOB 2P8PB 1I7UB 5T1KA 4P3CL 2ICES 5HHPB 4BZ2L 5FO8B 1AR1C 1KCRL 4F9PC 3I6LD 4U1SA 4WW1A 2C1PA 1VESA 1CD8A 2VO5A 2UZYB 3C5JA 4QF1B 4LLDB 5GSVA 3TBTA 3HZMA 3ZYIA 4JPWL 2P5WE 2DBLL 1CL7L 2H3NB 3UC0H 1CDGA 1TETH 4D9LL 4QHLB 3HNVH 2Z91B 5AYQA 4BA8A 5CAYB 2P44B 4J3XA 3HE6A 1Q9OB 3RNKB 2W59A 4MNQE 4PRID 1CI5A 2OL3B 2YD9A 3MV8B 4W4OA 4LASL 4NKQB 2BXYA 3X3GH 3VD4A 1A0QH 1ZS8A 3GNMH 3UPRA 3U7YL 5ITBL 5LCVH 1OD7A 5EU6A 4RFNC 3CLEH 3RU8H 2CDFA 5HHNA 3PWJB 4S1SH 1AGFA 1D5ZA 4LSUH 4MJ2A 4QRUB 1PLGH 3JXAA 1HILA 2I26N 4HKZB 4KK8D 3KPNB 3DROA 2H1PH 4P2RD 5T33L 2VABA 2OZ4A 3LEYL 4OIAA 1KLUA 3RDTB 4GW1A 2V9RA 2KH2B 1E6OH 1FIGH 1F58L 2VZOA 4Y89A 5T5FH 1BFOA 2R0ZH 3CMOL 4U1MB 1XIWB 4HWEL 5JO5B 5C0BA 3FRPG 1ONQA 2WP3O 2NZIA 5EZOL 2H26B 2HKHL 4JZJA 4P23C 3PV7A 3A67H 1U41A 4JG1L 1CFQB 1MCIA 5EUOA 5ITFB 1G9ML 1I8MB 2IAMB 3QNZB 4IRJA 3NA9L 1QRKA 1CXFA 3RAJH 1KCVL 3MRNB 2NLJA 3EZJB 1OTSC 4WO4B 2OP4H 2I24N 3VXRE 4U1GB 4EOWL 2P43B 3QRGL 4ZD3L 2C7UB 3NFPA 5J89A 1MLCA 3EYSL 2VWEE 1MOEA 2VDRH 2W0PA 2F74A 1IILE 4G8FB 4PUBH 4LMQE 5F1NA 4QOKD 1K9TA 4P48A 3PWPA 2BNQB 5SV4A 4PGCB 5D1QA 2AK1H 2R1XB 1K5NA 3PJSA 1KYOK 4ODHL 1YMME 1MHHB 5CZKA 1R0AH 1A2YA 1KGCE 2ICEA 4YXLL 5D7JB 5AEAA 4ZFZA 4XMPH 4K3EH 5SWSB 2EH7L 4NDMB 4X6DA 3GDBA 4NQXB 1SJVA 3MR9B 1JZ5A 4TTDC 5ANMA 2ITDA 3OKNA 1JK8B 1EXUB 1W8NA 5IF0A 1J1XH 4M5YH 5HSFA 3ARFC 1ETZA 3QJFB 3QQ4A 2AQ1A 4HFUL 4Y1AA 4FQLH 5F6IB 1ROWA 5CINH 4PJ5E 5DMGC 1FFNA 1ZOXA 2IMMA 3UYOD 3D18B 5I1JH 4LDLB 1BD2A 4R7DA 2ZSVB 4K71B 3D9AL 4OZGF 3QG6A 4HIJB 2UWEF 1PY4A 5HYEA 2XOTA 3O41B 3F6IA 1A21A 1Q9KA 3LN9A 4FXGB 2P5WB 4LEXH 5F3BA 1MJUL 3EDDA 4Z8FL 5IJVB 1N5YL 1WSST 5HHME 3L5XL 4JHWL 4PJAE 4KK5D 1RURH 3W9EB 1JFQH 2I25N 4XX1G 5LVEA 2VISA 1B0GB 2D4FA 1F90H 3MRGB 4Y4FC 3RGHA 3L1OH 4X7FC 2AJZB 2RFXA 2IPUG 4MNQB 2N56A 5DUBB 3VXNB 2DYPB 5FYKH 2O5XL 2R23A 5IWLC 2LVEA 1OAYH 3EO9H 1AQDA 4Y19E 1G0DA 3X12A 1U8HA 1FNEA 3V7AE 2BRRH 1CGYA 3WLWC 2X1QA 3JTSB 3T1FA 5IHUL 5CP3H 4MJ4A 4NQCA 5EWIL 1F4YL 4X99A 1FCCA 5KSBA 5D1ZB 1TNNA 2FHBA 4MB3A 4KK9C 3KYKH 1S5HA 4GJTB 3RVVD 1GPOL 2KKQA 3MV9D 1YEGH 5DTFA 3DXAD 1QR1A 3PL6A 2JK5B 3CFBB 5D6CA 1UGNA 2NXYD 2UYLB 2VN4A 5DJZB 4UNVA 3RWEB 1JGUH 1KJ3L 5CEZH 3AB0C 1IGMH 1S7TB 3OPZL 3Q1SL 1QSEA 4ONHA 4L3EA 2YD3A 4BSWB 2PYFA 2VDQH 2X89D 5CJXA 5F3HB 2P47B 1ZSDB 3GMNB 1C5CH 3CVHL 4OT1L 5EU7E 3C09B 4IDJH 1MWAH 4N8CL 4ODSL 3KWWA 3L7EB 1Z0NA 1ZV5A 3GBMH 1DQTA 5IBTL 3R8BB 3PQYA 2DQHL 1YEJH 3MNZA 3IGAB 3VXRB 3FFCA 4K8RC 4QWWC 1X5YA 4YPGA 5EO0A 3EOBA 2FB4L 2XN9A 5DVNA 3SCMD 5CZXD 1YNLL 1FLTX 2R56L 2CLVA 4R2GD 3O11A 1WISA 4PJCB 1HINL 3B2UC 4WI5A 3QO0B 4YHPB 2KBGA 4JO2H 2VXQL 3SGJA 2HA1A 4W4OC 2V2TB 4G8EA 5IHBA 1CYGA 1DUYA 3TO4B 3MXVL 4C55A 4RRPA 3LMJL 1CN4A 4G5ZH 1YMMB 4AH2A 1F3DH 2ATKB 4HCRH 1H3XA 1OAKH 5JOFA 1XZ0B 4BKLA 1A6VH 5IB4B 1Z0MA 2FECL 3REVA 1G7HA 4ENED 1BZ7A 4XHQA 3UTTA 4LLYA 1S9WA 1A47A 4GT7A 3IFPA 1N4XH 4LRIC 5CZVL 4CW1B 1U92B 4OM0L 3WJLA 1RHHB 2OTWA 4APQC 4G80B 4PJ5B 3DWTA 3WDJA 3MV8D 3QPXH 5T3XL 2VDPL 5E2VL 4DGIL 4NPYB 2GTWB 5DEZA 4EIZC 1QVOB 2MNUA 3KR3H 3UAJD 4Z76B 5GZOD 2ZNWA 3IJSB 3K74B 4XAKE 1KN4L 1P4LB 3GMLB 3T3PE 2QSCL 2FR4B 4WGVB 5F7KC 3NH7L 3PGFH 4WU5B 4LCCB 5HHMB 4PJAB 5A3ID 3VXUD 1SJEA 4V2BA 2FBJL 4JHBA 2EECA 4H8WL 4RFEA 3RDTD 3SGEI 4RAVB 3JVGA 2AVGA 5A2LH 4LCUB 1J0HA 5T3ZH 5JDSB 3BGMA 1I8KA 3NABH 1HZHH 1GH7A 1I8LA 1JWUA 3MRLA 1CCZA 2CMRH 3W2DL 3W5MA 4PLNC 2BY2A 3KPSD 4FQIH 1KFAH 3NACH 2AGJH 4HH8A 1OARH 3C2SA 4Y19B 5BXFB 5B8CB 4XP9L 2CRZA 3T4AA 3MLXL 2Y07L 1CF8L 3H0TB 4ONGL 4GW4A 3T08A 3WEXB 4XWOC 3NPSB 3X13B 3DVNA 1ZLUH 3O3UN 3HUJF 3AXLB 5TH2B 1BEYL 1GOHA 4NKIL 2VN7A 1A14H 3JWDC 4LPXA 4WO4D 3ZE2E 3EDFA 4DUWA 4XC3H 3AS0A 1OD9A 3B6SB 2PYEB 2QADB 1FE8L 4PB9H 1IAOB 1VACB 1JF1A 1FDLH 2H32B 3QEGL 5GRVL 4OQTL 3ZE0E 2BNQD 4NO0B 4GMTH 1OAQL 2V7NB 1T1ZB 5AZ2L 4HWZA 4F7PB 1ZGLM 2ZG1A 4YEEA 1DN2A 4DW2H 4BK5A 3L6FB 5D7JD 5E8NA 4LLVB 3BUYB 3SQOL 4JB9L 3ZSSA 5CHNB 3BO8B 4JFXA 4OIIL 5SWSD 3CX2A 4NZJA 1DQDH 4PJDA 3VG9C 1HXYA 1MCPH 3D39E 3O2WH 4JR9L 1XCTB 3LV3A 4UV4H 4UIMA 5H35B 3GSNB 3NA4A 2DQUH 2AJ3B 3MJ8A 5HDQL 1AGDB 4JFFD 1UWEL 3H9YA 3S96A 4HPYL 3QG7H 1J8HA 4Q58C 4BUGA 1UACH 1LO0L 1YC7A 3WFEH 3QSKB 4XVJH 5CMAA 1MVUB 1TZHB 4NFBA 2NW2A 4J6RH 4NHCH 4P4RA 4PB0L 4GS7C 1YC8A 5FGBA 3K0WA 2B4CH 25C8H 3PABA 5FIEA 4KTDL 3FN9A 4JDVB 3QI9A 3RJDA 1QO3B 5I75C 2P5WD 3BKYH 5LGKA 4EQ3A 2I5YL 2DAVA 1T5XB 4LL9A 5B3NA 1U8KB 2ZUXA 4GRMB 1SBSL 4JDZB 5D96B 1D9KD 5HHOE 2DTMH 4MNQD 4P57B 4Y4KA 4O9HH 2E27H 2ERJC 4R26L 3FAWA 4F58L 4HKXB 4MWFA 2AAVA 3KNBB 3LKPA 4FQHA 3DYOA 4NQEE 5FUZH 3K7UA 4HDIB 4U05A 5HHQB 5DJXA 1J1OL 4CN1A 3R4DA 3PWLA 3FO9B 4QXUH 1X4ZA 1A4JB 1KEGL 5E6ZA 4S11A 3FN0H 2RJMA 1U91B 4CN6A 2CLRB 5KVDH 4ZFOB 5C08E 2WINA 4ZAKC 4Y8DC 1HCFX 4MAYA 1MREH 1L9MA 1YEHH 1FL6B 2V9TA 3BQUA 1FP5A 4O5LH 2B1HL 4M1DH 1CL7I 1UEMA 5ETUB 3O2VL 5IW1B 2F53E 1A3QA 2Z9TA 1UB6B 3QPQC 4LVOB 3T3ME 1MHEB 4PTUA 3MJ9H 5LGJB 3INUH 3W5NA 3CK0H 1W72A 4XP5L 1XF1A 5F9AC 4U0RB 3VXTA 3SE4A 4EI5C 2Y5EA 1XF5B 4DQOH 4HS6A 4I5BA 3LKRB 3QHFH 5I1HL 2NNAA 5E1HB 3VXRD 3WKNA 1FRGL 2VQTA 4WV1C 5C2BH 1NC2A 3NPZB 1WTGT 4L4JA 2FD6L 1AFVH 3O6FB 3QUYB 3VCLA 1I3RA 4N8VA 3ULUE 5EORL 4XVSH 5IM7A 1PW3A 4OZ4A 5SV3A 1YUHA 2IFFH 2R0KH 5DC9B 2Q86A 3U0TB 3ULVC 3QWRA 2B4CC 4P9HL 1KT2B 4X5XA 2Z35A 5I74C 1NANH 4MNHB 4OLXL 4PJEE 1YMMD 1YN7A 1KGCD 2GJZB 1YY9D 1TVHA 4MJ5A 4H25B 2AV1A 1JPGB 1YY8B 3ARVA 2QHRH 3OJMB 2BMKB 3D39B 1B4JL 4CADA 5SWZA 4LPYA 1MCWM 1NUFA 3HI5L 1JNNL 1U3HA 5EG6C 4X0KB 4R96A 4Z7WA 2J7LA 4HWBH 5TGBA 2CKBL 4K7PH 4Y4HA 2ADIA 1P84J 4HMDA 4NP4L 3VXOA 1ITBB 4KDWA 2DQCH 4B7IA 4YQXH 1UZ6F 5IEHB 1JN6A 3VXSA 3QH3A 4G8GA 5DO2D 1AD0B 1JUFB 4XGZA 1QSFA 1AIFB 2W0FB 5DK2A 5HGDA 2YBRA 3X17A 2EYSB 3CNKA 5HHMD 2AXHA 4PD4K 2ZUVA 1IE5A 1N64H 3VWJB 1YYLL 3QQ9D 3BISA 1NQBA 2W91A 3M1BB 4ETYA 2A83A 1CFSB 1OGAD 5E1AA 5KSAA 4ODXB 5HHOB 3F8UB 4PG2C 3R0MA 5TF1H 4KWUA 4KHTL 4ZOEA 3RY4A 1RZKL 5T1LD 5AUMA 2F5BL 4Y19D 4X8JB 3GIVB 4BQ8A 4ZFFA 4FFWD 3OKYA 5HDOA 1FNSH 1TVBA 4NQEB 4Q6IA 1AE6H 3DI3B 4JY5L 1OWRM 3CDGA 4G8IB 1JWMB 1UVQA 2F5AL 4YDVB 4Z7QE 3S9DB 1WBZB 4TUOB 3E1F1 3MGTB 3C6LA 1QUNA 5ICXB 4M6OH 1OSPL 3TVMD 3MRDB 4Y5XC 5C08B 3QWOB 7CGTA 4NN6C 1EEYA 4KPHH 2QADD 2NTFA 3EJYC 2C4FU 1P1ZB 4TPRL 1RUKL 2RB8A 2EDEA 4FMFA 4ZSOE 2F53B 4XVTH 4K8RL 4NO0D 1ZHNB 4M4RA 2XNAB 4CVZB 5IT2H 1YYMH 5HI4D 1H3TA 5C3LD 1KN2H 2XT1B 3DECA 3FT3A 4MGXA 1IEBB 4MQXC 2NY4B 1DE4B 1RFDH 1UJ3A 4GRLB 1IGTA 1IC4L 3RWCA 1EFXA 2AQ2A 3H7BB 1T4KA 3S34L 2XACC 5C0CE 4MA8H 5DD5L 4J2XA 2LABA 3HC0A 2PW1A 1U6AH 4UTAH 5ISZA 1XGPA 1RMFL 1M7IB 4YBLB 1MAML 4EUPA 2NQCA 4KHXL 1I9JH 2OZ4L 4FQ2H 2P1YA 5FA3B 4YFLF 3QO1A 2VZ3A 3QUMA 2EZ0C 4PJEB 3WSQH 2B7DT 5GIRB 4P5TD 4PY7B 3GIZL 5DHXB 1FZOA 3VFUB 1XF4B 4WUUD 2P24A 3TT1L 4H20H 1T1XA 2EXWD 4MMXC 3VJ6B 1ZVYA 3IDNA 4HFWA 3V6OE 1XR8B 1CDIA 2Y36H 1G7LB 4X98A 4K9EH 1SJXA 1VADB 1H8NA 2AK4E 1GAFH 4OAWB 1AGBB 1CFVH 1HH6B 1M1SA 5ADPL 2EEAA 4L9DA 1N7ML 5I1CH 5DJAA 1JPTH 2IQAB 1KEML 2Q7YA 5C7XH 4O58L 4YR6B 4AIZB 4XAKD 3ECBB 1P2CB 1CLZL 5ESQA 1DBBL 5T1MA 3WFZA 3S3JA 2HWZH 5E5UB 5JNYA 1EHXA 1V05A 4M7ZC 5LXGH 5HYSG 1T80A 2OK0H 3AM8C 3WIFA 4PLKD 4P3DB 1A6WH 4CMHC 3LKQA 4LU5L 4HBCL 4Y2OA 3EYFA 1X4YA 3QNXB 3RWGA 3U0PB 5TJWK 3VFPB 1G7PB 2FECI 4X5WB 2D7NA 1ZTXH 2X09A 3JWDL 4MNGE 3F12B 3ZL4H 2E6PA 4LBEA 4DK3A 3OBAA 1NCUA 4JFDE 1SEBA 5F7FA 3D69B 2CUHA 4DTGL 4YBQC 1NAMA 4E41A 4QHMB 5B39G 3JTTB 3L3OA 2WSKA 1RUQL 1LNUA 4C59B 2WWKT 5E99L 3NZHL 3KJ4C 1EK3A 4JPIB 4LSSL 2Y06H 5I1KH 1JNHB 1S7SB 1CDHA 4UT7H 1RJLA 5CUSH 4DN4L 4ESKA 5I8OH 5E00A 4P46A 3MODH 4DZ8B 5EU3A 3QUYD 3AS1A 4J8RB 4K23H 4OCYL 5FGCE 1RUAL 1WZ1L 1T5WB 4R0LC 3HUJA 1U3HC 5E5RB 3IYLW 1JPFB 4JN2B 5K93A 2X4NB 4I77L 5CGYC 4KJPD 3X14B 4ZSOB 1J12A 4JEGB 5I18H 1M71B 3RL1B 1WBYB 1GZPA 1TPXC 1MVFA 1I9EA 5DC4B 3CD4A 5F9DC 5KANG 4Z0BH 4ZOBA 4DVRL 2YUXA 1Q0XH 3I84A 2OMNA 3QZWA 4K9EC 3D39D 4EBQH 1DQLL 5C0CB 2W9DL 5DF0A 5C0DA 4AG4H 3DUUB 2X10A 2D03H 1CICA 5D72H 5FYKE 4XH2B 5HGAB 3V0AC 1JPSL 4PGEA 5FUOH 1NCNA 3SKMA 2NY1C 2YA1A 1RIVL 5EU5B 3M8OL 4HJGA 4XPHH 2D31B 3ZDZE 1U8LA 3UJTL 4KKAD 5C6TH 3MRHB 2DWEA 1S7QA 3TH4T 5MEQA 3ZKXB 1AO7B 1FAIL 4HGWB 5I1GL 2RR3A 5A16B 4G9FE 4Y5VA 4XP6L 5JIPA 2J6EH 3EO0B 2WM0A 3VWKB 5AZEL 1RZ7H 3VWJD 3EOYG 1S7WA 2RIKA 3E6FB 1RZFH 1AJ7L 2AK4B 4MD4A 5ALCH 3L3JA 3MOAL 3LSOB 4XB8A 3BZFB 3TN0B 4KY1L 3K81A 4DUVA 3CFKB 3VW3H 3NTCH 3OJDA 4GAFB 2YS4A 5TPWL 4NQED 3LDBC 4PRPA 3BD5A 5GSRA 4LP4A 1YDPB 1CE1L 1DFBL 3OKOB 4N9GA 2CUMA 2Y6SD 3MLZL 3O2DA 4QHNA 5T1DL 5HPOA 5IIEA 4X6FA 3MNWB 4JO4H 4J3SA 2IPTL 1KCSL 3O8XB 1U58A 2AQ3A 4LKCB 4NWTL 1EH9A 3DMMA 4WWKD 4JZOB 2HT4D 5C08D 1FNFA 3RY6A 4JFYA 3UBXB 4G7YL 4I0KA 5FK9A 5E24E 1MPAL 3AB0B 3V4VL 1N8ZA 3RPIA 2JE8A 4KRMB 4MNGB 3T0DA 4I4WA 4GRWE 3OKLB 2F53D 4M02A 4X5LA 1I7RB 4X9GA 4HIEA 4JFDB 2E7HA 1EAPA 3HA0A 4G6JL 4HQQH 3TBWA 1U8PB 2CK2A 1CQKA 2ESVA 3GJFH 4JZNA 4GQPH 4GRLD 3CFJB 4L4TE 3U6RB 3ULVL 4D9RE 2FEDD 4F2MB 3F7YA 3CH1A 2YKLL 4WJ5B 3VFGL 1NLDH 3QIBA 5GRVK 3FQXB 1RJYA 3VI4E 4NC0B 5FGCB 3ULUD 1MELA 2NY0C 4S1DD 4G3YL 3QULB 4OKVB 5HGHB 1YN6B 1ZHLA 4BQCA 4MA3A 5K9OB 3FN3A 4MX7B 1IAKB 4BSVB 5CILL 4QRRA 4GG6A 1IM3B 2LE9A 1I1FA 2FSEB 4XAWL 4FQCL 1HYSC 5FDYA 4NQDE 3G5ZA 1HSAB 2EDWA 1CDBA 4Q9RH 3RFZC 3DX9A 5D1XC 4XPBH 3SE3C 1KIUA 2C1OA 4BK4A 5T3ZE 4GKSB 4MCYA 1M05A 3SGKC 32C2B 5DZNA 4PV9A 4BFEA 3S35L 4JGMA 4JVWA 4HAGA 2P5EE 1SQ2N 3TLRA 2FEEL 4UV7H 4D0DA 3WFBH 1ES0B 2C3VB 3LPGA 2R1WB 1X5XA 1XGQA 4PRAA 3MOBL 4G9FB 4O00A 4QHUA 5F9OL 5EO1B 3EGSB 2CRYA 4WGWB 1ZA3B 4HS8H 1UC6A 3WN5C 3LHPL 3JV4A 4EI6A 3PWVA 1QFUH 3V2AR 1OTUD 1M7DB 4M43L 3N1QC 5B38A 1D5XA 1FAKT 3ROLB 1T0MB 3IRPX 4XI5D 5BV7H 1MWAB 2GK0B 3MTRA 1LGVA 1G0YR 1U3YA 4LEOA 5E2TH 2IQ9H 1KBGL 1S7XA 3MA7A 3VDAA 5LQBL 4OV6F 3EYVA 4XZUA 3KDMA 4KVNH 5F9WB 5GRYA 4V1DE 1VDGA 2VDOH 4NNYA 2JJWA 1QFWH 3BJ91 3O45B 1YECL 4DCQB 5FYJL 1A6UL 5F1KC 3VFNA 3R06A 5TDNB 2QHRL 2Z4QA 1WZLA 4RWYL 3C8HA 1II4E 4MDIB 2HFGH 4UIKH 1IL1A 1S7UA 2UZIL 3RIFK 3TBVA 1Q1JH 4RQQA 1HI6A 5EZJB 3G04B 2DQJH 4GRWB 1JCKA 4OFVA 4HJJL 1ZGLP 4S1RL 4ZTOL 4M6AA 3HI6H 4AEIH 5I1LA 5E8PB 1LD9B 5C0JB 3B2VL 4O51B 4WW2B 3UPCA 2VNCA 5AAWA 4L4TB 3V5KA 2IH1B 4K3JH 5IB2A 2DLFH 3EO1A 1OY3B 5K33A 4JE4B 3SBWA 4C83A 4LVNC 4U6TA 2BJMH 2XXCB 1WLHA 4HXAL 4ELMA 1P4IL 5C0FB 4HK3J 4JKWA 4TRPH 1EZVY 5I0DA 2HN7B 3SDCD 1OHQA 4ZO6A 2DN7A 2R69H 4MXWH 4LNVA 1RZ8B 5I16A 5K9KA 4ZUUB 5HDBF 3OKKA 2XZQL 5AD0B 3HE7D 5DQDH 3MYZA 4TNWK 3ILPB 5GS1A 1FNSL 3O9WA 1OAUH 1E4WH 4KQ4H 3A6BL 4KZEL 3P0YL 4POZD 1OSZA 1I7TB 3VWKD 3MRPA 3F6LA 4ZNCD 3ZDXE 3BKMH 1YZZA 2FJHB 1R3LB 5L88L 2B1AL 2DOCA 4JFEA 2JF1A 4PJ9A 5GZND 1W72L 1R5WB 3BHBB 3RY6C 2P7TB 4TNVF 2P5EB 1ZLVK 1CR9H 1U93A 2BP3A 1NC4B 4FQJL 4OUUA 4OFIA 4XP4L 2VB5A 3VU2A 3AMKA 2R8SL 2V7HB 4YHOL 3VH8A 1GGYA 2FYYB 4TUJA 5CGMA 1FFPB 2BVQB 1EUTA 2H2PD 3MBED 4JRYA 1KLGA 1URLA 2NX5A 5KOVC 4AM0B 5CBAA 3W39A 3VD5A 3DV4B 4GSDH 4W4NA 3RGVC 1QHOA 1VFAA 2IALB 1BM3H 1BIIB 4RAUA 3NIGE 3QIBC 4JN1H 3CMGA 2GFBB 4LLUA 1IKFL 1S78C 5E6IB 5HJ3A 5ABDE 1ULVA 2NY5H 3P77B 4MA8L 3GGWA 1X5ZA 1ZT4A 1WK0A 1P4BL 5I19H 3PIQB 4IS6B 2JB5H 1OM3H 4LCWE 4UTAL 1J0ZA 4JFDD 1BQHB 3UTQA 4CGTA 1XGTA 3A6OA 3OB8A 4Q9QH 1ZLSH 4ZNEA 2FATH 1LO4H 2DDQL 5INCA 1GGIH 1WBXB 3EIFA 4JVPA 3FT2A 1DBAL 1WT5C 4V1DB 4EVNA 3P73A 1RULH 2JB6B 3NGBC 4NT6B 5A1AA 3LKOA 5CBEA 4DEPC 2AKRB 4OGAD 4WV1B 3F7QA 5IFAL 3AU1B 1J1PH 4PJFF 1ZWIB 2PXYA 1J05B 3CC5B 1DEEB 4O2FA 3P40A 3S8WA 5DD3H 1OB1B 3U0WL 5M95B 1U36A 1QHPA 1GGBL 2ORBL 3ULSB 2Y5TA 3OXSB 2CLZB 2HH0L 1PBYA 4LSPH 3OV6A 4U2YA 4JFZH 1DLFL 4JANB 1PG7L 1BZ9A 4F33A 4NO3B 3WD5H 4FRWA 1I9IH 5DR5L 4XCNA 3DX7A 3MRQB 1DBMH 3ARTA 3SKUD 2G75B 4KVCH 4YHZH 1GGUA 1LMKA 4LKXB 5CEYA 4H88H 4K3DH 1I1AB 4EXPX 4F57H 1GC1H 1G6RL 2CDGA 4OD3H 5I6XC 1YNTB 3WKMH 4OTXH 1P84K 4YHMH 3HCVA 5JHLH 4JPVL 1IQWH 3V7AG 5F1IB 3ZSTA 1IVLA 3RNQB 3OZ9H 3KYMA 4G9DB 4G9FD 4NKDA 4GKOA 5FYKU 4DOHE 5J8OA 8FABA 1N6VA 3SDAC 3QUZC 1UH2A 1CVSC 4GUPA 4I2XB 4XRCA 4QKXB 2XRAH 3TF7C 4MJIA 1F4AA 3B9EA 3BH9B 4G6KH 4YNYA 1A4KB 5I71C 3LEVL 4WNQB 2HYMA 3GZKA 3U7AA 3IXAB 2DQEH 4R6UA 3GJEA 3WXWL 4MVBD 3MRMB 1NLBH 5J6GA 1BFVL 1WIOA 2X4UB 4O2EB 5FECA 2AJUH 5DFWH 4JQIH 4TSBH 15C8H 3N1FC 1L7TL 5BVPL 3FB8A 2V2WB 5DD1H 2YWYA 1A8JH 3MLTA 3TZVB 5KSUB 1JGVL 1T20B 1TTGA 1KULA 4YIQA 3MRKA