3OF6A

Human pre-t cell receptor crystal structure
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T cell receptor beta chain
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6A02
1AGFB 3MNZB 1WC7B 1R5WB 4PJCB 5E6IA 1L6XA 4W4NA 1KB9K 2W92A 3CC5B 3T4AA 3GUTA 1NMCB 3ARTA 4M1CD 1QBLL 4Y5VA 1Q8MA 3OL2A 2BNRE 3QUKA 1N0LA 2BY1A 5ICYB 1S7WB 2R39A 4AEHL 3BZDA 4OZFB 4NUJA 1I7TB 3ZKNC 4PBWD 2ZG1A 5T33L 3QIUB 2BVUA 2HP4A 3KPRD 2FB4H 4EVNA 3QA3A 1ZLUK 4NJ9L 3GBMH 5BZDA 1BZ9B 1GRWA 3BKJL 4M7JH 5FK9A 4WY7H 3TP4A 5HSFA 1Q9OA 5KSUA 1EHNA 2L7JA 3BFOA 2CDFA 1DR9A 1SJXA 3SDXA 4L3AA 5GGRY 5FO7B 3TO2B 3AS0A 1KLUB 2FRGP 3REVB 2V9RA 2GTZB 1OL0A 5JLZA 3C2AH 5LBSL 3LN4A 2EXWD 3X12A 4DGIL 1RD6A 3PDDA 2JJSA 1MFAL 2CR3A 3P0YL 2IAMC 4OT1H 5D7JB 1HZHL 4K94L 3QDGA 4IRJC 4JFHE 2V17H 4I48A 4HKBA 5EU5B 4CADA 3IDXH 1CTNA 3DYMA 3TNMB 2H3NB 1T1ZA 2RIKA 1MREH 1K8IB 2LABA 5CKAA 2R4RL 3QXDA 2MSPA 1UWGL 3WJLC 3HCVB 1RUMH 1MCPL 5HI3C 1HCVA 3KPSE 2UY6A 4CNIB 1A4KB 3EGSB 4HF5H 1T7VA 3DIFB 2P1YA 2VDLL 4OLVL 4XNMA 1N5AA 4LLVB 1P9MA 3V2AR 4JO1H 3EZJB 1NC2A 5IHLB 3L1OL 1UZ8A 3VXRE 3TNMA 4I0KA 2A6JA 1J1OL 4YBLC 2VKWA 3CVHB 2VB5A 3O8XA 3NZ8B 4TSCH 3SKUD 3OHXB 4KUCD 4GKSA 5DK0A 1INEL 4MAYB 5HYSA 1PJ9A 4GLRH 5IJKA 3GRWA 1NGQH 3BD3A 1AC6A 5GS0D 4FNLH 4RX4A 3BP7A 3ELAT 4KMTH 4JZOB 4KKLD 1H3WM 1IM9B 1LNUB 2PXYB 2QLVB 1D6VL 3QI9A 2BVEA 5E99H 4PJBF 5E6ZA 3D85A 3QJFA 4MNGA 1R5WA 3L7FA 4PJCA 4LARH 1IFHH 2GJZA 1ZLVK 3WS6A 3SKMA 1RJYB 2I24N 2DLGA 3MXWH 2HT3C 3GMLA 3FT4A 4OZGE 4C4KT 4ZPTB 3EYQD 3VDAA 1JRHL 1H0DB 2GJ6D 1OAUH 4ZFZB 1JMZA 4OFVA 5ID1A 1RZ8A 1JNJA 4OBSA 4P3DB 2Y6SC 4ELKA 5JQ6L 4XPHL 2X1XR 5ALCH 1A9BA 1WIPA 1ZHBA 3PWJA 4OZFA 5ESVA 3S34H 1AI1H 3TPUA 1TLKA 2EYTB 4AEFA 5JW4R 2BZDA 3HN3A 4ZFGH 3UC0H 1UZ6F 2PW2A 1NC4A 3HI5H 4R8WL 4GSDH 4XH2A 1W0WB 1G7QB 4DKAA 5EN2B 1C7SA 3U0PA 1I3RA 1RULH 4Q0XH 1OAXH 5DFVC 4LNVA 3X11B 2IH1A 1YEJH 5C3TA 3HG1E 4R4BA 4M48H 5IB3A 2BNUB 4Z77B 3NZHH 5J1AB 3M45A 4ZPTA 5GGRA 3GO1L 2QADC 4OZIE 3BE1L 5CJQH 2NLJB 4Q58C 1WV7T 4K8RL 3TVMB 1YEKH 3PIQB 1HH9A 1NGPH 4JY4A 2VITB 2D3VA 1CFNA 4XWGH 1WTLA 2PYED 4KUZL 1KTDA 5IGXH 2IANE 1I9RH 4YFDB 4LPYA 2VISB 1JP5A 2I60L 4Q9CA 4HIHB 3WD5L 5DK2A 2DD8L 4NKDA 3QEUA 4HWEL 5FGCE 1CFSA 2B39A 3VG9C 1BFTA 4NUGH 2IPTL 4YE4H 2A6IA 5HGAA 4Z76A 2GEEA 5F6HJ 5D6CA 2X4PB 1XF1A 4JFYA 2RFXA 3VXUA 2OR9L 2Q76A 2UYLB 3G9AB 4HWZA 4XP6H 3TN0D 1RK1A 3FT3B 2P24A 3TA3A 2DI8A 1BOGB 4NSKB 5F1NA 4M7LT 5DJ8A 3BH9A 3G08A 3S5LA 4X80L 4MLIA 1J8KA 4KKBC 1NC2B 2XPGB 5K9KB 1XGQA 1PBYA 2YA2A 4GS7C 5I74B 3UTOA 4TNWF 1DBML 3N50A 3QEQD 2R1WB 1MCWM 2EIEA 3L3DA 4OGAC 3ULVC 3D9AH 1CDHA 5DQJA 4N8VB 1FCCA 4GXUM 5I8EB 3Q5OA 1YY9D 2A0LC 4HAGA 4MVBC 1VADA 3MODL 3T0AA 4X6DE 2NX5E 1TNMA 1A6AB 3RZCC 5GGSY 1ZOXA 3CFIC 4KVNH 5ACLA 1RIVH 1H5BA 3RL2B 3QNYB 5F93C 43CAB 1AP2B 4Q9QH 1GPOL 4KY1H 3V6ZA 1NCCL 4M93B 3DVGA 3VE0B 4RFNB 1Q9WA 2DQJH 5FA3A 2F53A 3S34L 4PJ5B 2EC8A 3M07A 3FT4B 1T6WA 2X10A 1F6AB 4KDWA 4JDZA 2WLYA 3HR5A 2P5EE 1JRHH 1KB9J 2P24B 3TA3B 2A0LD 4HKXB 4LHUA 5HHPB 5C0RL 5KSUB 1INDL 1TVHA 1NGQL 2G75B 4JVPA 4PR5B 3WFDL 2A77L 3TBYB 1CIDA 2ADFH 4P9ML 2OR9H 3RDTA 3VFWA 1MH5A 3CUPA 4NKDB 3D25B 4XNUL 1P1ZB 4AG4L 5HYSB 1D6EA 1MIEL 5ICYA 4OFKA 3L1OH 4WCYH 2HLAA 3IFPB 4PS4H 1HILA 4HIJA 3TVMA 4P23A 1L0QA 4TPRL 1OAKH 4RRPA 2XWTB 2I26N 3MMEA 5D96C 2CO6B 3TVMC 3UTQA 4M6ML 2PXYD 4BK4A 1NFKA 3HFMH 4YPGA 4PY7A 1U95A 3BH8B 2WNGA 2APFA 2V5YA 1XFPA 2XTJD 2EKSB 4GXUN 5CFHA 5INDA 2ZOLB 4ZFGL 1SJHA 2NY7H 4UU9A 2BC4B 3IDMA 5GGTH 5BQ7A 3VFSB 4OGYH 5BXFA 2RGSA 3MV8B 1A6UH 4YFLI 4NFDA 4XAWH 2P8LB 3T0VA 1SBSH 3WNKA 1OPGH 2FX7H 4OLXH 5JXAH 4X4XB 3RUGA 1C7TA 1QSEE 2EYTA 5KW9L 1EXUA 1G84A 1ZLVH 1TENA 3N9GH 1CFTB 2B2XH 4PJEA 3MBEA 5EU6B 3MRNB 1MH5B 3G6JA 5GS3A 2BNRD 1TFHA 2CKNA 4JLRA 2FD6L 4XCFH 1UWXK 4Y5YC 1T5XA 4L4TD 4LSTL 3FO9B 1MJ8H 1DQJA 2CDGB 1FRGH 1RK0A 1QRNB 4IM8A 1MCKA 2R29L 3T0EA 3QIBC 4LLWB 4MJ5A 1FL5B 3MRKA 2H6PB 3TBTA 4BQ6A 2NY1D 2JK5B 4FABL 2IALA 5E9DB 4OZFH 2XZZA 4ZFOA 5ETUB 3DX9A 5TDNA 1BVKB 1U92A 5F71A 4JZNA 1TXKA 2OSLB 1T0NA 3RPIB 1E27A 3L95A 3G6JF 3V8OA 1FFNA 4XMPH 1HK6A 5J6HB 4EI6B 1I1YB 4U6VL 4YHIA 2E6PA 1BVLB 4N0UB 3V5KB 4YHML 3FB6A 5IVXA 2ERJC 4H8WL 4TSBH 3R06A 3TLRA 3KYNB 1CDCA 1CGSH 5DRNA 2H1PH 3FQTA 3ARGC 2VZTA 2P8LA 3LHPL 1G7IA 4X99B 1SJEA 4XCEB 4MZ2A 5I8CB 4U6TA 4KZEL 3QUMH 1NDGA 2OZ4A 2EDFA 4TUKL 2DTMH 4UINL 1OCWL 3MRFB 5IV2B 5C07B 1JGVH 2R69H 1S9VA 1YEIL 2BNQB 5GSRB 4PLKD 3H3PL 5K9KA 4E9LA 4ZUWA 2PTVA 2FIKA 5SWZE 1F4AA 2VDLH 3GHBH 1X5XA 4WIQA 3TN0A 3V5DB 4HDIA 2C1PB 2J8UB 1R3IL 1I8KB 4PUBL 1HSAB 1UWGH 2QQLH 5KTEL 4NHUB 3QXVA 3MJ6A 3BKCL 4G8GD 3QCVH 4X4XA 2FL5B 3HE6C 5C09B 1IQDA 3AU1A 3WLWC 4F37F 2UWEA 3PHSA 3Q48A 3QUXD 2AK4A 1MIML 4NCC2 3TBVB 3MV9E 4K7PH 3DPBA 3WBDA 3CSYA 1FZMB 1R3LA 3QUZC 3OAUH 2RCSH 4QRPA 4P2CG 1F3DJ 2Q8AH 2PYEA 5MEQA 5BVPL 3NFPB 2EZ0C 4OT1L 3C6LA 4DVRL 3QUZA 2GTWA 3VRJB 4OAWA 2QQKH 4ETQA 3A0OA 2OL3H 2CRZA 2YR3A 1OTTC 2DM3A 3X14B 4TTDC 1UB6A 1U3HB 4OGXH 3V6ZB 2NY1B 4HG4K 2PF6A 3HPLB 4I77L 1CGYA 4EN3B 2DKUA 4QHUA 3CSYB 3DX6A 3RL2A 3V52H 1J5OL 5EDXA 3WJJA 2C3WA 3UDWA 2DRUA 4XPHH 5D1XD 4AT6B 2H2PD 5D1QD 4JHBA 3J7HA 2GY5A 3SE8L 1Q9KB 4DEPB 1ZA6A 5I1GH 3PWJB 3TPUB 4Y19B 3PWPA 3ARFB 4I0PC 3DMMA 5KS9B 4DZ8A 2I9TA 4BK5A 3JV0A 2WBJC 2UWEB 4JEGB 3IFOA 3P9MB 4GAYA 3F8UB 3RVUC 1XGQB 1G7PB 4XX1G 3BGAA 1L0XA 1ADQL 2BNQA 1ONQB 1M6OA 5I2IB 4Z8FL 3UTZA 3QWRA 1ADQA 3CFEA 3QAZC 5I1AB 4A6YH 1NFDB 4ERSL 2XQBH 5J12C 1RUQL 1MPAH 4G9FE 5D6CB 3BP6A 3RKDD 4MJ6B 5T3ZE 1I7UA 4LSSL 1FG2B 4ZNEE 2HT2C 3DVFA 4XNQA 3CDFA 4NN7C 1S7VB 5TPWL 5J11C 2QQKL 4R96B 3S96B 3EYUH 2WMPA 1PSKL 1XIWA 5IMMA 3D2UB 5CWSB 2X4TA 1XF5B 3MUGA 2VXVH 4J3XA 4XPAL 4ZS6C 3RU8H 2FYYB 5FOJA 1BWWA 4MQ7A 4RSVA 5DD6B 1RMFH 3KXFB 1P4BH 2GTWB 3RWGB 1KIQA 1QFWM 3GZKA 4OFIA 1BLNB 1FL5A 3GSOB 4XT1C 1JUFA 3VH8A 5C1MB 3ULSA 3QEGL 3P0GB 4KPHH 1FFQA 1I85A 4YDJA 2R2EB 5DVMA 1UJ3B 4QHNA 5GRZA 1P7QB 4X5XB 1FO0B 4Y89A 2BSTA 1G9NH 5DD3L 3UAJD 5D71H 2K1MA 4UT9H 3PGDA 1U3ZA 4QRQB 2EE2A 3MGTB 3V4VH 3X13B 5JQHC 2R0LH 5F6IB 1GGUA 2J2ZA 2VH5L 1LO5B 5IBLC 3P4LA 1YEIH 1GGTA 1FC2D 4UIKL 3BT2L 3EFDL 3MBEB 5EU6A 4AZ8A 2ZNXA 1YN6A 1KIPB 3VXOA 1OSPH 2WUCH 3S7GA 5JDJA 4FTVD 4PY8I 2PUQT 1RJYA 3MUZ1 4U1JA 5IR1B 1FNGB 1NBYA 3EOTL 4LSSH 4FMKA 4YEFA 1QLRB 5IB5B 4P57B 4BZ2H 4H88H 1A7OH 4V1DB 3KJ6H 1SJEB 3DUUA 2Z8RA 4RMRA 5IW6B 1TVDA 5TGBB 1G7IB 1UA6L 4DN3L 1JPST 3RNKB 2A83B 4UV7L 4TULH 1RZFH 1I3GH 4DVBB 1ADQH 1CFBA 2EC9T 3QHZL 3RGVA 3P73B 5LVEA 4ZTOH 1MFEH 1ES0A 5E95B 3OMZA 4R0LC 3SKJH 3LEYH 2IAND 4FFZH 2DOCA 2PW1B 4LCCC 5K59F 3FQRA 4ZS6D 2P7TA 2XWBB 2NY4C 5A16A 5CJXA 3KR3H 2DQEH 5C09D 1JHKL 3T04D 1UACH 3D0VA 2HMID 1KTLA 3GSRA 3MV7E 4FRWA 4LLYA 4YGVA 4NO0D 3NFPA 1FO0L 3L7FB 4XCCL 1Q1JL 5KANG 5CHNB 4KY1L 2HRPL 4UV4H 4F7CB 5I9QB 1QTYT 2R2BA 2VN7A 4ZO6A 2WIIA 2RCSL 3FN9A 3MNVA 3QUMB 2W0PA 4LVOC 4PLJC 1OLLA 4OFYA 4DZBA 1J0ZA 3BP4B 3E1F1 4JDVB 1MCHA 2R0ZL 4OGYL 3S88H 3H42H 5JIHA 5J11B 1YQVL 5C70A 4QGYA 3VRLF 2JJWA 5DI8B 5ICXA 4WO4C 3WIIH 3DROA 3EOTH 4M62H 1HXYA 1Z9OA 3IDJB 4HMCA 3AAZB 4M7KH 5EPMB 4R97C 3MR9B 5BO1L 3U30C 2NX5D 5J1SC 1ZE3C 1OOAA 3ROLB 1D5BB 3BWAB 4RWHA 2V2TA 2R2EA 4GS7B 1RHHB 2QHRH 5SWZB 1ZT7A 4HHAA 4FFYL 5DC0A 2B4CH 3TJEL 1MEXL 1T7WA 3HZYB 2DKSA 2KUTA 2Z4QB 3NABL 3O6MH 1JNNH 2B20A 3VMOA 5D2LB 4XPTH 4UINH 3QHFL 3L5IA 4PG2A 5E2JA 3IVKB 4YDVB 1S3KH 4BH8A 3FQTB 5HHMB 4P2QA 4QRRA 1OARL 2I9LA 3KLAB 5FGCB 4R26L 2W59A 3TO4B 2JIXA 2CR6A 5KN5A 2H8PA 2B7DT 2WBWB 2WW8A 5IB5A 4Z76B 2NY3C 1MHPL 4X4ZA 3O9WC 4QXWA 3T0EB 5DMIH 1AO7E 3MRHA 4NO3B 1FL6A 2OX5A 1VFMA 4GMTL 3QHTC 2JCCA 2NY5L 4PJAA 1VEMA 3PWVB 1DQQA 4H25B 4JQIH 2QQQA 3O6LH 3LS4L 4XP4L 3UYRH 5CEZL 4DN4H 2YA1A 4JM4H 4BQCA 1IEAB 2VYRE 3BZ4B 3IYLW 3T77A 4XBPA 3SQBA 2VC2L 3UC0L 4XPFL 4R0LA 3C5ZA 3BD5A 4WU7A 2J1KA 4LOUD 1QBBA 1PY9A 3H7BB 2YD6A 4OUUB 4Y5VB 1BQLL 1U8PA 4QXGL 3K8LA 1IGYA 4RCAA 4CN4A 3KJ4C 4M4PA 1W0VA 5DS8A 3ZDZF 3JTSB 5K9QI 5I8EA 5B3NA 5BCAA 1P7QA 5E8DH 3D39A 4NZJA 2VDMH 1CXKA 2DLEA 2WWMC 4I3RL 4PGDA 1WAAF 4XH2B 4ZQKB 1CBVH 1UB6B 1GZPA 2D0HA 3HZMB 1MCBA 3LEXA 2X9YA 5FB8A 3LH2L 4OZHB 3WIHH 4IDJL 3PDOA 3PHQA 2XZCL 4XBPB 3SDCB 4N8CL 1FG9C 4GG8A 3V0VA 3OX8B 3BAEL 3T3ME 4ZAKB 1CDYA 2YEZB 5FDWB 1KCUL 4JFYB 5DDHB 2XN9A 4HFUL 5MENA 2IAMB 4CN1A 3BESR 1A6ZB 4JZJB 3SKMB 3K7UA 2NCMA 1J8HE 5FYLD 3BX7C 3NIFE 2HLFC 4PYGA 4X5WA 3MROB 3LVEA 4N1EA 4JPIB 4NCC1 3KPPA 3DO7B 1OGTB 3ZT5A 1Q0YL 4IJ3B 3SBWC 5D5MF 2ZSWA 3OKLA 1LEKA 1Z5LB 2B4CL 3UTZB 4IS6B 3EYFB 1KG0B 3FZUC 2AJZB 3QIWB 3BUYA 1OF2A 5FO9B 4LCYA 2DD8H 1P2CA 2HJKB 3QUYB 4H1LG 3VWJB 4BELD 4DCQB 4I2XB 1AXTH 1X5HA 2PO6A 4U1GC 5CJOL 2FB4L 1G6VK 3SDXF 3U0PB 4JB9L 4WFFD 1J7VR 2W65A 3T3MF 5E03A 4WGVB 3TYGH 5HVGB 4RGNE 4HIIB 5EU6D 1UFUA 3D18B 1A7RH 2I07B 5D7IB 4O58H 2OLDA 2B0SH 4NP4L 4L9DA 1KPVB 4YHLH 2JJVA 4H0HB 3QZWG 4OF5A 2DDQH 4QF1A 1GZQB 5AZ2L 4DUXA 3IDJA 4UT6L 2GSGB 3ARDC 5DA4A 5MEPB 5J6HA 3ZYOA 1OF2B 3SDDC 4P99A 4FQPA 1A4JA 2BVQA 3LEVL 3HA0A 2F9BT 2PYEB 5MEQB 3Q0HA 2IJ0C 1SYSA 4YIQA 4WHYG 5ADOL 1IAOB 3BIKA 1QRNA 4KGLA 1MRCH 1WEJH 5MI0C 5MI0B 4PJ7F 4WTZA 3MBXL 2FCBA 4NGHL 3MLYL 5E0QA 4JZOA 3HRZB 3HS0B 1BD2B 4ESKA 1SYVA 4KC3B 3QEQA 5CBAB 5ERWB 1NJ9A 5DJ6B 5T1LB 5HPMB 3FQNA 1EXUB 2KQMA 15C8L 2EDJA 3EHBD 3MRDB 1U58A 4FNLL 5H2BA 5F7HA 1N6QH 2KZ1B 5EO9B 3AB0C 3ARRA 1G9MC 2BRRH 4OM1H 3HPJB 1MUJA 1AQKL 3NCCB 5ISZB 5GZOD 1RULL 2FEDD 4M8QA 1K9TA 1Z3GL 1BBJA 3HI6L 3MV9B 2Y06L 4H0GA 5F9JA 4WVRA 4PG9A 4YXKH 2GYSA 1KIPA 1VB9A 5MERB 3CVIL 2EDBA 3O9WB 4RFNC 5C6TH 2DWDB 3LAFA 2VXUH 3ZDYF 4WO4A 1NUFA 5JW3L 1X5IA 5CAYB 2IQAB 1CXHA 3PDGA 3O6FC 1MEXH 3QIUD 3KNBA 1YEGL 5EOCJ 3QCTH 4J1UB 4M6MH 1BIHA 3BKYL 4EDXB 1CLZH 4L3ED 1G1CA 5J7CC 3RIAK 2D03L 5GS1A 4XCYB 3SDXE 1T0NB 2X4OA 4NQDA 3S9DB 5LG1A 1JPGB 4U1HB 2VXTH 4DW2L 3ULUL 4EZMA 2EH8L 2JIXB 3QIBB 4G8IA 5AUMB 2GJZB 2R0LL 1FGNL 5CCKL 5GS0H 2QL1A 3O4LB 4WV1B 1QSFD 4XB8A 2IPKA 3VFVA 1QFUL 4FQQA 5D2NE 1GGYA 2DKMA 5E2VL 3MV7D 1NCAH 1FLTX 4OM0H 4BUHA 5TJWK 1KCKA 3VXSE 4LVOB 4UV4L 4HX1A 3KPLA 1EVTC 5KVFH 4K55A 1A3LH 2XTLA 4YBHA 2F54B 4BZ2L 3T1WA 1P4IH 4N8CH 3DV6A 4DFIA 3BRDA 1OAUL 3LKRA 4RGMC 1D9KC 5F7UA 3IB4A 5EZLA 2LQRA 4QOKD 4TULL 5INDB 1NFDA 2WV3A 5DK3A 1KCSH 1TETH 3GI8H 3VXRA 5J0BA 4XPFH 1ZANH 4Y5VC 3S35H 5I8OH 3RVWC 1EHLH 1NEUA 1YZZA 1AIFB 3SKJL 4M8QB 1I7UB 1YUHA 3MJ7A 3LKPA 4MQXC 3VFMA 4R90H 4XP5H 1G6RL 3ROLA 3DI3B 4N0CC 4QRUA 1NPUA 5T1KB 3B9DA 4L4VE 1DUYB 1JHKH 4G8FA 4U1SB 1X7QA 4Y19E 5BRZE 3S36X 2KDGA 3VI4F 2A74A 2VERN 1CF8H 1DBKL 5I2IA 1MFBH 1EVUA 5E2UH 2EIBA 4M1DH 1LO0L 2BDNL 1RU9H 4NJAL 4PJCE 3CUPB 5FHAH 4CGTA 1Z9LA 4ZXBA 4XWGL 2X70A 5EO1A 4PRHB 3KDMA 4OCYL 2OJEB 5EG6C 3NTCL 4NQCE 3CAFA 4K94C 5AWNL 5D7SL 5HHPA 3W5NA 5JW3H 4OFPA 3CFBB 1OAQH 1X44A 1FLRL 3WFHA 1Q9OB 3MCKA 1BBDH 4KJQD 3SE8H 4ODWB 1L0YA 3OBAA 2O26U 1MFCH 4EN3A 2AXHA 2Y6SD 1WJ3A 1QLEH 5DVOA 3JV5A 5FIEA 2HJLA 3I6GB 2ADGB 3QDJA 1GOGA 1J5OH 1I7RA 1MHCB 3MLSH 4RMVA 1T7XA 3ARZA 5DHYB 4ETQB 5EOTA 3HZVB 3LKQB 5J13C 1ZEAL 1PG7L 2VDKL 1A7QH 2FJGA 3MXVH 1X5AA 3PJSB 2P8PA 5E4EC 4P3WA 4YHPB 1JHLH 4NNXB 4NDMB 5DEGB 3UTSE 3G5YA 2CDEB 4R0LB 4F37K 2AEIT 4PJHB 1F00I 1I8KA 1G9EA 4J2XA 5SWSE 3BEVB 2LTQB 3U48A 2HTKC 4EUPB 1LO5A 2QR0B 5LGJA 2FL5A 4MA7L 4HZLB 3BDBA 4M1GH 4ZYKB 5IBLD 1ZSDB 4ODVL 5EC2A 3IF1A 2H32B 1KBGH 5FKPA 1BQLH 2EXYC 3MLVL 3FOLA 5FHAL 4QRTA 1JHTA 3FT3A 1C5DA 1HKLL 3ARDB 4AENB 5CZVL 1MRFL 4O9HL 1M7IA 4UT7L 1HQ4B 3SO3B 4HJGA 5J12B 5C0AD 5HHMD 4GRMB 4XWOD 2X4RA 3OKMA 5SX5H 1GGIL 4KDTA 5FCUH 4AEIL 4LDOB 2FBJH 2HJFA 4XC1H 4JQIL 4Q9BA 3V79C 4MNQD 1JGLH 2XN9B 4M6OL 5ANMA 4UDTA 4WW1B 1RZ7L 2DS4A 4KRPC 1MAJA 5CJBA 4LSQL 2F74B 4YR6A 1CN4A 5IQ9B 2DMBA 5BV7H 5DUBB 4P46A 3ULUF 2H45A 5FB8B 1YEEL 2AJSL 3V7MA 3HZYA 2X4TB 1F90L 4YUEL 2WM0A 2ITCB 1BGXL 2FH6A 5I6XB 2YPLD 1T1XA 3L3OB 3SCMA 2HG5B 3CK0H 4IBLT 3BWUC 5E24E 4KJWC 1DQMH 3QIBA 2GSIB 1OGAD 1WFNA 2F53E 4HUXB 2CLVA 2A1WH 2VAAA 3L3GB 3ARPA 3OR7B 3HAEA 2VJXA 1FYTA 1MLBB 3B5GA 3BZFB 3O4OB 5D6DC 5I66A 1W2KT 4LPUA 1J87A 5IEKA 1EMTL 4PJFF 4EIGB 4XHQA 3AS1A 2VWEE 3DYOA 4LLDB 1CE6A 5JW5A 1IM3B 3CFJB 4NO3A 3CLEL 3UEZA 1X6NA 5T3XL 1TZIB 5E08H 2BSRB 4HPYH 2HTLC 1NEZG 2YKLL 1D9KB 2Q8AL 4XX1E 1PEZA 2XWTA 3UZQA 1NLBH 3K81A 3UPAA 5J06A 1BM3L 2EE9A 1NLDH 4ZTPH 3BKML 1J1XL 3EO9L 4PP1D 4QNPF 5A16B 1U42A 1ZHLB 4IJ3C 3EYVB 4G6FB 4KZEH 3H9HA 3PGCB 4C56B 5HYEA 4I18A 3EJYC 2OM5A 3LD8B 4CU6A 2C3HA 4UDUA 1N8ZA 4CVZA 1DE4A 4OFDA 3L5XL 3T65B 4DAGH 4Y5XA 1XGUA 4ODSL 3T1FA 1A1OB 3QEGH 4MD4B 4WGWB 4XVUD 1T7YA 2CJUH 4PTTB 3U9PL 1XT5A 5DFWH 5D9SA 2HTKD 4H1LA 3EUUA 3RWEA 4Y2DB 4XRCB 1R3IH 3T4AB 4UMGA 5DD1L 4MCYB 2E9IA 1SEQL 1ODAA 3OAZH 1CGWA 1OW0C 4WU5B 1ZHNA 5BRZD 1XF2A 3GMPA 3EFFA 5IHBA 4LSPH 5CZVH 1AHWB 2C3VB 4YZFE 4PJBA 4NT6B 1ZA3B 4PJ5A 1CFVH 4PJEE 3TBWB 4OGXL 5B38B 1R0AH 2Q7YA 3UCRA 4M02A 3K2MC 5DI8A 2ORBL 5ICXB 1RVFH 3GJEA 3V6FA 4KMLB 1RZKL 2A73B 2JF1A 4NHUA 5JO5A 3PUCA 1NGYA 4F33A 4P0DA 5F1SA 5GRJL 3V7AE 4EXPX 5TE6H 2NR6D 4JQVC 3QIUC 2NY2B 1I4FA 4ODVH 3MLUH 1F4YH 1CI5A 5C7XL 3B43A 2MWCA 4N8VA 3AS2A 3H0TA 4ZSOB 4DKFH 3OR6B 4QRQA 3FB7A 3FCTA 5DRZB 5IKCB 2ITCA 4HFWB 3HC4L 1OAZL 5GGTA 1UENA 1RU9L 4NJAH 3E6FB 2HG5A 1PSKH 3AB0B 1JZ8A 4KFZC 3CPLB 1LE5B 3VJ6A 3QWOA 3O11B 5BZDB 1L7TL 3FTGB 1VENA 4PIRF 5HHME 4NRYB 1V3JA 4Z9KB 3CK0L 4WUUE 3H6JA 3N1PC 2D03H 4XXCA 5I6XC 1T80A 3L95B 4G42B 2XPGA 5HHOD 4NZTL 1KF9B 3CDGA 4CVXB 2YWZA 5JPNB 3FFCB 2R4SH 3VD5A 4KRMB 3ES6B 5D7LA 1NL0H 1LDPH 3GMQA 2H26A 3QRFM 3GMNB 1WK0A 2EEDA 4DKEL 2X4OB 3OAYH 4NQDB 4JFFA 4MAYD 2ZCLL 4PJGF 5FO8B 5DRXB 1DBBH 2R0ZH 4YO0A 3MQIA 4HGWB 4HGMA 5KVFL 3R1GL 4GKZA 3SDDB 1ZANL 4WFEE 1P84K 3B2VH 4Z7WB 4MQTB 5L0QB 1BFOB 3TV3H 1CL7L 4FQ2L 5K33A 1BD2E 5JIIA 4LSQH 5FF6B 1B4RA 2V6HA 4GG8B 4ORGA 3V0VB 5DGQA 2ZNWA 3IDMB 1CFTA 2VDRH 5BS0E 1FGNH 2PETA 1CDUA 5DVKA 1YEEH 2ATKB 2Q8BL 1IARB 2PR4L 3TYFB 4XC3L 2N56A 1G6RH 3RKPA 1AQDA 4O02L 3TWCH 4W70A 2CUHA 3ARVA 3D85D 4QY8B 4U7MA 4HJ0D 2P46B 1CBVL 3MODH 1IGFH 1VPOL 4UAOC 3UBXG 2YMXH 4O51A 1DANT 5M7QA 3GB7B 4RDQF 5DO2D 4Q0XL 1IFHL 3QUXA 4R6UA 1UM5H 2XNAA 4YHKH 3JUZA 5CSBA 5IFAH 2W9EL 5I1KH 3LPGA 1TJIH 3G04A 3PL6A 3E8UH 4HBCL 4OCRL 4IOSD 4PGEB 3VXMA 3FRUB 3GMLB 3RGHA 4JZJC 1WWAX 1DBJH 3WS6C 5ALBL 5TF0A 5IBUG 3UJJL 1U8NA 2VDKH 2YPKA 3K8KA 1HHJB 2GI7A 5A2LH 3VH8G 2D9CA 5IB1B 1IKNC 3GKWH 2J8UF 1B4JL 1RHFA 2FHCA 2V5MA 2X70B 4APQA 4IMKA 1R24A 4KUCF 3MLPA 4O2CB 1I9EA 3RVXC 3FT2B 4M5ZH 3DXAA 5D5MB 3TBSA 3JWOC 1KJ2L 4GKSB 4YK4B 3MJ8A 3VWKA 2ATPB 3D18A 4BZ1H 3CFKB 3WHE1 5C0CE 1PFCA 5FUOL 3I02B 4JJHA 4ZNEA 4FQIL 1DN2A 3TN0B 2FJHB 2E7CA 5FYKU 1MVFA 5BRZB 4YFLF 2RHEA 2YD3A 3LKPB 1QRKA 3MA7A 4P4RB 3KPRE 1TTUA 4HHAB 3BP5A 1I9IL 1R3KB 4X7SL 3QDGB 3WIHL 3O6KL 4MX7B 4G8GE 3ZYZA 3A6CH 3NIGF 4NZDA 1JPSL 1JGDA 3QT2A 2BJML 2XKUA 4X4ME 1WTGT 4TUKH 4Z7UA 4DUVA 1T83A 4HBCH 1FAKT 1VHPA 2Q86A 4OAWB 5DJ2A 5E8PA 1V5JA 2HT4C 2DLFH 3T8XA 2VXQL 5GRJH 3KR3L 2C3XA 2Q76B 3IGAB 4CMMA 3GI9L 5HHXH 1S7XB 5ENWA 2VISA 1QSFB 5C9KA 5FM8A 4LKXA 4M1GL 1HIML 3BN9D 3JWOL 4ZPVB 3P4OA 3LS4H 4QXTB 4XP4H 3UYRL 2VLMD 3L3IB 5BV7B 5I17A 4OLYH 4J3SA 3QULA 2IBZY 3TIDA 4JFXA 1DZBA 5DJXA 2QKIA 3LB6C 4JG0H 4RGOH 4GRLB 3M17B 3EYQC 4NN5B 4UOW0 4G6KH 2VZUA 4KQ3L 4M7LH 4XNXH 2EYRA 5FUCC 3H3KA 4NDMA 1NBVH 5DEGA 4XP9L 4YGAB 1N64H 2ITDB 1G7QA 4DWHA 1C08B 5DR5L 3NCBB 4NKOA 1VKXB 4X8JB 1RIVL 4XHJC 3OKEA 1MUJB 1S8DB 3QI9C 4PJ9D 4Z95H 4F9LC 4DKEH 5C6TL 3U4AA 1R3JB 4HIJB 3ZTJG 4JFOA 2W60B 3VD7A 2BSRA 3U7WH 1ED3B 5GISH 3TO4D 3RL1A 3NABH 3TCLB 1UYWL 4OQTA 4JO2L 5AG8A 3MRGA 5ESVB 3WD5H 3WHE0 4HKZA 2ZOKA 4POZD 5FUOH 4HPYL 1EJOH 4JY5H 1KJMB 3U46A 5C0RH 5J89A 3IFLH 5HI3D 5FF6A 3OSKA 1FFNB 1BZ7B 5KSBB 4F80A 4KV5F 1A6VL 1UXSB 4UQ2A 4M5ZL 4JFXB 3FO2B 5INCA 5H94A 1V7NH 1P9MC 4TVPH 5EO1B 4GO6B 4ETYA 1SYVB 4WI8A 5EFIB 2EE3A 4XCNB 4JFEB 4LEOB 4OD2B 1N26A 3HRZA 3IU4H 1FNSH 2XA8H 4MYWB 5EIIB 4EEEA 3LN5B 5GIRA 4L8BA 4FQCL 3PHOB 6FABH 3O3UN 1U8JB 1UXWA 4N1HB 3RRQA 4OJFL 1EGJH 5I1LB 4PJ7A 1EHLL 5CS7A 4KU1A 4BSWB 4JFFD 4MAYA 1T1WA 5F7EH 5JPNA 4WW2B 1H9VA 1UWEL 4P9HL 3BPOC 2CIIB 1Q72H 1YUHB 5IB2A 2W9EH 4Z7UB 2XZCH 1FSKC 4MSWB 3S6CA 1WBYB 3O2VH 1MVUA 1WGOA 1P5UA 2XY2A 3CDYA 5L8LB 3OXRA 1T5WB 5EUOA 4YFEA 3P30H 2VLJA 4Y16B 5ADOH 3EO1A 4UOJA 4I18C 3R8QA 1G6RA 1TJHL 4XMKH 4IMKC 3J8F7 5D1QC 3VD9A 2ADJB 3STBA 1II4E 1FNEB 2EECA 4Y1AE 2NX5A 4C54A 4XC3H 4RAUA 1K8IA 4OIIH 1M7XA 3QFJA 3AC0A 2HLAB 3IFPA 1B2WH 4K3EH 2VSDA 1UB5A 1UEYA 5IVZA 1V7ML 2D7TL 3STLA 3BXNB 4M7ZB 3GJEB 1V7NL 1IGJA 5EIVA 4U0RB 2DQDL 1RUAL 3PWLA 4LSVH 1XGTB 3VGEA 3NCYS 2X4NB 3ZZ1A 3T2NH 4U1IA 4JFPB 1A3RH 4HXBH 1EIBA 4OCNC 3DHJA 2F5AL 3G5YB 2F5BH 1O7SA 4TQEL 3O4OC 1UXSA 1E4JA 4UQ2B 3MJGX 3N9GL 2YEZA 1CTOA 3OGCB 4L1DA 4H1LB 2HWZL 3PIQA 1MFAH 4X7SH 3RIAF 4PTTA 2ICWA 1IL1B 4MD0A 1I7TA 4WDIB 4C56E 1BZ9A 1CQKA 3WN5C 1QA9A 1NUNB 1I7ZB 1MHCA 1ZTXL 1MF2H 3QIUA 5SV3A 2FDBP 5CP7B 3BVNB 2AJVH 2HH0H 3KXFD 5C0BE 43CAA 1P7HL 5MERA 1EAJA 5I1CH 1HI6A 1I1RA 4PJIA 1Z0NA 1B3JA 4YXHL 3DLQR 1OP3K 1VGEH 2UV3A 2H32H 3B9KA 1D9KD 3WNOA 3QXWA 2ID5A 4R3SB 4JQXA 2OCFD 3UDWC 2Y5TA 4IRSB 3UTPD 4YH6A 2XWJB 4XTRC 15C8H 1P4LB 4ELKB 1I9JH 3U79A 4Y2OA 1IC5H 1MCNA 1UM6L 1W0VB 2VZSA 5DS8B 4WEUD 4P5KB 2LTQC 4NKMB 5F88A 4AEEA 1G7LA 3QXAA 3OKOB 3HE6D 2VL5B 4JRYA 2JLLA 2C26A 3RUGE 1HEZA 1R5IB 1QEWA 3CZFA 4UIMB 4AH2B 3STZB 2G9HA 4Z7VA 4KHTH 4FZ8L 4TUJA 5E94B 5C08D 3ALPA 1ZV5A 2E27H 3VFMB 3OKDB 1FL6B 4WWKC 4GMSL 3I3BA 3OQ3B 4OLZL 3P77A 1J05B 4GW1A 4YHOH 3H9ZA 3GBNH 4Q2ZA 3PWUA 1BLNA 2WZPD 4QEGA 1HNFA 3T0EE 4FZEH 1UQSB 1FH5H 4KRPB 2Z9TA 3ES6A 3GIVA 5D7LB 3A6CL 3BP7B 1S7QA 3PXJA 3F7YB 2FX8L 2MKWA 4HBQA 1VDGA 1JNHA 3KLAA 4X6DF 1IGMH 1OQOA 3B9AA 4FFZL 1AXIB 3L5WA 3ALWA 1KXQE 3QQ9D 4K2UL 2YK1L 1B6DA 1YJDC 2DWEB 5ETUA 5I30H 1NSNL 4OF0A 5BZWB 1ERNA 3Q6FA 1T1ZB 3VFGH 5F9DC 2CRMA 5IWLA 4JFDB 4D9LH 3GSUA 2OL3L 2NXZC 3TO4C 1N7MH 2XA3A 5T5FL 1YMMB 4UZGA 4OTXH 4PV8A 5TQ0L 1A6TB 2VZ3A 4CDGC 1A9BB 1ZHBB 5DQDL 3HMWH 3KYKL 1IVLA 5GS1B 5CILH 4S11A 3O41A 1M7IB 1H3PL 1JTTA 4U7KA 1S9YB 4APQB 1JHTB 1YNKH 5KSAD 2JCCF 1QRNE 3O6ML 4K7PL 2OL3B 4FZ8H 4YXHH 4Y1AD 1G7LB 4RFOL 5T1DL 4WO4B 1AE6H 1LK2B 5C08B 5LAXA 5FYLH 1OARH 5I76B 6CGTA 5T1KD 5DURB 3QEQE 4LQFH 3V4UH 2A1WL 1K4CB 2VO5A 4PYHA 3OXRB 2VQ1B 1LP9E 4OCWH 3I6GA 3MV9A 5JHLL 4ZDHA 4KKAC 3WO4C 3W0WA 2X9WA 4M48L 2PYEE 4QCIB 1UKSA 4KMQA 1NDMA 5E8DL 1EJ6A 1Q94A 4K9EH 2V2XA 4GT7A 4GUPB 1J9CT 4ERSH 1UC6A 3IFNL 3LKOB 5C9JA 1OP3H 1DQDL 3MRDA 4R8WH 2EDLA 3T1FB 2GT9B 1C5CL 1S7WA 4NC0B 4LSPL 1RZKH 5J6GB 1ZAGA 2NY6B 1IGYB 1JCKA 3QQ9C 1JF6A 3PWLB 1KULA 5CZXC 3EDKA 4LPWA 2GJ6A 4JHZA 1MHHB 1K6QH 1S9WB 4XNUH 5E9DD 1AGCA 2IGFL 3VD3A 2Q20A 3ARBA 4GMSH 4HH9A 5BVJB 4LL9A 1JF1B 3BDYL 4M6NH 1J86A 1Q1JH 1X7QB 4YDIH 2CD0A 5DMIL 4O4YH 1QVOA 5LWYL 1ZKAA 3RWHB 2UZIH 1JGUH 1AFVL 5K9JL 4S1SL 1KXTB 1UB5B 1EO5A 4MWFA 3GSNB 3CLFH 3BZEB 3MRPA 2DM4A 2Y36H 4FQHB 1XF4A 4LQFL 3NAAL 1XGPA 4O2EB 2HRLA 5DURD 2D7OA 1ZLWK 3L3GA 1RZJC 2R1YA 4NQSA 4F15C 2AEQH 1XGRA 4YBQC 4LSRL 4JRWA 8CGTA 1C08A 4KK8D 4MHHG 2ZJSH 4MD5B 3MGAA 1Z6JT 4FOMA 2F54D 5IOPB 3RWCA 4XP1H 1DQML 3S3SA 4JO1L 1XF5A 3QDGE 3TYGL 4X6CA 2BSSA 3DXAD 4O9HH 4UT7H 4AMKH 2AJZA 5DD5H 3S98A 1X5JA 1AE6L 3U82B 1K5NA 4TVPL 3D9AL 5DUBA 1MFDL 2V9TA 4KI5C 4GW4B 1QLEL 1G0XA 32C2B 3G08B 3KPSA 3W82A 3DWTA 5BJTA 3JVGA 3N06B 3IDYC 1N0XL 5I17B 3DVNA 5HI4D 4H20H 2E7MA 1NGPL 2R1YB 4NQSB 4ZD3L 1CICD 5F3BA 1IGTA 2YUXA 2FECI 1QBMH 3GMOB 3CH8A 4MD5A 4PJ8C 1RVFL 4KTYA 5L6YH 3BZEA 4NFBA 1HEZB 3ARFD 3CZFB 3CXHJ 4K7FA 5C0AB 4AQ1B 2IAMA 5DT1L 1VGEL 5JO5B 3VFGL 2Z92A 1F3JA 4PBVC 3REWA 5DD0H 3A6BL 4XCYA 1T1YB 3A67L 1GOFA 1H3TA 1JGEA 1TTFA 4KROB 1I8MA 2OBGA 1TTGA 3E2HB 1Q0XH 3T0ED 1K4DB 4H0IA 5IM7B 4S1RH 4L8SC 1AGBA 4MNGE 1P7QD 5DD1H 4ZO7A 1ED3A 4L9LC 4G5ZH 1QNZH 4G7YL 5KVEH 3U83A 3MA7B 4P4RA 3BSZL 5F7NC 4YGVB 1P4LA 1I8IB 5GGQH 4G6MH 1A22B 3LEYL 1HWGB 1DUZB 1FE8H 4JN2A 4M6NL 5FAAA 3QNXA 3O8XC 5F7EL 1AY1L 2PYFB 5H2BB 1FSKB 3QDJE 3HE7D 3TH3T 3V6BR 3FFDA 5JTWA 1VFBB 1K6QL 1W72B 2EEAA 1YN7B 3MLYH 1NBZB 1SBSL 3BPOB 2EIZB 5AD0B 4NHCH 2Q8BH 1QSFE 4S1QH 3K0WA 5IW6A 1M7DB 1NCCH 2MTPA 4EN3C 4NWTH 5EO0B 1L9MA 1BQHB 3LZFL 4ODHH 5ESAA 1T6VN 4F3FB 4F7MB 3TNNB 2FHBA 2O61B 3QPXL 1I3UA 2VLKA 4HQQH 5H37H 3R8BB 5DZOA 4LKXB 4U1JB 5IR1A 2NY5H 4L8DB 2M26A 3L3JB 1CD1A 5I73B 3DI2B 3AMKA 4YHOL 4ENEC 3BRFA 4AQOA 1WWWX 4PRPB 4KHXL 4I0PA 5E2WL 1YEDA 1EA9C 35C8L 3BGFB 3I75B 1QO3A 2XG4A 2AJXL 5HHOA 4CJ0A 2V5TA 3V52L 1HCFX 4P2YA 1N4XL 1GZQA 5E5UB 1E4XH 2O5ZL 2N7BA 4U1NA 4UNUA 2DL9A 1YNKL 4PBXA 4F7EA 4LSUH 4NM4L 4JFDA 4Y2DD 2O5YH 3WKMH 5D8JH 2BXYA 3HCVA 2EH8H 5DD6A 4E0RB 3WFCH 2VDQL 2HYMA 4UB0H 4I2XA 4LLAA 4OBRA 4QWWC 3W9DB 1X6LA 1MQ8A 4ZNCD 1WT5C 3NIDE 3RPIA 1WCQA 1U2CA 3WN5A 3IETA 1F3JB 2ICES 1KNOB 4ODHL 4TNVF 1NEZA 1F5WA 4CVUA 5J57B 2YPKB 2R23A 4YHYC 5JLZB 4CRPA 3BO8A 3QQ3A 5DK2B 1E6JH 2ZUVA 3BP6B 5C92A 4KQ3H 5INCB 5C0IB 3UTTD 2XKNB 1G7JA 4NO5A 2JK5A 3HNVH 4ODXA 4JFEA 4LEOA 2AEWA 2P42B 3FMGL 3NH7H 2AJYH 4L4TB 4PJHE 3S35X 3SO3C 3MRCB 5DUPL 4ZS7H 3OPZL 1KCSL 1TETL 5I19L 5FM4A 3LKSB 3FHAA 3JWNC 5GJSL 4EOWH 2P5EA 4O58L 2XWBA 2EDWA 5HYFA 5EBLA 3U46B 3OX8A 2DQUL 4KJYB 2DQGH 3C8DA 4C57C 3U4EB 1N5YL 3P3YA 2XWJA 4U3HA 3GI9H 3RWCB 1ZA6B 1JBJA 5E6ID 4WW2F 5JHDA 1EFQA 3BUTA 4XXDA 2YD8A 1ZGLB 3RNKA 4FQXD 4G7VL 3MV8A 2HKHL 3ARGA 3VXMD 5DRZA 5IEHA 4WI3A 2LVCA 4UQ3A 1R3JA 5LXGH 2EDXA 1H3GA 1QOKA 1VESA 3EJZC 9CGTA 1WZ1H 3UP1A 4NZUL 3VW3H 4ENED 2EYSB 3RZWA 2IQ9L 3DETC 4E41B 1QACA 5DC9B 4BKLB 3RHWF 2RR3A 4FABH 5EUKA 4LHUD 1TVBB 4ODWA 5D1ZD 5CMAA 1CL7I 3WFZA 5CINH 5IBUB 1IL1A 2Z93B 1OVZA 1JZ6A 4XNZB 5DVNA 1KN4H 1NMAH 1A6VH 1HILB 4N68A 1EEYB 4QGTA 1HXMB 3O3BB 3UJJH 3UPRA 1R5VA 1JI1A 2Z92B 4NNPL 2O5XL 2W9DH 5CSZB 2LAAA 1MHHA 1S9WA 2BHYA 3NFSL 2XN9E 2ZKHL 4LVNC 5JXAL 5MENE 1WCBB 3CZJA 3IDIB 1JYXA 4NOBA 5L88L 3V4VL 1OWRM 1BEYH 1T3FB 3HAEH 2A9ML 4JPWH 1D5MA 2GFBB 4JM2C 5J9PB 1KGCE 2F53B 2OK0H 4TSAH 3VFOB 4BH8B 3NPSC 5AWNH 4PJFB 1QBML 2XIDA 5DFTA 4NKQB 3E3QE 4N5EC 1IRAY 1MRCL 3LB6D 4HG4J 4E0RA 2Z91A 5T3ZD 1MCPH 1NMCC 5FGRA 4L3EA 4E41A 2E9BA 3MBXH 3FB8A 4JAMA 1CDIA 4CL7A 1DTUA 1U91A 2FEEI 2MCPL 4P2OD 3SE3C 4EQ2A 4OCLC 2AJYL 4HFWA 4U1MA 4XXDB 4O02H 1GOHA 1HHHB 4EOWL 1XGPB 1YY8A 1HHIB 3GSVA 4YAQB 5D2NB 2FBJL 1NGXA 4YHNA 1EEZA 4LHJB 5D1ZB 1J8HD 3MRIB 5FYLE 4LU5L 3OKKA 4YHIB 3NCYP 4X7TB 3VI3E 1FE8L 3IDGB 4U6HA 3VFRB 1RUPH 2EDYA 2P5EB 3DX7B 3GDBA 4QLRA 3DGGA 1XR9B 3K80A 3L3JA 4D8PA 2B5IC 1RI8A 3EAKA 3QDGD 1W72H 3VFNB 3BP4A 4DGVH 3P2TA 3MLVH 5C0FA 3QPQD 4P48A 4GAFB 4PJFA 4A2MA 2NXZB 2UYLA 4HWZB 4KI5D 3S37L 3TBWA 3NN8A 5F96L 3L3OA 4YDIL 4K3JH 5D7IE 3UBXA 1BFVL 2R9HD 4TSAL 4N0FB 3FQRB 3BRGC 5I1GL 3IU3A 1RJLB 4PJEB 1FVDB 1R3HB 2H9GB 4PTUB 3H8NA 3D0VB 1KCVL 1KJ3L 5EUKB 2YPVH 5J1AA 5F8RC 1UJTA 2AW2A 1NAKL 4R26H 1C5BH 2OI9C 5F3HB 1A2YB 3ZHLA 5C07D 1CXLA 4N8VG 2AK4E 2O5XH 2E3VA 2W9DL 3CCHB 4GKOA 4WJ5A 4G6JL 3MOAH 4EUPH 3BOVA 2WK2A 5IESH 1FV1A 1L6ZA 4JFZH 5DUML 3MO1A 4ZQKA 4LF3A 5GZOC 1JNNL 1ZHLA 3AREA 4HJ0C 2LVEA 3EOBA 4Z78B 4F7EB 3G5XA 4ODTL 2EYRB 1MLCA 1S78C 1B0WA 3I50H 1DDHA 3Q5YA 2FWOB 4PGJA 3N85L 7CGTA 3PQYD 2NZ9C 1PEWA 3RPKA 3RDTC 4UTAH 3KHOA 1BM3H 3JWOH 3TPKA 4B53A 3VXME 4JGUA 1NANI 1MREL 1CE6B 1DCLA 4PJGE 3SPVB 3I75A 3INUL 5ERWA 12E8H 2GSIA 3BZ4A 4I9WD 1QD0A 1P53A 2JB6B 2P8MB 1IKFH 1MQKL 2I5YH 4I1NB 1FN4B 3FJTA 3BZFA 3CJJA 4NQED 2CDEA 3O6FB 1ZWIB 5ELIA 1A7PH 3C2AL 2AXFA 3EOBB 3I3EA 4KROD 4GRWE 4CKVX 3FQUA 5EU4A 5AEAA 2AEPH 3DRQA 4ZPVA 2FSEA 3KPNB 4K23L 1TZGL 3DXAE 1MCIA 3AXLB 1I1FB 1Y0LB 3CNKA 4QT5A 3KYOA 1I75A 2BNQE 3BPCB 4DKFL 3CMGA 3QDMD 1B9ZA 4CMMB 2EO1A 4IEFB 4A6YL 3MREA 4PP2A 4K3DH 3TM6A 5JORA 1JUFB 3VH8B 4PRPD 5HD8C 3HNSH 3B9KD 4YHNB 2F58L 1SM3L 4HWNA 3BGFC 4PJXE 4F7TB 1SHMA 2DBLH 4G42A 1W72A 1FVDA 3MSPA 3C60B 2AABH 3PWPD 5FHBL 4S2SA 5F1KC 3FB7B 1J0HA 3QAZB 3IXTA 5DMKA 4M9PA 4ZSOA 4KVCH 4K8RD 4RGNB 4FQHA 4YXLH 3BISA 4FN0A 4LLVA 5D7JC 4NBXB 4P2RA 4GFTB 3RNQA 3MA9L 4JY6B 4KTDH 5FO9A 1FBIH 3OJMB 4ZUVB 4LNRA 5FM5M 2A73A 5C0CB 2NXYD 2ZUWA 4TNVK 5T1LD 4FQXB 3WCYA 4IS6A 4DN3H 2CMRL 3QDHA 2BMKA 1RZGA 3O3AA 4JKKA 1LO3H 2DI9A 3TO2A 5DD3H 4O2FB 5B22A 2VE6B 4HKJB 1CE1H 3M1BB 5ESQB 1LWRA 1IGIH 4J23A 5C0DA 2ZPKH 5DMGC 5ID0B 2R4SL 5BO1H 4A2LA 2X4QA 3QIWC 4JM2D 4MCYA 3ARFC 5CJQL 3B4NA 1A7OL 5CILL 4MCZB 5E1AB 2B1AH 4WRLA 2DB8A 3ECBB 1MHEB 1YYMH 5IW1A 4FFYH 5EU6E 3EDJA 3LDBB 4JDTH 4ODTH 3ULVL 3CVHL 4L8SB 1BQHA 3E0GA 4G8EA 5ESAB 4F7MA 1JRHI 2YSSA 1T1WB 4HT1L 3QUZB 1PVHA 5LGHL 4LRNH 2VUYA 5HDOA 4EIZC 1S9KC 4KJPC 5IMLA 1GYAA 3W9EB 1F6LL 3T2NL 3G04B 5KVDH 3MJ9H 1KLGA 3I6LE 2X4QB 1J0KA 2OJEA 4KWUA 4U3CA 3MFFA 5FV2A 1LMKA 1C5BL 1AI1L 5EN2A 1N59A 2C7UB 1DN0A 4MDJA 3K4AA 5I1KL 1WFTA 5FYJH 3NBNA 1S5IH 3O3EA 1RZ7H 1KENL 1KXVC 1YYLH 3GUTB 3RAJL 1CGXA 3DUUB 4GRWH 4JKLA 1FZKA 5D7JD 5D93B 1FFOA 1ORSA 3FQWB 2NPLX 5ITFA 3V95A 3F12B 3V5HB 1T1YA 1F90H 4H25A 3SEPA 1XCQB 1LO3L 4AEHH 5GSVA 5HDQL 5IM7A 5C0GA 2XZQH 5IV2A 1PKOA 3CMOH 3B9KC 5CJ5A 4X98A 3VXRB 2IPUG 3BJLA 2F19H 1BJ1J 1PZ5B 4HIEB 1BFOA 3DARA 4QYOB 4MJIB 4FHBD 1LNUA 2PXYA 3C60C 4LDEB 1XR8A 3U1SH 1NGZB 2IANA 4S2SB 3T0DA 2HFGL 4Q9RL 4GOSA 4KJWD 1NDGB 2AERT 4GW4A 3S3JA 4YNYB 3WXWH 3NACL 3DTXA 3VXSB 1HQRB 3OJDB 1UJ3A 3KLDA 3FO0H 1BVLA 2R1WA 2KKQA 3VFPA 4J4PC 4OZ4A 3KPSB 2ARJB 3GMMB 5ADPL 4WFFE 5I1EH 2E7HA 2KBGA 5JA9A 5CLWA 3QUXC 3PL6D 4PJAF 3E6FA 5SWSD 4XNMB 1AO7D 1P7KA 2HN7B 1JV5B 3TIEA 4GBXC 1IKFL 2PCPB 1F4XL 1KEML 1KJVA 3ZE2E 4CNIA 5J4MA 2DQTH 1OTUD 4FZEL 1J1PH 4ZFOB 2BP3A 1S3KL 2DQFB 1A7BA 2HFEB 4NNYB 5H35A 4RZCB 4QOKE 5I16B 4MJ4A 3MYJA 4P46C 2Q86B 4HZAA 4FXKB 5IHUH 3MRRA 1KJ2B 5HHQA 3O4LD 3F6LA 3W9DA 3GRWL 3SJVA 5ABDE 2A2QT 1JNLH 3FN0H 5DSCB 3VG0L 1EZVX 3K2UL 1Z2KA 5KSAC 1PDKA 3Q1SH 3BAEH 1PQZA 2EO9A 2J88L 3AREB 4X7DC 3LPWA 5DYOA 4Z78A 4Z8FH 3BP5B 1W72L 1TCRB 1U8LB 1MY5A 4HS6A 5DTFA 1X4ZA 5D2LF 5EOCL 1ZHNB 5TQ0H 1C8PA 1I1AB 1OTSD 4HAFA 1D5IH 4WCYL 2R9HC 5E56A 4KKCC 5BMFH 1AHWA 3KHQA 1DLFL 3OJVC 1NCTA 2VDML 1FZOA 1GAFH 5DEFB 4GQ9L 3U4BH 4KVNL 1BIIB 3RAJH 5B3JE 1DVFC 2JIXD 1PZUB 4MA3B 1EX0A 1RZ8B 4P23B 1MJ7H 2GITA 4GBXA 4L3CA 2A83A 1L7IL 4M03A 3FFCD 2MCPH 2IFGA 1KCVH 1KJ3H 3CFCL 3RVVC 3ZE0E 3TBYA 7FABL 5JQ6H 4L4JA 3VU2A 2QHLA 4A6YA 4Z7QE 3HNSL 2DICA 1XF3B 3D25A 5E1AA 4QO1A 1DLHB 3P4OB 5JDSA 2AK4D 5ITBL 1A6ZA 4JZJA 4K71B 3BDYH 3ILQD 3QH3B 5AZEL 3C60D 4JN1H 2CXGA 1KPUA 4ODBD 2FH8A 4PJBE 3ULUD 4HKXA 4LHUB 5B4MD 4NWUL 4DK6A 5KSBF 2DJ4A 3UTSD 3O81A 4JRXA 4BUGA 2QEJA 3IETB 4NQXA 3KPRB 2OL3A 1IC7H 2IC2A 4IOFD 5JPMA 3CVHA 1QSEA 4Y4HA 4PJIF 4IIQC 3EKCA 2MHAB 1DUZA 4JN2B 1X9QA 5CBEA 3ZE0F 5E8EB 5GHWL 1RPQA 1CZ8H 2BRRL 4OM1L 4D0BB 8FABA 3L3HB 3NOIA 3L5WB 3GHBL 5HVHC 2NTSP 3WFCL 4J3WA 4ZFFA 4KDVA 1K3IA 5KTEH 4ZMAT 4PUBH 4BSWA 3TF7C 1A6UL 1MJUH 1XH3B 2NY6D 2ZSWB 4NKIL 3H3BC 3X3GH 4EI5A 2OXHA 1EK3A 1KELH 3GSXA 3BUYB 5FA4B 2DJSA 5LCVL 5GGVL 4BFIB 3ARUA 1EGJL 1UH3A 3BPLB 1OCWH 3MUHL 1SY6A 4PRPE 4AM0A 4NSKA 4UILL 1QQDB 2DIJA 1FAIH 3MREB 4PP2B 1CDBA 4LASH 4JFFB 3ZTJH 4Q6YA 5F3BB 5D7LE 1GC1H 3BYTA 3QIWD 4X7EC 2BX5A 4L5FH 1BZ7A 5KSBA 1PX3A 3GO1H 1FFPA 5CD5C 4G7VH 1F8TH 3MLRH 1W8NA 1LEIB 1ONQA 2F5AH 4G9FD 2LU3A 5CMAB 2W0FB 5B4MC 3MRMA 2ICCA 2Y4SA 1WBZA 4D9QD 4S10A 1HH9B 2NNAA 1VACB 3MV7B 2CIKA 3B9EA 3IJHB 1YECH 1BJMA 3ARWA 1CWVA 3DECA 5DZNA 5K93A 1CD9B 3O9WA 4KAQH 4M00A 5BS0A 4KK8C 3RIFK 3C2SA 1DN0B 4MDJB 3VXPB 1A6WH 4YHKL 4CW1A 1E6OL 3S4SG 5HJ3B 4WFGD 3UZEA 3V6OC 2A77H 4KI5F 1GGBL 4PG9B 3FOMB 3JTSA 3OAZK 4Z7WE 4U1KA 5F9WB 3UTSB 4GAGL 4XVTH 5CCKH 2XICA 3QCUL 3IAPA 1HIMH 1H3UA 1XEDA 2DQCL 2AI0L 3WUZA 1HDMA 3WFHB 4U6XA 3ULUC 4PJ7B 1J0YA 2ZCKH 3FAXA 4F7PB 4MCZA 1QZ1A 2AQ3A 2WQ8A 2C4XA 4H26B 3B2UC 3SY0B 5GGUB 2AAVA 3ARXA 2XKNA 2GFBA 1JN6A 2DYPB 3BN3B 4I3GA 1Q9LB 4IOFC 4GLRI 3CH1A 5D1XC 4L5FL 2E8ZA 4KUZH 4LAJH 1T04A 2Q7NA 3I6LD 3F58H 3JTTB 4MA1B 3QWQB 1GXEA 4OSUL 5IMKB 2NY7L 4X9HA 3HI1A 3MYZA 3IJSA 2EE6A 4U1IB 1U8IA 5IK3B 1OLZA 2DL2A 5D8JL 3TO4A 4TTDD 2A6JB 4HDIB 3JV4B 1T2XA 4F9PA 4HV8A 3QBTB 2EXWC 3MLZH 2YWYA 1AR2A 2ADJA 3ARDD 1N8ZB 4CVZB 4P2QB 25C8H 1YMMA 4QRRB 2MPAH 5C0BB 1KCLA 1Q9WB 1TMCB 3SDDD 3T0BA 2XV6B 1Q0XL 4QF1B 1FJ1A 2AJVL 5BOZG 2BDNH 5D2NA 3OG6B 4OI8A 3QO0A 2X4UA 4L4VD 2R8SH 1I3VA 3VGGA 1M05B 3LKRB 2VLRD 1CVRA 1CG9B 4ZUTA 3RY5A 1G1YA 5EU5A 3MZGB 4D0DB 4RWYL 3LN9A 5HHNA 5F9OL 2K3TA 3SE3A 3C60A 3NGBC 1BQHG 4RGOL 3KPRA 3QZWB 4K7PY 4WW2A 4X6DB 3NCJH 3MLWL 3FB6B 2F15A 1TJHH 4XMKL 3GJFH 5EB9A 1T22A 5CJXC 2QQNH 5HYJD 1S7QB 1S7SA 4B7IA 2VIRB 3PF2A 4S0SD 4ZUUB 5GIRB 3B8YA 2VLLA 1LO2H 1NFDE 2W07A 2XYCA 4IDJH 4NPYA 3WUWG 3BHBA 2DYPD 4UBDC 3A6OA 4Q2ZB 5C6PB 1U8KB 4QHKJ 1AHWC 4F2MB 3KPPB 1D5MB 5J9PA 4F7CA 5ALCL 4CMHC 1H5BC 4CUCA 1ZS8A 5EOQH 4GBXD 4GAJL 2IPKB 4G8GB 3VFVB 2LU7A 2Y07H 1DQLH 3STZA 1JFQH 4PJXB 5C0EB 3U36B 2HN7A 5ACZB 2D7MA 4EJ1C 1RSFA 3VA6A 1C16B 5HY9B 1KIQB 4I5BB 3ESUF 2R2HA 1VFUA 4NUGL 4YE4L 3JWDC 5CEZD 4KMTL 3RL1B 3TCLA 5D7KD 3KPQA 4HLZH 4U1KB 4JY4B 2P5WD 2F74A 3T4YA 1HDMB 3T0XA 5E8NA 3VMPA 3L9RB 4G9DA 3QUKB 1L7IH 2OMBA 4NKOB 1JNLL 3VI4E 4HUVB 4JG1H 1PYWA 3FQUB 5EU4B 1N4XH 3WDHA 4ZO8A 4NC1E 3GSQA 1EGJA 1MOEA 2AKRA 3QNZB 1A0QH 3O8XD 3K8MA 2WWMD 4TSCL 2NZIA 1DL7L 4P4KA 1KOAA 3GNML 2NY6C 5L2KB 3MOBH 2X89D 3ARGB 3IDYB 3ET9F 5CP7A 4LLQA 4OUOA 3FN0L 3TZVD 2AGJL 3CXHK 1E4WH 1U8MA 4F58L 1GGCH 5HGGS 1HYRC 5IKCA 1UVQB 3B6SA 5E08L 3OF6A 1CR9H 2QHRL 5C0NC 4JFZL 1WBZB 2ENYA 1INQB 3L6FB 5I1JL 4IDLA 2BOCA 3H9YA 4MA1C 3UBXB 5IJKC 2VR4A 4YBQD 3UJTL 4CMHB 3PWVA 5GPRA 1NJ9B 5DJ6A 3LEVH 3THMH 3EO0B 3MGOB 3QP3A 3MRHB 4MMZC 4YHPA 4JPKH 1XGTA 4JANB 2ZG3A 4HIXL 3OB0H 1KCRH 5E5MB 4QTHA 4RA0C 2YS4A 4J3TA 2ORBH 5HHOE 2OYPA 3DGGB 3U7AA 2ARJA 1CXIA 4EI5B 2R0KH 4N5UA 4HULB 1I3GL 2GJJA 4X6CB 1EO7A 1NC4D 5TFSL 2YPLE 2NXYC 4GAGH 3C08L 1RIUH 4CN6A 4K2UH 2AS5M 1IAKA 1U41A 2ZCHL 4PJ7E 2VZ1A 5T1MB 3U2SA 4MDIA 5E2TL 1OGAE 2F53D 3FONB 4JM2F 1XGRB 8FABB 4MJ6A 1YA5A 4KK6C 5HHVL 1EFXD 4R96A 4Y16A 4XVJL 2GHWB 4P5TD 1UQSA 3QUZD 2GUOA 4U6YA 1LDPL 4HUUB 5J3HC 1TQCC 5JUEH 1JL8A 3HNTL 4X80H 1IEHA 5C0JA 5FGBA 4XCCH 3PP3K 4JO3L 5IB2B 1AGBB 2GK0A 2VE6A 4JM4L 2W1NA 5E8EA 4WHYH 4TUJB 2FJHA 3IJYA 4YHZH 3SJVB 5KANI 3AAZA 5EPMA 2PNDA 3U9UA 2HVJA 2UVEA 5IK3A 5FKPB 4ORZC 1YY8B 2CUIA 2Q6WA 2VL5A 3MROA 3BDXA 3LSOA 1G7PA 4OLVH 1MWAA 3MCG1 3TJHC 4MNHB 3AMLA 1Q38A 4KXZH 4PJHA 1CICB 4UILH 2Z35A 2VDPH 2CKBL 5J8OA 5JZ7D 2VL4A 3T09A 1HOCA 3PL6B 4LMQE 5M95B 3E2HC 1UM4L 3QWRD 3TNNA 2R56H 5D7LD 2X1PA 5IVOA 1ND0A 3CXDH 4OCWL 4XPTL 1N7ML 4RGND 3C8HA 5IVXB 5JHDE 1XMWA 4PJAE 4AK1A 3AROA 4L9LA 3HC0A 2CLRB 4POZC 1NUDA 4OZIB 2G2RA 4UIKH 4FQJH 4R4BB 4NZRH 3DNKA 1H3PH 1B0RA 3BMWA 5K9OA 2WINB 4ISVB 4CW1B 3VDBA 4NQEB 4P57A 3MLXH 5E9DA 1WWBX 3MLUL 1NGZA 2IANB 2DQIH 1NC4B 3HC3H 3LKNA 5DYOB 3Q3GA 1FDLH 3ULUE 1B0GB 4GKNB 2YUWA 5HYSG 2ED7A 2VRAA 4Q74A 4I3RH 5IEKB 4FXGB 1MNUH 3TGXA 4HQQL 5C0GB 2R1XB 2VLME 2Y36L 5KBNC 5L8KB 2VN4A 1IGIL 5I30L 2GQHA 4NRXB 3OKNA 4X5LA 4LSRH 4Y4KD 1FGVH 4Q7DA 1QSVA 4WTWA 1HH6A 4NO5B 1NAKH 1D5XA 3C8KB 1HN1A 4KKLC 4PJ5E 4XP1L 2X4SA 5GS1C 1CGVA 3Q3GB 1S9VB 4BFEA 3SE4C 2WUBH 1JWUA 4NCDA 2JB5H 4EXKA 1MCCA 2I25N 1NEZB 1ACZA 4LRNL 3ZKND 5E8NB 4K9EL 3EIFA 4HJJH 2DTML 3SKOB 1G7MB 3CX5J 4LARL 3U0WH 4IIQA 4ONHA 1J12A 4R4NC 4Z7QF 4LLMB 1UZ8B 3W2DH 1Y0LA 4ZD3H 3OJDA 1U92B 4NM8H 4QCIA 5ANMB 4MAUL 5T1LA 2IG2L 1QSED 4Y4HD 1KENH 2CLZA 3QJHB 3V4UL 4PPTA 4UBDD 1J05A 4IOIB 4M3JA 3HLAA 1L4IA 1UXWB 1RHHA 2X4SB 1YEGH 3S4SA 4I77H 4CBPA 4FQQB 5EH1A 3IRZA 4QHMA 4HS8H 1FG2A 3RWFA 4LLWA 5EU3B 2COQA 2WANA 4QRTB 4Y1AB 1TZIA 1QG3A 3N1QC 5MHSD 2V2TB 2BVQB 1QO3B 1ZHKB 2B1AL 5CEXB 1C5CH 3FT2A 4NZRL 4LGPB 1JWSB 1RURH 2G5RA 2W38A 5HGBA 4FFVC 3HI6H 4KTEH 1NGXB 1OD9A 3KS0J 1MLBA 3CX5K 3MLXL 3G5VB 4JFFE 4WNQA 3KYMA 5DD5L 1F3DH 4LVNB 2C3GA 1GGCL 4Y4FD 3VFSA 1JZ2A 1P84J 3WLWD 5CIPB 4X9BA 3Q2CA 4C83A 4F3FA 5IT2H 4OV6F 3TT3L 2VXUL 5EO0A 3OJ2C 4EVNB 3IT8D 2CMRH 3BVNA 4YXLL 2L0DA 2NW2A 1MWAH 1TZHB 4Z95L 3F65A 1BF8A 2Y07L 3QQ4B 1DVFB 3MLSL 2ZUTA 5D93C 5F1IA 2QSTA 2UVFA 3WLBB 5MEOB 1PD6A 1OTTD 1TIUA 1FCGA 1IZJA 4S1DD 3C5ZD 3DUSA 1SM3H 1EJOL 4WW1A 1JZ5A 3RU8L 5CINL 2J12B 3ROOB 1JFQL 5MP6H 4JR9H 5IROC 5E2UL 3TYFA 3O3DB 3MRQA 5IUSA 2QQNL 5A3ID 4I0PD 4V1DA 5DHVH 3FRUA 3DX7A 1M7DA 4DTGH 4MXQC 4XVJH 2R15A 3DVGB 3VE0A 3MRBA 4ZAKC 5D71L 1LO0H 3IF1B 1HHIA 1IGCH 1F6AA 4PRIE 2F19L 2A6DB 5CUSL 2EDKA 3WXVL 1LEGB 4MNQB 2FEDC 4LAQL 2CQVA 3UBXI 1G6RB 3F7PC 5DJAB 3WSQH 5EA0H 4YHZL 2DQGL 3GIZH 4QXUH 3AVEA 5EUOB 1M4KA 1IGTB 3EFDH 4X5XA 1P4BL 2NTFA 3L3DB 4NQDE 1F02I 1U6AH 3EDDA 3HMXL 5BS0B 3BJ91 2NY2C 1MWAL 4LFHG 4IMLB 4JO4L 4M4RA 3SCMB 4U3XA 2YD1A 3JSSA 2NW3B 3SGKC 2FYYA 1NLDL 4ZTPL 2CPCA 1NFIB 2HJKA 3QUYA 4DCQA 2ADGA 2RQ8A 1CT8B 1B88A 5I1JH 1I1YA 3GSOA 4FFVD 2CKBA 1IAII 5KOVC 1BWMA 1AGEB 3VXSA 1DQQB 3LKSA 1S7VA 3ZTNL 3QFJD 3R06B 4PGBA 1GH7A 2OTUB 3NTCH 1CXEA 4UTBH 4WV1A 1JWUB 2JJTC 2AJXH 2AV7B 1SEBA 4G8GA 1JPFA 2BK8A 4MAUH 2FECL 2VDOL 4FP8L 2NTFB 1D7FA 4UUJB 2DQDH 4TPRH 4NO2A 1R6VA 1OAQL 2Z35B 3WIHA 3GMNA 4X4MA 3CFEB 1HXMA 3O3BA 1BHGA 4MJ5B 4AJ0A 4LRIC 1C5DB 3JWDL 1HYSD 4HSQA 4LCCA 3NIFF 5DJCB 1CFQB 3HUJB 4PGBB 4FA8A 1NKRA 3AM8C 1XCQA 1KTDB 3PV7A 1OM3L 2O93L 1UCBL 1J8HB 4JPVH 2GIYA 3IDGA 3G6JB 2R2CA 4HUKB 4BSVA 1T22B 2F54E 3WSQL 2QSVA 1DBAH 4TYUA 4JO2H 3ARGD 4Y19A 1MF2L 1U8QA 2H2SD 1ZSDA 2VOTA 3CPLA 3P30L 1Q9KA 2IG2H 5TQ2L 3WNPA 4OD1L 1Z9SA 1QRND 3N1GC 1F11B 3OZ9H 5BQ7B 3H9SE 2HWZH 4BM7A 2R0KL 2VLJB 3QO0B 4DTGL 3LPFA 2DLIA 3NZHL 4R7NA 2N4IA 4NN6C 5DJDA 5C2BL 1W0WA 3SGJC 4KKCD 2YXMA 4NQCA 5JPMB 5GRVK 4KJQC 3HNVL 3U7YH 1A1OA 3KS0H 3HE7C 4L8SA 1ZVYA 4RGNC 2IMMA 1MHEA 4JE4B 2W0KA 3KYAA 3MRBB 3WUWB 1HOCB 1EERB 3NPZB 5GZND 5CGYD 1T0MB 2AK1L 4H8WH 4TSBL 1QSFA 4L8BB 3RA7L 4JJ5A 1N5YH 1ACYH 4YDKH 4F2MA 1JWMB 4M93C 3RDTB 3WFBH 5JDSB 2XXCB 1ETZB 2YZ1A 2I5YL 4PJ9B 4QRPB 4FFWC 1LK2A 1MWAB 1LILA 3MZTA 5AZ2H 2VLKE 2XA8L 5JNYB 4JREC 3AY4C 2FGZA 3TT3H 5HD8D 4X6EB 1IM9A 2KQNA 2M1KA 2ZKHH 3GMQB 1EV2E 1S7SB 4Y8AA 3TCXA 3ALXA 3DGCR 3OG4B 3NFNA 3C6SB 1DEDA 1DBMH 2FD6H 3GSVB 4YAQA 1QFWH 4YLQT 1ES0B 1FYTB 1DVFA 3B5HA 3FN3A 3RQ3A 3X3GL 2FATL 1WITA 3VXPA 2AJUH 1N2RB 3PL6C 1T89A 1EEZB 5LCVH 5JMOC 4M62L 4RMQA 4OCSL 1LGVA 2VLRB 1DFBL 2Z4QA 3RIFF 2ESVD 4PRID 5CEYA 4N0UE 4ZFOL 1AGFA 3MNZA 4MVBD 3FCTB 4U6VH 4JB9H 1T4KB 3T2QA 4HWEH 3NFSH 1YC8A 4OKVB 4YJZL 2J8UE 2FX9L 2DQJL 4JFDE 4LEXL 4HX1B 3FB8B 4JAMB 4R4FH 5FKAA 3G6DH 3G5ZB 1S9YA 25C8L 4N0RA 1AQKH 1IMHC 4PV9B 5IIEB 4HUMB 1OW0A 2EDHA 3BYYA 5EIQA 2B5IB 2OMNA 3VWJD 1A64A 3QULB 3GSWB 3WFDH 2GK2A 2IALB 3CX2A 4DZBB 1CK0H 3W2DL 4GG6A 1U9KA 3QEUB 3CFCH 5IFJB 2OZ4L 2XY1A 3S37X 3LQAC 4QOKA 2JKXA 2VC2H 3P40A 1BVKA 1A1MB 3LRGA 5E94A 5J13B 5H37G 3QFJE 2BXZA 4RMTA 1HH6B 5ALBH 3KXFE 1WCBA 2X5PA 3W11D 3ARDA 1WF5A 4Q6IC 3DETD 3SJVE 1NBZA 4F9LA 1TZGH 4JFEE 4XNZC 4PGCB 1YECL 3V4PL 2D4DA 2BNUA 2OP4H 2ZSVA 1G7MA 1T21B 2FWOA 2PR4H 5MHSE 3LS5L 1YNLL 4UU9B 1GHFL 3UTPE 4P4KB 4ELMF 3LH2H 2NLJA 5SWSB 3U7YL 5E6IB 4FG6C 1JZ3A 1RUPL 3WFEH 1GCFA 4MX7A 4UQ3B 4Z18A 3TH4T 4Y88A 4MJIE 3L3HA 4Z7NF 1V3LA 3NCJL 1KIRB 2ZP0T 3L5XH 1AJ7L 1R0AL 1F97A 4WU7B 4Y5XC 4DN4L 5IMOA 1CGUA 2FX7L 4OLXL 4PRHE 5DMYA 3CCHA 3QDJB 3BH8A 3F58L 4DQOH 4LIQE 1PGRB 1YNTB 3QR2A 4XZUA 3GSNA 4ELMA 5C0BA 4NRXA 5C3LD 4U0QB 3FHQA 4HIXH 1DBBL 5ISZA 1QA9B 4PJAB 5C0AA 2P5WB 3MLTB 3NFNB 4PJIE 3HFML 3SQOL 2V7NA 3VXRD 3X3FL 1HINH 2J5LB 2Y7QB 5LGHH 4A6YB 3Q5TA 5GGVH 1UKQA 2MKLC 4LAQH 1JPFB 3HI5L 1HHJA 3DMMD 1WICA 2FBOJ 4XVTL 3VFWB 5HXMA 4ZXBB 4HC1H 3SDYL 1XF3A 3RFZC 5J6GA 3PG2A 1YEJL 3U0TA 2APVA 4U0RC 3OAYK 4U1LA 1MCDA 5D2LE 4NGHH 2HFGH 4G8FB 4Z7VE 1IGFL 3QNYA 3HG1D 1A4JB 2X2YA 5CZKA 3ZT6A 3ECBA 3FO0L 1IGML 5IVXF 2V5RA 1SEQH 1DEEA 3UO1L 5ADPH 3QRGH 4E41E 2ZJSL 1U3JA 5IJVB 4PD4K 1MVUB 1IC1A 3O4LE 5EWIH 2PKDA 1MFNA 2NYYC 3CSPA 1VADB 3S3PA 1E6OH 4PRBB 4NN7B 5GJTL 2AQ1A 1A7RL 1CFVL 3QDMA 3QG6B 4Y4FB 5EC1B 4JDVA 1CVSC 5AYQA 5I1AA 1LD9B 4PRPA 1YPZE 5DT1H 3DRTB 2ATPA 1BPVA 4LCIH 3B83A 3DO7A 1KN2L 5HHOB 3NAAH 3DX8B 4GQPH 5GS0C 4DKDC 2NX5B 4O4YL 2ZCLH 1KG0A 1A6TA 4I0PB 5TF1H 5A1AA 4YO0B 4RISL 4WWKD 4YBLB 3RNQB 1DQDH 2HFEA 5JXEC 1XF2B 5FO8A 4AY0A 2FO1A 3D69A 1IT9L 5BZWA 4G80B 2DDQL 4PJFE 2JELL 2H8PB 4I0CC 2EIDA 5F97E 1NAMH 4ZAKA 4OZ4B 3A6BH 4RMWA 3SDCA 4GJTB 5E99L 4OSUH 4NC2B 3SDAC 3UTTE 5T3XE 3MJ9L 4QHKI 4HK0B 4X83A 3UYOD 1MELA 1E4XL 5L2JB 3W81A 2VITA 1EMTH 4U2ZA 2PYFA 3TZVA 1ZVSB 3VMNA 1GIGH 4TOYL 1U93A 1VFOA 3FB5B 1YQVH 1ZLUH 1LP9A 5JOEA 5B39B 1TCRA 4HS6B 4X98B 4EDWH 4KK6D 4G8IB 3D48R 1F2XK 3LD8C 3MRJA 5D6DA 4M8VA 1C1EL 3MR9A 1NKOA 4WWID 3BN9C 5DJAA 4MWFB 4KGJA 4MJID 5D1QB 2ATKA 4HKZB 3RX7A 3RTQD 2E7BA 5HPMA 3OR7A 4U49A 2IBGA 3WMSA 4L4TA 4PD4J 4Y4KB 3QEQB 5CBAA 5TF1L 4QXTA 2HKFL 2J6EL 1PLGH 4XI5D 1MPAL 4AMKL 1UZ6E 4FTVB 1H15B 1JWMA 3U0WL 1QPPA 5T33H 2GJ6E 3BMVA 4RNRB 3FKUS 4ONOA 4OCXL 3HZKB 4HCRH 1KACB 1QYGL 3BQUD 5TPWH 3CMOL 1A21A 1IBGH 3BKJH 4M7JL 3SDCC 1JPTH 3PNWA 4P59L 3WUWA 2D31A 3KPOA 1OM3H 3RP1A 5DRXA 1AFVH 1FV1B 4BFIA 2B1HL 5JR1H 1GGIH 5FCUL 5I8CA 2BHZA 3O0RH 4D3CL 1K5NB 1ND0B 3QI9B 5GRVL 1PKQB 5ITBH 1NCWH 1YMME 3BPNC 4N5ED 3D2UA 5CWSA 4Y8DC 2XTJE 1VGKA 2P7TB 1XH3A 1YEFL 2WBJA 1OP5K 5GRUL 1GAFL 4WY7L 4RAVA 4OD1H 4Y5YB 3KYNA 5F1IB 3DBXB 2NY4D 3PQYE 4YC2C 1ZK9A 2D31B 3KPOB 4NHCL 4OIBA 5TGBA 4PJ8A 5DLML 3FTGA 2BOBB 2XQYG 4NO0B 2G75A 2PO6B 4NOFA 4OB5H 3LQZB 2ZWLT 1U8LA 1U8KA 4HKBB 4HT1H 4Y2DC 5LAXB 4WNQB 3H0TB 3PP3H 2ESVE 4P2RE 5EWIL 3LOWA 2C4FU 1GC1L 3EYFA 2QR0A 5LGJB 3RWHA 1E28A 5D7SH 5FA3B 3M8OL 4LDLB 1QFHA 1HXYB 1PX4A 3CU1A 4LP4A 1LE9A 1C12B 1G9NL 5DQ9B 5LJYH 3K46A 1A14H 4NNXA 2QBWA 2XOTA 1KELL 4P2RB 2E7LA 2F8XC 5ICZA 1CQYA 2Z8SA 1T0PB 3AY4A 1I1AC 2ZOLA 2IH3A 5SWQA 2C3VA 3HC3L 3SDXB 3CXDL 5EZIL 2FHFA 3EFFB 4G6AD 3GHEH 5DJYA 1NFIA 4I4WA 4P5TB 4LLYB 1EFXB 2FLRT 2FJFA 3EYUL 2XACC 1QHOA 4MD0B 4P2OB 1FH5L 4P5MB 2XFXA 1XIWD 3FFDB 4NIKB 4OZHF 1JGLL 2K9UA 5DR5H 3QA3B 1T89C 4N0YH 1RMFL 3EYOA 4GUPA 2H2SC 4J12A 4HPOH 2QJDA 1NAMA 4YK4C 2AI0H 1S7RB 1U3HD 2C5DC 5BW7C 4GXVL 3M1BA 2OQJB 3OKDA 1MFEL 1T03H 4KI5E 1IT9H 1F13A 1FZJA 1NH6A 2IFFL 1DANU 1IBGL 2DTSA 4JO3H 4XBGB 1KSRA 1A7NL 1Z3GH 4KHTL 2UUDK 1F3RB 1EAPA 5A43C 2XN9D 1T66D 1XAUA 5FOBB 1AO7B 4OI7A 1AIFA 5SX4H 3WNLA 3U6RA 5T3XD 4X0KA 4MLSA 1F58L 1KFAH 5IJVA 3VXQB 3P4NB 3HMXA 4JKWA 4MA8L 4WI5A 5HJ3A 1FZKB 4EKXA 2CSPA 2I07A 4IRSA 4H1LH 4O5LL 4WJ5B 2PCPA 4PJXF 4G43A 5EUOF 5GXBB 3SOBH 5I1CL 2H26B 4Z0BH 5IHUL 3U4BL 5B39A 1MRDH 1ZGLA 1JE6A 5BJTB 4AM0B 2C7UA 3Q6FB 1QLFA 2FJGB 3AS3A 3FL7A 4F7TA 1FDLL 5F7KC 5FM5O 5DQJB 1AGEA 3ZKMD 2FZ3A 1NLBL 3C6LC 3F7YA 3V5KA 5IMMB 3ZMRA 3BEWA 3EW3B 1I9JL 4WV1C 5F8QC 4W6XB 4WDIA 4ACPA 4C83B 2Z31C 4LCCB 3AREC 1MJJB 4PREB 2EDRA 3MRKB 2XT1B 3MJ9A 5DVLA 2FR4B 5L9DH 3FO1A 1QR4A 3QJFB 4MNGB 2N1KA 3L3KA 5DHVB 5KS9F 1C12A 5DQ9A 4X5WB 3WJLA 2Y7QA 1XR9A 4IHOA 4YHLL 1FN4A 4I2XE 4D94A 3QRGL 4JQXC 4MQXD 4KK9C 5KZCB 2BHUA 1R5IA 4UIMA 5EUOE 3O6KH 1QSEB 2Y06H 3QI9D 4PJ9C 4Y4HB 5CIPH 1FNAA 4FQCH 4EDWL 3ZKQD 1FL3B 2Q3AA 5DK0B 1KIUA 1CIUA 4NZUH 1MQKH 1OWWA 3HUJF 5CJ8A 1HSAA 4LLQB 4Y1AA 5FYLL 3EYSL 4JFOB 4P5KA 4S1DC 2Q1EA 5BXFB 3G5ZA 3DMMB 5KS9A 3K4ZA 1HKFA 2VKXA 3PQYB 3S35L 4KXZI 3O11A 5I8OL 2V2WA 3OKOA 2X9XA 1HHGB 2BVPA 1GZPB 3H7LA 5HYJB 4PRHD 3MOAL 5C07A 1N2RA 2D4FA 4AT6A 1ZT7B 4YPJA 1JJUA 1OAYH 1SVZA 1RAMA 2VLRA 3VFTB 5LXGL 2X05A 1CF8L 1DBKH 4QHLA 3QEHA 4LLMA 3ULVE 1KT2A 3F5WA 3MACL 2PW2B 2UUDH 3KPQB 5DJXB 3WFBL 3VGAB 1PKQA 1NDMB 5GRYA 3OB0K 2VQUA 3W0WB 3JTTA 5D5MA 4XAWL 3IU3B 5MEND 1ETZA 3EDEA 3SCMD 3D0LA 3H9HB 1INDH 3PGCA 4C56A 5T5NF 1G7HB 3S37H 2APXA 4X6EA 4OLZH 12E8L 2IH3B 4XNXL 2PTTB 4Z7VF 3AUVA 3C5ZC 4XAKE 1I1FA 1I1AA 1W0YT 1A1NA 1LO2L 1A5FH 4QOKB 3UPRB 2UWEF 4YQXH 3WNMA 3NIDF 3UROR 1PQZB 1IM3A 3CFJA 4U1HA 5D72L 4JJ5B 1LE9B 1LK3H 1R5VB 4WHDA 2CRYA 3RWIB 4IRZL 5GQBA 3DV4B 2EDEA 3JV6B 1XGYH 5TE4H 1AP2A 4NQEE 2CH8A 1U8MB 3VFTA 4LASL 4PJDE 3T65A 2EICA 3ZSTA 4M43H 4JFQB 5HGDA 1ZMYA 3TA3D 4LU5H 4O00A 1T83C 3WDJA 2B2XL 3ZHKA 5F9AC 5HPOA 4NNYA 5CEYB 3DJ9A 2X41A 3VGFA 3WIFA 1S7TB 2MFNA 5EBGA 4BZ1L 2OK0L 2EDQA 1FO0A 4NO0A 1MIEH 2BRQA 1KIRA 2FO4B 1QLRA 3N85H 2ARWA 4PY7B 4JDTL 4CJ1A 3ULVH 3KLSA 4IOIA 1U8OB 3KWWA 4XMLH 4L3EB 3NCMA 5HYJA 4LEXH 2YXFA 3LDBC 4G9DB 2CIIA 1BAFH 4JG0L 3ZE1F 4K3JL 2X89A 2ARJQ 2K7QA 5JMRA 4MSWA 4BH7A 2ILLA 2G5BA 3BPNB 4UAOB 4RDQG 4QXUL 3PV6A 1A6WL 2YA0A 3P0VH 1TQCB 3MRCA 4YNYA 2CLVB 4F58H 4NZTH 1U3HC 2V5SA 3W5MA 4RZCA 3IDIA 1XCTA 3PP4H 1CGSL 4KV5E 4Y4HC 3FQXB 4DUWA 4F8QA 3E8UL 4W4OA 1ZWIA 5SWZD 3FO9A 1GHFH 2JE8A 5CP3H 2MMXA 5FDWA 3NN8B 3V9FA 3BIKB