2XWTB

Crystal structure of the tsh receptor in complex with a blocking type tshr autoantibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
b'SVLTQPPSVSAAPGQKVTISCSGSSSDIGSNYVSWYQQFPGTAPKLLIYDNNKRPSAIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSRLGIAVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 HEAVY CHAIN
publication title Crystal Structure of the Tsh Receptor (Tshr) Bound to a Blocking-Type Tshr Autoantibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2010-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtB01
3KYNB 3IFLH 4OF3A 1NMCB 1OPGL 4UIKH 5LCVH 1JNHA 3PV7A 1YNTB 5DJ2B 3P4NB 4Q9RL 3MR9A 4P9HL 3SDXE 4YXHL 3GB7A 3C8KA 1UJ3C 4JFZH 2FJHB 4FQXB 4LGSB 1QD0A 3V6FB 2Q76B 3P9LA 2ZKHL 3CVIH 5JXEC 2R2BB 2X1OA 3MLUL 4M3KB 4XPTH 1DBKH 2FIKA 3CXHJ 5J3HD 4XVJL 4BYHA 1JP5A 2ATPB 4JFEE 5K59F 3OQ3B 4F7MA 5E9DB 5CZXD 3AM8A 4XBEL 4G9DA 2NTSP 5GHWH 1RUKH 4O2EB 3HNSH 4LPVA 3GRWA 4NQSB 4JFYB 4FFVC 3GBLA 4YWGH 4Y4KC 3RP1A 5C0CD 4U7KA 1DBAH 2QQKL 5JIPA 4MB4A 4JANB 2C7UA 3PV6B 1JNJA 4Y5VA 4NQDB 2FJGB 1TTGA 4OCXH 2F19H 4BH8B 1X5JA 3UPRB 4PJHB 1QVOA 4P5MA 1RFDL 1X5GA 3SQOL 2OZ4H 5FHAL 3A6CH 3N1FC 1VEMA 2FD6H 4Y4HC 1FVEB 3TYGH 3BE1L 3NAAH 3I3EA 5FM4A 1BFSA 2YD3A 4JDZA 1FIGH 4G80A 1NC4D 1FNFA 3MRQB 5GGVY 1WJ3A 3IETB 4S2SA 3LS5L 4UNTA 2VXSL 3I2CH 5I17B 4APQC 1FNEA 1Q94A 5E6YA 4AEEA 2H6PB 1NCAL 3G5YA 1R5IA 5JR1L 4PJAE 3DMMC 5TDOA 4YHIB 5F1IA 4P2QE 4L8DB 4PJBA 5MENB 3NZ8B 4PJ5E 5H35B 3T0EB 3TCXA 4CN1A 5EN2B 1KPVA 1BQHG 4MXWH 2PTTA 3BN9D 3CZFA 1HHJA 4NZJA 4X4ZA 5I1HH 5EU6D 3MBEA 1KN4H 1I85A 3ARBA 1QSFD 3P77B 4P0DA 4MJID 4QXTA 3JV6B 2DQHH 3QRFM 4FTVD 1JWSB 1NCDH 5BJTA 4YIQB 5BRZE 3S88H 4N8VG 3VI4E 2GJJA 5I1DB 2R1YB 3NFNB 3U0PB 3LV3B 5AD0A 4OFYD 2YMXL 5FKAB 3CPLA 3DVIA 1RZ8B 4QRQA 5LQBH 5HSFA 4FA8A 3GGWB 4OGXL 2QSCL 3DXAB 2J6EA 3QCTL 3FB8A 3SCMB 3P30H 1E28A 4MAYC 3IFOB 2YA1A 4LRIC 3EYQC 3VFUA 1YY9C 4WGWB 2HJFA 3IDXH 2I5YH 2XN9D 4X6DA 3UBXB 4QOKB 2E5EA 1B0RB 4X8JA 2HMIC 1MJJA 5BZDB 3PGFH 2PNDA 1HILB 2VL5B 4DUWA 4PGEA 1CF8L 1ZGLA 2BNQE 4KI1A 5T3ZH 4LEXL 3IKCB 1Z3GL 1NUDA 3O2DH 3JWOL 2OTUB 4JFEA 3CX5J 1OP5H 3BGFB 4HS8L 1B2WH 3WD5L 3SN6N 4HC1H 1NDGA 1CXIA 1JUFA 1A8JH 1IC7L 3MA7A 4Z8FL 1NGXB 1U8HB 5BQ7A 3TJHD 5TQ0L 3LN9A 4HIEA 2FHFA 4J8RA 4M4PA 4P5KB 4XMLH 1XGRB 5ETUA 1PKQE 1NSNH 3V52H 3HAEA 2Q1EA 4PJ7F 3IDUA 3VXTB 2AAVA 4BQ6A 2UY7A 5HYIA 1DN0A 1NGYA 3HNVL 1A2YA 1AXTL 1KN2L 1BVKA 2X70B 2FZ3B 1OVZA 4R7DB 2RBLA 1IM3A 2J8UB 4WNQB 2QADC 2YN5A 3CU7A 4HDIB 2YEZA 3FQRA 5IJKC 3HB3C 4CMHB 5C0JA 1JPSH 1U42A 3BPCB 4X5LA 1HWHB 2WUCH 4JO2H 5IVNA 2FECL 1BAFL 1HEZB 5CEYB 1V05A 3X3GH 1CWVA 3AS2A 3SHSA 4Z7NE 1P7QA 4R26H 2JJUA 4N0RA 5DJDB 1LO4H 3KNBB 3RUGF 4MNHA 3KHOA 1G7IB 4P2QA 4LSRL 3LOWA 5CZKA 3LS4L 5C86A 5K9KA 4ZS6D 5ALCL 5ISZD 4HJ0C 5C1MB 2V5SA 3LKOA 4I18C 2VZVA 4YR6A 4HV8A 2IADA 4M61A 1UZ8A 4PJ9D 5TQ2H 3TZVB 4R4FL 3U7AA 3RZCA 4F7CB 4X5XA 4Q97A 4MA1B 2E27H 3C6SA 2OXGA 3HPJB 1WCBA 4PJCF 3VFMA 1XIWD 3HR5B 1RUPL 3K3QA 4ZO6A 3TO4A 3WO4B 2ZUVA 4ZTOL 4QF1B 4KJPD 4MJ5A 4NZTH 4KJYA 4PP1D 4ETQA 1I7TB 2XZCL 1L0QA 1HXMA 2ZNXA 3EOTL 4JDTH 4MD5B 4U1NA 3MV9E 4XPAL 2ESVA 4XNXL 3L5XH 2J1KA 3LKSB 4GW1B 4NNXB 3VXNB 5DK0B 5E1AB 1UEYA 3O8XD 4EN3C 4ODSL 3GNML 4YE4L 4ZSOB 5ICYB 1MCCA 3DRQB 4ZDHB 4IHOA 3A6OA 3INUH 3RWFB 2Z31D 1BX2B 3KPSB 1XF5B 3UAJC 3ROOB 4DCQA 4KHTL 2YR3A 1OAKL 1A7NL 1BIHA 3MOBL 2EYSA 3MUGB 1JV5A 3D9AL 1DSFL 4QHUB 1MFNA 1TETL 3I75B 4K94H 5F9OH 5DYOA 4UIMA 4YDVB 3JVGA 4IMLA 3ULVE 4DGVL 1RVFH 3QULA 3AVEA 3QWRD 3N85L 4P9ML 2OMBA 3OZ9H 4MX7A 5BRZD 5IMKA 4AMKL 3M1BA 4WHYH 1V7NL 4XP9L 5CS7A 4K3JH 4QRTB 4N5EC 1Q9WB 4HFUL 2V9RA 5IHUL 3V5HA 1A7OL 1SQ2N 4GT7A 2QJDA 2BY0A 5CJOL 3QPQC 4NFBA 1MFDH 5FK9A 4BQCA 1S7WB 3HC4H 5IROC 1MFCH 5I16A 1HH6A 3FZUC 1AD0B 1HDMA 1A3LH 3CH1B 5KANG 3TYFA 2IPKB 4MD0B 3QXAA 3WDJA 5I76A 4LLVA 3BHBB 3ZMRA 4UV4L 4F9PA 4U6TA 3MJ8A 4HKBB 4AY0A 3DUSB 4Z7WE 4GBXD 2CK2A 1FYTE 1I9IH 1T1WB 3NMEA 4NQCD 5D7IE 1KT2B 5EZJA 5DUBA 3ULUE 3E3QC 3T3PF 4TUOB 5LBSL 5EC2B 3IU3B 1T5WA 2VXQL 3F12A 5KSBF 1UM6H 3NCYP 5D7LB 5D2NB 5I1JL 4WFFE 1QACA 3IRPX 5T5FL 3UC0L 3PHOA 3QUYD 5L7XH 2K1MA 5D70L 4K71B 3BAEH 2DOCA 2CLRA 2O93L 3L3GB 1EO8L 1HSAA 3MRDA 2AK4B 1CGYA 5HHVH 2QHRH 2IQ9H 3FONB 4KZDH 1YN7A 5TFSL 3FB6B 4LFHG 4F37K 5C92A 4G43B 1IM9A 12E8H 2BZDA 1MREH 4LOUD 4PGCB 2PXYD 1J0YA 1D7FA 4RIRB 4WI6A 3CVHH 4M7JH 1BVLB 2D9CA 2PYEE 3MV9A 1VA9A 4AG4L 5J8OA 4YHNB 3EZJB 3T2NH 3ILQD 4CU8A 4XGZA 3R0NA 1UB5B 5C09A 4Z9KB 3TT3L 4G6JL 2PR4L 3IDYB 4E41B 1BD2B 2P44B 3G5ZA 5I0ZA 3VRJA 1EEZB 4EDWH 3SGKA 1KIPA 3KHQA 4ZFOB 1J88A 1OW0C 1UKSA 5F44A 1YECL 3H9ZA 4L5FL 3WS3B 3GK8H 4YGAB 4A2LA 2YD7A 4Z7OE 5BVPH 4GQ9H 5I75B 1KEML 3H9HA 3STLA 2QSQA 4CU7A 5D8JH 2OL3H 4LRNL 1IMHC 2FB4L 3MZGB 2BSSB 1A47A 1M7IB 3RIFF 1FE8H 2A9NL 3K4DA 4P3CL 5HI5D 5GS0L 4OFIA 5EUOF 3LQAL 1UCBL 4UT7H 5FGCB 2BVEA 1T0PB 1FL3B 3LIZH 2H26A 1UJ3B 1YC7A 4P2CG 5FDWB 1RZKL 2APWA 3GO1H 4UOW0 4HGWB 4OIAA 4ERSH 3WIHL 1VPOL 2NCMA 1NCTA 4X0KB 3VGEA 1J8HB 5T5NF 1RZ7H 4WWKA 4OZFA 3T0AA 3RA7H 4AM0B 1CYGA 1U8NA 3U79A 1LNUA 1ZHLA 4JN2A 2VR5A 5B3JE 3RTQC 3Q0HA 2UZIL 5D7IA 4Y4KB 5ERWA 3U7WL 5E2TH 1CVRA 2O5XH 5KSAA 5C0ND 5EPMA 5DUML 5J6HB 2IBBA 2YD4A 3R1GL 5DRXB 1CE1L 5E9DD 3ULVD 5IEKB 4PJ8C 4KPHL 1CLCA 4MD4B 5CWSB 3LKQA 4L3CA 5C0IA 3OR7B 3PWUA 3PP4H 4XWOD 2HWZH 1CDYA 3Q5OA 4DUVA 3REVB 1CIUA 2AV7B 3JZ7A 2Q8BH 1P2CA 2EXWD 4LEOA 3PWVB 2OK0L 1RUAH 2BERA 4JQXC 2OI9B 1Z9MA 2VDKL 3V4VH 1I1YB 3L6FA 1A9EA 4OD1H 2O5ZH 4JQIL 5GS0D 3SDCB 1T7XA 4JZNA 4UQ3B 2B1AH 3WNPA 2YS4A 5EIVA 4YXLH 1TQBC 5D7JC 4LHUB 5JORA 2AQ2A 1G7MB 5F7EL 3T1FB 4F8QA 1YDPA 3STZA 4QGTA 2NZ9C 4R4BA 3WS6A 1RZFH 3R4DA 3GSWA 5K9QI 4FZ8L 4NQTA 1IC4L 2WIMA 4NDMA 5J11C 1KCVL 1H3PL 3R8BB 5CSZB 3S5LA 1YEDB 5TE7L 3QIUA 1XF2A 4MNQA 4O4YH 5J9PA 5MEND 3T0ED 4WFFD 1BBDL 3DETD 4S1SL 4MDJA 4LPXA 3ZKMC 4NKIH 2VDOH 4M03A 4UDTA 2NY4B 1DL7L 3BQUC 3D1MC 3ZYOA 5ICXB 4CUCA 3IT8D 1A4KA 2V6HA 3B9EA 3D2UB 3CFKB 2CJUH 4PBVC 5TF1L 4Z0BH 3WSQL 1UWEH 1JHTB 3EYOB 5FUZH 4XP6H 3CFCL 2ORBH 1S9KC 4RGMB 3D0LA 2W0LA 3WIFA 2X41A 3FO0L 5D1ZA 3HMXH 3DXAD 5I1EL 1EMTL 1Y0LB 2PYED 4X99B 3IXTB 3D85A 4UNVA 5EB9A 5I8EB 4U6XA 3LD8C 3E2HC 2X1PA 2B7DT 4QOKD 1EXUA 4X80H 1U8JA 5ENWA 2D31B 3VCLA 3DSFL 3LN5A 2GAZB 3V95A 1VADB 3EGSB 2PO6B 4KKCC 3VD3A 3S98A 5D6CA 3CFEB 4KK5C 4Y1AA 5GZOD 5ID1A 4XCEB 3BZDA 1OARH 4NJAL 2D03L 1I8IA 1F90L 1TTFA 5I2IB 5GIRB 3RUGB 1U92A 1H8NA 5FDYA 5FGSA 4KGJA 1MCRA 2Y07H 1XH3A 3PHQB 4ZFZA 4XC1H 5EG6C 3QP3A 1YUHA 2QADB 5EZOH 1MCWW 5DMKA 1FO0L 4L3EE 4ZNCD 4K2UL 4AT6A 4PRNB 4KMTH 1FNAA 2AJYL 1JL8A 2NQCA 2X4NA 2V2XB 1LEKB 4PJCB 4TVSa 4PTUB 2H2SD 2DQCL 1H8OA 3UYRH 4DW2H 3RY6C 3V4PL 1HHIA 2NY3C 3PQYA 1EHNA 2BVPA 2SEBB 1XZ0B 5TPWH 3EHBD 4Z7UB 2ITDA 3ZHLA 1TFHA 2HFEA 4GH7B 4TNVF 5KVEL 5C07B 1ZT4A 2IFGA 3N1QC 3P0VH 5I1GL 4M3JA 4MCZA 4I18B 3DX6B 5CKGA 3CXHK 4P57B 1F3JB 5J0BA 3TESA 3NFPB 3OB0H 4JO4H 4IOFD 3SDDC 1KJ2B 1JWUA 2Y4SA 1E4WL 1YEJH 3SO3C 2VTFA 3BX7C 1A9BA 4BZYA 4ONHB 1MCEA 3LZFH 4D9LH 2GIYA 3Q6GL 4YZFF 4H88H 5HPMA 1NBVH 3UP1A 5ICZA 2Z93B 4RFNC 3RX8A 1AR1C 3TZVD 5B8CB 5T1DL 3H9SA 3X11A 5HGBA 3KLDA 1JNNL 1IJ9A 2IG2H 4P3DB 4R0LC 3UTOA 1AY1L 1Z6JT 4HIIB 4HX1A 4UT9H 3O6FD 5MEQA 3DROB 2YWZA 3DX8A 2RGSA 2HJKB 4UI2A 5EZLB 4CN6A 3MXVL 1RUMH 1UM4H 5EOCL 3B8SA 3DTXB 5FGCE 1AGCB 1KCSL 2BNRB 3QWOB 4NO5A 5EU7C 5FF6B 4XCFL 4S0TD 4U0RC 5T1MA 1Y6KR 3BUYA 3HZYA 2BSRA 3TA3B 4XT1C 5TDPA 4CRPA 2EO9A 5HHXH 2NLJA 1QO3A 1MI5A 5LGJB 4OLYH 5I9QB 5IV2A 4Y8AA 3KPSD 5DJYA 1NGPH 5F9WC 1W0WB 2E7CA 3K7UA 2V5TA 4K9EC 5EFIB 3U4AA 4Q9QH 1MIEL 1PKOA 1CVSC 4L8BB 5F9JB 5FECB 5GS2H 3WDHA 1H3GA 1IAKA 4LPYA 1URLA 4YDIL 4G42B 5L6YL 4H0GA 5CJBA 5KSBB 1NAKL 1KXQE 4GRLC 4PB9L 1JPST 3WV0A 4TSBH 1XGUB 1YEIH 4HKZB 1GZQA 1IAIM 4L3EA 3EJYD 2XFXB 1HQRB 4QHMA 1IGCH 3K4AA 4K3DL 2P8PA 1NDMB 1NFDA 1LEGB 3KPOA 3TPUA 4RGNB 4TULL 4U3CA 4FN0A 2DQIH 3WFEH 4HUWB 2ERJB 4IDJH 4PLKD 4HJJH 4U1KB 1A6TA 2M2DA 3GBML 4NBZB 2EEAA 3T65A 4LKCB 1S7TB 5JIHA 5IB5A 3QUXC 2WBJA 3EOBB 1G9MH 3H2WA 4YDKH 1X4YA 3D3VE 1VGKA 5IBUG 1S7VA 2J3SA 3CX5K 1QLEH 2XIDA 4ALAH 5H37H 2IALB 1F02I 1OGAE 1IAOB 4RWYL 2BHUA 3DUHA 1KLUB 5D7LD 1ZK9A 3KJ6L 1S9WB 5IWLC 1AFVL 3GSOA 1GZPA 1QFOA 1GCFA 2X7LB 4JY4A 3VD9A 5JDSB 5FO7A 4OIBA 4GXVH 4EUPA 1C8PA 1P4LB 1HSBB 3CU1A 1MHCB 5DURB 2VLJA 1IGJA 1IEAA 3UTSA 3MUJA 2AK4D 5JOPE 1W0VB 3LMJL 1K85A 4MAUH 1VFBA 3O11A 1MFAH 2ADJA 3EYSH 1WBYB 3ZDZF 1JGEA 3EYVA 1YEEL 4P46D 3B2VH 4WI4A 4I8DA 2Y6SC 4ZYKB 4X4YA 1U6AH 4EDXA 4PJ7E 4Z7QF 5EUOB 3SE8L 3ZKQD 3EJJX 3T8XB 1TZIB 4UB0H 3DVNB 4Z18A 3B43A 5ESVB 5IVOA 2B0SL 1YEFL 5ALBH 2P1YA 3MRBB 5JZ7D 3DHJA 2A6IA 3UTPD 5CEZE 2FYYB 1NCCH 3FT4B 5FO8A 3W0WA 1BD2D 5JIIA 4B53A 2L7UA 1MH5B 5DEGA 1PVHA 5FYKL 5I66B 1QBLL 3FMGL 3PGCB 2IMMA 4XNZC 3ZKNC 2VLRB 3Q3GB 2ZSVB 4KI5C 3CJJA 5E00B 2N7AA 4ELKA 4OUUA 2BOBB 4XH2A 3H42H 1UXWB 4YDLC 1IT9L 1XFPA 3RWCA 3RGVB 2FR4B 1XF1A 3BISA 1OLZA 4UU9A 4OJFL 4YPGA 4Y16B 1QR1B 4FQIH 2DYPB 5E8DH 2QKIA 1RK0A 3QXVA 4OUOA 4W68A 4EI5A 1XGPA 2BNUB 3MLVL 1OQOA 4CADA 1KJVB 3K2UL 1JIBA 2GY7B 3QFJB 3VMNA 1FORH 5F88A 1J8HD 5DFVD 3F6IA 3FN9A 3RVVD 3NTCL 3RX5A 2JTDA 3L95A 1MJUH 3L3JB 2D7TL 2X1QA 2BJMH 3C2SA 4GKZA 3IDNB 2W0FA 4KRMB 1CD8A 5FKPB 4OLUH 2IMNA 1AJ7H 1FGVL 5HHME 3L9RA 4WI3A 2H32B 5EA0L 5KAQG 3U48A 2H41A 1JRHH 1V7ML 5DC0A 3LQMA 1HOCA 4JRXE 4KHXH 5DQDL 2C1OA 5K9OB 4OSUH 2BVOB 2X42A 2D9QB 4YX2H 1DBJL 1CD1A 1L7IH 4OCRH 3VFPB 1MRDL 3VI3F 1A14L 1IGFL 3UPCA 4QXUL 2G60L 4IM8A 3QEQE 3L3IB 5ESQA 3PHSA 3W9DB 3HE7B 2EZ0C 3OPZH 1F42A 4M1DL 3SDCD 3V6OE 2D7OA 3KPRA 5CUSL 1HHKA 5F6IB 4LHUD 4MJ2A 1YEKH 2Q3ZA 4NC0B 4PJ7A 1TTUA 5C08A 4AIZA 2R1XB 2NXZB 8FABA 3FQNB 2XXMB 2IGFH 5AZ2H 2W60A 3G5XA 5DTFA 4DAGH 3LSOA 1UG9A 2AQ1A 4EIGB 1A6ZB 1FRGH 2Q6WB 2FO1A 4MJ6A 5FFLA 1KEGH 3DUUB 1TVHA 1S7RB 4DTGH 4XCNA 2XYCA 2CKBB 4X6EB 4YC2B 2C1PA 4Y4FB 5SV4A 2D7PA 5L0QC 1NAMA 3BPNB 4WDIB 5DS8A 25C8H 1OSZA 1JF1B 2DI8A 5GRJL 2R0KH 4NO2B 4I0CC 1GPOH 2RQ8A 3T3PE 4WTZG 1KLGA 5F3HA 2NY4D 2CXKA 5C70A 5LXGH 4MQ7B 5BOZG 4LLUA 1IKNC 4C56B 4F2MA 4CVWA 4PTTB 4RDQF 1SJHA 3ARZA 3D2UD 5IR1B 2YXMA 1RZJL 4WTXA 5HD8D 2NW3B 2NTFA 4XBPB 1AE6L 4YHYB 4G8EA 1NLDL 1JTPA 5EC1A 3JUYA 2EDWA 2Z91B 4RGNE 3F7YA 4JRWA 1NEZB 3IFPA 1E4KA 4UAOC 4WEBL 2FJFA 4XAWH 3WLWD 2JF1A 3NCCB 3WUWG 1K8IA 1F4WL 2LTQB 2JE8A 3KYKH 3KPLA 4KRPB 3EO9H 5CEZD 2OQJA 4U1IB 4O5LL 2V9QA 6FABH 1YPZA 1YY8A 1KJ2L 2PO6D 2AEQH 3LEVH 4K7FB 5C0CA 2EIZB 4LVNC 3CMOL 5GSVB 3RZCC 4NUJA 1PG7H 3SKNB 3D69B 5IHZA 2VDNH 4PRAA 5BV7C 4LSDA 3HMWH 4MB5A 3RNKB 4R7NB 2ZG1A 1LGVA 5KSVA 5FCUL 2VDPH 2DD8L 3JWDC 5L2KB 1JHLH 5CJQL 3BO8B 4JRXA 2NY3B 4LSQH 5J13B 3HC3L 4LSTL 4KKBD 1F8TH 1CG9B 3RJQB 3LH2L 4LCWA 3IU4L 3S37L 1D6VH 1AXSB 3QEQA 1UWGH 5DWUH 4U4BA 4PJIA 2P5WE 5JO5A 5KVGL 2GCYA 4LCCA 2HT2D 3HZVB 3PP3K 1XF3A 4LSPH 4M43L 4NWUL 5DSCA 1RIHH 2H2PD 2UWEB 5IT2L 1E4JA 5I8OL 1I1AA 4KAQH 4YHPA 5EUOE 2ZCLL 5I1KL 3G5VB 2WK2A 4P48A 5L8KB 4PJFA 1IGIH 3AXLA 2JB5H 5C07D 3WXWH 5IMLB 4H1LA 3GRWH 3WFHA 4PRHE 4CJ1A 5CHNB 1PW3A 1FVCB 2LU7A 2R4SH 5CJXA 3T2QA 4HUXA 5EU6A 1Q72L 1JRHI 1L7TL 3GMRA 4LLAA 3MCLH 4MJIA 1FNSH 3H0TB 4FTVA 3VD5A 1KIUA 3DOSA 4R0LB 5HDBF 1FFNA 4XI5C 2WMPA 3DYMA 4RFOH 3CAFA 3BXNB 4F57H 1BM3H 1IGTB 3BRFA 5EU3B 1FNLA 2GITA 3NCBB 4FFYL 3O45B 4J4PA 2YOCA 1REIA 3CIQA 5IFJB 3V9FA 3NPSB 1NBYA 1F97A 3C2AL 5F89B 3AREB 3DIFB 2F58L 4ZUTB 2XN9A 2HFFA 2KQNA 2AKRB 5K9JH 3NIDE 3PWLA 4L9LB 3TCLB 5I1IL 3IDGA 3QEHB 2HLAA 1RK1B 3GKWH 2IJ0C 4WW1B 1CLOL 2BNRD 3O6KL 4F9PC 4U1MB 4XNQA 5CJ8A 2Z0BA 1Q1JH 1UH2A 1LEIA 1Z0NA 3HE6C 5L88L 5AAWA 5F1NA 1HKFA 4ODTH 5SWZE 2XZAH 1JTTA 3QRGH 3MNWB 4N90E 4OCLC 2VSCA 2XKSA 1IQWH 4Y5YB 3OXSB 3UJTL 2DBJA 1T7VA 3S35H 2A6JB 4V1DE 1J87A 4QRPB 5DRNA 4Y7MA 1FJ1B 1T3FB 4GS7B 3DURA 3FKUS 3L5WA 5GZND 4FQJH 3F8UB 1C7SA 2NY2B 4R90L 2DB8A 3QFDB 3QUZC 1Q9LB 5C8JB 4AH2B 2J6EH 3HZKB 3UBXG 3OMZA 1FN4A 3S7GA 3QUMB 4QTIH 1MCOH 1CL7L 5GISL 3OKOA 1TLKA 4ZUSB 4NQEE 4QRSA 2ZOKA 4NBXB 2AI0H 3ZTNH 4DK3A 4NRZB 4JM4L 1HXYA 5HHNA 5F71A 4C83B 3SDAA 2PN5A 3EOAA 3MRIA 1WZKA 4ETYA 1T1XB 1PD6A 4RGND 2A74A 1F45A 1MF2L 4R4NC 1AGFB 2DQJL 3MV8B 3BDXA 3U1SL 3IXAB 4H26B 2LE9A 4WO4B 3PGDB 1RJYA 1ND0B 2R0WL 3DGGA 1X5ZA 1A7PH 2X10A 4JM2A 3DLQR 3RFZC 5T33H 1A1OA 1Y6MR 2ICWI 1ZHKA 3RAJL 2ZSWA 2MQ3A 5ISZA 4RNRB 3DJ9A 1TZGH 5CINL 4POZD 4NFCA 5KJRH 3H7BA 4XCYA 3GMPA 2DTMH 4Q58C 1NGQL 4HIXL 1J1OH 3HAEH 5GGUA 4N9OB 1EA9C 1WK0A 1RULL 3D18B 4P2RB 3QO1B 2VYRE 4X7EC 3BZEA 1ODAA 4WHTB 4CVUA 1KFAL 5DJ6A 4GUPA 3BI9X 4MCYA 4NQVB 4BELD 2PW2A 3HLAA 3TBWA 3MREA 4LIQL 4OCNC 1QLRA 5DURD 1KIRA 2FCBA 2GKIA 4PRDB 2CK0L 3GSUB 4AEFA 1T04A 3O6LH 4JO1H 1QLFB 3UJIH 1LO3H 3OAUH 3O9WC 2PCPA 3O8XA 3TO2B 1G7HA 4TQEL 1G7QA 4PJDF 3VMPA 5J4MA 4HUUA 1FC1A 4WWKC 5GRUL 4U6VL 3K0WA 2J88H 2E9WA 5E8NA 4D3CH 3D87B 3DYOA 1MIML 2FX9H 4JPWL 1EERB 1OAQH 3K1DA 5JNYB 3AFLA 3S9DB 1E4XH 2CIKA 3S34H 2VDRL 3MRJA 3QG7H 4GMSH 4KQ3H 5SWZA 1EHLH 3WXVL 2DJ4A 4GAFB 2X4SB 4M7LL 2YZ8A 3QWRA 1MFEH 1VB9A 1QA9A 3ZHKA 2W1NA 4MMZC 3TLRA 4DOHB 4OLEA 4W4NA 1WT5A 3TBTA 3QCVL 3VWKB 2VLRD 4G6AD 5F93C 1JNLL 3HFML 4OM1H 3SGEH 5EO0A 1FV1A 2F74A 4OKDA 2VAAB 4R96A 5L2KE 3RGVD 4YZFE 5E99H 4XZUB 2X09A 3C09C 1SM3L 3OR6A 5CEXA 3VDAA 3BDYL 2J8HA 4NNPH 4XNUL 4Y16D 3ULSB 4YBQD 2DYPD 2CLZB 4NHUA 4TUKH 1U9KA 2ATKA 4LCUA 5GS1B 2C3XA 2YPVL 4GBXA 3QEGL 5E5RB 4ZQKB 2V9TA 2JELH 1RJLA 4NSKB 4X8XA 4S1DC 1JK8B 1R24B 2RCSL 4NPYA 1CT8A 3QFJD 4PY8I 2ZPKH 2XPGB 4QYOA 3HG1E 2ZUYA 2VWEC 5C0GB 3BPOB 1I3RA 4X6BB 2NY0C 4OQTL 3C60A 4N9GA 5LWYH 5B39A 2Q7YA 3UTQB 4YEFA 1BQLL 1OSPL 4ZTPH 4V1DD 4OFVA 1VENA 2A9ML 2CKBL 3QUYA 2DM7A 1FPTL 5A43C 3ARFC 5JUEH 1KG0B 1UGNA 2Y5EA 4TSCL 2LAAA 3VFWA 3MJ7A 5A2KH 3HRPA 1RZGA 2EDOA 3M45A 1H3VA 2R56H 5D4QA 3MLZL 5EOCJ 3QXTA 2IFFH 3RKDC 4BKLB 3I6LD 2HRPH 1DUZA 4LQ1A 5FUCC 4Y88A 5HYJB 1F6AB 4BSJA 4YXKH 2Z92A 4LF3B 1OF2A 3QHZL 1YEHH 3RVTC 4YAQA 2YRZA 3T0BA 1PZUB 3HE7D 2YD5A 4J3WA 2ADFL 2VABA 2A6KA 4OZ4A 5C0BB 4ZAKA 2FO4A 1K6QL 1R0AL 1A6UH 5IESH 5INDA 5FYJU 3GI9L 4X4XA 5HYQA 2NXZD 4WUUB 2HLFD 1WITA 3EFFB 5L0QB 3QG6B 1NCWL 2PW1B 4IRJB 2I24N 4FQCL 1KIQA 5EUKA 3TF7C 2H3NB 4PGDB 1YA5A 1LO2L 4LCIL 3TV3L 3C08L 1WAAA 5KVMC 5FYLE 4HBQA 3RKPA 1YYML 4M6MH 1TJIL 5F8QC 3ZE2E 3GBNH 4Y4FD 4PG2A 3I3DA 4JRYE 5TE6H 4U6HA 4Q0XH 3U4BL 2ICES 2XQBH 1XEDA 4PV9A 2WWKO 2HT4C 3GMQB 2V17L 2VQ1B 3F7VA 2DQGH 43C9A 4YHKH 2CIIA 2NY6D 1QBML 4BFIB 3LPFA 4X9GA 3ZYJA 4KDTC 3KYNA 1IL1B 3BVNB 3KLHD 1A7QH 5DO2C 1XR8B 5CIPA 1E4XI 5DD3H 5BW7C 4JZJA 1F4XH 5K93A 4L8SB 2FJHA 4FQXA 2MNUA 1SYSB 3V6FA 2Q76A 4ENEC 3BKCL 4LPUA 3P4LA 4J3UA 2FHBA 4N8CH 4DZBB 5E94B 4RGOL 2EKSA 4KRLB 3ZDZE 1I8LA 4Z95L 4KRPD 4OLZL 5C0DA 4BH7B 1YEGL 5E9DA 2FGWH 1JMXA 1UZ6F 4X7SH 4Z7QE 1KPUB 2F54E 4O2EA 3MLSL 5ANME 4ODWB 2IANB 3B4NA 4QRRB 4ODUB 5JQ6L 5DMJB 2EDDA 4OF0A 2XKNA 2WUBH 3VFSA 3PV6A 2M26A 3SGEI 4NQDA 3MJ9L 1QHOA 1EFXB 3NA9H 4BH8A 3OV6A 3F5WA 3FOLB 4MXQC 3HUJF 4ESKA 1C5DB 2JCCF 4QKXB 1FVEA 5L2KD 4HF5H 2YK1H 4RQQB 1D5MB 3IFNH 2A2QT 5J12C 5JDJA 2ARJB 4OZFH 4P23A 2EDXA 3T0DA 1D6EA 5C0FB 3MRQA 5E08L 1JGVH 3IETA 3WIHA 1ZS8A 2BC4A 3RIAF 2P5EE 4JG0H 4C59B 4OGAD 5TGBA 3MRPA 4LSUL 4MWFA 4K9EL 3SO5A 4MA8L 4BQ8A 3S36X 4TRPL 4O2FB 2J2ZA 3FRUA 2VH5H 4LP5A 4FZEL 3IDMA 4GSDH 3W11D 4PRBA 3HC0B 3HG1D 3OAZH 4YHIA 2PTVA 1QKZH 2YPLE 4L8DA 4ORZC 4HEPG 4D0CB 4LASH 3NZ8A 5H35A 3TNMB 2EICA 1R5WB 1P9MC 2NX5B 1K5NA 1HKLH 2D0FA 5LJYH 1EZVX 4P4KC 3QJFB 1A22B 1MQ8A 1T20A 1T1ZB 4NBYB 1IGML 1T66D 4N0YL 3JV6A 4FP8H 5IMOB 4O51B 1JWSA 4OBSA 4JRYA 1WFOA 4LHUG 5E6IB 1AIFA 2HTLD 2R1YA 4GMTL 5HGGS 3QUML 5I1DA 4DOHE 5IB1B 5FKAA 3SKMB 1YN6B 1RZ8A 3FRPA 4X4ME 3X14A 4AQOA 1W72B 3GGWA 5CMAB 5DD1L 5FM5O 2GUOB 3DXAA 3SCMA 1C5BH 2DQEL 3VXQA 1RPQA 3IFOA 3ILPB 3ARED 3HNTL 5TH2A 4YHLH 3UBXA 3HE6B 4QOKA 3QI9A 2HVJB 1G7JB 1QQDA 4JHAL 5CP3H 1UXSB 3O41B 3IVKB 1DN2A 1BVZA 5D5MA 4LPTA 1ZHNA 1LO5B 3VI3E 5BZDA 3BP7A 5IMMB 1FNGB 4HH8A 5KS9F 4R2GB 5GSRB 1HZHH 1YMMB 5JPNA 5CZVH 4KKLD 4M8QA 4LBEA 2H1PL 5E5MA 3IKCA 4KTEL 1ZE3C 2Z35B 3FHQA 1QOKA 4N0UB 3GI8H 4JAMB 2AJVH 2OTUA 3RWDB 4LLYA 2MPAL 4TVPE 4M48H 4WV1B 4HAGA 3ZKSD 5BS0E 5FYLD 5DT1L 1JGUH 4TNWF 2H8PB 5I8KL 1U8HA 5ANMA 4QRPD 3QUKA 3KDMB 1KPRA 1E6JL 4P5KA 4AEIL 3MRMA 4QRUA 4YPJA 1F4YL 1OOAA 2NY2D 3GMLB 3IFLL 1ZXQA 1LVEA 5J57B 5FOBB 4IEFB 1K4DB 3T2PA 4WENB 4Z7VF 3MYZA 3AU1A 3GMNA 4A6YL 5T3XE 3WJLA 4PGJA 2X70A 2FZ3A 4KVNH 4JFZL 4I3GA 4HPYH 4NZRL 4R7DA 4WNQA 3DECA 3IB4A 2FBJH 4HDIA 4IIQB 5I18L 1LP9F 1N5YL 4MNGB 1G0XA 4XP4H 4Z77B 2QSVA 2DLFL 2VMFA 3M8OH 2P5EA 1U8MB 1CZ8H 4ZFGL 3MROA 3HNSL 3MV8D 4OZIF 1MCDA 5DJDA 4WO4D 5C0BE 3U4EB 2KH2B 1MLCB 3KNBA 5I73B 1BOGB 1ZLSL 4PJDB 4HLJA 2VNCA 2DQDL 4Q2ZA 2KUTA 2ZCHH 3GM8A 3KPPB 3L7EB 2YPLA 2XQYK 1EVUA 3KYAA 2F54D 3EOYG 3FO9B 2APVA 1FDLH 2CMRL 3RNQB 4RRPG 1VGEL 2NXYD 4ZUWB 3QIWB 3NAAL 3MLWL 4S1RH 3TZVA 1Y18A 2HTKC 4P2RD 1MHEB 4X6FB 3WNMA 5JLZB 5IQ9B 1OCWH 2APXA 1DUYB 4NKDB 4ZXBC 1FZMB 3RU8L 1FO0A 3MXWH 3UTTB 5DHXB 3LEYH 1WBXA 4LLDB 4N5UA 1H15B 4OAWB 3AB0C 4L4TE 4ODBD 1MEXL 4RMUA 3OBAA 2V5MA 1J11A 4X6CB 4XP1H 3IDIB 3DX7B 4GW5B 5EOQH 4CW1B 2AJSL 3AMKA 4QXWA 2YD6A 4HW6A 2GJ6E 3KYMB 3MRGB 5D2LF 4HHAB 3BD5A 5E1AA 2DL9A 3AY4C 2IBZX 3ARGA 3VRIB 3IRZA 1HYSD 4EIZC 1INEH 3JTTA 4ZDHA 5F7LB 2GY5A 2FX8L 1BX2A 3KPSA 2QBWA 1UT9A 1KN4L 4TSAH 2JB6B 3UX9B 2R23A 3ZT7A 1NCDL 3FOMA 5F7YC 4HG4K 1KTRL 1ZA6A 4I3SL 3C5JA 4G8GE 1ERNA 4FQQA 5CSGA 3P30L 3WMSA 1QSEE 3ARDB 4UILL 2MCPL 3S4SB 3B9KA 1DQMH 4WVRA 3SEPA 3IYLW 4N0CC 3VWKD 1GL4B 1ZVHA 1TXKA 2VAJA 1Q9WA 1ZA3A 1JZ8A 2LQRA 2XWTB 4I13B 5HDBE 1AGDA 1S7WA 4I48B 1J0HA 2R1WB 1AD0A 5T3ZL 3O2WH 1D5BA 1AD9A 1WWWX 3IDJA 9CGTA 4QCIA 4DEPC 1T0NB 3O2DL 3SE3C 1SBBA 2NY0B 4W6WB 3IAGC 1EPFA 1CXFA 1T5XA 5HGHB 1B2WL 2DIJA 4PYHA 4XHQA 1HCVA 3IKKA 1KT2A 3K4ZA 3VG0H 1JPGA 1T89C 4U1JB 4FQ1H 3OG6B 1EJOH 2JJTC 1H0DA 4P59H 1NSNL 1M6OB 1OGTB 3B83A 3VRLF 1A4JB 1IFHH 3LDBB 5MERB 5D1XB 3QBTB 5BMFH 3RY5A 5BS0D 5HY9B 4WIQA 1J5OH 2VZUA 4OZHB 5D7SH 1CK0H 3QZWG 4UUJB 5HYSB 2W9EH 3G6AA 4OCYH 1C5CL 2DLTA 3L3GA 4JPIB 4HCRL 4I5BB 2FL5B 2AK4A 4XPFH 1MNUL 4XNYL 2ZJSL 1RZIB 1RURH 2R4RH 4JO2L 1DQTA 3FB6A 4Y5XB 1N3NB 1DEEB 3V7AE 5J06A 2C9AA 2OTWB 2BMKB 1QYGL 3X3GL 4PGCA 3DPBA 4JFFA 4RIRA 3OAYK 4H20H 2AGJH 4NM8L 3R06B 1LO4L 3GHEH 3T77A 5HYJD 1JJUA 1EX0A 2GJ6A 1Z5LA 1E4KC 5T3ZD 2DI7A 8CGTA 3TFKD 1OAYL 5J3HC 4PJEA 1G7PB 2E7MA 5GGSB 2VDMH 3WHXA 1UB5A 1H5BA 5C0BD 1H3TA 3ESUF 4WWID 5CZXC 3QDJE 2A77L 4HBCH 1NGWB 5TQ2L 1HIMH 3GIZH 4E41A 1BD2A 3VA2C 1ACYH 3GSNL 3TVMA 1EEZA 4W4OA 5AYUH 3BH9A 5BV7L 4IRJD 3T4AB 3RDTD 1A6WL 1T7ZA 4OIIL 4J23A 1K4CB 2RR3A 3GSVA 1DP0A 3WS3A 3PE9A 4EUPH 1TJGL 3QYCA 2Q7NA 3UTZB 1MHPL 2R69H 3I02A 3PNWB 4JDTL 5E8OB 5F3BA 3AS0A 3CCHB 1IKFH 2XWBB 2YC1A 2XA8L 2ZWLT 1JGDB 1M7IA 3I9GH 5D93B 4L4TD 1RJCA 5E56A 4HGMA 4OF8A 3O3AA 1MRCH 5F8RC 5SX5H 4HT1L 2WIIA 4MB3A 1FL3A 1UJ3A 3N1PC 3RL2A 5EBWB 2G2RB 4MSWB 3HUJB 5FM8A 1NBZA 2DQTL 3PWJB 4IOSD 4ZOCA 1E6OH 2EEBA 4ZG1A 1ETZB 4P9HC 5T5NG 3PP3H 4X0KA 3QDGE 2V7NB 4M1GL 1S8DA 4K94L 1WC7B 1YQ2A 1B4JL 3U9PH 2XTJE 4FXGA 5DK2B 1RVFL 2R0LH 3BN9C 4Y4KA 5CJXC 3WE6B 3OJMB 1AC0A 4PYGA 1ZGLP 5IB3A 1P69B 5DR5H 5J6HA 3QIBB 5H2BA 1EBAA 3TJEL 4JREB 1QEWB 3EDDA 1FGNH 4RAVA 2QR0A 2B1HH 1LK2B 3VFVB 4G8GD 4Y4HA 4PJGA 5IQ7H 2IAND 4QGYA 5ID0A 3OHXB 3X12B 3PWPB 4FQ2L 2YSSB 5JHDE 1WFUA 3REVA 3PWVA 3QDME 4EBQH 2BHZA 3TH2T 1EFXD 4Y2DB 5HJ3B 4YFLF 3TN0B 1W72L 5JW5A 3UTTE 2EKJA 4RX4D 2X4RB 2FDBP 2HVKB 3SPVB 1YYLH 4APQA 4HWBL 5EDXA 4UQ3A 4U31A 3RY4A 3FN3A 4KI5F 1KB5B 5KANI 1G7MA 3T1FA 3DMMA 4P3WA 1YMHA 3VD4A 3ZDXF 1FFPA 1TNMA 3BKJL 1SVCP 1CFQB 1F58H 1T6VN 4QWWD 3RL1A 3THML 1F3RB 1M71B 2YN3A 2ZUQB 4PRIE 5E7FA 1I3GH 4CNIB 2BXZA 5CSZA 5DRWA 2V2TA 3QDJA 5FXCH 4K7PX 2X89D 4FABL 3BIKB 2N1KA 2O5YL 3TJHC 5JA9A 5KS9B 4N68A 2QHRL 4F9LA 1RIUL 2NX5D 2XY2A 3KXFE 4S0SD 4OBRA 3C6LB 5E2UH 3U0WL 4WGVB 3VXPA 1WEJL 2R2EB 4M6AA 4OLVH 1MREL 4L8CB 4PJBF 5HHPA 3NIFF 5EBLA 1YQVH 5FA3B 4GRWE 3T0WA 1T21B 4K23H 3KYOA 3D2UA 1CR9H 3N9GH 1FLRH 3VGFA 3FN0H 1MCHA 1QFUL 5E6ID 2X6MA 1JHTA 3EYOA 3D25A 1D5XB 4YQXH 1NC2A 1AQDB 2B5IB 3BIBX 3C87A 4HWZB 3HCVB 4LLMA 5IFAH 2FGZA 4MA7H 3B9AA 4HPOL 5I1CH 1NFIB 3IXTA 4N0FB 2X9WA 4BSVB 5TDNB 1SY6L 4EDWL 1HHHA 2VISB 4C54A 1Q9OA 3HI1A 4QY8A 4BZ2H 1O5DT 3QDGA 2D31A 3QISA 5JOEA 1FZOB 1ZOXA 1LP9B 4F7PB 4X6DF 1VADA 1UA6H 4LSSL 3EGSA 4ZS6C 5E2WH 3FB7B 2PO6A 4XXCC 1NAMH 4R2GD 3JWOC 5IBLD 4IRSB 5EIIB 5D8JL 1F13A 1R6VA 4PJ9C 4ZNEE 4PRPE 4OZIB 1KOAA 2DWEB 3LKNB 1NFKA 5EZIL 4XCEA 3OF6A 2OR9L 5CILH 2WBKA 4RSVA 1XIWC 5I2IA 1ZHBA 2DMBA 4UT7L 5ILTH 2I26N 4KJPC 1OB1B 4NRYA 3G6JB 4OCWH 1NKOA 4PP1C 1P4IH 5KVFL 1DE4B 4NN6C 1OY3B 2IH1A 5IJKA 5IF0A 3GHBL 4DGIH 5EO9A 1NEZG 2OP4L 4ZMAT 3VXSE 3CC5B 1JPFA 2AEWA 2V2XA 1LEKA 2IPUG 2VLKB 3LCYA 3FQTB 3NA4A 3O8XC 1R3LA 4HXBH 3RWJA 2OX5A 1ZLUH 3NACL 1NMBL 3DO7B 5HHOB 2Z31C 4PIRF 2SEBA 1XZ0A 3MJGX 1QRKA 4MS8D 4Z7UA 2VB5A 3FTGB 2A83B 2CRMA 5MEOB 2XTJD 1CDHA 4GKSB 4PLOB 4I18A 3DX6A 4KTDH 2XICA 2ICEB 4PRIA 5D2LB 1MQKH 3W2DL 4XPGL 1TJHL 1WCQA 4E5XA 1S9YB 1KC5L 3GJEA 1IILE 3BWAB 2HWZL 3FO2A 3VGAC 1KJ2A 2WINB 2XOTA 4I2XB 4ZXBB 3BMWA 4JG1H 4NC1E 4DJMA 4H5SB 1WVZA 4RAHA 1KBGH 2DM3A 2C26A 4G6KL 2X5PA 2Z93A 4KK9D 5CAYB 4HUNB 3QIWD 3ETBF 3WFDH 3SGJC 4BZ1H 3FT3B 2BK8A 1LO0H 1LDPH 2EYRB 4G8IB 4WFGD 3EO1B 1UZ6E 1ORSA 1OPGH 2LU4A 2X4OB 4P3DA 1NCNA 4HIIA 4S10A 1INQB 1FZJB 3UTTD 4EN3A 5ITFB 2HJKA 3BZFB 2X4PB 5FO9B 2I9LA 2F53E 3TBYB 1MPAH 3DTXA 2BNRA 2B20A 5FF6A 2ZKHH 2MQCA 3MLUH 4GBXC 1WSST 4G9FB 2JCCE 4XVJH 1PSKH 4WFHE 1EUUA 3TA3A 5JW4Q 3S96A 1HHGB 5I6XC 4XBEH 5LGJA 3EW3B 4X7CC 5K33A 5IGXH 3V7MA 2QQKH 2EC8A 5EFIA 1HCFX 3QUYC 5B38B 2QQLL 5F9JA 3KXFD 2CJUL 5FECA 4JPVL 1RFDH 4F80A 1UWEL 2Y23A 2FLRT 4XP6L 4XP5L 3SQOH 5FHAH 3BE1H 3HI6L 3VW3H 3V4UL 4I0PB 2GJZB 3ARDD 4LOUC 5IROA 1U3JA 3WHE1 2PXYC 1D9KB 4Z0XB 4HKZA 3DV4B 2XFXA 1HQRA 4KXZH 1AGBA 5DI8A 3LS5H 3MPCA 4DEPB 5F9AC 1NDMA 1EGJL 4L4VB 2VXSH 4KH2A 1SMAA 5I1LB 1LEGA 2YPKB 1BFOB 2AJUL 2YWYA 4Z5RB 1MJ8L 3ILQC 1NMAL 1TPXB 4HUWA 4U6YB 4JLRA 3UO1H 3FFCB 1NCAH 3FFDA 3ME0A 5JR1H 4ZPVB 3L3OB 4GO6B 1V5JA 3EYFA 5GGRB 2XNAB 4AENA 4GJTB 4LU5L 4LKCA 1A1NA 1S7TA 3EOBA 4EI6A 2VE6B 2XWJB 4JVWA 2Y07L 4JPKL 3IJSB 4K3EH 4FXKB 4I9WD 2A1WL 3DBXA 2JK5B 2D0GA 4GFTB 1IAOA 3L7FA 3NOIA 2MKWA 1G9NL 5D1XD 4R3SB 2F5AH 1ZV5A 1Q9KB 5IUSA 4YHML 2IAMB 1N6UA 1OWWA 1I1RA 5DD5H 2X7LA 4OGXH 5HI5C 5JDSA 2QSCH 3UYRL 3VH8A 2R2HA 4C4KO 1MHCA 5L2JB 3CSBA 3L3DB 3UEZA 4HS3A 5TPWL 5SWSE 5FYJE 3MLTB 4KMQA 1UQSA 3VXSD 5IB2B 4B0MM 3F62A 3VU2A 4HFWB 4DVBB 3BW9B 4O2CB 5IG7B 5D9SA 2EH8L 2V7HA 3WEXB 4M8VA 2YHGA 3PL6B 4P2OB 2L7JA 3VXUB 4JO4L 1CF8H 4ZOBA 1TITA 3BRGC 2L0DA 2QHLA 4CVXB 2PKDA 4OQ1A 4Z7VE 3PWNB 3DVNA 1Z3GH 2ICWJ 5ESVA 3JWOH 1OW0A 4GQPH 1S3KL 3OJVC 3GMMB 3WD5H 5C0NC 1IC7H 4Z8FH 3ULVC 4BSWA 1RHHB 1LP9E 4PP2B 1V3JA 5TQ0H 4KK8D 4X9IA 4XWOC 5EORL 1JNHB 3FT2B 1HN1A 2X4UA 3CXDL 2EXWC 2W59A 1NC4B 1AXTH 1KN2H 3MR9B 2DMCA 1QRNA 1FSKB 2GK2A 3GB7B 4LLQA 5T1LA 1ZTXL 2BOBA 5IBTL 2FX7L 4NZUL 3P9LB 2DM2A 5GS0C 2B4CC 3MFGB 2FIKB 2V5YA 2WLYA 2DDQH 1KNOB 4Y16A 4M00A 1QR1A 1BAFH 2DYPA 4G9DB 3JUZA 1W0YT 4MGXA 1KB5L 3WIIL 2HRLA 3RTQA 3QCUL 2BNUA 32C2B 4WFHD 2C7UB 4J3VA 2E3VA 4Y5VB 4NIKB 3QFJA 3U30B 4KK6D 4LSRH 2YD9A 3LS4H 4X7FC 1QVOB 1AKJA 4AEHL 5ALCH 5CBEB 4X7TA 3T0EC 1A3RH 2Q20A 3L3JA 3QO0A 3DETC 3MV7E 1S5HA 4R4FH 4ORGB 3IDNA 1M7DA 1JN6A 4JDZB 3V8OA 4JHWL 1I7RB 4G80B 1RUPH 3QIBD 2H32A 4Y2OA 5D1QD 4P4RB 4ZTOH 3RWIA 5D7IF 3V0VA 1T2QL 4HSQA 2XZCH 4KXZI 3EOTH 2DLHA 3O4LE 5BVJA 5D7JA 5K9OA 1R5IB 3PWPD 2C3VA 1KCRL 4XPAH 3CLEL 3SKJL 5TDOB 1N64L 3VFGL 1FBIL 4PJBB 5A2FA 1RUQL 4Y2DD 2M8XA 4CN4A 4QXGL 4ODSH 3GNMH 3TN0D 3W9DA 3HE7A 3ALWA 3CLFL 1TVBB 2GTWA 3MBEB 4KHTH 4C57C 3ARBB 5C3LD 5E4EB 2X4QA 4QXTB 1OAKH 1A7NH 4L4JA 5CGMA 4PY8J 3NN8B 3MOBH 3OKMA 1FFQA 5BJTB 1GGCH 4D94A 5FV2A 4Z7VA 3D9AH 4PB0L 1WTGT 1DSFH 5KVDL 3AC0A 1TETH 4OZGB 5GZOC 3GZKA 5DEFA 3HS0A 5J1AB 2FHCA 4DGVH 3BQUA 3BGFC 4LAJH 3RRQA 3FB8B 4XX1G 3TGXA 4JFHE 4X6EA 3IS0X 1J1PL 1X5YA 4AMKH 3PIQA 4X6DB 4Y4FA 1BOYA 5GS3A 1RQ5A 4Y8DC 2Q8AH 4LARL 1Q0XL 4XP9H 4X8JB 4MAUL 3C6LD 3C5ZB 4HFUH 1A7OH 4JGJA 1MJJB 5MHSE 3SDXB 3B2VL 4E0RB 2JIXB 2W92A 3ARWA 3GDBA 4GOSA 3VRLE 3VXME 4RDQG 2AVGA 4PGEB 1OT2A 1ZGLB 2H2SC 5SWSD 2EH7L 4C56A 3DRTB 5ELIA 4XBPA 4JFEB 3EHBC 3Q6FA 3CMGA 4NYLA 4L4VE 4I4WB 1JUFB 1HYRC 1WIUA 1NCCL 3TIDB 5AG8A 3MA7B 2WW8A 3REWB 5BQ7B 1NEZA 1ROWA 5LBSH 4HZAA 5CCKH 4J8RB 1I9RL 5ETUB 3ZL4L 1CXHA 4NKMA 4IOFC 2VXQH 3HPLA 3ARUA 4G6MH 5I1JH 4Q6IC 4U1IA 1A2YB 5T5FH 1H3UA 3UC0H 1U3HB 4IOIA 5D70H 1IM3B 2Q86A 1PEZA 2QL1A 4IRSD 4K7FA 1ADQA 2YEZB 1EO8H 3OXRB 2EIZA 2X1XR 1ONQB 3TZVC 1S9XA 1K3ZA 3MBXL 3CZJA 3SKNA 4MA1C 5TFSH 5B3JF 4L29B 1ZWIA 3RNKA 1J86A 1KCKA 3WO4C 1R3IL 1A3QA 2VZ3A 3O6FC 2FECI 2DMKA 3RY6A 1MVUB 3BO8A 1ED3A 2ZUTA 1CGSL 4K07A 4PJAB 4AG4H 1CG9A 4MNHB 4P2QB 1FORL 1IQDA 1CU4L 4PJ5B 5K9KB 4TUJA 1AXSA 4FOMA 3LKOB 2VLKD 3TT3H 1U2CA 4HV8B 4G6JH 1A0QL 4M61B 2BJML 5IM7A 1NL0L 2CUHA 1MCQA 4OV5B 5HHOD 2UWEA 3VXUE 4X5XB 1AJ7L 3C6SB 2BSTB 2HH0L 1WCBB 4KDWA 2X4TA 3TO4B 1YECH 4OF7A 5IMLA 2ZUXA 4MJ5B 1MCPH 4KJYB 5T1KA 3VFTA 3VFOA 5FGBC 1FVCA 3A0OA 1BLNB 2BRRL 3KS0J 1HXMB 3MQIA 3V0WL 1KEMH 4U0QB 4U1NB 3MSPA 3RQ3A 4LRNH 2FB4H 3H0TA 1EO7A 4R0LA 4ZO8A 2A9NH 4WU7B 5ADPL 3CGTA 5GS0H 1UJTA 1KCUL 3MJ9A 3EJYC 3LQAH 1UCBH 2A6DB 2P46B 3O4LD 5EU3A 3O45A 1N4XH 3BP6B 5IFJA 1RZKH 3VXMA 1YEKL 1JE6A 3WIHH 3DIFA 5EU5B 2ZOLA 2BNQB 5ACLA 4PLKC 1B3JA 2EYSB 3TIEA 3VXRE 4L9LA 3TCLA 4B7IA 3NH7L 5DYOB 3N1MC 4UIMB 1RK1A 1FRGL 4GAJL 1FHGA 4Z78A 2UZIH 3QULB 5M94B 5DJCA 4DTGL 2VR9A 4U1MA 3U7WH 3G04A 2VN7A 4MX7B 3FO1A 3GMOB 4G9FD 1KJMA 1PKQB 3M1BB 3MACL 5DUMH 5IJVB 4LVEA 4GG8A 3R1GH 1CE1H 4KRNA 3BEVB 4KI5E 4ZFFA 2R0KL 5HI4D 2AV1B 4KPHH 5C0EB 3MNWA 4HK0B 5D2NC 3V7AG 4Y5YA 5F70A 3ZDXE 1DFBL 4OTXL 2A6JA 4NOFA 1PEWA 4GRLA 4QRPA 1T3FA 4WW2B 4FQHA 5EH1A 4K71C 2OK0H 3EBAA 2FEDD 2VDKH 3P4MA 5I76B 3QFDA 1Q9LA 2D4DA 1A6AB 2WZPD 5MHSD 4JQIH 4TNWK 2MSPA 5JMOC 4TTDD 4W70A 5EZJB 3ARRA 4ZUSA 2DAVA 4I0PD 5IEHB 1I3VA 5F7EH 4P46C 4FMFA 4MDIA 1K3IA 1D9KD 3D0VB 4NRZA 3JXAA 4IJ3C 4WEUD 3LAFA 1T5WB 3OAYH 2NY1B 2VLMD 3F12B 3EO9L 4L4VD 4FZ8H 3QUXA 4J3XA 1SEBA 1GIGL 3AS1A 2CKNA 4JGUA 3TNNA 2IH3B 1H3PH 1KGCD 3FFCD 5JZ7C 5GQBA 4WO4A 3L3KA 5TE7H 3PGDA 1NFDF 2YBRA 1ND0A 5C6PB 1HE7A 3QQ9D 1KTLA 3MRDB 2D3VA 4O9HL 1BBDH 4JO3L 4U1GB 1YN7B 4S1SH 3TC9A 2ICWA 1IM9B 3O3BA 4RNRA 5IWLA 4HKXA 2PYFB 1J0IA 1DL7H 3U9UA 2VDPL 3MODH 1S5IL 3IS1X 2F5BL 3D18A 4P2RA 4RISL 5I75C 3V5DA 3KPMB 3MV9B 3QO1A 2P4AB 5D71L 5TF1H 3WSQH 2KL6A 3RWEA 4JB9L 3KVQA 4DUXA 4WY7L 2Z8RA 4WHTA 3H6JA 3CFCH 4XGZB 2NY5L 1D6VL 3PDOB 1E0OB 1UWGL 1UKQA 5C09B 2IAMD 2HKHL 3FO0H 4KUZL 4GLRI 5I1EH 1EMTH 1S7XB 4A6YA 4G5ZL 4PRDA 1KIPB 4Q9BA 1QLFA 3VXRA 2IPUK 2FLBT 1WIPA 3IJYA 1X4XA 1KTKE 2AERT 3DSFH 4XMPL 5DFVC 1VFAA 4XBGA 1CGTA 3PL6D 5C0RL 4P2OD 2LU3A 3VXUD 3RVVC 3SBWC 3HA0A 3STLB 2FEEL 5D96B 5JTWA 4DK6A 4MQXD 4QTHB 4KQ4L 4NJAH 4CDGC 2D03H 1JZ3A 3OTTA 3BESR 4ODHL 3W5MA 1TZHB 5AYQA 5HI3D 3WHE0 1B4RA 1EH9A 4CDHA 3VG9B 3H7LA 1FO0H 2G5BA 4YH6A 2AJYH 4OZFB 3VWKA 5DDHA 1U8NB 2OI9C 1PYWA 3GKWL 5C0AA 2DQCH 1NCUA 2XZZA 2QEJA 4Z7WB 2DF3A 4EQ2A 1FYTB 5D7IB 3V4PH 5ERWB 3SDCC 4XZUA 1MELA 5IVXE 5EPMB 2GEEA 5KVEH 4MXVE 5I1GH 1N6QH 1GC1L 4ODTL 4I3RH 2XZAL 2WNGA 2GFBB 3K80A 5GS1A 1JCKA 2NY7L 1CLYL 5C0IB 2ADIB 1V8HA 1BEYH 4M7ZB 1JK8A 1XT5A 1V3LA 3I6GB 2BY1A 1E4WH 3QNXA 5MI0B 2EDHA 4X6BA 3Q6GH 4TVPH 4NQXA 5HYEA 1UADC 3S4SG 2NYYD 1A9EB 4F9LC 5DD0L 2UV3A 3CFBA 2W9DL 5TE4L 2R39A 1QHPA 4JZNB 2IPTL 5IW6B 3H8NA 4U49A 4NM4L 5T1DH 3ECBB 2I07A 2NY4C 5FHBH 1YDPB 3STZB 1JNNH 1KG0A 2PYEB 2I9TA 2ESVE 5C7XH 3UBXI 2ARWA 3GUTA 5HD8C 5T3XH 4XAKD 5FA4A 3MXVH 4D9QE 4LCYA 1DBMH 5EOCH 4E9LA 1XGYL 4RMVA 1KCSH 3S5LB 4XCFH 4RGMC 2P8MB 4TN9A 3QIUB 4MNQB 5HYJA 1FCGA 5J9PB 4LF3A 1ZLWK 3WLWC 2OSLA 4ISVB 3VMOA 4MVBD 1AI1L 4MDJB 4O58L 2XTLA 4NWTL 3HI5L 2NR6D 2DTML 3MBED 3ARBD 2K3TA 1A4KB 1MIEH 2PO6C 1PQZB 2UVFA 5HYSG 2MHAB 4WUUA 1U8PB 4JFDE 3QG6A 2JJSC 4M6OL 1T03L 4RMTA 4LVOC 4YDIH 5L6YH 3D0LB 2ZUSA 3P73A 4KZEL 4NKQB 1IBGH 3D39E 1IKNA 4U6XB 5GRVL 1TMCB 2V2WB 4JFQB 4K3DH 4HCRA 1B6UA 4KKBC 5KZCB 3C5ZD 1HINH 3LN5B 3QAZC 4TULH 1RZJC 3GMQA 2VQ1A 1UCTA 5DRZA 1GVIA 3KAAA 2JIXD 1JWMB 1PZ5B 5LG1A 2HT2C 4P5TB 2P42B 4Y1AB 2FX9L 4HEME 1U91B 1IL1A 1CFVL 2H2PC 3DI2B 3BVNA 5IVXA 4Z76A 3NCYS 4JFED 1I8IB 4Q6IB 4KQ3L 1U92B 1R3JA 3ET9F 3O3DA 1XH3B 1JFQL 5KN5A 1YUHB 5DMKB 4JR9L 3MRNA 4GAGH 5E94A 5EWIL 4RWYH 3GSNA 4BH7A 3KJ6H 4UT6L 1KCLA 4DVRL 1BZQK 1VDGA 4DN3L 3O6FB 1U3HD 1EDQA 4OM1L 5DD6B 1HHIB 4QRRA 4ODUA 5DMGD 1KXTB 1DQQA 4TTGA 3WKML 5E2VH 5B8CC 3LMJH 1YPZF 2ITDB 2HFEB 1X7QB 3GKZA 5E8PB 1EFXA 5KG9B 1UB6A 1ZT4B 2E7BA 2VUOA 4NP4L 2XXCB 4MCZB 4LMQE 2VKWA 4KJQD 4RAUB 4TUKL 1YEEH 1T1YB 4EEEA 5SWQB 4MJ4A 4XVSH 5C09E 3MGOB 3V6OC 3SE4A 1MLBB 4NT6B 3PDGA 4LGRB 3SE8H 1MCWM 4RQQA 1D5MA 1II4E 1VKXA 2ARJA 2HT3D 1PY9A 4P2QD 2ZPKL 2B0SH 1YEFH 5C0FA 1L6XA 2AP2A 1DDHA 3L1OH 15C8L 2EDLA 4PJ5D 3HR6A 5HPMB 3TA3C 5LWYL 5MP6L 2CO6B 1Z9LA 5ICZB 4N8PA 4I0KA 4UBDD 3MRCB 1G6VK 1INDL 5DJ0A 4EXPX 2WANA 3CNKA 5I9QC 3B6SB 5HGBB 3BYTA 1JZ4A 5FYKH 3V5KB 1QBLH 3FMGH 4PJIF 4JFDA 4OD2A 2ENSA 4D0CA 3TO4D 3TNMA 5GZNC 3NCJL 3DX8B 3G6DL 1N2RA 3JV0A 1IC1A 4X5WB 2AEPL 4H25A 3W9EA 4PJFF 2IFFL 5CKAA 4F3FB 4F7TB 1IT9H 2EYTB 4UTAH 2B2XL 3D39A 3BUYB 2KPNA 5IMOA 3HZYB 2DKSA 2BSRB 3B5GA 4KVCL 5TDPB 4DGYL 4D9QD 2NLJB 1QO3B 5DVMA 3SKMA 1YN6A 3ZE1F 5IV2B 1W72A 2GSIA 1U8KA 1NJ9A 4GRMB 3GJFB 4RGNC 1H9VA 5IESL 1MUJA 4HWBA 4ZPTA 3ILPA 2ERJC 3K2UH 3STBA 2X05A 1I1CA 2BNQD 2LAGB 3U2SB 1CDGA 1ES0B 3HE6A 3OX8B 2DS4A 2HVJA 4MHHG 3AGVA 5ADOL 2J4WH 3E6HB 2GTZA 3PG2A 1BQSA 3MRFB 4WHDA 1DLFH 5M7QA 2QSTA 3NTCH 3O41A 5L9DL 2UYLB 3SY0B 3IVKA 2D7TH 1LO5A 1DBBH 1OAUL 5IMMA 1D5IL 1FNGA 3MLRL 3QNZA 4JHZA 3WL9B 1VSCA 4POZC 5GSRA 1YMMA 3ZSSA 1FGVH 3GBNL 1GZQB 4L3EB 2Z35A 4QHMB 2P8PB 4JAMA 3QUZA 3X13A 1OHQA 3GIVB 4JQVC 1V7MH 3BMVA 4WV1A 5IIEB 2GSGA 5DQDH 2H8PA 4R97B 1DBJH 3VXOB 3FQWB 2Y25A 4P46B 4OF6A 1FH5L 1MRDH 1A6TB 3ZKXB 4IJ3B 1A14H 1IGFH 4QXUH 1NLBH 2G60H 1K4DA 1P7KB 5IB5B 2Q3AA 2WBJB 4M1DH 2B39A 3Q48A 5CUSH 1AQKL 5H37G 1VGKB 3RBGA 1U36A 4NN5B 3BD4A 4J1UB 3OKLA 2IEPA 2VWEE 4PV8A 1ZEAL 2NY1D 4MNQE 2ZUWA 1SY6A 3MA9L 2RIKA 1A7RL 3P11L 4Z77A 3ULVL 4X7SL 2YUZA 2HKFH 4URTB 4YGVB 1GZPB 4JY4B 5FO7B 5B4MD 5JW4N 4EUPB 3CK0L 3GM0A 4JHBA 2R29H 1OTSD 4CVZB 3U4EA 4LVHC 1OP3K 3BH8A 1BOGA 1IGJB 1IEAB 1P7HL 3MO1A 2BY3A 3KPPA 4GXUN 2JJVA 3O11B 2ADJB 4PGBB 1IM9D 4NFDA 3TM6A 1JGEB 3FO9A 4JM2F 3WUZA 5GXBB 1SMOA 2B4CL 4G6AC 4LK4A 3QIWA 4X4YB 3MX0A 3RZWA 5EOTB 5FUCE 4LKXB 4IDLA 2YUVA 4X6FA 3ZTJG 5IQ9A 3IFNL 3MV9D 1RZJH 1DUYA 5DLMH 1OT1A 1MAML 3IJHA 3RGVC 1AE6H 3O9WA 3ZZ1A 5B21A 1XF4A 2MWCA 5DMIH 1NLDH 5C09D 1A64A 2A6IB 4XTRD 5LAXB 2VITB 1HH9B 4Y16C 4X6CA 3IDIA 4YBQC 3UJJL 2DN7A 5C2BH 4PBXA 3ULUL 5FO8B 3NBNA 3W0WB 3VFRA 2FWOA 4WI7A 4WEBH 5HBBA 2UZYB 2VQUA 1F4WH 1BIIB 3MRGA 4Y1AE 4HHAA 4O5LH 1HKLL 3NVQA 3IF1A 1KJ2H 3QQ4B 1LE9B 5DJXB 4XH2B 2W65A 4I77H 2IBGA 3NIDF 4OV6F 2JB6A 3RWCB 4M02A 1T0MA 3CMOH 4GKNB 4ZO9A 4UU9B 1QNZL 2VLLA 4YPGB 3L3HA 2AK1L 1BQHA 4WI8A 5H8DA 5I0DA 5FCUH 3WNOA 4GRWH 4XNMA 4EI5B 5CJQH 4ACPA 1XGPB 4ZOEA 4CADB 3K74B 3HC3H 5BOPA 4LSTH 3PQYE 4RZCB 3LH2H 4N8VA 4YHLL 5F1KC 1RU9L 1KV3A 1OTUD 5CGYD 3S37H 2Z8WC 3K8KA 1KLFA 5KVGH 5DJAB 5C9JA 1N5AA 3HE7C 2G9HB 2P8LB 1FYTD 4M43H 4NWUH 5CP3A 5IT2H 3D3VB 4I48A 2DLIA 5I8OH 3ULUD 1OAXL 4FNLL 5CZVL 5F6IC 2ZCLH 4IS6A 5I1KH 5KSAD 1P5UA 1EAPB 1OGAB 3GI8L 2GT9A 2NXZC 3IAQA 1C16A 1A5FL 2HLFC 3GSXB 3QDAA 3WN5C 5HGHA 3NABL 5B38G 3NPZB 5JW4M 1UKTA 2E9JA 1HQ4B 5SX4H 2C1OB 3M17B 1Q72H 1FNHA 2AJZB 1L7TH 4PFEA 3FAWA 1B0WA 3RVUD 3SOBL 1BREA 1WBZB 3ARFA 5IW1B 4GXUM 1IVLA 3H9SE 1KTDA 1JHKL 3OKKB 2AXFB 4YC2C 5ESQB 2HFGL 4Y4FC 5AUMA 3U0TA 3BPNC 5HY9A 5CD3A 2OTPA 3MFFB 3U83A 5D6DC 4OZHA 4FFYH 5HYSA 4JFPA 2E7HA 1HHKB 4KVNL 4OCSL 2DRUA 4PJ7B 3KWWA 5FOJA 1BJ1H 1G6RB 2F58H 8FABB 1T7YA 2GI7A 1U8IB 1MSPA 2NNAB 3BSZL 5DTFB 5DZNA 5I1IH 4XP4L 4HMCA 5I1AB 3U6RB 3W39B 4Y5XA 1N3NA 3WDIA 3KLHC 2BMKA 1EGJA 1MI5E 4RCAA 2FH6A 1CLOH 1EFQA 3O6KH 3P0GB 4YHYC 4XCNB 4CJ0A 1L6ZA 3R06A 1JZ2A 3BKMH 4NO3A 2VZ1A 5IKCB 3QIUD 4MNQD 2C1PB 2CDEB 5L88H 5DS8B 2OLDA 1F11B 5HVGB 1ZSDA 1OSZB 1EK3A 1J1XL 2LTQC 2FH8A 1G7PA 4LVOB 5F1SA 1T2XA 5GGSA 4KRPC 5F3HB 2C4FT 4G7VL 3UJTH 1NGWA 4HKJB 1R3HA 4U7SA 4F2MB 4OD3L 1SJHB 3SJVA 4R90H 1GOGA 2NTFB 3FL7A 1K4CA 4XPBH 1JZ5A 1NFDE 3QAZB 1FAIL 43CAB 3MLXL 1CFTB 5IW3A 5D1ZD 5EOQL 3IFPB 3CCHA 2XA3A 3H9YA 2XWBA 3S36L 4JM4H 1K8IB 3N50A 4KDTA 5DHVB 5J13C 5EIQA 1JGDA 1WAAF 4DQOL 1DLHB 2ED9A 5FB8A 5KZCD 2OQJB 1HWGB 1AO7A 3GSQA 2PF6A 4JKPL 2DQJH 5BW7A 3U1SH 1N26A 2AXJA 2UY6A 2HN7B 4OGAC 2G2RA 4MSWA 2R0WH 3PWJA 3V6ZA 1FVDB 4XWGH 4P5TD 4DKFL 4Y1AD 4NUJB 5HHMB 2COQA 3W11C 1CICB 3RAJH 5IHZB 2V7NA 4PRAB 5DMYA 2R8SL 1WC7A 5CINH 5DHYB 2VERN 1NGQH 4HIXH 5DK2A 2DKUA 4LAQL 4JRXB 2E6QA 2E7LC 3WE6A 1RULH 3DNKA 3DI3B 2VLJE 2BVQB 3CSYA 4D0BB 3UTSE 4LCWB 3QIBA 1T66C 1DQML 2DLEA 2EE3A 1KFAH 1QEWA 3QEQB 1LK2A 1NKRA 4BFGA 4MLIA 4XHJD 2XACC 5JO5B 2GCYB 2HTLC 3JV5A 5ESAB 4LIQH 3VGHA 3MV11 1GSMA 3PQYD 1I4FA 2YRPA 2YSSA 2CK0H 1I1AB 2MOVA 4YHPB 2EE6A 5BO1L 2C4FU 3NPSC 4PJFB 3HZMA 1BF2A 3AXLB 3AREC 1FL6A 1J18A 4H1LB 1WFTA 5EO1B 3TN0A 3WFHB 1L9MA 5DUPH 4L9LC 4OGYL 4U6VH 5GRUH 3J7HA 3U46A 4DN4H 5F96L 1KB5A 1U0QA 4NO0A 3OAZK 3I85A 1JPTL 5H94A 1F00I 3W0WE 4F33B 4HLZG 4JPWH 5SX4I 2EDYA 1FFNB 2VDRH 1AHWB 4KKLC 1P9MA 5BMFL 1G0YR 3V6BR 3WXVH 1SJEA 2GITB 2XG5A 2WP3O 4P4KA 1A1MB 3U7YL 2WSKA 2W9EL 1RIVL 1CIDA 1Q0YH 4QT5B 1NBYB 2H32H 3H9SD 4Y5YC 2HA1A 3BIKA 4PR5A 2XRAL 2EDTA 2HFFB 4GS7C 3QCVH 3PWLB 2AJXL 2NY2C 2GHWB 3X3FL 3QZWB 1JNLH 2E9IA 3HFMH 1K2DB 3MYJB 4L8CA 3PF2A 4LSVL 4WTWA 4XNQB 3VD7A 2NMSA 2VSDA 4WCYH 5FYJH 1P84J 5CP7A 1SM3H 4Y19E 1MWAB 5F1NB 3BDYH 2HG5A 1TCRA 2IF7A 1CLZL 2YKLL 1X3DA 1MI5D 1DEDA 1D5XA 4M5ZL 2YPVH 1QG3A 1AQDA 3ZE2F 4AQ1B 1ZT1B 3QEGH 3HCVA 2EDEA 4F8TA 1CXLA 2RCSH 3DURB 4N0FA 3VGGA 2AXHA 4A2MA 3TT1L 5TDNA 5A16B 1R5VB 4ZFOL 4WO4C 2K9UA 2VISA 3I84A 3WLBB 2DIBA 1XGTA 3DX9A 3LRHA 3T4YA 1OSPH 1FZOA 1FN4B 1FG2B 4LGPB 5A2LH 2A9MH 2CKBH 4FMKA 3OKOB 4KKAD 3FB7A 3P0YH 3B2UD 1IEBA 4QRSB 2ZOKB 1RMFL 4HQQL 4IRSA 3WFCL 2NXYC 1ORQA 4TSCH 4L3ED 1CL7I 5D5MF 2OBGA 3LRSA 3HKFA 3I9GL 4MA3A 3SDAB 3MRIB 1XCQA 4XCCL 1MRFL 2VL4A 5ITBH 4F58L 3T1WA 3LQZA 2CRYA 2P5WB 2PETA 1Z9OA 1CS6A 1KENL 3G6JA 4V2BA 3KPRE 3BGMA 4U2YA 1RJYB 3ELAT 1U8LA 1YNLL 4JM2B 1CDCA 4U1SB 4G8FA 3QHZH 5C08E 2ZSWB 4QLRA 5IFHL 2WBJD 2ADFH 3CC5A 4PRHB 1WWCA 3FQTA 4R8WL 3H7BB 5AZEL 5KSUB 1HYSC 1K6QH 3AS3A 1R0AH 5ACZA 1I9JL 4S1QL 5JXAH 4LVHB 3DO7A 4LQFH 1NCWH 3NZHL 2I60L 4FQCH 1LE5B 3BZEB 3MGAA 4GUPB 1I7ZB 5MEOA 5I30H 2DBLL 2B1HL 1LO2H 4LCIH 4S11A 3TV3H 4GKSA 4UZGA 2BCKB 3C08H 3BOVA 1ADQH 2ICEA 3MREB 4M5YL 2N56A 4WFEE 1YYMH 1S9YA 1P1ZB 1QLRB 1IC5L 5IQ7L 1TJIH 1KIRB 2VLJD 1I8MA 3BWAA 1G7LB 2WINA 4YUEH 1LK3L 2F15A 1XMWA 3E8UL 4I2XA 4ZXBA 2DWDB 4K8RL 1PG7X 4J6RL 4H5SA 2ADGB 1PLGL 3A67L 4BFEA 1G7QB 4HUUB 2EXYD 2V17H 3VWKC 4HD9A 2DIAA 4DKAA 1QBMH 3K46A 1HI6B 3EO1A 1T22B 5C6TL 2O26U 2X4OA 2CIKB 4Y19A 2VXUL 5DXWA 1N0XH 3MRJB 3AY4A 5SWZB 3I50L 3LY6A 5ITFA 1UWXK 3BZFA 2X4PA 5FO9A 5JHLL 2YA0A 2YUWA 1YPZE 3W0WD 5GS1C 3G08B 3MRKB 1BF8A 3BKCH 4V1DB 4NKOA 1QA9B 4NJ9L 3LKRB 1R3KA 4RGOH 5C0CE 5FUOL 4Z95H 1KSRA 4OLZH 3TBTB 1HHGA 2X9YA 3QA3A 1CCZA 1GGBL 3BPOC 3MLSH 1GXEA 4DZ8B 4OLVL 1FV1B 2F74B 3MGTA 4JN1L 5JQ6H 4R96B 5F7FA 3ES6B 1O7VA 4NQEB 4AJ0A 4GAYA 3QXUA 3GSRB 4P99A 5HDQL 3MJ9H 1CR9L 2WAHA 5FYKU 3B8YA 4LCWE 4K8RD 4NHUB 4NNYA 4CMMB 3MRLB 3TBVA 2ATKB 1IAMA 3K8MA 2BRQA 4EI5D 1G6RL 4PJIE 2FIRT 1RJLB 3BEWB 1CT8B 1BMGA 2WBWB 4FG6D 2Q87A 3DV4A 4YO0B 4OM0L 2WM0A 5E08H 3SE3A 4M6NH 4YBHA 3BP5A 4PJFE 5CBAA 4U05A 3ARPA 3LB6D 3C60B 5CEZL 3WN5B 5B39B 1BFOA 1S7UB 3WFBH 4LSUH 1ZLWH 3TFKC 4K9EH 4MA8H 5E2WL 4FZEH 1T89A 3D3VD 5EU6E 4ZPVA 2YXFA 3L3OA 4LLWA 1MHHB 1KYOJ 2JJTA 2XNAA 1QSFE 4MJIE 3ZE1E 3VFWB 4FTVE 1OGAD 3MJ7B 4NGHH 5I71B 2OXHA 5CILL 3TEUA 5CD5D 4IRJC 3DYPA 3RDTC 2XWJA 1NGZB 2GW5A 2CLVB 3S35X 4FXKA 1MY7A 4OCWL 1IGMH 4N0YH 1DUZB 3MNZA 2JK5A 2Z92B 4M7KL 2NY6B 5I15L 1N7MH 4JKKA 4DGIL 4YAQB 5JOPD 2XN9E 4GMTH 5A3ID 4ODXA 4R3SA 2VABB 1Q9KA 2DM4A 2A6KB 5AWNL 5GRXG 4QHLA 3ZT6A 3FQUA 4OZ4B 4D9RE 4XVTL 4ZAKB 5DD1H 5AAMA 5E70A 2FO4B 3MLYL 4UTBL 2DQEH 2DJSA 4WJ5A 5L2JA 2VO5A 1SVZA 3KR3L 3VWJB 3L3DA 2X44D 3HNTH 5JW3H 4LNVA 4WEMB 3K8LA 4JHAH 5IB2A 1G1YA 1KIQB 4HFWA 5EUKB 3BW9A 5IG7A 3VE0B 3OKNA 4XVUD 3MJ6A 4ZS7L 2QQNH 2VDLH 3PL6A 2BOCB 2VDQL 3CDCA 4L8SC 2H1PH 4KTEH 4CVXA 4E42B 3PWNA 1CDJA 3GMMA 4ZO7A 1QFWI 4PV9B 2MPAH 1CE6B 5DT1H 1EO5A 3F7VB 2F9BT 3E0GA 4B5EA 43C9B 5KBNC 4RFEB 3BZ4B 4PP2A 5MEPA 1E6JH 4AEIH 1SEQL 1Z9SA 1F4YH 4PJEF 4PUBH 1OP9A 1I3UA 4N1HB 5DQJB 3FT2A 5SX5K 1NC4A 2HJLA 4OB5L 5CIPB 4A6YH 4JZJB 1MPAL 1T7WA 3AUVA 4NZRH 4RBPH 4JE4B 4RMSA 4KDVA 1FFOA 2ENYA 2DI9A 5I18H 2EKSB 3SE4C 4K7PL 1N5YH 2AS5M 1PSKL 5DFTA 5C0DB 3HG1B 1S9VA 1KNOA 4TPRL 3KJ4B 2DLFH 1DVFB 1CFNB 4ZFGH 5ISZE 1DANT 1RJZA 4QWWC 3ZHDA 4H8WL 3JV4B 35C8L 5IGXL 4YDJA 32C2A 2XKNB 1ZLSH 3VFSB 4K94C 4PGZA 4KROB 1JZ6A 4HG4J 2DQDH 3SGDI 3IGAA 5HHMD 1CICD 1QSFA 3F5WB 1OAZL 5EBMB 5CBEA 2P24B 2CMRH 1VGEH 1HNGA 4OFYA 3MLWH 4JEGB 3VFNA 4JRXD 4OZFG 3VW3L 4ORGA 1CQKA 1C08A 2Z4QA 4P23B 1I7RA 3RU8H 1FCCA 3LPGA 1D6EB 1I7UB 4LCWD 1ZS8B 2F8VA 4P4RA 2BC4B 3QEQD 2L4OA 1WWBX 5TGBB 3MRPB 5E6IC 1MEXH 2R9HD 4MWFB 2AJSH 2IQAA 3UO1L 3FRUB 4FHBD 5B22A 3IDMB 4PRBB 1MWAL 1JYXA 1I1AD 5DA4A 1EIBA 4J12A 4OLWL 3O2VL 1AR2A 1BGXH 3ROLB 4PJGF 4JY5L 5I19L 1K5NB 1M05B 4HMEA 1CD0A 2FX8H 1TVBA 5E03A 1T20B 1ZLVK 2EIDA 4H0IA 4K3EL 1V3KA 3CFDA 4XXDB 3NN8A 4R2GC 3EFDL 5IBLC 4D8PB 4JRYB 5I8CA 1AIFB 5KW9L 4OZGA 4ZUUB 2F5AL 3QHTC 4I3SH 5J1AA 4OKVB 1U3YA 3X14B 1BJMA 4J4PD 5DD5L 4C58B 1ZANL 3AMLA 4WV1C 3VXQB 4UILH 3SQBA 2MCPH 1DQJA 3FB5A 5TH2B 1LMKA 5DQ9A 1XCTA 1IZJA 1DANU 2OJEA 3QI9B 4NC2B 3S5LG 5BXFA 1QQDB 1U58A 3LN4A 1RHFA 5EU4A 4D9RD 1PY4A 3C5ZA 5D5MB 2ED7A 1ZHNB 3BP7B 4PG9B 3SDXA 2ARJQ 4E0RA 2JIXA 2G5RA 4NQCE 2BDNL 1WZLA 4EXKA 5JPNB 4TOYL 3DRTA 4M8QB 3EYUL 1Z0MA 4LBEB 5E5MB 5HTSA 1P4BL 4RA0C 1J05B 1EEYA 4IIQC 1GAFL 4JZOB 4MS8C 4LLYB 1U93A 4DKEL 4I4WA 4ONFH 2EIEA 1WISA 2F54B 3TIDA 1S7SA 2XTJC 3JWNC 4XXCA 5ANMB 2ITCB 3REWA 3QUKB 1MCFA 4PY7B 4XPHL 1KPRB 2NXYB 3EKCA 4GG6E 1C12A 3MRMB 4QRUB 4PJ9A 4HH9B 1J10A 1DQDL 1JVKA 4GW4B 5I73C 1QTYT 4PPTA 1OP3H 5A2IH 1XIWA 1KF9B 2AXGB 3AU1B 3FJTA 3OKEA 5HXMA 3GMNB 4M1CD 4HIJB 3U36A 1U3HA 1C5CH 2AJ3B 3LPWA 4KK9C 4HCRH 3QIWC 3QNYB 3OXRA 1ONQA 2WQ8A 1MNUH 4KUCF 3F58L 2ZJSH 4XNYH 5D7KE 4HXAL 3SDAD 2DDQL 4L29A 1CBVL 2P5EB 1QYGH 3MROB 1ZLUK 5D72L 2P5WD 4NM8H 3BT2L 4NQUA 1MVUA 2CUMA 2Z31A 1F6FB 4J7RA 4JM2D 4PJAA 1T80A 4Q2ZB 2W9LA 2YPLB 1S78D 1T4KB 4HWUA 4PJ5A 1OAYH 2EDFA 4UQ2A 4M7LT 1J0JA 4G7YH 3VJ6B 2BFVL 4PRHD 2NW2B 1A3RL 2ED8A 3A6BL 4PJXE 5INCB 2A77H 3LKPA 1WAAE 1Y18B 1MJ7L 4OV5A 3GSNH 1BP3B 1UVQB 2BSTA 5BV7H 4Y0GA 5M95B 1A6WH 4OIIH 1FO0B 3P4OB 4ELME 5BRZA 3JWDH 3GFUA 4WU5A 1TDQA 1WBXB 1TJGH 3LHPL 3H3PL 5GGTL 1YNKH 1MHPH 3KS0H 1BLNA 1JGLL 4Z7UF 3SGJA 4XMKL 3QXDA 5DFWH 2VZSA 4HIHA 2XA8H 3ARDC 2FATL 4WU7A 3ARGB 1XGQA 3JTTB 4HT1H 2A6DA 1XR9A 5ECJE 3BP6A 3MRRA 3G9VA 2DQTH 4JDVB 4NQCA 5EU5A 2BNQA 2R23B 1RSFA 1GGCL 3FOMB 4JKWA 1X4ZA 4M1GH 1KJ3L 1ZA6B 5SWZD 1B4JH 4GRWF 5E9DE 3C5JB 3V0AC 3HHRB 4N90D 5BS0B 3N1GC 5IVZA 1GGIL 4FQQB 1CFSA 4PS4L 3JTSB 3GMOA 4YBLB 2FNBA 4GG6A 5GGQL 3CUPB 4Q74A 1PKQA 3B9KB 1U8QA 5IJVA 1NBQA 5KTEL 4NQDE 3TJEH 4QHKI 1F3DH 4KY1L 3BEVA 2Q8AL 1VCAA 3UZEA 2AV1A 4PJHE 5C0EA 3EDFA 1ZA3B 3LDBC 4HK0A 5D1XC 1S7QB 5CLTA 1AGDB 4FQ2H 4IRZL 4NQED 4JJHA 2PXYA 4WW2A 2DLGA 1D5BB 1AD9B 3PABB 5F1OB 3IDJB 4QCIB 4L3AA 1BZ9A 1W72H 4WTZA 4WI9A 1T5XB 2VN4A 5JOFB 1A6AA 1P84K 4HWBH 3MCKA 5SV3A 1WZ1H 3KPNA 4Y5XC 2PTUA 1JPGB 1QPXA 4HWEH 5IEHA 5CCKL 1OWRM 4WUKH 1H0DB 3D0VA 4LDLB 3W82A 1DQLH 3C8DA 1A21A 3BKJH 4D0DA 4G6ML 3THMH 3C60D 5MENE 3T0EE 1NCBL 5GPRA 3RDTB 3T04D 1EBPA 1ZMYA 2IH3A 3G6AB 5E8EA 4PJXA 3PJSB 5HGAA 1TQCB 4FABH 2F8XC 3WUWA 4R9HA 3CDGB 4ZUVA 1SBSL 2WWMD 1LHZA 4OLXL 2O5YH 1IAIL 3RWHA 3DV6A 4YK4C 1RIUH 3RBSA 4KK8C 2O61A 1QFWL 4NC1C 4ELMA 3U0WH 1WEJH 1YZZA 2PYFA 3OJDA 4L4TB 1U95A 4JFFB 1ZT7A 1U3ZA 1J12A 1G9NC 3Q1SL 2OR7A 3DXAE 5D7KD 3T77B 3KPMA 5J6GA 2Y7QA 2GJ6B 2GK0B 1Z5LB 1N8ZB 1QFUH 3RHWK 2VXTL 4X98A 4QOKE 4PJEB 3PDOA 5D93C 3SDYH 3WHXB 3BD3A 1H5BB 5LVEA 4ZAKD 1YNTA 2APBA 3TH3T 5D5ME 5DJ2A 3P4NA 1KELL 4YHZH 1S7XA 4HPOH 4UMGA 3MNVB 5JPMB 3MCG1 3TVMB 3VWJD 2VIRB 1SY6H 3BH9B 4EUPG 3TWCL 1X5LA 2R2BA 1D3CA 1UH4A 3GSVB 4KK6C 1MCPL 4QHNB 2ATPA 4FFWD 4X9HA 4LSSH 1OTTD 3I02B 3O6MH 2AABL 4G8GB 5F3BB 1U2HA 2YC1B 3NFSL 1QSEB 4UOJA 1EAJA 4NQSA 4ODVL 5GGVL 4JFYA 3W5NA 4QTHA 1Y6NR 2VZTA 3P2TA 2H9GB 5EZIH 4JANA 1FG9C 3ARXA 1KXVC 2OR9H 2FJGA 2XG4A 3O3AB 3QIBC 2WIIB 5GRVK 5D1QC