3OF6A

Human pre-t cell receptor crystal structure
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T cell receptor beta chain
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A02
1G9MC 2E27L 3SDDB 4MD4B 3BEVB 1OP9A 4F2MA 2WANA 5DSCA 5I17A 2FJGB 3RWCA 3FOLA 4KKLC 5IM7A 1RUML 1R3LA 1W8NA 4OLVL 5KBNC 2VLLA 5K9JH 3QPQD 5T3XH 3QIWA 1OSPH 1MQKH 4QXTA 3PF2A 1W2KT 1YJDC 3RU8L 3RY5A 3ALXA 4UDTB 2F9BT 2EDNA 2EEAA 3SY0B 1FORL 3L95A 4OM0H 5DUPH 5IMLB 2A9ML 4PLOB 3VI4E 1GJIA 3L9RA 5HHOA 1HHHB 5HHXH 1JPFB 2B4CL 2WZPD 1WBZA 3BSZH 1GZQA 5L6YH 3BDYL 3LB6C 1ONQB 1QP1A 2HA1A 1RZ8A 4JFXB 3SE3C 1TCRA 4NOBA 4AENA 5J6HA 3QXVA 1KCRH 4B50A 5HYQB 3IETB 3DGGA 4KHXL 1YY9D 5HYSB 2B2XH 3QIUC 3UTPE 3OV6A 4X9FA 1NUNB 2HJKB 3GMMB 3TT3H 5I30L 1NGWA 5KSUB 2OJZH 2BCKA 4U33A 3KPLA 3PWVB 4IRSA 2A83B 1C8PA 1MREL 4QNPE 3WJLC 2VR9A 1KTKE 4HKJB 1J8HB 4Y4FA 1FGNL 1GOHA 4L3CB 4A6YH 3TIEB 2XT1B 3ULVL 1YYLH 5I66A 3QUXA 1PZUB 4OCMC 3GSXB 1UM5L 3ARVA 3NGBC 1FC1A 4X6CF 1WIUA 4PRPE 2B0SL 5DC9B 2NY4D 3VXRD 3H3PH 4HJGB 4HUKB 5IIEB 3BPCB 3GGWB 4X6DE 4OGAC 1R0AL 1C5BH 2ZKHH 5I6XC 4HCRH 3VXUE 4ZYKA 3ZYJA 4KQ3L 3OF6A 1I9EA 2HLAA 1KJMB 5LGJB 5K33A 1PQZB 1G7LA 3AREA 1DBML 5C0AD 4M6ML 4XC1H 4O2EA 3WN5A 1JWSA 1IARB 1G7IA 4NT6B 5F88B 1FYTD 5EIVA 2IQAB 3IDUA 3M17A 4FFWC 3SHSA 3DRTA 2H26A 1A3RH 4XVJH 4OCXH 1GGCL 5HDQH 1ZVSA 1IJ9A 3KJ6H 5BZDB 1UJTA 2CRYA 4LPWA 4KV5E 2D7MA 3NVQA 2VL4A 4KTDH 5E94A 1WWBX 1KC5L 3MCLL 1CL7I 1N4XL 1RPQA 2DS4A 3X14B 4AK1A 4QRUB 1MNUH 1RHFA 4WU7B 5I1CL 1GAFH 4NQEA 3QDAA 1F3JA 4WUUA 1SQ2N 1DLFL 2YMXL 3KXFB 1INEL 1OF2B 1NSNH 4BQ6A 4ZAKA 3DMMC 4HIXL 3UAJC 4GKNA 4MA1C 1MFAH 4HT1L 1BM3H 1QQDB 5K59E 1YQVL 1FH5H 3RA7L 1EK3A 3C6LB 1DL7L 4X98B 1BP3B 3PGFL 4P2OA 4N1EA 1W72B 2VDOL 3DYPA 5FYJH 1OAKH 5T5NF 1DSFH 3LS5H 4J12A 4ONFL 1O7SA 5C07B 3O6FA 4DK3A 1KULA 1CXFA 4G6AD 1CQKA 5F7YC 3VRLE 2JELH 3VXSD 4RMWA 4NPYB 1LO3H 1U8HA 4Z9KB 2WBJD 1M71A 5EU5A 5FO9A 3B4NA 5LBSL 1K6QH 1KCSH 1CICD 3ESVF 4DZ8A 1W0WA 1ZT4A 2OI9B 1QRNA 4R4FL 3SDCB 4LIQL 4ZNCD 2QLVB 3GEWB 2OK0H 2W92A 4Y4KA 1P6AB 5J6GA 3HR5B 2J5LC 3KJ4C 2F5BL 2DQJH 2DD8H 3HUJE 4WWKA 5DFTA 3RP1A 4NQCA 1F00I 1PVHA 4PREA 2EXYC 4Q9RH 5DEFB 5EO0B 2QADC 1CZ8L 4WHTB 4JPIB 3BX7C 3U46A 3WNLA 5IVXB 3DTXB 1D9KD 3LKPA 4GUPB 4N8VA 1T66D 3VXMA 3SE4A 5GGTL 5HBBA 2XKUA 1JWMB 4JY4B 5CKAA 1QA9A 1CDUA 2A6JA 1XGYL 3VG0H 4WDIB 1J8HD 1VGKB 2XACC 1CGXA 2H2SD 2HFEA 3EJYC 3KAAA 3KYOA 4U3XA 5D7JA 4XVUC 2VWEC 1WFOA 3RWJA 1P1ZB 4M4PA 1E6JH 2EXWD 2F53D 3Q6GL 4RWYH 4NCC1 2AABL 4PJ8C 5MI0B 4LRIA 4Z7VE 1Z9LA 2X1WL 4OZHA 5JZ7D 2HT4C 4FZ8L 3WXVH 3IDXH 2W60A 2CLZA 3EKCA 2IPTL 3VXOB 1LHZA 2XXCB 4MJIE 4ZPTA 1P4BH 4ZUVA 5MERB 8FABA 1QBMH 3QDJA 1A6TB 3I9GH 3EBAA 1DANU 1WZ1H 1I7TA 2J6EH 1S7VB 2VYRE 4PRDB 4UQ2A 4XMLH 4XXCC 2MCG1 5CGMA 4EVNA 2CIKA 1P2CA 4RX4A 5EOQL 5F6HI 1NFIA 4FP8L 2XZQL 4JO2H 5EBLB 2Q8AH 4HFUH 2CO7B 1CD1A 5CMAB 2PYEA 4UILL 4XCNB 4Z76B 2OTPA 4LHUA 2F15A 3DNKA 5EU4A 5KSVA 1MAMH 4M1GL 2I5YL 5GSVB 1AD9A 2IH1B 5HPOA 4OZFB 1DTUA 1H8OA 4UT6L 1H5BC 5ESVB 2HT3D 4K94L 2VLJA 4YPJA 4D3CH 4P48A 5DUBB 2VDQH 1NC2A 5DRXA 4GG8B 2VE6B 4HKZB 4ODUB 3LN9A 2GT9A 5HDLA 5C2UB 3EJJX 3UTPD 3PXJA 1KUMA 5DMIL 4YEFA 3V79C 3HI5H 4NWTL 2R1XA 3NIFF 4HAFA 3VFTA 1FLRH 3RWHA 4D9RE 4G6KL 3FCTA 4LDOB 2XY1A 2JF1A 3CXHJ 5D93B 2NR6D 1DQJB 5CCKL 3FN9A 4AG4H 2J2ZA 1TCMA 1Q38A 4HIEA 3Q5YA 3DVNA 1QNZH 1P7HL 5TDPB 2WUBH 1EBPA 1L7IL 2NX5E 4MNQB 5DJYB 4YPGB 3OXSA 4OIBA 2GJ6A 4APQC 1J7VR 4Z7VB 1KBGH 3HA0A 4PRPD 5DQDL 3S3JA 3WKNA 4NN5B 4I3SH 1LMKA 4YHZL 5BS0B 4YIQA 4GS7B 1W8OA 3NH7L 2GI7A 2UWEF 1HCVA 3VXUD 4OI7A 4PY8J 4CRPA 3MGOB 5J1AB 4Y4FC 5JTWA 4PJBA 5JPNA 3UTQA 5GGVY 3O6LL 3OX8A 2MMXA 2FZ3B 3QUXC 1U8PB 1J8KA 3OGCB 3B83A 2UYLA 1T7VA 1F2QA 4PD4J 1JYXA 3MLPA 3S36H 1A1OB 1G0XA 5GIRB 5EU3A 5F70A 2JB5H 3SKNA 1HXYB 2O5ZL 3RI5F 2BNRB 1NANH 2VMFA 4NSKA 3W11C 3X17A 1HYRC 1LO0H 5ID0A 1CXEA 1QR1B 4WW1B 3ZKXB 1UVQB 5EZOH 5IG7B 1RUPL 1OB1A 2Z8SA 1G1CA 4GMTL 4KK5D 4LPYA 4ZSOE 3EYQD 2XTJC 1AGBA 3LMJH 3V8CA 3FT2A 2VSCA 4L4VB 5DHVA 3BEWA 3ILPB 1BPVA 3AXLA 2F8VA 3F12B 1N8ZA 4JFFE 4HXBL 4XPGL 3FB7B 5ALBL 3WXWH 1YEGH 4GG6F 4AZ8A 5D72H 4RGOH 1CLYH 2E27H 5FV1L 4L4TB 3QXTA 1F3RB 5C1MB 1IL1B 2EE9A 2MNUA 2VLKE 1A7RL 1FG2B 1RUMH 1YUHA 3K2UH 5GS0L 4OLVH 5IB3A 4RDQF 3MUGA 3F5WB 5DZLA 4OZGB 5JLZA 2DQCL 1UFUA 4XHJD 5CP7B 1QFWI 3GSOB 5KAQG 1IM3A 1I8LA 1AO7B 3U0PB 3RU8H 3OGOE 1FORH 2ICEB 4I18B 2X1OA 4ZAKC 1UYWL 3RDTB 2A9MH 2G60L 2NX5B 2V7HB 2B4CH 2Q86B 3IXAB 3C6SB 2VJXA 1K8DA 5GGVL 2PTTB 3O3BA 2L7UA 3MCKA 4P2OC 2BNUB 3D39E 4AMKL 1UJ3B 1C1EL 3OKDA 2NXZB 4U6HA 3QUKA 4NIKB 1EJOL 5IFAL 5C0GA 3KPRA 3VCLB 1B9ZA 5I30H 2BVOB 2D2OA 3QHFL 3MOBL 1JWUB 5DD3L 4GRWB 1QPXA 4JZNB 5ILTL 4RAVA 3X13A 3GJFK 1MREH 2X4TB 4HDIB 2Q3ZA 3IU3A 3QZWG 5DVOA 2VWEE 4OCWL 1QSFE 4JY6A 1FGNH 3UC0L 4L8SB 1NJ9A 3G6JA 4XP4L 4U0QB 4ZFZB 2B8OT 1AHWC 1UM5H 4QYOB 3SDDA 5C6PB 4MD4A 3BEVA 1KXQE 1KENL 2DTML 2FJGA 3MA7B 4Y4KC 4JGJA 2CLVB 2B0SH 4OCRL 4YK4B 3VFSB 4JZJB 3UBXB 2G75B 1R0AH 4YHIB 4Z0BL 1ZT7B 2NY7L 4KQ3H 2D7TL 3S37L 3FO2B 4UDTA 4YUEL 2CDEB 4F7CB 5IMLA 1TTGA 2P46B 4M6MH 1S78D 3RNQB 2R0LL 1HHHA 5BS0D 3SE4C 5D7IA 1ONQA 3TYFB 4MJID 4JFXA 4PG9B 5D7JC 2XZCL 1GGCH 5HYQA 3IETA 1B4RA 2EEBA 4PJFB 1KC5H 2HJKA 3GMMA 3MCLH 1N4XH 1P9MC 1M4KA 5KSUA 3RY6A 1I3UA 4OQ1A 4LRIC 5FEBA 3PWVA 3O2DA 4MQSB 2EC8A 2YMXH 2A83A 1INEH 4OT1L 4HIXH 2IH3B 1RY7B 3QIUD 4HKJA 1OLLA 4HT1H 1KB5B 3QXAB 3TIEA 3RA7H 1DL7H 4BJLA 3PGFH 2HKHL 3MRDB 4F7TB 5CJOL 3GSXA 1QFPA 2ZG3A 2IMMA 1BBJB 1P5UA 4C56E 2MCPL 2ESVE 4HJGA 5IIEA 3BPCA 4ONFH 2NXYB 1MCWW 4Y4HB 3GMQA 3EO9L 1WBYB 3OKLB 1GC1C 4LCIL 3ZTNL 5FYLL 2FNBA 4MWFB 3D18A 5LGJA 4D9RD 4UV4L 1PQZA 7FABL 2HAZA 4X4ME 1NUFA 1AO7D 4OGAD 4I5BA 4R4FH 5ISZE 4NT6A 4LIQH 5F88A 4IJ3B 2IQAA 4XVSL 3P73B 2DJUA 3K74B 1E4WL 3NCEB 1FAIL 4MVBC 4H1LH 4DGIL 2NX5D 5BZDA 1RJLB 5EWIL 3KVQA 1BQHA 3P0YL 1XAUA 3RUGF 1DQLH 3WYRA 3X14A 4PFEA 4QRUA 4FFWD 1A6UL 4WU7A 1CZ8H 3O9WB 3SDYH 3KXFA 1RU9L 5JIHA 1OF2A 4PJEE 4H0HB 4Y16C 5GGTH 5KSAA 1LP9E 1DANT 3C6LA 4AM0B 4X98A 3S88L 4XNUL 1W72A 4PJAB 3RTQB 5KVGL 1XGYH 2AQ1A 3DURA 5GISL 5H8DA 5DJ6B 4EDXA 1A9BA 2UVFA 5EBWB 4WHYH 1ROWA 1MLBB 2C9AA 3UAJD 3Q6GH 2P8LB 5C07A 5L0QC 1IGIL 2AABH 3SJVE 3I6KA 1U3YA 5K9OA 5JW3L 2E9WA 3ZE0F 2H2PC 3TZVB 1BJ8A 1TTUA 5HGBB 3BP4B 4FZ8H 2APTA 5I8KL 2IPTH 4JFFD 5IHZB 3SDCA 2HN7B 2AXHA 5J4MA 4Z8FH 2Y06L 1ORSB 2VLKD 2H6PB 2NY0B 4OD2A 4WI5A 2C3WA 5E8EA 5EOQH 4KXZH 4FP8H 3QR2A 1ZMYA 1CF8L 1HDMA 4Z7WA 4F7PA 5DEFA 4UILH 3U2SB 4N0FB 3T09A 1UWXK 4CU8A 4WHTA 5JW4Q 1TQBB 1SYSB 4BQ8A 1AKJB 4M1GH 5IVXA 3DTXA 2I5YH 4MYWB 4OAWB 2BXYA 4UT6H 4K94H 2V2WB 2EXYD 1MCNA 2B39A 4JY4A 3D39D 4HUUB 2QADD 4X4YB 4WDIA 5C92A 5ICZA 4R8WL 4X6EB 1P1ZA 1FNSL 3D69B 4L1HA 4JKMA 1BQUA 5ENWB 5B8CC 4O2CB 4NWTH 5SV4A 1DZBA 1LP9B 4G6KH 1DQQB 3CJJA 5E2VH 3DHMA 1NGPL 4KPHL 5F7KC 5HHNB 1QSFD 5CCKH 4QRPE 2EEDA 5F1IB 3VXOA 2EYRA 3TT1H 3FJTA 4PJ8D 1A6AA 1KJ3L 3B9DA 1VERA 1S7VA 3TC9A 1T5XB 4PRDA 5D6DA 3S6CA 4YHZH 3MNWB 4TOYL 2CJUL 3W0WE 3S8WA 4S2SB 5EBLA 2W0KA 4FQJL 2CD0A 4Q0XL 5CMAA 4XCNA 4Z76A 4CU6A 4LU5L 1Y6MR 4L9DA 4LGRB 3O6LH 4V2BA 2ZPKL 2W0FB 2PUQT 2ATPB 3MGTB 3Q2CA 5F89B 5GSVA 2IH1A 4OZFA 4LVHB 3SDDC 1BJ1J 2H9GA 5ESVA 5DJ0B 3TN0D 1QR4A 3EFDL 2AJYL 1UZ6E 1YA5A 2O5ZH 5DUBA 3GKZA 3AS3A 5LAXB 5GS2D 5AEAA 2VE6A 4HKZA 4J1UA 4Q2ZB 3BWUC 4YDIH 3BIKB 3V5DB 1LVEA 1RUPH 2ADFL 4GMTH 1LGVA 1F8TH 5C0BE 4OFKA 4HXAL 3FFDA 1S7SB 1D7FA 5L2KB 2EO1A 4XPGH 5EBMB 5ALBH 1QLEL 3N1QC 2V5TA 2NTFB 1DQJA 4P4KD 3FN0L 3LD8B 4E41E 2APVA 1B0WA 4PTTB 5TDPA 1DBJL 1A7RH 1X5HA 5GS0H 2BK8A 4MNQA 4PBVC 5DJYA 1RJCA 5GJTH 2C3VB 3P4MB 2IPUG 3WCYA 3PUCA 3UDWC 4C56D 2ESVD 4WW2F 3RY6C 1QACA 3INUL 4PB9L 1U8OB 2F5AL 2R0ZL 4XP6L 1UYWH 5CBEB 2G60H 4NRXA 3MGOA 5J1AA 4APQD 5F9DC 3BUYB 4MXQD 1S9KC 1Q9LB 2XNAB 5E9DE 3CVIL 2FZ3A 5GGVH 3LDBB 3O4OC 1U8PA 5ID1B 3ARZA 2BP3A 4AMKH 1A1OA 1U6AL 5ISZD 1HHKB 3VWKD 2JK5B 4XBGB 2BNRA 1EJOH 2IBGA 2Q7NA 5A43C 5IFAH 3OR7A 4OCLC 2XQYK 1QR1A 4LBEB 4WW1A 3SKMB 3QHFH 1UVQA 3MOBH 5IBUG 5ILTH 4ODWB 1ZLUK 3O8XA 4I0KA 3EOYG 4CVXB 4OCWH 3WDHA 3HI6L 4L4VA 3UC0H 3ILPA 3W11D 1WEJL 4O2FB 4IOFC 3FB7A 4L4TA 3TA3C 4PP1C 1KENH 2DTMH 3GJFH 2HTLC 5CEZE 4JQVC 4J7RA 3NZHL 2XKNB 5D1ZA 2IJ0C 4OCRH 1WWWX 1RI8A 1LO5B 2VC2L 3F5WA 4OZGA 3L3JB 1BFSA 3GSOA 3NAAL 3MV01 4MQ7B 2NY7H 4OFYA 3T3MF 2NMSA 3QQNA 2D7TH 3S37H 4QOKB 3U0PA 1E4KA 2VXUL 1ZLVK 3SJVD 4YUEH 3VA2C 2ICEA 2HFTA 4I18A 3RDTA 3TBSB 4HS3B 2R0LH 1UWEL 5KSAC 3IXAA 3SBWC 2FATH 1YEEH 1TZHB 2BNUA 2XWBB 1CFBA 2O26U 3KS0J 1UJ3A 2XZCH 4WI7A 4G7VL 4X4XB 2GY5A 3E6FB 3SEPA 3G5ZB 4R0LB 2VDKL 3C2AL 4HSQA 1VESA 1YZZA 4YE4L 4XHQA 5TJWK 3VCLA 5IVNA 5E9DB 2BVOA 4LQ1A 1JWUA 3O41B 5CWSB 4JZNA 3MQIA 1U93B 1KFAL 2VDPL 3FB5B 4HDIA 3PJSA 5GGRB 2R0KL 1NFDF 4BUGA 4L8SA 3SDCC 2HKHH 2EDBA 4X7TB 3VWJB 4ZFZA 5CJOH 1AXSA 5ADOH 1XIWB 4QYOA 3PWJB 3QUYB 3LIZL 3MA7A 2JJSA 4HK3J 2CLVA 1LNUB 2MCPH 1SVZA 3H2WA 5DK2A 3QAZB 3C8HA 4JZJA 3VFSA 3TFKC 3UBXA 2G75A 3EO9H 4YHIA 1ZT7A 3D2UD 5E5MB 4LCIH 5HD8C 3ZTNH 5FYLH 1OGAE 3FO2A 5D2LF 5CP3H 3CFJB 1AR2A 2CDEA 3PHOA 3EJZD 1IQWL 4UV4H 7FABH 3ZDZE 4F7CA 5JUEL 3RNQA 5LQBL 3K1DA 5FYJU 3BKYH 1F6FB 1ZOXA 3J8F7 1Z9MA 2ED9A 4QRPD 5I74B 2EE3A 3TYFA 4GH7B 4XVSH 1RZIB 3SOBH 1ITBB 1F4XL 1FAIH 1IGTB 4QHMB 4PG9A 1BGXL 4JHWL 1MCRA 3N1MC 3U83A 5EWIH 5C0DB 4N8VG 2LTQB 4PRAB 3P0YH 4P23B 4PJFA 2DQIL 4B7IA 1A6UH 4UB0L 1JK8B 3W0WD 1G9ML 3GB7A 5IB1B 2XYCA 2OXGA 4JFPB 4MS8C 4JQIL 2QL1A 1RU9H 4M61B 5BXFB 3MV9E 2IH3A 1FFNA 3MJ9L 3QJFB 3QIBC 1KB5A 2XA3A 3U0TA 4JGMA 4C4KT 3S88H 3MRDA 4XNUH 4F7TA 5KVGH 1CE1L 5HTSA 5GISH 4M4RA 5I1LB 1E27B 1BBJA 1CGSL 3MNZA 4Y2DB 4Y4HA 4YBLB 2Q6WB 1IGIH 1VFOA 1WBYA 5JW3H 1GOFA 3N1GC 4U31A 4C83B 1CE6A 1JZ7A 5C0BD 2HKFL 5IK3B 3SO3C 3MLSL 2OR7A 1MQ8A 5I8KH 1YEJL 3ARFC 1S7XB 1TNNA 3DX9B 4L8DB 4E41D 4NGHL 1T5WB 3P73A 2Y06H 1WJ3A 3K3QA 4JREB 2ZUWA 1OGAB 3BAEL 5A16B 3ZHLA 3ROOB 3B43A 1IT9L 3HE7B 3NCCB 2DWEB 1WVZA 1EMTL 1CF8H 1YEKL 2XICA 1DN0B 1ZWIB 3EFFB 5EOTB 2X89A 3O9WA 4MVBD 1FYHB 1BIHA 4G9DB 2UV3A 4U3HA 1OTUC 3V6ZB 1A47A 5LGKA 5E9DD 5B39B 4KZEL 4XRCB 1UWXH 4PJAA 1CLOH 3RTQA 1NCNA 1DN2A 3VG9B 5B38G 4IRJA 5J9PB 1Z9SA 5DJ6A 4R8WH 3DPBA 5EBWA 5I73C 5EU7C 4QXUL 4ODXB 1MLBA 1PKOA 1VCAA 1Q94A 1FNSH 1IKNC 4HBCL 4DAGL 4Y16D 3OTTA 3QDGE 2P8LA 2PTUA 5TDNB 1EDQA 3OKOB 1F11B 3EOBB 3IU4L 4XPBL 4JN1L 5ESAB 1MCDA 3TZVA 1NGPH 1R5VB 4KPHH 3BP4A 4ZS6C 5FGCE 4J6RL 3MMEB 1OCWH 2R2EB 5IEHB 3G9AB 5IHZA 2VDLL 3SGEH 3HPJB 1TJIL 2HN7A 3AMKA 3MODH 4LCWB 2H2PD 3RWIB 1KJ3H 5CEZD 4PIRF 4LQFH 2HT2C 4MA7H 1ORSA 4TYUA 2H6PA 4M7LT 1HKFA 1CFVH 3HNSL 5J1SC 2W9EL 4HWBL 3ZKXC 4TOYH 4JKPL 3CLFL 2CJUH 4RA0C 1LWRA 4Y5VB 2YPKA 4CW1B 4FQJH 3O8XC 4FFZL 4Q0XH 2Q8BL 4N0FA 2IADA 4BQCA 4LU5H 2ADJB 4XBPB 1XGTB 1SYSA 1WITA 1AKJA 3MRQB 4MXVE 5IBLC 4P23D 4PJDF 4OAWA 1LDSA 3TESA 2V2WA 5D1ZC 3EFDH 2WINB 4B53A 1QRKA 2Y5TB 4HUUA 3DV4B 4X4YA 4KGLA 2FRGP 3ALWA 4X6EA 4KK8C 1B3JA 4P5TC 4FXKB 4LVEA 2YWYA 3D69A 3WHE1 5ENWA 1BVLA 4O2CA 2A77L 1MI5E 3R4DA 5AD0B 4K8RL 1WZMA 4HXAH 1DQQA 2LAAA 4KMTH 4GAYB 4W4OA 1V3KA 1DEEB 3CFKB 1QLEH 2AEPL 5HHNA 2VERN 3FN0H 4U1GC 3IFLH 1T0NA 2IBZX 4HUNB 5F1IA 3HAEB 1DBJH 2VLME 4EEEA 2V2TB 1PYWA 3NOIA 3EHBC 1S7UB 4FG6D 4KK6C 4X80L 1X7QA 3MNWA 3DBXB 3TCLB 1LE9A 3U4BL 3INUH 2VRAA 4S2SA 5LCVL 4XC3H 1Q9WB 4PB9H 2F5AH 2R0ZH 4XP6H 5AWNL 3WS6A 3MNVB 1OGAD 5D8JL 4L29B 4AT6A 5C3TA 5IHLB 3CVIH 1IAIM 2W0FA 4PJ7F 2ATPA 1FNLA 5F89A 3G5VB 1BF2A 1OGTA 4XBEL 1U6AH 2JJSC 5DJ0A 4Q9BA 2GY7B 2EC9T 5IR1A 4OCSL 2Z4QA 2WIMA 4IM8A 4Q2ZA 5DI8B 3IDMB 3BPLC 1TNMA 5TF1L 3SGKA 3BIKA 2J88L 1YNLL 2KZWA 3V5DA 1ZV5A 4HWNA 5IVOA 5TF0A 4OBSA 4EXKA 3L3DB 4GLRI 5FM5O 3HI6H 3EDDA 2C3XA 1NAMB 2EDQA 3QHTC 1S7SA 1RK0B 1RK1B 5L2KA 3QEQA 1WEJH 3MV9D 5EBMA 1WAAF 5D1XB 4M48L 4UOJA 3SDAC 4RGNC 2NTFA 4F9LA 4PJHE 1ZLUH 1IVLA 2CXGA 5C6TL 3VMPA 3NFPB 2QQNL 3NZHH 3ULUF 4PTTA 4R97C 3SGJC 4WV1C 4HG4J 1KXVC 4LLQB 4DKDC 1UM4L 2C3VA 3KHQA 1MJ8L 3P4MA 3UJIH 1A5FL 3VXNA 3NAAH 4O51B 2VXUH 4G7YL 3TJHC 4Y1AE 5FKAB 2CKBL 1EERB 4JFEE 5CBEA 5J8OA 2J7LA 3MV8E 4JCLA 1EHAA 3V5HB 3BUYA 1T2XA 1UWEH 1P7QB 1Q9LA 2XNAA 4DOHB 4PJCF 5FUZH 4KUCF 3DIFB 5C09B 3UTTE 1HCFX 3DXAB 1ZLVH 1RIVL 3HMWL 1P4IL 2YEZB 3QHZL 4UTBL 3EDKA 2VXQH 5HHME 3ZKQD 1CD9B 3MLUL 4G7VH 4LCCB 4U0RB 3M07A 3H9HA 2JK5A 4XBGA 4JO3L 2VDKH 4Y4HC 3C2AH 5E7FA 2UVEA 4QRRA 1U8MB 2OZ4A 4LBEA 4ORZC 1LK2B 3SKMA 4WI4A 5E2JA 3LH2L 4PJGE 4S0SD 3IS0X 5EU7E 1KFAH 2OSLA 2VDPH 5TQ2L 4CVXA 3DI3B 4J3VA 2BVPB 2R0KH 3WIFB 4YZFE 1MJUL 2BSRB 4P57A 1AFVH 4O2FA 4ZPVA 4JJ5B 1YDPB 3OZ9L 3DSFL 5ERWB 1LEGA 3LIZH 3H8NA 2XKNA 2JTDA 3L3GB 1PG7W 2MKLC 1LO5A 2FBJL 4QHKJ 3L3JA 4U7KA 4X6FB 4ZUSB 3G6AA 4MQ7A 1H3UA 4KRPC 3IDGB 1F2XK 4QOKA 2I9TB 3QDGD 1KV3A 3TA3D 4BK4A 4PP1D 2HTLD 4UIMB 2L4OA 1MHEB 3Q5TA 5JA9A 4YFEA 3JVGA 3C5ZC 5IOPB 5JUEH 2V9TA 1U91B 4HS3A 1T83A 5LQBH 5C08A 5EU6B 3MLYL 5KVEL 4F9PA 3REWB 3ZYOA 1BQHG 2VB5A 1JTOA 4U3CA 2EDEA 4HLJA 4RAHA 3RTQC 2CUMA 3KYMB 1TZHA 2OXHA 4IRJC 2IFFL 1F4XH 2XWBA 5J7CC 1BGXH 3T2PA 4JHWH 4X4XA 1TETH 4JFOB 5EDXA 3E6FA 3G5ZA 2CR6A 2W0LA 1JGEB 3H0TA 1KPVA 3MJ8B 2DQIH 4TN9A 4KRNA 4AQ1B 3ECBB 3UTTB 4UB0H 1G9MH 4PJ5E 3TZVC 4Y2OA 4BUHA 3O41A 1VA9A 5CWSA 3NBNA 2EE6A 4JQIH 1MIML 4S1QL 1U93A 3FB5A 4G9FB 4EUPB 3U1SL 3MJ9H 5GGRA 2R2HB 2E9JA 2FH6A 4RBPK 4X7TA 3VWJA 2AJVL 1CE1H 1XIWA 5J13C 5TDOB 4Z7QE 3PWJA 3QUYA 3FO0L 5EPMB 1FZOB 1X4YA 4NZJA 4FQLL 3X3FH 1LNUA 3QO1B 3O0RL 4PLJC 3ZHKA 4L8CB 4TSAL 3FRPA 1FE8L 5JR1L 2QHRH 4LL9A 5E5MA 3C5JA 5TE4L 1CXLA 1FC2D 2HKFH 1MI5D 5FO8B 3CFJA 1I9IL 3MLSH 1J88A 1IEBB 1CCZA 1M6OA 1YEJH 2XN9E 6CGTA 1S3KL 2X4OB 4M7ZC 4CGTA 3TFKD 4FQPA 3GSWB 3V5KA 1NCBL 4NGHH 5D1QC 5HD8D 3WLWC 3VFGL 1EEZB 1RZIA 2VLMD 3BAEH 4QHMA 2P7TB 1G7PB 3PG2A 1AIFB 1IT9H 1EMTH 3RPKA 1U42A 1YEKH 3U9UB 4KI5F 1UEMA 3JV4A 3FKUS 4GFTB 2ADIB 1TDQA 1J0ZA 1F4AA 1JK8A 3QRFM 4UIKL 2ZP0T 5IB1A 4JFPA 1N3NA 4Z7NE 3F62A 4M7JL 4M61A 5AZEL 5BXFA 1MHPL 5DQ9B 3A0OA 3QJFA 1P4LB 4KZEH 4TNVK 1KLFA 2EIBA 5BW7C 3CX5K 3T77A 3IKKA 3ARWA 5FO7B 4WJ5B 5L7XL 1S9WB 4MS8D 5I1LA 1E27A 4I3GA 4IDLA 2BVYA 5CHNB 1D5ZB 3QIBD 4HBCH 4I9WE 4RGNE 4Y2DA 4DAGH 2Q6WA 1K8IB 3IU4H 5DURB 5E5RB 4NKDA 1LK3L 3WS6C 4XPBH 4JN1H 5GJSL 1ZTXL 3I02B 1Z5LB 4C83A 2EDOA 4PRHE 4RAUB 1YN7B 1MHCB 3GSUB 4GAGL 5IK3A 2K9UA 4J6RH 1T89C 5HI3D 1QFOA 3VGAC 4IOSD 5J1TC 1S7XA 4I8DA 4OIIL 2WWMC 3DX9A 2VDLH 3FQNB 2J12B 1TJIH 4N0UE 4L8DA 4W81A 4LSVL 4HC1A 5IKCB 1T5WA 5GS3A 4DVBB 2QQKL 1QYGH 2FD6L 4ONHB 4RFNB 2J3SA 3ZE1E 5A16A 4BSJA 1AGEB 4S1DC 3HNSH 2W9EH 4HWBH 3ARFD 3HE7A 3CLFH 4JKPH 3ROOA 2DWEA 5F6IB 2DLFH 2XN9B 1HHIB 4RZCB 2ADGA 4UNTA 4LLDB 3SE8L 4FFZH 4HULB 1DN0A 1ZWIA 3EFFA 4NFDA 4RWHA 5EOTA 4U1HB 5EN2B 3RVUC 4Y1AD 4JFED 4G9DA 5EUOE 3MV8D 4F9LC 3V6ZA 4S11A 2YD4A 4Q9CA 5B39A 2AXJA 2FEEL 2KL6A 3KLAB 3UTTD 2NPLX 2X1QA 3HI1A 2H3NB 4XRCA 1WK0A 1FN4B 5HHMD 5I1EH 1JRHI 5J9PA 1GPOH 2RJMA 5FECA 1OTUD 1FRGL 4ODXA 4ZOCA 5J12B 3KPSE 4JO1L 2DQFA 5TDNA 3RGHA 3OKOA 3DX8B 4K8RH 3D5OF 5ESAA 3FAWA 2ERJC 4C55A 3PWPE 5KS9F 1R5VA 4O00A 1JFQL 2AEPH 2VUOA 3MMEA 3MXVL 3QQ9D 4UDUB 4Z95H 4YFDB 5IEHA 1VGEL 5DZNA 5GRXG 5DMYA 4KKCC 5DVMA 2CR3A 4CKVX 4LCWA 4WTZA 4Z7UB 1MAJA 1X6LA 4X80H 4ZS6D 3LKOB 5DJ8A 3U4BH 5T3XE 1A7NL 5LCVH 3Q3GB 5EZLB 4Y5VA 2XG4A 3B5HA 4L3EB 4KKAC 5T1KB 3TNNB 4CW1A 1IM9B 4PJXB 5AWNH 3P0VL 4TNVF 4UBDD 5KANG 2ADJA 5D8JH 3UO1H 4XBPA 5F44A 2HT2D 1FHGA 1I75A 1XGTA 5DMKB 3OSKA 4UNVA 1A22B 4XT1C 5IWLC 4ELME 3TVMA 4XBEH 3LRGA 3EW3B 4XPFL 5I9QB 1BZ9B 1NAKL 2WINA 4HMEA 4OCSH 3DV4A 4NQDE 5CEZL 4O9HL 1F3DJ 4YHLL 5JPMB 2ITCB 1X5LA 5TF1H 3J7HA 4U7MA 5INCA 1IMHC 2J88H 4OZHF 3UYRL 4BSWA 3NPSB 3SKUD 1YNLH 3CUPA 4OLUL 1OD7A 4Z78B 3JVGC 1H3TA 3WJJC 5AD0A 4PJ5D 1HHGB 2G2RA 2X4RA 2E6PA 1T83C 1RHHB 4GAYA 4FQCL 1A3LL 4NN6B 1DEEA 4WU5A 4KK8D 4LSRL 4P5TD 3CFKA 4MXWL 1CTNA 4M48H 3WEXA 2NY3D 2M8XA 5ICXB 3KHOA 1TJGH 5DURD 3KPMB 5E4EB 2QHLA 5C6TH 3VFWA 2QQNH 3TH2T 1DJSA 2V2TA 3GI8L 3GFUA 2E8ZA 5GS2H 3FQXB 1GRWA 1S7UA 1UM4H 4ESKA 1MJ8H 2A9NH 2APWA 1A5FH 1HSBB 3D85D 2OP4L 3LHPL 1HKLL 3TCLA 5EO1B 4K3GA 2YPVL 1Q9WA 1I85C 3W2DL 1OAUL 2G9HB 4P5KB 2V17L 3MNVA 4L3AA 3EHBD 4L29A 1I3VA 4WW2B 1QBLL 3T4YB 3D0VB 1QUNA 2XN9D 4R7NB 2XA8L 3VWJC 5C71A 4N0YL 1RIVH 3HMWH 1P4IH 3QHZH 4HK0B 4UTBH 3ARGB 5F71A 5ALCL 4KROB 4EOWH 2HJFB 3MLUH 3LS4L 4QO1A 4ZODA 5CZVL 1X4XA 1ORQB 1U92B 2D9QB 4JO3H 3MBED 5DI8A 2ZZUT 1HYSD 3EO0A 1RAMA 3HLAB 5IF0B 4ELMB 3BO8B 4PY7B 3LH2H 1SM3H 3VGDA 2Z0BA 2RB8A 3ARTA 4KQ4L 3S5LG 5TQ2H 3L3DA 3GMPA 5DMGC 3EO1B 1RK1A 1MJUH 2EDXA 4DGYL 3UBXG 5D1XA 1O7VA 3DSFH 2DQUL 4Z7OE 4FQXD 3MGAA 4MNHB 3NFPA 3TYGL 1IBGL 3QP3A 5FF6B 4EN3B 2FBJH 4OSUL 3WKML 1UA6L 3C60A 1UXWA 4JZOA 4LLQA 3KLSA 1KN2L 4GG6A 4YXHL 1VEMA 4I9WD 4RGND 5EO9B 3SDAD 4O51A 3GIVB 4TQEL 5I1AB 3RAJL 2BNQA 4A6YB 4IBLT 2DM2A 4G42B 3HE6C 5DQJB 1HN1A 5FKAA 1JZ6A 5TPWL 1OAXL 3C5SB 5T1LB 4PRHD 3V5HA 3MLYH 1P7QA 5KVEH 3RL2B 3DIFA 2LFGA 5C09A 3RWGB 3NIGF 2BZDA 3PL6C 1XZ0A 3DXAA 2O61B 3BN3B 2AJ3B 1M7DB 5KSBE 2YEZA 5ITFA 2IFFH 3QWRA 3O4LB 3F65A 4CMHC 3O45B 5CINL 2I27N 5CJXC 4LCCA 3QEQE 2C4XA 2X40A 2YD9A 5EG6C 3ZL4L 5IGXL 1PJ9A 4N9GB 1SJVA 1MCIA 3UCRA 1X5IA 3VFVB 3BE1H 1LK2A 4NBXB 3EYVB 2UZXB 3MZTA 1NGYA 3JTTB 2R2BA 1MIMH 1PKQB 1TVBB 4NJ9L 3X11B 1A1MB 3L3KA 4K71C 2BSRA 5ITBL 4R4NC 1VEPA 3WO4B 4JJ5A 2AJVH 3UXFA 4PJIF 2ICWB 3BH8B 5ERWA 1DVFB 2SEBB 2P24B 3BOVA 3IGAB 1CR9H 3L3GA 3PQYB 3SKOB 5DRZB 3O0RH 3HE7C 2N7AA 3T0EC 1B2WL 2NZIA 3ZKNC 4NYLA 4TSAH 1GOGA 1FE8H 3KPPB 4ZUSA 5JR1H 5HHQB 3CZFB 3KPSD 4OLWL 3IDGA 5TE4H 1EGJL 2I9TA 4DJMA 4UIMA 1MHEA 1MH5B 1L9MA 3G5YB 1I9IH 5IOPA 3PWPD 2Z93B 2J8UB 4JRXE 3UPRB 1S3KH 5EU6A 5HJ3A 3REWA 1INDL 1G9NC 1MRCL 1NCBH 4KRPD 4S1RL 3VFGH 3KYMA 3LQAC 4MZ2A 4ZXBB 1E4XI 5DLML 3SDXB 4JFOA 3C5ZD 2AEQL 4X83A 2V2XB 3B9VA 1FAKT 2DQHL 1KN4L 3V6OE 2G5BB 5F7UA 4JFDB 3MJ8A 3ARGD 1KIPB 4U1MB 4IHOB 5T3XD 4J4PC 3ECBA 4WHCA 5I71C 4UIKH 25C8L 5A2JH 5L88L 3PE9A 1HSAB 1MHPH 4G9FA 4EUPA 1Z0MA 1D6VL 3ZDYF 2R2HA 2FEEI 2JIXA 5F93C 1GGYA 3L1OL 2NY1C 1BJ1H 3HTLX 3ZZ1A 3ARBB 5L7XH 5TDOA 4TUKL 1FZOA 5EPMA 3FO9B 3RIFF 2UUDK 1EFXA 2DOCA 5A2LH 2Y4SA 1YECL 3R06B 4NQDD 4M6OL 5E1AB 4NHCH 3MV7B 4TVPE 4ZOBA 4L8CA 4RGMC 3BZDA 2VDRL 1LK3H 5GJSH 1ZTXH 2PN5A 4JE4B 5MEOB 3QDMA 1DBKL 5FO8A 4GAGH 1NMAL 4V2CB 4PLJD 4N0CC 3SCMB 4LMQE 1NLBL 3TVMC 2X4OA 2OR8A 4OIIH 1YMMA 3GSWA 1J10A 2XZAL 5EZJB 4XNZB 1J05B 4OLZL 4LSVH 4YO0B 2QQKH 2FD6H 4MMZC 4PPTA 3T0AA 2P7TA 4J3UA 1G7PA 2CKNA 4X7SL 3HKFA 1TJHL 3U9UA 1CGUA 1HEZB 1UCTA 2YBRB 4GOSA 1MCOL 5D1QD 3WLWD 1ZA6B 1AC0A 1BD2B 1NMCB 4YHPA 5AUMB 5DQ9A 1HH6B 4G8EB 3N1PC 4GBXC 5D6CA 4AJ0A 1P4LA 4X6CE 4PTUA 1K9TA 3QCVL 5F3BB 5FO7A 1D6EB 1S9WA 4PGCB 1FRGH 4TRPL 1VFBB 1MCCA 3UPAA 4JO1H 4NO5B 1KTDB 1YYML 3QI9B 4JHZA 1Z5LA 4RAUA 1JFQH 1YN7A 3MXVH 2HMIC 4NN7C 2MPAL 3VW3L 4IIQB 1A1NB 1VGEH 2BXZA 1ZEAL 5IKCA 3VI4F 2QTEA 3CGTA 4DVBA 4ONHA 5IVZB 1M05A 5C9JB 1AGEA 1EO8L 4KVNL 3I6GA 5IQ7L 1A7NH 1T4KB 4R90L 4RZCA 4Y7MA 5B3JE 1JGDA 4Y0GA 3P0VH 5FDYA 4P46D 1EVTC 5IT2L 5JDJA 4U1HA 5EN2A 4EJ1C 4LLMA 4NUJB 2ZUSA 4HQQH 2FEDD 1JZ2A 4DEPB 1IEAB 4S1DD 1WSST 2YA1A 3KLAA 4XPFH 5ESQB 1NAKH 2H3NA 4HK3N 3KS0H 3CPLA 1JNHB 5E4IA 5CEZH 1FN4A 2ZJSL 3C60C 4O9HH 4YHLH 5ACMA 4ACPA 4OZIE 4XPTL 3U4EA 4F15C 4PJDB 3UYRH 1SJHB 5HGDB 3GUTB 4QRQA 4OLUH 3TCXA 4JM2B 3DX8A 3B6SB 3T0EE 4FQCH 1A3LH 4OF6A 2MQ3A 2EYTB 4LSRH 1CLZL 4MXWH 4UDUA 3L5HA 3HG1E 1MOEA 1J0JA 4L9LC 3ZYIA 4EDWH 1EFQA 3VH8B 5IESL 3EYUL 4Z7UA 4POZC 3WIHA 1ZGLM 3V0WL 4HIIB 4BH8B 3SCMD 2E7LC 4GW4B 4G6FB 5HY9A 2OP4H 2VXTL 2IWGA 3WHE0 1VEOA 3LHPH 1HKLH 3RGVB 5DFWH 1R3IH 3BW9B 3Q3GA 5EZLA 4BSVA 5DJDB 5TFSL 4L3EA 5T1KA 3TNNA 5BVJB 2V5SA 3NCMA 4KKCD 1IM9A 1U8IB 1OAUH 4PJXA 3W2DH 4IRZL 3IAQA 2GW5A 2V17H 1I7RB 5DMKA 3E2HB 3WE6B 1QBLH 3BN9C 1RZJL 4PRNB 4JRXD 4FOMA 2XA8H 4N0YH 2KDGA 3GMRB 1JIBA 1Y6NR 3GSNB 1DFBH 1XR8B 3CSBA 3NIDF 5ALCH 2DLIA 5B4MD 4FFVC 4EBQL 1BZ9A 4NQTA 3LS4H 5HVWA 4KHTL 5CZVH 4HS6A 4PJ9B 5JXEC 3TIDB 2DQTL 1AR1C 2YUWA 4NWUL 4OF5A 3IS1X 1OHQA 2FYYB 5JPMA 2ITCA 3FMGH 3FB6B 1ETZA 1OSZA 1HHJB 4R7DB 2WQ8A 2WMPA 3ET9F 4Z78A 2B1AH 4KQ4H 1TZIB 5ANMB 1HHGA 1S5IL 4I0PC 1RHHA 1TQCB 5J11C 5DC0A 1A0QL 2GIYA 4P2RB 4LSSL 4DGYH 2F54B 2X4QB 4OZIB 3T3PF 5ICXA 1CG9B 2DQUH 3GKWL 5INDB 1PY4A 1RZKL 3QI9D 3KPMA 4ZOAA 1KIQB 2AXFB 4D8PB 1W0YT 5DEGB 1IBGH 3TYGH 4XI5C 1QLRB 2ZCHL 4MCYB 1WFNA 4OSUH 1K3ZA 1UA6H 5GRUL 1KN2H 1HSBA 4YWGL 2YUVA 4NKQB 4YXHH 5GGSA 1AI1L 1UZ8B 1WCQA 3R1GL 5D70L 4TVPD 2Q1EA 4EI5B 4TQEH 5EO1A 3RAJH 3D9AL 4LASL 5GGUB 1EBAA 1F58L 4NHUB 3WUZA 5TPWH 3H9SE 2G9HA 3KYNB 4P5KA 4YBQC 4FTVB 5GS0C 5BZWB 4WW2A 3T4YA 3D0VA 1MEXL 4R7NA 1CDGA 2ITDB 4GKSB 4HK0A 1KT2B 2EDYA 1Q8MA 3HRZB 3GHBL 2X9WA 1I1AD 3IDIB 3ZL4H 5IGXH 2YPLE 1U92A 2NZ9C 4PJCB 3RZCB 5AAWA 3NIFE 1Z0NA 2X7LB 3GSVB 1S8DB 2OL3A 3BO8A 1EAPB 1ND0B 3IKCA 4NJ9H 5FIEA 5JOFB 3BFOA 1AD0B 5JHDE 3EO1A 4ZUWB 5CZXC 4XAKD 4DZBB 1Z3GL 3L6FA 1FNAA 4LSQL 4JVPA 4EKXA 3O2DH 4Z7VF 4XTRC 5ECJE 2I24N 4MNHA 5LWYL 2D0GA 1U95A 4ODSL 3P9WB 2IBZY 1JF5A 1KIRB 5GRWA 1A7QL 1B2WH 3ARXA 5DMGD 4EN3A 5KG9B 2UWEE 1QLFB 1YEFL 3MRKB 1ED3B 2PF6A 4O02L 1FNGB 3HZKB 4OLWH 4KAQL 1PD6A 2FJHA 3GIVA 5I1AA 4JFQB 4A6YA 4JRYB 3WHXB 1GCFA 4G42A 5DQJA 2EZ0C 3STLB 4G6FD 5D96B 5T1LA 4Y19E 4HMDA 1U9KA 4WI3A 5EC1B 1RULL 3RL2A 1INDH 3RVXC 1MRCH 3RWGA 4S1RH 4WI9A 4L8BB 1C7SA 2O61A 2E6JA 2AJ3A 1UEYA 1AJ7L 1I3RB 4KZDL 2BERA 3O4LA 3O45A 5I0ZA 3WFBL 3HE6D 3O81A 1WQVT 4NO0D 2AEQH 3FO1B 3OL2A 5SWSE 2V9RA 2WBKA 2PXYC 1KN4H 4P2QE 4N9GA 3DX7B 3B3IB 3PL6D 3DVGB 4XNXL 5DJXB 3VFVA 3NTCL 5MENB 3EYVA 25C8H 5L88H 4PJ9D 4WEBL 3JTTA 5DK3A 3OKKB 5E70A 1PKQA 1NGQH 1TVBA 1KLUB 3X11A 4E42B 1D6VH 1A1MA 4K23L 4CN1A 4QRTB 4EIZC 4P59H 1G7QA 3L1OH 1U3ZA 4YC2C 4H1LB 3D3VB 3KWWB 4PGEB 3B9KB 4XH2B 3WIIH 1B0GB 3MRBB 4OZGF 1B0RB 5T5NG 3BH8A 4OKVB 4NBZB 1DVFA 2HTKC 2SEBA 3IGAA 2MFNA 3OMZA 3PQYA 3SKOA 5EA0H 4P2RD 1YECH 4M6OH 4LPXA 4H0IA 5FYKE 4YHKL 2VDRH 3KPPA 1RUKL 4HH9B 2VZVA 3FAXA 2YD6A 4R4ND 5HHQA 1BVKB 3CZFA 2OCFD 2CMRL 1LDPH 2DWDA 4HWUA 1DBKH 2UUDH 2P5WB 1MH5A 5DVLA 1NMAH 3G5YA 4GW1B 1BIIB 3T0ED 1NLBH 2Z93A 2J8UA 3UPRA 5JDSB 3ZKND 2AJUL 2W38A 1NEZG 3T4AB 2XZAH 1MRFL 3HG1D 4CNIB 1U2CA 4ZXBA 2R4RH 4R2GC 3SDXA 4OF7A 2V2XA 4X7SH 1MJ7L 4GRWF 2E6QA 1IC5L 1SBSH 1TJHH 2G5BA 5DXWA 3OKNB 4JFDA 1W0VB 1CXKA 1MCOH 4ZNEA 1KIPA 3G6DL 4IHOA 2BVTA 5MEQB 1QSZA 1KNOB 2YR3A 5F9AC 4X5LA 4LSDA 1HSAA 4P4RB 1F4YL 2AKRB 1G84A 4AEIL 2VZTA 2C1OA 4QEGA 4Z18A 4YDLB 1TZGL 2EDJA 3QCVH 4J4PD 4NO2B 2BRQA 5HXMA 3ARBA 4S0TD 1HQRB 5M95B 2VAAB 3PWNB 3FO9A 4TRPH 3R06A 5E1AA 3MV7A 3BGMB 2DYPA 2NY1D 4K2UL 1YYMH 5F21B 1BJMA 2E8YA 4JPKL 3DX6A 5MEOA 4WTZG 1T1ZB 2YXFA 2MJWA 4MHHG 3L5JA 1EAJA 4D0CA 2MPAH 1N7MH 3OB0K 3WUWB 3Q1SL 4OLXL 2FJFB 3VW3H 5KJRH 4OM0L 5FXCH 1WFUA 5DUPL 1FVCB 3ARQA 5I9QC 3ZSSA 1L6ZA 1ZEAH 2R2CA 1J05A 3ILQC 3QYCA 4YO0A 4PJFF 2BY2A 4GRLA 4B41A 2FO4B 1EO8H 1R5IB 4NBYB 4KVNH 5IW6B 5IQ7H 4R90H 5DDHB 4OF8A 1OPGH 1E4JA 1HEZA 2YBRA 3QWQB 4D2NA 1I9JL 1T6VN 4XMKL 5GQBA 5IT2H 3LPWA 1XGQB 4XNYH 1ZA6A 3TBYA 3F58L 1C16A 3DETC 1BD2A 3H9SD 4S10A 4GO6B 1YNTB 5EH1A 1WF5A 5DJAB 1HH6A 4G8EA 2J6EA 3L3HB 3QDME 4JFYB 2X4PA 1ZGLB 5F3BA 3EZJB 3QA3B 1D6EA 2ZJSH 4F3FB 4PGCA 1D5IL 2YPLD 3CFCL 1KACB 1VFBA 2A38A 4GBXD 5C6WH 4NO5A 4FQ1L 4N90E 3RBSA 2RAMA 3MJGX 3MRMB 1KTRL 1VB9A 3KYKL 3B9AA 1J1PL 2C4FU 3BQUC 4HCRL 1CBVL 4MNGB 3WFEL 4M9OA 5EC2A 4WW2C 2VOTA 4M6NL 1CLZH 4N5UA 3VFNB 1TTFA 5JHDD 4RFEB 4IIQA 1RMFL 3DUSB 1JI2A 4KJQD 2AGJL 2RFXB 4KKBC 1KSRA 5KS9B 3V0WH 1WT5C 5BRZB 5IVZA 3ZTJH 2ICES 3RUGE 1PSKL 1NCAL 5C9JA 4Y8DC 4BYHA 4XZUB 3K81A 3ZLQC 1CGYA 5C0NC 4MDJB 4OV6F 5TFSH 2W07A 3OJVC 5FHAH 2NLJB 4JN2A 4IRZH 3NCJL 3JWNC 3LQMA 3R8QA 3F6IA 1ZT1A 5F9WC 1YEHL 1HNGA 2ATKA 4NUJA 5FV2A 3F7QA 1RZJH 1MVFA 4PJAF 3GIZH 4Y19D 5K9QG 4LKCA 3MLTB 1FFRA 4AEFA 5DHYB 4EBQH 4DUWA 3FQUB 4AH2B 4KHTH 2MSPA 2DQTH 4NWUH 1GL4B 4MAYC 4XCFL 1P5VA 5I8CA 4NNXB 4PJDA 3FFCB 5SWSD 3UX9B 1SJHA 5HGDA 4P2QD 3B2VL 1HQ4B 2ZUTA 1MFCL 4MZ3A 4JM2A 1FIEA 3D0LB 5E8OA 1S5IH 4XP9L 3C60D 1A0QH 5D2NA 1T0MB 2EYTA 3O3EA 3NZ8A 3QUZB 5TGBB 3GKWH 1RZKH 4KMLB 5CUSL 1XT5A 5GZNC 4PRIB 2ZCHH 2YUXA 4RDQG 3VH8A 1JVKA 3GI9L 1YC8A 3NABL 5FB8B 5GRUH 4NKOB 4HIIA 4BH8A 4GW4A 1NCDL 3JXAA 4YWGH 2JCCB 4GXUN 5SX4I 2OK0L 5E0QA 1AI1H 3R1GH 5FYKD 5D70H 3RGVA 1VFMA 3D9AH 4LASH 3BW9A 4P49A 4K3DL 4GMSL 1F58H 5DJDA 3RJQB 1REIA 3UMTA 1RUAL 1EUUA 3IDNB 5BJTA 5BVJA 1U8IA 5F1SA 5FYLE 3CVHL 4P2YA 4POZD 1I7RA 5DA0B 3GJFB 1NBYB 3MRIB 4U1IB 4LVNB 4PRNA 1MEXH 2GAZB 4HD9A 4UQ3B 3GMRA 5L8JB 3GSNA 2Q7YB 1XR8A 5E6IC 5GZOC 1UGNA 1IEHA 4U6YA 2JJTA 3GHBH 4KRMB 4V1DB 1U3HB 1B6UA 2FYYA 4PJ7A 3BN9D 3IB4A 1LP9F 2A73B 3FB6A 3FHQA 1FZJB 1BECA 1HHJA 1O0VA 3QUMA 4R7DA 4FFVD 4FQ2L 5C86A 3AM8A 1E6JL 1S5HB 1TZIA 4LARL 5ANMA 5JXED 1AR1D 1OW0A 4MA8L 2CK0L 4IMKA 4ETYA 2F54A 1DDHB 1Z3GH 2FX7L 2OZ4L 2X4QA 3OAYH 3RJDA 3TPKA 5MEPB 3RVTC 1CG9A 1QVOB 5CSGA 5INDA 3ZT5A 4GRWH 3IDXL 2PR4L 4FHBD 5LWYH 1KIQA 4D8PA 4ODSH 4E0RA 4LGPB 2X4SB 1QLRA 2EDTA 1A7QH 2BC4B 4I0PD 4MCYA 1P4BL 1ZE3C 1FNEB 5IB2B 4YJZL 1YEFH 4O02H 3JWOC 4KAQH 1QSVA 1UZ8A 4EI5A 1K85A 5GGUA 1H8NA 1YMHB 4X6BA 1J0KA 4XI5D 2Q8AL 3P4NB 1TPXB 4FTVA 4CDHA 5BZWA 1RULH 1FZKB 4Y5XC 3PHSA 4MD5B 2O5XL 5KOVC 1E0OB 4DK6A 2ZNWA 2ITDA 4GKSA 1MAML 3FQTB 1KT2A 4KZDH 2J4WL 1T1XA 1EHLL 4LHQB 5GSRA 3WFBH 5HVHB 4N68A 3NPZB 4J8RB 3QJHB 3IDIA 4EI6B 4YBQD 4KC3B 3TO4D 5GS0D 4M43L 4PJCA 4D3CL 5D5MB 3RZCA 4XNXH 4O4YL 3GSVA 2X7LA 3NTCH 5CILL 4RRPA 3K80A 4TVPL 1S8DA 4HJJH 4LPUA 1EAPA 4WEBH 1KJVB 1J12A 1WUNT 4JR9L 1ND0A 1WC7A 5FFLA 1GVIA 4GJTB 2NZ9D 2HLFD 4K23H 1Y18A 1AD0A 4AEHL 3S4SG 5EOCJ 1FLRL 4ZUWA 4N1CA 4DZBA 2CO6B 4G8GE 1CFQB 1FFPB 2D7NA 4BZYA 3JUZA 4OF0A 3VXRB 4JAMB 2J8HA 4GRLC 4A2LA 3E3QC 3ZT7A 4AG4L 1EXUB 3IJYB 1C08B 1FPTL 1KIRA 3B5GA 5FA4B 5KG9A 4YHKH 1KB5H 1FSKB 3QUZD 5CZXD 3RKPA 1QLFA 5CJ8A 1RUKH 1FNGA 3T1FB 3HZKA 5JORB 3MYJB 2CMRH 4XTRD 4MLSA 4N90D 4JRYA 1MUJA 2C3GA 3WHXA 3STLA 1FYTB 3V6FB 4ZUTB 2AJUH 1A21A 2QBWA 3S35X 5EC1A 5HYJE 2BY1A 4I2XE 4L8BA 4UUJB 1MFDL 5BQ7B 1VFUA 1I3RA 1XF4B 3LKRB 2EZ0D 4LPCA 3TWCL 3S36L 3FO1A 5FHBH 4L5FL 1S7WB 4ZFOL 1MJ7H 3EYOB 1IC5H 3DX7A 3RVXD 1AGCB 3DVGA 5DJXA 3G6DH 2APBA 3V9FA 1LO0L 5F7NC 5MENA 3C09C 3MROB 5IBTL 5D71H 4FN0A 1F4YH 2EECA 5I15L 1RQ5A 3OKKA 2XI9A 4AEIH 2IALB 1KLUA 3BJ91 4E42A 3LMJL 2PXYD 4QRTA 1Q1JL 4PBXA 1DQDL 3D3VA 4XH2A 1TZGH 1MAKA 3B9KA 4LVOB 5F1NA 4PGEA 3A6CH 3T8XB 1B0GA 1U58B 3MRBA 1B0RA 3AROA 4OKVA 2V5YA 2JJWA 1NL0L 2ZOLB 5E2UL 3T3ME 3U48A 1F3DH 3QNXB 1NGZA 1XH3B 2AK4E 4WO4C 4J3OC 2WBWB 3K2UL 3VXSB 4MSWB 5GPRA 2P8PB 4K2UH 3IT8D 4HH9A 2YKLL 4JPKH 1BVKA 1GGTA 2WBJB 4HGMA 3NN8A 2D9CA 1OTSD 1CICB 5J56B 4HIHB 3K4DA 2P5WA 5GGTA 3HNVH 2K1MA 3JZ7A 1AQDA 1DLHB 4PYHA 4GW1A 1BIIA 3Q1SH 4OLXH 5JDSA 1JTTA 3H3BC 1JZ5A 2E5EA 4UI2A 3DUHA 3T4AA 2IAMB 5D7LE 35C8L 4CNIA 5CSZB 1Q9KB 3OB0H 4WENB 4IMLB 1QSEE 2EO9A 2X05A 3AU1B 3JTSB 1EO5A 3OKNA 4I77L 2ICWI 1DE4B 2DIBA 2C4FT 1S9XB 3KPTA 1BLNB 1D9KB 1I9JH 4HC1L 4XMKH 5MEQA 1NFDE 1KNOA 3F58H 2IANE 5D2NC 4UV7L 4XWOC 5FYLD 2AKRA 1NMBL 3FL7A 4K9EH 5I1JL 1YPZB 3MLRL 1YEIL 3MLZL 3CSYA 1EHNA 5IP4A 1U8NB 3I3DA 5D9SB 1D5XB 1OTTC 2F53B 1MHHB 3EYSL 3PWNA 1D5IH 3CFCH 4ONGL 3RGVC 4QWWD 5D2LE 4FQ1H 2NTSP 1G9NL 3R0MA 4LNRA 2VLRA 3KYKH 1J1PH 1H9VA 3LQAL 1CBVH 2Z92A 3WFEH 32C2A 5D4QA 1T1ZA 2ED7A 3GRWA 5EBGA 5CEXB 3ZKMD 4M6NH 5HGHB 3WUWA 2FJFA 3IYLW 1RMFH 2JJUA 1FVCA 1CFTA 4G8IA 5AYQA 2AGJH 5FCUL 1P7KB 2YA0A 1PSKH 1NCAH 2FO4A 4JDVB 1R5IA 4EIGB 2B20A 1RZFL 5IW6A 3RVVD 1JGLH 1EPFA 5DDHA 2DI9A 3AM8C 1SMOA 1CXIA 4CAGA 4KGJA 4XGZB 3NCJH 3ILQD 1J5OL 2KBGA 2GCYB 1OW0C 1XGQA 1YEHH 5KVFL 4U2YA 3IDJB 3W9DB 3TH4T 5DJAA 1AXTL 1AH1A 5F1KC 4W70A 4JFYA 3QO0B 1ZGLA 3QA3A 3AS2A 4F3FA 4XCFH 3ETBF 3DETD 2YZ8A 1RZ7L 2ZWLT 5T5FH 3ZSTA 3BWAB 3DRQB 2IANB 1IZJA 5DA4A 2Y23A 1GXEA 3ULUC 3B2VH 2EIZB 1MFCH 4Z0XB 5L9DL 3E3QE 3MRMA 5IHUL 5JIIA 4XP9H 4Q58C 4JDTH 3PIQB 1VKXB 4MNGA 5GHWH 1G6VK 1H3XA 2YK1L 2WP3T 2EH8L 4MJ6B 3TLRA 4RQQA 5I19L 2I9LB 2JB6B 3DUSA 2QQLL 4G8GD 4PRPB 5CUSH 4PRBB 4DUXA 1CGVA 3TBVB 4PP2B 2RFXA 1TVHB 3ZDZF 5KS9A 3GI9H 3BQUD 3NABH 4X6DB 4OBRA 4QTHA 5BRZA 4K8RC 3RWFA 1BFTA 5DD1L 4ETQB 1NCDH 4HUWB 3VXUB 3TJEL 4XZUA 4WI8A 2FL5B 2YD5A 2IAMD 4K3DH 4GMSH 3S34L 1RUAH 4XP5L 1UENA 3CVHH 1CDYA 4YDJB 4XP1L 1DQLL 2E7BA 1AE6L 5DT1H 8CGTA 1CXHA 4HLZG 3SDYL 3MLTA 5C0ND 4JHAL 3MRHB 5HYJD 5JHLL 4ZOEA 5C0CE 4F57L 5CD5C 2YZ1A 3U30B 1DCLA 1IAOB 2R1YB 3RKDC 3L5WB 1JZ4A 4NNXA 1HK6A 3FFCA 1NGXB 1NDMB 4M1DL 2AXGB 4FQ2H 4G6ML 1HQ4A 3U79A 1QKZL 5FK9B 3D0LA 4FMKA 4LARH 3RI5K 4MA8H 4MAYD 1OAQL 5LGHL 2CK0H 3GMOB 1T0MA 2FX7H 2OZ4H 1HINL 2VDML 2Z91B 5DJCB 2PR4H 5ELIA 1PFCA 5J89A 4D0BB 4PRIA 3MRPB 5HSFA 2D4FA 4NKOA 7CGTA 2JCCA 4Z8FL 1KPRB 1NEUA 2AK4D 3V52L 2N7BA 3IDNA 4PLKC 5GZND 2W91A 2WWKT 1LO4H 2BJML 1NBYA 3MRIA 4U1IA 2O5XH 2GAZA 4UQ3A 5IB4A 1BAFL 3D25B 4W68A 2J4WH 2Q7YA 4YAQB 1OD9A 1EHLH 5DFVD 2GJZB 4F7EA 3BKJL 2P5EE 4NZRL 5D7LD 4FA8A 4KK9C 3HUJB 1FFQA 1U3HA 4V1DA 4M43H 3RIAF 3KLHD 2A73A 1NANI 1H3VA 4O4YH 1QSED 2VIRB 3QIWC 1FZJA 5CILH 5FYKL 4TVPH 5E6ID 1CK0L 1KGCE 4JR9H 5F6HJ 1MCPH 3QBTB 2CPCA 1S5HA 1WWAX 5C0IB 2IAND 4QHNB 4YBHA 4AEHH 3MO1A 1CS6A 1A7OL 5E2VL 2XPGB 1DDHA 3ZMRA 3B5TA 5DO2C 3LN5B 5MEPA 1OVZA 4LSUL 4WCYL 1QVOA 3FTGB 1EX0A 3S96B 2Z31D 4WNQB 1FPTH 3KPNB 2X4SA 2FIKA 2BC4A 2CDFB 3TT1L 3AY4A 1FNEA 5IB2A 1H3GA 1XCTB 3JWDH 3WFCL 3RVTD 3B2UC 5JXAL 3QWOB 4P5MB 1YMHA 1KEML 1IC1A 4QHLB 4DWHA 4IRSC 4J3SA 5BV7B 5DEZA 4KI5C 4MJIB 4POYA 4H5SB 4QY8A 3CH1A 1FZKA 5T3ZH 3Q0HA 4MD5A 3PDDA 4LGSB 1R3HB 1MFDH 2XQYG 3FQTA 2Q87A 5IHBA 4OQTA 3O11B 4C58B 2FSEB 43CAB 2AEIT 2EIDA 3TWCH 4J8RA 2XIDA 4JPWH 4EI6A 4L5FH 4NNYA 4U6TA 3GMNB 5GRJH 1U8LB 3VFRB 5D5MA 2OTWB 2KPNA 5GRYA 3OKEB 3QIUB 4YDIL 5IBTH 1KJVA 1WAAE 3HFML 5CEYB 1FO0L 5I15H 2W0PA 2DF3A 1UC6A 5I76B 4BQ9A 1F8TL 3EOTL 3DO3A 3C8KA 4JANB 1Q1JH 3GSRB 3AREC 4KH2A 1J18A 3OWEA 1DQDH 2D31B 4I3RL 3ULUE 2PO6A 1Q72L 2YUZA 3WN5C 1CFQA 1MJJB 1FFPA 4JKKA 3VXRA 3HC3L 4IDJL 4JAMA 1NL0H 3OJDB 5E2UH 4YFLF 1EXUA 3IJYA 4IEFB 5I75C 1C08A 5FA3A 12E8L 4JO4L 1XF5B 2FGZA 3NGBB 3E6HB 5SWZE 2ZUUA 3T1FA 3LRSB 5JORA 2YKLH 3MYJA 3EYFB 1J9CT 4PJIA 5GJTL 1A02N 5C0AA 2LU4A 4PB0L 5I6XB 1FYTA 3V6FA 4W6YB 4ZUTA 4NDMA 4U6XB 1F45A 3QEGL 1SMAA 1DQTA 35C8H 4UUJA 1PBYA 5BQ7A 2ZUQB 1XF4A 1J1OH 1UACL 3BPNC 1A64A 1S7WA 4LLWB 3EYOA 4NQUA 4FXGB 4JLRA 3IJSA 3VE0B 4I77H 1KF9B 4PLNC 1AGCA 1BZ7B 1F90L 1JV5B 2VQUA 3O6FC 4HC1H 4ZUUB 2CIIB 3MROA 4I0CC 3ARDD 4M93C 1PG7X 4UV7H 3KPOB 1NMBH 3N9GL 5CGYC 2ARJQ 1NLDL 5AG8A 5I1JH 1J0YA 3MLZH 1YEIH 3MLRH 2K7PA 1V8HA 2DICA 3OQ3B 4YHYC 3T8XA 1U58A 5HYFA 2R4SL 4LKXA 5F7FA 2VXSL 1WIPA 3EYSH 5C0CD 2ZOLA 3QNXA 4ONGH 1XH3A 5A3ID 1MCBA 3VXSA 4ZSOB 1N6UA 4MSWA 2CSPA 4BZ2L 2P8PA 1G9NH 4WWKC 2NQCA 2WBJA 4BKLB 4CVZB 3LQAH 1NFKA 1AXIB 1CICA 2DB8A 3FRUB 1UKTA 4JFFB 3OKMB 1I8MB 1DLHA 3PABB 3SY0A 4WO4D 4KKLD 5F9OH 1NBQA 2VLKB 2CDGB 3K0WA 1NKOA 3VD5A 1JPFA 5FCUH 3QFJE 2FATL 3UTSE 4AL8L 1Q9KA 5CIPB 1LILA 1YEEL 2YOCA 1RZFH 4IMLA 3IRPX 3CU7A 3AU1A 3JTSA 5HYSA 2P42B 1DE4A 4MD0B 1S9XA 2J5LB 1BLNA 1D9KA 3KJ4B 4U4BA 1J5OH 1NDGB 3LB6D 1GGBL 1H0DB 5KVFH 1ZS8B 3CDYA 3U7WL 1IAMA 5DYOB 1MIEL 4M1CC 5I8OL 1E28B 5JQHC 3D39B 1AXTH 1YPZA 2QADB 3PP3K 2V7NB 5AZ2L 1J8HA 1U8NA 2NY6C 4L3CA 5D9SA 2L0DA 4LEXL 4RMQA 1T7YA 1S9YB 3CNKA 1D5XA 2F53A 2P5ED 5IFHL 1MHHA 1RZ7H 3WMSA 5ADOL 4YZFF 2GTZB 5HHOE 2GSGB 2N4IA 4HZLB 4RMTA 5L9DH 3GGWA 3EAKA 5IHUH 3L3IB 4X9HA 1QSFB 4GKOA 3REVB 4DW2L 1OTTD 4OCYL 4AIZB 1KGCD 5CEXA 2YK1H 1MFEL 1F97A 4PJ8B 5HGHA 4X8JB 1KJMA 2EH8H 3VMOA 2UZYB 2ZG1A 5I19H 1QHOA 2QQLH 4KTYA 3SQOL 3BKYL 4B0MM 4EQ2A 1JGVL 4KI5E 5DD1H 5JOEA 2CXKA 4TTGA 5DJZB 1VPOL 3TJEH 4JDVA 3SOBL 3K46A 4ZTOL 2EIEA 4N8PA 1KCUL 2QR0B 4WWID 4E5XB 1C12B 3S34H 1JNJA 1NCTA 3LV3B 2FECL 4KXZI 4BFIB 4XGZA 4XP5H 4XVTL 3T2NL 1IE5A 2GCYA 4XP1H 4TSBL 4WHDA 1AE6H 3T65B 3QFJB 2X1XR 5GGSY 2F74B 1Y0LB 3TN0B 1A2YB 4XAWL 3IDJA 3W9DA 4JHAH 1EIBA 5JHLH 3QO0A 4KJPC 4F57H 1QQDA 1OP5K 1CDIA 2XTJE 3IAPA 3O6MH 1H5BB 4UT9L 2C26A 2CKBB 3BWAA 3DRQA 2VLLB 1FIGH 3KNBB 4M1DH 3DMMD 5KZCB 2EIZA 4G6MH 4Z7QF 3O3DB 4Z0XA 1QKZH 4QXTB 4P4KB 3K8LA 5LGHH 1OAQH 3PIQA 4CJ0A 1VKXA 1TPXC 2Y72A 1HINH 5EOCL 1MCJA 4NPYA 2VDMH 3CZJA 4MJ6A 2ZSVB 2I9LA 4AYFA 1NH6A 1L7TL 4PRPA 4C56B 4PRBA 2ESVB 4NQEE 2I60H 1NC4D 2D0HA 4HS8L 4PP2A 4YNYB 3TBVA 4WUUE 4X6DA 5FGBA 5J6HB 4YHOL 4ETQA 4HUWA 3BYTA 3VXUA 4TUJB 3V52H 2FL5A 4APQB 5SWZD 3HR5A 4H8WC 1XGPB 4KJYB 4OI8A 1ODAA 3UEZA 3KR3L 4TSCL 1UADC 3SGDH 5BVPH 1OY3B 3MRFB 4FQQB 2C5DC 3PDOB 1CGWA 4YDJA 5LKNA 2Y6SC 2H32H 4K8RD 4KUCD 5F7MC 5ISZB 4OJFL 2BJMH 2PO6C 5EO0A 5LVEA 4JPIA 3VWKB 4FNLL 2NY4C 1BAFH 4GUPA 1RZGB 3BKJH 4NZRH 3QUXB 1FL3B 4ZFGL 2VN4A 1N5YL 1IAOA 1XFPA 5AYUH 1JWMA 1FSKC 2R1YA 5C7XL 4MJ2A 3MUJA 3JV0A 1CLOL 5D7SL 3L5WA 3MLVL 1OP3K 4Q7DA 5FYKH 1NGXA 1ADQL 1VGKA 1NDMA 1QRNE 1I8LC 5DWUL 2R39A 2AXGA 4NKIL 1BOYA 1D3CA 1CK0H 4ZYKB 5FK9A 5I8EB 3E1F1 4PJEB 5CD5D 3GHEL 5DR5H 3C8DA 1A7OH 3RKDD 3GMOA 4NRYB 2EDRA 2XTJB 4OUUB 4Z7UF 1H3WM 4NKMB 4NQCE 5DJCA 3EJYD 2OL3L 4LSUH 4WCYH 2NY2C 4XVUD 4KTEL 2XRAL 3RFZC 1OCWL 3BPOC 1DEDA 3M17B 1K5NB 3MRPA 5MERA 3ARPA 3OJMB 1A6TA 3MODL 4PJXF 3SJVB 3IFPB 3WFCH 3BZEB 1CIDA 1KPRA 3VXME 4LQFL 4MA7L 5L2JB 1JMZA 2HT4D 5JXAH 1CFVL 4JFHE 4PG2A 3ZE1F 1KEMH 4YDVB 1BWWA 4NNPL 4YQXL 1F3JB 2GYSA 1F6LL 4ZAKB 1ZHKB 4ZO6A 1WICA 2I26N 4URTB 2XQBL 1MY5A 4YAQA 2GJZA 1CIUA 4KFZC 4PLKD 3QFJD 4GW5B 4OZHE 4G6AC 3UTSD 3VFUB 2ZCLH 4RMVA 2F58L 4GG8A 4ODUA 2XWJB 2VIRA 3LCYA 5DRNB 3CX5J 1WWCA 3QDJE 1H8SA 3HFMH 1DUYB 1FO0H 2LVEA 1MF2L 3EOTH 3G5XB 5C0IA 4MJ5B 4I3RH 2HFGL 1Q72H 2XPGA 4KMTL 3ZE2F 5KZCD 1D5MB 3HS0B 3QIWD 3LN5A 3HC3H 4IDJH 2YA2A 1LO2L 3FTGA 3S96A 1ZT4B 2PYEE 1V5JA 3IFLL 1ZA3B 4WNQA 3VGHA 3D2UB 4K7FB 4EUPH 3KPNA 1EHXA 12E8H 2CDFA 4JO4H 1AHWB 4KRLB 2DDQL 4Y4KB 1XCTA 2FBOJ 4LK4A 4YPGA 5HHOD 1WCBB 3K8KA 5J6GB 3HHRB 1CI5A 4Z7VA 3WSQL 5T1DL 3MJ9A 4PB0H 2VLJE 5BS0A 3QWOA 4P5MA 1N64L 4PREB 4QHLA 4XC3L 4QRPB 1ZVYA 4ZQKB 4MJIA 3QEGH 4H5SA 2H2SC 1CLCA 4QTIL 3V4UH 4N8VB 3VXMB 2EXWC 5E5UB 1EZVY 3OGCA 4K3EL 3O11A 3H9ZA 2FSEA 43CAA 4ELMF 4IRSD 1UACH 3W0WB 5GIRA 4KI5D 1U8LA 1U8JB 3SE3A 3VFRA 5KVDL 1HXYA 3W82A 2HFEB 4Y4FD 1F90H 1KB9J 3ZKSD 4F58H 2OTWA 3QIUA 2X41A 3QUXD 2X2YA 1N59B 4JJHA 1IKFL 1UWGL 5CEYA 5IG7A 2GJ6E 3N9GH 3V6BR 1N26A 1NLDH 2NY5L 3GSRA 4ODTL 2D31A 4UTAL 3FB8B 4XPHL 3JWOL 5HVFB 5IW1B 1MJJA 3WJLA 1RJYB 3F12A 5IMMB 5DS8B 2R4SH 3D87B 2VXSH 2V5RA 3OF6D 3OJDA 8FABB 3QDJB 1A4JB 4PJBE 1IL1A 2XTJD 1FG2A 3ARED 4N9OB 5HI4C 4BZ2H 3E6HA 5C0BB 2EC9U 1I8KB 3LRSA 5CP7A 3UJIL 1Q0XL 4DUVA 5J06A 1AO7A 3G08B 2WV3A 2ZUXA 1CL7L 4P3CL 3NIGE 2HT3C 1HWHB 2PYEB 4E41B 1IGCL 4Z5RB 1GGIH 5EU4B 2NX5A 2V7HA 4R3SB 2Q86A 3C6SA 5FUZL 3V0AC 3VI3F 2PTTA 3C6LC 4AL8H 2APXA 3RVWC 2VNCA 4NQED 3KYAA 4HAGA 4MDIB 4WUUD 1ZGLP 1GZPB 3MR9B 2VXQL 1HE7A 4LLWA 4ZAKD 2GUOB 3VE0A 2GT9B 4M5ZH 1BZ7A 1CFNB 1GGBH 4ZUUA 1NBVH 2CIIA 4P2OD 2JLLA 2OYPA 3U7WH 4F33B 1MIEH 4AIOA 5I8OH 3LPGA 5B38B 2X4TA 3VJ6B 5AZ2H 2ZOKB 4KDVA 3O6FD 1BF8A 4LEXH 4HWBA 5H2BB 2OI9C 5FGBC 1AFVL 4Y16B 4CUCA 5IFHH 3DVNB 3PP3H 3MRLB 5HGAB 5EZIL 4ZSOA 5IJKA 4K3HA 2YN3A 1KJ2B 4MB4A 5J57B 2J8UF 4BKLA 1QRND 2AQ2A 4CVZA 5FGSA 4DW2H 4OCYH 4XB7A 3FRUA 5L0QB 4JFFA 3OKMA 4PGZA 3CH8A 3GJEB 1MFEH 1I8MA 3PABA 4Y4KD 5EULV 3KPRE 4PJBB 3CU1A 3SDXF 2VLKA 2CDGA 2YN5A 2IMNA 4WWKD 4NQCD 3SQOH 1T7WA 1JGVH 1A4KB 3V2AR 1IAIH 1XF3B 5CIPA 2YD2A 5EORL 1VPOH 1T2JA 1JBJA 4ZTOH 2P43B 1KCUH 4FS0A 4LLVB 1TETL 5KSBF 1UH3A 3CC5B 3THML 3G6JE 3P0GB 5H35B 4OGXL 3VXMD 4YXKL 2YRZA 4MD0A 4XVTH 3IFOB 3T2NH 4TSBH 4JFHD 3MX0A 3MA9L 1OB1B 1ZS8A 5MI0C 4JFZL 4BH7B 1AGBB 2OMNA 3FT2B 1ACYL 5DYOA 4XAWH 5D7JD 3ZT6A 1E28A 5EFIB 3BDXA 3D39A 2V7NA 3UZEA 2COQA 3QXAA 2DMCA 1S9YA 4ZO8A 4UT9H 4W6XB 1NCUA 1YUHB 2GTZA 4WIQA 5D7IE 5E2TL 2GSGA 5D6DC 2YS4A 4HZLA 2R56H 3X3FL 3O6KL 4HWZB 4PG2C 4X5WB 1RV6X 1YQ2A 1QSFA 4J23A 3REVA 3QDJD 5I0DA 4XNMB 4ORGB 2QHRL 3OKLA 4AIZA 5GGQL 5B8CB 5CKGA 5EOCH 3P11H 4PJ8A 4MWFA 4X8JA 3P4OB 3QSKB 3O2VL 4RX4D 1F4HA 1L7TH 3OB8A 4BELD 3DROB 4HS8H 5E6YA 3SGEI 4QXGL 3S35L 4RA3A 2PYED 4YHOH 4LHUD 5DJZA 1J8HE 3QG7H 4LHUG 1C5CL 3QUKB 3PXHA 2QR0A 4E5XA 1C12A 1BQSA 1RJLA 3LV3A 4QHUB 3KR3H 4TSCH 1VHPA 4XXCA 5DMJB 4BFIA 4U1KB 2VLJD 1TVDA 3T65A 4OJFH 1MLCB 1NC2D 2ZNXA 2DL9A 3TN0A 4FNLH 3VA6A 4JKLA 1ZK9A 1JJUA 2M26A 5D93C 1ZAGA 4ZFGH 2F8XC 1N5YH 3L5XL 3ROLB 4AM0A 1A6ZB 5C7XH 2A6IB 5D7SH 3IFNH 1H5BA 1J0HA 2CKBA 3MLVH 2OMBA 3Q6FB 1ADQH 1S78C 3GSNL 1RZJC 5DWUH 3KNBA 4NN5C 3RZWA 4NKIH 2OR9L 3VXPB 3O3DA 4GS7C 4U05A 2MWCA 3MV9B 4KJPD 3MACL 4JDZB 4MX7B 4EQ3A 4P4KA 3ZO0A 5BV7C 2X5PA 3GHEH 4HLZH 1IILE 1T1YB 1OP3H 2GJ6D 1X5FA 1BFOB 4OGZA 3QUML 2OL3H 5HGBA 1UB5B 2HG5B 2ZSVA 4X4ZA 4KTEH 5D7IB 1SJEB 2XRAH 4YDKL 3VD4A 4C56A 2VQTA 2C1PB 2ESVA 3FT3B 2QV2A 4YNYA 3KXFE 2VKXA 2FX9L 4GKZB 2B1HL 4TUJA 1QYGL 2BSTB 3L5IA 4MB5A 1I8IB 4APQA 2IFGA 1XGPA 4KJYA 1OT2A 3VD3A 1RZKC 2DLFL 3BKCL 1YNKH 3MRFA 1EEUA 4FQQA 4X4MA 3PDOA 2GKIA 4NNPH 4YQXH 3U2SA 3CFBB 5ISZA 1I4FB 1BEYL 3VWKA 3R0NA 5C07E 2XQBH 3ULUL 3O3AB 2UZIH 1RZGA 3O4OB 1FL3A 2Y6SD 5MP6L 2E9BA 4GXUM 4DQOL 2PO6D 4JM2F 2F58H 5I1EL 4QRSB 5F7EL 2LV4A 1GPOL 1I1FB 5DK0B 3MC0A 3GMQB 4CVWA 1E4KC 1QFWL 4U1LB 5I8EA 1MF2H 4PJEA 4B7LA 5ABDE 4I18C 1LP9A 3RDTC 2DLHA 2HFGH 3D18B 4NRYA 4OUUA 1G7JB 3MOQA 4AIXA 4NKMA 4Z7WE 1LO2H 2ZUQC 1T80A 4I5BB 1MCQA 4Z95L 3V0VB 1RIUL 1K5NA 1KTLB 1UJ3C 2Z35B 3QDGB 3TA3B 5ACZB 2NXZC 5IVXE 2DDQH 3SJVA 3AS0A 3MRNB 3IFPA 3BZEA 2W1NA 1T5XA 5L2JA 3WSQH 5T1DH 3ABZA 2NY2D 1BQHB 3S7GA 2EICA 1N64H 5FGCB 2AJZB 3M1BB 3FN3A 4YDVA 4QF1B 3I50L 3NIDE 4XCEB 1K4DB 5FDWB 3UO1L 5B3JF 2X09A 4QTIH 3KPRD 1ZHKA 4L8SC 3MGTA 3EZ8A 1IRAY 2GK2A 4K3EH 5KSAB 3BJLA 4GW5A 5CJ5A 3VFUA 4X9BA 5DJ2B 3FZUC 1KCLA 4KMQA 3S97C 3DURB 5KVDH 5IJKC 4EDXB 1A9BB 3AAZB 5LAXA 4YK4C 1JNNH 4JZJC 5HDBF 2XWJA 2J8OA 4X7DC 1BBDL 5DRNA 1DUZB 5FOBB 1IKFH 4OZIF 3G9VA 3BD4A 3SDDD 1UWGH 1DUYA 3T3PE 1INQB 3I6KB 5K9OB 3G5XA 1AQKL 2NY5H 4MJ5A 4ODTH 5F7WC 4UTAH 4XPHH 3JWOH 3QPXL 3PNWB 3H3KA 1D5MA 3HS0A 5DVNA 3LSOB 3PDGA 2EKJA 4XCCL 3UJTH 1TJGL 4Z77B 1SYVB 1ZA3A 3D2UA 4K7FA 2EDKA 3F7PC 3TO2B 3LY6A 4LOUC 1AHWA 1B6DA 3VDBA 3ULVF 3K8MA 3U0WH 1MI5B 1WCBA 4OD2B 1N0XL 5E8EB 3UP1A 2A9NL 1Q0XH 1SY6A 2HVKB 4HX1B 2FGWL 4YLQT 3TP4A 4FXLA 1HDMB 4Z7WB 1CL7H 4P3CH 4F7PB 2NW3B 4QRPA 1IGCH 1C5DB 1U8OA 4ZQKA 3H6JA 1G6RB 5HYSG 2RR3A 1CU4L 3U6RB 4XNQB 4TUOB 1JN6B 5ID1A 3EOAB 3RHWK 3WFHB 1UXSB 2UY6A 4EOWL 5IMOB 3W0WA 1I3GL 1HHKA 3TBWB 1I1RA 1U8JA 2VL5B 1UT9A 1BVZA 4ZDHB 5ICZB 2YD1A 1GYAA 2FLBT 1WFTA 2NXYC 5CS7A 5K9KB 3BISA 3MLWL 4M5YL 2I07B 3UTZB 3GBNL 4YHML 1N59A 4MNQE 1P9MA 1SM3L 4ODWA 3HB3C 2CRIA 3ZDXF 2AS5M 3FQWB 5BS0E 3FB8A 3FT4B 5IW1A 1RJYA 5IMMA 5DS8A 5E2WL 3QIBB 1PAMA 3QNZB 3W5MA 4IJ3C 2EYRB 3U4AA 2MQ0A 5JNYB 1A6AB 1A4JA 1NBZB 4AY0A 3ES6B 5EZIH 3MYZA 4HPOL 2WM0A 2BOBB 5C0BA 1I8KA 3QEUB 2H1PL 2XFXB 1NPUA 3QNYB 4IOFD 3G08A 2A1WH 1UG9A 1UKQA 3O9WC 3TN0C 2BNRE 2NNAB 4KVCH 4PJHB 4E41A 3LKQB 5E00B 4Z5RA 4NCC2 5HI4D 5F3HB 3JV6B 2DM7A 4M3JA 3TBSA 2X10A 5F8QC 2F19L 1F02I 3SO3B 4R3SA 3ARFB 1JI1A 5AAMA 3VMNA 1U36A 3GRWL 5EORH 3V7AE 2H9GB 2IQ9L 4MDIA 4X8XA 4L4VE 1GZPA 3MR9A 3KXFD 1I1CA 1L9NA 3THMH 4J1UB 3HMXA 2GUOA 4OGXH 4Y1AB 4R0LA 4YXKH 4JFEB 2RCSL 4L4TE 3MV8B 5KSAD 1CFNA 3C6LD 4P4KC 3MA9H 5E9DA 3RVWD 4FMFA 4JFZH 5GS1B 3BE1L 4PY8I 2HVJB 2P47B 4F33A 1ACYH 4OZGE 5B38A 3BUTA 3FFDB 5HHMB 3VJ6A 5CFHA 1AO7E 2N1KA 4OD3H 2ZOKA 5C07D 1CD8A 5H2BA 2DL2A 3LKNB 4Y16A 4CVUA 3B8YA 3WV0A 3ZYZA 5SX5K 5E2TH 3MRLA 1CR9L 5HGAA 2NY0C 3O6KH 4MXQC 4PJGB 5F96L 5JIPA 1KJ2A 5I73B 4K9EC 1AGDB 1A8JH 1EVUA 4G8FB 2OLDA 3SDCD 2PW1B 5GGQH 3GJEA 1U8KB 1TQBC 3VWKC 4NRXB 3RHWF 3VGEA 2GJJA 1MWAB 3O2VH 3L7FB 3NMEA 1A4KA 4GRWE 4LLUB 4QXGH 3S35H 1XF3A 4GQ9L 4WY7L 1N5AB 1X5YA 2F8OA 3WNKA 4OTXL 3BVNB 1IGTA 1C5CH 4LLVA 3LQZB 3CC5A 3OR7B 3LOWA 5H35A 5C0DA 1V3JA 4PRAA 3IFOA 4P23A 1CDCA 3H7LA 3IJHB 4BH7A 1QZ1A 3MRCB 3O8XB 1PEWA 3CAFA 4W4OC 2LE9A 4WFFE 5EFIA 4LAQL 3B9EA 1X44A 2C3HA 4JPVH 4JG1H 3L5XH 2VR4A 2YRPA 2RQ8A 1JHLL 5D1ZB 5GRVK 4PJ5B 3AVEA 3GSNH 3V4PL 1DQML 2OR9H 4HWZA 3AFLA 4NHCL 3MACH 4P5TB 4X5WA 2KQMA 1FCGA 2H45A 2NY3B 4NFCA 4ORGA 4XNMA 5B8CA 5GRVL 1IAKB 3BP5B 1JGUL 4ODBD 1G7MB 3I3BA 2AERT 2VO5A 3P4OA 3QUMH 4PJFE 5DGQA 4NOFA 3HR6A 4YDKH 2BY3A 3BDYH 4LVHC 3D85B 4HGKC 1VFAB 3DROA 4U1GB 5FYKU 4R96B 3VDAA 2FX9H 4N5EC 2B1HH 1T21B 4KHXH 1OGAA 3SGKC 1HXMB 5CBAB 3UYPA 1JNLL 4DTGL 3LZFL 4QHUA 3RNKB 3BKCH 2CGRL 4OZFG 2R9HC 4U1KA 3NCFB 1QEWB