3MLVL

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
YLLTQPPSVSVSPGQTASISCSGDKLDDKYVSWYYQRPGQSPVLLMYQDFKRPSGIPERLSGSKSGKTATLTISGTQSLDEGDYYCQAWDASTGVSGGGTKLTVLFGEGTRLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvL01
5IFHH 4ODUA 1MWAL 4KRPB 2XICA 3O6FD 4Z7WE 3ULUF 5EBWB 5DHVB 4DKEL 4EUPG 4DEPB 3V5DA 2AP2A 3CCHA 3AB0C 2F8XC 4Q6YA 3EKCA 3QXWA 3EYVA 2P46B 3RVWC 5J3HD 4I0PB 1ZLUK 1MQKL 1MY5A 2AJXH 1NSNL 3ARRA 3UBXA 1T83A 3VFTA 2NY1D 5HYJA 1WGOA 3B9KC 5DRWB 4GKOA 5HHNA 2ZOKB 1OD9A 1P1ZB 3PF2A 5JIIA 3V6OA 1RZGB 2VKWA 3RWIA 2AV1A 1RZJH 1X7QB 4LIQH 3Q3GB 3DO7B 2IQ9H 4PG9A 2GK0A 5J9PB 1G7MA 3T3ME 4JHBA 2A0LC 4K3EH 5GJTL 4OAWB 1RD6A 5F1IB 4PRHA 2EE2A 1ZGLA 2ZUSA 4J4PA 3EFDL 5DWUL 3DTXB 5E9DD 1MUJA 1NGPL 4OV6F 4JG0H 4RWHA 4RRPG 1RHHB 5FGBA 3CFJB 5C08B 1A14H 1X9QA 1BIIA 5C6WH 2ZNXA 2ZCHL 4XNZC 3K8LA 1GC1C 2HFEA 5DD1H 2BNQD 3LKRA 5K9KB 1U8OA 5CD5D 4S10A 5T3XD 1G9MH 3BP5A 3IDJB 1A6UH 4ZS7L 4PYGA 4IRZH 4DAGH 1RZ8B 2CXGA 1T1XB 3HMXH 1S9VA 3QXDA 1AGDA 2XI9A 4I9WD 3CX5K 4QRPA 4ZAKC 1HKLH 5EO1B 4RMWA 3LAFA 2W9EH 3E6FB 2HKHL 3LB6D 4KZDH 1I1FA 3UTTE 4HJJH 4NO2B 4Z7UE 1PSKH 4F7CA 3GZKA 1QBBA 4HH8A 1XGRB 4YBHA 3MRNA 3ZL4H 3RX7A 5DUBA 4KHTH 3C60D 3F65A 2V2XA 1MJJA 4QLRA 3BXNB 1MCSA 2BFVL 2OI9C 2VJXA 4ZYKB 4CRPA 1XCTB 1A6VL 4JY6A 3T4AA 2RCSH 5A2JH 3CXHJ 5DJ2A 1JGUH 4UV4L 4HT1H 2RGSA 1LK3L 5SWSE 3HNTH 5EBWA 5GHWL 1YNKH 5DVLA 4WW1B 5DQDL 5F7DB 5E2UL 7FABH 4JZJC 4HGWB 2WBJB 3A67L 5TE4H 5HHPA 1HZHH 2GCYA 5IMMA 1JJUA 3CMOL 2HRPH 4I77L 4I0PA 1KACB 4TUKH 5GXBB 4DOHE 4M7LH 2KPNA 4QXWA 4OGYL 3RL2B 1IZJA 2GQHA 1NGXB 4H1LB 4X6EB 4NM4H 4LHJB 3WJLC 2H3NA 3N1MC 5DRWA 2CDFA 2J12B 4MNGB 1UACL 4HKJB 1GGBH 2ZOKA 3IJSB 4NJ9L 4WFEE 1P1ZA 3MJ9L 4RWYL 5TDPB 2OP4L 4HX1B 5GSVA 3Q3GA 2PTVA 5A2FA 2IBBA 3DO7A 2ITDB 5CFHA 3O2DA 2FWOA 1H8SA 1I1AB 3SO3C 4OAWA 4JRYD 5J6GA 3UTZB 3VFUB 4Q9QH 2O5YL 3H9HB 4X7FC 3DTXA 5ILTH 5L9DL 4NNXB 4OUUB 3LEVL 3WHE0 2H1PL 1FDLH 5C08A 4OGAD 1A7NL 4HZAA 4KUCF 1U8IB 4HCRA 5J11B 4QRUB 3O2WH 5K93A 5ESAB 3UYRL 4UAOC 1W2KT 3DO3A 1OCWL 3OAYK 2UYLB 1KELL 5GS1C 4BQCA 4XTRC 4ELKB 3THML 1DBBH 1CICB 1V7MH 5T3ZE 4WCYL 2CUMA 3WJJC 1YMMD 1DSFL 4M93C 3PWVA 3MFGB 4S0TD 4WI7A 2QBWA 5C7XL 1X5YA 1U9KA 3E6FA 5EOCL 1ADQA 2XZCH 4S1RH 2ZP0T 2FCBA 4MVBD 1ACZA 4NO2A 3QIBC 4S1QL 5JQHC 3C5JA 1S7XB 1CFBA 3KPSB 1A7PH 4HC1L 3MLWH 4NWUH 3U7WL 3ZYOA 2VLJD 5D5MB 3BXNA 1EFXD 1KCRL 4ZYKA 1RJLB 4CUCA 4OFDA 5I75B 1A5FL 2JCCF 1UFUA 1I9JL 1RAMA 1KB5L 3HMXA 4WW1A 4HF5L 2P5EB 5F3HB 4HGWA 2BRRL 3B5HA 3DMMC 4IRJD 3T04D 1G7JA 5C70A 1KXQE 5IV2B 3E3QE 2ZUXA 1QBAA 1F6FB 3ARGB 2J8HA 3O9WC 4KJWD 4PLKC 4POYA 1NGXA 4H1LA 3HI5L 4X6EA 4HUNB 4JGMA 3SDDA 2QL1A 5E56A 4MNGA 1IC7H 4NHCL 1SY6L 2P8LB 4KI5D 1C12B 5BV7B 5TDPA 4DGIH 1RZ7L 1AKJD 4MXVE 4B0MM 4FFZL 3BDBA 1E4KA 3FMGH 5GGRY 1SJEB 5I18H 3QUXD 5F7EH 3KJ4C 1C7TA 2VH5H 3H42L 4G8GE 3HUJE 5DJCB 1FNFA 4YXHL 3UTZA 3VFUA 2X70B 3QUYB 1OAZH 4Z0BL 3H9HA 3ZTNH 2UZYB 3BIBX 5GS3A 1NFDE 4PRDB 4PLJD 4WWKD 4NNXA 2AK1H 2Q8AH 3GMOB 4G3YL 4OUUA 3VD5A 4N8PA 4AQ1B 1FL6B 1ZAGA 3RI5F 4GW4A 5IFAH 1TVBA 3SKNB 4UOW1 4QRUA 4LRNL 1YECH 1SJXA 5E99L 1JYVA 5IJKA 5BRZE 5DRNB 3MLPA 1KBGH 1FG2A 2UYLA 5LAXB 4KV5F 3ARBD 2XN9B 5D2LE 3BD3A 1CICA 4HIIA 4RGNB 4X4ME 4LSUL 3FHQA 1KN4H 2PNDA 4NYLB 5IBLC 2W92A 5TF1L 4TVPH 5IVXE 1NCAH 3OJDB 2YRLA 1CLCA 3QFDB 3PHSA 1KPVB 2ZSWB 4JPIB 1S7XA 2EEBA 3CPLB 3KPSA 4YC2C 1BZ7B 2Y6SC 2Z8VC 2NY4C 4BSWB 3S3PA 1PW3A 1NANI 1CR9H 1K5NB 1AHWC 1P5VA 4JM2A 3TBSA 1UJ3C 4UIKH 5T3XL 4AMKH 4LHQB 4YAQB 5DUMH 2W0PA 3QNYA 4Y2DB 4EI5B 5CSBA 2O26U 3J8F7 3UAJC 4MHHG 5TE7L 5HHVL 2HTLD 1RUAL 5C07B 2CKBB 2P5EA 4NQEE 2E8ZA 5MENB 3G6DH 3QIUC 1TPXB 4P46C 6FABL 3M1BB 5IV2A 4PV9B 4HKXA 4NKDB 1IARB 3JBG7 4XCFL 5DD5H 1TETL 3QUMH 4FG6D 3BKCL 3NFPB 3TYGH 2AJ3B 5F9OH 3KS0H 2P8LA 5ITFA 2F9BT 3EYUH 1KCKA 1AXSB 1C12A 3MV01 3IAPA 1KCVH 4JY4B 3EDKA 5D7JB 3H2WA 3WIIH 3GUTA 1RIHH 1T1YB 2FJGA 3LIZH 1SJEA 4I48B 1TZIA 3W11C 1IEHA 5DJCA 3MV8B 1X5LA 4XWGL 1NGZB 3QUYA 4JJ5A 1P4BL 1HXYB 5GS2D 4GOSA 2BY2A 4PRDA 5LGHH 4XC1L 3B3IB 1ZT7A 5DYOA 1WFNA 3GMOA 5KW9L 4Y5XB 1FL6A 1FO0L 2CO6B 2K9UA 3VRLE 4KDTC 5ELIA 4JQVA 3KPRD 3SKNA 1FIGL 3SDAC 5JXED 3O2VL 5DRNA 4LK4A 3EUUA 2EH7L 3IFNH 5LAXA 3RP1A 1NFIB 2XN9A 2IPKA 1UWXK 3C5ZA 5BOPA 5JXAL 2ED7A 3UJJH 4NYLA 4NZUH 4BJLA 1U3YA 1J0HA 3OJDA 5GSRA 3ZKMC 1BEYL 2P7TB 3BHBA 4PJ5D 3W0WB 3D1MC 4PIRF 1KPVA 2ZSWA 4JPIA 3U9PL 3QDJA 3MGTA 2DTMH 4X9IA 4AIZB 5IMOB 1BZ7A 1YN7B 3MCKA 4S1DD 5DJ6B 1AE6L 2VTFA 5TQ2L 4BSWA 5C0BB 2HLAB 5T5NG 1FNGB 3ULVH 5DK2B 4NQVB 3EYQD 4GAFB 3MV7B 1BOGA 4NO0D 2F15A 4FQLL 4U6VL 3QXTA 1BLNA 5E6IB 4EI5A 1JPSH 1NUGA 2VWEE 3ETBF 2WUBH 4HKZB 4R4FL 4LF3B 1LK2B 1ITBB 2PETA 4YHIA 2AK4D 2P5WB 2WW8A 2PO6B 3PWLB 4Y4FD 2MTPA 3L3GA 5C07A 3WDIA 1BJ8A 5MENA 4E9LA 1MCIA 3M1BA 4WI6A 4PV9A 3VXOB 1MLBB 4M8VA 1G6RB 3PWPA 1A4JB 5DEZA 3RJQB 5BQ7B 1PZUB 4HEME 4HPOL 1NC4D 1NBQA 2H45A 5FECA 1JYNA 4BH8B 2AJ3A 4ODSH 1JZ7A 2BC4A 2EH8L 2HFTA 4ZPVB 1MFCH 1AXSA 3FT3A 3UO1H 4QXGH 4MZ3A 3S36H 4LLQB 5EU7E 3RWCB 4JY4A 4L3EE 4G6JL 5D7JA 2YKLL 1T1YA 2NZ9D 2V2WA 4F7EA 2VXVH 4DVBA 4I48A 1MCOH 3LN4B 1FL5A 2NY5L 1YNLH 1DDHB 3MV8A 1AP2B 1NGZA 3WFCH 2MCPL 5I1KH 4G43B 4YK4C 4I1NB 5J1SC 5KJRH 3MACH 3B3IA 1DBJL 5JHDE 3BP4A 5TFSL 5HVWA 4WW2F 4Y5XA 4JHZA 4GQPH 2J2ZA 1KV3A 2ZJSL 3EJYC 4XCCL 1S5HB 1XGTB 5KSVB 3CLFH 3WIHH 4NBYB 3BWAB 5BMFL 5CCKH 3QJFA 1UXWA 2Z0BA 5C0IB 1NFIA 1ND0B 4L4JA 3MV9E 1I8LA 4Y88A 4I3RL 1MNUH 3PP4H 4QXTA 4PJGF 2A6IA 4RMUA 4YHZH 2VERN 5FYKL 4DKFL 3RUGE 1EHLH 2A74B 1T7VA 4JHAL 2NXYB 4YZFF 1EXUA 1FJ1B 5LKNA 5D7IF 4DZ8B 4PB9L 2P7TA 4KTYA 3W0WA 2Y4SA 3D3VA 4K3JH 4AIZA 5E70A 5LG1A 1BFVH 4GG6B 5C0BA 1DVFB 5C0DB 4YGVB 1IC4H 1VGEL 1ZT4A 3LMJL 4M9OA 2QADC 5ESVB 4S1SL 5DK2A 1ZVHA 3BN3B 3MV7A 3T0DA 1RVFH 2X9WA 4ZTPL 1RHFA 4DW2L 1N6VA 4OLVL 5E6IA 5BO1H 1AH1A 5C0CE 3RU8H 4OT1H 1LK2A 4M48H 3NABH 4I3SH 5DA0B 2P5WA 2WQ8A 2PO6A 3PWLA 5LGJB 3VFNB 2R1YB 2AKRB 2B39A 3TLRA 4X8JA 4P48A 2NW3B 3DGCR 1MRDH 4H25B 4F58H 1TJHL 3VXOA 1G6RA 2V2TB 1A4JA 4V1DE 1DQDL 1MHHB 3IYLW 4BH8A 2ZCKH 3GGWB 1Z5LA 4ZPVA 3QWQB 4ONHB 3TGXA 4EN3D 2VLKE 2VXSL 4Q6IA 5I30H 4LLQA 5AUMB 1ZVSB 4FQXC 5BZDA 4OF5A 4HEPG 5EO9B 5SWZE 4DVRH 3MRIB 3BD5A 1IGIL 1U92B 4PJ9D 1MCWM 2A6JB 3LN4A 3KYKH 3V4VL 2DYPB 1AP2A 3F8UB 1MJ8H 2UWEF 4HUWB 4JFFE 4KQ4L 5D1XC 2LAAA 1HQ4B 4G43A 4EDXB 1UQSB 2CH8A 3L95A 4R26H 5KSAD 1PLGH 3GSOB 3BPLC 2IBZY 1YPZE 2DMBA 1S5HA 3CK0H 4Z0XB 1XGTA 5KSVA 1U6AH 4L4VD 4WI2A 5MI0C 3S96B 1LGVA 4K7PL 1HNGA 4P5TB 1GIGH 1DLFH 3MXWH 4XCYB 2UY7A 4F7PB 1ND0A 1QLFB 2WWMD 3V5HA 2HFFB 5AYQA 2HLFC 1IVLA 3OKDA 2Z8RA 3GMMA 1QSED 4X6CE 1XH3B 5SWSD 2A74A 3UJIH 2BDNL 3G5ZB 1BREA 4O5LL 5GS0H 1ZANL 5ICZB 2A77L 2R9HC 4KMTL 1KPUB 1IAIM 2QHRL 3V6BR 2FYYB 1REIA 2VDKL 1IGFL 3L5WB 5GRZA 3GHBL 2DI9A 3MLYH 5IBTL 2HWZH 5FCSH 4GG6A 1LO5A 1T83C 4BUHA 3RVTC 4YGVA 4N0FA 4ORGB 3FO0L 5DUPL 4K71B 4MAYB 1JHLL 3V6OC 2MSPA 4PJCA 2OR9L 5GZOD 5MEQB 3VXTA 3QQ3B 3F7VB 2GTWB 3MLRL 3HG1D 5LGJA 2R1YA 2O5XH 5HI4D 2AKRA 2ZKHL 1U91A 4U6YA 2NW3A 4NN6B 3U6RB 4JN1L 2HRLA 4J4PC 1DQLL 2Q7NA 3B9DA 5EA0L 2V2TA 1N2RB 4JVUA 2ADIB 4HG4K 1A7QH 1MHHA 1G84A 5L0QB 1OLZA 4G7YH 5FGBC 2AJSL 1B0WA 1K3ZA 1GOHA 3IU3B 1AD9B 1UM6L 3MBEB 4OFIA 5KVDL 4ONHA 4JFYB 4OLWL 4PJEF 1X6NA 1KJMB 4KROD 5AUMA 2Y07H 3EOYG 4ZFGH 5EO9A 2NX5D 3MRIA 4YHPA 4AIOA 1U92A 4HBCH 4U1IB 2A6JA 1N4XH 5J12C 3VXUE 2HT4C 1Q0XH 2GW5A 5IT2H 4P4KB 1KENH 1HQ4A 4EDXA 1J05B 1UQSA 1MRFH 4QTIH 3BKMH 4UTAL 1K2DB 5HI5C 4OSUL 3U9UB 1OQOA 2QR0B 3TA3B 2J8UE 4XNXH 4Z7VF 5LWYH 4OTXH 4PY8J 1ZSDA 1G7IB 4UT6H 5HHXL 2V7NB 1IM3A 3RVWD 1CGWA 1HKFA 3O41A 4H0HB 1CF8L 1U0QA 1OARL 3R0MA 1DP0A 4XCYA 2NY2B 4PREB 4F7PA 1CG9A 1SM3L 3P77A 4HXAH 4U7MA 4X6FB 1QLFA 4FQ2H 1UKSA 2Y36H 3OKYA 3B9KD 4PJDE 1QO3B 3TCLA 2YWYA 1V8HA 2APFA 4KRPC 1KTDB 1LP9F 1MWAH 3OGOE 3W9DA 3BGFB 3G5ZA 1BVLB 1KLGA 1YA5A 5ICZA 1L0YA 4U49A 5IUSA 1KPUA 4M5ZL 2FYYA 1WCBA 3UPCA 3WO4B 3INUL 1A9BB 4XWOD 4I0PC 4CW1B 3UTSE 1YEDA 3BWUC 5DEGB 1NSNH 1JI1A 3MRQB 1MCHA 2A9NL 4H5SB 4TOYH 4ORGA 1Q9OA 2OS7A 4CDGC 4P4RB 1ETZB 1FN4B 3U4AA 3V0VB 1FFQA 4MAUL 4I0CC 5FV1L 5FCUL 2GTWA 2LTQB 4CMHB 4MA8H 1QLEL 4QTHB 1X4XA 5KSBA 5GJTH 5F9DC 3LKOB 5JIPA 4M02A 3U6RA 3OKOB 1DQML 1FL3B 3FT4B 3RHWK 1I4FB 4GSDH 3ZE1E 1D5IH 4UMGA 4Y19E 4Y2OA 1FLTX 5DWUH 1N2RA 2DQTL 3QFJB 1WZKA 4OLUL 2A83B 3NN8B 4JB9L 4OZGB 3BVNB 4QOKE 1RK0A 3KXFB 2OSLA 4WY7L 4ZAKD 3MNVB 4PV8B 4X4YB 3IU3A 1AD9A 2KQNA 2MPAL 2ITCB 5C09A 4H88L 4JFYA 2NMSA 1PZ5A 1KJMA 3V4UL 1E27B 2J6EA 3ZHDA 4BA8A 3GO1L 3DVGB 3UP1A 4ZS7H 4M00A 4YR6B 3CXHK 4P4KA 4Q9BA 4X6BA 3WD5L 1K4CB 1S5IL 1J05A 4X5XB 1MF2L 3ZT5A 3IRPX 2QR0A 3QDMB 1BD2B 1Y6NR 3IU4L 3LN5B 4O58L 3GSUA 4UZGA 1J87A 4K3HA 4RZCB 3LY6A 5JW5A 1RUPL 4KQ3L 5CEXB 2DL9A 5JNYB 1A6WH 2L0DA 3SKJL 4PY8I 4PREA 4RQQB 4LSDA 1J9CT 5EZOL 1GGUA 4X6FA 1MCPL 2E3VA 1T2JA 1QO3A 4KFZC 5DJDB 4ENEC 2MQ3A 4JFDB 1F4HA 1KTDA 1LK3H 5GHWH 1BVLA 1JWMB 5DQDH 5E2UH 3SGKA 2WBJC 1FYTB 4YHYB 3A67H 5BOZG 3DETC 4DQOL 1A9BA 3CMOH 5DDHA 1G6VK 4I77H 1XGYH 5J6HA 3O4LD 5DEGA 4X9FA 4M6OL 4H5SA 2VDNH 1P9MA 3MRQA 4OGYH 1JWSA 4CKVX 2YD3A 3SDDC 1NC2D 3GJFK 2R56H 4NJ9H 3VW3H 3P11L 4JKPL 5IVZB 1QSFB 1ETZA 1FN4A 2OP4H 4PTUB 2E5EA 4YE4L 3V0VA 2EXYC 1E4KC 3FCTA 4UILH 4PJHA 5FGCB 3UROR 4J3VA 2CIKB 4NQCE 4QTHA 3VGAB 3S34L 1TTUA 3AAZB 1EEYB 3OKOA 1GZPB 1I4FA 3O6KH 2O5YH 5FKPB 2C3VB 2YMXL 3QWOB 1TXKA 3G5VB 4OLZH 3QFJA 4NP4L 2XQYK 4OZGA 3BVNA 5D70L 2D4DA 4Z8FH 3KXFA 3PWNB 4D9QE 4JLRA 1BQHB 2H1PH 3J7HA 4PV8A 5J11C 5J57B 1F13A 2VR4A 3QIBD 4R97B 3EDEA 5IJKC 3FT2B 1E27A 4LLMA 3UYRH 1J0ZA 5JDSB 1Z3GH 4IJ3B 3DXAD 3ULVF 4PTTB 5IBUG 1H3PL 1KELH 3HKFA 5GIRB 2VDPL 1CICC 2AJYL 1DQQB 4JKMA 4XB8A 3D25B 2AI0L 2J88H 4WCYH 1IMHC 3AXLA 1H15B 4LSQL 2R2EB 2WM0A 5C7XH 1NLDL 2Q87A 3MRLA 2VSCA 2VDQL 5EOCH 1JZ3A 1GL4B 4Q0XH 3R4DA 2OYPA 1BD2A 3LN5A 4S1QH 1HSBB 3DMMD 4YIQB 5CEXA 2XPGB 5JNYA 3U7WH 4MA7H 4B53A 4OUOA 4YBLC 5JR1L 4O4YL 4QRQA 5DJZB 4JPVL 4R90L 3O9WD 4PLKD 5E95B 4OZFH 3GKZA 4RQQA 4JM2C 1WAAF 4FFYL 2G5BA 5I75C 5DJDA 3OTTA 4JFDA 1A5FH 1FH5L 4DTGL 2D7MA 3MLVL 5DEFB 4MDIB 4HF5H 4NO3B 1IL1B 5ISZA 2DD8H 1FYTA 4NCDA 2BRRH 1IAIH 1I8IB 1YEJL 2HYMA 3P30L 2VR5A 1U8MA 1F45A 2BVOA 1TNNA 4QT5B 3BP7B 1CFTA 3OGCB 2EKSA 2H26B 4NKOB 1NGQH 3QZWB 4XXDB 4P2OB 3HI5H 2YUZA 4X7EC 4OIAA 5GJSL 4NHCH 3MPCA 1SY6H 1GOFA 3EDJA 4NC1C 4EDWL 3T1FB 2F8OA 4L8SB 5BV7C 2YZ1A 5IVZA 2XXCB 1QSFA 4PTUA 4AEHL 1RZ7H 2YPLB 5BXFB 3IDUA 1RZFL 2Z31B 4Y8DC 3HI6H 4N1EA 3TT3L 2BHZA 5E7FA 1CS6A 3H42H 3KJ6L 4WUUE 3QUYC 1UYWH 5CINL 4YXHH 4YWGL 1CXIA 3MREB 3QPXL 2C3VA 2GJ6D 4Z0BH 3QDGB 4U6HB 4U0QB 5DJAA 4LDEB 2A6DB 3QEUB 5D1ZB 1YYLL 3PWNA 3BZ4B 4G3YH 3B5TA 4HMCA 5IBLD 1BQHA 4JQVC 2OK0L 1D6VH 1W0VB 4HAGA 4LRNH 2DQGL 4WW2B 5E99H 5CLWA 2Y6SD 4TUOA 4ZUVB 1EV2E 2NY4D 3BO8B 3MJ9A 4PTTA 3LEYL 4BH7B 3WFEH 3HRPA 5GIRA 2YD8A 4HJGB 3G6JF 4RGNC 3C5ZC 1QYGL 4ZO6A 4FOMA 3D25A 4M1DL 3SKMB 4LSUH 2R2EA 1E6JL 2VOTA 3TO4B 5FHAH 5TF1H 4HIEB 3UAJD 3GNMH 2XY2A 3QI9B 5D7LE 3KLHD 1I7RA 4OKDA 3CLEL 1F2QA 4RNRB 5C3TA 5DRZB 1RUKL 3MLTB 4OCMC 3PWUA 1HSBA 3T0VA 1FPTL 4YIQA 4P46D 4PRIB 3N1PC 3OBAA 5D7IB 4LLDB 5DJZA 4FXGB 4R0LA 3KPQB 3ZT7A 1K8DA 4M8QB 4ETQB 3SPVA 2X7LA 2YPVL 1YMHB 1ZHKB 1BWWA 3BPOC 5T3XH 4EI5C 4UT9H 1LEIB 2ZG2A 4ZPTA 4XNQB 2EDBA 4FS0A 1MHPL 4NFCA 5DEFA 5TE7H 2X44D 4NO3A 5HHVH 1HCFX 1IL1A 3U30C 1RUAH 3HZVA 2DQUL 2YD2A 3I6KA 1IC5L 1TPXC 3HPLB 2DKMA 1I8IA 3W11D 4PRPD 6FABH 1Q9LB 3BP7A 3OGCA 2H26A 4XCFH 3B2UC 4XXDA 4EVNB 4P2OA 5ID0B 1KG0B 3JV4B 4OD3L 1J7VR 3MTRA 3BKCH 4HC1A 2IF7A 3DROB 3BT2L 4NRYA 4QHKJ 2AJUL 3SCMB 1L7IL 5D7JC 4BFBD 3SDAD 5BXFA 2V5TA 3DI2B 1JNHA 3PXHA 3TJHC 1ORQB 2DJSA 3ARFB 1EA9C 1KB5A 3S36X 4WHCA 4CN6A 3K4DA 4AJ0A 4LL9A 3GIVA 3FAWA 2X1XR 3QDGA 5CKGA 2CD0A 1XF4B 1DUZA 3JV5A 1A3LH 1T7ZA 4XC1H 3UX9B 4ZUWB 4FTVE 3MLZH 4XBGA 4Y5XC 3U7YL 2A73B 1JWUB 1F97A 4R7DA 5ANME 3ECBA 1W0VA 3CVHB 2WWKT 1FIGH 3TH3T 4GRWE 5IB3B 4GKSB 4F9LA 1SY6A 5E2WL 5IMLB 3O2VH 4ZUVA 3BO8A 2EH7H 4N1CA 4K23H 4BH7A 1I8LC 1XF2B 3D39A 3RQ3A 5JUEH 3IDNB 5DJ8B 2UVFA 2GHWB 4HJGA 4NOBA 2MKWA 4X99B 1KXVC 1BZ9B 12E8L 4EUPH 3CH1B 5E8EA 4FFVC 2ADGB 3TO4A 4HIEA 1QLRB 3TIDA 5FM8A 4TSCL 1A9EB 1BEYH 2AJVH 1QRNB 5DRZA 5FOBA 4QGYA 3MLTA 3EJJX 4PJBF 2XY1A 5FUCE 3U9PH 2FR4A 1FO0B 4NPYB 4NSKB 2FSEB 1AE6H 5TQ2H 3S5LG 5EC1A 5E5UB 4LLDA 4FXGA 3V8CA 1HXMA 2EYSB 5KSUB 3PUCA 2A9MH 2X40A 3FOLB 5E0QA 4M8QA 4POZC 3EW3B 1YMHA 2NTSP 3MRHB 1ZHKA 4ZUUA 4U6VH 5E6IC 2BSED 2R4RH 4NQDB 4ZO8A 5T1MA 4NRXB 1F58H 2PO6C 4GQ9H 1CDJA 3T2NL 3HPLA 1KT2A 2F53B 3TBTB 1J11A 1Q9LA 5E9DA 1NEZB 5KZCD 3SGDI 4G6FD 5ID0A 4EVNA 3E6HA 5KS9F 1PG7W 4X80L 4BELD 2GAZB 2WANA 1EX0A 2EH8H 2F8VA 4FXKA 2UUDH 3SCMA 3EJYD 1HHGB 4CVWA 2BNQA 3QUKA 3VFRA 5E8PB 4YQXH 3RIFK 3DX7A 2BNRE 3UBXG 3X13B 4G6JH 4YDJA 4YHNB 2YKLH 4WENB 4QHKI 3KLDA 1A6TB 1YEFH 2Q86A 3ARFA 4PJ7F 2R0ZH 3VDAA 3B9EA 4KK9C 4XGZB 2MCPH 3A6OA 3AUVA 1XF4A 3T65A 5BZWB 4ZUWA 4BFIB 5I8KL 4H26B 4IM8A 2ZUQB 4L29B 4KI1A 4JZOB 1JWUA 2ZJSH 3CZJA 3CVHA 1FZMA 4I5BB 5IB3A 4O00A 4GKSA 5KVEL 4L3AA 3LHPL 4X4ZA 4UTBL 1E6OL 1XF2A 4D3CL 1IAKB 5T1DH 2QADD 5DJ8A 4F7MB 4I3RH 3FTGA 2HT2C 4LCWD 2JE8A 4X99A 3KVQA 4F3FB 3O81A 3CH1A 2CLRA 4XBEL 1AQDB 4JHAH 2ADGA 2QSCH 5IESL 3D6GA 1QLRA 1BFSA 1UM5H 2BCKA 3DURA 4PB9H 3VXQA 1QRNA 4APQB 3H6JA 2YXMA 1B88A 5F6IC 1FO0A 1MFDH 3UEZA 4LSTL 2FSEA 3KYOB 1TVHA 2ED8A 3O6ML 5EUOB 3H9ZA 4Y1AD 3P4LA 2OJZL 5KSUA 2BY0A 4P57B 3FOLA 2VAAB 1JK8B 3AREB 2X2YA 3OXSB 1EBAA 1ZXQA 3MRHA 2R1XB 3VH8B 4DW2H 3OWEA 4X6DF 4NQDA 2H9GB 1U3JA 3IF1B 4FQXD 3GEWB 2X42A 1QSZA 2F53A 4NN7B 3NIDF 2I60L 3KLAB 3REWB 3TBTA 3PQYD 4Y19D 3AMKA 1TJHH 4MLIA 5D1XD 4X7SL 3HPJB 4TRPL 1I8KA 2WIIA 1DQDH 1OSZB 1NANH 3HR5B 5SX4I 2N7BA 4CVUA 4XP9L 3GJFB 1J88A 4L4TB 2SEBA 5LBSH 4G8FB 1F4WH 2IC2A 3VXRD 2VXSH 5E8PA 2ZCLL 2OTWB 1QR1B 3LPFA 3WUWA 4RX4A 1A6TA 1IGIH 4S11A 5FYLE 5KVMC 1R3IL 1VFAB 4OCSL 1L0QA 4YEEA 4U3CA 4NRZA 4JPKH 3GSQB 4XGZA 2VNCA 2HLFD 1AQKL 3REVB 4BFIA 2DF3A 4H26A 4L29A 1FZJB 1G0YR 4JZOA 1JZ6A 4HWZB 2B4CL 4HGKC 4TULL 2R9HD 5FM4A 2FDBP 1MI5B 3CVIH 4I5BA 1FVEB 2IANE 3WHE1 4GRLB 3TJEL 4U1JB 2ED9A 2R15A 3CAFA 5HYJD 3OB0H 1IAKA 3F7PC 4BYHA 1AXIB 2Z93B 1UCBH 1WUNT 3CFKA 1SYSA 2Q76A 2IGFL 5DZOA 1AQDA 2OTUB 1YEIL 1GH7A 3HZKB 2ENYA 4OZHE 5K9JL 1R5VB 1ZANH 5CJQH 3OX8B 5GS2H 2A77H 5I1JL 5K59F 4HS6A 4TTGA 2QHRH 2VDKH 1IGFH 2VDLL 5C6TH 4YHKH 4PRHD 4CU7A 3MYZA 1XGPB 5IBTH 3KYOA 1SEBB 4RAHA 5LXGL 5B3JE 5EUOA 5IHZB 1RIVL 3HC3L 4K71C 2WMPA 3FO0H 5DUPH 4P57A 2VAAA 3AREA 1S7WA 1T66C 3OXSA 1OAUH 2VDRH 1YN6A 3ILPA 1KNOA 3D18A 4HULB 3VH8A 3O8XB 4LFHD 2OR9H 1T3FB 2H9GA 1RJYB 4R3SB 5B39B 3IF1A 4D9RE 3QUXA 3P4MB 1EEUA 1E4XI 1UCTA 1CQYA 4KC3B 5EU5B 4U1KA 2ADJB 3REWA 1WWWX 4JN1H 2ESVA 2DIAA 2HG5A 5EA0H 4I18B 1OD7A 1AFVL 2QQLL 4HXBH 4X9BA 1BIHA 1KLUB 5D7SL 1OSZA 3GKWL 3OKMA 2WNGA 3HR5A 5MEOB 3M17B 1MREL 3GJFA 4L4TA 4P2QE 5KVDH 4X4XB 4OLWH 2IJ0C 1BX2B 2FX8L 4ORZC 5F7UA 4PJFE 4H1LG 1AGBB 3FB6B 2VLRB 4PLOB 4HFUH 4L8DB 4L9LA 1CTOA 1TZGL 4HJ0C 3OG6B 3ARBA 1VFAA 3MA9L 1K4DB 3HNVH 3KAAA 4P4KC 5H37H 4LEXL 4RFOL 4KRPD 3REVA 1Z2KA 5TGBA 4ISVB 4UTAH 3KDMA 1XMWA 1WITA 1FZJA 4HWZA 1FVDB 2LE9A 3DHJA 1MH5B 1FBIH 1MI5A 2FLRT 3GBML 2CMRL 3ULUE 2ZUWA 1FSKB 2AV7A 3DX8A 4KRLB 4GRLA 4I0PD 4Z7OF 4MNQE 4U1JA 2NY2C 1A2YA 1S9WB 3MRDB 5EU6E 1SM3H 2E7CA 2D7OA 1F3JA 2Z93A 4AYFA 1SJHA 1FVCB 3BGFC 1EGJL 4HUXA 5FUZL 2OTUA 1YYMH 1IGYA 1H5BA 3S9DB 4HPYL 3KPPB 2DLIA 5HHOB 3SGKC 1R5VA 3QCVH 3OX8A 4KJYA 4G80B 4QHLB 3MRBA 5E1AB 3LQAH 4M5ZH 5EPMB 3INUH 4Y16B 1ZLVH 5JHLL 1XGPA 2ADFL 1P9MC 2PCPB 4S2SB 5IHZA 2YXFA 3FAXA 3JZ7A 5C08D 1SQ2N 3KPLA 3JUYA 5CP3H 4PG2A 5I8EB 3MRGB 1VB9A 4MA3B 4DGVH 1QFWI 5DD6B 5AYUL 2LTQC 1RJYA 3LV3A 1NQBA 3H9SE 4MAUH 5B39A 3P4MA 2HT3C 3X12A 2M2DA 5D9SB 3V79C 4XT1C 2DM4A 1CE1H 1E4WL 4LDOB 2ADJA 3MLSH 2FGWL 1DQMH 4OQTH 2XWTA 2F54E 1QHPA 3A0OA 2DQTH 4OLUH 3D85B 4HUKB 4JB9H 1KLUA 1SEQH 1PJ9A 4Z9KB 5FFLA 5MEOA 3M17A 1IZKA 1S7UA 2MPAH 2H32H 1OAYH 4H88H 4X4XA 1JPST 1ORSB 2ICWB 1BX2A 3C8DA 1C5CL 3V4UH 3SE3A 1MCDA 4YDIL 1AGBA 2R39A 1A02N 2VLRA 1B6DA 3EJZC 5EH1A 6CGTA 2JB6B 4XP1L 5D2NA 5HDLA 2J4WH 2YRZA 1EJ6A 1NPUA 1K4DA 3JV0A 3WV0A 3MJ6A 2QQQA 4ENED 3WD5H 5F1SA 2FEEL 4Z7WB 1QBML 1S5IH 3O4OB 2XWJB 4Z7NF 4MQXC 1MF2H 1T0NB 4ISVA 3A6CH 4QHNB 4UBDC 4F57L 3RA7L 4G6KH 2WBJD 1FVDA 3IU4H 3CXDL 5FYJE 4O58H 1MH5A 5IF0B 3DETD 4KK6C 5C8JB 3O6LL 2DMCA 5L8KB 3Q6FB 1QFHA 1P4IL 4BFEA 4UOW0 4NQSA 1S9WA 2OL3L 3MRDA 4UINL 4XX1G 1MCPH 4NO0A 4XPBL 3IFOB 3RL1B 1C5DB 4FQIL 5GRVL 2DICA 2EO9A 1NH6A 2HH0L 3L5JA 3KPPA 3W5NA 2HJKA 4G80A 4YHYC 4QHLA 1UH3A 2AXHA 1HEZB 4J8RB 5E1AA 1XGUB 2X4NB 2CK0L 4O9HL 5EPMA 4NWTL 3VXSB 4DQOH 5M7QA 1KJ3H 1LHZA 2PCPA 1A4KB 3TO2B 2R1WB 4S2SA 4M6OH 5H94B 5CD3B 1L9NA 3PGCB 5EZJA 1BBJB 3DRTB 2EYRB 3EO9H 2VISB 2IBGA 4WV1B 5I8EA 3MRGA 4JKPH 1IM9B 5IB1B 4MA3A 4KUZL 3MGOB 5CBEB 2AEWA 3BDYL 1RMFL 3RGVB 4GG8A 3DHMA 3ET9F 4ZUTB 5D9SA 3S34H 1VKXB 43C9B 3ZE0F 1R3KB 4XVSL 4IBLT 4JGUA 1CICD 3WSQL 2O61B 5AWNL 2PYEE 2YMXH 3HE7B 4KK5C 4NP4H 4JDTL 1DANT 5D70H 3MO1B 4XP5L 3I02A 3EYFB 1VFOA 3WLWD 3UTTB 4Y5YB 3DUSB 5C92A 4Z7UB 1CZ8L 5C9KA 2MFNA 2CIIA 4R97C 5I8CB 2E27L 4ZFZB 2MQCA 3KPSD 2AGJL 1W72L 1DJSA 1OW0A 5CP3A 3IXTB 2NYYC 1E4XL 1N5AB 2IALB 2X1PA 2JB6A 4W4OA 3L6FB 1H3PH 1IBGL 1JHKL 2AJYH 25C8L 1K8IB 4JANB 1OP9A 4X0KA 2XWJA 5JQ6L 4GW5B 1NLDH 1C08A 1BBDL 4MNHB 2P5ED 2VDQH 4OGXL 1HCVA 3Q2CA 2JCCE 5IF0A 2VB5A 4DOHB 3PHQB 3O45B 3ARGD 1QACA 5HGBB 1F3DJ 3JVGA 5JR1H 1C1EL 1ZA6B 4O4YH 2EXWC 5I76B 2VXQH 4JPVH 1L6XA 4PJBB 2G2RA 3T0EE 3VFOB 4FFYH 4M03A 1GXEA 1KTLB 3RL1A 1C5DA 1F8TL 2BOBB 2YN5A 4G42B 4DTGH 2APWA 4JO2H 4KWUA 4LPWA 4OCRL 3GRWL 1HEZA 4IIQA 1XGUA 2X4NA 4GKZB 1YEJH 3QUYD 3HFML 2X1QA 4P2OC 3TO2A 4EIZC 5H94A 5CD3A 4LCCB 5KVFL 2YRPA 3PGCA 1ZGLP 1BBJA 3DRTA 4L8SC 3MODL 4NZTL 4EDWH 2XKNB 3OKNB 5JA9A 3O3UN 5IB1A 5KS9B 4KI5F 1RZFH 3TESA 4XPAL 2JJSA 3NTCL 4PJ9A 4ZUTA 1CXFA 4AT6A 3ROLA 3NCJL 3KJ6H 2XN9D 1V3MA 3DV4A 2V5RA 4RISL 4X9HA 4YWGH 4RGND 4ZUSB 3FJTA 3HE7A 1YZZA 2ARWA 1ACYL 4KV5E 3MO1A 2CLZA 3RWFB 4PJ7B 1XT5A 4NKIL 4E42B 3EYFA 1EVTC 3TPUB 3QO1B 5DURB 3UTTA 5HGAB 1KGCD 4Y5YA 4Z7UA 3QDME 2APBA 1JGVL 5I8CA 1S9XB 1QFWL 5L2KE 4F9LC 5I0DA 2AXFB 1OGAE 2WBKA 2DQGH 3U2SA 3QA3B 3W81A 4RBPK 1N5AA 2IALA 2VZ1A 4HCRL 3LEYH 3L6FA 5I17B 3ULSB 1QYGH 4JANA 4TNWF 3SDXF 1QSEA 4ELMF 4UB0H 4YPGA 4Y2DD 4EI5D 5SWSA 4EIGB 3PV6B 4GW5A 3TO4C 1E6JH 3SJVE 5HHME 1R3JB 2AABL 5C07D 1CXLA 1N6QH 3WDHA 3CLEH 5MEND 3FKUS 1RUKH 5HD8C 3WFHA 5AZ2L 1FPTH 1DQTA 4J1UB 2I9TB 3UC0L 1RI8A 1JN6A 4G6ML 4MJIE 5KOVC 3QSKB 4OBSA 2NY1C 1A6ZB 1ZA6A 4G8EB 2C26A 5I76A 2B0SL 2Y25A 2DLHA 3SO5A 2X05A 4ODTL 1HHIA 1AI1H 4R4BA 3RNQB 3VFOA 4N8VB 4JO4H 2VXUL 1KTLA 4L8BB 2E7LA 5CJBA 3P9LB 2BOBA 1DLHB 1PKQB 1MCFA 1TMCB 2AQ3A 3G5YA 4C57C 1MLCB 4WFFE 5D7JD 2YN3A 4CBPA 1CU4L 4WI3A 5FGCE 3HG1A 1DN0A 1MHPH 4G8GB 1QD0A 3DNKA 2CQVA 3HUJB 2DQUH 3TJHD 1QFUL 4GKZA 3MV8D 3RTQB 2B1HH 1NKRA 3CFIC 1NFDB 2YHGA 3V6OE 3S3SA 3X14B 2XYCA 3L7EB 1A0QH 5FO9A 3MOBL 4M43L 1T89A 2FX9H 3BT2H 3SCMC 2AJUH 1PVHA 4HIXL 5B38B 1M71B 2XKNA 5INDB 4QEGA 5T33L 4WFHE 3GI9H 3BE1L 1A1OB 3MRCB 5I2IB 5BRZB 4GJTB 3G04B 3IAQA 3ARFC 1OGTA 1J1XL 4YHOL 1N64L 4FA8A 1G7PA 1T1ZB 5F3BA 4ZUSA 3RNKB 2D7TL 4JFPA 3PJSB 1LEKB 3LB6C 2Q7YB 4G5ZH 3TBVB 5SX5K 5IVXB 4FFVD 4Y7MA 4E42A 3U7YH 3KPNA 4U4BA 3VFMB 1BFTA 1TVDA 5HYEA 4DCQA 5IIEA 1DE4A 3W0WD 2O93L 3MROB 4IDJL 4G7VH 3AM8A 1NGWB 1U3HB 1AIFB 4EXPX 3S3JA 3OKLB 3QA3A 4DUVA 5C0BD 3ZKNC 4PJIF 4WU7B 4QRPE 2EDOA 2P1YA 5I17A 2J5LB 3MV7D 4POZD 4X5LA 5CEZE 5E6ID 1TITA 4ZQKB 1P7HL 5HPOA 1P53A 1R3JA 4NQEB 2P5WD 2XZAL 4DGYH 2PO6D 4GMTL 4J6RH 3ZKQD 3L3KA 3P2TA 4WVRA 1DFBH 3GHEH 2CO7B 4ZXBB 5BVPH 2I9TA 2V7HA 1G9EA 1NCUA 5F71A 1A6ZA 3I6LE 4G8EA 2DJ4A 5FV2A 1M6OB 4KZEL 2IMMA 4G8IB 3BZFB 5CGTA 3RNQA 1BQLL 4N8VA 1KIPB 3MRPB 3NH7L 3T8XA 5AG9A 4LLUB 5EWIL 4A6YB 4L8BA 2XZZA 3RJDA 3P9LA 1DLHA 3KPOA 3RZCB 4M7JH 1MLCA 3RDTB 3P9WB 2FIKB 2H2PC 4N8CH 5F88B 3MX0A 5ACLA 4HHAB 4F9PA 3K2UL 3VG9B 5F7LB 2K7QA 3UCRA 3HUJA 3T2NH 2RR3A 3C2SA 4GXUM 3RTQA 1NJ9B 4HDIB 4ESKA 1NFDA 1G9NL 3ZYZA 1B0GB 4KK9D 2Y5TA 1WIOA 2AERT 3L7EA 3L3OB 1NLBH 1K85A 4NZRL 4OGAC 1D5MA 1UJTA 5INCA 1NCCL 5CIPA 1CGVA 1T2QH 1M71A 4PJ8B 1A1OA 3MRCA 4XPFL 5I2IA 5BRZA 3WEXB 3G04A 4YHML 1T21B 4I3GA 1OP5K 1PEWA 5BV7L 4YFLI 5D2LA 4P2CG 1DEEB 2Z8WC 1YQVL 1QQDA 4PRBA 3NGBB 2ZNWA 2HT2D 3C5SB 3RNKA 4WTXA 1T1WB 1VA9A 3DIFB 4OZFB 1T2XA 2Q7YA 1XGQB 2ZUQC 3TBVA 5I8KH 5IVXA 2NXYD 1N8ZB 3A6BL 3NVQA 4M9PA 3WL9B 4JKWA 3HNSH 1RURL 1R3LB 2UZIH 3C6LB 4PJGE 3C09B 4LIQE 4X83A 4XI5C 5DS8B 3MROA 2W1NA 1U3HA 5H2BA 1X4YA 4YZFE 4WDIA 2JJVA 5EIVA 3OKLA 5KVEH 3LKPB 3LHPH 5D7IE 2XG5A 3MUHL 1DVFD 4WU7A 4RMRA 4UTBH 1AD0B 3U1SH 4JM4L 3N85L 1Q94A 2VABB 2MKLC 5ESQB 4JG1L 3K74B 4N0YH 2NY5C 4ZQKA 4JN2B 4OCXL 4XBEH 1KCSL 4M7ZB 5DQJB 4NQEA 3ABZA 2W07A 3NCYP 4YLQT 3LEXA 4P59L 5CJXA 2QEJA 4FQHB 3TV3L 2EYTB 3VI3F 2CDGB 5E94B 2RQ8A 5ETUA 3UPAA 1N0XH 3CFBB 4O51B 1ZLWH 3O6MH 3W2DL 1G7LB 1M6OA 3AREC 3DARA 4BKLB 4G8IA 3TYFB 4ZOCA 3MOQA 1KIPA 3E8UL 3MRPA 1OTTC 4A6YA 2R0LL 2H2SD 2WV3A 5IHBA 3RZCA 5F6HI 3RDTA 2AXGB 3F62A 4Q74A 1N26A 2FIKA 4HLJA 5F88A 1II4E 4FXLA 3U48A 3K1KC 3QUXC 4XBPB 4DN3L 4HHAA 4RIRB 1HILA 2C4FT 2KDGA 3VI4F 1ZOXA 4NN7C 5GGQH 5E08L 2YK1L 1FE8H 2DYPD 1FNHA 1NJ9A 3T3PF 4HDIA 4QRRE 3MLUH 2CKBL 1B0GA 4TNVK 3SE8L 1A3RH 1MCRA 2Y1VA 3MGAA 1JTPA 3O3BA 4UT7L 4X7SH 4XAWL 5D71L 4OZIA 4TPRL 4UI2A 4P2RE 3T1WA 3L3OA 5TE6H 2UWEE 2X10A 4PJ8A 1I7UA 5I19H 4OF7A 5EN2B 5AZEL 5IW6B 1OAXL 3UJTL 5T5NF 3L3IB 5LCVH 4L9LC 4P5TD 4DWHA 1RIUL 2J8OA 3ARBC 1HWHB 3MV9B 3OPZH 1A7BA 1LE5B 4OCSH 5BS0E 5IKCA 1T1WA 1P69B 2O5ZL 2UV3A 4RGMB 5EORL 3RUGB 3DIFA 4RMTA 2XTJB 1AQKH 4LVNB 1XGQA 2OBGA 1KEML 3WL9A 4LP4A 1R3LA 3C6LA 5FYJD 1B3JA 2DQCL 4KTEH 4GRLC 5J13B 5C0JA 3FRUB 1JPGB 5F7NC 3LKPA 4CN4A 3QG7L 1AD0A 4QRTB 3OAUL 2VABA 1T66D 4MAYD 5J7CC 3WHXB 1Q1JL 2IGFH 2VIRA 5FYLL 4KKCD 1R5WB 1H5BC 5D6CB 1YEIH 2HTLC 1FGVL 1VENA 3K7UA 4FQHA 1U8LB 3BSZH 3LH2H 2CDGA 5E94A 3V7AE 2GEEA 2AW2A 4R2GB 4V1DB 1QKZL 1NUFA 3CSGA 2FJHB 4MS8C 5LXGH 4O51A 2VZSA 3HC3H 1G7LA 1XZ0B 4NDMA 4UDUB 3BEVA 5GISH 4JRXE 3TYFA 2BVQB 4PG2C 2FZ3B 2VLKB 3MBED 4YDVB 3IVKA 3IDYB 4L3EA 4J3WA 1NBVL 3JWNC 2ZZUT 4M7KL 5SWZB 4XBPA 1H3UA 4RIRA 2BP3A 1BVKA 2ENSA 1KFAL 4HJ0D 1A6AB 3KYMB 3NCFB 3MR9A 4PJEE 5IHUL 2VMFA 4MA1B 2Q3ZA 4KXZI 4P4KD 2W91A 2RB8A 2E7HA 2QQKH 1KIQB 5JHDA 1AFVH 2QQLH 4GRWF 4CGTA 1IAOB 3WS3A 5D7SH 3GKWH 1IGTA 3MOAL 1YPZB 4XP4L 4HKBB 4CU6A 1KOAA 1G6RL 3NFSL 2DN7A 2EDNA 3TA3D 1MREH 4JRYB 1QFWM 4LSRH 4U7SA 5DD3H 3DV6B 4RBPH 3T0WA 4D94A 3SE3C 5D7KE 4DN4L 2V9RA 3P4NB 2FX8H 4FQ1L 5IW6A 2C7UB 1FORL 3KYAA 3FQWB 2XOTA 2FGZA 5D2NC 1W0YT 8FABB 4Z7VE 2DM3A 2GSGB 2NY2D 3G5XB 4FNLH 5A43C 5IB4B 1LE5A 3MA9H 5K9OB 4XVUC 2P24B 4LEXH 2Q6WB 3SGDH 1Q9WB 3BRDA 4RFOH 3ZYIA 4F7TB 1G0XA 3ZKXB 5GGUB 2R2BB 4NO5B 2LU3A 2NTFA 1G0DA 2B5IB 1QPPA 1LP9E 2DQEL 3GBMH 5E4EC 1FSKC 1YEGL 3QCUL 1W0WB 5I74C 1KJ2B 1XF5A 1GAFL 1LEGA 3FRUA 1BQHG 3DBXA 3EYQC 1MCWW 2DIJA 2IADA 3O3DB 3WE6B 2BJML 4RGOL 3OAZK 2GKIA 1KIRA 3V0WH 3WHXA 2Z4QB 3MRRB 5C0CA 5CHNB 2ID5A 3ESUF 4LAJH 1EGJH 3V9FA 4M6NL 3GSNB 2HKFH 1QUNA 3V0AC 4ZOAA 2HT3D 4ZG1A 1MFEL 3JV6B 1U8LA 5MP6L 1NMAH 2EC9U 4NJAL 4P3CH 4MQ7A 4V1DA 2R23B 2FJHA 2X4SB 4ALAL 3QFJD 1CL7L 2FB4L 3KXFD 4NUJB 3ULUL 5IQ9B 1CDCA 2P8MB 3D2UB 2FZ3A 4JZNA 1RJZB 2D31B 4JQIL 4ODWB 5JW4Q 2C1OB 3STZB 3MRMB 4TVPE 5AYUH 2DI8A 5SWZA 2DBLL 2G5RA 3PWPE 3EJZD 3C08L 3VXUB 5IROA 4W70A 4JFFA 1JGDB 2YUWA 3B43A 2EIZB 4U1SA 1AY1L 1JPTL 1IAOA 1DUYB 2D0FA 2EKJA 1YPZA 2J8UB 4UBDD 4BSVA 4HKBA 5EC2B 5CGMA 1I1YA 1BD2D 2XQBL 3H7BB 4XPGL 3DV6A 1B4RA 3P4NA 1WQVT 1C5CH 3QUZB 2C7UA 1N3NB 1OW0C 3DYPA 2IG2L 4KK6D 2AJZB 5DQ9B 3VA6A 3FQWA 4W4OC 3TBYB 2HFGL 1WWCA 2GSGA 4PBVC 4XP1H 1Z9LA 3G5XA 5IB4A 1INQB 4PJDB 2P24A 2VE6A 3O4OC 2VO5A 4JFDD 1BECA 4X6CA 2Q6WA 1Q9WA 2HVJB 1F2XK 4F7TA 2GT9B 5HGDB 3JTTB 1LE9A 1LO0L 5GGUA 2R2BA 3PGFH 4NO5A 5SX4H 3MXVL 5CILH 2I26N 1H8OA 1CLOL 3KNBB 5ISZD 2FJFA 1FYTD 1VDGA 5C0AE 4ELMB 2LU7A 1MJ7L 5HDQL 4X9GA 2G9HA 3O6LH 3UTSB 1KJ2A 3EYSL 3JVGC 2FNBA 4M3JA 3KPMB 1P4IH 1SJVA 4LU5L 3HAEH 1JNNL 3PL6B 2OL3H 3PP3K 4UINH 3OXRA 3SDYL 3WE6A 3QEGL 1B4JH 3MRRA 1YEEH 5CHNA 4F80A 1QSFD 3SN6N 2HH0H 3D3VE 1NGYA 4YBQC 3VXME 1JI2A 3IDXL 3IAGC 4IIQC 3VFSA 3JV6A 5T5FH 3BUYB 3C9NB 4G6AC 1T4KB 5DLML 4C83B 1A1MB 2FO4B 5JOEA 2VRAA 2R23A 4XCNB 2AVGA 5FYJL 4DK6A 5HY9B 2ZG1A 4QOKB 4C58B 2YD1A 4KK5D 5JO5B 1T6WA 2NY0B 3IDMB 1UA6H 3IETB 5ITBL 2P8MA 5IW1B 3VWKB 3D2UA 2PKDA 4OQ1A 3QEHB 1RJZA 2F58L 1IKFL 1OP5H 4ODWA 5FO7A 4K9EC 2C1OA 3STZA 3MRMA 3BDYH 2JJSC 4PJ9C 2NYYD 3VXUA 5E8NA 4C59B 5ABDE 1EGJA 1JGDA 4FMFA 1I3VA 4HK0B 2EIZA 3HE7C 3IXAB 5AWNH 5MHSD 3QNZA 4JDTH 3ULVE 4XP5H 1DUYA 2D03L 3ILQC 3V4PH 2V5MA 5GRUL 4Y5YC 2J8UA 3VFGL 3IDIB 5EC2A 1LO2L 4ONGH 3QWRA 1OT1A 5ICYA 2E27H 1WK0A 4UU9B 3VDBA 4EZMA 1J1PL 1N3NA 1U3ZA 4XVTL 2AJZA 3FRPA 5DQ9A 4YXLL 1E4XH 3L1OL 3ZTJG 1GJIA 2EXWD 4MXQC 1EEZB 1PQZB 3QHZH 4JHWL 4ZNEE 5DD0L 5JOPE 1MFBL 4PJDA 3WS6A 2ATKB 2J6EL 25C8H 5JMRA 3VFWB 1L4IA 4PJIB 2B2XL 5DTFB 3JWOC 2GT9A 1IT9H 3JTTA 3WKML 4BZ2L 4K2UH 3LS5L 5HHOE 1T20A 1WAAE 2K1MA 3KNBA 3FQNB 4K8RL 4LQ1A 4XAKE 1WF5A 4IHOB 3RWGB 2F5AH 1OF2B 2P8PB 4ODBD 3UTSA 4XNUL 1F6LL 4OM1L 4Y1AA 1C1EH 4JO1L 4P2OD 3PL6A 4KTDH 1W72B 2Q1EA 2E7LC 2X4RA 4ZSOB 3RVXC 4NFDA 1F8TH 5GZOC 4KHXL 4GFTB 5D93B 2YPLD 1H3XA 2GTZB 3DJ9A 4NQCB 5D96B 5GZNC 4J3UA 2BSTB 1NBZB 1NAMB 3BUYA 3C9NA 3DVIA 2V17L 4MLSA 5DHVH 2C3HA 4Y19A 5GGVH 1A1MA 2FO4A 3HFMH 1F4YL 3QDGD 2DKSA 2NXZB 4XCNA 3DSFH 5HY9A 1HH9B 4PJCE 4QOKA 3ARDB 5D1ZD 2R0WH 4NUGL 3PABA 1T89C 4LSSH 2X6MA 3VWKA 3F12A 4MJ6B 3MODH 4ERSL 3QNXB 3HAEA 3KWWA 2OL3A 4P23B 2PYFB 3WXWL 2C4XA 3ZMRA 3NAAL 3BDXA 4TSAL 5DC0A 1U36A 4XPAH 5F7WC 1NCBL 3BQUB 3NTCH 3NCJH 4QY8B 2CRIA 1MIML 15C8H 2EIBA 4OIBA 4F15B 1BGXL 2Y5EA 1VESA 3BAEL 3GSRA 1M1SA 3O2DH 4HK0A 5EBMA 1SVCP 1TJIH 1AO7E 3OKKB 2EDFA 3BYTA 1ACYH 3U82B 2DQDL 3TO4D 1RK1A 4NKIH 4MWFB 4CVZA 4NGHH 4CVXB 3IDIA 3QI9D 3G6JE 4Y5VB 1EPFA 2XV6B 3AM8C 3R06B 5C3LD 1QFWH 3BJ91 4ZFFB 4UU9A 5HD8D 1P4LB 1VEMA 2X4UB 4PRID 3U4BL 5HYFA 1T03H 1JGEB 1FFPB 4QXUH 1TLKA 4U0RB 3UTOA 3I84A 4FZEH 4H20L 1S7QB 4WEBH 4HCRH 1EEZA 1PQZA 3DYMA 3MCLL 5D1QB 4RFNB 1D5ZA 1MHCB 3N0PB 2ATKA 1ZLSH 2ZPKL 1R24B 3Q6GH 1S7TB 4RFEB 5JIKA 3VFWA 5DTFA 3WUWG 4PRNB 3TNMB 5DJXA 1D9KB 2X4OA 3FQNA 3MNWB 3TFKD 4XWOC 4MD0B 2P45B 5A16B 3VXSE 1HHJB 5AZ2H 1OF2A 2R69H 4ODXB 4Q9RL 3UC0H 1CQKA 4PP2B 1ADQH 1JUFB 3CH8A 1W72A 1TQCB 3E2HB 3EYOB 3SCMD 2WP3T 4NC2B 4FP8L 5J56B 4F9PC 1CU4H 3WN5A 4NQCA 3FQRB 1FC2D 2BSTA 1NBZA 3P0VL 4WUUB 3ARFD 1NAMA 4XVJL 4I4WA 3RTQC 4C54A 5L88L 1PBYA 3QEQE 1BQUA 2R2CA 4U7KA 5FHBH 1HH9A 3WO3B 3UTPD 1UH4A 2JB5H 1QNZL 1EJOH 4D9LH 3DUUA 3QNXA 4HIXH 5KG9B 4P23A 3B9VA 1WZMA 1XCQA 4H1LH 1L0XA 3D0LB 1IGML 5EZIL 3RKPA 4M62H 3BQUA 4GAYB 5ADPL 1A1NA 3ZKND 3EDDA 4QRSB 4QY8A 2KBGA 4HUUB 3VH8G 3BW9B 3NCEB 5JPNB 3CFDB 2Y9RT 3GRWA 4JREC 2D7TH 3OKKA 5DHVA 1KCLA 5D7LB 1KF9B 1VADB 4Y5VA 1QRND 4IDJH 1U3HC 2VLME 5BW7A 2V5SA 1P4LA 2X4UA 1FFPA 4LCIL 3QH3B 2C1PB 1UADC 1S7QA 3S98A 2J5LC 1L7TL 3BZDA 4PJBE 4LCUB 1MHCA 1CLZL 1K3IA 1R24A 2YA2A 3MC0A 1RZGA 3ARYA 1E28B 1X7QA 3TNMA 4NQDD 3CDGB 2H2PD 5J9PA 1HK6A 4K3DL 5CZKA 5CJXC 2W9DH 4GMTH 4Y4KB 5SWQB 4LQFL 1SVZA 3S88H 2VDOH 1PG7L 2F53D 3M45A 3VD4A 5A16A 5F1IA 1RPQA 2P42B 4YHLL 3BGMB 4ODXA 4OJFH 2XQYG 4PP2A 5GGRB 4XXCA 3FO9B 4XPHL 3F7RA 1RHHA 4LLWB 4KZEH 3CFJA 1BQLH 4GO6B 2Y72A 1M7XA 2PXYB 5EWIH 3RZCC 3RDTC 4WU5B 4XCEB 5K9KA 3I2CL 4CU8A 1C16B 3I6GB 5KS9E 2HN7B 3VG9C 2VZ3A 3K2UH 4GS7C 3IDJA 3L5HA 4RX4D 3RZWA 3QQ4B 4WUUA 1I3UA 5F72S 3GBNH 1RZ8A 1T1XA 4YJZL 4E0RB 5I15L 3F58L 5F1NB 3PHOB 1G9NH 2VL5B 4TN9A 4FTVB 4N5ED 4FQJL 5EO1A 2CUIA 2PW2B 5JMOC 1JPFB 4PJ7E 4NZRH 4PJXF 1NCCH 1AJ7H 5C0RL 2JELH 3HZYB 1M05B 5ANMB 4M5YL 4PJ8C 4XNYL 5KG9A 1CD9B 2P4AB 1XGRA 1SBSH 4GRWB 4XI5D 5D7KD 1QR4A 1M4KA 4XPFH 3D0LA 4YHMH 1K6QH 3VFPB 4GAYA 5BV7H 4N68A 1XCTA 4HUUA 1SBBA 1YQVH 3BW9A 2H41A 5JPNA 2E6JA 1F4XL 3IS0X 1NMBL 5B39G 4FN0A 3K81A 1CN4A 5D7LA 3A6BH 5F7DA 1VADA 1IEAB 2VQ1B 3C6LC 1RURH 1ZA3B 2WBJA 4J7RA 3KYNB 3D69B 4APQD 5DFTA 3N1FC 4JVWA 3MRKB 1KN2L 3V6FB 3RY6A 3PP3H 3RL2A 4GUPB 3QH3A 4ZFOB 1P6AB 1OY3B 2M1KA 3ARED 4YH6A 1OP3H 4HKJA 3IJSA 2BVUA 3N85H 2FL5B 1PFCA 1OTTD 2VWEC 4JG1H 1E28A 4HX1A 1MAML 1PKQE 2ITDA 4OCXH 3CDGA 1KCSH 3NCMA 2X4PB 1AXTL 4NHUB 1I1AA 4Y4KA 5SWQA 5FYKD 5HYIA 3BKYL 4OLXH 3LS4H 4HH9B 4X6DE 4M4PA 5IOPB 2ESVD 3BGMA 2PTTB 2E7BA 5GGRA 4LIQL 3FO9A 5JW4N 3STBA 5F7MC 3EO0B 3NIDE 3E8UH 4KJQC 3VGDA 4L4TD 5I16B 2ICCA 1U8IA 1QZ1A 5EU7C 3QBTB 4B50A 1OB1B 3FZUD 2BNRB 2VAJA 4U33A 4WU5A 4XCEA 1F3RB 5F9WB 3I6GA 5ESAA 4YDLB 4JG0L 3QQ4A 4ELKA 5JPMB 5E08H 2YK1H 3JXAA 1A14L 1JZ4A 2A6KB 4YDKL 4E0RA 4JFHD 3GI8L 5F1NA 3PHOA 3G9VA 3SE8H 4UT7H 3CDYA 5H37G 4HIHB 4XAWH 4XB7A 4XNZB 2DQFB 5DD1L 1TTGA 4TPRH 4R9HA 1OQXA 1JPFA 2EZ0C 1G9ML 4EKXA 2IH3B 3HZYA 1M05A 5ANMA 3QQNA 5FYKU 3ISWA 1MI5D 5HPMB 4LMQI 5AZEH 1OAXH 3UJTH 3VJ6B 4GRLD 3VFPA 4PJAF 3VGHA 5D5MA 1RIUH 2DOCA 3C87A 2W9EL 1RJLA 1INEH 4E41E 1BJMA 1IEBB 1N0LA 4ZS6C 2O5ZH 5EORH 4LVNC 3ZL4L 3H3PH 4D0CB 4KHTL 3KLHC 3ZDYF 1KEMH 4PBXA 2XWBB 2N7AA 1IEAA 2VQ1A 5F3HA 1S7RB 1ZA3A 3KYNA 3D69A 1I9RL 2DQCH 1U8HB 3MRKA 5J13C 5L8JB 1ZT1B 2RCSL 5HDBE 1OWWA 3V6FA 2WUCH 3ARGA 1JGUL 4CDHA 4GUPA 4MS8D 1N7ML 4ZFOA 5K59E 3HNTL 3CVHL 3QG7H 4TSBH 4KY1L 2Z92B 2YA0A 3OAUH 5F70A 1X5KA 3BIKB 2FL5A 1DL7L 1HZHL 1I1CA 3DVFA 1HQRB 3LRHA 1INDH 2HRPL 4TUKL 4HFWB 1FGVH 4YXKL 3RI5K 4NHUA 4WO4B 4QHUB 5DMIH 5H35B 1NDGB 4JFEE 4NM4L 4HH9A 4RMQA 5JW3L 3K46A 2X70A 4R2GC 5IOPA 2B4CC 3BYYA 5EOTB 1YY8B 5AD0B 1J1OL 2PTTA 1QKZH 1BMGA 4X5WB 3GMQB 2J7LA 1B2WH 3EO0A 5I0ZA 3D5OF 1A6PA 4HS8H 3ALPA 5T1LB 1I85A 4YO0B 3C2AL 2ICWJ 2BNRA 4Q9QL 3G9AB 5IK3B 1JFQL 5C0GB 4M7KH 2ZSVB 1F00I 2VLRD 1KC5H 4RAVB 5IROC 1KFAH 5CUSH 1FDLL 1NC2B 2A6KA 2Q3AA 4MA1C 1RUML 4XVUD 4WFGD 1BJ1J 4HIHA 1XF3B 2LV4A 4IDLA 3RVUC 3MOAH 3RWEB 4XP4H 2IH3A 1G6RH 5FDYA 1ZLUH 3QFDA 1ZHBB 4LSPH 1J8HE 2IANB 4NM8L 3CPLA 4G9FE 5HPMA 3VJ6A 1CD1B 2QQNL 4KU1A 5FB8B 4KAQH 4M93B 1RUQL 3UYOD 2FBJL 1T6VN 3FFCE 9CGTA 1Z9SA 1CIUA 1K5NA 4KGJA 3L3DB 4S1RL 1G1YA 2OM5A 1YEHL 4YAQA 2CLVB 4Z7OE 4Y2DA 4J3OC 3Q5TA 4D0CA 5HDOA 3CUPB 1BP3B 1PY4A 2I5YL 2WINB 4HAFA 2F5BL 3ZKXC 4OZHB 4NWUL 5HHOD 2CKBA 2XWBA 1S7RA 4HQQL 1UZ8B 3D39E 3ES6B 1U8HA 4LSVL 5HGGS 3TC9A 3QAZB 4Y16D 1ZT1A 3QCUH 3CSYB 3RX5A 4NKDA 1GAFH 3TN0B 4HWEL 1WFOA 4GAGL 3NFPA 4AEEA 4N90D 4I13B 2BJMH 2IEPA 4RGOH 3BIKA 2F19H 1S8DB 1MFNA 2MMXA 3AS0A 5DMYA 4M6NH 3BRFA 4LPCA 1D5BB 2Q8BL 4WO4A 4QHUA 2EEDA 1NDGA 3S35L 1MFEH 3TT1H 1N6UA 3MNZB 5MP6H 1CFQB 2ARJB 43CAB 4NFBA 4NJAH 1NBYB 1HXYA 5AD0A 5HYSB 5CLTA 5FA4B 3D85D 3GMQA 4MCYB 4IMKA 4WGVB 2LQRA 5DFVC 3GBLA 4P2QB 5I18L 1MAJA 5T1LA 3MQIA 4YO0A 3KJ4B 3L9RB 4I2XE 4PJFB 4JQIH 1GGCH 1OAZL 4UIMB 5ACZB 1JVKA 3PXJA 1DTUA 4XMKH 3ZTNL 5C0GA 2ZSVA 3HMWL 3T2QA 4GBXB 4RAVA 3Q1SH 3ZT6A 2AK1L 1RZIB 3C08H 3JUZA 2ICWI 4JQXA 4RA0C 2HA1A 2CRZA 2BNUB 3HZMB 4GXVH 5IFAL 3K2MC 4JEGB 1XF3A 3QXAB 1JPTH 2BNQE 2XTJE 5DJYB 1TDQA 1HOCB 1U58B 5IEKB 4MB4A 3RPIB 1CLYH 4OB5L 2IANA 4XPGH 5IMOA 4Z7NE 1GRWA 1YN7A 1YY9D 5DJ6A 4MNQB 3S37L 2NLJB 1CD1A 2IG2H 1EHXA 5DMGD 4J2XA 2FX7L 5FB8A 2HLAA 4I9WE 1J0KA 4OLYH 1FNGA 4HZLB 5EU6B 4HSQA 4NQVA 1FFOB 3WS6C 1MJUH 1NCAL 4CADB 3FQXB 4AQOA 4AZ8A 5GGSY 1KEGH 2OR8A 4ONFH 4XPTH 2CLVA 2L7UA 3VFVB 5HGHB 4WIQA 4HKZA 4LF3A 5ADOH 4OZHA 4KVCL 3N1QC 1LO0H 4YBQD 1UT9A 1CLOH 2IMNA 1UZ8A 4LGSB 3SY0B 1WZ1H 4G6AD 3VXSD 3ES6A 3JSSA 4PB0H 1AHWB 3W82A 4AMKL 1MLBA 1FAIL 3CSYA 2BMKB 3TN0A 5BQ7A 1EO7A 1DCLA 5TDOB 1S3KL 2JJTC 3PL6C 4D0BB 4AEIL 3M8OL 4KVNL 5I1EL 3QEGH 1BVZA 1FZOB 3G6DL 3CDFA 1IM9D 3OAYH 3QIUB 4V2BA 3RWCA 1NCDH 1NDMB 3H9SB 4FQQB 2BRQA 3C8HA 3KR3L 3X17A 2FH6A 1U95B 1GVIA 3IDXH 1EHAA 3QUML 3MNZA 1DDHA 5DT1H 3UZQA 1CFQA 2ARJA 43CAA 4ZO9A 2F54B 5IBUB 3T08A 1NBYA 3EYUL 1KUMA 5HYSA 2VZTA 3KHQA 3HE7D 2NY0C 1KCVL 3WIIL 4MCYA 3S4SB 3ZE0E 1J12A 4Q9CA 4L8CB 3ILQD 3ZE2F 5ITBH 3LIZL 4P2QA 3UTTD 3VWKC 1OSPL 4D0DB 2FEDC 4JRYE 3P0GB 2F58H 3L9RA 4PJFA 4ONOA 3LQMA 4UIMA 3BWAA 5ACZA 3SOBL 1CIDA 1X5FA 4OF8A 2KQMA 5IB5B 4GBXA 1OTUC 3CX2A 5C0IA 4N8VG 1VSCA 1LDPL 1YEKH 5DJ0B 4MXQD 1Y6MR 5BJTB 2NPLX 2BNUA 3D0VB 4CN1A 4NT6B 5B4MC 3MA7B 1I7ZB 1BF2A 3EAKA 3WFZA 3QXAA 3SDAB 1FJ1A 1UM4H 2D03H 2XRAH 5GRUH 4J12A 3IFNL 4DZ8A 3HHRB 5CSGA 1LO2H 2YC1B 2W0KA 5B22A 1T5WB 2EE6A 3WIFB 4MNQA 4LHUB 4MZ2A 2NLJA 4XVTH 4KPHL 1HWGB 1YJDC 2BVPB 3R0NA 1DVFA 1YMME 5C0DA 1FRGL 3UJJL 5ESVA 5DK3A 1DR9A 2IPTH 1MFBH 4CADA 3FQXA 4WFED 2J6EH 3HB3C 4KXZH 1HH6B 3VFVA 3RVXD 5HGHA 2B2XH 4JM2F 3N50A 4UV7L 3WKNA 4U2YA 2QTEA 1Q38A 3WKMH 5A1AA 3VFNA 4BZ2H 5TJWK 5SV4A 2VLJE 5GZND 3SGEI 3ZZ1A 1QA9B 3ULVL 4H25A 5EU4B 2OXHA 5DFWH 4XNUH 5KVGH 4OM1H 4OCYH 1ZEAH 5TDOA 3LZFH 4D0BA 3LKSB 5TPWL 2EDLA 4K94L 2XIDA 4UOJA 1FNSL 3GGWA 1FZOA 3VGEA 4PGBB 4TTDC 4KHXH 5D93C 4AIXA 1ZVSA 3U0PB 3LRSB 4FQQA 3WN5C 2YD5A 5D96C 1W8OA 1U95A 4EJ1C 3I9GL 2DYPA 5CZXC 2V17H 5T3ZD 4G9DB 4HUWA 2F54A 2PYEB 3DSNA 5DXWA 1F4YH 3I3EA 1MFCL 4KI5E 2QHLA 4QXGL 3K8KA 3V52H 3MJGX 3S36L 3ARDC 5K33A 2GY7B 3RAJL 2NCMA 3GSOA 3S4SA 1LO3L 2GJZB 1U93B 4NUGH 5DURD 4FABL 4D0DA 1MCOL 1WWAX 2XZQH 4P23C 4ERSH 4Z0XA 3OR6B 2C3XA 3U4EB 3BPNB 3S96A 2R4SL 5I1KL 2R0KL 1FLRL 4P5TA 1VGKB 5IB5A 3BQUC 5KJRL 1NCBH 1BM3L 5JZ7C 5DJ0A 2XA8H 1MIMH 5BJTA 2DJUA 3MLXL 1BGXH 4JY5H 2HFFA 3BAEH 4NT6A 2X4QB 3HS0B 3MA7A 4F37K 3CLFL 1I7ZA 3RFZC 2IWGA 1XH3A 3WIHL 4DEPC 2LU4A 1KYOJ 1MEXL 2CUHA 4DKEH 5F96L 1IILE 4Y5VC 3BEWB 1GGYA 3RIAF 2JCCB 3SDXE 4ELME 1ZWIB 3L5WA 5BW7C 4LOUD 3PP4L 4K7FB 4UQ2B 3U79A 3WIFA 3P0YL 4LHUA 1BQSA 3U4BH 3FO2B 1MQKH 4U0RC 2BVPA 2VITB 3G6AB 4MSWB 1EHLL 1T0PB 4H20H 3T0EB 3MCLH 3QDAA 4MAYA 4FZ8L 2PW1B 1HI6B 1A7OL 1PDKA 3PDOB 3NPZB 1HH6A 1R3HB 4NQXB 3VWJB 4K3JL 3P40A 5MEQA 4PS4L 3QQ3A 3F7VA 2DQHL 2FECI 4CMMB 1D5XB 4G8GD 1JZ5A 4OV5B 1QA9A 4C56B 3RTQD 1VFMA 1IFHL 3ZYJA 3EFDH 5D8JL 1NGPH 4XXCC 2ADIA 1AGFB 1FP5A 3RU8L 4OT1L 3LKSA 1MAKA 4HUVB 4M48L 4I3SL 3IKCB 4X8XA 4WGWB 3MBEA 5IMKB 2ZCHH 4PGBA 4O2FB 4C55A 4F58L 3ELAT 5BRZD 5EOCJ 4FP8H 1NCTA 3FB7B 1XIWB 4U1GB 3FB5B 1UWXH 4U1IA 2C5DC 3RWJB 3P0VH 1WEJL 5HJ3B 5L88H 1U8KB 3NZ8B 1MIEL 3FN0L 2PYEA 3SEPA 5EIIB 4KGLA 3STLB 4GKNB 1F42A 4A2LA 2DLGA 4LLYB 1K2DA 3OHXB 2HKHH 2GJZA 2IFFL 3DRQB 1FCGA 1U93A 3U9UA 3TA3A 4OFKA 1FFRA 4LPYA 1KIUA 5L2KB 1G7IA 3OR6A 1OGAB 2V7NA 3U4EA 1U3HD 2BXYA 3EO1B 1IGMH 3U7AA 4PR5B 3DECA 5ADPH 2X41A 1PLGL 5E5MB 2BFVH 5HI3D 2ARJQ 3L7FB 3S5LB 3VRIB 4K9EL 1A6VH 3BPLB 5I1IL 1MCLA 1R6VA 4PJAB 4ODVL 3HS0A 2D9CA 3DVNB 3KPRE 4GH7B 4UV4H 3ZDXF 2BOCB 3SJVB 5HHMB 4PJIE 2H8PB 5DZLA 2OX5A 1L9MA 5C2BL 4NQED 1M7IB 1GIGL 3BEWA 3NIFF 5FIEA 3BPCB 1ZWIA 1P7QB 4ZXBD 1J0YA 4K7FA 3RY6C 4MJIB 4CW1A 5F93C 3FO2A 3VGFA 2VITA 3G6AA 4W6YB 4MSWA 2OMBA 3UJIL 1UKQA 3T0EA 5GS0L 1L7TH 1UACH 3S7GA 3V5DB 1CLZH 2PW1A 1HI6A 3PDOA 1UZ6F 2BY1A 4ZSOE 3MJ9H 4P4RA 4PJ5E 4RWYH 5KAQG 2YD4A 2NR6C 1R3HA 3RZCD 3G08B 3VWJA 3ZO0A 1IKNA 3RDTD 2ZUYA 5E8DL 3R8QA 1I1AC 5C0FB 4QCIB 4Y4KC 3UBXB 3LKOA 4LQFH 1PG7H 1FL3A 3FT4A 4YHLH 3JWOL 1ULVA 4W6XB 4ZODA 2VUOA 3B9AA 3RWIB 4PGJA 2AV1B 2A83A 3NN8A 4OI9A 5L9DH 4XPHH 3LEVH 4NKQB 4HUVA 1Q72L 1PX3A 2GK0B 3GIZL 2AK4E 3MNVA 4X4YA 3K1DA 2R2HB 5FUOL 1G7MB 1A7NH 2ITCA 5IMKA 4PJ8D 4O2FA 1MCKA 3I2CH 5DK0B 1ZGLB 2D3VA 3FB7A 1OCWH 1QBLL 1XIWA 3DVGA 4BM7A 3RWJA 3NACL 3THMH 4YR6A 2AEPL 4PD4J 1UWEL 3NZ8A 5F8RC 5I15H 1BIIB 3F58H 1K4CA 5FXCH 4JFOB 1DSFH 4GKNA 4X5XA 2HFEB 4FQJH 3LPGA 3NBNA 2Y07L 3WLWC 4ZFGL 3OHXA 3ARSA 3QDMA 1QEWB 1TNMA 3C6LD 4M5YH 4XNYH 4RZCA 3MSPA 1CT8B 1YQ2A 5IT2L 4HC1H 1S9VB 4PR5A 1X5JA 1AGDB 2ZWLT 1MRFL 4QRPB 4YFLF 4QTIL 3V7MA 3BKML 3L7FA 3VRIA 3WNPA 1KCRH 4N0UE 4XNXL 1YC7A 4OF3A 1S7SB 1F4XH 1NMBH 3DVNA 1I9JH 4F7CB 2BOCA 4UT6L 3SJVA 1KTKE 2H8PA 1KB5H 5DUBB 5T3ZL 1G9NC 2G60L 1JWMA 4GLRI 2V2XB 4HWBL 4NCC2 4UQ3B 4BK5A 4ETYA 5FUCC 4HBQA 4HXAL 3IJHB 1P7QA 3SBWA 2Y36L 1FC1A 3ARGC 4P99A 1CBVL 4MJIA 1QP1A 3T2PA 5ICXB 2QLVB 5DJ2B 4L3CB 3BH8B 2WBWB 4JE4B 1ES0B 2YSSB 3IDGB 4LNRB 2X9YA 4HUMB 3VI3E 5DGRA 4GG6F 3SE9L 4ZO7A 4KJQD 5HHPB 2GCYB 5IMMB 1MAMH 3G08A 4L3ED 2X4TB 4FFZH 1AXTH 2CIKA 5C0FA 4PJCF 4QCIA 2NY6B 3PE9A 4TOYL 3AAZA 3BKYH 1EEYA 3KG5A 2H3NB 1GZPA 3CFCL 2CDFB 5FKPA 3E0GA 4MQTB 3QWOA 3G5VA 3VI4E 5JHDD 5GSVB 3H3BC 2APVA 4MMXC 4MA8L 2R2HA 1I85C 2EZ0D 2FWOB 3T3PE 3H7LA 1U8QB 5J6GB 5F9WC 4GSDL 3FT2A 1D5IL 4TVSa 4YDLC 5DK0A 2OLDA 2FECL 2DWDB 5JDSA 2W59A 1K9TA 1OAKL 3MV9D 4ZMAT 4FRWA 1DQQA 1TIUA 5H8DA 3QQ9D 4YDKH 3GI8H 2NY3B 3OF6D 1CXKA 1H15A 4JFOA 4DFHA 4ZS6D 4NC0B 2XTJD 3MZGB 3T77B 1QEWA 4PJGB 4W4NA 3RWDB 4Z95L 1CT8A 2XPGA 4QO1A 3ZTJH 3EHBC 3HC4L 1KULA 5J0BA 3PWVB 4PFEA 3GFUA 1A47A 1KSRA 2X89A 2EDQA 1T5XB 4Y2DC 1S7SA 5FGRA 3C5JB 5C0CD 4A2MA 4L4VE 5E2TL 5C86A 3X11B 1A6WL 4MDIA 4MXWL 5IEHB 1OOAA 4JAMB 4UQ3A 3GSWB 1KB9J 4WTZA 3Q48A 3VU2A 5GGVY 1I9RH 3IJHA 2LVEA 1H0DB 4R2GD 5ICXA 4QT5A 4V1DD 4L3CA 3BH8A 4NKOA 3QZWA 1TETH 1QSEE 1N7MH 1ES0A 2YSSA 3CVHH 3IDGA 4LNRA 5CJ8A 2W38A 4KY1H 1G1CA 2Q20A 5DVOA 1UG9A 4RDQG 1CGSL 3T1FA 4L8SA 1LDSA 1DL7H 2VLKD 1JNJA 1IAMA 3FRPG 1G7JB 2YPLA 1J86A 2X4TA 3NA4A 1XGYL 2Z31A 5SWZD 4Z6AT 3U0WL 4WO4C 5EU3B 4YXKH 2IPUK 2IBZX 2VDNL 3SDDB 2X09A 4JFFD 4XWGH 5JW3H 3MREA 1VEPA 2R56L 4QRRB 1P4BH 3GSXB 4U6HA 5KSBF 3VW3L 1J1OH 3WYRA 5I71B 1KTRL 2A6DA 4P2RB 3QEUA 5EUKB 5D1ZA 4IMKC 4UILL 3BZ4A 4OGZA 5KW9H 5E24E 1FO0H 2UWEB 3RVUD 3SGJA 3HG1E 1LO4L 3C2AH 1U8QA 3O6KL 1VACB 1BOYA 1JFQH 4WW2A 2DWDA 1PD6A 4OLZL 4A6YL 2WLZA 4Z8FL 4U6XB 4JQXC 1H3VA 5BS0B 3RGHA 4Y0GA 1PKOA 1I8MB 2GUOB 1CGTA 1RUMH 3SKMA 5JXAH 1UXSB 4GW4B 1TVBB 1EK3A 2GY5A 2DBJA 2C3WA 5JA8B 4KKBC 1Z3GL 1FG2B 3QI9A 3T77A 2JTDA 1VEOA 2NX5E 1IRAY 4PJGA 4MDJB 4RNRA 1UB5B 3RWDA 4NM8H 4PRIA 4HIIB 3T2OA 1XFPA 1MSPA 1P84J 2J88L 2QQNH 4GRMB 4LPVA 4URTB 5D7IA 2YR3A 1RUQH 3KPQA 2FBJH 3RKDC 4ETQA 3HAEG 4LASL 4BQ8A 4Q0XL 4FQLH 1YEHH 1T5XA 3R8BB 4O2EB 3MRFB 2HAZA 1LEIA 5C0NC 4R4FH 4XNQA 2I5YH 4RMVA 2F5BH 1EZVX 3X11A 5EDXA 2F74B 2VXTL 4MA7L 1CFSB 1CI5A 5IEHA 4JAMA 2AEQL 3GSWA 4YBLB 5KN5B 1PY9A 4HQQH 2OJEB 1RV6X 3QAZC 1H0DA 4OFYA 4V2CB 4JM2B 4LSVH 3TBSB 2VKXA 3TN0C 1V3LA 3QNYB 2D9QB 4QHMB 4HWEH 4GAGH 4HPOH 1KG0A 3CD4A 3JV4A 4X98B 4JRXB 3ESVF 2EDHA 4M4RA 2VUYA 3DROA 5DFVD 2DD8L 3D2UD 1IAIL 4BQ6A 2DLEA 2B1AL 4HKXB 4OI8A 5EU3A 2D0HA 1NGQL 1ORQA 3TH4T 2Q8BH 3VXUD 3S35H 2EE9A 1AGCB 3FFDB 4PJEB 4PJHF 2NY5H 2RHEA 4OF0A 4QRRA 5ITFB 3GSXA 4M7LT 2YD7A 1OHQA 3VG0L 4P2RA 4BSJA 1DBJH 5EUKA 5TFSH 2OR7A 3GUTB 1V3KA 1EERB 2V9QA 3HI6L 2A73A 2UWEA 2FJGB 1TZIB 3QWRD 4OZGF 4XCCH 1UYWL 1VACA 3C8KB 4JJ5B 5I8OL 3QUZD 5BMFH 5IMLA 4GBXC 2DIBA 4ZTOL 1ONQB 3HMWH 4O02L 4Z7QF 4Z7VB 1ZT7B 5DYOB 2FIRT 1T7XA 2RBLA 3F7YB 4U6XA 4Y4HB 5BS0A 1FIEA 3IDNA 1JNLL 4PUBL 4LFHG 1I8MA 2GUOA 2BHUA 1D6VL 2COQA 1UXSA 5EFIB 1BZ9A 2BERA 5FYKH 2E9JA 4DKFH 4NN5B 2NXYC 3IRZA 4B5EA 2CSPA 4POUB 3ORJA 2KZ1B 3OJ2C 4B7IA 3OSKA 3FN3A 4MDJA 1A9EA 3WFEL 1UB5A 2BVYA 5LQBL 1LP9B 3ULUC 1I9IL 2IPKB 4OB5H 4NPYA 4NSKA 3S37H 3C5ZB 3UTSD 4GRMA 1DVFC 3GJFH 4RMSA 4U3XA 1CFVL 2FX7H 1X4ZA 1VGEH 3LMJH 2EYSA 4R4NC 3PL6D 5FHAL 4S1SH 5E2VL 2WK2A 2PTUA 3HI1B 3GNML 2M8XA 4UDTB 5DC9B 5GSRB 3BFOA 3BHBB 4ZTPH 4O2EA 3MRFA 4OLVH 4ZDHB 5ERWB 3QDJB 3MGTB 3IJYB 3MCKB 4NRXA 2P49B 3RX8A 4DKAA 4P9HC 4KVCH 2F74A 1CFSA 1EMTL 4W68A 5KN5A 1Q0YL 5HHQB 2OJEA 4M6ML 3LKNB 5CGYD 3NIGF 2GK2A 1NEZA 4KKAC 1BOGB 1JV5B 4N9GB 1FAIH 3FL7A 4UT9L 3LCYA 3BPOB 1BLNB 2FEEI 4QHMA 4WNQB 3S8WA 1S3KH 4QOKD 4X98A 4AEIH 4JRXA 2NY0D 4YHIB 1QTYT 2GAZA 3K80A 3M8OH 4KVNH 5I1EH 2H2SC 3L3GB 4K07A 2FHBA 3VWKD 3U30B 4RA3A 4XMPL 1HHGA 2FEDD 3X13A 4YHNA 5DHYB 3KR3H 3PWPB 5KBNC 3O4LE 1OTUD 2W9LA 5FECB 2C9AA 1AGCA 3FFDA 2DI7A 4PJEA 3V4VH 4KQ4H 2BC4B 4NNYB 2KUTA 3FT3B 5B4MD 5BZWA 3B83A 5EZLB 2B20A 2OQJB 4F7EB 2V2WB 2YD6A 2R29L 4DVBB 1OSPH 3HE6B 1FL5B 1FAKT 2I27N 5DVKA 3C8KA 4HWNA 4P5TC 3SOBH 4K7PH 1ONQA 4Z7VA 3EZ8A 1A3LL 4N1HB 1CD0A 4OZIE 3BP4B 3MLZL 3F7YA 4Y4HA 1LDPH 4F7MA 2JIXB 4EI6B 4O2CB 4F3FA 3W39B 3QIWB 3HB3D 5EFIA 3QUMB 4KDVA 5HDBF 1NFKA 2BDNH 3CJJA 1MCBA 4O5LH 1GPOL 3QJFB 1UXWB 4HGMA 4KMTH 1JTTA 3DXAE 4K23L 5C0AB 1HHHB 4APQA 5JUEL 1LP9A 5HBBA 3GHBH 4QXTB 3LDBB 4XHQA 4KPHH 2A6IB 4MYWB 5DMJB 1TTFA 1FRGH 1FCCA 3UXFA 1JK8A 4MB3A 1EXUB 4WHYG 3X3FL 4MAYC 3HI1A 4UDTA 3SQBA 1J5OL 1XR9B 1DQJB 1JHLH 1ZTXL 2AJVL 4BK4A 3TCXA 4KKCC 2QSQA 2R1XA 4ZDHA 5ERWA 3D3VB 2WQRA 4TTDD 4UV7H 3IJYA 3OG4B 3VXMB 3MLRH 4NQCD 1VPOL 1ZT4B 1YC8A 2A9ML 5HHQA 4NN6C 2ICES 2ZKHH 3KLAA 5GRYA 3LKNA 1DQLH 2DL2A