3MLVL

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
YLLTQPPSVSVSPGQTASISCSGDKLDDKYVSWYYQRPGQSPVLLMYQDFKRPSGIPERLSGSKSGKTATLTISGTQSLDEGDYYCQAWDASTGVSGGGTKLTVLFGEGTRLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvL01
1OWRM 2VTFA 2FCBA 4CDGC 3MLYL 4K7PY 4BUHA 1UB5B 5FO9A 4OCWL 4NKIL 2GUOA 2RGSA 4OI9A 3AB0B 1AR1C 3DURA 3ARBB 5C0BB 4HJJL 4YDVA 3QDJA 4GG6B 5HYEA 5C92A 4PV9B 1KCRL 4JB9L 1VPOL 1JNLH 1RK0A 5IMLA 1S7UA 3HPJA 4LCIH 4MHHI 3T4YA 1FORH 3SGDH 3L3GA 3CDFA 1B0RB 4DQOH 3SKOB 2W9LA 3MLWL 3UTPE 2XA8L 5HVGB 5ERWB 4RFEB 4XBGB 4QRSA 5JOFA 2NR6C 1LE9A 4MQXC 3WCYA 3REWB 5MEPA 2VIRA 4OZIA 3DUHA 3GSVB 2HT2D 3TZVC 3LB6C 2LTQB 3BMWA 3LRSB 4QXGH 2XN9E 3EYVB 3L3IA 2BRRL 2BXZA 3P11L 1Z0NA 3O45B 2AI0H 4KTDH 3C60C 1H8SA 3GI9H 3PWNA 5BO1L 5C0JA 4PJ9D 5IB5B 1WBYB 3IDXL 4PJ7A 5ANMA 5IW1A 1EAJA 3TLRA 2OTUA 5F9WC 1W0WA 3KDMB 4NHUA 3MODH 3QWOB 5HXMA 5FKAA 3UTTD 2D3VA 1QRNE 1E6JH 4JO2H 4HXAL 5IR1B 4NN6B 3HB3D 4D94A 4XNUL 4BQ8A 2BC4A 2MTPA 1BVLA 4Q9CA 1FGVH 2WBJA 4HIIA 1TTGA 5DQ9B 3MGTA 1G9MH 1QSFD 1Y6MR 3OKEB 4KUZH 4LKCA 4NO5A 4Z9KB 1Q0YH 3WKML 4OLUH 4E9LA 2FYYB 1BJ1J 3V6OE 1BIHA 4K71B 5DRZA 4ZFFB 5JW4M 3EJYD 5AUMA 3BPNB 5EC2B 5C0AA 1FZOA 4XPFH 1BFVL 1FZJB 3O6FA 2VZOA 1XAUA 3QCUL 2VDQH 1MCNA 4RIRB 3ARGC 4ZTOL 3BUYA 4NKMA 2AS5M 5I1AB 5DK0B 5E9DE 3SOBL 3SDYL 2NMSA 1KCUL 4S10A 3MCG1 4YBLC 3FAWA 1A7NH 1U8IA 3ESVF 1YMMB 3HCVB 3JWOH 4PRID 3TH2T 3DX9A 1LE5A 4P5TD 1WSST 3O41A 3D0LA 4MNQE 1I3RB 1FHGA 4Y16A 3QA3B 4KHXL 1D5IH 1OP5H 1U8KA 4GBXA 5DMYA 1GC1H 4PJHB 4MCYA 5FYKH 3QB7C 5E2WH 2DLFL 3DUSB 4NM8H 2DTMH 2YHGA 1XT5A 2V2WB 5JZ7C 4NHCL 4KK5C 4CDHA 5FYKU 3BSZL 1NAMH 2AJYH 4HH9A 4PLKC 3VXSA 4BA8A 2MOVA 5D70H 3VRLE 3U36A 5CBAB 1NANH 2F54D 3WFEH 2JCCE 3SJVB 4G3YH 1K8IB 3KS0J 3PWPD 1T0NB 3ZLQC 3MRIA 4WNQA 5GRVK 1F4XH 4GLRH 4XVSH 2DICA 2VLJD 3HI5L 1BM3H 4JDVA 4OCNC 1W0VB 4L3CA 4XPGL 1VGEH 4YGAB 1J1OH 1YN6B 3DUUB 4H20H 4ZDHA 5BRZA 3T0EA 4PBXA 3FQUB 4OV5B 3VXNB 4Z76B 2GYSA 1AGFA 1KCSL 5C0CB 4ORGA 5SX4I 4MJIE 1E4XH 3NH7H 4EUPH 5F9JB 3VU2A 3DOSA 1J05B 1OWWA 2VYRE 2ZPKL 4DEPB 1I85A 5HYFA 1OSZB 1S7RB 2BSTA 4RNRA 4WCYL 4K3EL 3VXME 4HS3A 1QSVA 3EGSA 4Y5VC 3P77A 2C1PB 2J3SA 3MRCA 5BV7L 3KLAB 4LSUL 1F02I 4G6ML 3DXAD 4J1UA 4PRBA 5DD6B 3H9SB 1BX2B 3FONB 4NJAL 2ADGA 5DRWA 4FXKB 3HC4L 1VSCA 1IEAB 5FV1L 3PP4L 5AZEH 4OZGE 2XI9A 3IDIB 3RL2B 2Z92A 1L7IL 2HJFA 5GZNC 4PJCE 5C71A 4WWKD 4U6XB 2HVKA 2YPLE 1Q0XH 4KKCD 3W9EB 2EC9U 3U0PA 1OW0A 2JB5H 4XP9L 1ZHLB 2X4PA 4OCYL 3RWFA 3SKMA 5C0EA 3O9WD 3IDNB 3GUTB 1UXWB 3R0NA 3IJHA 4R0LA 2NY5C 4KQ4L 1OAXL 4EZMA 3IS1X 1H3XA 2VDKL 5DEZA 4F7MA 4ZMAT 3RGVC 2VWEC 1UG9A 3QCVL 4EKXA 2WMPA 3QT2A 3V0WH 5HYJA 2V5RA 1ZA3A 4OF7A 4NO3A 1AGBA 5CJXC 5EU3B 4OT1L 4JFPA 4LDEB 3QDHA 5LGKA 4IDJL 3N1QC 2BNRB 3VCLB 3S35L 3BKYL 4YXLH 5DJYB 2HH0H 2YC1B 3MJ9L 4OD1H 3THML 3QDMB 2VDML 3HMXH 5JPMA 4FZ8L 2C3XA 3FT3B 1LNUB 4EJ1C 4JFHD 1DQDH 3BKML 3GO1L 1NUNB 2X4RB 1CGXA 3LHPH 5SWZE 3UYRH 4F7TB 4KVCL 1QFUL 1H0DB 3CDCA 1BVKB 5DK2B 3NBNA 1RV6X 2KQMA 3MJ6A 1UACH 4JDTH 3T65B 2NTSP 5A2JH 4UZGA 3JWNC 4H25B 4NFDA 2A0LD 5J13B 4M62L 4JQVC 4ZUTB 4NNYA 3BZEA 5F89A 2H32B 2FJGB 3GMQB 3L3HA 4RBPH 1XGPB 4Y19B 3WNKA 1JF6A 4Z18A 2VNCA 1NQBA 1CIUA 4Y4KC 4PGDA 1RAMA 2DI9A 3IT8D 5IKCB 4X4ME 4YIQB 4OJFL 1F6LL 1F4YL 5HHOB 3CGTA 2DLTA 1HXMB 1JGDB 4X99B 5IROC 4Z7VF 5AWNL 5D1XC 2QJDA 1KIRB 1IILE 2D31A 1J0JA 2YEZB 3CNKA 1F58H 3BT2H 2DB8A 2BDNL 5E8PA 1X3DA 1DBJH 3IFOB 1OVZA 1SQ2N 1S7VA 1FZMB 2CKBH 2X70A 3DI2B 3WSQL 1N0XL 3O3DA 1SYVA 4D0CA 3S98A 1CFQB 5DYOB 5E03A 3OKNB 1ZEAH 2BNQB 3V0AC 1QSEA 2ATPB 2FIRT 2IQ9L 3W2DH 5HDLA 2HA1A 1J1XH 1H3PL 3FCTA 1P6FA 1ONQA 3QULB 1CIDA 3VDCA 2B1HH 4BZ2H 4KH2A 5KS9B 4YJZL 4Y1AE 5F7EL 4P2OD 1NCWL 1YEHL 4HZLB 1UJ3C 5D4QA 3S34H 3QG6A 3WMSA 3KS0H 3EOBA 4Z7UF 3VWJA 2H26A 3UPAA 5TDNA 4FQ2H 4LEXH 2QHRL 1J8HA 5C6PB 2HG5A 3DURB 3UTQA 4YDVB 2WAHA 3QDJB 4I0PD 4OLYH 4WIQA 2CR6A 4Y5YA 1RK0B 3X3FL 1JHKL 1WJ3A 1S7UB 2QR0A 5I75B 1G9EA 5C08D 4XPHL 2ICES 5FYKE 1BOGA 2QADB 5TH2B 1ZLSH 1NAKL 2YD3A 5F1IA 3QEQA 2HRPL 1IKNA 3OAYK 3L3GB 4KVNL 2V17H 3HE7D 3U7WL 1LK3L 5ISZE 2F15A 5I16A 1NMAH 2Y06H 5C0DA 5EIIA 4IOIB 1DVFA 5DVMA 4QRSB 5JOFB 5CINH 3VGHA 1LE9B 1CS6A 3TA3D 3E3QE 1CLZH 1R24A 5MEPB 4OZIB 3OJMB 3QQ4B 5BVJA 4L1HA 1FG9C 4OZHF 2FEDD 3AFLA 4FQIL 1F11A 4HDIA 1TTUA 1Q9LA 1T83A 1RIVH 4BQ9A 4L9DA 4RGOH 4N0YH 4QXUH 4HHAA 2ENSA 5FO7A 3L3IB 2ADFH 1PBYA 4L3ED 1W72A 5FGSA 5TQ0L 1K3IA 3D2UD 3U4AA 3VGBA 5J89A 1X4XA 4F15B 4XRCB 2VRAA 1NCTA 1HE7A 3V2AR 5C0JB 4PJ7B 2Q1EA 5GGSA 5D71L 2DWEA 3RNKA 2OTUB 4FFZL 1LD9B 3K8LA 4NHUB 3WYRA 1AXIB 5DJ0A 5GGTL 4PGCA 1FNSL 1CDCA 2G5BA 5CEXA 1Y18B 3TBVA 3LPGA 4HFUL 3ARBD 4HGKC 4IRJB 4TSBH 5C0BD 2BC4B 1BVLB 3DX6A 1S7QA 4HIIB 4J3TA 2NY4B 3QCTH 1TZIB 3WS3A 4ONHA 4NO5B 2EE2A 5KVEH 2J6EL 3PV7A 3U9PL 1MREH 1NGQH 5DRZB 5AUMB 3V4VL 1EH9A 1DL7L 4GT7A 2DQFA 3EOTL 5CP3A 5C0AB 1FZOB 4NUGL 3PJSB 1EX0A 2IGFH 3O6FB 4J7RA 2GSIB 2CR3A 5TGBB 3U9UA 5F96L 3BUYB 2Q76A 4HUXA 4NKMB 4YC2C 4WFHD 4EDWL 4JY6A 4POUB 2XY2A 1MCWM 4PY7A 3V5DA 1EERB 3MRQA 1U8IB 1TQBB 1KJMA 1NSNL 2FX9H 4MB4A 1V3LA 5CCKL 1LE5B 4KKLD 3F6IA 2IG2L 1WV7T 3O41B 3D0LB 1KIUA 3K74B 4MD0A 1TVDA 4B53A 4CNIB 2A38A 1KPRB 1U8KB 2VLMD 5I74B 5D2LF 4MCYB 2NY6C 4QRRE 4XC1L 3L3JA 4TVPH 4NQUA 1RZFL 3UTZB 5KJRL 3L9RA 3VXSB 2HT2C 4HH9B 4KXZH 4KZDH 5F9OH 3CCHB 4LAQL 3MFFA 2VSDA 1DQLH 2AXGA 1RD6A 1JRHL 2DBLL 1ADQA 3O2WH 2FSEA 1WFNA 5L0QB 5DHXB 3CMOH 4LPXA 1WZKA 4WNQB 2E7HA 1EA9C 4PJ9C 1PW3A 2BNUA 3FFDA 2BSRA 4X6BA 4JZOA 3QNZA 5K59E 4XCYB 1RU9L 4L3CB 4R7DA 3IXAA 5BRZB 5JIHA 2EYSA 4QY8A 4CMMA 3GMOA 4Y88A 4R4NC 3WNPA 3HR5A 1MCJA 1AGFB 1KIQA 1VFMA 2CJUH 2P45B 4LCIL 4ORGB 5EIVA 3FL7A 4ZUVA 1UEMA 1SHMA 4RWYH 1FORL 1VADA 4PLJD 4G8GB 4JANA 5D2LA 2YUWA 1T7VA 1U41A 2BSTB 1FLRL 4HS3B 4DQOL 2NQCA 1YMMD 3AY4A 3EGSB 4DJMA 3P77B 4FFVC 1MFBL 3NACH 4FOMA 1KBGH 3MRCB 4JRYA 1IE5A 5FYLD 4PJEF 7FABH 4Z7VE 4EXPX 3HE6C 3EJYC 4J1UB 2P8MA 3F7YA 3TC9A 3B6SB 2ADGB 5DRWB 5IQ7H 3UZQA 4XX1E 1CL7H 4R96A 4QXGL 2VLJE 2E6JA 3RIAK 2Z92B 1U3ZA 1FL3B 3RTQC 2HJFB 3AS0A 1HQRA 4XBPA 3CFJA 4KTDL 3U0PB 3GI9L 3RWFB 2X4PB 5C0EB 3EKCA 3WHXB 3SJVD 4YBHA 3SKJH 4Y2DC 3GSOA 2IBBA 3MODL 2HFTA 4K94H 1E6JL 4JO2L 4Z7UE 4YH6A 1S3KH 3BJ91 5T1KA 1JMZA 5E5RB 2CO7B 5HYJB 2ARWA 2OCFD 1AGBB 2W07A 1G9ML 4KUZL 3F7RA 1F5WA 3P9LA 4PJEA 5C0CD 1Q0YL 1NFDE 2NYYD 3RKDD 4MX7A 4MA7H 2UUDH 2QTEA 2CXGA 1H9VA 1T2JA 5KSBA 4J4PA 4XPFL 2J12B 2XRAH 3HG1E 4TNWK 2VDQL 1BVZA 1K4CA 3GMNA 3EDDA 3GMMB 2XKSA 1HSBA 4AYFA 3H9SD 4KV5F 4PJAA 3LEXB 1H3TA 1MCOH 4UINH 8CGTA 4Q6IC 4NZUH 1A7NL 4LDLB 4Q0XH 2P1YA 4Y0GA 4OZHE 4RA3A 4GH7B 4OTXL 3VW3H 1L6XA 5D5ME 4PLNC 4LCWA 2OMNA 1X5XA 2R56H 2QKIA 1XF5B 3ZHDA 1M71B 4YR6A 4NNYB 1D5IL 1G7JA 4J3VA 5F89B 3BZEB 1IGIH 1OGTA 1UH3A 3C9NB 4HK0A 5E6IA 3PDOA 5E2WL 2ZUUA 4YQXH 3ILPA 5DJAB 1WC7B 2H41A 2XQBH 2DTML 1NAML 2AJYL 3PV6A 4JREB 4YHOH 2OK0H 3V5HB 1N6VA 5D70L 1IGYA 4YAQA 5HYSG 5I76A 1QFWH 3WFEL 1DEEA 4G3YL 2D31B 2BHYA 4LRIC 2ZUQC 3V6ZA 2APXA 4KKCC 2WSKA 4L4JA 1S7TA 3CD4A 5E8PB 4DUWA 2BNRD 4M43H 1ZSDB 1S7VB 5HD8C 1UVQA 3C5JA 3VA2C 3BYTA 4D0CB 3O3DB 1SYVB 3QDMD 4K9EH 2PYEE 1VGEL 1J1OL 1MRFH 1GGIH 1PVHA 3LEVH 3NFPB 5FHBH 1MFEL 4AY0A 4HUNB 2ILLA 3SQOL 1MAJA 2CDEA 3MBEA 4YHPA 1REIA 4K07A 3FCTB 3NH7L 1ONQB 3IJYB 4M1GH 5FYJH 4LCYA 5CGMA 5IHZA 2APTA 3ZYZA 4KWUA 3QG7H 1I1AA 2XG5A 1OP3H 1A7RH 5FYJU 5MENB 3EOBB 4KKBD 5EOCJ 5IVXF 3HR6A 3VWJB 4LF3A 1QACA 1JWSA 3ULSA 2E9IA 1A22B 1J8HB 2HG5B 4FQXA 4PJBB 1KELH 2VLKB 3UTQB 4BFBD 3PWVA 1OT1A 2E7CA 3KG5A 2KDGA 2QR0B 4YE4H 4AT6A 4Y19D 1TETL 1BOGB 2J4WH 5DD1L 4TVPE 2QQKH 2P49B 5HHOD 5K9KA 2JB5L 2CUMA 4MAYA 5I16B 3I3EA 5C0DB 5EZJA 1X6LA 1DVFB 1H5BA 4JKMA 5I71C 1VFUA 3T1WA 1ITCA 1E6OH 1UM4L 3O6LH 4GXVH 1R24B 3LKQA 3PDGA 4G9FD 4S1DD 3PXJA 3MZTA 4HDIB 1J5OH 4AEHL 4HHAB 5FO7B 2VJXA 1HNFA 3V0WL 1W72B 5IB3B 1CE6A 3MRMA 1IZJA 3EJJX 3O4LE 4RISH 4YXLL 4XNXH 4XWOC 2B1AH 2XWTB 1A7BA 4HWZA 5GGSB 4FQPA 3RNKB 2CMRH 1EFXA 5J8OA 1N59A 4PRPE 5ELIA 3MRJA 5DJ0B 1R5WB 5HHXH 4PGCB 3RY4A 4LVOC 1S8DA 2G5BB 1DQDL 5CEXB 1N5AB 5CUSH 1JYWA 4JCMA 1J1PH 4OB5H 3LHPL 3UYRL 2ERJC 3TBYB 3QDJD 3DX6B 1S7QB 3RWCA 4MLIA 3NAAL 1UCBH 1MWAA 3MRDB 3WS3B 2P44B 2YS4A 3IFPB 1UACL 3NCBB 4QO1A 4JDTL 1Z0MA 4ONHB 4P59H 1FVEB 2DIAA 2QADD 4QHMA 3H3KA 1I7ZA 5F7MC 3P4MA 1TJIH 2DQFB 4IMKA 1S9VA 2IFFH 3QWRA 2LAGB 3U9UB 4BM7A 1OB1A 3WN5A 2DKUA 2Q76B 4HUXB 4N8PA 4QHNA 3HRPA 3OAUH 3ME0A 1ZTXH 4JY6B 1T4KA 3HLAB 4I0PC 2ZOLA 4PY7B 3V5DB 3X17A 3MRQB 4LRNH 1UH4A 3LZFL 3FRUB 4HV8A 1KJMB 4PGEA 4FRWA 4Z7OF 4OCRL 1KTDA 1DN0A 4QRUA 4HKJB 4PY8J 2X4SA 3ARRA 1A6UL 5C0BE 1F58L 3BT2L 5IIEA 3LPFA 1QFOA 1DBJL 4U4BA 1AHWB 2CKBL 1WIPA 3HAEA 3OXRB 5L88L 1J12A 2RQ8A 3L3JB 1KIPA 1ZEAL 4NIKB 3L9RB 1A3QA 3BVNA 3W2DL 1MJJA 1J1XL 3GMPB 3HPLA 2FECL 5DMGD 3MFFB 4PUBL 4LLWA 4BZ2L 2B2XH 5HGGS 4IRJD 5TQ2H 4AEIH 1FNLA 1O0VA 1D6EA 2FSEB 3RWGA 3S34L 1JNNH 5KVMC 3N1FC 2NY4D 4I77H 4KV5E 2GI7A 5DLMH 3VFRB 1U8HA 3SKNA 4Z7NF 4FQ2L 1IEBA 4NM4H 3FFDB 2BSRB 3OKLA 1OL0A 1QO3B 3PABA 5AYQA 4JZOB 4RQQA 3ELAT 3KYAA 1V3KA 4N0FA 3ZDXE 4R7DB 4MGXA 5C0AD 4QY8B 1U8NA 4CMMB 4OLYL 4KJPC 5SWQA 3O6FD 3HR5B 3ZE2F 3I02A 2NLJB 1KIQB 2EE6A 1IGTA 1VERA 5KTEH 4ZUVB 4NKDB 1ZLSL 1BZ7A 1JZ4A 2XQYG 3ARBC 1VADB 2WQ8A 4UDUA 3L5HA 4MDIA 4FA8A 2V17L 4JANB 5D2LB 5FECA 5EOCH 1X5AA 3NPZB 4JFEA 5K33A 3IFLH 1NMAL 3O4OB 1YPZF 2Y06L 4X4XB 2AJSL 3CLEH 5CINL 1FDLH 1CLZL 3F7YB 1HYRC 3RUGA 4TN9A 3FQTA 1DUYA 1WFUA 5MERA 3X11A 4EOWH 4I2XA 4R96B 3RX7A 4HUKB 2AJZA 4RGOL 3MRKA 4N0YL 1ROWA 4NUJA 4QXUL 2ADFL 1HQRB 3UTSB 2DL2A 4L1DA 4XBPB 5E2JA 3CFJB 3VXSD 4X80L 4P46C 2XTLA 4PJXA 1NGZA 4ZSOE 2LTQC 1K8DB 3BX7C 3WLWD 5FYJE 4MNGA 1NGYA 4KKLC 1Y6KR 4KROB 3HTLX 4GUPA 3TN0A 3U0TB 1CICB 1RZIB 4PV8A 2HLFC 3GSOB 3BP5A 3HC3H 4FMFA 1O5DT 3KYNA 3OHXA 5IVXE 3IDGA 5GS2H 5T1KB 2A77H 1YMME 3QIWA 4TSBL 5BRZD 5GISL 3V6BR 4NN6C 4F58H 3QPXL 5KVEL 4HEME 1BREA 4MX7B 5DZNA 1MREL 3QRFM 1NGQL 1KCVH 1T2QH 4G8GD 3N50A 5EFIA 3WXVH 3U79A 5KSBB 1BFOA 1KSRA 2YD7A 3HZYB 4R8WL 2IGFL 4LPWA 2ZCLL 1K4CB 3GMNB 3PGCB 1HSBB 1CT8A 2DQIL 4HGWB 4PJAB 1IAII 4X5XA 3DTXA 2FX9L 4J3WA 4PY8I 5DVKA 3ES6B 4LCWB 4PLJC 3S36H 1FV1A 4GRLC 5KSAA 3IVKA 2QKIB 2OI9B 5CWSB 4YR6B 5L2KB 1G7JB 4OF6A 1OGTB 2FH8A 4RX4D 4HK0B 4M6AA 3PDOB 5C0CE 4HKZA 3FJTA 3PG2A 5KSUA 5F6IB 1FVDA 4I3RH 4MQ7A 2ZUYA 4TVPL 4GKZA 3EAKA 5EO9A 1HXYB 1T5WA 4KZDL 3BH9A 1HDMA 3PV6B 5F9OL 1P4BL 5DI8A 3KPQB 1DQLL 1IGYB 4YAQB 4IRZH 1Y0LA 5HYJD 3O2WL 4Q97A 4MXQD 4F2MA 3U4EA 3CMOL 3V6ZB 2GJJA 3H9SE 1S7TB 5J1AA 3RI5F 4KQ3H 4NT6A 5GZOD 5TF1H 5JIIA 1UVQB 3C5JB 3U46A 3UTOA 4C57C 4G43B 1QUNA 3DBXA 3UJIH 1A1NB 4I18A 2VB5A 5CJOH 2CDEB 3BE1H 4YHPB 2CJUL 3TNNA 2IBGA 2EDTA 4G9DB 43CAA 1YEGL 2V7NA 3BP6A 3SDCB 4LCYB 3WDJA 5IHZB 3BGMA 3F5WB 5F1NA 3OJDA 1NC4A 1I1AB 1EO8H 3L95A 1DQQA 3WJLC 2HTKD 5GPRA 3GHBH 4LF3B 1JWSB 4U0QB 4LNVA 2CDFB 5J7CC 2NYYC 1PG7X 3NACL 1RK1A 5ALCH 3LQAC 1KBGL 3RKDC 3B8YA 5J3HD 4FQXB 4JKWA 4PS4H 7FABL 3MXWL 3BQUA 4Z7OE 2DQDL 1N7MH 3GB7A 3U1SH 2IADA 2VDRH 5IQ7L 2Y6SC 3FO2B 1CL7L 1PYWA 4N1CA 1DBAH 1S7SA 1XF3A 4QHKJ 5AD0A 2A2QT 4YX2H 4DKEH 4GAYA 3AU1A 3WNNA 4LVNB 4P3CH 2V9RA 3QDME 1IAKA 2PW2A 5K9KB 5LWYH 4MAYB 1HK6A 4ELKA 5EZJB 1D5MA 1JZ3A 1H5BB 1GSMA 1YDPB 1JCKA 3SKJL 2OQJB 4FTVA 3MNWB 5GXBB 3D85A 2GY7B 1S3KL 3NCEB 3H7BA 1DBKL 1S5IL 3SPVA 1EV2E 3VWKC 1G6VK 2CQVA 1XEDA 1SJHA 1CE6B 2SEBB 3MRMB 4W4OA 4JO3H 3ZE2E 1CGSH 1UT9A 2FO1A 4HWZB 4LASH 4QTIH 2CIKA 4Y19E 5D7SH 5MEND 1N59B 3VWJD 2BVOB 1FL6A 2FHBA 2LE9A 5ITFA 2XRAL 1MOEA 4J2XA 3WFHA 1J8HD 1YPZE 1QBLH 2DIBA 5HHOE 3V52H 1SJEA 4TYUA 2VLKD 1N6QH 2W0LA 3OF6A 1MCOL 4UINL 2DJ4A 4NQEA 4Q0XL 4G7VH 5BOZG 4ETQB 4UIKH 3VW3L 1TCRA 1N0LA 1NCBH 3P4MB 1MCFA 2Y4SA 1MQ8A 4D3CH 5F7DA 1FYTE 1S9VB 3UYPA 2KZWA 4FFYL 2R8SH 2BNQE 3S37X 1J86A 1IGIL 1DVFD 1OB1B 3WN5B 4QHNB 5KS9E 4YQXL 2DM2A 3UMTA 1IKFH 1HILB 3DMMA 2Z8RA 2R0KH 5E8OA 4RGNB 4YHOL 2OK0L 4HV8B 4PGEB 1QFWL 2FZ3A 3MACH 2EDJA 3RAJH 1EO7A 1UWGH 1KTDB 1DN0B 4QRUB 2EIZA 2AK4B 3KYMB 2X4SB 2EXWD 4Q2ZA 4OF5A 1UM6L 2W1NA 2XTJB 4JFFB 4M43L 3GBMH 1OQOA 3HAEB 4K9EL 5FOJA 3VFPB 1MRFL 1GGIL 4QNPE 4ZD3H 4YBQC 1KIPB 1YY9D 2ZUXA 3ALWA 3BVNB 4S1DC 1MJJB 3HPLB 5M95B 4M1GL 3IDJA 4KZEH 4CL7A 1AGCB 1T0MA 5T3XH 2J8OA 3QG7L 1U3HA 25C8L 2FBOJ 1A7RL 4N1HB 1F45A 1U8HB 4J8RA 3K3QA 3SKNB 1IEBB 2HYMA 3OKLB 3PABB 2VXUL 4RQQB 4XP4H 3RZCA 5FUCE 3ZYOA 3EYSH 4Y4HA 1KELL 2YUVA 3BD3A 1INDL 5DTFA 2ENYA 3G6AB 1U8NB 2PR4H 1D5BA 4TOYH 4D9LL 2P47B 1CD1B 5SWQB 3MV8A 3I02B 1BQSA 4YE4L 2FDBP 4QF1A 1BZ7B 4L4TE 4MS8C 2V6HA 2J4WL 4UDUB 4PJ7E 4MDIB 4IM8A 3MLUH 1AQKH 5C07A 2QQKL 5FECB 1KGCE 4E41B 4FQLH 3TH4T 4JFEB 1VACA 5I75C 5HDBE 3I6LE 1AH1A 5E8DH 3GNMH 4WO4C 4HS6A 4XB8A 1BEYL 4NCDA 2F53A 1E6OL 3MX0A 1FE8H 3JBG7 4UNVA 3PWUA 3RUGB 3FQTB 3QXAA 5C3TA 4JPVH 5MERB 3X11B 1RIHH 1J5OL 3I2CL 4I2XB 1FSKB 4NZJA 4KY1L 1HSAB 5D1ZB 2AJZB 4AEFA 4NUJB 4LCCA 4NN7B 4RDQG 4YXKH 1FFRA 3VG0H 3RBSA 4U1JB 3KPSA 4PJXB 1FL5A 1R3LB 4JFDE 4RISL 5IB1A 2B1AL 4MNGB 1NGYB 4DCQA 4GUPB 5SWSA 3GSNH 2CMRL 4MZ2A 1ZXQA 3ZSTA 3V5KA 4PV8B 2IPTH 3BP5B 3RWEA 3GSXA 1DLHA 2LABA 3DX7B 2EE9A 5HHXL 1P5VA 1BF2A 5BZWA 3VI3F 5E00A 5CUSL 1J1PL 4OB5L 3VD4A 4JJHA 3FQRA 4N8VG 2W38A 3Q6FA 2O5YH 3HZMA 4P59L 4LLDB 1TPXC 2LVCA 4LSDA 4XPBH 2XXMB 5EFIB 2WBJC 1TJIL 1XFPA 5CEYA 5FGCE 2L4OA 1BFOB 2AABL 5K9QG 4U1GB 5CZVH 3ZE0F 3SE4A 1JTOA 1D9KA 2B4CH 1ZTXL 1CT8B 2QQLH 1FGNH 3VJ6B 1MPAL 3TZVA 1HH9A 2RCSH 3O6FC 1OAYH 2ITDA 5ESAA 3DTXB 4LRNL 4XB7A 3GJEB 5HSFA 3O81A 3SE8H 3KXFE 2MWCA 4Q74A 3UTSD 1FV1B 4XVTH 3C60A 1PLGH 5HHME 3IVKB 4G8FB 1LP9B 1W72H 1AC6A 2F58L 4M7JL 5IUSA 3MNZB 4KROD 4Y89A 4HKZB 4XC3H 1CICD 2YPKA 5KSUB 4YFDB 3S88H 4MQ7B 2H2SD 4DWHA 2EIDA 5EO9B 5T1DL 4Y16C 4G8GE 1OOAA 3BDYL 1T5WB 4GBXC 3BH9B 1HDMB 4H8WC 1NKOA 4OZFB 1I7UA 5I74C 1FPTH 5T1KD 2B5IC 2B2XL 5MEQA 1N8ZA 5TQ2L 1OGAA 4YO0A 4AEIL 3GHEH 5CGYD 2P5WA 3HI6H 4F2MB 3BD4A 1JNNL 1KLFA 3U4EB 2CK0H 3UBXI 5J1AB 1UZ6F 4HWEH 4NT6B 4NM4L 3WLWC 3U46B 4TUJB 4FZEL 4J4PD 3KYOA 5L0QC 4QOKE 4I18B 5DUPH 2XYCA 3MUZ1 3WHE1 3I50H 3LH2H 5ID1A 4XI5D 5CP3H 4YWGL 1BD2A 3DVNA 4N68A 5KTEL 1SY6H 5KOMC 43CAB 4NBXB 3VD5A 3BP6B 2R1WA 3JV6A 3BGMB 3T0EC 1G7HB 5F1NB 1M7IA 3OJDB 1NC4B 2FIKA 3CZFA 4O9HH 3FZUC 3FTGA 3MPCA 3IFLL 2IC2A 3P4OB 5IHBA 5EBGA 4FQCH 1RK1B 3CLEL 3P9WB 1I85C 3JUYA 2CLRA 4LCWD 3BQUB 3OR6B 4CN6A 4ZFOL 4HC1H 5DR5H 2E3VA 3GB7B 1AO7A 2AEWA 2IADB 5L2KD 1A2YA 1MIMH 5TE6H 2R9HC 4EOWL 4XH2A 5JW4Q 1TVBB 1ZANL 4U1NB 3DGGA 4X9BA 1S7SB 1XF3B 5B21A 3ZYIA 5GRUH 4PGBB 4Z5RB 3V7AG 2PW2B 2Q86B 3NN8A 4KJYA 4PYGA 4YHKH 3IAGC 4KMTH 2W60A 4PJGA 1D5MB 1NCDH 4Z7WF 4XCEA 2H1PH 3DYOA 1A6VH 5T3XE 4FTVB 5KVFL 3HC3L 3LS4H 3D85B 1OW0C 2DAVA 3GM0A 3J7HA 5C0IA 4NJ9H 2A77L 5L9DH 3GSQB 3SPVB 4P2RA 1QLEH 3OKYA 5GGVH 3UBXA 3DETC 4G7YH 4MD5A 4R0LC 4PJIF 1HHIA 1SJHB 2EKSA 2JK5B 5ICXB 2YUXA 2UV3A 3CC5B 3SO3B 4F58L 3SDCD 1KCVL 2YD9A 1T2QL 4JPWH 4G5ZH 2DM3A 3WXVL 4MXQC 1I1AD 3M1BA 3IAQA 2DYPB 2Q7NA 3ULVD 3IDUA 1RZKC 5ITFB 3M17A 1D7FA 3REVA 2YBRA 2ICWJ 4FQXD 3RWIB 1X4ZA 2VR9A 1SJEB 1WTGT 4Z7WA 4NQEB 5C0ND 4CU6A 4YFLI 1WWAX 5F7HA 4QWWD 1UH2A 3D87B 4MXWH 1TCRB 3QFJE 3EYOA 2QQQA 3S36L 5L2JA 3LN4B 3ZKMD 3HZKA 5ALBL 5F7DB 4OZ4A 2H45A 4MAYD 4KI5D 4HKBA 2BSSA 4APQA 4C56E 1CLOL 5F3HA 2X7LA 4NQDB 4I3RL 4NQCA 2FEEI 1I7TA 3DMMB 3VFVA 3K1KC 5E8OB 3NPSB 4HMEA 2PW1B 3RGVA 5MENE 4OCXL 2YXFA 2ADJA 2EECA 4IRZL 2DQTH 4UT9L 3RZWA 4OUUA 3U48A 3OG6B 4JGMA 4TSCH 1J88A 1J8HE 5CS7A 5F8QC 4RGMC 2EIZB 4PJBE 4LLVA 4Q2ZB 1G7QB 3LD8C 4HCRH 5FM4A 1NC2B 2VLKE 1R3KB 3FFCA 4KQ3L 5TF1L 3V8OA 3QQ9C 3T4AA 1AI1H 1KJ2B 1B88A 4ODXB 5D7LA 1HYSC 3BIBX 4ALAH 1EFXD 1CFSA 4GXUN 1BZ9B 1BZQK 3BE1L 4WHDA 5GHWH 3B3IA 5D9SA 2HVJA 1ZLVK 3ZE0E 1ZGLP 3IDJB 4M9OA 1JPSH 1T0MB 4FG6C 4C59B 3MV7E 2OSLB 1XCQA 4LSVH 4M5YH 4RFNB 1EO8L 1KJVA 1JZ8A 1HH6A 3MRNA 3OJ2C 3VH8A 3GHBL 4WUUB 4K8RC 3WXWL 5B38A 2UYLA 3RZCB 5GRWA 5IJVB 1MI5A 5ESQB 3SKUD 5SX5K 1OAUH 5DTFB 3S35X 3W9DA 3U1SL 1D5BB 3ARDB 4I4WA 3KLHD 3U30C 2J8HA 4QF1B 4X7FC 1DBAL 2HKFH 4Y4KA 5FM5M 4YX2L 1G7IA 2IH3A 2VLRE 5C07B 4P3CL 2W59A 3DHMA 1C8PA 1XGRA 4Y5YC 2XA3A 2NCMA 4WTZA 5ECJE 4GRWB 2ESVA 4RGND 1VACB 4TNVF 5D1XA 2O5ZH 1QVOB 4HS6B 1J0HA 4ZOAA 2F53B 4WW1A 1GCFA 3DRTA 2IEPA 3RKPA 3PWUB 2VH5L 3QXAB 2XTJD 4JFFD 3K0WA 4OKVB 3IDYC 1DVFC 1UZ6E 2AEIT 1CQYA 5J1SC 5CAYB 2M8XA 5IFAH 4RRPG 2V7HB 3HC0A 2MJWA 4JO3L 1G9NC 1FL5B 2D0HA 2IAMB 2H6PB 1CGSL 1T83C 1IARB 2ZSVA 1TQCC 2D4DA 4NQTA 5DJDA 3S3PA 1YNLL 4LASL 4QTIL 4DCQB 5SWSB 5D7SL 3SDXF 4A6YA 4NDMA 3P40A 2VISB 3V5KB 5FOBA 2EXWC 3RWEB 1DLHB 1A9BB 2H8PA 2ICWI 2R69H 5IW3A 3NABL 4P57A 5E00B 3H3BC 3F7VB 3V52L 4TVSa 5E24E 1RZGB 1II4E 3DX8A 2XIDA 1N6QL 2VLLA 1A7OH 3G6DH 3HZMB 5EU5A 1CFBA 4OLZH 4UIKL 1F97A 2ZWLT 5KAQG 1IC1A 3JUZA 1NGPH 1NCBL 3UCRA 4D3CL 1X5KA 4U6YA 4E41D 2ZOKA 2A6JA 3E6HA 4JFED 4S0SD 4MB3A 3MV9E 4G8IA 2A1WH 2R8SL 1BBJA 5H8DA 2GJ6A 4OCLC 3WDIA 4G42A 1D9KB 4JGJA 4M5ZH 2X1OA 1XH3A 3TZVB 2Q7YA 1HH9B 1IKFL 2FBJH 3EYUL 3QDGA 2R0KL 5A2KH 2ITDB 3BESR 4WI7A 1EFQA 2R1YA 1QOKA 2G75A 5D1ZD 4P2CG 1EEUA 4ZNEE 3MACL 3RAJL 4H1LA 4WVRA 2K7PA 3PUCA 4XAKD 4Y8DC 3C60B 4PJIE 3VGAC 1RQ5A 1NCAH 1TMCB 3TV3H 3BH8A 2DM7A 3QNXA 3GIVB 5F9WB 2BY1A 1FN4A 2YPKB 4YK4B 4HK3J 2GAZA 2R0ZL 3IDMB 4ZD3L 3RI5K 1QP1A 1C08A 2R1XA 4NOBA 2HFFA 5HPMB 3GFUA 4YGVB 1I7UB 1JL8A 4OFYA 5EO0B 4O2FA 2ZUSA 4NC1E 4KZEL 5MEQB 5ESVA 1N8ZB 1OGAB 4MDJA 4YO0B 1NFKA 3NCMA 2P5WB 4M9PA 5T3XL 5FFLA 4NBYB 2ICWA 2HT3D 4IS6A 1ACZA 4R6UA 1YEIH 4GKOA 5INDB 4N90D 5CZXC 4QLRA 4O5LH 3NIDF 5D96C 3QAZC 2WANA 4XP4L 1XF2A 3NZHH 3RVXD 3EYSL 1NGWA 5J11C 5JMOC 5C7XH 3KYOB 1CXFA 1RZJC 2FATH 4KHTH 1T0PB 2PR4L 4TOYL 4D2NA 4JFQB 3UTSE 4ZO6A 3O2VH 4HXBH 3QHTC 1ZGLM 1BD2B 2NX5B 3DVNB 1C5CH 1FNFA 3X3GL 3TIDA 4ZFZB 2R1WB 3JV6B 2BY2A 3MLUL 1AQKL 4YBLB 1WF5A 2FIKB 1EJOH 2BCKA 4FQLL 4EBQL 1TZGH 3TJEH 2XWBA 4DVRH 2DQJH 5FM8A 2OM5A 1P84K 2CLRB 5TE7H 4NNXA 4NPYA 1FE8L 4AIOA 5JO5A 1AO7B 1I4FB 4JPVL 3AY4C 5DRNB 2I25N 1RIHL 1LO5B 4XH2B 3BDXA 3DGGB 4LSTL 3PHQA 2WWMC 2BVUA 3O2DH 4YXKL 2QBWA 3O3AA 5JHDA 2DLEA 3VD9A 4TPRH 1EO5A 2EICA 5CJBA 2I9LA 3CX5J 5I30H 3WKNA 3KPMB 2W60B 4PJGB 2B0SH 5CKAA 4I0KA 5E8EB 3T3MF 2FX7H 5DMIH 3OZ9H 4QEGA 3S5LG 3AAZA 3G04A 2IPTL 4NNPL 4KKNA 4JRXA 1ZHBA 5LBSL 5C0IB 2D0FA 1P9MA 1TXKA 1QR1B 5DJZA 4YEFA 4KROC 5HHQA 2I9TA 4P2RB 3UBXB 4NP4L 4MD5B 2H2SC 4EQ2A 2EKSB 1RUAH 1T20A 2O5YL 3LMJH 4V1DB 3BP7A 1T7WA 5C8JA 1T22B 5L2KE 2WK2A 4U1IA 1YZZA 3EDKA 3IXTB 4KJWD 4XPBL 5CGYC 1FYHB 1NC4D 3KPRA 3M1BB 5M94B 4OKDA 1EHNA 4NBZB 4Y5VB 5HVHB 2N4IA 5CZVL 3REVB 2YBRB 3WUWG 2EYRB 4X8XA 3S37H 2BRQA 3HE6A 5A2IH 4ZOCA 3IU4H 3E2HC 3BQUD 3STBA 1HKLH 4PJDF 2B4CL 2HJLA 2QQLL 3GSWB 3MRGA 3LOWA 3V4PH 2Y5TA 1U58A 2RCSL 4XI5C 2A83B 2HN7A 5KN5A 3P2TA 4JFZH 1A1OB 4Z0XA 3SE8L 2DQEH 3EYOB 2MQCA 3BPOB 3PP3H 1P6AB 2JJWA 4XVTL 3HZKB 1PLGL 3WS6A 3ECBA 4OZ4B 2V2TA 1W72L 2YD5A 5DJXA 3BEWA 5T5FH 4HKBB 2BSSB 3AS2A 4JM2A 4K3DH 5F3HB 4XC3L 2X7LB 4FTVD 1G0YR 1RURL 1T04B 3S88L 4Z6AT 3D85D 3SDXE 4NQCB 1U8OA 1I7TB 4YDIH 3VFVB 4QRPA 1DBMH 3CVIH 4ELMF 3RGVB 1FPTL 4YDKH 5E6IC 3VGFA 1MJUH 2ADJB 1JNHB 4JY4A 4OUUB 3GHEL 4EUPG 4OFIA 3RVVD 3HI6L 2DQCH 4QT5A 2HLAA 4N0UA 1WCQA 4X83A 1CN4A 1MCHA 4PJDA 4EVNA 4HWEL 3FFCB 3C09C 4FXGA 2VOTA 3T4AB 3FQXB 3HKFA 4JRWA 4WEBH 4P2YA 4P4RA 4QHUA 4P9MH 5J6HB 1JPFB 1CFSB 4JQXA 5DUPL 3KHOA 3I50L 3LH2L 1CDBA 1BLNA 4F8QA 4H26A 1SY6L 3B3IB 2HVJB 3ULUF 1HWGB 3ULUH 4KI5E 4R7NA 1FAIH 5A1AA 2ZUTA 5HYQA 1JVKA 3RWHA 3O11B 1KJVB 4O9HL 4UTAH 3MRNB 4NQED 2OP4H 1WEJH 3MBEC 3VH8B 3CLFH 4FQCL 5B38B 1R0AH 2UYLB 2HTLD 3EOYG 5GS0C 5I9QC 1MI5B 5EU7E 4ELMA 4HC1L 4AIXA 1I1AC 5DR5L 3S96B 2FH6A 5JR1L 1U8LA 3D1MC 3ULVC 4I4WB 5JA8B 1DANT 5EO1A 5TE6L 1FC2D 4PRDB 1T1XA 3KPTA 1MUJA 3GMLA 4FQXC 2UWEF 4Y4KB 5GRUL 1P2CA 1G7IB 2IH3B 4M61A 3MUGA 1CCZA 3DMMD 2ZCKH 1XGRB 1RFDH 4LHQB 2D7PA 2ESVB 2DJSA 5C0NC 1GHFL 3FT4A 4YHKL 5BS0E 2FGWH 3GK8H 5KW9H 4UU9A 5D1XB 4OZFH 1NCDL 4QWWC 5E7BA 2BOBA 2EDEA 4C83B 3VXRA 2H1PL 1A6VL 4LVNC 3LRGA 3DRTB 5I1JH 2A6KA 3VI4E 2VQ1A 3LS4L 3ZTNH 1NC2D 3VFUA 3QI9A 4MAYC 1A3RH 3TVMA 5HGDB 2C3GA 3NIDE 4NRYB 4P48A 2EC8A 4XVUD 2WP3O 3GBNL 3RIFF 1QLEL 5GGVL 5DC9B 3ZTJH 4ZXBA 5JTWA 5FCSH 1NEZA 3HC0B 2J1KA 5FUZH 2RB8A 3S8WA 3PHOB 4HPYH 4LEOA 5HHNB 5DJDB 1YEFH 4XPTH 1UJ3B 3STLA 4G5ZL 4A6YB 3HHRB 4ORZC 4NDMB 4ERSH 3VRJB 3MMEA 2AERT 2V2XA 3P30H 3O6MH 4X98B 1RHFA 1PKQB 4WUUD 2ITCA 4ZO7A 4S1SH 3PNWA 4WW2F 4KRPB 3RZCD 4P57B 4DN3H 5BQ7B 1JZ2A 2YRZA 4JPKH 5JOEA 3EOAA 1B0GA 5HDOA 1IAIH 3RWDA 4LOUD 1TVHA 2VLLB 3ARDD 4IHOB 2AK4E 1UWXK 3SGJC 5EU5B 2EXYD 2Q6WB 1BBDL 1Z9MA 1KUMA 1CFTA 2XTJE 2R4SH 4JFFE 4MXWL 3VXQB 3VMNA 1KLUA 2YR3A 5C07D 3TT1H 1KCRH 4JB9H 2BSED 5D2NC 3U0WH 1CD0A 2ZOKB 3E6HB 3LPWA 4J23A 3G6JB 1AXTH 4AENA 1JP5A 3OGCA 2DLHA 1BBJB 2LU4A 2GJ6B 4BQBA 3F6LA 4XX1G 2F53D 4GSDL 1WBZA 1PX3A 3T3ME 4MCZA 2ZG1A 3H7LA 2Q7YB 1EBAA 4P2QA 2R1YB 5FA4A 4YXHH 2G75B 3WN5C 1A1MB 3QZWG 3HRZA 1PQZA 2W91A 2NPLX 2R2HA 4H1LB 3ZT6A 4TSCL 1QKZH 3SQBA 2V5MA 3I3DA 1YUHB 3VFGL 1ZT1B 3NVQA 4P0DA 1KT2B 2IAMD 4RGNC 4NQSB 3HUJA 3QNXB 3N9GH 2RBLA 3VXPA 3IAPA 5SWSD 1FN4B 1EMTH 2GAZB 3MJ7A 4TUKH 1QNZH 2EO9A 1M05A 1C08B 2R1XB 3UEZA 2HFFB 1MHPH 4I48A 1AR1D 1W2KT 4O2FB 4X7EC 5GHWL 4E41E 2EE3A 35C8H 1FNHA 4MDJB 1ZV5A 3PXHA 4D9RE 4X6CA 3RL1B 2ICWB 4M5YL 2C3VA 4IS6B 4WTWA 1G0DA 2XNAA 3SN6N 3LKNA 4NGHH 4RDQF 1F3JA 2PN5A 1VFAA 4JHZA 4KTYA 4W6YB 4LQ1A 2NNAA 4GFTB 1UA6L 4H88H 2CO6B 1NGWB 5E6ZA 3NFSH 5C09E 4G6AC 4IOSD 4DZBA 2OMBA 4WEMB 1NGXB 3VFTB 4OF3A 3TO2A 2E7MA 2K9UA 3WIHH 3W11D 1RJZA 2HKFL 4LLUA 1D9KD 3D39A 3RNQA 1F6FB 4RMRA 1F3DH 5JHLH 1E4WH 5DXWA 3TZVD 2QSCH 3JZ7A 2Z31A 3LB6D 3MCLH 1P7QB 2BCKB 4OFPA 3N06B 1T1YA 4GAGL 5DJ6A 3WIIL 3VFMA 1KCUH 1A7QH 2VAAA 4YDLC 1IAOB 3CFKA 4NNXB 3SGEI 3C60D 4NPYB 2ZJSL 5JO5B 3NCCB 1MNUH 4FQHB 4NRXA 5IFJB 3X14A 4HBCL 2NY6B 4B5EA 3W5NA 1BQHA 4IJ3B 3SHSA 3KHQA 4HH8A 2OX5A 3PHQB 4DUXA 3D25A 1KJ2H 3O3AB 5IFAL 5JHDB 4KHXH 1RJCA 1LK2A 3RJDA 1G6RB 2CIIA 4L29A 1F6AA 1OGAD 3ULUE 2XZCH 3VXTA 2P5WD 3EUUA 3BSZH 1HQ4A 3AAZB 3G04B 1PJ9A 4JRXB 1ZHBB 3QEGH 1TIUA 4MQTB 2R69L 5GJTL 4WI6A 5DJZB 3TN0C 4CN4A 5HHQB 1E27A 2P5EA 4WDIA 2EH7H 3AS3A 4PBWD 3TGXA 1CXEA 3UTTB 4PJ5E 1T20B 1A7OL 5GIRB 3G6DL 1WVZA 4KKAC 1BD2D 2NX5D 1AXSA 5JNYA 1BQUA 1LP9E 4OLZL 4XPGH 5MHSE 1HKFA 1WAAE 4U1IB 3QIWC 5DWUH 2RAMA 2UWEE 3KPRB 5CIPA 5TFSH 2R2EA 3OB8A 2A1WL 2ZPKH 4GRWH 4BH8A 3HE6B 4L8BA 3RVXC 5E7FA 4HLZG 2HJLB 2X6MA 4M5ZL 4FABH 1GIGH 1AO7D 2Y5TB 4BJLA 2FBJL 4NFCA 4XXCA 5CFHA 5KN5B 4G6MH 3RTQB 4Z78B 3GRWH 3DV4B 1IVLA 1J87A 4NJAH 1LEKA 1PD6A 4P46A 2X44D 3QUMB 1QFWM 1NCAL 1GPOL 3BEWB 2PCPA 3L7EA 5H94A 3TV3L 4JM2B 4U1KA 2BOCA 1VHPA 4Y2DB 2EYTA 4XP9H 5KSAC 2FR4A 4WFFD 1U8OB 4QRPB 2BX5A 2X4OA 1ES0B 2OLDA 2VDPL 4JZJA 1NJ9A 4P2RD 2J8UF 1K9TA 4PTUA 4JY4B 4TSAH 4KQ4H 4QT5B 2HLAB 4N0UB 5F9AC 1RUML 3NCYP 4V1DD 1YEIL 1JTTA 1CFVL 3VXUA 4EVNB 4FXGB 3WIFB 3QCVH 4JHAL 5D7IA 4YUEH 4P4RB 1SYSB 4O2CA 5C7XL 4YHZL 3ARQA 2FATL 4KHTL 1X5IA 3S35H 3G9AB 5F7YC 4S11A 3EDFA 1BLNB 3QUZA 3MJ9H 1ZVHA 1C5CL 5I2IA 1NLDL 2AJ3B 1V3MA 1T7ZA 1H15B 4LHUA 2HP4A 5HYQB 4I18C 3RWHB 3SY0A 1A8JH 3MRRA 1L9NA 4W68A 3CSYA 4UQ2A 4HWUA 4MSWB 2JIXA 5EUOF 3TJEL 4DVRL 4GRLA 5TE7L 3K8MA 3BZ4B 4TNVK 5ITBL 1U8LB 1NCUA 2A6IB 1Z9LA 1BHGA 1T1XB 3GMLB 3LKRA 3BN3B 4NQCD 4TPRL 1LO0H 1JGEA 2AV1B 2YN3A 3RGVD 5I30L 5IOPA 4YHYC 2X41A 1MH5B 1GVIA 3JV0A 4UU9B 2DQGH 2B0SL 5DGRA 3OKOA 4QRQA 2ZUQB 4LDOB 5DMIL 2VITA 1I1RA 4ZUSA 1F4YH 2VQ1B 4OFKA 4RFOL 3VFUB 3IU3A 1XGQA 3QI9B 3FFCD 5CZKA 5JLZA 2D0GA 4NQEE 2A9NH 1I8KA 5D7JC 3WFZA 4HAGA 1VESA 5EUOA 4ZXBB 1RUAL 3LMJL 1EGJH 1QHPA 1NEZB 2Y7QA 5B4MD 2NY0B 3GJFH 3PQYB 1N64H 2OR7A 2Z4QA 3ILQC 1N0XH 3G5VB 3CH8A 5IV2B 3CFIC 3STLB 5C86A 4NQDE 1QG3A 2V2XB 5DFVC 3PWJA 4W4OC 3SO3C 2ITCB 5F7EH 5L7XH 1NCWH 1YEHH 3MUY1 1MI5D 3IU4L 1HKLL 2YRLA 5E5MB 3QEUB 3GBLA 3EOAB 1B0GB 1FG2A 3V4PL 5DC4B 5TPWH 1TVHB 1KF9B 1KPUA 3B9EA 2AQ1A 3PIQA 1F4WH 4AM0A 4JFZL 1IM9A 4Y4KD 1CFTB 4X6DA 1KLUB 2DQEL 4LARL 3X3FH 3QIUC 5EC1A 5HI3D 2LAAA 2OBGA 2ESVD 3EW3B 3TCLB 3ZKND 1FO0A 5I19H 3OGCB 5T5FL 1INEH 5D1XD 5I71B 1JZ6A 1A5FH 4TULH 2DM4A 4MZ3A 5HJ3A 2XN9A 2XQYK 1S9YB 5CBEA 3TIEA 3V79C 4YDIL 3MO1A 3ROLB 1A14H 1GOHA 4M03A 3D3VE 5IFHH 1DBML 3CVIL 3CFCH 1WT5A 5BZDA 5FA4B 2XZZA 4YDKL 5JORA 4WUUE 3HRZB 1PQZB 5KVGL 3E6FA 2R2HB 2F5BH 3KJ4B 3MBXL 3NFNA 2DQCL 5DEGA 5T5NG 3DMMC 2PO6A 3KAAA 5J0BA 3NOIA 4L9LA 3QUYC 3HUJB 2OL3B 4GG8B 4JFYA 4WEBL 1LEGA 3S4SA 3VXPB 4P9ML 2PF6A 2X09A 3IKCA 2OXHA 15C8L 3PL6A 5MEOA 1V5JA 1MRCL 4I48B 5D71H 4KRPD 5CJ8A 3VGEA 3HNTH 3GGWA 4FFZH 4GRWE 3V6OA 2ERJB 4OF0A 4XVUC 1FAIL 1CR9H 1LO3H 1OARH 4X6CB 1X5YA 2FO4A 1SMAA 4GO6B 4UTAL 1FNSH 2XNAB 3LKNB 1WEJL 1TNMA 4CVZA 3QIBC 1VFAB 3KNBA 2NNAB 1R0AL 5E2TL 1E4KA 4ACPA 4ZNCD 4ZS6D 5E9DA 4RFNC 1U3HC 3B5TA 4WHYG 4WV1A 4RAUA 4DZBB 5HI4C 3BFOA 5HPOA 3TO2B 2FNBA 2GJ6D 3QH3B 3RZCC 5DT1H 3W5MA 1RJZB 4LLUB 3RNQB 3D39B 3L7FB 1CDIA 4KK8D 4Y4HC 3TF7C 2BHUA 1KB5H 2XFXA 3NCJH 4NUGH 5DK3A 3MRHA 2X5PA 4MNQA 4LOUC 2NY5H 3QDGD 2ZCKL 4PJFB 8FABA 4HS8H 4K7PL 4YLQT 3RDTA 2EXYC 2FGWL 2VN7A 3GK8L 5DJ6B 3VFMB 3M45A 3GSRB 1ZT7A 2VAAB 2J8UE 5JXEA 3CFKB 1GOFA 1L0YA 5I1JL 1HZHL 5KAQF 2Q3ZA 1U93B 3ZTNL 3KPNA 5CCKH 1MFCH 2EEDA 3X14B 4LKXB 3SDAC 1DTUA 3JTSA 5EPMA 5CGTA 1BQHB 5I1GH 2VDOH 3V7AE 1NCNA 3D25B 4ODTH 32C2B 4UV7H 2JCCA 3O3BB 4X7DC 1LK2B 2FGZA 4OZGF 4OFYD 2MCPH 1A6TA 2NTFA 3PHSA 5I8KH 3HZVB 2BP3A 4HPYL 2DKSA 2J6EA 2CIIB 1F6AB 1YEFL 3VXTB 4L3EB 4LCCC 2D7TH 1V7ML 5KJRH 3MLRH 1HQ4B 4ERSL 1ZHKA 3O6ML 3SGDI 5IW6A 1JUFA 3RVWD 4S1SL 1PG7W 1JRHH 2JJTA 4MJIA 1A0QH 3AREA 4DN3L 5FGBA 1HINH 2G9HA 1E27B 4JPKL 2P5EB 4WDIB 3UPCA 2YPVL 1IAIL 1AKJA 3QJHB 2W65B 2JELL 3OAZK 5F8RC 3UPRA 5E5UB 2WLZA 3VXMA 5GRZA 3JSSA 2VMFA 4ZUUB 1RU9H 4OQTH 5H35B 5IK3A 4NC2B 2R4SL 4WI3A 1F42A 3G5YA 5EBWB 1FNAA 3TT1L 1UXSB 2FRGP 5DZOA 1SM3L 4V2CB 1P7QD 3U0WL 5I8OH 4LSQH 2R2EB 5B3NA 1ODAA 1ETZB 1AXTL 2FLBT 5A43C 4WO4A 1AQDA 3MQIA 1P1ZA 4AL8H 3A6CH 4WU7A 4JPIB 4BH8B 2OS7A 4OZGA 1FLRH 4PJCA 4LSSH 5KZCB 2YPLA 1MFBH 5KBNC 2NY6D 3SE4C 3T77A 4P5MA 4CJ1A 4YXHL 2X2YA 4I9WE 4HMCA 3W11C 5BJTA 3CK0H 1D9KC 3QNYA 5JHDD 1QKZL 3Q1SH 5GRXG 1LEKB 5EU4A 4P46B 4NCC2 3BHBA 2VXTH 3Q0HA 2PCPB 5H94B 1MAMH 4U1KB 3GSUA 2AKRA 4XCCL 2BOCB 3N9GL 2NX5E 1EMTL 4TUKL 1QNZL 2EYTB 1U92A 4P9HC 2FR4B 2DS4A 1WFOA 4JRXD 3L5WA 2AJXH 2P8LA 1MCCA 4PTTA 1MHPL 2YOCA 2X4OB 3QSKB 4JZJB 35C8L 1NJ9B 4PTUB 4YK4C 1A3LL 4ISVA 1T03H 2VSCA 4R4ND 5E4IA 4I1NB 4HUMB 3Q5TA 2VZTA 4NGHL 2FL5B 4TQEH 5IBUB 1PZ5A 1CDYA 4XWGH 4BYHA 5IB4A 5D7IB 4H88L 5T1MA 1YEDA 3NFSL 3KPRD 5SWZA 1CXKA 4I13B 4KUCF 3U7AA 1AD9A 4FFVD 1M6OA 3QUZB 4FQQA 1T80A 5MI0B 3W39B 3HE6D 3WIHL 4KRMB 1N5YH 2COQA 2P43B 5JHLL 1QFPA 1E4WL 5DRXB 2QSCL 3MCLL 3SY0B 3MRRB 3ARZA 3TO4A 2D7OA 4AEEA 3CSYB 1ERNA 1LGVA 2GTWA 5BXFA 1J8KA 3RTQD 3RVTD 3DRQA 1KTRL 4JAMA 5ADOL 1A7QL 4GRLB 1LEIA 3SO5A 3I3BA 2NY1C 4U0RC 1MNUL 1NANI 5DMKA 3F12A 4X4MA 4OTXH 4JM2D 4V1DE 2ZZUT 1JIBA 5D6DA 4Y2DD 2WINA 1JE6A 3TJHC 1KJ2L 5J9PA 2JJSA 4MD4B 4G6FB 4ZOBA 3WD5L 4QRPD 1JGEB 5C0GA 5GGRY 2I60H 3MGAA 5IOPB 1WBXA 1OLZA 3T09A 3CMGA 3RIFK 2CUIA 3LQZA 2XZCL 4QRQB 1E4XI 2VITB 3A0OA 4PD4J 2AV7A 3IU3B 1R5IA 1XGQB 1OD9A 3QEGL 1K5NA 1CBVL 3MRPA 5FEBA 3BPCB 1KPVA 3NCFB 4Y1AA 1I8KB 2EH7L 2X1PA 3BWUC 1GZQA 2CRZA 5FDYA 3UZVB 1WK0A 2YZ1A 1C1EH 4K23H 4XCNA 2A9MH 1TJHH 5DGQA 2Z4QB 2VE6A 2AEPH 4E5XA 5DWUL 5F71A 3LKPA 1MFEH 1VFBA 1NBYB 4X8JA 4Y4FA 5B39A 3SQOH 4NSKA 1IC5L 3PWJB 5TFSL 4BSWA 3IYLW 2K7QA 4LPVA 4U2ZA 5K9JH 5DVOA 1JPST 3CVHA 2JJUA 4N9GA 1QLFA 2DMKA 5BOPA 2VWEE 1N3NA 3M8OH 1FG2B 4FABL 1UWEH 2IPUK 1GIGL 5CMAA 5HVHC 3MA9H 1IZKA 5ISZA 1NAMA 5J1TC 3PIQB 4X6DB 3GRWL 5DD3H 5JIPA 2R0LH 4B7IA 4PRHA 5EC1B 4LSRH 3MNVA 4Y2OA 1TETH 4U6VH 1FO0B 1JPGA 4ODUB 1QR4A 5DD1H 3MOQA 2V5TA 1G6RH 4NKOA 2VZUA 5HJ3B 2XN9B 3BPOC 1UKSA 5CBEB 4JR9L 3TIEB 4DOHB 1UZ8A 3KVQA 3QI9D 3MO1B 5HD8D 3VFNA 1JYVA 4P23A 3O3EA 3DNKA 2O5XH 4APQC 5IEKA 5BZDB 5JORB 2R2CA 3VWKB 1UM4H 4MHHG 1FP5A 1HOCA 4LP5A 2BMKA 5F72S 4TSAL 3SDDA 1BAFH 4ZXBD 3C2AH 5DEGB 2PO6B 4BK4A 2NY0D 3PQYD 4NC0B 1VCAA 4AEHH 1QBMH 4S0TD 2K1MA 4YUEL 3S4SB 2OTWA 3VD3A 3D18A 1ZGLA 3IKCB 3GZKA 2B39A 5MEOB 1EEZB 1H3VA 3OB0K 3GGWB 4CVWA 5JDJA 4KDVA 5ID0A 1U0QA 5I1KH 4PRNA 4CVZB 5B4MC 4LU5H 4MQSB 5D6CA 3KWWA 3GEWB 3NAAH 1NBQA 5E9DB 4NZRH 4WV1B 4OLXH 4PBVC 5K59F 2KL6A 3QUMH 5I8CA 4YPGB 2IANA 1Q9KB 2CUHA 5IB2A 1JHLH 4L4VE 2XFXB 3EHBC 3OKDA 4L8SA 2LU7A 5DVLA 3MRHB 4MNQB 1LO0L 4P2QD 8FABB 2MKLC 4HIJA 2C3WA 3RDTB 1Q9OA 1WITA 1PKQE 4WI5A 4HX1A 3J8F7 1U3YA 2DQGL 4QRRA 2B8OT 2Y23A 1YYLH 4OAWA 4KGJA 3HMXA 5HI3C 3LZFH 3DSNA 3MRFB 2FLRT 4OFVA 3L3DA 4XWOD 4TUOA 3ZKNC 2DI7A 3S36X 4OCRH 3JTSB 1YECH 4F9PA 1I75A 2A9NL 1JPTH 4HEPG 1A6UH 1K6QH 3L5XH 3ARVA 2JCCB 3IF1A 4YHMH 4G9FB 2NW2A 5IF0A 5I6XC 1EGJL 4LLYA 1S5HB 2FD6H 1A6TB 1C5DA 2YD6A 1N64L 1S7XA 2MPAH 3G6JE 3P3YA 1PEZA 5L88H 2IMNA 2FWOA 2B20A 2MKWA 2JE8A 4KK6D 4PUBH 1V7NH 1D6VH 5L7XL 4MJIB 3AREB 4O4YH 1XGUA 3WL9A 4BELD 4LPUA 1YMHA 3T2QA 3GMRB 3RWJA 1AKJB 3FKUS 4IMLA 4R9HA 5TPWL 3UPRB 1ED3A 4LFHD 5FO9B 3VXMB 2GUOB 4PJ8A 1B6UA 2N7AA 1OD7A 3I75A 4GQPH 4KRPC 1F4WL 1F00I 4LVHC 5IK3B 2DIJA 3D39D 5ABDE 3R8QA 1S7WA 3G5YB 2CD0A 2W0PA 4Z7VA 1NFDF 2CLZA 5IMLB 3HPJB 3CPLA 4ZO9A 3HMWH 4EI6A 5I19L 1J7VR 3T4YB 1INEL 3WFBH 2R4RH 4WO4B 1AQDB 4WU7B 1A5FL 3OX8A 1OTSC 4TULL 2CKBA 4G8EA 4ZS6C 4PJCB 2M2DA 2OZ4H 3FHAA 5EA0H 5AAWA 2YPLB 4R3SA 1HCVA 4GXUM 1A14L 5IFHL 2XZQH 4N5ED 5ACMA 2AJSH 4P5MB 3CFCL 4JFXA 4UNTA 1ZLWK 5BJTB 4KK8C 2F5BL 2VIRB 3QNYB 4RMWA 3BN9D 5JA9A 5D5MF 3C5ZA 4Z7UA 2X89D 2QQNL 3GSUB 4JGUA 3WNMA 2AKRB 5HHPA 5IG7A 5EOTA 4NCC1 1FFOA 4X80H 1U92B 1UGNA 3PWNB 2KH2B 2HT4D 5E95B 3RGHA 3L5WB 5GQBA 2H3NA 5LAXA 2P8LB 5EBMA 5ANMB 4M7ZC 5IW1B 1NFDA 3HNTL 3BRFA 1W0WB 4GMSL 1UM5H 2P5ED 4HUUA 1CR9L 1LO3L 1OARL 1UB6A 1YYMH 2G5RA 1QLRA 4KJPD 5FKAB 4OBSA 1I1FA 3OKKA 4KDTC 4J3XA 3F7QA 1ZKAA 1TPXB 5FHAL 1PZ5B 3HG1A 4WWKA 5IB4B 2Z8VC 5T1MB 1Q94A 5GISH 4DKFH 2WBJB 5I1DA 4XNZC 4W81A 1C7TA 3OV6A 1YEDB 3MGTB 2IWGA 2EDYA 5SWZB 3UZEA 3BMVA 4C55A 3FN0H 4LKCB 3QPXH 1OP9A 1M6OB 3RVWC 4MJ6A 3MLTA 4FQQB 3TEUA 5L8LB 4OZHA 4C54A 5EU6A 5DT1L 4NN5B 4DTGL 5F7NC 2H9GA 3NCJL 1KB5L 4BH7A 5DURB 3R06A 4R8WH 4QCIA 5KZCD 2NY5L 1J10A 2VZ3A 1U3JA 2ZCLH 2GTWB 2VXQH 1BFTA 4HS8L 4M7KL 5BXFB 3BGAA 3MGOA 4F3FA 1ZWIA 3DRQB 2DQIH 4JAMB 1LEIB 2BVTA 1A9EA 4P46D 5F97E 2ATKA 3C6LA 5DMKB 3DX9B 3F12B 3UTTE 1MFCL 1CXHA 1T5XA 3FO9A 5I1GL 2VDOL 2HLFD 2WINB 2OL3H 1RHHA 4ODTL 4UV7L 4S1RH 4Y16B 5DHVH 1WQVT 4GBXB 1PY4A 3M07A 5C6TH 1EHAA 1QSFE 4NQVA 5C0GB 2MCPL 4HLZH 2B5IB 5I8KL 1WBXB 4MA8H 3QXDA 1KFAL 4IJ3C 5FIEA 4DKAA 2D7TL 5EUKA 2PYEA 3MLRL 3GJFK 5EORH 4AQOA 2WWKO 2AV7B 1P4BH 1R5IB 5IESL 1K5NB 2FJFA 3U36B 4DGVH 1I9JH 3MRPB 7CGTA 1A0QL 3QO0A 1HINL 3STZA 1P4LA 4M4PA 1KPVB 4Y1AB 3BOVA 3TWCH 1GZQB 3MRIB 1LQSR 1W8OA 1JN6A 1JWMA 1PAMA 5DDHA 3BEVA 4MLSA 1I8MA 2E7BA 4XCNB 3QUZD 5DO2D 4JDVB 1P9MC 4OQTL 4PRIE 4RMUA 4E5XB 4LHUD 4ZDHB 3T0EB 3LKPB 1VFBB 4X8JB 1XR9A 5B39B 5EN2A 5I8OL 1FQ9C 1G7PA 4LSQL 1YEGH 2F5AH 3CVHB 5JMRA 3F7PC 5ACLA 5AAMA 4WFGD 1QLFB 4AL8L 3A6CL 3EFDH 2LVEA 4GRLD 1N3NB 4RNRB 1YQVL 2C26A 1OSPH 4LSSL 3P4LA 5ISZB 4XTRC 3NA4A 5FDWA 1I8IA 3QJFA 3MXWH 3CK0L 2DQDH 4PRBB 1F8TH 2EDNA 4NWUH 5JXAH 2F54E 3FQNA 4G6FD 3Q1SL 4PRHB 5H37G 2VXTL 3PWPE 4Y5XA 4I3GA 1WLHA 3TP4A 4PFEA 1MAML 3OWEA 1A6PA 3RVTC 3S3SA 4WGVB 2AXFA 4NKOB 4X6EA 2HVKB 4CKVX 3EO0A 3SKMB 3WS6C 1UZ8B 4AG4H 3D48R 1KLGA 1U8JA 3UYOD 3VFNB 2AJXL 4P23B 3O3EB 4JM2C 5IEKB 3O4LA 3IJHB 4JKPH 3WLBA 5HVWA 2MNUA 4R0LB 1T03L 3SDDB 4AK1A 1ITBB 1T3FA 1AY1H 4KGLA 6FABH 2QL1A 4PRPA 3BXNA 4OSUH 3VD7A 4F7MB 3F62A 1DBKH 4TQEL 1S5IH 4H5SA 4XWGL 3HE7A 3BISA 4CW1A 4HWBH 1ZA3B 1WISA 1XZ0A 4NO3B 2NZIA 2OTWB 4GG6F 1A4KA 3DXAE 4JFPB 1ZGLB 4BFEA 1WTLA 2A74A 2X42A 2O61A 3AC0A 2WBWB 4U1SA 5KANI 2X1WL 1NDGA 3UC0H 1N5YL 1T7YA 2EIBA 2G2RA 3GI8H 5JPMB 3QP3A 4JQXC 4CVUA 4JVWA 1AGEA 4M6OH 5TDOA 5F7FA 4F8TA 2Y6SD 1U8PA 4QTHA 4PRNB 3MXVH 4R4FH 2VL5A 1OPGH 3INUL 2PTVA 1NMBL 3SGEH 3PWLA 5F88A 4ZO8A 4PB0H 1AGDA 3O8XA 1A6ZA 3ZDXF 5F44A 5I8CB 1J0KA 4M02A 2IANB 3PQYE 2XN9D 3CZJA 5E4EB 5T33H 4KPHH 4L3AA 1JGUH 4FFYH 1J11A 5C0BA 1IGFH 4HIJB 2I60L 3L3HB 1Q9OB 3VWKD 4HX1B 4KAQH 3EO1A 1ZT4A 3LKOA 5GJSH 4PGDB 4RGMB 4QRRB 1OAQH 5LXGL 1N6UA 3LD8B 2BY3A 2PO6D 3P0YL 2ZCHH 3QHZH 4OAWB 2YN5A 2XV6B 1YEEH 3AMLA 4TUOB 3SKOA 4JFHE 1FZKA 1BP3B 1GH7A 1I3VA 4XBGA 3ULUC 3PL6D 3IF1B 1UM6H 1PKOA 2MMXA 1C1EL 2NW2B 4K23L 3QI9C 5IF0B 3REWA 2A9ML 1TJHL 4LLYB 3QYCA 3BJLA 3JV4A 5CP7A 1C5DB 3TVMC 2X70B 1B2WH 4YEEA 3OAYH 2AEPL 1T66C 3P4NA 1GGUA 4BZ1H 2FWOB 5FO8A 2VR4A 4ZXBC 1QSEB 4KI1A 3EYVA 1JYNA 1NBVH 3MLZH 5K9JL 2NY0C 5T5NF 5C0RL 2RFXA 4LCUA 1XGUB 3WL9B 1MELA 4ODVL 1YMHB 3QG6B 25C8H 2HRLA 3OG4B 1WBYA 5E9DD 5IB5A 3M8OL 1UWEL 2DF3A 2KQNA 1HWHB 2H26B 5TDNB 1SJXA 3MA9L 3U30B 2VXUH 4PJ8B 2VZVA 5HGAA 3I75B 4U1MA 1ND0A 5IR1A 1S7WB 1INDH 5FYLH 5DD3L 4LNRA 4D9LH 4Z7VB 2R0LL 4MNQD 5I1EH 4Y5YB 1IFHH 2CLZB 2P48B 4LSRL 4LMQE 1JGLL 3CPLB 5FF6A 4PJHF 3RDTD 3MCKA 4PP1C 4U6VL 4EI6B 1MRDH 1TDQA 3AVEA 5F1IB 3QEQB 4M1DH 3JVGA 3OX8B 5EB9A 1G6RL 2CKBB 5JXED 3QQ3A 4G8EB 4LQFH 4DFHA 4ZFFA 4X6CE 5EIIB 4Y7MA 3IDYB 5EC2A 2O5XL 3EDEA 4ZSOA 4Z7QF 4QKXB 3T0WA 1BEYH 4JFXB 1OTUC 1VEOA 4NZTL 4WHYH 4Z77A 4RIRA 4YBQD 4UOW0 1BAFL 1OF2A 5BVJB 2NY2B 3C2AL 2WBKA 1F11B 3I2CH 2W0FA 1Q9LB 3C5ZB 4DFIA 4KY1H 4ODSH 4Z7UB 1TQCB 5F1SA 5AG8A 1QBML 4EN3C 5IVXA 4GW1A 1XF1A 5IG7B 1FIEA 5HHPB 3EDJA 5EOTB 3RU8H 1YMMA 2EH8H 3KJ4C 1FFOB 4WW2C 2W9DL 2IH1A 4K3HA 1KC5H 5EBMB 4MJID 2DWEB 4PJFE 3ARED 2OYPA 4PIRF 5C08E 3LQAH 3QA3A 4U1LA 4HUUB 5GRJL 1AKJD 4L8DA 3DO7A 1QLRB 2F8XC 3U2SA 4W6XB 3SGJA 1X5FA 3OKKB 3VXMD 5I1KL 3TBVB 2V2WA 2CXKA 4MS8D 1B90A 3HG1B 5A3IC 2HJKA 4LU5L 4R2GD 3X12A 1UKQA 5IWLA 3I85A 1Q94B 5I1DB 1RY7B 3L5JA 3N1PC 3Q2CA 5D2NA 5JW5A 1FRGH 3PDDA 3FQWA 4NZRL 4KK6C 4OLXL 1Y6NR 4WO4D 3QUML 4MAUL 4MJ6B 3MLTB 5ILTH 1T0NA 1VGKA 4OZHB 1A64A 1FO0H 3KLDA 5EU6B 1JHLL 4DVBA 3ETBF 2AABH 4POZC 4BH7B 3R06B 3MLXH 4L3EE 1DANU 4QCIB 2YPLD 4U3CA 5TF0A 3DUUA 1WWWX 3MGOB 4OV5A 1AD0A 4WEUD 4F3FB 4Z76A 4HLJA 4WY7H 1OP5K 4WTXA 1MPAH 1RMFH 5F9JA 4WI9A 1YYLL 2L7UA 3VGAB 2Z31C 4CMHC 2ATKB 3D9AL 3TPKA 2GY5A 3C6LB 1I1CA 1OSZA 2E7LC 1YECL 3HNSL 1T5XB 2Q8BH 3F58L 3ARYA 2C1PA 1JPTL 1RHHB 1K6QL 3L5XL 4MD0B 4YHML 4FS0A 4GG6E 2F58H 1WZ1H 4M7JH 4D9QD 4WI4A 4NQVB 2X10A 2FD6L 3H9SA 4N5EC 1HI6A 3FONA 5K93A 2MPAL 3O6KL 4WI8A 5T1DH 5EUKB 2PYEB 4O02H 3BDYH 5FV2A 2EO1A 3BN9C 3IDIA 1HIML 2EZ0C 5LCVH 1ACYH 1V7NL 2FJFB 2AXGB 5D96B 3QAZB 1D6VL 4X9GA 2WBJD 3QO0B 4O4YL 5J11B 3STZB 1P4LB 2J88H 4WFHE 5DVNA 5SWZD 2DN7A 3IDNA 4BZYA 3QUKA 1JN6B 1JWMB 5DDHB 2HT4C 2BNUB 5IMOA 1YNTA 4X6BB 5E2VH 5EWIH 2OTPA 4C4KO 4FZEH 3QNZB 5E1HB 3IXAB 3FN3A 1RZ8A 3V6FA 1B3JA 2EYSB 4V2BA 5DURD 3CDYA 3GMOB 1XR9B 2ED9A 4YWGH 5EN2B 1IBGH 3AM8C 5ICZA 3HMWL 2H32H 3WFBL 2R4RL 5LJYH 2VLME 3ZHKA 5AG9A 5C0FA 5LQBL 1MJ8L 2OZ4L 5EA0L 4I3SH 3QDMA 3CH1A 4DGYH 2XZQL 3KGRA 4JRYB 2YA1A 1CTNA 2MCG1 5I1LA 1IQWH 2P8MB 1DJSA 4JDZA 5IMMA 4Y16D 3FQNB 2APVA 4GBXD 3I9GH 4Y5XB 1ZANH 3LAFA 4XXCC 1ULVA 4F7TA 1BVKA 2C3HA 3QFDA 1ZVSA 2AXFB 3EO9H 4X6EB 3EO0B 2XICA 3IETA 3CIQA 1KLGB 1U8JB 4UT7H 5KS9F 3ZT5A 4BFIA 1YN7A 1CZ8H 3O4LB 4Y1AD 1UM5L 3MV01 3RY6C 5KVFH 1YYML 4Y19A 1T3FB 3LQMA 3RPIA 4D0DA 4CJ0A 4PRPB 3BXNB 2Q87A 2Y25A 3HFMH 4H5SB 5F7WC 4CW1B 4JZJC 3MYZA 1A21A 1T89A 1CGTA 1YPZA 3T0ED 4DKFL 5HHOA 1XZ0B 2QSTA 5FYLE 4R26H 2J5LC 1HXMA 3FZUD 3P9LB 1A4KB 1T1ZA 4PJEB 4ZFOA 3FN0L 5IVZA 4LHJB 1KIRA 1FC1A 4NQXA 2O61B 4PJHE 4U1SB 4MA3A 3E2HB 5FYKD 1NDGB 4QNPF 3VMOA 3G5XA 3HI1A 3NA9L 5BV7C 3PGFH 2AEQH 4GQ9H 1FZMA 1AGEB 5TDOB 2R9HD 3B83A 3K7UA 3KPOA 1FYTA 1NL0L 3HAEG 5ISZD 1BWWA 4OUOA 2VXQL 3QUZC 5DO2C 4HJ0D 3NGBC 2AJUH 5MI0C 3OKNA 3VA6A 2BNQA 1J9CT 4XHJC 2VL5B 4Z7QE 2ATPA 2CSPA 4J12A 5FKPA 3SJVE 1UQSA 3PWLB 1WFTA 5F88B 5KS9A 5GRVL 4PRHD 4RBPK 4OZIF 1AGDB 1L4IA 4ZAKA 3VG9B 3O8XB 4HZLA 1A6ZB 3ALPA 2C4FU 1NBZA 1YC7A 4KTEH 5ALBH 2OL3L 4S1RL 1B6DA 4TTDD 5C6TL 4P23D 1CLOH 1B4RA 4Q9BA 5E6IB 1R3HA 4MA8L 4PJ7F 4PRAA 4FHBD 1GGTA 3DETD 3EO1B 3ILPB 1ZT4B 3LKOB 3SDDD 4X6FA 5TH2A 5EORL 1URLA 5HDBF 3C09B 4JCLA 3R0MA 4ZTPL 4OCXH 5ACZA 3TPUA 4DGVL 1I9JL 4Z0BH 4OBRA 5I76B 4IIQA 4UT9H 1DEEB 1EXUA 4DZ8A 1FZKB 3UJTL 4IOIA 5J12C 4PD4K 3K2UL 1YJDC 3TWCL 4X6DE 2RR3A 3JV4B 5CP7B 2NZ9D 1IAIM 3QQ4A 5B3JF 3P4NB 3B9KA 2GK2A 3U83A 3BDBA 5FO8B 1MFDH 4GS7C 3MBEB 2HKHH 5CILH 4DOHE 1Q1JL 2F5AL 2YA2A 4U33A 1KN2H 4M48L 4XRCA 4UTBH 2RFXB 4LCUB 5I9QB 3EFDL 3RRQA 4L4TA 3TBSA 1OSPL 1MLBA 3ULSB 1X5LA 3WXWH 1LD9A 5HGAB 4HUWA 2VQUA 4U1MB 1ND0B 2IAND 4XMLH 3DV6A 3ZSSA 2Y1VA 1F8TL 4LNRB 4NWUL 5JXAL 3PWVB 1Y18A 1LVEA 3ET9F 4IRJA 1N4XH 5FF6B 1KG0A 4AT6B 3MCKB 4PG9A 4H8WH 4QXTA 2BNRE 2EDQA 1TZIA 1DBBH 4QRRD 2GFBA 2P8PA 1DSFH 2MQ3A 3QQ3B 3FB6A 3FMGL 4AG4L 3QQ9D 4KDWA 3ZKXB 4N8CH 4ZSOB 1KJ3H 3PJSA 1HYSD 4JFDA 5D7JA 4JKPL 3LKQB 4Z77B 2GSIA 5TGBA 1OF2B 2VH5H 4XP1L 1AY1L 3LRHA 5DHYA 6FABL 3TYFA 4OSUL 3VXOA 1ZAGA 2W0FB 3WFDH 4JO1L 1AR2A 1WT5C 4X5LA 5IVXB 4FG6D 4GW1B 3QXWA 4UQ3A 4HWBL 4R90L 4OI7A 4ZOEA 1NH6A 1UYWH 1QSED 4OV6F 4M6ML 1PSKH 2PO6C 4K8RD 4Z95H 4QYOA 4NWTH 3KYKL 4L9LC 3C8HA 2IH1B 3T2NH 3GIZH 3G08A 1YNLH 3K8KA 3CVHH 4CNIA 3UC0L 4U1LB 1KPRA 1WZLA 1EFXB 5CEZD 1G7LA 3GI8L 2EDHA 4L8DB 3DO7B 1OAZL 3DO3A 3MRJB 3PL6C 2VQTA 4M6OL 3U2SB 4PJ8D 5EZOL 1S8DB 3NABH 3MXVL 5D1QA 3CSGA 3S97C 4R4FL 3UTZA 2HJKB 3W0WA 5IM7A 1OPGL 2MFNA 3X12B 3V6OC 1GGCH 3CCHA 4OZFG 3RWCB 3QIUA 3QQNA 5D2NB 1MWAB 5AYUH 5JW5B 4D8PA 4PB0L 5GGRA 3FQWB 5GSVA 1MSPA 4OIAA 1BF8A 4UB0H 5B8CA 4QHMB 4G9FE 2AXJA 3QEQD 2NXZB 1VGKB 1I7ZB 1G84A 3MLSH 3UXFA 1E4KC 2NY7L 4ENEC 5M7QA 3KXFA 4DVBB 1IC7H 5T33L 5LGHH 4KPHL 4WV1C 3KR3H 1JGUL 4IEFB 4JG0H 4XCYA 3ZTJG 1NFIA 1IGFL 5KG9A 4CUCA 1AD0B 3CFDA 2DLGA 4KAQL 4TRPH 5E08H 1PY9A 1T4KB 5GJSL 3MTRA 3C08H 2ZOLB 2NY2D 1OAQL 3EYUH 4KMQA 5I8EA 3ZDZF 4UOJA 4BSJA 3QPQC 3NIFF 2ZCHL 3QHZL 3VE0A 2WUCL 3C5ZD 3QUYA 4G8GA 3RDTC 4PG2A 1YEEL 3BRDA 2BFVL 4YHNA 5BMFH 1HHKA 5JXEC 4WGWB 1KULA 2ED7A 5CLTA 5IIEB 3QDJE 3WUZA 1Z6JT 5LKNA 4U3XA 4X4ZA 1RZKH 1HI6B 1B2WL 5C9KA 3B6SA 2YZ8A 4UAOC 2R0ZH 1CVSC 4BZ1L 1FNGA 4RMQA 3P0VH 5F1KC 4QOKA 5SX4H 1FL3A 4NRZA 1BFSA 1NBVL 3MLZL 3QIBA 5CSBA 4LLWB 3HG1D 2QSQA 2YD1A 5MP6H 1NPUA 4K55A 3H3PL 1D6EB 3RWGB 2DWDA 1Q8MA 1LHZA 3CXDH 3WHXA 4RX4A 3QUKB 1MEXL 2YK1H 4OZIE 5C3LD 5IMOB 5C2BL 1YNTB 3X13A 3SGKA 3FB8A 4N0FB 2JJTC 5EU6D 3AREC 4FP8H 5FGBC 5JIKA 2MHAA 5CD3A 1RZ8B 3V6FB 4UBDD 5FYLL 5I1EL 1IFHL 2RJMA 4QHKI 1IGTB 1ZLUH 5ICZB 1MRDL 3X3GH 1EBPA 3CU7A 4R2GC 5F70A 4M1DL 4D9QE 5ANME 4YDLB 5C0FB 5C9JA 2X40A 1PGRB 2YKLH 4LQFL 3C6LD 3MJGX 4EBQH 4XBEH 1YJDL 3CH1B 3SDAA 4XXDA 5GGQH 1T21A 3WBDA 5I1LB 4JDZB 5IMMB 3RHWF 1DUYB 3GMMA 4O58H 2Q3AA 2UVEA 2X1XR 4OD2A 4H0GA 3UX9B 4LSTH 4KFZC 3MZGB 4ODSL 3LEXA 1UC6A 1EEYA 3JWDC 3MRKB 3QFDB 3OL2A 4G80A 3RU8L 1ZVSB 2EH8L 5B3JE 2PYED 4K7PX 2YD8A 5CZXD 1BJ1H 5C0AE 1NGZB 3IETB 2R0WH 1BMGA 4LLAA 1MLCA 1KC5L 1TJGH 4K8RH 3U82B 2DDQH 1XF5A 3TN0B 4BFIB 1JZ7A 1M71A 1YN7B 2MQ0A 3LQAL 3ARUA 3C9NA 4EI5C 4NNPH 4EXKA 3R1GH 1AFVH 4JE4B 3V8CA 2VXSH 2UUDK 5LBSH 3ARXA 3KYNB 3BZDA 3OHXB 3RPIB 4D0DB 5CEZH 3IDGB 1U42A 5DJAA 1WC7A 4YPJA 3BPLB 5F21B 3QIWB 5ICYA 4PJBF 4NP4H 1YPZB 1JBJA 2PTTA 3V5HA 4XMPH 4ZFOB 2ZG2A 1FRGL 1T1ZB 4RA0C 5IVZB 2V5YA 3UAJC 2CDGA 4NQXB 3EJZD 5ILTL 2I24N 4MA3B 1FO0L 3G5XB 3HI1B 4DN4H 3QFJA 5I1HH 1ZSDA 1TLKA 3OSKA 4TVPD 2PXYA 3MLXL 3P0GB 3KPOB 1FYTB 4JRYD 3VXSE 1LDPH 3NFPA 2DQHL 1IMHC 2WWMD 3U4BL 1YNKH 4NN5C 4WY7L 4C56A 5FKPB 1RMFL 5ADPH 1UQSB 3IJYA 5FUOH 4JFOA 3GSNA 4X5XB 5GS3A 5J57B 3TO4C 4ZAKB 3DHJA 2QEJA 1NBZB 1ZMYA 1G9NH 1SVZA 5MENA 2Q8BL 5HY9A 5KSAB 5IP4A 5BRZE 4F7PA 3T0EE 1FNEA 3DSFH 4PJBA 1WZ1L 4QRTA 3FAXA 2VLKA 1R3HB 4PRAB 5FGRA 3O4LD 5D6DC 1RURH 2W92A 1FVDB 4XVJH 2JJSC 4GKZB 5EDXA 4X7TA 4X6FB 5CHNA 4O02L 1BWMA 2ZP0T 4PRPD 1CFNA 2CLVA 3IGAA 4UILH 4GRMA 1G9MC 1K3ZA 5LCVL 1ACYL 5DI8B 3L5IA 1KXVC 1QD0A 3TPUB 5ACZB 5DD5H 4IIQB 1Y0LB 4XCFH 4ESKA 1EXUB 1KB9J 4DZ8B 5A40E 5H37H 2J88L 4WHTA 3MV7A 5CJ5A 5E2VL 5EWIL 1EVTC 2AK1H 4PRHE 1OP3K 4WENB 4HG4J 2FX8H 3DBXB 3B9KB 5HGBA 4WU5A 5DEFA 5JQHC 2PYFA 3TNNB 1IBGL 3FO1A 2BVPA 3CFBA 2V7NB 3RVUC 1PEWA 5IB3A 5LVEA 3JWOC 1H8OA 1MCQA 3G5ZA 1UKTA 4L4TB 3C8KA 3L95B 1DQQB 1UFUA 3TBSB 3IFNH 4Y4FC 1NEUA 2I26N 2XWTA 3LDBB 2VLRA 1ZVYA 1MLBB 3ZDZE 3O8XD 4I3SL 2M1KA 3NIFE 4DGYL 4PYHA 2F8VA 2OR9L 3TT3L 3CUPA 1GC1C 4HUWB 3DV6B 1IQWL 1R5WA 4N0RA 4F80A 1S9XA 5JR1H 5HYJE 1N5AA 2XXCB 3I9GL 4YHYB 1KG0B 5E6ID 3TBYA 4PGZA 4PG9B