2XWTB

Crystal structure of the tsh receptor in complex with a blocking type tshr autoantibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSDIGSNYVSWYQQFPGTAPKLLIYDNNKRPSAIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSRLGIAVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/immune system
molecule keywords THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 HEAVY CHAIN
publication title Crystal Structure of the Tsh Receptor (Tshr) Bound to a Blocking-Type Tshr Autoantibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2010-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtB01
1YC7A 5JXED 5E99H 3FOMB 3M8OL 3BSZH 2NY5C 3OSKA 4X80L 3B9EA 1FO0L 3FN3A 4UUJA 2EDKA 5IR1A 2VDRH 2Y72A 1DDHB 5CJ5A 2VQUA 1UXSA 4FTVE 2Z9TA 5E56A 3RWDB 1MLBA 1QSVA 3EW3B 4X6CF 1QSFE 3SJVB 4D0BB 5CEYA 3KYKH 4MXQD 1JGDB 1JGUL 5IM7A 4Z8FL 4XCEB 4H88L 2X4TB 4KHTL 1YUHA 5BVPL 5JPNB 4HC1H 3FL7A 2CMRL 4R3SA 5IB3A 4LCYB 3MA9H 1WCQA 3BP6A 4QF1A 3WXVH 4B53A 3NFNA 4XZUA 2QEJA 3P9MA 2IJ0C 4U6VH 3VFNB 1ORQA 2HTLD 3LKRA 1OP3H 3LB6C 4Y16A 4FFVC 2F19H 3F58L 1S7XB 4M61B 3V7AE 4Y4HB 4H0HB 3RVWC 1GOGA 5KVFH 4G6AC 3KXFB 1R5WA 3B5HA 3U48A 1KLUA 3IETB 2ICWI 3HR6A 1JPSH 2X4UA 5ALCL 5DD1H 2HFGL 5DR5L 4JRYD 3VFWA 1A22B 5BQ7A 4MA1C 5JOFA 1EEUA 1BWMA 1NCAH 1C1EL 1TJHH 5DURB 5H37H 1WZMA 4WI2A 4TNWF 3HZYA 5ERWB 1XGTA 5E2TH 4OF8A 5D5MB 3B8SA 2M26A 4XPFL 1OP9A 5L0QC 2DF3A 2CDEA 2FDBP 4QRTB 1Q9WA 1OD9A 3SCMB 2WIMA 7FABH 5HYSA 4JR9L 1NLDH 3VFOB 1XGQB 2NZIA 1HWHB 3V8OA 4KJYA 3FMGL 4BQ8A 4P2QA 4ALAH 5I30H 5FCUH 2EXWD 4NQUA 3GKWH 3IU4H 4Y5VB 3WLWC 5HYFA 1MRCL 5DQDH 4F57L 3FQRB 3ARFC 1GSMA 3BUYA 1LD9B 2I24N 3HZMB 5HHVL 3C60A 2DICA 4TVPL 4HWEH 4N1HB 2OJZH 2BSTA 2HP4A 3GMLB 3X17A 3VMPA 3HC4L 3CDCA 1FAIH 4X6DF 4K9EL 1MI5A 5DHYB 3GNMH 2P43B 3RBGA 2JJTA 3CGTA 5IV2A 4MWFA 1EERB 3HRZA 4J3UA 2CUHA 1EZVY 2D0HA 2AJYL 2EIEA 2AQ3A 2Y06H 4HEME 3EZJB 4K7PX 4HUMB 1HHKB 2FEEI 2HKHH 4MQ7A 1X4XA 2HKFL 5EO9A 4CU6A 4YUEL 5EU3A 2EIZA 3B2VH 1O7VA 2MSPA 1NJ9B 2XTJE 1NUFA 4LGRB 3CPLB 3W9EA 5CD5C 5DDHB 4UZGA 1G7QA 4P4RB 2WBJC 1KCVL 2N56A 3V8CA 2HFEB 2OSLA 5IQ7L 3MBEB 4RAUA 5JR1L 5CJ8A 4DOHE 3LMJH 1QSED 4QHKI 1EHLL 2FWOA 2KKQA 2VC2L 3U9PL 3ARZA 3FN9A 4R4NC 4RIRA 1U8NA 2A83B 2EO9A 4ZXBA 5M94B 3I02A 1RJZA 4KRPB 4H20H 5EBMA 4UDUB 3MUHL 3O2VH 1DEEA 3UTTA 5FM4A 1P53A 1C5CH 4L4VD 4XVTH 4OF3A 4L4TA 5I75C 5D7JB 5GRXG 3ARUA 5EOCH 1F6AB 5GGRB 4JFYA 4OQ1A 3BIKB 4UT9H 4LCCC 4P5MB 5EC1A 2VL4A 1J7VR 1F8TL 3UMTA 1OLZA 3ES6B 3PL6B 3OKEB 3AXLA 1FPTL 5DRWB 5FO9A 2FB4H 4JZJB 4M6NL 5I8OH 2ZNXA 1LWRA 1V05A 3MV8D 4HS3B 5KOVC 1G0YR 2ZNWA 1TCMA 3LQZA 2XN9E 1ORSA 1RUMH 3MRJB 3BKJL 3HMXL 1U8PA 4U33A 1VFBB 3RUGB 5GS1B 3VFMB 2YUVA 5HYQA 5DMGD 1R3IL 1Z6JT 3QUXA 4G7YL 1P7QA 2FD6L 4Q2ZB 4LRNH 5F6HJ 1ZT4B 5GISL 4JFXA 4GXVL 2CGRH 1L0QA 4YHOH 5IMOB 2IFFH 1XF2A 3MGOA 3ARWA 3FB8B 1RULL 2B1HH 1RHHB 2H8PB 3TA3A 4FTVA 1HILB 4K7PL 4O2EA 4OUUB 3HFML 3BHBB 1MWAB 4QHUA 5F93C 3TA3D 2X10A 1LO2H 1E4WL 2YD4A 4JDTH 3DV4A 3IDIA 5DHVA 1UYWH 1S9XB 2NX5E 2PO6B 2VAAA 5I73B 5FA4A 1IILE 3CDYA 3S8WA 2VITB 2Q6WA 4ONFL 1OW0A 3UPRB 2IG2L 5C0GB 2J88L 3ORJA 1JWUB 5BRZD 4KKNA 3QUZA 4PRBA 1J5OL 4GMTL 5KVDL 1HDMB 2VLJE 1UA6L 4PTTB 4TN9A 2H2PC 3CFDA 1A7NH 3BEVB 1CDHA 1F4YH 1DN0B 4C83B 1YEGL 5I1EH 3GSNA 4TPRL 4JFPA 3ALWA 4P4KA 3G5YB 3V7MA 4LHUA 2ZCLL 2H26B 2W0PA 1YMMA 4YEEA 5ACZB 4PJXE 1G9NH 3LAFA 4K2UH 2JJUA 4FQPA 5MEPA 1G6VK 1NBYB 2GK0B 2ZPKL 5D7IF 1WZ1L 4IDLA 1ZS8A 2YD8A 1XR8B 3U7AA 2AV1A 2ADGA 5B39G 4GOSA 5IFJB 3BZ4B 4I48B 4IRSD 1SYVA 3INUL 4OF6A 4P46B 1RZJH 2A9MH 3TIDA 3GEWB 1C5BH 4YXLH 2YD9A 3MACL 1FFNB 4GRWF 1FZJA 5D71H 3VA2C 4LQFL 1B0GB 5TDPB 3ARXA 3RWIA 2DLFL 3HB3D 1QQDB 3PNWB 3LKNA 3BH9A 4MXWL 1P7HL 5TQ0L 3JVGA 3GJFB 3AY4A 5F8RC 4PJCA 4PJ9C 2FATL 5A2JH 4K3JH 5FHAH 4OSUL 3QEQD 3QDMB 1WV7T 4NQED 2QR0A 1QBMH 2HN7B 5LG1A 1WC7A 4QOKE 1U3HA 1UADC 3BPOC 4KKAD 5E00B 3UDWA 3IDJA 1KC5L 3V0WH 5DI8B 3W0WB 1Z9LA 1UCBL 4GAGH 4J8RB 5IBLC 3UZVB 4YHZH 1MHPH 4P5TA 3DURA 4MLIA 5AG8A 4KV5F 2Q8AH 1UB5B 3LDBB 2DIJA 2JTDA 5DZLA 2BC4A 3IKCA 4XMLL 1WBZA 3BP5A 1FG2A 3JUZA 3H6JA 2X4SA 1AC6A 5K9JH 3VRIA 4ZFOA 1IEBA 3O3BA 3O8XC 5JZ7D 1KYOJ 5KSBF 3N50A 3HC0B 3OKMA 2FBOJ 3PWUB 4XCYB 3B43A 4HFUL 4PJDF 1DZBA 3Q5OA 3MMEA 4V1DA 3K0WA 2NY2D 3QFJD 3C08L 4G6FD 3ULUH 4RNRA 3NMEA 5IG7B 3CFCL 4UTBH 3ILPA 4F3FA 1OARH 3L5XL 1A4JA 3BW9B 2VDPH 4PJ7B 4FQXA 2VQ1B 3MGTB 2AV7A 1LNUB 2DWEB 4JM2B 4ERSH 5CP7A 5E6YA 2PTVA 1KN4H 1YEEH 1HQRB 3GMOA 3LOWA 1EHXA 1BQHB 1FZMA 2YS4A 3BGMB 3RIAK 1ZSDB 1ZANL 3W82A 3S37L 2HLFC 4OM1L 5I2IA 1BQSA 1K8IA 1FLRL 2CLRA 4K71C 2VZOA 1YEJL 3LN4A 4NKIH 2Z92B 4G6MH 2R0WH 1A3LL 2BFVH 5SWQB 4NKMB 4OLVL 3B9KC 3EYSL 4YPGB 1MWAH 4AEIH 2NR6C 3U83A 2J4WH 2CR3A 1AGBA 4HBCH 4GRLB 4YBLC 5F7UA 3LRSA 1I9EA 1HHHA 1G6RA 4LPYA 1FV1B 3DX7A 2X1WL 2EDYA 3F7PC 1OAQL 1JNNL 1WTGT 1Z3GL 4IJ3B 1YC8A 2GJZB 4PJGA 2Y5EA 2FEEL 3VCLA 2AK4D 4P3DB 4WI7A 2A6KB 3H3PH 4GW5A 4NWUL 3DVNA 1HHJB 2YUWA 1GIGH 1YPZA 4YFLI 1QLFA 2YZ1A 3ALPA 5FHBL 1N64H 5DJYA 1IGIH 5I8EB 1NGYB 3BKML 3VG9C 2P5WB 2LU4A 1U0QA 3V6OE 4AYFA 2IBZY 3QDAA 5FA3A 1XIWC 5MHSE 1BFVL 4HJJH 3OB0K 1H0DA 5HDBE 1DLFH 3GMMB 5F1OB 3U4EA 4HHAB 5IB2B 5ISZB 3TVMC 1A6ZA 2CLZA 2E9WA 3CX2A 1UJ3C 4UOW0 1ZKAA 1WAAE 4OCMC 4S2SB 1INDH 3QBTB 3MLXL 5L6YL 5BJTA 4RMWA 1I7UA 3O4LA 4G5ZL 2DDQH 2IH3A 4A2LA 3R8QA 4HH9B 1EO8L 4MNHA 2OP4L 3KPMA 3GJFH 4XP5H 5E9DA 2DQEL 5J9PB 2APWA 3QR2A 2E7LC 2Y7QB 4G8GE 1UKTA 5ICYA 1EVUA 4J3VA 1OCWH 5TE4L 1HNFA 3VD4A 1F00I 1NC4B 2P8PA 2I9TA 1J0KA 1DQJB 4KFZC 2CR6A 4BZYA 4OZIB 1G7LA 5LAXA 1JF1B 4ZPTB 3EDJA 2HJLB 1V7NL 4JQVA 1JMZA 3D25A 4GLRH 4FFVD 4Q0XL 3QZWA 1TNMA 1BJ8A 5SX5K 3N1QC 3CZFA 4HKXB 1FGVL 1ACYL 2V2XA 4HZLA 1D5ZB 3RDTB 4KK5C 3SDXE 1TETH 4YIQA 3LEVL 3RVWD 4OLXL 5DJ6A 4IRZL 1T1XA 3DETC 2DLTA 3TZVC 4BSWA 25C8L 5GXBB 1P2CA 1BWWA 3N9GL 4WCYH 3MXVL 1A6TA 4XMKL 5KVGL 3KNBB 1NFDA 1R3JA 5EIQA 4AK1A 3PHQA 2AKRB 3VXMD 3B2UC 3REWB 5I1KH 4Y19D 1E28B 5IK3B 5CP3H 3K74B 4CJ0A 5L88H 1RUAL 3ECBA 3QO1B 4QRPD 4Y4FD 3X13A 5DVKA 3ZYZA 5KS9F 2YPVH 4NHUB 4R26L 2FX8L 4ZAKB 1RZJC 5CINL 1CR9L 1VSCA 3UTZA 2EDWA 1GCFA 4GG6E 2Z0BA 3C5ZC 2QSQA 5J1AA 5F1SA 5F9WB 2VLLA 4WFEE 1QR1A 4QRRD 2Q7NA 3PWPE 4OLUL 2X44D 4DGVH 1CE6B 1J0JA 1RK1A 5IVZB 4JRXE 1HZHH 4KI5E 3VFVB 5B4MC 1KGCD 2X89A 4JN1H 2OR7A 1UM4L 2D4DA 4Z76A 4N0UB 3WFCL 3MJ8A 5KSAB 1FP5A 2JCCE 3VXQB 2EH8L 3VXSA 3FOLB 2LU3A 5CBAA 5FO7A 5DQJA 3B6SA 1U92B 4WUKH 3BMWA 4FFYH 1A7QL 3H9SE 3NH7L 1N7ML 1ADQA 1ND0B 5HXMA 3U4AA 4I5BA 1AXSA 4Z7WF 2J5LC 4JE4B 4X99B 1JN6B 5D7LD 2NLJB 5I1JL 1VFAB 2W59A 3ULUC 3L6FB 5EZLA 3P30L 2FR4A 4LSVL 1RVFL 4MZ3A 3U0PA 1A7RH 3UYPA 1YNKH 5C0BD 2G5BA 3DNKA 4UAOB 5H35B 5I76A 3RL1B 3UYRH 5DSCB 1NEZB 1YY9C 5HHPB 3LSOB 4WUUA 3OR6B 1HQ4B 3QUKB 4LKXA 5KW9L 3V6ZB 5TQ2L 3SDCC 1FL6B 1OPGL 2ADFH 2WWMC 4KGJA 3I3BA 4KMQA 3DROB 4Y5XC 1ED3B 1VADB 5EZIH 5DA4A 3L95B 3EYVB 5HY9B 2PYEB 4QYOA 3G6AB 3T65A 1A3RL 1OGTA 4RMVA 4M3JA 4W81A 4RISH 1RU9L 1C7SA 4L8CA 1G7HB 1DANU 4CMMB 3UTSE 1YEIL 4TUJB 4PJEA 5GSRB 1JHKL 4J7RA 4OLZL 2BHUA 5ITBH 5C0RH 2X7LA 1Q0XH 1JNLL 1TQBC 5I74B 3JV6B 3FQXB 3A6CH 1YEHL 5KBNC 3NN8A 2GCYB 1TVHB 2XZQL 3T2NH 1S7SB 2B5IB 3WN5C 5IHZB 3WLBA 1J1PH 3BVNB 3C87A 3DHMA 5K9KB 1GGCL 3I9GL 1BFOA 4YFDB 1KIRA 4ZUWA 1PY9A 3NGBC 1Q72L 1QD0A 3T0EC 2BVPA 3MRFB 3BQUB 4HPOH 3RTQC 2AQ2A 1JWSA 3PQYE 1FO0B 1JGLH 3SPVA 1NGWA 3D69A 1AFVH 4MNQD 3GSRA 5FGRA 2HVJA 2Q8BH 2JIXA 5DMIH 2AJSH 5DS8B 1NGPH 4FP8L 4WGVB 3LPWA 5BV7L 3BKCL 3Q1SL 3RX5A 3S4SB 4JFQA 1CL7H 4NUGH 2R23B 1B9ZA 3D3VD 4LF3A 3VRLE 3LEXA 4XH2B 5EU7E 1GGYA 3V6FB 3Q0HA 3FT4A 1ZEAH 4NO0A 5DF0A 5JLZA 5ID0B 1U8HA 3SDXA 1FVDA 1QNZL 5DD5H 5T3ZE 5C8JB 3ZKND 4X4XA 5I8CA 4XPTH 3GSXA 4M03A 2LE9A 2ZUUA 5ANME 2R1YA 1MY7A 1T1WB 4NRZB 1O5DT 4NRXA 3S7GA 4PJBE 4K23L 5TDNA 1DBBL 1S3KL 1N6UA 4JFED 1MHCB 2C3WA 3D1MC 3MNZA 4NCC1 4I4WA 3QXDB 4BM7A 1I9JH 2WINB 3UBXA 4LSPL 4FABL 1EH9A 1DE4A 5ABDE 5ICXA 1N5YL 3BPCA 1PKQE 3MFFA 3LDBC 5F1IB 3E6FA 4F80A 4LDEB 1OSZA 5IR1B 3BN3B 4ZOBA 2IANA 2JB5H 1UXSB 1BJ1J 4XC3L 2GITB 1CGYA 1LMKA 1MLBB 5DWUH 5EUOE 1DLHB 2IAND 4H5SA 2QSCH 5CEYB 3S88L 3QIUC 3CLFH 2M1KA 2JCCA 2F15A 3ROLA 1GGTA 5JW5B 1AGFA 5SWZA 4OGAC 2H1PL 4OFPA 4R3SB 5IB3B 3S5LA 1F11A 3T3PE 5HVGB 3BP6B 2R2CA 5DTFA 3MCLL 1KPUA 1MAKA 2ESVB 4U1GB 4DVRL 1AC0A 3MRGB 3NFNB 4NFCA 1BX2B 3P9MB 4JPVL 3RY6A 3H9SA 4OGZA 4G7VH 4WEUD 5GJSH 3LKRB 1ORQB 1RPQA 2R4RH 1T5XB 3MUZ1 4J1UA 4Y16B 1MRFL 4XP4H 3EKCA 3P11H 4G80A 3TBYA 5EU6A 1U3YA 2V2TB 1N6VA 1RMFL 4YK4C 3G5VA 3PWJB 3R1GH 3EDDA 4H0GA 2NY1B 1R5WB 5EU6D 5HHXL 3B9DA 1KLUB 3ZYOA 5LCVL 4TULH 1KXTB 4JFFD 4FQ2H 3C8KA 5BQ7B 1QBLL 4BUGA 4FZEH 3TFKD 4JRWA 1TPXC 3OJMB 4MGXA 2QQNL 2VO5A 1CFNA 2NY3B 3O6KH 1K3ZA 1XGTB 5FYKD 3TWCL 1FQ9C 1JGEA 3VRJA 4HXBH 1AD0B 3EJJX 2YA2A 2HVKB 4M7LT 2CDEB 4ODBD 2WQRA 3OKKA 4Y88A 5GIRB 3GJEB 3A67L 4MAYD 3RX8A 1Q9WB 1UZ6E 5GGSB 3C8HA 5HYSB 2VIRA 3B9KD 2H2SC 1S7RA 1T83A 2N7BA 2BJML 3M8OH 2HTKC 5IFAL 4L8DA 3HAEB 1X7QA 3O6FC 3WNKA 4X80H 2CIIA 4PLKD 3LD8B 1FO0H 4LRIC 3ZT6A 3EO1B 4YNYB 5A40E 1LP9F 5LQBL 4X4ME 5CBEA 2BCKB 3C60B 3VDAA 4OM0L 2BSTB 3J8F7 2F54A 4TOYH 1EO5A 1MFEL 1JGUH 4Z8FH 2FH8A 2NY6C 4H88H 5H2BA 3RNQA 4U1LA 4KHTH 5BVPH 3TBWB 2F54D 2ED7A 4EKXA 2CMRH 1MCKA 1PSKL 2DM4A 1UWXH 5IV2B 3MLWL 4MWFB 4MQXD 3HRZB 4JRYE 1EPFA 3IS0X 1HSBA 4XXCC 5FYJD 4F2MA 3WKML 1YMHB 4I77L 5EO9B 3QDJD 4S0TD 4X5WA 4PJ8D 5EU3B 2EIZB 1KG0A 3FQUA 3I2CL 3F58H 4RFEB 3RIFK 1MCCA 3W9EB 4U31A 3LPGA 3EJZC 1F3DH 3HI5H 4R7NB 3RZCD 2OSLB 3W11D 1XZ0B 4GQPH 1JZ2A 4CU7A 1MPAH 4HIXL 5SWSD 3FB7A 2FWOB 5DR5H 2HFGH 1LK3H 3JWDH 4RIRB 1XH3B 1HXYB 1U8NB 3VA6A 4ZXBB 5BO1L 5C09D 1RJZB 3EOAA 5EBMB 5F70A 4PYGA 3WCYA 1DEEB 3UTTB 4PBXA 4WU7A 4O4YL 4L4TB 1CCZA 1CXFA 2W0LA 3FT2A 3UAJC 5EZOL 4UBDD 5C3TA 4X0KA 1RURL 1KJ2L 5DJ8A 4M7JL 5EC1B 2GK2A 1D6EA 4LCWA 1B0RA 4PJBA 5DFVC 3AXLB 4JPWL 4JR9H 3BWUC 4XCNA 5BXFA 5FO9B 2DQGL 4JY5L 3QPXH 2D03L 5FK9A 2VSDA 2DD8L 2OTUA 4FQ1L 5I0ZA 2K7QA 2CLVA 1ORSB 1T0MB 4ODWA 1AR1C 1MRCH 4F57H 3TZVD 4C59B 3VWKA 5DYOA 4EJ1C 3CIQA 4CJ1A 1LILA 1AP2A 5HYQB 5HHVH 3EUUA 3I6LE 4N8CL 1F4AA 4TVPH 2AP2A 1M7IA 2EEAA 3L5IA 1RJLA 3QUXB 1P7QB 3VWKD 5IB1A 1WF5A 4JFXB 3HE7D 5CD3B 3RKPA 3HC4H 3P0VL 5D1ZD 5GGTH 3MGOB 1XF2B 3HA0A 4K9EH 4FTVB 1BECA 1BJ1H 2BVOA 2DI8A 2EDRA 3IB4A 1AD9A 3I85A 1QSEE 2XNAA 2PUQT 3OKOB 3CVIL 3K8LA 2AJYH 4LLVB 4S1RL 3L3KA 5DK3A 3IDIB 4JG1L 4L4VE 5FA4B 5A3ID 1XF5B 3FT3A 3G6JE 3MA7A 32C2A 1IM3B 4K3HA 4Y2DA 4YUEH 5IHLB 1XEDA 4FA8A 3ULVE 3T3ME 1RK0A 4OZ4A 1A3QA 3BYTA 4MB3A 4TYUA 5T3ZL 3QUZB 4PRBB 4Y2DD 1KCVH 4LHJB 5IQ7H 3DIFA 2A6JB 3QEHA 5JR1H 3GSOB 3ZYIA 3CFDB 3CH1A 4AIXA 1EHLH 2V9QA 2VC2H 3MV8E 4M7LL 4HX1A 2YMXL 4PRPA 5ADOH 1C16A 1UKSA 4RA3A 4JKPL 3F8UB 5B3JE 3GSNB 3HAEH 4YO0B 3BD3A 1I85C 4JFPB 1JZ5A 4P4KB 2ICWB 4OFVA 4LHUB 4Q9BA 5IVNA 4CN1A 1YMMB 4HWBA 4L9LA 1H5BA 3P77B 5MEPB 2QLVB 2W60A 2EECA 1W2KT 1K4CA 2YWZA 1S8DA 1F8TH 4C57C 1JZ7A 1FPTH 1PGRB 4HT1L 2R2HA 2W0KA 3IAQA 1SYVB 3ARDD 1LDPL 5DJ0B 4ZS6C 1DTUA 1LEIA 5F7MC 3BKJH 3RWIB 4XVSH 3HMXH 3LKNB 3SN6N 4C56A 2V9RA 4RGMB 3TT3L 4PJCB 1GAFH 1R3IH 3MYJB 2FD6H 5GISH 4GXVH 4C58B 1EHNA 2QR0B 3T4AA 2O5YL 1BJMA 1WC7B 4AEEA 3CSPA 2MPAH 1RULH 4UILL 4K7PH 3QXAA 4DFHA 1NL0L 3HFMH 5HYIA 3IDJB 3STZB 2XZCL 3BP7B 2LTQC 1IQDB 1E4WH 3QIWB 4P5TB 3ULUF 4X5XB 2FGWL 2D7TL 4MJ6A 4P2RA 1CDGA 2GYSA 3OHXA 5D1XB 2BC4B 4OZFA 1WBZB 1FG2B 2X4SB 4ONFH 4F15B 1KB5A 1IEBB 4DZBA 2IG2H 5IBTL 2J88H 4P2RD 4PJAE 2FX9H 1J5OH 3OKMB 3S98A 2YWYA 4GMTH 5KVDH 3N1PC 3MMEB 4FZ8L 2OM5A 4V1DB 4P5KA 1UA6H 3RUGF 4BZ2L 4ENEC 3S96A 3ILPB 4NT6A 4F3FB 5CUSL 1A4JB 2VLRE 4HIHA 4NQSA 4H25A 4FQXB 5FUCE 4ISVA 3GI9L 2PW2A 1YEGH 4X6DA 2R29L 4NNYA 1IM9A 5AWNL 2PTTA 4QT5A 3FQWA 3QI9D 3OG6B 1K8DA 1OWRM 4Z18A 3BEWB 3MRPA 2XXMB 4YXKL 4LBEA 2YA0A 5FKAB 3VG0L 4PTUA 3UC0L 1XFPA 1WZ1H 1K8IB 4O58L 4U05A 1MCPL 1SYSA 3VI3F 4DK3A 2LVCA 5EA0L 3STBA 4KJQC 3INUH 4JY6A 1IAKA 4ZFZA 3MACH 4LDLB 4JG0L 4LQFH 2W92A 2DLFH 1Q9KB 1RV6X 4LP5A 1I9IL 4MXWH 4WRLA 1PX3A 2IPKA 5TQ0H 2VUYA 4LVOC 3ARBC 3JWDC 2DQCL 3LRSB 2XN9B 3PHOA 5D72H 5DJDA 4OSUH 1D5MB 3WO4C 4IOSD 5MERA 3DX7B 4ORZC 4DGYL 1KB5L 1CFBA 1B4JL 3RP1A 4CN4A 4QRSB 2XI9A 4PJGB 1MOEA 4R90L 3VCLB 3PXHA 1EMTL 3SO5A 4HBQA 4RMSA 5DRXB 5C0EB 1KC5H 1VEPA 4GW5B 3FKUS 1T0PB 4U1IA 1UCBH 1TQCB 4G3YH 3TBTB 5E8DL 1QLFB 5DJYB 4CADA 5B8CC 2GEEA 1S7UA 1NANI 2YD1A 5GRYA 3UP1A 1QFUL 4XMLH 4M3KB 3W2DL 5C0CE 3ALXA 1WT5A 4Z5RA 5MI0B 2HAZA 1H0DB 3ZT7A 4HFUH 1CD1A 2JLLA 3C08H 1GGIL 4HKZA 4WWKD 3CFCH 2IAMD 3H8NA 3MODL 2WP3O 1A6ZB 2CLZB 1ZV5A 4BH7A 3L5XH 5HHOE 3S9DB 3DGGA 5BJTB 4WFGD 1I7UB 3O4LB 2DMKA 3ZKMD 5CLWA 1LE5A 1PX4A 3FZUC 4X4YA 5LVEA 4K9EC 1LDSA 3X12B 2FRGP 4XGZA 2VLJB 5AD0A 1A2YA 5BCAA 2IH3B 4N5EC 4PJ5D 2R8SL 1I1AD 3WIHL 4G8EB 4MNHB 3KPMB 1ZANH 2EEDA 5E9DB 3JV4B 4NKQB 5D2LE 3U46A 2F58L 3S37H 4OM1H 3VWJB 3FB5A 5EORL 5ICYB 1QFWL 1FLRH 4CAGA 1NMCC 1FYHB 2P8PB 3C09C 2I9TB 4KHXL 4S1QL 1SVZA 2AK4E 4ZDHA 1A3LH 5TDOB 3TH4T 4IDJL 2VZ1A 2ATKA 3HNVL 4OLVH 4QY8A 1CLZL 1EGJL 3EYSH 4KKLD 2P5EA 4WNQA 4OIBA 3QZWB 4QWWC 3H3BC 1X5KA 2SEBA 2PETA 3DUUB 4YIQB 5HDQL 5I1LA 1T04A 1CIDA 5DJ6B 1T1XB 4MJIA 4PJ7F 1D5BB 1A21A 3KPOB 1IC4L 4BSWB 4IBLT 1M7DB 1P2CB 3VXRE 4Z77A 1OAQH 1JNNH 4KK8D 1Z3GH 1A6TB 4YZFF 3E2HB 3G04A 5E03A 3QH3A 5CJXC 2XQYG 1NFDB 1R3JB 4HDIA 2LAAA 4XBPB 5D7IA 4NWUH 3PHQB 2WM0A 5C9JA 4XHJC 1MJ7L 5FHBH 2EIBA 5I16A 5L2KA 3BKMH 2C1OB 1EIBA 5FKPA 3X13B 3B3IA 3L5WA 3D2UD 4U1JA 2MMXA 2HMIC 1U8IA 1BREA 1DQLL 4M7ZB 4KZDH 5CZXC 1BFVH 3K81A 3UTZB 1KEML 4LKCA 4OCWH 5J1AB 3ARRA 2VLLB 1S9KC 3RVUD 1VKXB 1CE1L 5A43C 5F9DC 1XF4A 1X5IA 2PW1A 4LLQA 3EAKA 2AJUL 4PJAA 1RK1B 3MLXH 5L6YH 4HXAL 4X6EA 4G5ZH 3U30C 2H6PA 4UB0L 1WBYB 4RDQF 5E4EB 1VB9A 1CBVL 4N68A 3MJ8B 4M62H 1EO8H 3QIBD 2OP4H 5AZEH 1KNOB 3VXSB 2DQEH 2OZ4H 1S7QA 5DZOA 3MUY1 2Z91B 5FO7B 1U95A 2R4SL 5DQJB 3B6SB 3GZKA 2FCBA 2K1MA 3VFRA 1NEZG 2AW2A 3BRDA 2DL2A 1AXSB 4PJDA 3CDGA 1WFNA 3L3HA 1HCFX 1T1YA 5FYKU 5GZOD 5DK2A 4Q0XH 5HDLA 1JZ4A 4Y19E 3C6LB 4XCFL 3MZGB 3FHQA 1FGVH 1ACYH 2W07A 2Y07L 2YD3A 4JKLA 4QRPE 3LEVH 3U0PB 4OLXH 1YNTA 1QLRB 4WTZG 4IRZH 1MCJA 2G5BB 5DO2D 4I0PB 4JAMA 4NC1E 1EFQA 5I76B 1FSKC 3N9GH 1H3GA 3MXVH 1UM5H 3WSQL 3LPFA 4XMKH 3EHBD 2FHBA 1T2QL 1CT8A 5KVGH 3GSUA 2F5BL 4WUUB 4DGIL 5C0JA 3B4NA 4AIZB 3HG1D 2OMBA 3ZDXE 2BNQA 3OB0H 3EJYD 4LKXB 3NPSB 3GBML 4GBXC 4IRJA 3AREA 1SY6H 3MRRA 2Z31D 1RUAH 2V17L 3HE6A 4Z0BL 4QYOB 4R26H 3T65B 2FX8H 5HHMD 2BX5A 5CINH 1X3DA 1CR9H 5T1LB 1OGTB 5C08A 4YHKL 3MO1B 4L8CB 3HE6D 4NN7C 2P47B 2W65A 3BO8B 3A6BL 4Z0XA 2GHWB 5HD8D 4PJEB 1KOAA 2EE2A 5C0CA 4LLMA 3O3UN 2BHZA 4YDJA 5IP4A 2XA8L 5ILTL 1UM4H 5D7LE 4Q9CA 2BNUB 3WFCH 5FV2A 5HGDA 1NAML 1T66C 4YDLC 4F7CA 3NN8B 4EN3C 2CUMA 4HEPG 3CCHB 4PRID 5AYUL 3WLBB 1T21B 5SX5H 2JKXA 2OI9B 4X83A 1II4E 5F1NB 2W1NA 3HRPA 1KIRB 4ZUWB 1SHMA 3NH7H 2BVPB 1JWSB 5CMAA 1VACA 3WJJA 4Z7VF 1NGWB 1HKLL 1SEQH 3RI5K 4M4PA 4G8GB 3D69B 5TFSL 3TN0C 3P4NB 5I1JH 2CH8A 3P30H 4FXLA 3RGVC 4LSVH 2NW2A 3VGBA 1VESA 4L3EA 1OAUL 1RVFH 3DYMA 2WQ8A 1FJ1B 1FH5L 5FIEA 4DZ8A 4JFQB 1HINL 4Q6IA 5C0NC 4KVCL 4AJ0A 4L3ED 1IE5A 4LF3B 3MJ9H 3PGDB 4XBGB 3QNXA 2QADD 3FT4B 2DQHL 4NO0B 1OAXL 5AYQA 3SDXB 1FVDB 5DFTA 5KW9H 5B22A 3JV0A 3HMWL 4QGYA 3ZL4L 5TQ2H 4X4XB 1OPGH 3B5GA 2R1YB 2L7UA 1X5YA 4HK0B 2WLZA 1U8MA 3TLRA 4NRXB 1J0IA 4FQCL 3QYCA 4MDJA 3IDNA 4JHBA 5C0AA 3BP4A 1A3RH 1PG7L 5EG6C 1AHWC 3U0WH 4YHYC 2DQTL 3TC9A 3WNMA 3MNZB 1RU9H 4W6YB 4DKEL 4KQ4L 5D93B 3UBXB 1DE4B 1MUJB 4R6UA 1RQ5A 3IFOA 1ZGLP 1TIUA 1YEIH 5ESAA 1R3HA 4PLJD 4QHNB 3BPCB 4CVZA 1F6LL 2Z93A 1JHKH 1D5XB 4OLZH 1LO3L 4HGWA 1JTPA 3ILQC 4JFOA 1OSZB 1JNLH 2G9HA 4JEGB 2I9LA 3PWPB 4U0RB 4L9DA 1YEHH 3MLZL 5T3XD 4OI8A 2PXYA 2QSTA 1CTOA 3O45A 4JRXB 4Q9QL 1MFNA 5KS9A 1GGCH 3I9GH 2XTJC 4PBWD 4HIEA 1BFTA 3ZKSD 3BIAX 1MVFA 5E5MB 2JCCB 4HWUA 1AGFB 5SWZB 5IBUB 4U1KA 3PP3K 3S5LB 1VA9A 4KY1L 1DVFC 1F11B 3GDBA 5C0DB 2NYYD 1L0YA 2J8UF 5TGBA 5DTFB 5GRJL 1KPUB 3IF1A 2I07B 3SDYL 5IKCA 3GM8A 4PRHD 3H9SB 4HKBA 4FP8H 4C4KT 5BV7H 1FLTX 1JI2A 3VXPA 1AE6L 3Q1SH 4J1UB 1U8OB 4RBPK 4JFEE 4G80B 4W6WB 1REIA 1JF6A 3BGFB 2OYPA 3G5VB 3OR7A 1CQYA 3L3IA 3ROOA 1S9YA 3QRFM 1HIML 1U58B 1QNZH 1Q38A 1SBSL 4BFEA 4HUVA 2WBWB 5J13C 5HYSG 3V4PL 2OL3A 3V0AC 4K23H 5EUKA 4F7PA 3P3YA 1A64A 1CFNB 4HJGB 1S3KH 4Z7WA 4ESKA 4WFHD 3TNMA 3VRJB 3DPBA 1NCDL 5F7EL 2AXJA 3H0TA 2ZSVA 2YEZA 1Q1JL 4TNVK 3OKKB 4LSPH 4FABH 1N8ZB 2ARJA 2VIRB 1N5YH 3QCUL 3Q5TA 4PB0L 2J2ZA 1KXQE 4DW2L 4L8DB 4JHAL 1X7QB 1ETZA 2CIIB 3QG7L 1TTGA 4WO4C 1T0NA 1S7VA 2BNRA 2HFFB 3F65A 1KJ2B 4XC3H 3SBWC 3I50L 1SJHA 3MZTA 1PJ9A 3I75A 4Y4KA 5IEKB 1MHHA 2BNRD 3S88H 2BY2A 4YC2B 4YWGL 4GW1A 2HJKA 3D39D 4ZYKA 3LHPH 1AI1H 5H2BB 3DTXA 3KPSE 8FABA 4LFHG 3QWQB 2H1PH 5HSFA 2WBJA 4YAQA 4J3OC 5J11B 5HI4C 5C07E 3TH3T 3MCLH 3VWJC 4DVRH 4WHTA 4CDGC 4JPVH 1HSBB 5H8DA 4RFNC 3FJTA 1ZLUK 1HK6A 3C2AL 4FG6D 4F2MB 2XYCA 2EE3A 3NZHL 4Z7UE 4X5WB 5E8NA 5GGVY 3PQYB 1KG0B 1MRFH 3HS0B 1FFOA 4I2XA 2YXFA 4D0DB 4LU5L 4XNYL 1RMFH 3QQ4A 4Z7NE 2QTEA 3L3GA 4MNGA 2LVEA 1W0YT 4N0CC 3H7BB 1RD6A 1AQKL 1ZT7A 1ZHKA 1S9VB 3VXUD 4LCCA 5HHXH 5LCVH 1OT1A 3QEUA 3BESR 1QBLH 4R2GC 5EH1A 3EOAB 4MA7L 4HQQL 3UCRA 5CCKL 2QQNH 3KAAA 4WU7B 3EDKA 2RAMA 5GJTL 3FT2B 3SE4C 2ITCA 1ZXQA 3R06A 4RSVA 3TWCH 3VGGA 4DFIA 5MENE 5FYLD 3NIFE 5BW7C 1HHIA 5DJ8B 1BOGA 2ZKHL 4Z7OF 1NGXB 5ANMB 5IB4A 1C5DA 3A67H 4QRQB 5DFWH 4NO3A 1D6EB 2VN7A 4KPHL 1ES0A 4PJBB 2UY6A 3QUYC 3AGVA 1MF2L 5BXFB 4RGND 5CJOL 1CGSL 3BI9X 2DKSA 2VN4A 2BJMH 2AVGA 5FK9B 1NLBL 1C08A 1LK2A 1D9KC 1NGZB 3UJJL 4M02A 5DYOB 1YJDH 5FM8A 1PKQB 5LQBH 1AP2B 5FYJE 2F8OA 4EI5C 5J7CC 3L5HA 1K2DA 3QDJE 1M7IB 4OM0H 1RJLB 3MRLA 3EGSA 3M17A 2XQBL 3QDGA 5CKAA 3RFZC 4KKBD 5IB1B 2Q86A 3RWFA 1MFEH 5DA0B 1NKOA 3C9NA 1JPGA 4MXVF 4D9LL 4ONGL 5IMMB 3QULA 5K59E 1A4KB 3O9WC 2BVOB 3Q5YA 4BYHA 5K9QI 1FGNL 3MLWH 5H94B 5SWSE 1JE6A 2XNAB 1KV3A 4M8QB 3AROA 1NMBL 3L3KB 3ABZA 4LLDA 5IW6A 3VI4F 2FYYB 4MHHG 3MLVL 4I77H 3FT3B 3MA7B 2ED8A 32C2B 3WDIA 3ARGC 2A1WL 2EXYC 4KZEH 5IW1B 3MLRH 4LHUG 3I2CH 4GRMA 1BD2A 4HC1A 4J4PC 3WS3A 5J6HA 2Y6SD 3DIFB 4M7KL 3QEHB 2ZSWA 4MYWB 4HIXH 1E4KC 3IRZA 5DUBB 4PRPB 1TFHA 1C16B 1CDBA 5BO1H 4BSVA 2ENSA 3CXHK 5FOBA 1ZOXA 2BVQA 3FQTA 4JFHD 1M1SA 3NFSL 3S36X 4O4YH 4XAWH 4L9LB 4DVBA 5EZOH 4LVNB 1H5BB 3QUML 1UCTA 1MCHA 2DMBA 1RURH 1YDPB 2RIKA 1JV5A 1KJ2H 2W60B 3ZE0F 4PJFF 4M7JH 1IGTA 3V79C 4F8QA 1K4CB 1S8DB 4YBHA 1KF9B 4PJ9A 5ID1A 4JPWH 5BV7C 2DQGH 5L2JB 2P8MA 2V7HA 5E95B 2D03H 4K07A 2DD8H 4FQ1H 3DSNA 1FNHA 5A2LH 4YHML 1AGEA 1NH6A 3D9AH 2PF6A 1G7IA 2FIKB 3O41A 3TCLB 4U7MA 1O7SA 2JF1A 5EBLA 3STLB 1KTLB 3DXAA 4HKJA 3X3FL 3QHZH 2XKUA 1KCLA 3V6OC 1H8SA 4N8CH 4Z78A 1MCRA 3GMQB 2EDLA 4NBZB 2NY4D 4RQQA 1MCQA 2RGSA 3DXAD 3T4AB 1FL3A 2P24A 4L8SA 3P0VH 2KQNA 3VDBA 1Y18B 3T1WA 1I8KA 1LHZA 4APQC 1N5AA 3RWJA 5FECA 2UYLA 5LGJB 4XTRD 2BMKA 3U7YL 3TO4A 2H9GA 3CVIH 4X7DC 3S97C 1D6VL 4X6CE 4BK5A 5DJZA 3BT2H 3W39B 1OWWA 4MJ6B 1ZMYA 4JG1H 3TO4D 3OHXB 3MV9A 4OZFB 2YC1A 3D0VA 4K3EL 4BFIA 1AKJB 4XB8A 1J9CT 1KB5B 1Q9OB 2EEBA 4DZBB 1HWGB 4JRYB 5T3ZH 5C07A 5F71A 3L3OA 4FMKA 1LP9A 4LNRA 1XR9A 4XCCH 2VR9A 4P5KB 5DD1L 3S36L 1KPVB 5BS0A 3QQ3A 3S96B 5A2FA 4NT6B 4M7LH 2IALA 2RR3A 2YMXH 3P40A 4H25B 5KANG 2NXYC 2PW2B 4X6DB 4JKPH 4NNYB 1IM9B 1W8NA 2MQ0A 4JANA 2PTTB 2AXFA 4M93B 4QT5B 2O26U 3ZLQC 4Z95L 1K8DB 2F53D 1M6OA 4NOFA 4C54A 4OZGE 2V5RA 4LBEB 1NLDL 2ID5A 2CDFA 4AT6B 1SYSB 5I6XC 4HT1H 4MCZA 3HPJB 2BK8A 5D7KD 2F8XC 1IAKB 1LDPH 3OX8A 5EZJA 4K8RD 1RY7B 4JHZA 5JHDE 3IDMA 3RGHA 3ESUF 1I9RL 3Q2CA 5A2KH 2RFXB 2IPKB 4KK9C 1KFAH 4HWEL 3TT3H 3VMOA 4D0BA 3PJSA 3PHOB 5DJDB 2EDOA 1TDQA 4NN6B 5MERB 2X4TA 3OPZL 4X6FB 3RVXC 3GK8L 2O5YH 3SJVD 4HIJA 5JPNA 1XIWA 5EOQL 2AJZA 3GNML 3CH8A 3ZHKA 4UILH 3HUJE 5C71A 2CJUL 4AIOA 1EEYA 4IMLA 1FVCA 1NL0H 1S7WA 1IAIM 2XZCH 4DEPB 3DMMB 3AMKA 1WIUA 2HKHL 1K4DB 2R1XA 4CADB 1T6WA 2D7TH 1S7UB 1P4IH 1J8HA 2FEDC 5F6HI 3IS1X 4EXKA 4M00A 1S7XA 4E42B 1IJ9A 1NAKL 4JGMA 5IBTH 1ZA6A 2CRMA 3BZFA 3NOIA 5I1IH 4XPAL 1J0YA 4YDIL 3IETA 1YJDC 1CD1B 4FZ8H 3SDAC 5HDOA 4L4VB 4BZ2H 2E7LA 4Y4HD 3G6JB 3O81A 1UB6A 3KXFD 4PJCF 5CUSH 4BH7B 5T33L 2B39A 4Z7QE 4EIZC 3DGGB 4H20L 3PHSA 3GI9H 5GZNC 3BYYA 4XVTL 5AWNH 2F74A 5BZDA 1LE5B 3BISA 5EOCL 3ZTJG 4LK4A 3LKSA 4XGZB 1A2YB 3UO1L 4NN5B 4OQTL 2CRIA 1J87A 4ZTPL 3QZWG 5C7XL 3JUYA 4QRTA 1A1MB 3U46B 4OKVB 3SCMA 1IC1A 3FB5B 3VG0H 3VFOA 3UC0H 4O58H 1MCPH 1CICC 4F9LC 2Z35A 1QA9A 5EA0H 3QP3A 4NNXA 4D9RD 1ZE3C 5FGCE 2EZ0D 5EO0A 4ZDHB 1NDGA 5FYJL 2ATKB 4OI9A 4JG0H 4QY8B 4KK6D 4WV1C 2P5EB 4P2OC 4FFZL 1I9IH 4XI5D 1LD9A 4I1NB 4TSAL 2E9JA 2VLME 3TT1L 2BRQA 1QFWM 4EBQH 4MQSB 2CRYA 5FDWA 5I1LB 1T04B 2DQCH 1FCCA 2QHRH 4MJIB 4DGYH 2B1HL 1B4JH 2X1PA 5DHYA 3QWRD 1IGCL 4LSDA 1FVEA 3MGAA 5FGBC 3G04B 3QH3B 1WFOA 4R90H 3C5ZA 1EMTH 1XCQB 4HDIB 2KUTA 4TUOA 1VERA 1CFTB 2DRUA 1LO2L 4P23B 5E8DH 3OKNA 1X4YA 2EYRB 4K3DH 4WFGE 5L2KB 2B2XL 3TJEH 3IDYC 5IVOA 3B3IB 1I4FA 1QFUH 1U3ZA 5KN5B 5I71B 4GRWB 4U1JB 2VXUL 1NMAL 3EOYG 1U8IB 4HUUB 3CPLA 4LKCB 5DDHA 3ZDZE 1QFOA 4XC1L 1I3UA 4F37F 4JREB 4XX1G 5E6IC 2DJSA 2GAZA 2KL6A 1GGIH 3WO3B 3W5MA 3TJHC 1W72H 1EBAA 3MODH 3MBED 1KIQA 4KMTL 2IMMA 4LLQB 4PJAB 3V4VL 4UT7L 4LOUC 1F42A 2UVFA 4X6EB 3I3DA 1F6AA 5GGRA 2R8SH 3WIHH 4P5MA 5D7JD 2VLRB 2BVUA 5FUZL 2F58H 2V6HA 1S7QB 3PL6A 3OKEA 5EORH 5DRWA 2AEQH 1VHPA 4P9ML 3WDHA 3NA4A 4HS3A 3TH2T 3M07A 5EU7C 3NZ8A 2NY0B 3VFRB 4MSWA 4KHXH 3PL6D 3MRJA 4S1QH 9CGTA 3HNSL 1QHPA 4IDJH 3HNVH 4OZGA 1Q94B 4OFYA 3CDGB 4ODXA 1LE9B 2J7LA 1NBQA 1T1YB 1FAKT 5DK2B 3TESA 3K2MC 3K8KA 3SDCA 3WD5L 4KROC 5FHAL 3CK0L 5HDQH 4Y5XA 4CMHC 1YNTB 1OB1B 1DFBL 5DMKA 1A6WH 5JHDA 1IC4H 4JAMB 3OAUL 1RHHA 1QRNE 4OCRL 2CXKA 4R0LC 1HILA 1CT8B 4AH2A 3GSUB 2ZJSL 5C0JB 3MR9A 3V0WL 3D18A 2N7AA 2H32H 1IC5L 1MWAA 2BNQB 2DBLL 3BHBA 3GBLA 4TSCL 3IKKA 3E1F1 2HYMA 4IRJB 3AREB 5CGYD 4NNPL 1MJ7H 1IMHC 3O4OB 3MRRB 3EYQC 1KPRB 3V5KA 2ZUQC 3SDDC 5K9JL 5D96B 3O6MH 4PJXF 5C0GA 1HYSD 1DQLH 1JWUA 3C6SA 4QXUL 5A2IH 2PO6D 4LGPB 5C08B 1KEMH 1L7IL 2E5EA 4MA8L 2ZCHL 3VD9A 3Q3GA 2W65B 3DRTA 4Z0XB 4FQLL 2XICA 1D9KD 1CDJA 4UTBL 3WN5A 4RAVB 1JHLL 4UV4L 1CE1H 1R3KB 5C0CB 1I8IA 4YEFA 4ERSL 2AJUH 4LLMB 1KN4L 1YEEL 3G5YA 4YFEA 3T0EA 4YDJB 3RTQA 1FYTD 1A0QL 1TNNA 5DT1H 1JYWA 4UB0H 3HZKA 5HGDB 4GT7A 4X9HA 1CBVH 4PLNC 4F7CB 3PV6B 5GGRY 5HHOB 1MFDL 4WWID 2ZCKH 5J57B 5I9QC 1XR8A 2R4SH 3SE8L 2RB8A 2PKDA 2YK1L 3GRWL 4LCIL 1DQQB 4R4FH 4UV7L 4G6ML 2R0WL 4S1DC 3HG1E 5CMAB 4OD1H 5JXEC 5D2LB 3PNWA 4P46D 4DUXA 1K6QH 4IHOB 4UOJA 3GJFA 3UPAA 4R96A 5D1QB 2IWGA 2NW2B 5JPMB 2Y07H 3QDMA 4LPVA 5HHME 4DZ8B 2J3SA 4Q6IB 5JDJA 3KPTA 4HLZH 2HFTA 4R9HA 2YKLL 3QDMD 3QNXB 1T2QH 4XP1L 4MXQC 5HYEA 2F5BH 4MS8D 4DGIH 4CVXB 3MCKB 3E3QC 3UBXG 3GBMH 1N64L 2DYPA 2A0LD 3VD5A 3VXRB 1UB5A 1GPOL 1X44A 1U8MB 3W0WD 1QFHA 1WLHA 2KZWA 4MDJB 5KVEL 5DUMH 2V17H 2WUBL 3IDNB 1FIGL 1HHGA 5C0AB 3BP4B 1Q8MA 1IAOB 5HYJA 2HTLC 1C7TA 4YHKH 2C4XA 4PRIE 3A6BH 3RY4A 3QNZA 3IFOB 5ESAB 1R3HB 1MH5B 2Z93B 5IW3A 3MGTA 1LNUA 3QIUA 5CP3A 5DJXA 4HGWB 2GIYA 2FLBT 2LV4A 5HVWA 1BQHA 2XA8H 5IBUG 5ILTH 5DJ2B 1EDQA 2G9HB 1AR2A 4JM2D 2I9LB 3S5LG 2NTFA 1JIBA 3GHEL 1NAMH 1ZSDA 4NO5B 4AEHL 1KSRA 5CHNA 1TVDA 3HKFA 4IS6B 1BM3L 5AYUH 1RUQH 1KYOK 1ONQB 4JDZB 4ZUTB 5KS9B 5ESQB 1I3VA 2AEPL 1D5IL 1OF2B 3MRNA 4K7FA 3L1OH 3MUGA 5SWQA 1F45A 4Z6AT 4YX2H 2NXZC 4U1KB 1MIEL 2B4CC 4OIIL 1NCCL 2HT2D 3IF1B 5IKCB 3MTRA 1P6AB 4HKBB 3EOTL 4GRLA 2FJFB 2EXWC 1OAUH 4MA1B 2JB6B 2Y25A 3VXPB 2VJXA 4JLRB 1FH5H 1YQ2A 4D2NA 1HINH 5I15L 4HW6A 4KVCH 1ZHBA 5HDBF 2D2OA 1T03L 1EEZA 2GJZA 5L0QB 1NANH 2DQHH 1OAXH 2A6KA 4HFWB 3L3IB 5I66B 1JK8B 1FBIL 1S9YB 3ZE2E 2AAVA 3HMWH 3ZL4H 5DRZA 2WK2A 4OV5A 1WAAF 5I8EA 1NGYA 5FUOL 2OL3B 1QRNA 1TZGL 4DN3H 3VGAC 4FQCH 3RKDD 5EUKB 4F7PB 1GZPA 2JJTC 5F9AC 3VD7A 2P5WD 1PG7H 2BVYA 3QQ9D 4LRIA 5T3XE 1A8JH 1MAJA 1MLCA 2DTML 2YEZB 4KQ4H 3ARFB 4XPGH 4X7SL 5ISZA 5EU5B 2ARJB 1T7VA 4DGVL 5KVMC 1J10A 3U36A 4FMFA 1HZHL 3GMNA 5ISZD 1NBVL 4ZS7H 5IMLA 5JORB 4NQDE 5CSZA 4N8VA 4OFIA 5SX4I 4HS6A 1T0NB 3THML 4PRHE 1S7VB 4PGCB 3MLZH 1OAYL 3SDXF 1SJHB 2WIIA 3CLEH 3FB6A 3I75B 3PDDA 4XXCA 3WL9A 4Q9QH 2PR4L 4XHQA 2HJKB 4PV8A 4ZYKB 4H26A 3AM8A 2MCPL 5A16B 1DQJA 3BE1L 3DTXB 2Z8VC 3FO0L 4EQ2A 1F97A 2Q3AA 3SE9L 8FABB 4MD0A 2HJLA 1RZGB 4POZD 1NC4D 2ORBL 2WBJB 4KY1H 3U4BH 4HH8A 2YD5A 4JO3H 4YAQB 4D9QD 4S11A 2GTWA 5B38B 1BVLA 5DC4B 1CI5A 3SDYH 3QA3B 5JIHA 4PREA 5GHWL 2EYSA 4ZPVA 2WMPA 3RU8L 4JFDD 3RDTD 5I17B 5EC2A 3MRMA 5I75B 2DKUA 5DMGC 2X40A 5J06A 1JUFB 1W0VA 2C4FT 1ZT7B 5GZND 1ZHKB 4LCCB 1HIMH 2I27N 3QEUB 1G7JB 1T6VN 3V4PH 2M2DA 3T2QA 4KI5F 3QO1A 1MVUA 2IEPA 4HUKB 4PUBL 3TA3C 1U36A 1S5IH 1TZIA 1I1RA 4Z7VA 2ITCB 3R06B 2JCCF 3MRDA 3RQ3A 2JJVA 5F7EH 4NQXB 1P9MC 4ODVH 1HHIB 4ZAKD 1Q1JH 5IB4B 1C5DB 3NCEB 2CKBL 3UJTL 4CN6A 3SOBL 3D39E 5SV4A 4PB0H 4DW2H 1AJ7H 5IVZA 1C08B 4JHAH 3VFVA 4ZUUA 1CF8L 3QG7H 3UZQA 2X2YA 3K2UL 5EIIB 3CMGA 3I6GB 1KLGA 2X1OA 3W81A 3VXQA 3A6CL 4MLSA 4Q6YA 1MCBA 3PP3H 3FOLA 3CSBA 3I50H 5FO8B 1DBJL 5KSAD 2BDNL 3MRLB 4U3HA 2CK0L 2MCG1 3QDGB 1S7TA 2DN7A 3RWFB 4YWGH 1MAML 3C9NB 3FO9A 1JPGB 4HPOL 4RBPH 2OBGA 1ZLSH 3VXUE 1UWGH 2P1YA 5BZWA 4NKDA 1ZT1A 2NLJA 3CXHJ 4OCYL 4IRSC 2OXHA 3UTPD 12E8L 5FUCC 2K9UA 3S3SA 4PGDA 4LLDB 3ZE1E 1BIIA 2RQ8A 4J6RL 3SY0B 5IW6B 1RZ7L 3AB0C 3HB3C 4P59L 3MX0A 4P57B 3NZHH 2ZUYA 4EOWL 4HK3J 4U7SA 3BXNB 4PS4L 4XNYH 4GRMB 1JPFB 1YEDB 4EUPH 4FRWA 5D6DC 3WS3B 5J6HB 2WP3T 2MKLC 3JVGC 1AQKH 5DD5L 3QUKA 3V6ZA 1OLLA 3ISWA 4D94A 4RGNE 1P6FA 1UVQA 1NC2A 3ARPA 3DROA 3EYFB 2J1KA 2DLEA 1ED3A 1VADA 4KKAC 4BSVB 3L95A 4MA7H 4P2CG 5CCKH 4QNPE 2PYEA 2BVQB 3FQTB 1CIUA 2CQVA 35C8L 5ELIA 4MMZC 2RCSL 1L6ZA 3JWNC 3NACH 2J8UA 4DWHA 4PB9L 5ETUA 2HJFA 5LGHL 4CMMA 4KQ3L 4E41E 1KXVC 5GS0D 4NFBA 4KPHH 3BDYL 5JZ7C 4OGXL 5ID1B 4PJ9B 1MF2H 5CJOH 1CGSH 2P8MB 3RBSA 2V7HB 2NY2C 1MREL 5F6IC 3HPLB 4LPTA 4XWGL 3JV6A 1G7IB 4NJAL 3BPOB 2WLYA 1K85A 2MFNA 3FQXA 4LSQL 5IWLC 5J4MA 5DWUL 4HKJB 4RAHA 5ENWA 1V3LA 5IHUL 5IHZA 1S9WB 4Z78B 5I1GL 5K9KA 4RQQB 5IEHB 3KS0J 4NCC2 4OZFG 2G2RA 5JDSA 1AO7A 2P24B 2YR3A 3U7WL 3VRLF 3MRFA 1I8KB 3O8XB 4D9LH 4ONGH 1N5AB 4JGUA 1FO0A 1CXEA 2YPLA 5FECB 1JF5A 2UYLB 1I7RB 5ITFB 1FGNH 3BQUD 5TPWL 1IGYA 2H9GB 3W9DA 3IVKB 4PY7B 4WI9A 3AVEA 5GRVK 5DJZB 4ZUVA 4PJBF 4JFHE 2R4RL 4U6HB 3KPSB 3S4SA 2ERJC 3MLVH 4XP4L 2YC1B 3D0VB 2A1WH 2R23A 1WCBB 3R1GL 5EFIA 5C07B 3L3OB 3T1FA 3VW3L 4LNRB 1XR9B 1EHAA 1E6OL 2FZ3A 4M7KH 5F7YC 1WITA 3KR3H 1WIOA 5BS0B 3PE9A 4FQ2L 1B2WL 5DQ9A 2IALB 4LCUB 1T1WA 4H8WL 4K71B 3Q48A 1TJIL 3CX5K 3NIGE 5T3XL 4EEEA 5FXCH 1UEYA 4ZNEA 2KQMA 3B9KB 3QUMH 4U2YA 3QXDA 4KUZH 5CILL 2VDLL 1M6OB 4CGTA 2C9AA 5EUOF 5F89B 2VLKE 3AFLA 4BZ1L 1A47A 5IMKB 2VDQL 3ARBA 4YBLB 5F1IA 2E7BA 3N85L 4MCZB 2APFA 1CDUA 4WEBL 3DX9A 3CJJA 3GM0A 1L6XA 5MENB 3OX8B 4RCAA 5EZJB 2FGZA 4YHMH 2A6IA 3IDMB 4OLYH 3GFUA 2VZUA 1B90A 2EDQA 2GITA 1JJUA 5KOMC 1CLOH 2FH6A 4O2FB 1U93B 3FO1B 3X3FH 4X5LA 4BK4A 5HGHB 1DLHA 4TOYL 5B8CA 3ARYA 3PJSB 2IBGA 1BEYH 3VG9B 5GRVL 5T1DL 4AZ8A 2RJMA 4TVSa 4HIJB 1XIWB 5JW5A 2AJZB 4RA0C 4JY4B 1PYWB 3UPCA 3FFCA 1EEYB 3ET9F 4IMLB 5INCA 1FVCB 1S7WB 4M6AA 5HHNA 2ESVA 3OXRA 3U7YH 3DARA 3MRGA 3DO3A 1BX2A 1W8OA 1D6VH 4URTB 3TVMB 2R1XB 1UJ3B 1DQTA 4JDVA 2L0DA 2YRLA 3O6LL 5EIVA 1J8HB 1J1OL 1T5XA 2DTSA 3KPRA 1JTOA 1EFXA 3MOQA 4K3EH 3DYPA 4XNZC 5GGTA 1OSPL 4Y2OA 2V2TA 2F53E 3PWJA 4QGTA 4WW2C 1ZA6B 3BAEL 2VWEE 3HI5L 4HV8A 4Y16D 3BZFB 5C2UB 2JJSA 4YBQD 1MPAL 3F6IA 1LK3L 3JWDL 3S36H 5MP6H 4GH7B 2NY1D 3MLTA 1UB6B 1OGAE 3CAFA 5GGQH 4M8VA 2F74B 5BZDB 3OKYA 3T0WA 3LKSB 1RZIB 1AD0A 2FJHA 4Z95H 2HVKA 4YHPA 5GIRA 3GJEA 4Y4FC 2NY3D 1LO0L 3LKOB 2YUZA 5GGSA 1TITA 2NXZD 4NC1C 2FBJL 2Z35B 3QPXL 1XGRB 4WHYH 5CGTA 1DUYA 1QA9B 3PDGA 4NNXB 3HAEA 3TZVB 4LL9A 4H1LG 2IPUG 2OR9L 1IAMA 5EO0B 1NDGB 4FS0A 2P46B 3ZO0A 3EO1A 5CJXA 4OIAA 4N0YH 4P2QD 1I9RH 4YNYA 4LASL 4KKCC 1L0XA 4GAJL 2BCKA 3WBDA 1KTDA 4UOW1 15C8H 1Q0YL 2K3TA 1WISA 5FDWB 4NM4L 4OTXL 3NABL 5J89A 3P0GB 3C60D 5GGTL 3OPZH 1DN2A 3KGRA 3GK8H 4YH6A 3TBWA 4GKSA 4B41A 5EOQH 5M95B 1KULA 1FVEB 3U82B 4DUVA 3C5ZB 2DIBA 3HMXA 3PABA 1CFVL 2CJUH 4G9FA 4PJFA 5E2VL 1AH1A 3MV7E 3RA7L 1HKFA 1MI5D 4TUOB 2ZUWA 5CJBA 2C7UB 2FNBA 1CGWA 3KS0H 3OKNB 2V7NA 4X4ZA 3VGHA 1YMHA 5FYLL 5TE6L 3CU1A 4W4NA 1JMXA 1I4FB 3F62A 1WWBX 3GO1H 4RFEA 3V5DA 3GGWB 1NAKH 1WZKA 3FRUA 3K1DA 5AAMA 2FO4A 5E2WH 4R7NA 5D5ME 1N3NA 4XPAH 3ARSA 4YDIH 1XZ0A 1SMAA 2GAZB 4LFHD 2UWEE 1MCEA 3KLHD 1XH3A 1HXYA 1ROWA 1DL7H 5ADOL 5T33H 1KIQB 2VZSA 4D9RE 4U3XA 2GSIB 1U8QA 4OCXL 1IZJA 4ZXBD 3RZWA 3UO1H 3UTTD 2J5LB 3MXWL 1X5GA 2ILLA 1AGCB 4OQTH 4L4TD 4ZTPH 5FM5O 3IXTB 5C7XH 2YN5A 4HMEA 2NNAA 4H0IA 5IT2L 4LIQE 2VNCA 2YZ8A 5IROC 5GGUA 3NZ8B 5GGSY 1U8LA 2AEWA 4MSWB 4RWYL 1T0MA 4OUOA 5FYJH 4XVSL 8CGTA 4NO2A 2VLKA 4OZGB 2J6EL 4ODXB 1J0ZA 3F5WA 4FFZH 1OVZA 4TSAH 5AUMB 4GBXA 3SDCB 1GAFL 3TT1H 4L1HA 2FJGB 3G6JF 4Y5XB 2BY0A 5DMKB 3ULVF 3T3MF 5CD3A 5JHDB 3KLAA 2MPAL 4Q58C 3D85A 3QUXD 1P7QD 3CFKA 1XT5A 1IGCH 3L7FA 4AH2B 2BZDA 4WVRA 2IGFH 3MR9B 4LPWA 1QSFA 3D18B 3OJVC 1KCSL 3OKOA 1F2QA 4FTVD 4LLVA 4KUCF 3VXNA 2X4PA 5B3JF 3LQAL 5E08L 3V5KB 2B2XH 1XF5A 1IM3A 1IQWL 2AI0L 3WDJA 4C4KO 2VXUH 1NMAH 4WHDA 1R24B 2HT3D 3C6SB 1E4XI 2DAVA 2OTWA 1T22B 2R15A 4JB9L 2FX9L 1TQBB 3FN0L 4O00A 1CXLA 3T2OA 4XC1H 3Q3GB 3KJ6L 2A6JA 3DRTB 3GSOA 2OTPA 4EN3A 1P4BH 2DQFA 3QUZD 4UNUA 2BSSB 2KH2B 4K7PY 3WN5B 3MBXH 4KMTH 2V5TA 1RIVL 1I8IB 4YO0A 1IGML 2ADIB 1UEMA 3NGBB 5EBGA 2ICWA 3T0EB 2XTLA 3V4VH 4HWZA 3RTQB 4UT7H 3ZKNC 2O93L 2HA1A 3GIZH 3HZKB 1J86A 3WYRA 2OJEA 3P77A 4FQQA 4P4KD 4LHUD 3TN0A 3ZTNL 2R9HD 1YMMD 5D8JH 3S3PA 3RUGE 5FUZH 3RGVA 2JELL 4P9MH 5F7NC 3ETBF 2QKIA 4OAWA 3S37X 4N90E 5DJ0A 2CIKB 4IM8A 3HNSH 4D8PA 3F7YA 1KIPB 5EU4B 1AXIB 3LRGA 1BIHA 1LO4L 4R96B 3WD5H 3MYJA 4X7CC 5D72L 3CK0H 5FGCB 1DFBH 4ZFFB 4OCLC 2AABH 4PJAF 3OAUH 1NCWL 1J11A 4OCRH 1AHWA 3EZ8A 3IDGB 4KTYA 2ZJSH 3STZA 1U3HD 3KJ4C 1JZ6A 1PBYA 3BP7A 1IC5H 5I1CL 2DBLH 4TSCH 4G3YL 2X05A 1IQDA 1X6LA 1GC1C 3QIWA 2DYPB 4LSRH 4NNPH 4X5XA 1AQDA 4Y5YB 4LQ1A 5D1XA 4W4OC 1FYTE 5F7WC 4P5TD 1HHGB 1TZHA 3VE0B 1ZA3A 4QXUH 5D1XD 4GQ9L 5HYJB 1L7IH 3HR5A 4MA8H 2ZCHH 4OT1L 3C5JB 4ORGB 3OAZK 2EC9T 4FQLH 5DJCB 1P4LA 3QNZB 4K8RL 4GKZA 2E6PA 4CBPA 1JHLH 4RMTA 4UV4H 3DUHA 4V1DD 3QIUB 1F2XK 3P4OB 5DJXB 3O3AA 2ADJB 3RVVD 4DKFL 3VXTB 1FZOA 1UGNA 2ITDA 2NPLX 4FQXD 1A0QH 4JCMA 2AK1L 2NTFB 3TFKC 1DVFA 2VTFA 2Y36L 1RZ8A 3BEWA 4ELME 5CHNB 4UTAL 4X98B 5F3BA 1QP1A 4GG8A 5FKAA 1MFDH 5FCSH 3SE8H 1QPPA 2YK1H 3GRWH 1TCRB 4LCIH 4MAYC 4UV7H 3SGEI 3JBG7 3MRNB 4K7FB 3MUGB 3LEYL 4HJ0D 2H41A 4YK4B 5HHQA 1TXKA 1Q9KA 2DQIL 5CS7A 2OZ4A 1I3RA 4PLKC 1OP5K 2X4RB 3IAPA 1T83C 3WFEH 3W0WE 2XN9A 2IADA 1CU4L 5F88A 1D5MA 1TPXB 2DJUA 3OGOE 2UY7A 3UJIL 5E5RB 4ODSL 3O2DL 2WUCL 1ZHBB 2XN9D 4OZHE 5DD3L 4QRSA 1MFBL 1I75A 1EEZB 3L3DB 4NOBA 2YKLH 2WV3A 1WJ3A 4XP1H 1AIFB 5DRXA 5C0EA 5FGSA 5J12C 2WANA 5E5UB 4AENA 3TBTA 5DRZB 4OV5B 1UH4A 3VFUA 1GPOH 4MQXC 1QRNB 4PJ7E 1N59B 5KVEH 3CSYA 4PJIE 1GZPB 3O6FB 2WUBH 4N0RA 1FIGH 2AGJL 4KZDL 4KRNA 5CIPB 1YQVL 3L7EA 4OCWL 3AUVA 5CEZD 1MLCB 5D2LF 4PJ8C 4I3RL 2XKSA 3SBWA 3TYFB 2NX5A 4WI8A 4AMKH 4KJWD 4HGMA 1MQKL 1FORL 3RI5F 4XRCA 5BMFH 4X8JA 3RZCC 1JYVA 3U36B 2NY6B 3W11C 3KPPA 3GMNB 5IMLB 1FFPA 5CSZB 4N8VB 3X12A 2VLJA 4HS6B 3HZVB 4M62L 3GHEH 3O4LD 4G8EA 4LIQL 4W68A 4X7FC 3K80A 5AZEL 3JV4A 4AEHH 1HH6A 2OZ4L 3ELAT 2VYRE 3VWJA 3WE6A 3ZKXC 2WIIB 3FB6B 2X9XA 3WL9B 1A6AB 1BM3H 1CZ8L 4UBDC 1NBZB 3KLDA 3IFLL 5DHXB 5E9DD 3JTSA 1P5VA 1GHFL 1PZ5A 3QXTA 1H9VA 2AEPH 4H26B 4PJXA 4PV8B 4F9PA 4IIQC 1D5IH 5TDOA 3JSSA 4MD0B 1PQZB 3IT8D 1RZFL 2E7CA 1MIEH 4NP4H 4FQHB 4OIIH 4CVWA 2GTWB 1KEGL 1NCCH 1BVLB 2FECI 3QXVA 4G43B 1CFQB 3D5OF 4IEFB 4PREB 3EOTH 3DUUA 3QG6A 2GSGA 5HI3D 4DN4H 3CD4A 4IMKA 5EB9A 2EYSB 1D5BA 4ZPVB 3BRFA 3KPOA 1T80A 1IKNC 1M7DA 2P5WE 3NCFB 5I15H 5EC2B 2ICES 3MRMB 2HT4D 4ZOEA 3HCVB 1UM5L 3QDHA 3TBVA 5EWIL 1T03H 1SJEA 1W0VB 1E4JA 4NQCE 3VWKC 3FHAA 5JW4M 5BW7A 3BN9D 3HE7C 3DGCR 2E8ZA 4XBPA 1FBIH 5D1ZC 1F13A 3DVGA 2NZ9D 1SY6L 1E4XL 4NKOA 4QOKA 5FUOH 2C1OA 3WIIL 5TF1L 1P5UA 2R1WA 1MVUB 1TZGH 3PWLA 1OTUD 1TZIB 4Z7VB 3MJ9A 3MRDB 4PY8J 4XVJL 4WW2F 1RIUL 5A3IC 2DTMH 1P7KB 4UIMA 4X7SH 4EI5A 1VKXA 3HHRB 2HH0L 3KG5A 4YJZL 2IQ9H 4Y2DC 2LAGB 4KKCD 4PGZA 2B20A 2VDOL 4ZUUB 1NCUA 1NBVH 1WBYA 3O9WA 4OZIE 1KLGB 1OTTD 3THMH 2X89D 1KNOA 2ZUVA 4A6YL 3NTCL 1OAYH 5I1AB 2Z91A 3MJ7A 3DRQA 3FONA 3ZZ1A 4JFDE 4O9HL 2I60L 4QHLA 2PR4H 1S7TB 4H1LH 3VXSD 4F7EA 2WBKA 2MCPH 3ARGA 3FO9B 5CSGA 5EBWA 3BE1H 3FO0H 1N26A 2DKMA 3SE9H 4ELMA 4J4PA 2A73B 1SEQL 5BZWB 3ZDXF 2ORBH 4NKDB 1ZT1B 3O3DA 2APXA 2XZZA 3ARDC 3C6LA 5ESVA 4PGDB 1X5AA 4BUHA 1BIIB 3D48R 5GHWH 1TTUA 1E4KA 3L3JB 3QAZC 1QLRA 4TNVF 3C6LD 4I0PA 3RU8H 7CGTA 2MOVA 2N4IA 3MJ9L 5CIPH 1YY8A 2X70B 3S35L 3MRCA 4AIZA 3MRQA 4GKOA 4XAKD 1GOHA 1MIMH 1UVQB 3FO2A 2NTSP 3RAJL 4WUUD 5HVHC 3EO9L 1NC2B 4UDTB 2W38A 3KYAA 2VZTA 4JQXC 4E0RB 3MSPA 5TE7L 4PUBH 1I8MB 2E9IA 5H37G 5T1LA 3U0WL 3QSKB 2J8UB 5HI5D 3MNWA 5KAQG 3MO1A 5J3HD 1A02N 4N0UE 5ETUB 2HJFB 3BO8A 1FFQA 3EYOB 2OK0L 2CKBH 3HI6L 3UJTH 3C8DA 3V6OA 3SOBH 1FE8L 4FQIL 3PWVA 5K33A 5JOPE 3F12B 4R8WH 1CF8H 1KUMA 2VDKL 4APQA 2BNUA 3K2UH 4RRPA 3SE3C 3KLSA 3NCBB 4QHMA 3UTPE 1RUPL 1Z0NA 3N1MC 4YLQT 1L4IA 4WHCA 5ENWB 1WAAA 1NQBA 5GRUL 2LTQB 1F90H 3CCHA 4TTDD 1DBJH 3QI9C 1DBKH 1T21A 5IVXE 4ZUSB 4ETQA 2BDNH 2CK0H 4NQDB 4L29A 5F1NA 1MAMH 2G2RB 5JDSB 1AO7B 2XKNA 3M1BA 3B9AA 2YPLB 4G8GA 5I18H 3MRBA 3CX5J 3P4NA 4Y1AE 3VH8A 1IGYB 1HEZA 4OCYH 2X41A 12E8H 3W9DB 4A2MA 3GHBL 4EDXA 5EOTA 4G8GD 4J6RH 4ZUVB 4PP2A 2JIXD 1FJ1A 1RZ7H 4P59H 1FCGA 1U42A 3OF6A 4EOWH 2XT1B 4PS4H 3PGDA 4EIGB 4XBGA 5EFIB 5HPMB 3T1FB 2CPCA 3CFBA 1I1CA 3FQNB 2W9EL 4Y8DC 2FZ3B 3G08A 5IIEB 2DWDB 3KWWA 4NO0D 3RPIA 5DQ9B 2AERT 1VCAA 3TO2A 4HK0A 1MRDL 4MD5B 5JIPA 5IJVA 4WU5A 1UACH 3DI3B 2F9BT 3U2SA 35C8H 4R97C 2RCSH 1KT2B 4MX7A 4Z9KB 4PGEB 2GJ6E 4PB9H 1FIEA 5LGHH 5FV1L 1PZUB 3EIFA 4LPCA 1MUJA 4KQ3H 4LVOB 3BDYH 4QHNA 1JZ8A 3ARBB 4OGXH 3MLYL 1IFHL 3NBNA 4Y5YC 4GW4A 3K3QA 4CU8A 3ZDYE 1D5XA 3VFPB 3WO4B 5J0BA 4P48A 4EI6A 3F7QA 4GG6A 3DX9B 3IU3B 1MREH 4IOFD 4WWKC 2IAMC 4S1SL 4UIKH 2G75A 1CXIA 4XWGH 1OTSD 4YHLH 2BXZA 2A6IB 4NJAH 1MCIA 5J1SC 3HN3A 3PWPA 4LSQH 2YUXA 4JO2L 4GS7C 3ZKMC 3LH2L 1ZTXL 5IHUH 1L9NA 2E8YA 4JRXA 5D4QA 3PWPD 5B8CB 3T8XA 5I1GH 1I1AC 2R2EA 3D6GA 3LHPL 1AI1L 4ZO7A 2FECL 3U7WH 4NQVB 5E5MA 4JRXD 4MJ5A 4KI5D 1SM3H 1Y6NR 4L8BA 2NY7L 2AJVL 5C0DA 6FABH 3FFCB 5INCB 5HHNB 5TPWH 3OXRB 5GS2D 2I07A 5SWZD 2OS7A 4PV9B 3SDAA 5GPRA 5L8JB 1IGFH 5F9JB 4JDVB 4KKLC 3QO0A 1MHEA 5DJAA 3KPRB 1U8OA 1BBDL 1EFXB 3VXUB 3H9SD 5E0QA 5LGKA 3TPKA 3EO0A 1JCKA 4M9OA 2DBJA 5HGGS 4HV8B 1A5FL 3VW3H 1F3JA 5KAQF 2VSCA 5IB5B 1WFTA 1U58A 1E6OH 4OF0A 1X5FA 4KK8C 1B2WH 3MLTB 5GS3A 3D87B 1YEFL 5I0DA 1CICA 1NMCB 2IH1B 2XQYK 4H8WH 1CK0L 1TJIH 4M48L 1RZKH 5T3XH 3C09B 1T89A 4ZD3L 1H3PL 3DSFL 4HJGA 2FJHB 3LKQA 3QXUA 4GSDL 1NPUA 4QTHB 3RVTD 4YHPB 5CILH 2VDLH 4P2OA 1BF8A 1N8ZA 2FIRT 5AEAA 4ODTL 4LNVA 4BZ1H 5SX4H 2VDQH 3E3QE 2NW3A 3MLPA 1DUYB 3N85H 4KC3B 4N9OB 2A77L 4WEBH 3RVUC 1DQDL 3MLUL 5FGBA 3LKPB 3UTSA 2AXGA 4E41B 1YJDL 2HFFA 5E2UH 1KJ2A 5F96L 1KTDB 2W0FB 5IEKA 3CC5B 3RWCB 2ATPA 4Z7UF 3Q6FA 5T1MA 4N5UA 2DQJL 3QIBC 4OJFH 4KDTA 3DOSA 5LJYH 5T1DH 4Z7NF 4GKSB 1U91B 2BSRA 4B50A 4CL7A 3PABB 4PJFB 4G9FB 2NMSA 5IVXA 2EKJA 1HYRC 5C6WH 5E6IA 1G9EA 3TP4A 1OAZL 1T2XA 2V7NB 3QCVH 1S78D 5BOPA 1EJOL 4KDWA 2GFBA 1GGBL 3O6LH 1J1OH 3PQYA 5GZOC 4KZEL 1IGJA 3HS0A 3MLRL 1OSPH 4D0DA 5JXAH 2ARJQ 3V5DB 3FRUB 3U30B 3KPQA 4NZDA 2ICEA 3NIFF 2FO4B 3PQYD 3BAEH 3H7BA 3TBSA 1N3NB 1S9VA 4UI2A 4JPIB 5DO2C 1CD8A 3GUTB 4MVBC 1OT2A 4V2BA 4JJ5B 5E8EB 3EHBC 4WTZA 2VXTL 2X9WA 2AEIT 3QCTL 1CGVA 4J3WA 4JCLA 3EJYC 1ERNA 1U8QB 4XAWL 4FQJL 3U6RA 1N4XL 4P2QE 3SO3C 2Z31C 3MRHB 3CFIC 1NGXA 1YZZA 5ANMA 1LO0H 1X5HA 3CDFA 4QRQA 5HJ3A 2NNAB 2I26N 2E7HA 4LVHC 5IGXL 1QVOA 2FBJH 3HE6C 5GGUB 2O5XL 4LCWD 1U8LB 5K59F 2IPTL 2FSEB 1FSKB 2GJ6A 3EOBA 2OR9H 3QNYB 3D9AL 2GTZA 5HD8C 4R0LA 1NGZA 1MI5E 5DLML 4NHCH 2VLKB 4NO2B 4FXGB 3F5WB 4O5LL 1PKQA 4LASH 3QHZL 4GAJH 3O3EA 1SBBA 4GBXB 4FFWC 5L9DL 1Q0YH 4N8PA 4PP1D 2A74B 3GSQA 5DUPL 4NM4H 2P8LA 4OTXH 3NABH 3SDDA 3J7HA 2YXMA 3KLAB 4LARL 4W6XB 3D85B 2IQAA 3K1KC 3CFKB 4GXUM 5IMMA 1A4KA 3GSVA 5HGBA 1CQKA 3L7FB 3LY6A 4I3SL 3QRGH 5H94A 1QBAA 5EUOA 1CFVH 1QSFB 4JKMA 4NN7B 5E2VH 4Q9RL 3RA7H 4M8QA 1J8KA 2CDGB 3VXNB 2BVTA 3BT2L 2X4PB 2FYYA 5T1KA 3ULSB 5FYLH 2ED9A 5TE6H 1EUTA 5IW1A 2X6MA 3F7RA 5GS0L 1QEWA 3WJJC 2VH5H 2OTWB 4L4TE 1BBJB 3WMSA 4WGWB 2R0KL 4XCCL 3BX7C 4YDLB 2V5YA 1OHQA 5JOEA 3V5HA 3NFPA 3W5NA 4EN3B 2DQFB 1KJ3L 3VMNA 5DUBA 2QADC 2R2BB 5JUEH 2GQHA 4MA3A 4NJ9H 4YE4L 2I5YH 4HWZB 4OCXH 1FNEB 4PRPD 3RX7A 5J56B 3AC0A 4U1HA 4LP4A 2B8OT 1J1XL 2OJEB 4FQQB 3SKOA 1YDPA 4DQOL 4NM8L 3MXWH 1PW3A 3TN0B 5C0IB 4JKWA 1OGAB 3DWTA 3RGVB 5IT2H 1Y6MR 1F4HA 4HCRL 5EO1B 4M1DH 4JZOA 5L2JA 2QKIB 2DI7A 4OAWB 5DD0L 1WWWX 4RWYH 3LN9A 4HGKC 5FF6A 4D8PB 2BRRL 4PLJC 3F7YB 2FIKA 3TCLA 4HMDA 2J6EH 3UTQA 1DANT 2B7DT 3NIDE 3STLA 1EZVX 1KTLA 2QBWA 1KFAL 3CVHL 4U2ZA 4M4RA 1B0WA 3GMQA 4QCIA 3BDBA 3K8MA 4C56D 4H8WC 5FAAA 3LV3A 1K9TA 5BRZE 1RZKC 4LSUL 2ZG2A 3OGCA 1WBXA 1Y18A 4M1GL 3SEPA 3DYOA 4F7TB 3OJDA 4X4MA 1AHWB 4YHYB 5LGJA 5CZKA 1WUNT 2PXYC 4ELKB 4YHNA 1KCSH 3DX6A 5C6PB 4GUPB 5I8KL 4PYHA 1AQDB 1WIPA 1E27A 1P4IL 3LQAH 3W39A 5E08H 5M7QA 4AL8H 2VQTA 2NYYC 2GT9B 1IQWH 2AI0H 4M1CD 1AKJA 1HCVA 1Q9OA 1BQHG 4MHHI 3MV7B 1TZHB 1ZA3B 4JB9H 4JRYA 3FN0H 1YMME 3HC3L 2DM2A 5I1IL 3HR5B 1TJGL 1AKJD 1WGOA 4OZGF 3KJ6H 2Z8SA 3MNVA 5FEBA 4KJPD 3QPQD 4QXGL 1P4LB 1KPVA 2APBA 1A9EA 4GKZB 2D7OA 1RIVH 1UFUA 2XTJB 1MCFA 3MLSH 1IGMH 3A0OA 4XNQA 3O3AB 2O5ZL 3BMVA 1FZOB 2ITDB 4DOHB 2E3VA 1IM9D 1DVFB 2UWEB 3LIZL 1RZ8B 3ZTNH 1I7ZB 5F3BB 4GG8B 3QEQE 1KTKE 5DD6A 4AT6A 1W72A 4NQEE 2JELH 4PJCE 4I18C 2DL9A 1G1YA 3HPJA 1GXEA 3IFPA 2VERN 4L4JA 4RDQG 3WIFA 1G9MC 3HUJF 4RMRA 3L5JA 5HHQB 1YYLL 4NBXB 2YA1A 5KZCB 3WIHA 2KBGA 2RFXA 2ZOLA 1U8KA 1ZVYA 1I3RB 1LO4H 4EBQL 5J13B 4OB5L 2ZOKB 2IADB 4P9HH 5F88B 4EZMA 2QHRL 2YBRB 4X6FA 3SQOL 4CDHA 1KB9K 1X9QA 3KPLB 1NCWH 1V3JA 3P4MA 5LBSL 3F7VA 4NCDA 4JO4H 1T7YA 3QFJE 2EKSA 1OAKL 1EGJA 4JO1L 3DMMA 5HTSA 5I1CH 4Y4KC 3G9VA 4AENB 4V1DE 4Z7QF 2YRZA 1K4DA 5E8OA 3I6LD 4K3DL 3NPZB 3VFUB 3TJEL 3DMMD 5I1DA 3K7UA 3CSYB 3SKNB 3BPNC 1IVLA 4E42A 1QSEA 4N8VG 1K5NA 4WO4B 2B4CL 3L7EB 4FG6C 4GQ9H 4HF5L 4AQ1B 2QQLL 4OT1H 2X9YA 2H32A 43CAA 2NX5B 2DLGA 4L4VA 1W72L 2ARWA 3G6JA 4K8RH 3PP4H 1C12A 5E24E 4XRCB 4X8JB 1CDIA 3C5SB 3RNKA 3T0VA 3KPPB 3TNNA 4DKFH 1FFPB 4PD4K 2A2QT 3ULVD 5KANI 3BJLA 2AK1H 1IRAY 3MV8A 5IJKC 2GI7A 2Y36H 1HH6B 4XPHH 1A1MA 3WE6B 4OKVA 4UTAH 2XG5A 3NCCB 2VDMH 2AEQL 4RFNB 1H8NA 1IC7L 1X5ZA 3HI1B 5D2NC 3JTSB 3PIQA 4KUCD 4TUKL 1PZ5B 3U9UA 1Z5LA 4PJXB 2FHCA 4ODHL 4L5FH 3LEYH 4RGNC 4PJGE 4QRUA 2DQIH 1ZHNB 3R0MA 4A6YB 3B9VA 3QG6B 2GSGB 3OKDB 1YPZE 1YYML 2P5ED 4R2GB 1CU4H 5HBBA 1A6WL 5DEGA 2GY5A 4G6KH 3BPLC 4CVUA 4HAFA 3UJIH 4ODSH 3O2DH 1FFRA 2WUCH 1BF2A 3TBVB 1PDKA 3ZDZF 5CEZE 5DD3H 1MFBH 2OLDA 4MJID 1CGXA 1SJEB 1BZ9A 4KKBC 1FRGL 1P9MA 3KDMA 1XCQA 1CFTA 4P23A 3DVGB 1KJVA 2FO1A 5BRZA 3QUYB 2EYRA 3OAZH 4NKOB 3I84A 4QOKB 5DEFA 5DVMA 3P2TA 5C3LD 2R1WB 4P23D 3ZHLA 1J18A 3LVEA 2QHLA 3OZ9H 3O6ML 5KN5A 4HUUA 1D9KB 3PWLB 2AGJH 3JXAA 5BVJA 3DHJA 3O4LE 5L2KD 1YQVH 1QO3A 4YXHH 2ZWLT 4I3RH 4UIMB 4EI5B 3BDXA 5E9DE 3VJ6A 5E6ZA 1FYTB 4MCYB 3IJSA 1VEOA 4OGYH 5F8QC 3WKNA 1MQKH 1FORH 3BKYL 1A1NA 2Y6SC 1A14L 1BOYA 4D3CL 5DT1L 3JZ7A 4MDIA 3P0YL 3O9WB 4JPKH 1JWMB 5F9OL 1JGVL 4JM4H 4UT6L 3M45A 4LIQH 1ZK9A 2VLRA 3X11B 4IRSA 3SGKC 3H7LA 4ZNCD 2ZCKL 1UC6A 3MJ7B 3DRQB 1I3GL 3FONB 1CZ8H 4QHLB 2VLRD 3IFLH 3LQAC 4JVPA 5IHBA 3T4YA 4F7EB 1ZGLA 1GHFH 1OP5H 4R4FL 3ARGB 4WW1A 3MROB 5EBWB 1F4XL 5A1AA 4QXTB 2D0GA 4IOIA 1X5LA 3FRPA 4RGOH 1P1ZB 4EVNA 4ELMB 1RIHL 4OD1L 1Q94A 2NY0D 2YOCA 5D6DA 1KCUH 1RZFH 1K6QL 3QEQA 3O3DB 1LE9A 3BWAB 4GAYA 1NAMA 3VXME 4O51A 5CFHA 4NQEA 1NFDE 1KEGH 2X09A 5ESVB 1JYXA 2IMNA 1OB1A 4RZCA 3IGAA 2IBZX 4KGLA 3VFSA 2BY3A 4MVBD 2Z4QA 4CNIA 4HMCA 3WHXA 3PDOA 1YY8B 2LU7A 5EWIH 2NY4C 3MRCB 3MRQB 4QRRE 4PR5A 1T1ZA 1A7OH 4JVWA 3FO2B 1V7ML 1Y0LB 5CEXA 1E4XH 3GSNL 2VDNL 1KPRA 3DX8B 5BV7B 1JHTA 2BNQD 1KGCE 4OZHB 4XTRC 4L8SC 3WIIH 5TF1H 3LS5L 3CFJA 5DUML 5HGAB 4IRJD 3ARED 4N1EA 3QFJA 1M4KA 2GJJA 3MNWB 6CGTA 1KELL 3TO4C 4XVJH 4BKLB 4B7LA 2P4AB 5IWLA 1RIUH 4LEOA 4W70A 3DUSA 4E5XA 5C08D 1PG7X 4U49A 1XGYL 2WWKO 4RAVA 4XX1E 2HH0H 3VXSE 1R3KA 4PJIB 4OBRA 4P9HC 3QT2A 3PWVB 2UZYB 4NRYA 2VDOH 4FFWD 4APQB 5C0CD 5ACMA 5FB8B 3WJLA 4QHMB 1INQA 3PV6A 4JVUA 4RFOL 5HHOA 4A6YH 3NTCH 1ITCA 5IFHH 2EYTB 3WFDL 1RUQL 5C0BE 2P7TA 5FDYA 3B8YA 4ETQB 4O9HH 2I60H 4F37K 4L29B 3S4SG 5HHOD 1KACB 1DQQA 5E4IA 2VWEC 3L1OL 3UTOA 2BHYA 1H8OA 3CUPA 5C0FA 4YX2L 2XKNB 3M1BB 3KYOB 4XT1C 4XAKE 5D2LA 5E1AA 4GFTB 5ECJE 4OD3L 1CGTA 4IHOA 1T20A 3MRBB 3VH8B 1HEZB 3X3GL 4WUUE 4FNLL 5D1QA 1NCBL 4K8RC 5JPMA 4EDXB 5EOTB 4GJTB 2XWJA 4PP2B 1FN4A 2AK4A 1IZKA 2NXY