3OF6A

Human pre-t cell receptor crystal structure
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A02
4LAQL 2EZ0D 3LV3B 1J8HD 1DQML 4TVPH 1V7NH 4WI4A 3RWJB 4L8SB 1QFUH 1TTFA 1NQBA 3PUCA 3ZT7A 2MSPA 4S11A 2Y4SA 1ORQA 3BQUA 2DM2A 3HZYA 3VJ6A 1BMGA 3WL9B 1T4KA 1RK1A 5HI5D 3V0WH 2C9AA 1Q94B 4D0BB 5JDJA 2OTWA 1ZGLM 4BFEA 1A14H 3RIAK 5IWLA 4P23C 3QJHB 3NCJH 1KPRA 2NW3B 3GSWB 5GZND 4D3CL 4IHOA 1YN6A 3SE4A 1TQBC 1FBIL 5K9KB 3ABZA 1RK0A 1NKOA 1MFCL 5D70H 3OPZH 3VDBA 4GKNB 1G84A 3QAZB 3KYKL 3DMMB 5I8OL 2NNAA 5ANME 1KJ3H 3SE3A 1X5LA 5DURD 5I19H 1U42A 1ZTXH 5ENWB 1CFNB 4OLUH 3QFJA 2ADGB 5HDBF 4L8SC 4EUPB 2PW2B 3NABL 4X80H 4GLRI 5DA4A 4L3CB 5JIHA 4JFDA 2DD8L 3IT8D 1UM6L 4JEGB 3GO1H 4HZAA 5E6IB 3DXAB 1G7LA 2YD7A 1GC1C 2CDEB 1T22B 1RULL 3AVEA 4RISH 3HUJE 1U3ZA 1U8LA 1RJYB 1QFHA 1UACH 2ATKA 4KXZH 1UJ3B 5FHAH 2IH1A 1WFUA 4YHLH 3FFDB 4MJ2A 5DHXB 3GKZA 1XIWB 4WGWB 5FKAB 4Z6AT 2CIKA 3CCHB 1PX4A 2G60L 4Q9QH 4AEIH 3L5IA 1NAMH 1FAIL 3S5LA 1A1OB 1BBJB 1D7FA 1QSFB 2V17H 3MLVH 4KZEL 1ACZA 5AZ2H 2BDNH 3FQUA 1AXIB 3QAZC 4IM8A 4NQDE 5CWSA 3P9LB 5JPMA 4Z7NF 1OQXA 2AP2A 1CE6A 4TSBL 4L9LB 1N6QH 1J9CT 1VFAA 2ERJB 1YYMH 1TJHH 3MV01 4PLJC 1B3JA 5MEPB 4QGYA 1XF1A 3QDHA 3T0AA 2XTJE 4XTRC 3D18B 4XT1C 3U0WL 1FZJB 4DOHE 2FBJL 1NSNH 1Q0XL 5F6HI 3JWOH 4G6JL 3M1BB 1BD2D 5DR5H 4XAWH 3FRPA 4Y1AA 5DJ6B 1OTTD 3JWDC 3S34L 5CFHA 3EDEA 1U3HA 2VZVA 2PCPB 4ZMAT 5CKGA 3LAFA 1G0XA 4S1RH 4HPYL 4ENED 4ZOCA 3FN0L 3MRBB 4Y2OA 1HSAA 2FJGB 3UAJC 1GGYA 3CGTA 4WEBL 3JVGA 1FSKB 1XIWC 3G6AA 3RPKA 3CXHK 2YKLH 4PJ9A 3RTQA 4NCC2 2C1OA 2VWEC 1KCVH 3SY0B 4ZO6A 1MI5D 1S7VB 4GKZB 4JZJB 1XEDA 2BSED 3TBSB 2R2BB 3PG2A 1UH2A 2PTUA 1X5XA 3RL1B 4JPVL 1FV1A 3CMOH 2XKSA 4FFZH 1EGJA 1WC7A 4L9LC 4JFOA 3TT3H 3U7AA 2DI8A 3K74B 4G9DB 3HCVB 5C92A 5HYQA 4NOFA 4QHMA 5C0AA 2LQRA 5DD3L 4LHJB 5ISZE 1GH7A 1X6NA 3ARED 3B83A 2HT3C 1GGTA 5C71A 2VDKL 1V8HA 2B2XL 3MCLL 4X7SL 1LVEA 2P8MA 2EKSB 4QYOA 4PRAA 1A7OH 4KJQC 3MACL 1FLRH 4OF7A 4F37K 1Z2KA 3DX6B 4PD4J 2FO4A 3X13B 1LP9A 1ONQB 2YZ1A 3BYTA 3RDTB 5FDYA 3VI3F 3N1FC 4YWGH 4OQTL 4JFFE 3WDJA 5DO2C 2JB5L 3F58H 5JMOC 3T2NH 1K8IA 4Q0XL 4NZTL 2FHBA 4KK5D 2DTSA 2I5YH 2R29L 1FSKC 4XPAH 2VRAA 4QOKE 1DJSA 5FYJU 4M7JL 4RAUA 2UZIL 3GMMB 5INCA 3U6RB 2O61B 1F4YL 1J7VR 1KELH 3FONB 3RVXD 3D25B 2B0SH 5JQ6L 4JZJC 2O5ZL 4LEOB 3SKJH 1U8KA 4MLIA 4WIQA 3RVTC 5T33L 5I1EH 3AXLA 3MV8D 3QCTH 2HKFL 4EXPX 3T0BA 4FTVD 4OGXH 3AFLA 3V4VL 4HIJB 4KTDH 4F7TB 2GCYB 2VLJD 3SBWC 1T2QH 2BSSA 3WIFA 1XR8B 4NQVA 2IFFH 1MFEH 4KKBD 4JLRA 5D7LD 2Z92A 4QRPD 4PJAA 4XP1H 5C09E 5JW3L 1NGXB 5F7UA 3ARDC 2X4OB 3M8OL 1NCDH 3X3GH 2EC8A 2CK2A 5H35A 1UENA 4JQVA 3QXDB 2ITDA 2X1OA 3QIUD 2XWJB 3MJ9A 1YNTB 2BSRA 4YXHH 4LLUB 5C3LD 1DFBL 1ETZB 5FA4B 4LLWA 4U1IA 2IAMD 3KXFA 5IM7B 2P5EA 3QUXB 4S1SH 3UZVB 1CXLA 5IB3B 3ULVD 2GI7A 1N2RB 1P6FA 4PJ5D 1KCSH 4PRPB 5M94B 3GBNL 3MREB 1X5JA 4HHAB 5JHDA 2CKBB 2AAVA 4LNVA 5DI8A 2IAND 3WXWL 5E08L 4WJ5A 2FH6A 4AM0A 5D4QA 2YRPA 4OFVA 2Y25A 3P4OB 3P9WB 3LQAH 1JFQH 3HZKB 3O3AB 43CAB 4PV9A 3MRKA 3FOLB 1RIHH 2J88L 3LV3A 4FABL 3S3SA 1IKNC 2P4AB 1BQHA 3MJGX 5TE7H 3P4MB 5IVXE 4ZD3H 4Y88A 5DJDB 5D5MA 2H8PA 3U9UB 3MRIA 3BP6A 4LHUB 1Y6KR 5FO7B 1L0YA 1UA6H 3PWLA 2R56H 3BZEA 3FJTA 5FUOL 4Z7VB 2I07A 1Q94A 4D0BA 5BRZD 4C4KT 4LSQL 4OLXH 1S5HB 5AUMB 3BAEH 4U49A 3QZWG 3GSWA 1UWGH 3QUXC 2AXGB 5CBAB 2PXYD 4JKWA 4DGYL 4LQFH 2IPKB 3OBAA 3LQMA 1NMBH 2J8HA 4HLZG 1JZ2A 3QEUB 4MA8L 4GKNA 5JLZB 4FHBD 1GAFL 2PXYA 3QRFM 2ZKHL 4MJID 4MHHG 1JUFB 4H1LG 5MI0C 3DMMA 2DN7A 1JYVA 4OT1H 5DHVA 3EKCA 4MNQB 4I2XA 2H2SC 4R7DB 3GM8A 4LPCA 4NC0B 5ENWA 1CFNA 4L8BB 1VPOH 2ADGA 2XKNB 5EOQH 4EUPA 5IJKA 1ZV5A 5C0CD 4RMSA 4L3CA 2NY3C 4JN1H 1C5CL 3MLXH 4G7YH 2R0LL 3K7UA 4FQXB 5T3ZL 4J3OC 1IAIM 4LSPH 5E6IA 3DXAA 1UWXH 3QIBD 4L29A 2QSCL 4NN5B 3WXVL 3BPLB 1T22A 3ARBA 1II4E 4NO0D 4UDTB 5EWIL 3TT1H 4QRQB 4XH2B 4KJWD 1A6AB 5I18H 4JFEA 4OKDA 4P2QE 5A40E 1UJ3A 3HB3D 1DBKL 3MV9E 4LAJH 4WI3A 3U1SL 3FFDA 5FFLA 1A1NB 2I9TB 3RKPA 5FKAA 4U1HB 1MQ8A 3CCHA 2NY5C 4NFDA 1OP3H 1P5VA 1A1OA 3G5XA 1QSFA 2JCCB 2LU3A 5ICXB 2A1WH 5DRWA 1C12B 5CBEA 3LMJH 2GAZB 3GZKA 4XXCA 3VXQA 1H15A 3TO2B 2VXSH 4HULB 1MFBL 1CCZA 4LOUD 1WFOA 3L3GB 4ZS7H 5GGQL 2QQQA 4GAGH 5EG6C 3BIAX 1V7MH 2HFGL 4UT7H 3D18A 1DQTA 3MR9B 2XACC 1ZANL 2DQHL 4R97B 4LKXB 4P4KC 1I8LA 3PL6D 4FQXC 3AY4C 5C6WH 1KXQE 1F4HA 2BY2A 1FL3A 1ZVSB 4NN5C 1WF5A 1I1AC 4K7PY 2PCPA 3SE8L 4MXWL 2COQA 4HCRL 3O9WD 4LRNL 4M02A 4WUKH 5C07E 2B7DT 5BS0B 3VFNB 4H5SA 2H1PL 4N0RA 1KIRA 2PO6C 3SE9H 3SDCD 1AGEA 2EDNA 4MGXA 1T0MB 4Q9CA 2P8LA 3BMWA 1T04B 4NYLB 4ZXBC 4ALAL 3TFKC 4AEHL 4WW2F 4OGAC 4NWUH 4HUUB 1AD9B 3SQOH 4GKZA 2X9XA 1JHLL 3JV6B 3SDCA 3C08L 2FECI 2R2BA 1QFWI 5C1MB 1PZ5A 1JF5A 3BZ4B 4P3WA 2OQJB 3UTQB 2BNRD 4AQOA 4QT5B 5LAXB 1HHIB 3DBXB 4G9DA 2FGWL 5MEND 4L5FH 5IEHA 3KPOB 4PRHD 4GW4B 5IT2H 3DVNB 4R97C 3C09B 1A7NH 4UNTA 4X9BA 3F7YB 1J0JA 5J1AA 4I0KA 4PGCA 3HZVA 4U6HB 5HYFA 3X13A 1ONQA 3RDTA 2YK1L 1JNHB 4WW2C 2A2QT 4C58B 3M17B 1FDLH 4I3RL 1XH3B 4BH7B 9CGTA 1F3RB 4XXDB 1CD1A 5CILH 5GGSB 4FXKB 3V8OA 5CEYA 4YNYA 3WFBL 3BD4A 4O02H 1AD0B 3DIFB 1SHMA 4HQQL 1Q8MA 1OT2A 1OHQA 1OAXH 2VLKB 4ODBD 4MJ6A 1BAFH 3GMMA 3U6RA 5D6DA 2YZ8A 5JW4Q 5DJYB 4NKDB 2AQ2A 4MDIA 4J4PC 1GJIA 3AU1B 3FONA 3NTCH 4YZFE 2GTWB 4HXBH 4LEOA 1A6WH 2NLJB 3DYPA 4M7LH 3MA9H 3QEQB 2JIXA 2J6EL 4XNXL 5GRVL 3HG1B 3UC0L 2OZ4L 5FKPB 1DN0A 3O3DB 3E8UL 1WIPA 5LCVL 2GCYA 5J1SC 5ESAA 3VXRD 2EIBA 2FO1A 1KEML 5CLTA 3FZUC 1WFNA 4PD4K 1NGXA 5LXGH 4KGLA 3WIHL 3VXRA 4XC1L 1QKZH 1GPOH 4X6CF 3T09A 3IU4H 2E27H 3DWTA 3MO1B 3N1PC 4O4YH 4DN3L 2XWJA 1UCTA 5KZCD 4YXLL 1T1ZB 4LLUA 4HH8A 4C83B 4Y2DC 1HZHL 4WUUB 4RQQB 1BM3L 4QHKI 4W81A 4QTHA 3GJEA 4XP9L 1UGNA 4KQ4L 5JDSB 5IB3A 3EO9H 3QCUH 4NZUH 3EZ8A 2X70B 2WUCH 5HHOE 5A3IC 4U4BA 1Y18B 3K1KC 4HHAA 3LH2H 4X4ME 5KSAD 4PJCF 5K9QG 2WW8A 3BXNB 4U2YA 4U1LB 3O4LD 3ZDYF 5KVMC 3SDXB 3TO4D 1ZOXA 3P4OA 4BQ8A 2DJSA 2OTUB 3HZKA 2BP3A 4UINH 3O3AA 43CAA 4DW2L 3FOLA 3KYMB 1JI2A 1MCIA 5MP6L 4OD2B 2JJTA 3ZL4L 3S97C 3T8XB 1HHJB 5SWZD 4K3EL 4KHXH 1MAML 3UO1L 5DJDA 3HKFA 3EYUL 2LE9A 2HJLB 3WFCL 4G8EA 2HRPL 4DKFL 4LHUA 5IW3A 2FEEI 5ADOH 5F8RC 4R90H 1GYAA 1T6VN 1T7YA 1YY9D 1MHCB 4ODHL 2V2WA 1LK3H 4D0CA 3NIFE 4JANA 4Z7VA 4QXUH 1JMZA 4OUUA 1H5BB 2NY0C 1YEEL 5D7IA 2GITB 2IPUG 5AUMA 4O5LH 1N8ZA 2ZNWA 5DMGC 1FFNB 2VISB 3QI9B 5GS0L 5E94B 3RIFF 2XPGA 4LCYB 2AXGA 4O9HH 3K4AA 3FKUS 5J11B 2VDQL 4GAJL 3VXPB 3MZGB 4HPOH 3PDOB 5HVHB 5JLZA 4CVWA 1WSST 3MGOB 3WYRA 2CJUH 4JKPL 2R1XB 5F6IB 5IMMB 1YEFL 4MNQA 2W0FA 3A67L 3RBSA 1BF8A 1Q72H 4I9WE 4NC1C 1EGJH 2VXVH 3UYRL 3WMSA 1XGPB 2EKJA 5GRUL 4L8BA 3ZHKA 5IBLC 4NQED 2BNUB 1LO4H 3WJLA 4NRZB 4P2RB 4POZC 1JHKH 1QSEB 4WFEE 4OQTA 2EDBA 3U7YL 4NQEA 2WANA 4XNYL 3VA6A 3CSBA 2BVQA 4J3SA 1SEBB 4G8GD 1BJ8A 5D72L 2FR4B 5C0BA 4UDTA 4QRQA 1H5BC 3QQ3B 1A6AA 2XV6B 3ESUF 5B4MD 5IBUG 4OF8A 3S9DB 5IVZB 5L9DH 4FFWD 3S37H 5L2KB 3QI9C 4G8GA 1KB9K 2DBLL 4OM1H 1SJVA 4EI6A 3TNMA 2BOCB 3ULSB 4JM2F 4U1HA 2YUXA 4OF3A 5FYLE 4R8WL 4KUCD 5I75C 3ETBF 3VXUB 1HINL 5ICXA 5D71L 1ACYH 1LGVA 1ZEAH 5H37H 2Y6SC 1JV5B 2VDRL 1MCOL 1S9WB 1C12A 3K8MA 4NRYA 5F6IC 2WUBL 3DPBA 5KJRL 2VAJA 3QQNA 4Z0BH 2VITB 3L3GA 1UADC 3VFMB 3DNKA 3OGOE 4N9GB 4PJIE 1ZSDB 4LRIA 5CEZH 1KOAA 3NGBB 4UT9L 4X4YB 4DFIA 4WO4B 1PEWA 4LKCA 2AI0L 3QDME 4IIQC 3PIQB 5D7SL 1HKLL 2O5XH 2VN7A 5C7XH 5J9PA 5GGVY 5IP4A 1X9QA 4TULH 5SX5K 3LQZA 3EYOB 1JTTA 1MCPL 2F5BH 4HS3B 4JPIB 3UTOA 3QIWC 1SM3H 2EDTA 4GUPB 4XB7A 5IQ9B 5L0QB 2VDPL 4JM2C 5EZLB 3V0AC 2KKQA 2EH7H 1IZJA 1F4XL 3A0OA 2IGFH 2Y72A 5BS0A 4LFHD 3VFNA 3DJ9A 2EIDA 3ZZ1A 1RUAH 1WT5A 2PTVA 3QT2A 3O0RL 3RRQA 1OW0C 3V7AG 4P9MH 3I02B 2HMID 1BVKA 1QNZH 3BP4B 4MXQC 3T0EB 1T0MA 5GJTL 4NYLA 3VXSB 3LKRB 4XCCH 5FK9A 1JYNA 3OKNB 3BRGC 2ESVD 5FYJH 4YFLF 3KPQA 1XGQA 4OZGE 3H6JA 5BJTB 1GGBH 4YFLI 3BGFC 1FGVH 4NNXA 1IAIH 1J1PL 4YHKL 3BZ4A 5DWUH 5F97E 3WSQL 2OQJA 4DGVH 3B2VH 4E9LA 4P46D 2C3HA 2ESVA 3SGJA 3DBXA 3EJZD 4MZ2A 4PJ7B 4WO4C 5SX4H 3KPOA 4JDVB 4ODXA 3OL2A 3DVNA 3ZO0A 2DYPD 1UH4A 4P46A 1R5VB 2ZG2A 4GW5B 4C56D 1T83C 2GUOB 3PP4L 4EDWH 3P0GB 4U6HA 1VGKB 2Q86B 4XBPB 3OZ9L 4ODTL 5CSBA 1PKOA 2DYPA 2VB5A 4XPGL 1JNHA 4PJ7F 3M17A 4BH7A 1XH3A 4LSUL 5DD6A 5LBSL 2GSGB 1L6ZA 2Z35A 4FXKA 4KMTL 3WJJA 5DJ0B 4OFIA 4HF5L 5BZDA 1WZMA 1AD0A 3DIFA 5I16A 1QLFA 1D5BA 5ICZB 3T0EC 2E7CA 3BE1L 4YJZL 2J8UE 1HH6B 5DJYA 3QDGE 2DKSA 2YSSB 4KI5E 5B8CB 3AUVA 3H3KA 2ORBL 4H1LB 2NLJA 4YDKH 5FAAA 4KVCL 3QEQA 3DUUB 4X9GA 2DL2A 1DN2A 2EXYD 2F54B 3H2WA 4DWHA 1KJVA 3B8YA 3QBTB 1R3HB 3O3DA 5DHVH 5D1QD 2B8OT 4ELMF 2IG2H 1CLCA 5F7DB 5BVJA 4K8RL 5HHME 1UB6B 3ARFD 3HI1B 2VLRD 3RI5K 5DLML 5HDQL 3C60A 1GC1L 1KN4L 4HK0A 5DK3A 2OMBA 5F96H 2AV1B 1CFVH 5HYJD 5AYQA 4F2MB 2VABB 1KJ2L 1FHGA 2XQBL 4BZ2L 3VDAA 5JIIA 1KPUB 4YDLB 4OAWA 5D1XD 3NCEB 4WW1B 5GRYA 4H25B 3D39E 4TNWK 4C83A 2FD6L 1CDIA 3UPRA 5AG8A 3TN0D 1WISA 2H2PC 5JDSA 3UX9B 3H0TB 3BKYL 3MV11 4HUKB 1HOCB 4HWZB 2DOCA 5B8CC 1DUZB 1ZA3B 3EJYD 3G5YA 5T1KB 3C2AL 1AQKH 4LBEB 3W9DB 2RR3A 2Y06H 3RGVC 3BXNA 4U1LA 3SDXA 3MLRL 3QA3B 1BIIB 1NCBH 3MNZB 2W07A 4BQCA 1A3QA 1WK0A 3WUWG 4OD2A 5AZEH 5C0EB 2OP4H 1ADQL 3T8XA 3GK8H 3R06B 3MRDB 3T65A 1OGAD 3SDAC 1YEJH 4NJAL 5E99H 5HHNA 4Q6IC 2QQKL 4X7DC 4HCRA 1LILA 4MMXC 5IFHL 3CLEL 4O00A 4HIXH 4HEPG 1MHCA 3KPNB 3P77B 3C87A 3PQYB 4UDUB 4Z95L 3AM8C 1E27B 3WFZA 2VXTL 3Q1SH 3V2AR 1JGUL 1KG0B 2GITA 1NCWL 3X3FH 4NQTA 4LCYA 2BERA 3TV3L 4ZSOB 2PYEB 2XQYG 2YEZB 3VWKD 1VACA 4FNLH 3N06B 4WTZG 2ZCLH 1WIUA 4WU7B 4PRID 3VXPA 4LU5H 3PDOA 5F1OB 5C9JB 3UTPD 1UH3A 1PX3A 1KIPB 4OIIL 1I9RL 4LAQH 5C0JB 4H0IA 1XCTA 4XCEB 2GFBA 4OCNC 5CHNB 5IMMA 4NUJB 4MAYA 1E4JA 5HYEA 1RIUL 4U1NA 4HUNB 5FUZL 1JWMB 1NCCL 3QPQD 4LPXA 1XGPA 4LLMB 4JRWA 2IALB 3QQ9D 4ODVL 4OLEA 5BXFA 4NRZA 4P2RA 1QSEA 1WICA 2D7TL 1AQDA 3IB4A 1CDGA 2FHCA 3QUZD 1SEBA 4K3DL 4OB5L 3ARGC 2FR4A 5FO8B 3U82B 4Y16C 1A7PH 1A9EB 3QQ3A 5GRVK 2JELL 5HGBB 2WBWB 4PJHF 3ZSTA 4D3CH 2AK4A 2HTKD 3ARXA 2NXZD 2AGJL 1FBIH 4FFVC 1MFCH 2BOCA 4LCWD 2O26U 4QHNB 3TBWA 4DFHA 3WKNA 3CNKA 5JOFA 2J6EA 1BREA 1P7HL 2OZ4A 4E41E 2PTTB 5D9SB 1QEWB 4MAUH 4NNYA 3KYKH 2VDML 5I8OH 4HD9A 4NO2B 1J05B 4WEMB 2ICCA 4F9LA 1S9XB 4FMFA 1S9WA 1PG7X 4N5UA 3O6ML 3G9AB 3HMWL 1OLLA 5I6XC 4XNMA 3NABH 4TPRL 3VMOA 4WENB 3VFMA 5DZNA 4IMLB 4N9GA 2FL5A 1FLTX 1ZSDA 2NY2C 3WIHA 4X4YA 2DD8H 4I18B 4B7IA 5KSBF 4YDIH 1NGQH 3I6LE 2L4OA 3EYOA 1S7QB 4NNPL 1RULH 3QDJD 4GG6E 5DVOA 4GUPA 1G1CA 2R4SH 5EZLA 5HPOA 3BPCB 4X8XA 4L4VD 4MA1B 1J8KA 2HT2D 5CJXC 1GOHA 5F6HJ 2B4CL 2Q8BL 3MLWL 4KDWA 4PJDF 4ZAKD 3Q6FB 4HXAL 1ES0B 1A6ZB 3FT2B 5TPWL 1ED3B 3STBA 4U0RB 2BVOB 4ZNEE 1H9VA 2G60H 1OP5K 3IVKA 3I02A 4ZQKB 1FAIH 2UY7A 3BP4A 1YECL 3MRGA 4ZAKA 3SDDB 1NL0H 4KZEH 4P59L 1RUML 1NMAL 3H9SB 2YMXL 1QR4A 2P43B 4WVRA 3V4PH 5MEOB 3VXSA 2BY1A 3OKNA 4KDTC 4EN3D 3V52L 3CZJA 4K94C 4TSBH 4HGWA 3TYFA 1JGEB 2BVEA 5D96C 3I3BA 3D0VB 3RWIA 4TSCL 1NUDA 1K6QL 4PJBF 3U0WH 3H8NA 2FBJH 1E28B 1Q0XH 3O2DL 4I18C 2DM3A 4M4PA 4JDVA 3IDXH 5CAYB 5DTFA 4BH8B 3OXSB 3S34H 5DJ8B 1ZLWK 4GW5A 2AJYL 2HKHL 2GUOA 1NPUA 3F7VA 1VGKA 2Q86A 4XBPA 2PKDA 1D5ZB 4HPYH 3FN0H 4JDZA 3BHBB 4CADB 1KCKA 4F7EA 3RUGB 4WEBH 1A9BB 2GSGA 5H2BB 1ZMYA 4UQ2B 5INDA 3MGTB 3QZWA 4NC2B 2OK0L 4S1QL 4N0YL 5DJ0A 4Y4HB 4WRLA 5IB4B 4PJGE 3SKOB 4D0DB 3JXAA 5ICZA 3HUJB 3EYSL 1O0VA 1HH6A 5D1ZA 3BESR 1A64A 2Q1EA 1Q9OB 2AEQL 4H1LA 4JPVH 4L4TD 3CZFB 5KG9B 1R3KA 3DUUA 2ICES 4H8WL 2X5PA 3KPSE 2F54A 2ENYA 12E8L 1A3RL 4L4TA 3B3IB 1MCBA 1H0DB 4APQB 4XVJL 1QZ1A 2VDKH 1T66D 3MCLH 4X7SH 1GGCH 4OFYA 3TA3D 4O2EB 1ZT1B 4XP5L 1P9MC 3VXMD 1UB6A 3HI1A 5DEZA 1YC8A 3PWUB 3MACH 2MTPA 2CH8A 4R0LC 1G6RL 4Y4KD 3EFFB 2VQUA 4GBXB 4U3CA 1NDMB 4M93B 2WBJB 4OQTH 5EPMB 3L9RB 3GMNA 1GIGH 1L7IL 2AV1A 2JB5H 3O11B 4Q0XH 4NZTH 5IBUB 1KCRL 4F2MA 5E5UB 2VABA 2R29H 1JGLL 1XGTB 1WJ3A 3OKKB 4HKXB 4YDJB 1KPUA 2GT9A 4WW1A 4V2CB 5EBMA 2YD5A 1BVZA 4KK6D 4M5ZH 4EI5C 1F4YH 4XP4L 3H0TA 4PGEB 1OY3B 5T33H 5DD0L 3VFRB 4HWZA 2IQ9L 1G9NC 4CU8A 4R4FL 3UDWA 2HKFH 4LBEA 1AKJD 5DMJB 5D7JB 1CF8L 5FO9B 1YUHA 3L5JA 4ISVA 3V4VH 1UM4L 3S6CA 1AGDB 3CC5B 3C6LD 3CFJB 3QA3A 4ELKB 1BIIA 3TVMA 2XZAL 5GS1B 1NC2A 3MNZA 3PHOB 4APQC 1AKJA 4XZUB 5K9JH 1JIBA 1HXMA 4K23L 5C0EA 4MD4B 5JW3H 1YQVL 3MRDA 3R06A 4UBDC 2DWDB 3M8OH 1FIGL 4M7ZB 4N68A 5DEGB 2LABA 4FXGB 3WHE1 4C55A 1U93B 1CTOA 5C0DB 5IOPA 3T3ME 5EN2B 2XTJC 3VGAB 4YC2B 3KPNA 1DFBH 3P77A 4WFGD 4RGNE 1OP9A 3ZTJG 3ARVA 4G6KL 5BOZG 5E8DL 3B5HA 3RKDC 3T08A 1DQDL 2X4RB 4ZSOA 2PYEA 2YEZA 5HPMB 3GBNH 4JFFB 3MLPA 3UJIL 3UTZB 4WU7A 5E08H 3WXWH 4PTUB 4QHLA 3HE7B 4KRNA 5SWSD 4OZIA 2QLVB 5C9JA 1JF6A 4GFTB 2F53B 3ARRA 3IDGB 1A6VH 2BRQA 4Z78A 1TVDA 2J88H 1N3NA 1CZ8L 4XCEA 4FG6C 5CHNA 4FABH 5I15L 1WZLA 4TUKL 2OLDA 1IEAB 3VFWB 1M6OB 2WINB 3RP1A 1JWMA 1U6AL 5TF0A 4WFFE 1DL7L 4LLMA 3I2CL 3HNVH 3MNWA 4I3SL 3L7FB 2NX5D 4KQ3L 1Q9LB 4OKVB 3UTSB 5C0RH 1T2XA 4J8RB 2ARJQ 3QFJE 5TGBB 1SBBA 2D2OA 3CVIH 3FO1A 5FUOH 2X7LA 4AK1A 3O8XB 4X6DB 4LSQH 4LIQL 1J12A 1DEDA 2FECL 4JFDE 5FO8A 3DURA 4LCUB 5HGBA 5I74B 4Y5YA 4D9QD 2P5WD 5EOCL 4HDIB 4DGYH 1I1CA 5H94B 1JPST 5BV7B 4FQCH 4NKIL 2VZ3A 3U9PL 3ZYZA 4QHNA 4J3VA 1AO7D 1EXUB 4MA8H 1GAFH 3VD7A 2ZKHH 3HE7C 4Y19D 4PBWD 4NO2A 1LDSA 4K7PX 1S9XA 1D9KC 1NCAL 1WV7T 2XWBB 3GKWL 1I3RB 4KVNL 1NGZA 4HJGB 4LP4A 1UZ6E 3OGCA 1G6RB 1CLZL 2AK1L 3TJHC 5ADPL 1C5CH 3ZKNC 2D0GA 1NBZB 5EZOL 1WQVT 3RBGA 3S7GA 2R0LH 1A4JB 5T3ZH 4Y5XC 5DJZB 1ZLUK 5IB2B 4IOFC 2C3XA 2QSCH 3PWPB 3WXVH 1IKFL 1KJ2A 3O8XC 5EWIH 2EIEA 3N50A 1EV2E 2FIKB 2JJUA 2MCG1 2V9QA 1DBKH 1V3JA 3EFDL 2Y23A 4MS8C 4X7TB 4Y1AE 1FN4A 3MRNA 3RQ3A 3EOBB 1ED3A 1FVEB 5FV1L 4LSVH 3QG6B 4BKLB 5E7BA 4P2YA 2BVOA 2CRZA 4PLJD 3BN9C 3MFFB 2CIIB 4JFZL 4XTRD 3OKYA 4G43B 3SDDA 2R2CA 4R2GB 3H9SA 5IVXF 3DGCR 1FCGA 3BOVA 3DETC 4MNHA 1F58L 3BKJL 3VWJB 1MFBH 4QNPE 3QULB 3TIEB 5GGQH 4HBCL 4ONFL 1ADQA 2X1QA 5TJWK 4HMDA 3WUWB 6FABH 3BGMB 3D0VA 1X7QB 2P44B 2HFGH 5JORB 3G08B 3FO0L 3B9AA 1JJUA 1ZHLA 1ZANH 2DQHH 3DVFA 2X1PA 1Z9OA 4U1MB 1AC6A 4RGOL 4JFPA 4BH8A 3UEZA 2IPUK 3OXSA 1DLFL 2AEWA 5DJ8A 4JO3L 4UU9B 5EOCJ 4N0FB 5C0AE 4MXWH 5JW4M 1K2DB 4HCRH 3MLYL 4LRNH 3FCTB 4YBHA 1BX2B 2W65B 7FABL 1FO0B 3B9KC 3BHBA 4F33B 2H1PH 3RUGA 1A9BA 4TNVK 5H2BA 4UQ2A 1LP9E 1CGVA 1IFHL 4NDMB 1A7QL 4J12A 1QQDA 4Y0GA 4Y4HA 3JZ7A 4ALAH 4AEHH 3GSVB 5IB4A 5IKCB 3H9ZA 1MWAL 4D0DA 4IMKC 4CRPA 4KHTL 3REWB 2HT3D 3N0PB 4ZTPL 4KROB 3C08H 1IGML 1AI1H 1T7WA 3ILPB 4KJQD 4OV5B 3KJ4B 3CZFA 3VWJC 5I1KL 3OHXB 2VH5L 4OFPA 4G7VL 4JO4L 2E7LA 1A02N 4UB0L 2Q20A 3R1GL 4KK8C 4CU6A 3F12A 2FGWH 4YO0B 5DO2D 4PGBB 4JAMB 1EJOH 5BW7C 1UEMA 5DT1L 5IMKB 1HDMA 1ZT1A 1FVCB 5A2FA 5CEZE 3PWUA 2PETA 4ZFOL 4GBXA 3QXWA 1FNGB 4OSUL 1XCQA 2WBJA 4I3RH 5E8NB 3RVTD 3L9RA 4PJAE 2BC4A 1AGBA 4NQCD 4JVUA 3WFBH 1XGTA 2W9DL 3OKKA 4HIIB 4HKXA 2NY4B 4HQQH 4YDJA 1HEZA 3L3IB 5T3XL 4YBQC 5CS7A 5CZKA 3O6FC 2QBWA 5CMAA 1IM3A 2VXUL 3LKOB 3IETB 3T77B 4ONHA 4PGEA 4O2FA 2FX7L 5EU6D 3VFRA 5C07B 3KXFE 4XNXH 2J6EH 3UC0H 2P5EE 2OZ4H 3ARDD 5DJ2B 3ULUL 5JXEC 3L3JA 4QHKJ 4DGIH 4UTAL 3DGGA 5EBLB 5D7JA 1DP0A 5FO9A 3E8UH 2CQVA 1J0HA 2IH3A 3B6SA 1C8PA 3CFJA 3ZE1E 1KN2L 5T5NG 5FYJE 4TOYL 1V3LA 5JHDE 5GS1A 2R0WL 4GMSL 1QA9A 1WWBX 1IM9D 3DYOA 4KH2A 1KEMH 5SV4A 1WAAE 1E4KA 4PGZA 2DWDA 1ZAGA 3OX8B 2YPLB 1I3UA 4XC1H 4HKZB 4FXGA 4DZBB 1U93A 5E8OA 1A47A 1EJ6A 1D5XB 5C0NC 1CG9B 4HIEB 5EN2A 3PV7A 4O2CB 2W91A 4YXLH 3GHBL 3LB6C 1ZWIB 2FH8A 5F1NA 1HZHH 1YA5A 4Y8AA 3HA0A 4Z7UF 5I1GL 4KQ4H 4K7PL 4WEUD 3P0VL 2MFNA 4HWNA 3WFDH 4WFHD 5DEFA 4JRXB 3PV6B 4YXKL 2YD1A 3MLSL 1CDUA 5F7YC 1RZJC 2ICWJ 4JG1L 1S3KL 3W9EB 4GXUM 5EU3B 3HE7A 4PB9L 2BJML 2NTFB 2Z31A 2LVCA 4CJ0A 2C3VB 1YJDL 1A6TB 1IZKA 4DW2H 2K7QA 3IDGA 1OP5H 1KFAL 5MP6H 4YHYC 2VJXA 1DEEB 4QRUB 3ZL4H 3BJLA 5AD0B 1M6OA 4K3EH 5FIEA 3BEWB 3UO1H 5C6PB 5I1AB 3SQBA 3IXAA 5ID0B 1KC5L 3EYUH 3OJDB 1UWEL 3QUXD 4I2XE 1H8NA 1M4KA 3L7FA 2HRPH 4QKXB 5EO1B 4DKFH 3EOYG 1Q9LA 1H3GA 1T1XA 2Y36L 4PRPD 5TH2B 3UTSA 1KGCD 4J8RA 4W68A 5TGBA 2FCBA 3IDUA 1F13A 1NH6A 4XPFL 4LCIL 4YZFF 3WE6B 3BKML 4DEPC 3W39B 4LQ1A 4X6DA 5SV3A 1YEEH 4QRSB 1IGTA 4LCUA 5GS0H 4W4OC 1MWAB 3DXAE 2EDWA 2BVPB 2H2SD 1MCLA 3MOBL 3S8WA 1G0DA 2EDYA 1ZLWH 4JZNA 1V7NL 1RV6X 2VDQH 4GAJH 5HGDB 4P5TA 1QFUL 4JFEE 1EXUA 1PQZA 2NY3D 3L3HB 4JKPH 2DWEA 3VFUB 3GRWL 1YEFH 3FTGB 3A67H 1QP1A 4GXVH 3V0WL 3UYRH 1QSFE 1IMHC 2GTZB 5GRUH 1I3RA 3V0VA 4HJGA 5HHOB 1A14L 1MCDA 1G6RA 5FF6B 1EPFA 4HKBA 2DQFB 3K81A 5CD5D 3U7YH 4XX1E 4XNYH 1INEL 5IIEB 2VL5B 1NFDF 3PWPA 3CH8A 5D72H 3ME0A 4E0RA 1RJLB 1X5AA 1WBYA 4IRJA 5TDOB 2Q76B 5I71B 1OAZL 2APVA 3WLWC 1TJGL 4X7TA 4ODUB 2EDLA 2BOBA 1YYLL 3EOBA 1RI8A 4BKLA 4W70A 2J2ZA 2CIIA 4R8WH 4X80L 5FGCB 3MUY1 4G43A 1HINH 4FA8A 5D71H 4J1UB 3UCRA 1DLHB 2VDRH 1MCOH 1UVQB 4P4KD 2BCKB 5EFIB 1PYWB 5GSVB 2WUBH 4IOIB 5KANI 5KJRH 3D69A 3IS0X 4J7RA 1NUNB 3GSOB 3UTTA 5CZXC 1I1AD 2EDDA 3LZFL 1U2CA 4M6OL 1FH5L 3B2UC 2H26B 2NR6D 4XCYA 3WUWA 3T1FA 4UT9H 1VADB 3FO9B 3GMPB 4OCRL 2AI0H 5JORA 2EDHA 1DBJL 5FHAL 5D7SH 1HH9B 1HKLH 2YBRB 5DZLA 5TDNB 3FT3B 2PO6D 1MCPH 1ZVYA 5F21B 1OT1A 2N7AA 4EQ2A 2VDPH 3O3EB 1EDQA 2EYTB 4ZXBD 3WBDA 3TFKD 4MX7B 4N0FA 1F4XH 3AS3A 4OGAD 1X5HA 2KDGA 3N1GC 3MLVL 2M8XA 1K2DA 1S7XB 3BISA 3HLAA 2XQYK 2V9RA 4ORGB 3FCTA 3BW9B 1G9ML 1XF4A 5DGRA 1OPGL 3O0RH 1C5BL 4OFDA 4HMCA 2E8YA 3D2UD 3UBXA 4NDMA 5FM8A 5GJTH 4WTZA 3GSVA 1LK2B 3SKUD 5F1SA 1CICC 2Z0BA 1MHPL 3REWA 3WD5L 3D2UA 1NSNL 4L1HA 1GHFL 1RVFL 1T20B 5DR5L 2ICEB 5EORH 1HILA 4OV5A 4XCNB 2A73B 1J1PH 4YHKH 3U4EB 3WSQH 3PHQB 2XN9B 4AMKL 2F58L 4YO0A 4Y4FB 4PGBA 2R69L 1S9YB 3VRJA 4JAMA 4XNQB 1F11A 1P84J 4XNZB 1K4DA 3C6SA 3MRQB 4WI5A 2XY1A 1NCUA 5IMKA 4LDLB 1FVCA 2GEEA 3R4DA 1B6DA 3ROLB 4H0GA 1W0YT 4ODTH 1CYGA 1HYSC 4J4PD 1MCEA 1FNGA 4XPGH 5E8NA 4LSUH 4U1SB 5GRZA 5LBSH 3QDMB 4Q2ZA 1A1MB 4KMTH 3OXRB 4YQXH 4HF5H 4FFZL 1U8JB 4HIIA 3L3IA 5I73B 4PJIF 2HH0L 3V9FA 3LDBC 1I85A 3IETA 2ORBH 3FZUD 3I3DA 4Q9BA 4GJTB 4KVCH 1FNHA 1QYGL 3KLAA 4M1CC 5CEXB 3WNPA 1BWMA 3LHPL 1VKXB 1X5FA 3CPLA 1T5WB 1PKQB 4M48H 5EBLA 5I1LB 4E5XA 4F7CB 1NFIB 1B0WA 4OCXL 3V5DB 4YWGL 3KYNB 5DF0A 4Y4FC 4JCLA 3FO2B 4K8RH 1FC1A 3FOMB 3RL2A 3CLFH 2YXFA 4Y2DD 3HC0B 4FXLA 5DLMH 5HDQH 1KIUA 1GC1H 1KN4H 5HD8C 1XGUA 2VLKD 3V5KB 1IJ9A 1QFPA 2YPLA 4JRYD 1W0VA 1UKSA 4YHZL 4HKZA 4DZBA 4RX4A 4N8CL 1KELL 1TJIL 2APXA 1ZA6B 4X98A 3CDGB 5DQJA 1P5UA 2OR7A 5A3ID 1D5XA 2HVJB 2YR3A 1CG9A 4HIEA 3RWDB 1KJ2H 4BZ2H 3LS5L 2N56A 5GGVL 1RZ7L 5I30L 1YNLL 5IW6B 3HG1D 4Y8DC 1RIVL 3QWRA 1L9NA 4UTBL 2A0LC 3WFHA 2XZQH 1JPFB 2FD6H 4B41A 4OZGF 1ZLUH 3D0LB 4JKMA 4OGXL 4ACPA 3TBVB 2WBKA 5I73C 4GLRH 3GSUA 4HW6A 4LPVA 3LD8C 4Z7VE 3H9HB 4JRXA 1EFXB 5D7IE 3A6BL 3C2AH 4AIOA 3W9EA 2Q3AA 4AH2A 3IDMA 2NTFA 3MLRH 1JNJA 2C3VA 3SKNA 1SJXA 4HFWB 4NRXA 1A6TA 3I9GL 1Z3GL 4ZG1A 4NQUA 2VKXA 4PJ8B 1INQA 3IDIB 3MRRB 4QRUA 3K0WA 4WGVB 5TF1L 4MWFA 1CGUA 3QDGB 2NY0D 5D2LF 3SO5A 3VGFA 5AD0A 5FM4A 3IFNL 5I1IL 1ROWA 5DMGD 3BEWA 5I1AA 4WUUD 1NAMB 2IBGA 4NJAH 4PJEB 3NPZB 5ID0A 4MNQE 3EHBC 3QG7L 2QQKH 4X99B 3VMNA 5EO1A 3QUYA 4NFBA 4MQXC 5IFHH 3CLEH 3HN3A 1CD9B 3U4BH 1FYTB 4ZUWB 2J8UF 3ZLQC 1K9TA 4M1GL 2QSTA 4PG9B 2VE6A 4Z95H 3C5ZB 4J3TA 3W39A 2VXTH 1OSZB 3IGAA 3KAAA 4QRSA 1EEZB 2X4TB 1NCWH 2DQIL 1YEKL 3G6JB 3NPSB 4FQQB 1I8KB 3RX5A 1MWAA 1JZ5A 1HQ4B 3TV3H 1KCUL 4HUWB 5C0BE 5JZ7C 2B1AL 5IBLD 4P99A 1CGYA 4YUEL 5E0QA 3Q2CA 3QUML 1PBYA 2FJHB 3CDCA 5HGDA 4BSWA 3LKQB 4KKCD 4CMMB 5TQ2L 4POZD 2GYSA 3L3HA 1I9RH 2OL3L 2ICWA 2X2YA 3VFUA 3X14B 3SJVA 3CU7A 3FTGA 5E4EC 2V7HB 1RIUH 3AB0B 5FUZH 1MH5B 1NCCH 2GTZA 4KI5C 1G7JB 4U3XA 4ODVH 1MAKA 2IBZY 1AR1C 3BAEL 5FF6A 4XMPL 3QI9D 3OB8A 2IMMA 4ZFOA 2MHAB 1HIML 2D7TH 3OMZA 5T3XD 5F7NC 3TJEL 4RBPK 3F6IA 4LQFL 4XHQA 5IIEA 2VL5A 1ITBB 2DLTA 4K3DH 4OB5H 4HX1B 1EHAA 1NDGA 3RWGB 2Y6SD 4I48B 2V7NA 2Q76A 1CFSA 3IAPA 4D8PB 3NPSC 4EXKA 4OT1L 4DQOL 5HBBA 5J56B 3LN9A 2GSIB 1X5YA 1QR1B 2OXHA 4ZDHA 3V6OC 2G9HB 3KGRA 2WAHA 4M62L 2VDMH 1FGNL 4GOSA 1MRCL 1ZHKB 1ZE3C 1U95B 2CUHA 3MLXL 4J1UA 5BS0E 4V1DA 5EULV 1UVQA 2A6JA 4KJPC 5EFIA 1PYWA 3QIWD 5GSVA 1XGRB 3O6MH 4NKQB 1QRNA 3K46A 3HMWH 3I75B 4JM2D 5JIKA 3GSOA 2A77L 3TT1L 4I0PC 1A21A 2EO9A 1J1OL 1VADA 1D6VL 2QKIB 5L2KD 1AE6L 1MEXL 5TDNA 3D3VA 4IRSB 4UZGA 1BFOB 4Q6YA 4NNPH 5CIPA 3LS4L 3RWEB 1O7SA 1ZT4B 2PNDA 3PWJB 4MXQD 3GSXB 3TIDB 2ESVE 4MVBC 2HWZH 3CFBB 3O3EA 5H37G 5E2WL 4X9FA 5ESQB 3QNYB 4KRMB 5EUOA 3VXUD 3ARPA 2HYMA 4G9FA 4E42B 1D5IL 1JNNL 2B4CH 2Q8BH 3MLWH 4HXAH 4C59B 3BW9A 3LMJL 3U46B 5TPWH 3RVVC 3T4AB 3MFGB 4UIKL 3EOAB 2W9EL 1CQYA 5BQ7A 3FQWB 1HK6A 4GQ9H 1YECH 2C4FU 4F15B 4YIQB 5TFSH 4P59H 5DC0A 1RUMH 3KPRD 3TBYB 1NMAH 2J3SA 1IEHA 3RWCB 2YMXH 4ONGL 4WO4D 3BO8B 4WWKA 2A6DB 1V7ML 2ADFL 3EUUA 4UT7L 3WNNA 3MJ7B 5I17B 1S7TA 3HRZB 4M6AA 1KEGL 1T20A 1IEBB 1ZHNB 3KPRA 3V52H 1RHFA 2A6IB 1VCAA 2A73A 3HS0B 3PGDA 1CGXA 4TSCH 2CGRL 1K6QH 1JGDB 3PHQA 3EJJX 3QEHA 2XA8L 1P7QD 2XN9A 4E41B 1WGOA 3O2DH 2DL9A 1BOYA 3QEQE 4XNQA 2CR6A 3CFDB 3MRQA 1IAOB 2H45A 3FB8A 3ZE2F 5JOEA 4P2OC 2AJYH 2HKHH 3GUTB 3SCMD 3U48A 3T0ED 4DCQA 3ROLA 3HE6B 5J6GB 5T3ZE 3QUKA 1I7RA 3OAZK 1MNUL 1AIFB 2DQTL 4LHQB 4WV1A 4AENA 4U1SA 3SCMA 2OTPA 2EYSB 2NY7H 4RMQA 1I9EA 2OK0H 3CSGA 3OXRA 4S1QH 1KENL 4N0YH 3QUMB 4N0CC 3N85L 2FB4L 4I3GA 3ARZA 1MPAL 3GMQB 3DARA 3VD5A 2FEDC 4YPGB 1G7PA 3RY4A 2W59A 2AEQH 3MV7B 1XF5B 3IJYB 2WWMD 5CEXA 1VKXA 3O4OB 4GG6F 4H8WH 1PKQA 1NMCB 5E9DD 2BFVL 2X89D 1P84K 1T21A 3F5WB 12E8H 4KV5F 5LGKA 5DJAA 3KYNA 3LKSA 3FO2A 3D87B 4XP5H 4OF0A 5TE6L 3ZT5A 1DVFD 2KZ1B 2CLVB 1NC4D 3FOMA 3OKMB 5FYKD 1DANU 3SDXE 5K9OA 3RY6C 1HHGB 3EIFA 3HC0A 2OM5A 4HUVA 2E7BA 4KY1L 4X83A 2DLFL 2H2PD 5KVGL 3HE6C 1DVFA 3U4AA 5IESL 3LQAC 3JBG7 2DMCA 1KCRH 2YHGA 2HVJA 1A6WL 4OLVL 4JHZA 1TDQA 3RWDA 3UP1A 1JGLH 3E3QE 1S9VB 3RGVD 3HPJB 1MIML 4GRLB 4MA3B 5SWQB 4JHWL 4L9DA 2GJ6B 3Q48A 4JGUA 3MYJA 5F89B 1JPFA 3ZDZE 4WI6A 1UXWB 3P73A 2H9GA 3D0LA 3TBVA 4ETYA 4R3SA 4XP4H 1TNMA 2K3TA 3Q3GB 3H9HA 3IAQA 5DD0H 2IQ9H 4R4FH 1EFXA 1CLYL 3SDAD 5C08A 3KPLB 1A7RH 1CF8H 1R5IB 3O4OC 1UM4H 2NY6C 5KAQF 1QBML 3DTXA 1GPOL 3Q6GH 4RGMC 4HFWA 1PLGL 1CT8A 4PJGB 2Y7QB 2O93L 1EHNA 4PJ8A 3STZB 4NQSB 3IDIA 3MRRA 4O51A 1N7ML 2HT4C 5I76B 4UILL 4PLOB 4L8CA 2IJ0C 2XKUA 4RFEB 1YNKL 1FIGH 2DQJL 4PJEA 5A43C 5HI4C 4X99A 3RZCB 1KIQB 4PLNC 1J86A 1FYTA 4ZUWA 2C4XA 1BEYL 5T1KD 3C5ZA 4P2RE 5BOPA 5LG1A 1QSEE 4GRLC 4XMKL 1OSZA 2D7OA 4L3EB 5F3BB 2X4TA 2X1XR 1MQKL 4G6KH 4F57H 1I8KA 1T89A 3F7QA 4XX1G 3ALXA 4RFNB 3FT4A 2EC9T 1DQDH 1ZGLB 4N1CA 3RU8L 3UJIH 3N1QC 4RIRA 2ZOKA 4R4BB 2AK4E 5DD1L 1NEZG 3LKQA 5TDPB 2F8XC 1W8NA 3ES6B 5E4IA 3TZVB 5HYIA 4HC1L 3VG9B 3BIKA 3X14A 1CZ8H 4R90L 4TUKH 4F7PB 1R3JA 1K85A 1FQ9C 3ARGD 3SKMB 3PQYD 3G5ZB 5L7XL 4Y16D 4QXUL 4KRPB 1U6AH 3RVWC 3NIDE 1DL7H 1NGYB 1VEMA 2RJMA 3I2CH 1G7JA 1WBXA 4TTDD 1WBZB 4KQ3H 1EX0A 2N7BA 4FFVD 2BZDA 4HSQA 2MHAA 2FJFB 4LCCB 3RZCC 3NFNB 4QRRB 2EEBA 2P49B 4LIQH 4PREB 4HX1A 3TESA 4QGTA 1FIEA 2EDOA 1QVOB 2JK5B 4XAKE 5EOCH 4NN6B 3SGKC 4NKIH 2Z9TA 1YMMB 1BECA 3U9PH 2D7NA 3GDBA 1Q72L 4ZPTA 4CMHC 1T1WB 2IQAB 1QR1A 4MQSB 4OGZA 1XMWA 2NY2D 3LPFA 1IGJA 2CUMA 1ORQB 1J8HB 2AABL 4IJ3B 4I8DA 1U95A 2Y5TA 2VUYA 3O6KH 1T4KB 3RHWF 4PRBB 4DJMA 1K4CB 1NCAH 4M7LT 4PJFF 2WIIB 4KVNH 2OTWB 3T3MF 4AL8L 4KRPC 1YEHL 3VXSE 2AK1H 2ZNXA 4QTIL 4IHOB 1YN6B 2QKIA 4YX2L 5B3JE 4R4NC 3W2DL 3BX7C 4F7MA 4KKLD 1RK0B 3NZ8B 1UEYA 3FAXA 2Q87A 4M7KL 4LCCC 4IRSA 1BFOA 4PY8I 4ZTOH 3WS6C 1IKFH 3V6FB 5IFJB 3RWEA 1ZT4A 2DM4A 3NVQA 3TIDA 3GSXA 3CFBA 2A83A 5ESQA 4PP1C 4OTXH 4V2BA 3BSZH 3UZQA 3EFDH 4P9HC 2BNQD 4NN6C 2AXHA 4D9RD 5A2JH 2W60B 2LU4A 3JWNC 4YLQT 2Z4QB 4YIQA 4OLZL 3TBYA 1EO8L 4KTEH 3BQUC 2A6DA 4IJ3C 5IV2A 1WZ1L 4X0KB 1F58H 3BKJH 4LARL 3MJ7A 5I17A 5EC2B 3HRZA 1ZHNA 4HBCH 4ONFH 4WI7A 2A6IA 4FQJL 5IMLB 3OQ3B 5IWLC 4FQLL 1WLHA 4URTB 2IGFL 2XRAL 3THML 3UJJL 2V9TA 1W72L 3SE4C 3BVNB 4LSTL 4RGOH 3CFDA 1IAOA 1DLFH 2NZ9C 2ZG1A 2F54E 4P9ML 2C3GA 4IEFB 4JO3H 1EHLL 1UG9A 3H3PL 3GUTA 2ZG3A 3MLYH 5J6GA 7FABH 1IILE 4QY8A 4EOWL 1TQCB 3C5JA 1CBVL 3SE3C 1AIFA 5CWSB 4AIXA 1INDL 5JPMB 1N0XL 1CE6B 2EYSA 2XI9A 4P5KB 3B4NA 4AY0A 1IFHH 4PJBA 3ULVL 1VFAB 5I0ZA 3QUMA 4OI9A 2MJWA 1BJ1J 1ZVHA 1UZ6F 1MWAH 3B2VL 3I85A 4RMTA 4HGKC 4XPTL 3IAGC 3GMQA 2RQ8A 4ZTPH 3MSPA 2AJUL 4YPGA 3RNQB 1REIA 1FFQA 5KS9A 3MV7A 1M05B 1XF5A 1C08B 5I1KH 2VH5H 2K7PA 1U3HB 4JO4H 2BSTA 1FRGL 4UB0H 3R1GH 1BD2B 1DSFL 4WY7L 4WI8A 2C3WA 4RMWA 1X4YA 4NWTL 5ICYB 2HJKA 5DT1H 4QLRA 3G6AB 2QQLH 1J5OL 1JRHI 3OKMA 2ZUXA 5DUBA 1S7UA 4PYGA 3V8CA 1XFPA 5F9OL 2X4PB 4EI5D 1F42A 2AKRB 4ERSL 2R0ZL 4OSUH 1CDJA 4EKXA 4EVNA 5E00B 2CXKA 2LU7A 5FA3B 1RJCA 1RZFL 5A16B 3OTTA 4ZFZA 3E0GA 3KLSA 1F02I 1WC7B 2W9DH 4GRLA 3ARQA 4QNPF 5T3XH 2Z8WC 2GJ6A 5K59E 4OLWL 5JPNB 5F89A 4RBPH 3ZE0F 5HY9B 5HYQB 2VXUH 4QHMB 2W1NA 3PXJA 4U1JB 2VL4A 5I1HL 2FX7H 5MHSE 3ARUA 3HRPA 4UBDD 4NQDD 3ULUH 3FHQA 1BVLB 4K3GA 2EC9U 4W6XB 2FO4B 4UTAH 1U3HC 3KPLA 1N64L 2BXZA 3AREB 3HC4L 1R5IA 4ZSOE 2PYEE 8FABB 3A6CL 4OCLC 3AAZA 2QJDA 2XTJD 2R0WH 2Y7QA 1EFQA 1K8IB 3L5HA 4HG4K 4NM8L 1KLGA 3STZA 4OZIE 3JVGC 5B21A 3BPNB 2R4RL 4PJ9C 4YAQA 3RTQC 3EYQC 2AEPL 1LP9F 4RFEA 4RAUB 5INCB 3RKDD 4OGYL 4OCYL 2I9LA 1E4WL 1U8KB 5CIPH 4F37F 2HG5B 3GHBH 4F8TA 5I1GH 5E6YA 5J0BA 2EE3A 1A6PA 1CU4L 4S1DD 5F3BA 4K7PH 4L3EA 5IEKB 3P0VH 1HWGB 1JE6A 3MV8B 4FG6D 4YXKH 3S88L 1VHPA 3CUPB 3MLSH 5L6YH 4NQXA 4JLRB 4RRPG 2Z92B 1FORL 3VW3L 4JG1H 1S3KH 3Q5TA 5FGBA 3GK8L 2VZ1A 4R4BA 4PB9H 3GBLA 2BJMH 4PG2A 1F8TL 3ES6A 1YJDH 5D7LB 5H35B 1EBAA 3TZVA 2ITDB 1KFAH 3WN5A 1JI1A 2BSRB 1F00I 5D7KE 4PJAF 3MRJB 5ISZD 4AJ0A 3SKMA 4ZODA 5ETUA 3UPAA 1CI5A 1RQ5A 5IB1A 3BPNC 3KXFB 1KC5H 1UWEH 1CDBA 3QIUB 2Y36H 1V5JA 2ZSWB 2FJFA 4U2ZA 4PP2A 3OF6A 5DJXA 4JFFD 5DS8A 2IAMB 4LCIH 4XPFH 3NFNA 4QRRA 4LFHG 4IS6B 3BKMH 4WJ5B 4KPHL 4PREA 3IXTB 1MHHA 5EB9A 1QVOA 4QOKD 2JK5A 1D9KD 4BFGA 3MOBH 4DZ8B 2KPNA 3NCBB 3ZE1F 1YMMA 4LPYA 1OAQL 1BQHB 1T1WA 1ZXQA 2IQAA 4QOKA 3TJHD 2E8ZA 5FDWB 1F2XK 2YPKB 1VA9A 3FQXB 1WAAF 3OAZH 5D5MB 3ZKND 2H8PB 3NZHL 1J8HA 3MRIB 2WNGA 3BP6B 5A2LH 3GRWH 1CWVA 3PWLB 4PRBA 3BZEB 4JQVC 1FZKA 3IF1B 2NY1C 1K4CA 3O8XD 2I07B 1HXYA 2WIIA 3UPCA 3KVQA 3H9SE 3MMEB 1IQWL 3GB7B 4KK9C 5C09D 5LGJB 1A7PL 5EUKA 1RZIA 4CKVX 4MS8D 5F7WC 2EECA 5DMYA 3BPOC 5BRZB 3T0DA 1INEH 3NZ8A 2AJZB 3BN9D 3GMOA 4JQIL 3V6FA 5FECB 5IFJA 3OJ2C 4HKJB 2PXYB 2ILLA 4N0UA 1X44A 1CXFA 4MAUL 1OSPL 1OAZH 4S2SB 5DMIL 2DQGL 2VDOL 3DETD 2XZZA 5DRNA 1TJGH 5DHVB 4EDXA 4I2XB 1WCBA 1YYLH 1AHWA 4MJIB 5GGTL 3EOTL 1T7VA 2W60A 2D7QA 2NYYC 5DMKB 4Z7NE 3AGVA 2Z4QA 2XG4A 3RUGE 2M26A 4JFYA 4WHYG 3IU3B 4ZS6C 2VLLA 4PPTA 4X0KA 4L29B 1NGQL 4YDIL 4G5ZL 5EC2A 3EO1A 5JW4N 3ARBB 3LZFH 1L0QA 4M6OH 2P47B 1FH5H 4BFIA 5IMLA 2R4SL 3UJTL 3L5WA 4YHPB 2FZ3B 3MOAH 5F7EH 4OCRH 4JFEB 2OXGA 3B9KD 1BFVL 3QIBB 1DBJH 2Y5EA 1R24B 2QEJA 3BVNA 5BO1H 1IARB 5IROC 3MNVB 5M95B 3QHFH 4PB0L 3REVB 3G5XB 4LVHB 1NL0L 2PXYC 5DRWB 3RFZC 3V4PL 5CBEB 1G9MH 3DMMC 1D3CA 3VXQB 3LEXA 4M1DL 1OPGH 3U36B 1HHHB 1H15B 3VWJD 1C5BH 5JO5A 4P5KA 2ZUVA 5E8EA 2OS7A 4HH9B 5IJKC 3MPCA 3BT2L 2BHZA 1MHPH 3OKDB 1NEZB 4HC1A 4MCYA 3WD5H 5CD3B 1SJHA 2RAMA 1GHFH 1RVFH 2EDEA 2GK0B 3RNQA 3U30B 3IDXL 1FL3B 5E6IC 5D2NA 1M05A 3T4YB 3SOBL 1C08A 3ARBC 4XVTL 1X4XA 4X9IA 1DBAL 3R0MA 5DVNA 3LCYA 3PL6B 1BD2A 4AMKH 2F58H 4QXTA 2R69H 2GY5A 1UJ3C 4H88H 1T80A 4H5SB 1SEQL 5ICYA 2G2RA 4Y5VB 1KIRB 2WSKA 4U7SA 2GK2A 1BQUA 4PY7A 3LEYL 1AGEB 1S7RA 4YBQD 3O6FD 1V3MA 2P8LB 2X4PA 4LVHC 2AKRA 3TPUB 3VCLA 4BQ6A 5E00A 3LKPB 3NCFB 1L7TL 3SDCB 3S36L 4P2QD 3DRQB 4XXCC 5JXAH 3MV9D 1CL7L 5FA3A 3HI5H 1PZ5B 1UJTA 4R96A 4Z77A 5A16A 5JXED 2YC1A 1MI5A 4PLKD 2ERJC 1YQ2A 5EH1A 5JPNA 4ZYKB 5HY9A 2HH0H 3P9MA 5I8EA 5F7HA 5IEHB 4CVXA 1J87A 3KPPB 4KMLB 4U1JA 2CRIA 1GGCL 2BNRB 1I8LC 1QYGH 4JO1L 3U30C 5J1AB 5MENB 5ERWA 3LHPH 4PGCB 3V7AE 3HZVB 1BVLA 2AW2A 2HJFA 3VGGA 2VNCA 2VMFA 4GRWB 3AREA 3T2QA 4XWGL 4OCXH 5C0ND 1VSCA 8FABA 3FN3A 1GIGL 4JQXA 4OD1H 1JWUB 1CD1B 1LQSR 3LB6D 4ORZC 4QF1A 1WEJL 5CEYB 1MLCB 4YNYB 1B4JL 3TLRA 3H7BB 3TBTB 2EYRA 3GJFK 2VQ1A 2F53E 1JHTA 4MJ6B 1F4AA 5IFAL 2NCMA 3GNML 4YHZH 4CGTA 3QEGL 3FFCD 3L3KA 4M5ZL 4MDIB 1JYXA 4N8CH 1TJIH 4Z18A 2EDFA 4GXUN 3SDCC 2HTLC 3KG5A 3LS5H 5GGVH 5I30H 1RZ7H 1YNLH 2JIXB 3GJFA 2HG5A 1RIVH 4UTBH 3FFCA 1U8OA 1DN0B 3UTSE 5IEKA 1NAKL 2EDXA 3MV8A 4N5ED 1PY4A 1A0QL 2IBZX 4KFZC 5ESAB 4G6ML 4X6DE 5EZJB 3CUPA 3L7EB 4HFUH 4MQTB 3A6BH 5K9JL 4FTVA 1FNSL 5HHVL 1P69B 1JBJA 5GGSY 2VLJA 3D6GA 3VXRB 3T2PA 4HWEL 2VN4A 1OF2B 5D7LA 3I9GH 3RDTC 1Z3GH 4QRPA 1W72A 2C7UA 4Z7UA 4MCZA 5TF1H 1BIHA 2FX9L 3MRJA 3IFNH 4DK6A 5I1IH 1PAMA 2R8SL 4FQ1L 4DAGL 4AEFA 4QTHB 1U8NA 3GJEB 3QG7H 3QIUA 4MA7H 4TUJA 5D6DC 2ZSWA 5HVGB 1AP2B 1QO3A 4CNIB 4M1GH 2IAMA 1DBMH 1Y6NR 4IS6A 2VZOA 3ORJA 3TM6A 1WITA 1CFBA 3IXTA 4PJ5A 5HHQB 2DQIH 1YEKH 1NCTA 1NKRA 1KV3A 5T1LD 5FHBL 1WVZA 3PWPE 1A6VL 4P3CL 1KCUH 2IANA 4DZ8A 2O5YH 1B88A 3GSRA 1JZ8A 3O4LB 2D9CA 2B1AH 4Z7QE 4YUEH 3QQ4A 3QUMH 3TO4B 3ALWA 4UOJA 3DV4A 3GGWB 5TQ2H 3F62A 5FDWA 2YPKA 3FQXA 3PE9A 3HNVL 2IBBA 5GQBA 2OL3H 4G8EB 5GS3A 5C3TA 5C0RL 2JB6B 1CIUA 1FNAA 3IF1A 2DS4A 3ZDXE 2V2WB 1A22B 3CVIL 4D0CB 3BRDA 4JANB 3GI9L 4OUUB 2J12B 4Z7WB 3FRUB 1OD7A 3MMEA 5D7IB 3KLHC 1OWRM 1TPXB 3GB7A 4K55A 4G6AC 1N8ZB 3WLWD 5LGJA 4XMPH 1TZIA 1YN7A 1HIMH 2XPGB 5ALCL 3UTTE 3TJEH 2GY7B 5BRZA 1TIUA 1IC7L 4FQCL 3GFUA 4FZEL 5IROA 2AJZA 4Z7VF 1UFUA 2BHYA 2ZWLT 5FECA 1DQQB 4HKJA 1NGWA 3T1WA 1SBSL 4S2SA 3OR7B 1WTGT 2J4WL 5F9WB 4DQOH 2W0FB 1D6EB 2HA1A 4MJIA 2JJTC 3B2UD 4N90E 5HHOD 5DMKA 4M62H 3HC3L 1FGNH 4GSDH 1MRCH 2RCSL 1JP5A 4DUWA 1NFDA 2OBGA 3IU3A 4NQEB 3NACL 2BVQB 5C0CA 3U7WL 1F6AA 2A77H 5C0BB 3HAEH 1H8OA 1A4KB 2APBA 5A2KH 1J1OH 4HV8A 2FZ3A 4XBEL 4YHPA 1D6VH 1N5AA 3QIBA 2UYLA 4G8GB 1AE6H 1R24A 4DVRL 4EI6B 1MEXH 3TNMB 4NO0A 4ZUVA 4EIGB 5CCKL 1GRWA 4OV6F 4F8QA 4LSVL 3LS4H 1ZK9A 3MNVA 2AQ1A 5E2WH 1F90H 3REVA 1G7MA 1CICD 4DN4L 1D5IH 1JNNH 4NRYB 2RFXA 1IAMA 3U36A 3BZFB 1HHHA 3KPMA 4UIKH 1JNLL 2W9EH 4M4RA 3ILQC 1F2QA 4PRNB 1CXEA 4F9PA 6FABL 2JCCF 4HH9A 4ONGH 4Z5RB 3SGDI 4LKCB 3WJLC 2ADFH 3BEVA 3O2VL 2VR4A 5J9PB 3OKDA 1NEZA 3IDNA 5CD3A 2VZSA 3LQZB 5CSZA 1KEGH 2GK0A 2QQNL 5JA9A 1MCKA 1N4XL 3T4YA 3BPLC 4I9WD 1SYSB 3ARSA 2CGRH 1HYSD 2XA8H 3PL6A 4U05A 3CX5J 3FN9A 4GH7B 1R3LA 5CZVL 4WFED 1I1RA 4RDQG 2YS4A 4Y5VA 2H41A 1KACB 1JCKA 4OCMC 1M7XA 1BVKB 4KUZL 3O9WA 4X8JA 4K71B 3SO3B 4Y7MA 1UCBL 5HYSG 3MA7A 1Y6MR 3TPUA 5FK9B 1MNUH 2DQTH 3LKPA 3VRIA 3QHTC 4U7MA 2E6PA 1R3IL 3DRQA 1AI1L 4M1CD 3KPQB 1T0NA 1L0XA 3TH2T 1XGQB 1KENH 2YPLE 3N85H 2FB4H 4NNXB 4AYFA 4XP6L 4IRZL 1IGCL 4LRIC 5FYLD 2ESVB 1MPAH 4ZYKA 3JTSA 4DK3A 1EJOL 1U8QB 3QO0A 1M71A 3AMKA 4ODXB 2UZYB 3KPPA 5DUPL 3RAJL 2VLME 43C9A 2QR0B 1OVZA 4NBXB 1R0AH 5ECJE 2BNRA 4P46B 1SY6H 2ZUUA 3VFVA 2YXMA 5HD8D 5MENA 3MRMB 5KVDL 2BFVH 4PRHA 4MSWB 4MJ4A 4JRXE 4LEXH 2DYPB 5GRXG 1YEDA 2Q7YB 2DMBA 5DD6B 4C56B 2Z35B 3QDMD 1JWUA 5TE6H 1U9KA 2HVKA 4CW1B 3FMGL 2A0LD 1BQLL 5ACLA 1WT5C 1MLCA 4RZCB 5BZDB 3H7BA 4KY1H 3TBTA 5DQ9B 1OD9A 5I16B 1QLFB 2DLFH 1D5BB 2BK8A 2G75A 5KVGH 1LE9A 4YFEA 2DQCL 5A2IH 3MLZL 5IESH 4WHTA 3HI6L 3KHQA 4OLVH 4B53A 3NA9L 3GM0A 2ADIA 4JE4B 3BKCH 5GGTA 1MIMH 3S35L 4JHWH 1DTUA 4DGIL 1VFUA 1KJVB 4BQ9A 1JGVH 4WTWA 3SGJC 5BVJB 4HK3J 3UZEA 4JREB 4UAOB 5EZJA 3TYGL 4AQ1B 4OLYH 1ND0B 2JJVA 3L7EA 1CLYH 1BOGB 3S96B 5F1IA 3GHEL 3C09C 4P46C 3C60B 5D1QB 5FUCE 5J6HB 4HK0B 4JFQA 3EHBD 4X5XA 4YGVA 1DCLA 5HGAA 1MFDL 2EE2A 1QBMH 4MQXD 1OF2A 1PLGH 3ARFB 1YMHB 3MBED 1GZPA 2VLRB 4HT1L 4W6WB 4G3YL 1N7MH 4BZ1L 4UILH 3WJJC 4OAWB 1YNKH 3MBEA 4XWOC 3SJVE 2DQJH 3UPRB 5F88A 3TCXA 5EBGA 3WFDL 5BMFL 1B4RA 5JZ7D 1T03L 5D1XB 1AP2A 4CNIA 1JVKA 1BEYH 3G5YB 2QL1A 4I1NB 4ZUUA 4POYA 4RFOL 3TN0B 1P4BL 4NZDA 3IJSB 1QLRB 1CFQA 4XMKH 4JY4B 5HHQA 5I1DA 1MQKH 2OCFD 3VFSA 2X6MA 5J13B 5E70A 5D2LA 1OB1B 2A74A 2GKIA 4NIKB 1QSVA 5KSAA 1FZOB 3RU8H 1PY9A 2VIRA 3BH9A 4LLVB 3O4LA 3QDGD 3IFOA 2JJWA 3JSSA 4JREC 4KI5D 1OL0A 3T65B 3TO4A 3G04A 1SVCP 5DD1H 4K07A 3GGWA 1EAPB 3SDXF 3C60C 1CFTA 4RAVB 2DQUL 5HHNB 3MQIA 1S7SB 4HC1H 3LEVH 3O45A 4YPJA 1OAYL 1HE7A 1MUJB 5IHUL 4B50A 3FB7B 5SWZA 2JB6A 2CDGB 1OGAB 4XPBH 1KT2B 3ULUE 5L7XH 5FGCE 3WHXA 2YN3A 4Z7WA 3FRUA 5HHMD 3TWCL 4ZO9A 5I8CA 5TQ0L 4P49A 3VGHA 4V1DE 1TCRA 5GXBB 1ZS8B 5CINL 1QRNE 3NAAL 1J0ZA 2UWEB 3QNXB 2MQCA 5I8KL 1VACB 4OZHA 5F3HB 3E1F1 3PGFL 2FATL 3A6OA 4X7CC 1WUNT 4NHCL 4U6TA 4K3HA 1DQQA 2FSEA 5EDXA 1S8DB 4KJPD 3D39D 3D3VE 3PP3K 3OR7A 2YD4A 4PRIB 1XCTB 2GFBB 3VDCA 5IG7A 4MAYB 1D6EA 4GXVL 5F93C 1HCFX 1BFSA 4U1NB 5EUOE 4G9FE 1VGEL 4I0PD 1G7IB 3DVIA 3MRHA 4LGSB 2AABH 5BXFB 5J3HC 1JRHL 3E3QC 32C2B 4BSJA 1MCNA 2PN5A 4JY6A 1AQDB 2V2TB 1BJ1H 4BM7A 5EBWA 3CAFA 1HHKA 1T7XA 5GIRB 4PBXA 4MVBD 4AL8H 3CK0L 1YEHH 3D85D 2ZZUT 4NM4L 1A4KA 1BZQK 4QTIH 3LRSA 2AK4B 2XA3A 1U92B 3QO1A 3RVVD 4YX2H 3W2DH 3H3BC 4M7KH 1TTUA 3TBWB 1Q1JL 4ZFFB 5JOFB 5J11C 1U8HA 3OJVC 5KVEL 2NXZB 2XN9E 3KPTA 3P0YL 5HVHC 4NNYB 4JDTL 1MY5A 4LCWB 4X6EB 4KU1A 3LSOB 4LMQE 2HLFC 4A2MA 4TQEH 3BZFA 3GJFH 3ELAT 4POUB 3SGEH 3ZTNL 4MAYC 4XNMB 1LE5A 2FL5B 3JUYA 4OLZH 4PRNA 4JHAL 3H9YA 1EO8H 3B5TA 4RRPA 3NIDF 4Z5RA 4NHUA 1YPZB 4TVPE 3S4SG 4GKSA 1WZ1H 2DLIA 4LARH 2CLZB 4GAYB 1FP5A 2H3NB 4P2OD 4FQJH 4GKOA 4GMTL 5EIQA 2BMKB 4GW1B 1I1FA 1UC6A 4FQLH 1SYSA 4RNRB 4K9EL 2XRAH 3THMH 1LEIA 3BI9X 3UJJH 3QDJB 4ZUSA 3QFDA 1W72H 2VC2L 4LSTH 3STLA 5J8OA 4L4VB 4N0CD 1PKQE 1MF2L 3CMGA 3IVKB 4PRDB 3LPGA 1EHLH 3JV4A 3MRGB 3H3PH 4ZAKB 1MCCA 1UQSB 1WWCA 3NCMA 3K8KA 2FEDD 5GGRB 4EOWH 4F9LC 1CBVH 1INDH 4U0QB 1N0XH 5EORL 4HGWB 3TYFB 3ULVH 3R8BB 2OR9L 2GJJA 4UOW0 5GRWA 5A1AA 3RWIB 3OKOA 4PS4L 4XPTH 4E41D 4EN3B 4K7FA 3NGBC 1CDHA 1GXEA 2AJUH 1U8QA 4DKEL 5DTFB 3FQTB 5B3JF 4N1HB 2CLRB 2QR0A 1CIDA 2KQNA 3LRGA 1RUQH 1FRGH 1F3DJ 5L0QC 3MRMA 1TETL 3HE6D 4JB9L 2DM7A 3F7VB 5IW1A 3CX5K 3MJ9L 4G8FB 1DSFH 4WY7H 1L9MA 4MSWA 1CDYA 5T1MA 2DRUA 4JDZB 3L3DA 3F7RA 4NWTH 1X5ZA 2Q7YA 1F45A 3W11C 5C08E 4F7EB 4C56A 3CXHJ 1FC2D 1XR9A 4LASH 5INDB 1I8IB 3QZWB 1J5OH 1EA9C 4CW1A 3M07A 3I6LD 4YQXL 4RZCA 5C6TL 3IS1X 5F9OH 5I1CL 5DQ9A 1MCJA 4ZAKC 4ERSH 2R0ZH 2VDNL 1SQ2N 3P4LA 5EA0L 5IB5A 4WWID 5D1ZB 3L95A 1U91B 2XICA 1RZFH 3V4UL 1R3KB 4PJEE 4CUCA 2EE6A 3H7LA 3OB0K 2NY6D 4RMUA 2ZUQB 3P11L 4OLWH 5JW5A 4FQ2L 5ITFB 1UM5L 4HWBH 4M48L 3F7PC 1FYTE 4L4TB 3Q5YA 5C8JB 5I1HH 1CD8A 2HT4D 4JO2L 4MHHI 1ND0A 1BOGA 4QXWA 3S96A 3CLFL 5C2UB 4TUOB 5CP3H 1SYVB 1Z5LB 3G6JE 3EGSA 3KDMA 2OR8A 5D1QA 5J6HA 1N64H 3HC4H 5HI4D 2HFTA 4JPKL 1R5WA 3A6CH 3GMNB 4HUXA 2F8OA 3ARFA 1YMHA 3SPVA 5DGQA 5GS0C 1FYHB 4HJ0C 2VLRA 3V6OE 4Y4KB 1N26A 4NM8H 3NCYS 1QACA 3DX8A 5J57B 1P4IH 1F97A 2R4RH 2GT9B 2AEPH 2X44D 1HI6B 3MJ8A 5EBMB 2XZQL 5HYJA 3OKEB 3HNTL 4OGYH 3KS0J 3BP7A 4OCYH 1T5XB 2D0HA 2R1WA 1E4WH 5HI3D 5D1ZC 1VEPA 5D1XA 2VKWA 3U2SB 1EHXA 3TN0A 4HZLB 2YWZA 2XG5A 3IJSA 1QLRA 3NN8B 4JY4A 1YUHB 1CU4H 4ISVB 2ZUQC 5L2JB 5ITBL 2LTQB 4JFHE 3TVMB 2IPTL 5DYOB 1OB1A 1NC2B 3S88H 1AKJB 4J3UA 1FZOA 1HXMB 3QWOA 1FORH 3VW3H 3RVWD 4LLVA 4WI2A 1OGTA 3WV0A 5JHLL 1HSBA 1EAPA 1KBGH 3EAKA 1F8TH 3JWDL 4RAVA 4KJYA 5DRZA 3RWHA 3ZHLA 2A9ML 1S7SA 2OSLB 4MNGB 4LVOB 3KPSD 3FB5B 3KR3L 1FVDA 3RX8A 5IOPB 3RZCD 1MUJA 5B38G 3U4BL 3FB7A 2CDGA 1OGAA 1KT2A 3WLBB 4YDLC 2MPAL 4FQIL 2W9LA 1ZS8A 2PR4H 3BN3B 1HKFA 3QNXA 2UWEA 3UBXG 5HYSB 3BP5A 4X7FC 2WM0A 5F3HA 1GL4B 3PNWA 3TNNB 2YUWA 4KPHH 1N5YL 4QHLB 1RD6A 3UDWC 4OZIB 4ZO7A 3VWKA 3DO7B 2DDQH 2MWCA 2FRGP 1S8DA 3CFCH 3G6DL 4PJXB 5DXWA 2EICA 4Z78B 3MRLA 1URLA 1YY8B 1X6LA 1N3NB 4PRIA 2CO7B 1TNNA 2LTQC 3TVMC 4P3DB 1OAQH 4A6YH 4HJJL 4KRPD 5IUSA 2D31B 4UMGA 1G7IA 2W0PA 5DQDL 3MNWB 3NZHH 2Y07L 1PW3A 2PW1B 32C2A 4TVSa 2V2TA 3FO1B 2X7LB 5FYLH 3PJSB 2E7HA 5GIRA 2R23B 2NX5B 1TQBB 2DIJA 4X6FB 5AYUL 1RMFL 3KYAA 1IQWH 1BLNB 3DURB 4GRWH 1Z9LA 4N8VG 4Y5YB 1BF2A 1U92A 2JJSA 1FFPA 3QUZA 4RAHA 3S3JA 4MXVF 2DQEL 4JQIH 1MRDL 1LO0L 4ZFFA 4GO6B 2P5WB 2CMRL 3ET9F 2DTML 4LL9A 4L8DA 4RGND 1OSPH 3BQUD 2CD0A 5DMIH 2DQGH 2VDOH 3QYCA 4PJFA 5IQ7L 4LCWA 4X6EA 3SDYH 3LSOA 1AO7B 3DLQR 3TPKA 4OCSH 3T3PF 1J0KA 5GGTH 3EOTH 4ZO8A 4Y19B 3RNKB 1OARL 1NGZB 3OGCB 1IL1A 2HN7A 1Y0LB 5DVKA 2N1KA 1IQDB 2KUTA 5CJOL 2RIKA 2VZTA 5CGYC 1YPZA 1KB5L 4PJBE 3VGEA 3NBNA 1NJ9A 2CLZA 1EVTC 2D03L 2NZ9D 4G5ZH 4GAYA 3WKML 4EEEA 1FG9C 2IEPA 2H3NA 3MUJA 4LPTA 1KJ2B 2DAVA 1JPGB 2BMKA 3UJTH 4GW1A 2HWZL 1CE1L 4RNRA 1Z9SA 1BFVH 4UUJB 4WFFD 4M8QA 3BUTA 4QHUA 1FN4B 3MRNB 3QDJA 5KS9E 3MV7E 4Y5YC 4F58L 4YE4H 4U1GB 2QHRH 2DBJA 1BZ7B 5FXCH 4AT6A 3QFJD 4L4VA 1IAKB 4AEEA 3GEWB 5ILTL 4PRDA 4PB0H 2XOTA 4GQ9L 5TFSL 2DQDL 4JFDD 1UQSA 3HPLA 1VERA 1PDKA 1XF3A 2ARWA 5GGRA 4Z0XA 5IR1B 4M1DH 4OI8A 1K3ZA 4MNHB 5J06A 3C8KA 4K8RC 2AXFA 1P2CB 1QPXA 1OTUC 1FNEA 1RUKL 3BT2H 4OJFH 4G80B 4EN3A 5FM5O 1ZHLB 3GIVB 5K9QI 1QHOA 2OMNA 4LP5A 4JFPB 3FQTA 1H3XA 2GJ6E 2YPVL 2CLRA 4AIZA 3SOBH 3VFTA 4XVTH 2PUQT 5ACMA 1DBAH 1DDHB 3W81A 4G8FA 3ZSSA 3NCYP 1Z0MA 4MA1C 3MGAA 3CSPA 3BDBA 5E2TL 1SEQH 2Q3ZA 4YHOL 4K3JL 1RHHB 3DX9B 4U1GC 2X42A 4YHNA 5DC9B 1MREL 2H32A 1I8IA 2NY7L 3LEYH 1QOKA 4U0RC 2WQ8A 1QQDB 1TZHA 3SDDC 5ACZA 3BH8B 2CKBL 1L7TH 4NT6A 3S36H 1KUMA 5C70A 3RUGF 4Y1AD 1CL7H 1U91A 4P5MB 1CQKA 3QPXL 4Q9RL 1U3HD 3P30L 3MBXL 2NPLX 3QXTA 5I2IB 2JKXA 3P3YA 5BVPL 3P4NA 2F19L 4OZFH 3F12B 4LLAA 3HNSL 5ITFA 1GGUA 3HUJF 3L6FA 5TE4H 4TNVF 1UKTA 3JV0A 5C8JA 4U6VH 1HDMB 4JO1H 4ODSL 1RPQA 4PJ9D 1GOFA 3RTQD 3EYQD 3MRCA 1EVUA 1N6VA 1O7VA 4L3EE 4TUOA 1SYVA 2R15A 1Z5LA 3PP3H 4JN2A 2OJEB 1QBBA 2SEBA 4KI1A 4Z76A 3DUSA 4XWGH 5ABDE 3TA3A 3K1DA 1XCQB 3L3OA 2BC4B 3VXMA 2W0LA 8CGTA 5IVOA 3GI8L 1AGBB 1UB5A 4Y4KA 1KLUB 1WEJH 4NKOB 4MJ5A 4XI5C 1HCVA 2A9NL 1B4JH 1HNFA 2OJZH 4CJ1A 3MODL 1HEZB 1HI6A 5IFAH 1MY7A 4Y4HC 4NQCB 5CMAB 3GNMH 1IM3B 3OKEA 5C0AD 2NY5L 3QEGH 3OKLB 1T5XA 4WDIB 4ONHB 4O2FB 4U6XA 3CSYA 5E95B 3UYPA 3U2SA 3CVHH 3L3JB 4HZLA 1RZKC 3DGGB 2Z91A 1A7RL 3NN8A 2E7LC 1QG3A 2CUIA 3E2HB 1DUYA 2IH3B 2KBGA 5EU6B 3B6SB 4NO3B 1NAKH 5L2JA 5JOPE 1A0QH 3Q6GL 4QRRE 4YHML 4J6RL 1KB5B 3ARDB 5DYOA 4G6MH 1N0LA 4WHCA 1QA9B 5DC4B 3OR6B 3WNOA 3MUHL 1FNSH 5HHVH 3S4SB 2LAGB 2ZOLB 3K80A 4WNQB 4KZDL 3VFOB 1EIBA 1KCLA 3C6LA 4FP8L 3GSNL 4HWEH 2VYRE 1IM9B 2D9QB 4GBXC 2LAAA 2X4QB 1YMME 2OSLA 4MNGA 4M93C 5E8OB 1KJMB 2WBJC 3FB5A 4BK5A 2FX9H 4ZOBA 1J8HE 4HIHB 5F1NB 2R8SH 1BPVA 4FQ1H 1LDPL 4TRPH 3WLBA 4DAGH 1JPTL 4LVNB 5CEZD 1FFRA 5DUML 1CGSL 4F57L 3M45A 5DEFB 5HYSA 1O5DT 2K9UA 5BCAA 1P53A 2X4NB 3TNNA 5CSGA 5DRXA 2Z31B 5C0GB 5JNYB 2B1HL 3W0WD 2QADB 5D7JC 2X1WL 5FHBH 3DO7A 4PJXA 3E2HC 5CGMA 2NY1D 4P3CH 5IGXL 1YY8A 3BWAA 5GS1C 4P3DA 5SWSA 1I3GL 4N0UE 3HTLX 3T0WA 3ROOB 1T6WA 4KK9D 3MTRA 4P23D 5E2VL 3W0WA 1E4KC 4QWWC 2D31A 2JTDA 3GIZL 3KXFD 3CH1B 2P5ED 3CFKB 3IXAB 4M43H 1I9IL 3MROA 4M7ZC 1T1XB 2PW1A 2YN5A 2HP4A 5E03A 4P23A 2P7TA 2B4CC 3QDAA 4YH6A 1MCSA 4R7NB 4OF6A 1S78C 3GI9H 3K8LA 3PJSA 5FYJD 5JHDD 2DI7A 3VGAC 4YC2C 2R23A 2NX5A 4X6FA 1ITCA 1QFWL 2AERT 1BLNA 5F8QC 4HS6B 1IGTB 3CJJA 1MCHA 4LVNC 5ALCH 2FYYA 1B0RA 1NFKA 5BZWA 4NKMB 4O58L 1IC7H 3LKNB 4JZNB 4TYUA 5KSUA 4FZEH 5MI0B 1WAAA 4LPWA 3VXOA 2NYYD 3SEPA 4P5TB 5IVNA 2E9WA 4X6DF 2P48B 1PQZB 2DLGA 1MLBA 2P5WA 1SBSH 2Z31C 2DWEB 3RWJA 4ZS6D 4L8SA 4D94A 3QSKB 2QADC 2MKLC 2J4WH 3O6KL 1AO7A 2NY3B 4NPYB 4Y19A 3V0VB 3RNKA 1BWWA 1Y0LA 3HC3H 3WL9A 2RCSH 4MD0B 4HKBB 3WDHA 3QH3B 1OTSC 1IQDA 4NCDA 5CKAA 4OZ4B 2ZP0T 4PGJA 2Q6WB 2F5AH 3NACH 1VB9A 3OB0H 4XVUC 3QJHA 3U7WH 4WHYH 2NW3A 4ZTOL 4E0RB 1JPGA 1WBYB 2J5LB 4IRJB 5K9KA 1Q38A 4XBEH 2QV2A 2WMPA 4OTXL 3DMMD 3BSZL 3GMRB 5DJCB 1KB9J 1MSPA 3Q0HA 4UUJA 5EU5B 1NUGA 5D2NE 4DVRH 5I74C 5L8KB 2BOBB 3JUZA 5CCKH 1U8IB 4R26L 1GVIA 1BZ7A 1EH9A 5BV7C 3C9NB 2VAAB 1E6OL 1IAKA 1BD2E 4P2CG 5C2BH 4P5TC 4Z7QF 4DN4H 3VGDA 5F7FA 3ZHDA 4KTEL 4H8WC 1WIOA 4M00A 5IR1A 3D69B 3DXAD 2PW2A 1NBVL 5E6ID 3UTTB 1JNLH 3ARBD 3I84A 5IBTL 3ZDXF 4P4KB 4XCYB 2XFXB 2X9YA 3T1FB 1P2CA 3GSNB 2R0KL 4JFED 4M6NL 3O2VH 4PBVC 2CDEA 4G80A 1I1AB 4EBQL 3UAJD 3DI3B 3GIVA 5F72S 1FE8L 1XIWD 1IGIH 1MI5E 1ZLVK 2HFFB 2QQNH 1RJYA 1IGYB 1N4XH 3W5NA 1AJ7H 4G42B 5B38B 3ZKSD 1QSFD 3HLAB 2WV3A 2J5LC 1JN6B 1DDHA 1HQRB 1NLBL 1XIWA 2PO6B 1PVHA 4IRJC 1DQLL 2ZCKL 1NBYB 1XF4B 2UZXB 5CZVH 4ZXBB 4QEGA 5FGRA 1BBJA 2CKNA 1RHHA 3DX9A 1WFTA 2A6KB 2DKMA 4KUZH 3UBXB 1FL5B 5LGHL 1UCBH 1MJJB 3P9LA 5LWYH 3BH8A 2J1KA 2BRRL 4R2GC 3D2UB 4L9LA 1R3IH 1AFVL 5MEPA 1HILB 4U7KA 5DD5H 4P5MA 2FLRT 2FEEL 1NLDL 1FZJA 3UBXI 4XP6H 4IRZH 5I2IA 1IGCH 4F80A 3LOWA 3M1BA 1LO3H 3LIZL 5DJ6A 3VRJB 1F11B 4NUGL 1K4DB 5DUPH 3RAJH 3C6SB 3FFCE 1UXSB 4AG4L 2NR6C 4WW2B 3MUZ1 2QQLL 1FZMB 2EXWC 2ED9A 3MRBA 5KVDH 3MV8E 2OJEA