3LRSB

Structure of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG-16 Heavy Chain Fab
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 211
sequence length 211
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsB02
4QCIA 4EUPH 3EYFA 4ELME 5C0BD 3OAUH 4U1LB 5IP4A 2R69H 3T1WA 4DZ8B 3V4UH 1NANI 4S1DC 2X2YA 3I2CL 5E6ZA 5A3IC 1D6EB 2VQ1B 1BLNB 3PJSB 2X4SB 2RAMA 1ZWIB 1BFVL 1FAIH 4MQXD 4GG8B 4NQEE 4UIKH 3EJYD 3H42H 2OQJB 2JCCA 1IM9D 3F5WA 2DKSA 3O2WH 2NTFA 4HIHB 1X9QA 3IDUA 4TN9A 5IMKA 2KUTA 3WHE0 5EU3A 3D25A 1T04B 3DVNB 3GIVA 2HH0H 4GQPH 4PRBA 3FTGA 3WDJA 2Q20A 3ZKMD 5KJRL 3BOVA 4JR9L 5IK3B 2ZCLL 1YEHH 2R0ZH 1RUAH 5D1ZB 1G7IA 1LD9B 1MHHA 1LEIB 3PE9A 4QWWD 4XC3L 5MEND 4HXAH 3QJHB 4I3RL 1U93A 4GKOA 4M7LH 3TJEL 1UJ3C 1ED3B 3JV6B 5KZCB 3PWJA 1NLDL 1KELH 5KSBE 4LCWB 2VR9A 4KKLC 4LCCB 2AABL 4KGLA 1MJJA 2DQTH 4M1CC 4U2ZA 1BFOB 2HT3D 1KN2L 3STLB 1MRCL 1TLKA 4KKBD 5I73B 1K8IB 4GMTH 3AAZB 4Z7UB 1JI1A 3MLWL 4X5WB 4MCZB 4X4ZA 3N1FC 4G8EA 4OLZL 3MLSL 1BAFL 5M7QA 3L95B 2UY6A 3MOAH 1F6LL 1BD2B 2BSTA 2BVUA 5E2VL 2E8YA 4ONFL 4I3SH 3WBDA 4PRHE 4PJXB 1T4KA 2VDMH 5E1AA 2EDBA 3JTTA 4PLKC 2I60H 5F72S 4P3WA 4GW1B 3FO2B 4L3EA 4Q0XL 1YECL 5HHME 4BZYA 3RBSA 5ALCL 5J11B 2EXWC 4NGHH 4K9EH 2AK4B 4NHCL 2DJUA 4IS6A 5F97E 3ZZ1A 2YN5A 1P1ZB 2X9XA 3RNKB 4MZ2A 3QCVH 1KEMH 3EDDA 5C7XL 5F7WC 4WV1B 5BVJA 2PCPB 4Y19D 4NWTH 2ID5A 3UTSA 4YHLH 2FATL 2BDNL 3T2NH 3MLXH 4LGPB 2DMKA 3VWJB 4JHWH 3WJJA 4S10A 4LCUA 3EDEA 3QEHA 5F1IB 4XWOD 2YA1A 35C8L 1YEIL 3CFEA 3JWOH 1P4LB 4YPGA 5IKCB 1X5FA 4LLMB 2X9WA 3K3QA 1ODAA 3BKYL 4NZTL 3QSKB 3SJVE 4KQ4H 5K9JH 2F53E 2IADA 4FQXD 1A9BB 1JHKH 2VB5A 1OM3L 5FHAL 4L8SB 2R1XB 5F3HB 5ESVB 1MVFA 1PEZA 4RMQA 5D5MF 1PZUB 2YC1A 3QPQD 1HEZA 2H2SD 1MCOL 1SJHB 1JVKA 2BNRE 5I66A 5T1MB 3S88H 3QDJD 5DMKB 2Z9TA 3ARFD 3VG9C 3TEUA 5I16A 1FO0H 1I1YB 2L0DA 5AZ2H 5JLZA 4Q2ZA 1JHTB 1S3KL 2EKJA 2KH2B 4ZDHB 4IIQC 2IPTH 5DD0L 2A1WL 1NC2A 5ANME 1JWMA 1AHWB 1IQDA 1TZIB 4KK6C 4RGMB 3BZEA 3VWKA 4RGOH 1FZMB 3AREC 3CSGA 4KKAD 4LSQL 4HWEL 1K8DA 4HH8A 1MJ7H 2AJ3B 3I3DA 4Q6IB 2R23B 2JELL 4RFNC 1UJ3A 4FS0A 3PP3K 4NRZB 2MKWA 3MRRA 1PY9A 5FUCC 1XGPA 4Y2DC 1UCTA 4WU5B 3VXRE 3WKMH 3IU3A 3V0WH 5F7MC 4LF3A 1U3HD 2VISB 1BQUA 3HE6A 1AGEB 3DURB 2C3HA 4U1MA 1Q0XL 3BE1L 4MA3A 2IAMA 3MOBH 3KLAB 3QG7L 2ADJB 2GYSA 1P2CA 3JXAA 3RWEA 1ND0B 4MX7A 4ERSL 3OJMB 4C4KT 3TVMC 2WBJD 3DX9B 3EKCA 3IGAA 5GRJL 2FX7H 4L3CA 3WJLC 1JYXA 1KCKA 4NT6B 5I15H 3EYQD 5JIKA 4YFDB 3X12A 3BVNA 1NCCL 3RY4A 4IRSD 3ZHDA 1EVTC 3VI4E 4OIBA 2Z31B 5DK2A 2FEEI 4MQXC 5J6GA 3O6LL 1R3IH 3EJYC 1PW3A 1UG9A 2BMKB 4P2RD 1YMMD 3HC4H 1S7XB 4XPTL 4G8GB 4S2SB 5JOFA 2HN7A 1P7QD 5DD3L 3D1MC 4R7DA 1FVEB 4EI5D 2DD8H 1GGCH 2JF1A 2ZOLA 4CN4A 1MHEA 1FZOB 3ILPB 1KACB 2YEZB 4H20L 3FAXA 3ZKMC 1FHGA 2XFXA 3ESVF 3GSRB 1BZ9A 4XGZB 4YDIL 1WBZB 3QIUD 1QQDA 5E4EC 2CK2A 2HJLB 4E0RA 2GJ6E 5D7IE 1D9KB 4QWWC 4CVXB 3FB5A 4U1NB 4YR6A 4NOFA 1C16B 1MRDH 4EUPB 2YSSA 4LLWB 4FZ8H 3HNVH 1OLLA 3DX7A 4JJ5A 2VOTA 4HK3J 5TE7L 4LKCA 3ULVH 1JFQH 4J3OC 4LCIL 2V7HB 3BPCA 4CVWA 3NABL 3CCHB 3QUYA 2APFA 4M1GH 1GPOH 5LCVL 5DMJB 5ADOL 1ZHKA 4U6YA 3L3HA 5F9WC 3ULVE 4KKBC 3MCKA 2P45B 4J3XA 2OLDA 3IVKB 1G7MA 4PJIF 5J06A 5ELIA 3BH8B 4J8RB 3ABZA 1IM3A 3RWGA 5CEZD 5MERB 1RJLA 3HPLA 3KPRA 1PFCA 3RUGF 5INDA 1OL0A 3KPSB 4RNRB 5FYJL 2D4DA 2ESVA 4F80A 2EDLA 3THMH 3RL2A 3TH2T 1QSEB 3VXMD 1SY6H 2X89D 1Q38A 5BOPA 1MI5E 2UZIL 3IF1B 3OX8B 3SJVD 3AREA 1MJ8H 3MV8E 4JN2A 3BHBB 4M5ZH 1KJVB 5JNYB 4DVBA 3ARDC 5IB5A 3F7VB 1WFTA 1WWBX 5HJ3B 2J5LB 2CO7B 3C8DA 3DYMA 1DR9A 5CIPA 1OSPL 2GFBB 4ZFFA 3GEWB 5HVWA 3FMGH 4LVNB 3P0YH 2BNRD 4JKWA 1UWGH 4I48A 4NO3A 1BIIA 4UT9H 5J9PB 4WW1B 4G7VH 1A6TB 1JN6A 1IGFL 5ILTL 4LGRB 1VACB 1J8HB 3TVMA 1A22B 5LWYL 5FFLA 4HS8H 5GXBB 1UJTA 3IDNB 3WJLA 5JPMA 5GIRB 4DK6A 3BJ91 2WWKT 4NSKA 3OWEA 2NXZD 1N8ZA 3EO9L 4HIXL 2F58L 3BP7B 1L7TL 1A1NA 3QPQC 1M6OA 2WW8A 4PY7B 1BVKA 1HXMA 2DI7A 3ROLA 1QBMH 2XI9A 3GMMA 1FNEB 1AKJD 3TBYA 3T09A 3ARFC 3I02A 3LS4L 4FFWD 5BRZB 5DK0A 1ORQB 3QI9B 1AY1L 4C83B 2P42B 4PGBA 3VFRB 3P9LA 4E41B 3N9GL 3QIWC 1G6VK 4M62L 4MNQE 5LGHL 1ZA6A 4XNXL 5BZWB 1QSFB 1U8HB 3CNKA 3V5KB 3DUSB 4HS3A 3QIBD 5EWIL 4QHNB 3H3BC 5IEHB 5IW1B 4XPGH 5MENA 3OKDB 2XRAL 4XNUL 4BQCA 3GGWB 4P9HC 3B9EA 3G6AA 4PJ7F 3VD3A 1LEKA 4ZQKB 5IBUG 3TA3B 4PG9A 3B5HA 3KR3L 4DKFH 4LSPL 5CZVH 2VLKA 3W0WD 4F7EB 4HUMB 4FQQB 5E8EA 1TZGL 4JPWL 4FQIL 4NUJB 1FFOB 4MS8D 3KYNA 5CINH 1KTKE 5HYFA 1EAJA 1FO0B 3NZHH 1FV1B 4M9OA 1DUZA 5F70A 2WBJC 4DN3L 4NKIH 5E08H 2YMXL 4R97C 1Q72H 3EYQC 3B8YA 2RBLA 2Y07H 3QG6A 5KOVC 3SCMD 4KI5D 4PRPB 4IRSC 3TYGL 4HC1H 4NM8L 4BZ2L 4G6KL 1CD8A 2E9JA 3O6KH 4PGCB 4DUXA 3WUZA 4WFHD 5HHNA 2DQDL 4Z7VA 3ROOB 4XX1E 4TVPH 2DKUA 3PGCB 5FYLH 3VGFA 4EI5C 4OD2A 2VL4A 2W92A 4WO4B 1FYTA 3GSUA 4FG6C 3ARDA 3B9KD 3BGFB 4GUPA 4YHZL 1TVBB 1QLFA 2FBJH 5E2WL 3BP5B 2BVOA 5EORH 1EXUB 3O3BB 3B9AA 3QIUC 1ETZA 5I1GH 4TVPE 1L7IH 5FYLE 2NY6B 2GTWA 1IC7L 4HIIB 5AEAA 1JMZA 2HLAA 4R8WH 3I6LD 2ZKHH 1ZLWK 3LQZA 1RV6X 1RK0B 2QQLH 3FQNA 3BWAB 1RJZB 1QA9B 1E6OL 3OPZH 5D7LB 3L3IB 3CJJA 3MNVB 1D3CA 1XR9B 5ALBL 3X3FL 4YX2L 4UNTA 3D39E 5IQ7H 1CYGA 3MRHA 3F6IA 1BQLH 1ZVSB 3VXQA 1N7ML 4TUJA 3MRJA 4ODVL 1BJ8A 4EQ2A 3I9GL 4R4BA 3PWPE 2XPGB 4O2FB 3QDAA 5C0JB 3UC0H 1DLHB 3NFSL 3DWTA 1FORL 1DZBA 2YZ8A 1GOHA 5IIEA 1IAOA 4XVUD 5D6DC 4FQPA 3OJDA 5H37G 2APTA 4WNQB 1J1PL 3CVHH 4Y7MA 4H5SB 2BNUB 4PREB 4HLZG 1G9MC 1I4FA 1T0MA 2MQ3A 3QIWA 4CU6A 3G9AB 4KAQH 1RIVH 2H32A 3DBXB 1KBGL 2QKIA 5J0BA 1LO5B 4DK3A 4OSUL 3D2UB 4P48A 1PG7X 4QHLB 4P57B 4ELMA 1RHFA 3JWOC 4G9FE 5EBLB 1MCFA 4YHML 2ENSA 3LN9A 1NL0L 4GXUN 5JHDE 3MLPA 2EIEA 3TCLA 1YN7A 4MXWH 4O5LL 2P5WD 2HT4C 4NQEA 5C71A 2AJSH 3P0VL 1RZGB 2YD3A 2A6JB 1O5DT 3MTRA 2J3SA 4YBLC 4GKZB 2GSGB 3Q5YA 1FIEA 2D0HA 4EBQL 4NO0D 4FQ2L 3VGAC 4PJBE 2YPKA 1C12B 1EJ6A 3KPNB 4JRYE 3O6FB 1MCCA 3DVGA 2WIIB 3H9SB 3KHQA 4MSWB 3G6JE 2AGJH 2R2HB 4XT1C 2NY5C 4LRNH 2VR5A 1VEMA 4IRSA 2FJGA 2YD2A 5MI0C 2WV3A 3AXLA 4ZFGL 3QRFM 5KSBA 1DEEA 2VDKH 1EUTA 1I8MB 3U7AA 2FX9L 2Q8BL 1P7QA 4RIRA 5E8DH 1T1WB 1UQSA 2GUOA 2BSED 1MCQA 1VADA 5IQ9B 4X7DC 1T7WA 3CC5A 4P9HL 4YE4L 2P1YA 4UNVA 2CQVA 3HLAB 3LPGA 4HV8B 2YR3A 4HIEB 2GAZA 4ODXA 4XNMA 5GZND 3OAUL 3QIBC 3V4UL 3DI3B 1ZT4B 1WICA 3KS0H 3O4LB 4AYFA 2HKHH 1K6QH 4EUPG 1FAIL 1KCSH 4UIKL 3SDCD 5A43C 2QQNL 4PRHA 5F9JB 4AQ1B 3S35X 3C87A 5KG9B 4Q97A 4Z7NE 4QNPF 2ATKB 4LASH 3F12A 3KJ4C 5TQ0H 3ORJA 1HHHA 5I6XB 1HH6B 2HH0L 5K9QI 4IOIB 3LEXA 2XKSA 3BESR 1YEHL 2R0ZL 2OSLB 2Y25A 1LE5B 3FFCB 4ZTPH 2Q7NA 5C0FA 4Z8FL 3NAAH 5IBTH 5FIEA 5SV3A 4HXAL 4M7LL 3W81A 1H0DA 1R5IB 1RJYA 2W59A 2EDRA 3EOBB 5D6DA 3SCMC 1VESA 4KI5C 4YHIB 4RGNE 4YXKH 2WLZA 2X4PA 5FCUH 1QRNB 4HMEA 1P4IH 3E6FA 2VQTA 2JJWA 5A2KH 4LCYB 3VXMA 5B3JE 1Z5LB 2DQTL 3UTPE 1ZT7B 4NKMA 2XG5A 2VKXA 3QAZB 3DHMA 5CD3A 1NFKA 1XMWA 3SJVA 4UU9A 3TPUA 1DUYB 2CDFA 1CF8H 2D7TH 3B9KC 2F53A 4X7TB 4GMTL 3HC0A 2VAAB 1XH3B 3PWPD 1ZLWH 2VITA 4ODHH 3IFOA 3VRIA 1BZQK 4A2MA 1IC5L 3HG1B 3QUZD 1AR2A 5FYKD 2EDHA 1F3DJ 3BO8B 4M8QA 3ULUF 3LD8B 2BNRA 2FD6H 4I3SL 4QRTA 4TPRH 4IDLA 1CLYH 2VDML 4Y4HD 2I60L 5A2FA 1GHFH 2CKBH 3PWNA 3EOAA 2WQRA 3MOQA 3EGSB 3WIFA 5ANMA 3OQ3B 5L9DL 1RJCA 2VXUH 2YZ1A 4K9EL 1B2WL 2R4RL 1EHNA 2IPUG 3LPWA 5AD0A 5K9QG 2CDGA 2ENYA 4NQCE 1KEML 3SO3B 4FXGB 1FN4A 1MJUH 5DDHB 4MD0A 1JYWA 2O5YH 1NAMB 4NWTL 3FO0H 5T3ZE 1QYGH 5CEXA 3L7EB 1ZSDB 3TO2B 3T2NL 3MLXL 2MQ0A 3F58H 4XVUC 1AKJA 3QDGD 1HHGB 3VXRA 4JHWL 1DQLH 5DMGD 1C5DB 3JWOL 5GGSB 5FM5O 1KIQA 5E8PB 1INEH 1NUFA 7FABH 4R96A 3QEQB 3U4BH 1NSNH 1S8DA 5FO9A 1KLGB 3SDAB 1GZPA 3DARA 4KRPD 4PR5B 4KQ4L 2RCSH 5CP7A 1JHKL 1SMAA 1FNLA 5H35B 5DK3A 4P59H 3UTZB 3ZSTA 4G6AD 5BO1H 1C1EL 4CU7A 2V9QA 3S3JA 1BF2A 3HRZB 3S88L 4PB0H 3QO0B 3W2DL 4LNRB 3DO7A 4G5ZL 5E8OA 3LPFA 3LRHA 4J3UA 1T0NB 1YNKL 5AZ2L 2NY5L 4PGEB 4X4XB 1IZJA 2IPTL 3V5DB 5HHOE 1A6AA 3PQYE 4WUUB 3D18B 1JPSH 4YGVA 4RGOL 1H3VA 5EZIH 5FF6B 3W39A 1BOYA 4B0MM 1MJ7L 1AIFB 2GSIB 4HUWB 4P3DA 3D85D 2GJ6A 5D7IA 1J0JA 3QHTC 1CGYA 3WCYA 1F4HA 3SCMA 3OJ2C 4I0CC 3D3VD 4M7ZC 2XICA 5D7SH 1RU9L 4JHBA 2W60B 1IAIH 3E1F1 5IM7A 5FM5M 3DOSA 3C5ZD 5DJ2A 3NCYS 4EIGB 5FKPA 3MOBL 5JOPD 3IJYA 3B9KA 4LLUB 1A6ZB 1HQ4B 2UWEF 3RZCB 3ZE0E 5HYSA 3WFEL 3MSPA 2FX7L 3CMGA 1CN4A 3UTQA 5I15L 4F57H 3KYAA 2BERA 1HH9A 5GISH 5GGQH 5IBLD 4OGXH 1Z0NA 4B53A 2WP3T 3SDCC 5EC1B 4RGND 1R3IL 4OF3A 5E8NA 2EYTA 4P23D 3TNNA 1JGEB 3HC4L 4UDTA 3SPVA 2VLJE 4F2MA 4R90H 4RDQG 1UM6L 1NFIB 4MDJB 3MLZH 1GGCL 5DJAB 3SE4A 4LSDA 1F4YH 4K7PH 3DPBA 3ARBB 4GRLC 3FHQA 1EPFA 1ZMYA 3CIQA 3MV8A 1N6VA 5D7JB 1KLUB 5FM4A 1G7HB 3DXAE 1FJ1B 4HJ0D 2FGZA 5GSRB 3UX9B 3RIAK 3U30C 1DBJL 1NBYB 4C56E 1SY6A 4O51B 4LPVA 1JWSB 1AR1D 4X9HA 4Z76A 1URLA 3DX6B 4QRRB 3HNVL 2IBBA 4J7RA 3PHOB 1V7MH 2XKUA 5L6YH 1YPZE 3ULVL 5FK9B 1JFQL 2VC2L 4HQQH 4XVJL 2GJZB 3FCTA 1T83A 4HS6B 5L0QB 4L8BB 4WI9A 5F1OB 5TQ2H 5CKAA 3AMLA 3LIZL 4ZYKA 5A16A 2C1OB 1F42A 4QRUB 4UILL 1GPOL 1MRFH 1QR1B 2YUWA 5HYSG 2E7BA 1IBGH 2WUBH 4WI4A 1YUHA 3ZDXE 4X4YB 1M71B 4P2QB 3UPAA 4NQCD 1YNLH 5CGMA 5SWSD 5D6CA 5DWUH 5FKAA 3RI5F 4NKOA 1E4KC 3KXFD 4M6NH 5T3ZD 1J1XH 1ES0B 4XNZB 3GHBH 1S9YA 2JJUA 1N3NB 4HG4J 3OKKA 5DD5L 4WTWA 2PO6D 4NZUL 3FONA 3T65B 4MJ5A 4Y4HC 3EHBD 1ZS8A 1I3VA 3O3EB 2JLLA 3REWA 3FB6A 5KN5A 1SY6L 4PJAB 4MNQA 5IESH 4MGXA 4R3SB 2VDPH 4M5ZL 1MF2L 3VFVA 4XP5H 1YEGH 3ETBF 1U8MB 5EU6E 5ISZE 1H8SA 4HKXA 2GTZB 4XPFH 3FMGL 1JZ5A 1N59B 4N0UE 1T1ZB 2K1MA 1JWUB 4KU1A 5CJOL 3NGBC 3BP6B 1KT2A 1DQQA 1L6ZA 4RAVB 5EO0B 1OP5K 1FDLH 3ECBA 4GRWH 4G7VL 1INDL 3PGDA 3UMTA 2L7JA 1ITCA 3IFPA 1JTTA 1DJSA 5JO5B 2ADIB 4OLXH 5HHOD 4HJGB 1D5IH 1P5UA 3MJ6A 3PQYD 4IDJH 4OF5A 2VN4A 1WT5C 1AO7D 2JB6A 4X99B 5AWNH 4PV9A 3QYCA 4KRMB 4HS8L 5KS9B 2G9HB 4U4BA 5DHVA 4Z7UF 5IVZB 3KPQA 5GGRA 2VLRB 4G6AC 3BZDA 3T4YB 3L6FB 1QBML 4H8WC 5E6IB 4D9QE 2YK1H 2EE6A 2QHRH 1QOKA 4UQ3B 5IG7A 1TXKA 1VHPA 4G42A 1QO3B 3OKMB 3SDXE 3TBSB 4LPTA 3C5JB 5GS0D 3MFFB 1BM3H 4GRLA 3CAFA 2Z93B 1IEAB 3MV9B 2H6PB 3FT4A 4JCLA 5C70A 2NCMA 2DLHA 5AUMA 4CGTA 2YUZA 4G43B 3KYMB 1G0DA 3TYFA 4ZFZB 7CGTA 2Y23A 2BY2A 3OKNA 1VENA 3K1DA 5D1ZD 2Q86B 2I24N 3QDHA 3WFBL 3L7FA 4O2CB 5B39B 3LQAH 3TM6A 3OKLA 1DDHA 2DTSA 3HZVA 3WLWC 4NNXB 5CLTA 5KZCD 2CPCA 4X8JB 4MXVE 3SBWC 25C8H 5F9OH 5ENWA 1CWVA 5C3LD 3C5ZC 1YEJH 4OLYL 4ENED 4NJ9H 3GM0A 3RWIA 3D39A 2X1XR 1NKRA 2P47B 1U91A 5CINL 2H1PH 3NZHL 3CU7A 2VRAA 5FA3A 1FFQA 3ES6B 5GGRY 3PWPA 4DJMA 5DHYA 1F8TL 3QUXA 2AW2A 1II4E 1E4KA 2BJMH 4G7YH 1CIUA 1Q72L 2FR4A 2FJHA 3AB0B 5IMMA 1JRHH 1J12A 4H26B 5IBLC 5I71B 4FXLA 5I9QB 1R3HB 5HDBF 5I1LB 4WFGE 4RGNC 4MD5B 3O6KL 3OAYK 4Y4HA 5IB2A 5JIPA 3BKML 4WJ5A 3WS3A 5IUSA 3FT2B 3KJ6H 2AJVH 4P23C 4XX1G 1MCWW 1LWRA 1P53A 4DOHB 3WSQH 2AKRB 3BKJL 5I2IA 2OXHA 4NNYA 4TVPL 2W91A 3MA9L 5FYLL 2PYEB 5GGUA 2VR4A 3U36A 2XN9E 3VJ6B 4MQSB 5F89B 4NQDE 2E8ZA 4YAQB 1MREL 4LSTH 3CVHA 3RVUD 5EORL 4HJ0C 1JF1A 3EJZD 5F7EH 4G9FA 4EDWH 5I1GL 1DBAH 3REVA 4CNIA 4YQXH 5ADPH 2ZSWA 5JHDA 5E9DE 1DBKH 1EFXB 4JHZA 1DQTA 3ZTNH 5HHPA 4XAWH 1AR1C 4NN6B 4DKDC 4JG1H 2ZUUA 3OPZL 4IRJA 2ZUSA 3IDIA 1S9KC 1M7DA 2XIDA 4Z7WE 2Q87A 3ARXA 1XGTA 3LAFA 3L5JA 2WINA 5HSFA 1TPXC 4JY6A 4PJBA 3ARSA 2XA8H 3U4EB 5J89A 4OZFH 4JRYA 4HFUH 3RU8L 1OW0C 1BQLL 4N0YL 3CFDB 4F37F 4EN3C 1CDIA 2G2RA 3G6JA 4X5XA 5DC9B 1K5NB 4X80L 1CQKA 4QO1A 3T08A 3U6RA 5TDOA 5ISZD 4KHXH 5A40E 3QJFB 1DBMH 2LV4A 5DRWB 4JDVA 4ZO7A 3WS6A 5C0IB 4DW2H 4HUXB 5BVPH 2PO6C 4ODWA 3CVHL 4P2YA 2O26U 3EHBC 1CXFA 5EOQL 2VIRB 3P11H 4H0HB 4U6XA 1NEZB 1XGUB 3OKOA 2BRRL 3FQTB 1EBAA 4DZBA 4EDXA 3VGEA 2P7TB 1EIBA 5F7KC 2JIXA 5EUKB 4FQHB 1D5XB 2P4AB 1DVFC 3BSZH 1OP5H 1XGQB 2I5YH 4JANB 1H3TA 4YPJA 3UPRB 4K55A 4MXWL 2DLGA 2AJSL 2YUVA 1VFMA 2IBGA 3EDFA 1I3RB 3H9HA 4PP2A 4RMTA 4Y16A 1JYNA 4AEFA 4L4TE 4YHNB 4XMLH 3C5ZA 5AYUL 1GGYA 2HVKA 3FRPA 4UBDC 4PRDB 1MCSA 3HCVA 4ZXBA 2D3VA 5EBMB 4UQ2A 2Y36H 4H8WL 1GOGA 3N85H 3KYKH 3IDMA 1JGDB 3PIQB 2AGJL 1QSFE 3GBLA 3FRUB 4LRNL 5ECJE 3O6MH 2DDQH 5DR5L 1FFNB 4BSVB 4MMZC 2X40A 1ZEAL 5D93B 1KPVA 5KSBF 2NZIA 1KENL 2VDKL 4P23A 5I8OL 1ZHLA 4XP9L 4HGKC 3HS0B 2WIMA 2FL5A 2Z31D 4GRMA 2F74B 3RL1A 3P4MB 3EDKA 4D0CA 3S36H 2VE6A 3DUUA 3G5VA 5GS0C 4GAGL 4I5BB 4G8GD 3JV4B 2CO6B 3UXFA 4IEFB 4TULL 1LO2H 1RHHA 2ATPA 4GRWB 1JYVA 1DQJA 3JVGA 2B4CC 1A6PA 1CICA 4UV4H 4YK4C 5L2JB 1UXWA 3WLBB 1WZ1H 2XWBA 2ZCHH 3MGOA 4JGUA 4Z5RB 5ABDE 3K7UA 1K6QL 3LVEA 4MCYB 1FNGB 3VFUB 4HAFA 3DV6A 4OLVH 1D9KD 4YHPA 3O4OB 5TGBB 4PJ5B 3CSPA 3MV11 4WFGD 3SE8H 1IFHH 3MRPB 3GJFA 1WQVT 3FRPG 4X6CB 1EO5A 5EOTB 1WAAF 2PTUA 1Y6MR 4UI2A 2V5YA 5FO8B 4JDTH 3B4NA 5D1QB 1OW0A 2FX8L 2AJUL 4MNHA 4U1GC 4K71B 4EN3A 1U8OA 4ZUTB 2HP4A 5D96B 5TDPB 4LFHG 3WXWH 2CKBA 3NAAL 4NQCA 5IBTL 2DLTA 3S5LB 4P2CG 2VUYA 3U83A 3OAYH 3TWCH 3CXDL 4FRWA 5JW3H 2VWEE 1HDMA 4KJWD 1QFUL 4AK1A 5FCSH 3CFJA 4NN7B 5ID1B 1AE6H 3QQ4B 1B0RB 3EW3B 3MCLL 4HHAA 1P4IL 2ARJB 3KPSD 2XYCA 4NHUA 5J13B 1MCLA 4R7NB 4G8FA 4WW2C 4QRQA 3S37X 5AAWA 3U7YH 1T5XB 4Z78A 1QSED 2F5BL 1FPTH 2OTWA 4KMLB 4PJHE 5DJZB 2VLLB 5FOJA 2NY0D 3EFDL 5J8OA 3ZT5A 2BY1A 4FOMA 1E4XL 4ZS6D 1DVFA 3ARZA 4P4RA 3RVUC 4OGAD 5EO9B 3OB0K 3PUCA 2ITCA 3EJZC 1QHOA 4PJFB 1GGBL 1ZA3A 1HOCA 3CZFA 4X6EB 3HZMA 3JV0A 4M43H 4YXHH 2OMNA 3ZKXC 5FUOH 3BW9A 4UNUA 4TPRL 2E7CA 2XOTA 1H8OA 5E94B 1WTLA 1GHFL 1R3JA 3B3IB 5ITBH 2CKBL 2IFFH 4FQ1H 5HHOA 4AQOA 3TBVA 3PQYA 1BECA 3BIKB 2X42A 2GY5A 3RWHB 5T3ZL 2CIKA 3HAEA 1D5MB 2ZUTA 1J8HD 3SKNB 4QHKJ 1SJVA 2CK0H 2NX5B 5JA8B 1MVUB 3D48R 2E3VA 3FO0L 5DJ0A 1QYGL 4NBXB 5C0CE 4HK0A 4QRSB 2DQFB 1CFSB 3RKPA 4PP1D 1DQLL 3IS1X 5K59E 1INEL 3QULA 1IAII 1ONQA 7FABL 3RHWF 4M6MH 1NSNL 2QQKH 4JM2B 5BRZD 5J57B 1YN6A 3RTQC 4QXGH 3S7GA 3KHOA 4E41D 3B6SA 1AHWC 1QSFD 2CH8A 4HKZB 4P59L 4RGMC 3WEXB 1QVOA 5DRNB 5ACMA 4QEGA 4APQB 4OZFB 3WNNA 1F3JA 1NDGA 5BO1L 3N06B 1MNUH 3ALXA 3GM8A 2ZUQB 2O61A 5T1KA 1PVHA 3TP4A 3QJHA 3WFCL 3HPJA 3RZWA 4PB0L 1D5ZB 2A9NH 4HFWB 4JFOB 2GJJA 1U8JA 1UFUA 5T5NG 2VLJA 3JBG7 4XPBH 3TA3D 4P0DA 1UB5A 4BZ1L 5DT1H 2VAJA 4OFIA 2RFXA 3I75B 4AH2B 3DXAA 5HGBA 3UJTH 4LSSH 1PYWB 1O7SA 2XKNB 4DVRH 3CDGB 1X5JA 4RA0C 4C56A 5C9JA 1Q9LB 5JMRA 5E2UL 4MCZA 5C09E 5D2NB 4L5FH 4NJAH 1VERA 3M1BA 3O0RL 5BMFH 5D7SL 1FH5H 2OJZH 3VRLE 1YPZA 2NYYD 2BC4A 4PRPD 1G9EA 2BCKA 5EIVA 3K2MC 1A6WH 2C3XA 4LLDB 4WW2A 2Z31C 4L8DB 2IQ9H 1QNZL 3L3OA 5IGXL 3FHAA 3L9RA 4PJ8B 3BRGC 4BK5A 3ULVF 4WO4D 3DV4B 4J1UA 5J1AA 4F57L 5CEYB 1FZKB 3NCFB 1W72H 3LDBB 5GISL 5I75C 5GGQL 1XEDA 2DWDB 4OGXL 4CVZB 2ICWB 2NY6D 4L8CB 5C0EB 4AJ0A 4F7CB 1W0VB 1D9KC 2W9DL 2YD7A 3LN4A 1RAMA 5H8DA 3MREB 2RHEA 1LE9B 5F6IB 3IDXL 1KCLA 2EXYC 4R90L 2FCBA 2VZ1A 1F4YL 4K7PL 2FEDD 5D7LD 2CGRH 5IKCA 1T5WB 3EO1B 3F6LA 1JNHA 1L0YA 4U6VH 4K7PY 4XMPL 4OLUL 4ACPA 1AD9A 3V6FA 3BYYA 4I18B 2ZUXA 1BZ7A 1PSKH 1OY3B 5ISZA 5I0DA 4P2OB 5I1DA 4XHJD 2AJXH 3MBEC 2VL5B 1T1YB 4N0UA 5F3HA 2P24B 4KJWC 1V7ML 1OT1A 2SEBA 5C08B 5SWQA 4HQQL 3WN5C 5BV7H 4XI5C 5CSZA 4NC2B 2VDRH 2HRPL 4ZUVA 4FNLL 1NFDE 3RGHA 4F3FA 2V9TA 2VZSA 3RTQA 3KWWA 3P30L 1OLZA 1IBGL 2WUBL 3T2PA 1K3ZA 1ZVHA 3RPKA 3ZE1F 1UZ6E 2NY0C 4JCMA 1AHWA 3DSFH 1YNLL 4ZS6C 5FGCE 1KIRA 1K85A 4OGAC 2HFFB 3NH7H 5DWUL 3SDDA 1T22A 3D2UD 2Y6SC 4M6NL 3X11B 4FFZL 4Q9RL 1J0KA 2X7LB 1KCRL 3GHEH 3KPPB 3MJ8A 4KK9D 4OQTH 5C07B 4HIJA 2PW2A 4XTRD 1JL8A 3I3BA 3T0VA 3WUWA 4LVNC 3E8UL 3SDXA 3O81A 1F4WH 1XF5A 3U0WH 3RJDA 4YGAB 3KNBB 2D31B 1AGEA 4JB9L 4OF0A 5IESL 3RPIB 4G8IA 1BJ1J 4XP5L 4P3CL 1CG9A 1NGWB 3P9MB 1IMHC 2XT1B 3MRDB 3O6FD 3V79C 5CBEA 1L4IA 3H9SD 1T03L 3S96A 4LMQE 4C58B 1N5YH 4ETQA 3BXNA 4XPFL 1MCRA 4R9HA 1AGBA 5HHXH 1U95B 4LP5A 1EMTL 3UDWA 4JKPL 1B4JL 1UACL 1XR8A 1MLBB 2FIRT 5GRUH 4S11A 1MH5A 3QO1A 2PW1B 4MQ7B 1U3ZA 5KAQF 3RWFB 3HNSH 2XNAB 1IGJA 1ZK9A 1PJ9A 1FVEA 4LKXB 2XWJA 3GSNH 1H3PH 1WC7B 4OZHB 5DJDB 1XGYH 4J3VA 4QOKB 2Z8SA 2MTPA 2ZG3A 3CX2A 1RFDH 4NM4H 5EZLB 4J23A 4HUUA 2HJLA 5C09D 1QBLH 1QFPA 1XF4A 4QTHB 1YY9D 5IVXE 3ZYIA 1HYSD 1JRHI 2YK1L 3WUWG 3C6SA 4JAMA 4LIQH 3O4LD 2OCFD 3VD4A 3FT3B 3QPXL 1FSKC 3F7QA 3KG5A 5CMAB 4CMMB 1GGUA 5BXFA 5B38A 4D9RE 2X10A 5ERWB 3LEVL 3MCG1 2YWYA 4HUKB 3SE3C 2XN9A 3T3MF 4NQDA 4KRNA 1EZVX 2VDOH 3O9WA 3JWDC 5C8JA 2QJDA 4RAHA 4QY8B 5CJQH 3FFCD 5HVFB 1S5IH 3MBEA 3VFGH 1L0XA 3BEWB 5E9DA 3G5YB 5JW4Q 3X13B 5JUEL 4L29B 4L9LB 5LQBH 4CADB 5DVMA 5IB3B 5MERA 3MUZ1 1RK1A 1S7RB 1ZHBB 5FM8A 3WN5A 2FWOB 3A0OA 2XZZA 1CFNB 2NYYC 25C8L 3A67H 3PWVB 2FBOJ 4NBZB 4X7SH 4Z7WA 2CRMA 1YEJL 1A14L 5D71H 3HFMH 2Q3ZA 3DIFA 4NJ9L 3NZ8B 3G5XB 3MJ9H 3IKKA 3SKMA 2H1PL 32C2B 4OM0H 2Y1VA 1LGVA 1JPST 1T1XB 1QTYT 2G5BB 3VXUB 3ARGB 4WO4C 1BREA 5H2BB 2I9TB 1CDJA 1HHKB 1R24B 3LEYH 3O2VH 4Y5VB 3O8XB 3BGFC 1U92B 3WV0A 2IALB 4LARH 5HJ3A 3C2SA 5HYJE 4RWYH 3HG1D 2GFBA 5MEOB 2NY6C 5DQDH 3FN3A 2IBZY 1Q9KB 5B38G 3RWDB 4PTUB 4JFEE 4LPUA 3GRWH 4PRIB 3DLQR 1J7VR 4GLRH 4XBGB 1SVCP 3QP3A 3VXSE 3RDTC 4D9LH 1MCIA 2X4UB 4DCQA 5DD1L 3W11D 3OKEA 4LSTL 3LS5H 1R0AH 5F7EL 1KIPB 3TLRA 4JDZB 4KTYA 3CSYA 3LCYA 4YQXL 3OR6A 1A6UH 2DMCA 1XCTB 1G7PA 4KJQD 3MRMA 5DJXA 2N7AA 4XHJC 1HCFX 4JFPB 1EVUA 2OTUA 1PD6A 4I2XE 4QHMB 4J3TA 4XAWL 3VFSB 3P3YA 3BWUC 1P69B 4MJ4A 4BFIB 2F54B 5GJTH 3OF6A 2C1PB 2AEQL 5EUOE 1MIML 2X4OB 1R5VA 4JG1L 3O3DB 1SQ2N 4L4TA 2OR9H 3G08B 1RZJC 8FABA 1Y0LB 1Q9OA 1MPAH 2CMRL 4HPYH 3F7RA 4JVUA 4X6FB 4HFUL 3GMQB 4JZOB 4NN5B 3QEQD 3PL6B 5T3XH 3FOMB 3SDAD 2WAHA 4OB5H 4BYHA 5BZWA 1QSFA 3GKWH 3BEVA 4JO3H 4MAUL 5DJ8B 2N1KA 2OL3A 2AP2A 4GKSB 4N8VB 4PJCE 3NN8A 2VN7A 1T89A 5T3XE 2ERJC 3VH8A 1B3JA 1I3UA 4IMKC 3MROA 1I7UA 4KK9C 4U1KA 4WU7B 4XTRC 3HTLX 3TV3H 5F44A 1NMBL 5DA4A 3EZ8A 4QYOA 1OAQH 4ZG1A 4LP4A 4RZCB 2IH1A 4FQQA 5IW6B 5IB4B 4BH7A 3QWRD 1FE8L 2A6DB 1OHQA 5HDOA 1FFOA 2NY3B 1U36A 3UJJH 4WUUD 4UUJB 4QT5A 1FG2B 3L5WB 4XVTH 1U8PA 4ZPTB 1B4RA 3BSZL 1CDYA 1RUPH 3O6FC 4NDMB 1UKTA 4O58H 3MRGA 1RZKC 4WFFE 3BDXA 1UM4L 3QXAA 2JJSA 1QPXA 4OZGB 2AAVA 3MRBB 4HBCL 2BNQB 3IJHA 4FMKA 5HYQA 1S7WA 5AG9A 4GW5A 5CILL 1CD1B 4WRLA 4XC1H 4K3EH 2XACC 2EDWA 2OL3L 2IANB 4D9RD 2O5ZH 1U3YA 2HMID 1HXYA 2XZCH 4ZAKA 2Y36L 1E6JH 4PRNB 1JHLL 4N1HB 1YEDB 1JNLL 1RZFH 3KYKL 3FO1A 3U0PB 3NTCH 2DRUA 3RZCD 1NDMB 1KCUH 2C26A 2HAZA 1IE5A 3O6ML 2DKMA 4X6BB 4DUVA 1IC4L 1VSCA 3U46B 5EN2A 4IHOA 4X98A 4HD9A 2P5EB 4OT1L 2HT2D 2N56A 4HIIA 1YY9C 3WXVH 3WL9B 3G5ZB 2AJYH 1A4KB 2B1HL 2E6JA 3DGCR 3ELAT 2MHAB 5F1NB 1M7XA 5B3JF 3RDTA 1IQWH 1MQ8A 4PJDE 5M95B 1DFBH 1S9WB 3MUGB 3W5MA 1XR9A 1LO2L 2WWMD 1G9NC 1HSAB 4PJHA 4JFDB 1JZ6A 4UV4L 1U8IA 5HPMB 3ARBD 4ODSH 4P4KB 2ZNXA 5D7JD 4NQSA 3FQUB 2ZCHL 3FFDA 2HA1A 3TH3T 4OD1H 2LE9A 1NCNA 3GSXA 1A0QH 2VSCA 5LGJB 5HYJD 2DBLL 3VG0H 4OLVL 5JTWA 1KTLA 5TH2B 3SE8L 1IFHL 1HQRB 1FLTX 4X0KB 2NLJA 4QRRD 4XBEH 4GAJH 3V4PL 2GCYB 5DRZB 1ROWA 1LP9E 1F3DH 4MAYC 1YNTB 4BELD 4MJIB 2C3VA 3PABA 1TFHA 5IJVA 4HW6A 1XCQB 5JPNB 3GJEA 3QAZC 5KS9F 5ITFA 5FHBH 3QQ3B 3PDDA 5FV1L 3EYOA 3TIDB 3TWCL 5JW3L 3K80A 5KBNC 4J3SA 5HHQB 1HHJB 3RNQB 2P8MB 5C0CA 4IMKA 5FYKU 4AENA 4PB9H 1QSZA 4M3KB 2Z35A 4EJ1C 1AE6L 1ZHNA 3TNMB 5DVOA 3T4AA 1HHIA 1B90A 1MWAB 2X1OA 3IXAA 2OBGA 3QRGL 3GSQA 1JV5B 4WENB 43CAB 1G0XA 4WHCA 4CMHB 5JOEA 2BVYA 4KUZH 4PLNC 3UBXB 3FN0H 3T77B 1FPTL 1G7JA 3W11C 1ZLSH 3FOLA 4M48H 5BV7C 1K4CA 5JIIA 3BP4B 4OCWL 1WBXB 4X5LA 5EU5A 4F7PA 4N9OB 3GMLA 3MFGB 4YXHL 4M43L 1X7QB 3TJHC 4O02H 5FUOL 3SO3C 2HFEA 5I1KL 4EIZC 5IR1B 5ITBL 5LKNA 2H8PA 3MXWL 5MEPB 1E28B 5J3HD 5IQ9A 4OCSH 3FB8B 2EIZB 2CK0L 3LKRA 3CXHK 5EZOH 4YDVA 5DTFB 3VW3H 1A7OH 5C09A 2FLBT 5IMOB 2VQUA 4MJ6B 4WI3A 4MB3A 1JNNH 3SOBH 2J8UE 2VLRD 3EYUL 4BSJA 4H25B 3MRIA 5SV4A 3T3PE 5E6ID 4P5TB 5C0AE 1U8QB 3GMOB 2GT9B 2QQKL 5DEFB 1RZKL 5D72H 3OR7B 5HI5D 3LSOA 4WEUD 4QXGL 1HH6A 4M7KH 5F7HA 3M45A 2P8LB 3MV9D 2DIJA 2PXYD 4OV6F 3ALWA 1CCZA 3LKSA 2H26B 4UTAH 3KPOA 3KLHD 4YDLC 1JNJA 2IMMA 4I0PB 1FFPA 3WNLA 1ZLUK 2A9NL 3EYVA 1CGWA 2HWZH 1W72A 4JFHE 4XPBL 1I1AC 5DQJB 4MAYA 1I7ZB 4P5KA 5IEKA 1C08A 4JM4L 4OFKA 3IETA 3HR5B 5DT1L 4J4PD 2IQAB 2HMIC 5DFWH 3UJTL 4LSSL 4UV7H 2DQIL 3HR6A 4HXBH 2FIKA 4LU5H 5DUPH 4I9WE 1NBZA 1T3FB 1VFAB 5IFAL 4NJAL 3MGTB 1S7VB 3AU1A 2BVEA 1G9NL 5BMFL 1Z3GH 4F8TA 1SJEB 2HT2C 2OJZL 2RJMA 3V8CA 2GKIA 1A6WL 3UAJD 6FABH 3QH3A 5C2BH 5ESQA 1EZVY 2IQ9L 1NFDA 5JMOC 3OAZK 3ZMRA 1GIGL 4Q9CA 1CXHA 3V0VA 2HJKA 4H1LB 4QF1B 2WWMC 4Z6AT 5ICXB 4RFEB 1AGDA 3I2CH 4LEOA 3ARBC 3HUJB 2F8OA 4RA3A 2EIBA 4IRZH 3SQOH 4PY8J 3F62A 4Y4FC 1BFVH 2NW2A 2W0PA 3MA7B 3FB7A 1W72L 2PUQT 3C5SA 5J12B 4Z0XB 4YIQA 5GS1C 1OF2B 2ICEA 4QXUH 5DDHA 3DHJA 3T0XA 2D7PA 3MLRL 5K9OA 2CLVB 5CSGA 2Z4QB 4DUWA 1EFXD 1GXEA 1W0WA 4U1IA 5L2KB 4EQ3A 2WNGA 1EBPA 1RZIB 2ZZUT 4BSWB 4PS4H 5JIHA 3O41B 2ZCLH 4BKLB 4BFGA 2Y9RT 1J8KA 1MLCA 4OQTA 4U6VL 5HGDA 4KY1H 4F7TB 4UDUB 1OB1B 4XC3H 5KSVB 3PWLB 1NEUA 5JORB 2CDEB 1PSKL 5F88B 3GSWA 1NLDH 1D6VH 1TVHA 3KYOB 3WE6B 1CDHA 2Q6WA 1QR4A 1X6NA 4P46B 3QFDB 2PTTA 3D6GA 3EO0A 4FFYH 3VRJA 2BOCB 2DM2A 5FO7B 1SMOA 2IC2A 3MRLB 1I9IH 5BV7L 1JUFB 4XNZC 5JZ7D 2VDRL 2LAAA 2AXJA 5DMIH 5E56A 2QADD 1PQZA 1MRCH 4YZFE 2HJFB 5FECA 1UVQA 5DS8A 3QCTL 5CAYB 4EZMA 1PAMA 3QWRA 1H5BB 4JRXB 1U8LB 4OZIE 3CUPB 4GRWF 5SWZE 1BAFH 3PHQA 1ZE3C 4IJ3C 3W9EB 3D69B 1XIWB 3C9NA 4U3XA 2UUDH 5E2VH 3NH7L 2QR0B 5FF6A 4I8DA 5T1LA 3R8QA 4BUHA 1AIFA 5HDLA 2D7OA 2NW3A 4JZJB 3RX7A 2EH8L 2X41A 1EX0A 1WTGT 5EBWB 4N8PA 3GSNA 1GC1C 5IVXA 1D5BB 1F11A 5JW4M 4OQTL 2QSCH 2EECA 1KNOA 4K8RD 1I1AA 1YECH 4Q0XH 2JKXA 1QLRB 1F4WL 1KN4H 4XXDA 5ALCH 4KTDL 2EDXA 4PJGE 3U0WL 5ETUA 4X6CF 3STZA 4JFXB 3VMPA 3VFPA 1RUQH 1CDGA 1X4XA 2OJEA 2R0WH 4TYUA 5C7XH 3KDMA 3P4OA 3GBNH 1PKQB 3AUVA 2OR7A 1IEHA 3GB7B 1RI8A 4PJ7B 3C6LB 2FATH 1FGNL 5HHXL 4XRCA 3HI5H 2ITDB 3IJSA 1V7NH 1YEIH 5TE6H 3WHXA 5E4IA 3QXDA 1YMHA 1CD9B 2ADFH 3IDGB 3BKYH 4XVSH 2EDYA 2OMBA 1K4DB 4U1SA 1TVDA 4X6DB 5HI5C 4UAOC 1JK8A 2ICES 3GSNL 1H3PL 1XGYL 1HNFA 5MEQB 2PXYC 2F19L 4Y4FA 3E6HA 4K7FA 2M26A 2QBWA 1RFDL 4NM4L 1ZLUH 3V7AG 1MCOH 1Q0YH 1NJ9A 2R56H 3O11A 1XAUA 4I9WD 4UOW0 5GS1A 3BPNB 3KLHC 4QRPB 4PJFF 1QBLL 5CJXC 1JPGB 3QFJE 1IEBA 5HYJA 1KG0A 4G6MH 2Y5EA 3GMPA 5D2NE 4JFEA 3MJ7B 5DD0H 2A1WH 4WVRA 3H7BB 4PJ5D 5LAXB 1WV7T 4YC2C 4E5XB 2EZ0D 4GLRI 4WWKD 1T21A 3VXSA 4LSQH 4LNVA 4HWEH 1WCQA 4TVSa 4J4PC 5FUZH 2ZUYA 5BS0E 1BBJA 1KGCE 1H15B 2OP4L 1JPFA 2VDOL 3QR2A 5B3NA 1KPRB 3ZL4H 2E7MA 3HMXA 4X4YA 2NTSP 5CJQL 4M7JL 3Q5TA 4JVPA 3VFGL 3RIAF 1CLOL 3RAJL 2HLFD 4ZUUB 5DFVD 5KVEH 4I2XA 1SHMA 3MRFA 4KH2A 2ZOKB 4LVHC 4V1DE 3MUJA 5EUOA 3AB0C 4MNGE 1N3NA 1UB6A 5I0ZA 3A67L 1QZ1A 1L6XA 1H3GA 2X4NB 3FQRB 4PJ9B 2FJFB 5HGAA 5I9QC 4Z7WF 2EE2A 1N5AA 4U33A 3HFML 5D71L 4ERSH 3DECA 1U3JA 5ICZB 3X14B 3IFNL 3UO1H 2DS4A 3C8KB 5GRJH 4LSRH 4OM0L 4JM2F 5L7XL 4RMSA 3U1SL 1KB9J 2P46B 2ARJQ 2A83A 3MX0A 4E42B 3O2VL 3LEYL 2LVEA 3QEUA 4PJCA 3BD5A 4MA1B 1P6AB 4LARL 1A9EA 1I8KB 3MV7B 4RWYL 1XZ0B 2C7UB 1SYVB 4XPTH 2GTZA 4OFYD 2Z92A 5DQDL 3CH1A 1A3LH 1S7TB 1T1ZA 2BVPB 1JWUA 4OUOA 1EJOL 3HMXL 4RAVA 5EO0A 3FO9A 4Z0BH 2FRGP 2QSQA 2VDQH 4H20H 4NN6C 4MA7L 1NGZB 3I6KB 4X83A 5DRXB 5BZDA 4D9LL 2XWTA 4YDIH 2FSEB 2PN5A 3QDMB 4LLYB 4F15C 1MFCL 2DQEL 1NUDA 5FA4A 5IMLB 1G7LB 4JFQB 3VXPB 4CDGC 1AFVH 1A6UL 1NGXA 1A3RH 3BYTA 1MUJA 3VXOB 1OARL 3GBMH 3W82A 5DD6A 5TE7H 2BSRB 5T5FH 5DJCB 4XPHH 4LCIH 2IH3A 2ZSVA 4MDIB 3CDCA 2OR9L 4JFYB 4NO5A 4ZO6A 5EFIA 5EU7E 4ZO9A 4GG6E 4HZLA 3T2QA 3PNWB 2QADC 5I19H 4N9GB 4HPYL 1X5GA 4MQTB 3VFWB 4F9LA 4D0BA 1GC1L 5T3XL 5DYOA 2PXYA 3G6DL 5C0DA 4JM2D 4OB5L 1RMFL 3AFLA 5F7DB 3GKWL 1T2QH 2FO4B 5CJXA 5JXED 4LRIC 1TNMA 4Y1AE 2IGFH 5SX5K 5I17A 4APQD 2J8OA 4DKEH 2DMBA 2PF6A 4PUBH 3ULSB 5E2TH 1NC4B 1IT9H 3QUMH 1AQDA 1WF5A 4K8RC 4KV5E 3TV3L 2UZIH 4NNXA 3BQUB 4QCIB 1CFBA 2HFGH 4PJDA 1DQDH 3EYFB 4W70A 3F7YA 4FZEH 2V7NA 1ORSA 2GQHA 3UJJL 2J6EA 1RUPL 1I8LC 4LLVA 1XF2A 2JCCB 3DROA 4O58L 5FB8A 1S5HA 5D2LE 3F5WB 3QFJD 1CXKA 2NTFB 5IMKB 5EU3B 3D25B 5TJWK 3GIVB 4GFTB 4PRBB 4NO2A 4XC1L 3SQBA 2UZXB 3FTGB 3L5XL 2VLME 4Y89A 3GMNA 1LP9A 3FT2A 5LWYH 1BMGA 2O5ZL 1G7IB 1OSZA 1AXIB 4GXVH 3W9DA 2XZCL 4L4VE 1E6JL 4RQQA 2VZTA 1VEPA 3QNYA 1RZFL 3ZDZE 1U93B 3EO9H 2BVQA 4O9HH 3NTCL 1OGAE 1EAPA 2DIBA 4PJ8D 1WCBA 1SBSH 3PWJB 1WBYA 4NKDA 1MHPH 4RBPK 4M93C 1MHCB 3UJIH 3M07A 1MJJB 3K74B 2MJWA 5IROA 2Z0BA 3MZTA 4JFFE 5CIPH 3N9GH 4Y5XC 2FGWH 2J6EL 3O4OC 5LGHH 1EERB 2X70A 1BX2A 2V6HA 4XNXH 4JQVC 1IQWL 5LXGH 1JGLL 2WM0A 2W0KA 2EZ0C 4WWKC 4G8EB 1JZ3A 1R3LA 2X09A 2BSTB 5C9KA 5EC2A 4RRPA 2XRAH 5JQ6L 4ISVA 4K71C 1RIHH 5GJSH 5D96C 5E1AB 3JTTB 4O4YH 1TJHL 3S36X 1V3MA 1LDPH 5F7NC 1F97A 4P2OD 5DFVC 1CLCA 4LSPH 2K7QA 4L3EB 5ACZA 1NLBH 4TNWK 4V2CB 1T2XA 4Y8AA 4XBEL 4GAJL 2NR6D 3BDYH 4IS6B 5C08D 4NN7C 1Y18A 3OGCA 1TQBB 2FHBA 2OM5A 3QNZA 1AC0A 5C0BE 4LLAA 3CDYA 5BVJB 3OKYA 2EYSA 2YMXH 3UTSB 1LMKA 4OZHF 1NAKH 4DGYH 3TYGH 3IRPX 4LRIA 3KPTA 1JJUA 1EEQA 4ODBD 4BZ2H 1D5XA 4LCUB 3GUTA 3CFEB 4JANA 4F33A 4PB9L 4YPGB 4C54A 3TO4C 2J8UA 3GKZA 4IOFD 1ADQH 2DQDH 1U58A 2DQGH 3RY6C 2VABA 2BSSA 2ZG1A 1CGUA 5C07D 5C0AA 3VU2A 2IADB 5IT2L 4F7MA 4FQJH 4YHNA 4YHZH 5E2WH 3FN0L 1MAKA 4XWGH 4RRPG 2KQMA 1ZLSL 2YC1B 4Y8DC 2LVCA 4M48L 1HEZB 4AG4H 1IC7H 4PG2C 1ZVYA 5I66B 1N2RA 1IL1A 4MMXC 5I16B 3QISA 3HE7C 3ILQD 5KSAA 5JLZB 1E6OH 3GI8H 5DQ9A 5F7UA 1NC2B 1JWMB 4NQTA 5IHUH 5ALBH 3X3FH 3X17A 1IQDB 4YX2H 3BZEB 3VWKB 5GRZA 3EIFA 1K8DB 2IPUK 1BQSA 4NC1E 5CGTA 3B5GA 4NRXA 2PR4L 4ODVH 2R0LH 2YA2A 3I9GH 4OCSL 5JDJA 2YXMA 1UJ3B 4OFVA 5JA9A 2K9UA 4NFBA 3NFSH 1FORH 4JM2C 4KK8D 4M03A 3MRRB 3L3GB 4K8RL 4XZUA 3K4AA 1CZ8H 4ODTH 1Q1JL 1XGPB 1A7OL 3TBTA 3NFNA 3IU3B 4PRAA 4QOKD 3OL2A 4LF3B 4ZSOE 4ORGA 1BGXH 3HE6B 2VXTL 1J1PH 1CGXA 1JNNL 2KZWA 3LOWA 3SOBL 4FA8A 4U1MB 4MA3B 1VKXA 3R06A 4Y5XA 2IAMB 2BOBA 3RWEB 1P2CB 3R4DA 4JVWA 4MX7B 3DVFA 2VLMD 4JQVA 4ZUSA 4YJZL 1I9EA 2NY4D 3CX5J 4WWKA 4JPKH 3IGAB 5D72L 4L3CB 5E03A 1TDQA 2A73A 1INQA 2DJSA 4M7KL 4U6HA 4JPVH 2D03L 2DQUH 3X12B 3BVNB 4L1DA 2NZ9C 1IC1A 4Y19E 4X9IA 1NL0H 4UTAL 5DK2B 5J6GB 4O5LH 3M17A 5E99L 3P0VH 5JOFB 1L9MA 2HN7B 2DL2A 3BZ4A 4R7DB 1WWCA 1JZ4A 2ZOLB 2AQ3A 3HRPA 5D2NC 3RWJA 1MHEB 2DB8A 3NCJL 4EBQH 4FQ2H 2X5PA 2XFXB 1BZ9B 1NH6A 4RX4A 4R7NA 3GNMH 1QQDB 1J1OH 1XGRA 3UZQA 4E0RB 1DN2A 5D1XB 1JGVH 3FB5B 4YR6B 1F3RB 5GSVA 4UV7L 1JGUH 2YSSB 4PJ8C 4LU5L 4JJ5B 4LHUD 3ARGD 4ZFGH 4LKCB 2HVJA 4OF7A 3QDJE 2VTFA 3TO4A 4X8XA 3O8XD 3BPCB 3K4DA 1Z3GL 5I1IL 1TZHA 3U79A 2FX9H 1J05A 2Q8BH 4M3JA 3QUYB 5HD8D 4LEXL 6FABL 1FZJA 2OZ4H 5C2BL 1ZHKB 4YE4H 4P9HH 3L3HB 4U6YB 1PBYA 3MCKB 4KDWA 1P84K 1G7MB 4PRID 2XQYG 1IM3B 3RWGB 4OZIA 1RJLB 1A7QL 2QQQA 5SWZA 3KPRB 4R2GB 4PG2A 1HI6A 2BP3A 4LK4A 1OAZH 4IRZL 3SQOL 1S7SA 5INDB 1FVDA 1OAYL 1RURH 2HRLA 3V6OC 1EGJH 3FQXA 3VG9B 3TPKA 2QQNH 5ICYA 3HE7A 2ESVB 2DI8A 4QXUL 4AT6A 4ONOA 1NCDL 4XMKH 4HWNA 3RL2B 4BQ6A 4P2OC 1BEYH 2BHYA 3DETC 4OZGF 2GITA 3BJLA 4U0QB 3VCLA 3ZKSD 1DLFH 5HGHA 2V5TA 1CFSA 2F54D 3AREB 3HZKA 4PJGA 4JN2B 2ED8A 2NR6C 4PS4L 1OTUD 1CDUA 1N64L 5EU4A 5IB5B 3ZDYF 3N1GC 1R6VA 1K9TA 4RFNB 4Z8FH 4LQFL 3K8LA 4KY1L 5CIPB 1AP2A 3ARRA 4ZFFB 2DQJH 2XZAH 5D5ME 1IGMH 4I48B 4NO3B 1D6VL 1BIIB 8CGTA 2ARWA 5IHLB 4P2RE 4JZNB 5DRNA 3TN0B 1YMME 5IBUB 1F4AA 1JN6B 4FFYL 1BJ1H 5EO1A 4UT6L 4N8CL 4EVNA 4Z77A 1I9IL 4WTXA 1QHPA 4YHKH 4NOBA 4IOFC 4U1HA 2RGSA 4KTEL 3TVMB 5DMIL 1RZ8A 5EU7C 3OG6B 5JPMB 1I85C 43C9A 3OHXA 3U9UA 4Z7OF 4N0CD 1N8ZB 3C09B 1SEBA 1CFVH 1IC5H 3AROA 4U49A 4AH2A 1M6OB 1BVKB 1HXMB 4JO1H 3ROLB 2E9IA 2DAVA 2NY3D 4H88H 3GMMB 1LVEA 1WZMA 2V2XA 4ZTOH 3QFJA 3I02B 4JY5H 5IOPB 1FL3B 3CZJA 3ILQC 4R0LA 5DK0B 5D2NA 4MZ3A 5GHWL 4PGBB 3P9LB 1BIHA 2QSCL 5CEZH 1ZA6B 5L9DH 1KN4L 5EZJB 1B2WH 2R4RH 5E4EB 2PYFA 4HS3B 4GJTB 5KSUA 1YEEL 1RUQL 2R0WL 4AZ8A 1GZQB 5MENB 5BS0A 2IAND 3SY0A 5FGRA 5CEZE 3FL7A 3GBNL 1G9MH 1NCAL 3BGMA 2DLEA 5HDQL 4KK8C 3G6AB 5DO2D 1LEKB 4PBXA 1MAMH 4PG9B 3DV4A 1CT8A 2VLKB 3HI5L 5DEGA 1K2DA 3KLDA 4V1DA 1V7NL 2M1KA 5E8EB 4MNGA 5TE6L 3TF7C 2ICWA 4P9MH 2Q7YB 3VXME 2P5ED 2MPAL 3KYNB 2ADFL 4XVSL 5E5RB 2DYPA 2Y5TA 3I6GA 4YXLH 1DUZB 4MXQC 5KVFL 3HI1A 2NY4C 3C08H 1DL7H 3LV3A 3U48A 3QG6B 4JFDD 3WHE1 3VXTA 3QZWA 1C1EH 1Q0YL 2R56L 1ACYH 2M8XA 4P4KD 1TMCB 3W2DH 4G5ZH 4G6ML 5HHNB 1YNKH 4Z7VB 3VE0A 1O0VA 2AXGA 2VL5A 2NY5H 4OD2B 5EPMA 3SE9H 1KULA 1IZKA 4L9LC 3CD4A 4HDIA 1FYTB 4U1JA 3ARDB 4GUPB 1F4XH 3V8OA 3MR9A 1QLFB 5AG8A 3EDJA 1Q9WA 2BVOB 2EH7L 3GSOA 1G7QB 1I1CA 3E3QE 3P73A 1ETZB 5FUZL 1N26A 2GTWB 4ZPVA 4PJIE 4P49A 2HLAB 3ZL4L 4HH9A 4JEGB 3F65A 1V05A 4G3YH 3DMMD 3LQZB 3RUGE 3FQNB 3D0VA 1RU9H 3OXSA 5KVEL 1CGVA 1YY8A 4Y5VC 4YDJA 3IAQA 4NNPL 4AM0A 5I1AA 1OTSD 2XG4A 4Z9KB 5HD8C 4GG6A 4QHUA 2V2TA 3A6CL 3V4VH 1I85A 4MA8H 3MRHB 4Y0GA 3VXQB 4TUJB 5JHLH 3J8F7 4R4BB 3UO1L 1ZKAA 4ESKA 3WFEH 4LSRL 4CN1A 4GBXD 3QZWG 5K9KA 3QWOA 1C5CH 1IGIL 5CCKH 1WUNT 5IIEB 1IAOB 3NCEB 1EH9A 3L1OL 4R4FH 4Y1AA 1EHXA 3MYZA 5IV2A 1G84A 4NWUH 2R9HD 4OCXH 3W0WE 1T0MB 3QIWB 1A3LL 1UM6H 2CR6A 5C0ND 3IDJA 5KVGH 5GRVL 2H32B 1FRGH 2QKIB 4Z0BL 2VDQL 2UVFA 3STBA 4G80A 5HGGS 5EIQA 1S7UA 1OTUC 5FDWA 1B88A 4U3HA 4WGVB 2E7HA 4ELMB 3QUMA 2A74A 3L5IA 1DBJH 4PJEE 3PXHA 3DGGA 4Y5YC 1AFVL 4NQEB 4F9PC 4KI5E 4PV8A 1A3RL 4GXUM 4KZDH 1PKOA 1U2CA 3ZHLA 3GBML 5D2LA 3RGVB 3LKOA 2H45A 5T5FL 2QLVB 4XPHL 2VC2H 4WFHE 3MMEA 4XVJH 4YBHA 1F02I 2OX5A 5EB9A 2XTJE 3MNWA 4QTHA 3BPOC 2YPKB 3LIZH 1IGYA 2E6QA 4PD4J 4UILH 5CHNA 1SYSA 3DVGB 4N1CA 2HT3C 5I19L 1AGCA 2QV2A 2EYRA 1JE6A 4UT7H 4P5TD 2W9LA 5HY9A 4L4VA 4NC1C 4XCYA 5F8RC 4N0CC 1OT2A 2FJGB 2D7MA 1OGAA 3AXLB 1J11A 1KXVC 3QNXA 1BVLA 1T2QL 2HG5A 5KSBB 3HUJF 4EXKA 3I6LE 2Q8AH 1DEEB 5DD5H 2IGFL 4NZUH 3LRGA 1OAXH 3P4NA 2RIKA 1FCCA 3WO4C 1P7QB 3FKUS 1LQSR 3L3JA 4RIRB 4DKEL 4I77H 4IIQA 4PUBL 2GUOB 3OGOE 4S0TD 5E2TL 1IT9L 1VADB 3QUML 4CADA 1CS6A 1T2JA 2DWEB 1PDKA 2EDTA 3CC5B 4I0PD 4JFFA 3TT1L 2DOCA 4L4JA 2HFGL 4NQVA 1WJ3A 1DQDL 2GAZB 4ODXB 4XNMB 4FZEL 1MF2H 1FLRH 4WHTA 1CBVH 3FN9A 5F93C 4PRHB 4LHUA 4Y2DA 5DO2C 1RD6A 5CJOH 1LHZA 4RAUA 4HGWA 1U92A 4U7SA 1PG7H 1MELA 3F12B 1INDH 1CK0H 3MGAA 3OXRA 5FXCH 5GRYA 1HHHB 3ARTA 1UZ8A 4XWOC 5HHMB 1KJ2H 4OCRH 5IVOA 3LEXB 5IHZA 1VGKA 3KPLA 4PTUA 3DYPA 3PP4H 4MB5A 4BQ9A 5C0FB 3WIHH 3WNPA 4GXVL 4WDIA 4PBVC 3BIBX 4FQXC 5CWSA 3MZGB 5C0BA 1KPUA 4MWFA 1H0DB 1YYMH 2AQ1A 4O9HL 3CDFA 5DHXB 5GGVL 4XBPA 3QXUA 1SBSL 4BH8A 2MSPA 3NCCB 3VI3F 1MHPL 2P5WE 4OI7A 2H2SC 2X4PB 2V17L 5GGVY 4P4KC 3E6FB 2ZCKL 2CJUH 3UJIL 1IM9A 4X4ME 1PLGL 4NKMB 2J7LA 5CD3B 3ZE2E 4BFIA 1I7TA 4FXKA 1HK6A 4HEPG 4UU9B 3TPUB 2FGWL 1DANU 1REIA 3VDAA 1JF6A 2F53B 3P40A 5LXGL 3HC0B 5L2KD 1I3GH 2YKLH 4TSCL 4OCYH 2VITB 3O45A 3IFOB 4KKAC 1ADQA 4TUKH 4HWUA 4Y5YA 1W2KT 4M8QB 5DF0A 1S9XA 3WFBH 1RIHL 3B2VH 4QRTB 5GJSL 4OLWL 4YBLB 1P7KB 4S1SL 4FHBD 4AIZA 1P5VA 4NCC2 3DMMC 3JV5A 4O4YL 4XPAL 5E00A 3D87B 1LDPL 4OAWA 3BN9D 3PWNB 3EOAB 5BJTA 4IMLA 5CLWA 3VGAB 3WIFB 3BPLB 5ANMB 1NLBL 4P46D 1U3HC 5EDXA 3WMSA 5ESAB 1OTSC 5DHVH 5F6HJ 4OLYH 3BDYL 3AY4C 5AD0B 2CDGB 3UYPA 3WDHA 4K94C 1FN4B 2JK5A 4Z7QF 3BMWA 4MD0B 4JY4A 1F8TH 4CMHC 4UB0H 4X6DF 4GBXC 2ADGB 4PYGA 5CEXB 1NAKL 4DGYL 5TPWL 3MO1B 3QXTA 3VXRB 2D7NA 1Q94A 3M8OH 1XIWD 2G75A 4CU8A 4ZSOA 3BKMH 1KIQB 1T6WA 4R96B 2R9HC 1ADQL 4IOSD 3BKJH 4JREB 5FO9B 4K3DH 3GDBA 2XTJD 2DQGL 3EJJX 3MA9H 1GZPB 5C0NC 4KVCL 5EIIA 4WCYH 4B5EA 5CP7B 4TNVK 4FQJL 1MREH 1PGRB 1Y6NR 4XWGL 4HEME 1O7VA 3AS3A 3VFTA 4ELKA 5JR1H 1QEWA 3L3DA 4Y19A 4AG4L 2R1WA 4LHQB 5CP3A 4P99A 3INUH 3DO7B 5E8OB 4PTTA 5MP6L 3GJFK 2A2QT 3DRTA 3KJ4B 5TFSL 2P8PB 3C6LD 3GI8L 4G6FD 2KKQA 2CRIA 4RMRA 1CGSL 1DQMH 1A6AB 1WSST 5IHUL 4NPYA 1EV2E 4GS7C 2X4RA 2EEDA 4U7MA 4W81A 5EA0L 5FYKH 4YGVB 4OBRA 3WL9A 4UIMA 4V2BA 4N0FA 3RU8H 4K2UL 3W39B 4N0YH 4FQXA 5K33A 4BUGA 3GSVA 2R0LL 2MHAA 4P3DB 2GJ6B 5D7IB 3CPLA 4X80H 4L1HA 3MUGA 3MLYH 2C3WA 2EE3A 5TF0A 5C0GA 5FYKE 4C55A 3BDBA 2AI0H 3OZ9H 4P4KA 1CZ8L 1D7FA 4ODTL 2UVEA 2A0LD 4I4WA 1WWAX 1QUNA 2VH5L 1EA9C 2X4QA 3QDJA 3ARFA 4W6YB 3GFUA 5IM7B 1BGXL 3S4SA 5B22A 2UYLA 2Y06H 2Z91A 4QRPD 5DJ2B 5EOQH 5BCAA 4TTDD 5BQ7A 3PG2A 5FKPB 3IJYB 2IEPA 4LDLB 4BFEA 3MUHL 3BIAX 2BRRH 1S7QA 3C60D 1OQOA 1JTOA 5HYSB 4JPKL 12E8H 2GCYA 3MODL 1U8KA 1HILB 3UTQB 5D4QA 4JPVL 3LRSA 2DQUL 2V5RA 1HH9B 4YDKL 1R3KA 2OZ4A 1SM3H 4KMTH 3KPMA 1CFTA 3DMMA 5E8NB 4XCNA 1KYOJ 4FTVE 4WI2A 5DSCA 2ED7A 2EYTB 4QXTA 2C3GA 3TNNB 3QDGE 4JN1H 4UDTB 2FB4H 5EG6C 3SPVB 2LU3A 5CJ8A 4F2MB 3A6BH 1V3LA 1U3HA 5AYUH 1YA5A 1MI5B 1EGJA 4HJJL 3MV8B 1T7VA 5LGKA 4QTIL 4H8WH 3T0EE 5T33L 4OIIH 3GNML 1J1OL 1KB9K 2WBJA 4PJ9D 4POYA 3E3QC 4GBXA 3UBXA 1JGVL 2FECI 2NXZC 5D5MA 4Z76B 1JGUL 3JTSA 3MRQA 5DR5H 4OI8A 5INCA 1Z0MA 4DKAA 1ZEAH 4FN0A 3ULUE 3S4SG 4P2RA 1KENH 1NMCC 1IGTA 1YMMA 2LABA 5I8OH 3FCTB 4XP9H 4N90D 4YBQD 4EKXA 1RQ5A 5JW5A 3EOTH 4ZYKB 5A16B 4FFWC 3FQWA 4EI5A 5D7KD 2Z8RA 3MV7D 3NIFF 1QKZL 3CFBA 4GAGH 2OZ4L 1YUHB 2B5IB 2EC9T 4TULH 3HZYA 4RCAA 4YZFF 2A6KA 2R15A 1NCTA 3QIUA 4I3GA 3LN5A 3IKCA 1I1FA 5FKAB 4NKOB 5EH1A 1S9YB 1OAZL 3OKKB 2NMSA 1RURL 5F3BA 1EGJL 1TCRA 3LKPA 5F9DC 3D3VE 1S9VA 2YOCA 3FONB 4MJ5B 4RISL 4XP1H 1A7RL 4E9LA 1ZS8B 4XMKL 2JCCF 3KLSA 3BUTA 5KW9L 1HSBA 3REWB 4BFBD 1BEYL 3FB6B 4TQEL 5KN5B 1EUUA 5IMOA 4P46C 3TH4T 4MNQB 1QLEL 1DLFL 5E7FA 1DN0B 5JOPE 2FX8H 1KTDA 2AJUH 4MS8C 3UYRL 3T0DA 3VFVB 3D0LA 1PZ5A 3DNKA 2FECL 3CLEH 5DEFA 3WKNA 1F45A 2XXMB 2DQJL 3OR7A 3UZEA 4HKXB 1B0GB 1P9MC 3CXDH 2XZAL 2FNBA 5I1CH 1IGML 4LQ1A 1I75A 1QFUH 4OI9A 3SKOA 1KT2B 1DQQB 3H2WA 4ETYA 3ECBB 3MCLH 1XIWC 1G6RH 3PGDB 3GMRA 2C4XA 3IFPB 2AVGA 4WFED 3Q6FA 4CRPA 1MCEA 4YHKL 2AJZA 4JZJC 2X89A 2XTJC 4OFDA 1YEKL 1FL6A 1JI2A 3TBWA 1VFOA 4HKBA 2F5BH 3WDIA 1MIEH 4ZNEA 2J88H 3EFDH 1TITA 1E4XH 5DHVB 3RRQA 3V52H 3KPQB 1C7SA 3GJFH 5CBAA 1CFVL 1GGBH 1KB5H 3AS1A 5GGRB 4HKJA 4YO0A 4LDOB 3QHFH 4JO1L 1MCPL 1N6QH 4H88L 2CUIA 2BRQA 2MOVA 3OB8A 3DUHA 5IG7B 4ZTOL 4JY5L 2R2CA 4G42B 1YC8A 4CL7A 4GRLB 2J2ZA 1NUGA 3FT4B 5CEZL 4KK5D 2FHFA 4NUGH 5AUMB 3ZYZA 1CE1H 5T3ZH 2NY1D 3V9FA 5HXMA 3TYFB 3Q3GA 2UWEE 4XCCH 2I9LA 3LKNA 3OKNB 5SWSE 2AXFA 3PXJA 4PJIA 1G9ML 3KXFE 3L7FB 1RUKL 3BRDA 1J18A 1KOAA 1HYRC 4OKDA 3RUGA 1DDHB 4FTVD 1MAML 3HZVB 2A0LC 4GAYA 1BQHA 4U6TA 4Y88A 4LLQA 5ENWB 3TCXA 3UTTE 2LTQC 4P9ML 3RWIB 3D39B 1E27A 1UEYA 1WIOA 4TTDC 5HYIA 1U91B 4Q58C 3LH2H 2W0LA 4YXLL 5FA3B 2EDJA 3TFKD 1KC5H 5L2KA 3T0ED 3PWPB 3C60C 5DHYB 3QIBA 3QUXB 4YFLI 3ZO0A 5FOBA 1WEJL 3C08L 3ZKND 1X4YA 1DL7L 2FR4B 2FJHB 1A1MA 5T1DH 3HNTH 3O2DH 4X9GA 5IMMB 3S9DB 1Z9OA 1OD9A 3OBAA 1ACYL 3ULUD 3WFCH 2BFVH 5IB2B 4WJ5B 1N0XH 3HAEH 3WS3B 1EEYA 1T7XA 5HI3D 3LZFL 3WO3B 3W0WA 2PTVA 5I2IB 2VZUA 4JFZL 4NNYB 3SE9L 3BH9A 3NA4A 5GGUB 3O3AA 3U36B 4BZ1H 4L3ED 1F4XL 3U2SA 1AO7E 1JUFA 5IB1A 3CVHB 3U4AA 1JF1B 4G9FB 1EEZA 3REVB 3CH8A 4CNIB 4PJ9C 2AEPL 2ZSWB 4PJEA 5JHDB 2WBWB 3ARVA 5HHPB 5GS0H 5E2UH 2M2DA 3NGBB 4G3YL 1BQHG 1I8IA 3UTSD 3O0RH 2IG2H 2B4CH 1M4KA 3MNZA 4IRJB 4RMVA 3SKUD 3IDIB 1M7DB 5JW4N 4YBQC 2XV6B 4TUOA 1U42A 4MA1C 2WINB 4JY6B 4PJBB 1QNZH 3T8XA 3EAKA 3NPZB 5IGXH 4JRYB 2I07A 3V4VL 1CFQA 4MA8L 5CFHA 3G6JB 2G2RB 3BT2H 4X5XB 5JHLL 2CLZB 2H3NB 2ED9A 3MV01 3U6RB 5TDOB 1FVCA 5GZNC 1C5CL 4S1DD 5CCKL 4JDVB 3SDYH 4M61A 1RSFA 5DA0B 2NQCA 4HAGA 4XP4L 4R4FL 5IHBA 4S1RH 4ODWB 2W9DH 5L8KB 2P43B 2C5DC 4NWUL 3EBAA 1HIML 4OCXL 4LCWE 4U6XB 1X5ZA 3IDXH 3RWCA 4HBQA 3T1FA 1M7IA 2R1YA 3OKOB 5KVGL 3LHPL 1JCKA 1AH1A 4TOYL 1FRGL 1NC2D 4EDXB 2DQCH 4O00A 4XMPH 3IDGA 2JIXB 4OLUH 1LO0H 3VWKD 4Y4KD 1A7NH 3H9YA 4Z7UE 1YDPA 1VFBA 1Z2KA 3G04A 1BFTA 4KZDL 2HKFL 3H9HB 4PP2B 4PYHA 1BD2E 2MQCA 4Y16B 5DGRA 2AERT 4PJXE 2HVKB 2HRPH 3R8BB 4FNLH 4Z95H 3CX5K 4KDTC 2X4TA 3HCVB 2AV7A 3HE6D 4ZXBB 4M1CD 4UQ2B 1U8NA 3P30H 3C60A 3IDMB 2IAMD 3LY6A 1FIGH 1PX3A 3MPCA 1KXQE 4UT7L 4Q6YA 5LAXA 4LVOC 2AK4E 3HKFA 3VXNA 2W65A 2AXHA 1KJ2A 5D9SA 2JJTC 3VFMB 3VDBA 3QUZC 3NIDF 4LBEA 4FFZH 4M7LT 4RGNB 4Q9RH 1KPVB 2P5WA 2Q8AL 1KCRH 4P23B 5DEZA 3BN3B 4QXWA 3WIHA 1ZHLB 1OAXL 1BPVA 4X4MA 2VSDA 4GRMB 3RL1B 4PLKD 3O3UN 4I77L 4D0CB 2VE6B 3E8UH 4HF5L 3DUUB 3CSBA 3UTTD 4GKNA 4MVBD 4NO0A 2ATPB 1RHHB 4AEHH 2HYMA 4JB9H 1DQJB 4KK5C 1CICB 1UXWB 5IF0A 2NY1C 2XWBB 5JDSA 2FJFA 5FYJD 4P3CH 3WFHA 5CZXD 3MGOB 1FLRL 3B9VA 1AQKH 1T03H 4P5MA 1CBVL 5I8EA 1E4JA 3ALPA 3DV6B 5D1XD 4YHPB 1EMTH 4JKPH 1B4JH 1UACH 3GJFB 2Q3AA 5HDBE 1PG7L 4HMCA 4QGYA 1CK0L 5DMGC 4U0RC 1KJ2L 4OCRL 4MNHB 2LAGB 4XH2A 3H0TA 1S7TA 4EN3B 1EEUA 1U8OB 3QUYD 1J0ZA 3PP4L 2CKBB 4NQCB 3WIHL 4KRPC 3ZT7A 3IAPA 3BISA 3T0EC 3PV7A 5IFJA 3NIGF 2NNAA 3ZKNC 4M6OH 1YYML 2CLRA 1EFQA 4F8QA 2FYYA 3AS0A 4WI6A 3SDCA 3CFJB 3KPRD 3V95A 4R2GD 1MCWM 3ULUC 2CJUL 5H94A 3VFOA 4NHUB 3QPXH 3PWUA 4G8FB 5HI3C 4PIRF 3TT3H 1NBQA 1NCUA 2ESVD 4QRQB 3UPCA 4TSBL 1J88A 4Z78B 4AEIH 3PV6A 2LU7A 3LEVH 2OTWB 1J9CT 1X5IA 1HINH 3RX5A 2YWZA 1DVFB 1F6AA 3OMZA 1I3GL 2YKLL 1WLHA 3ARED 4OCYL 4P4RB 2ITCB 1ULVA 5HVGB 4TUKL 1UKSA 1J86A 1ZA3B 1HOCB 3CZFB 1PY4A 3HZMB 3BZFA 4XHQA 3Q5OA 3BW9B 3B2VL 3MLVL 4G9DA 5JUEH 3L3KA 4D8PA 4JPIA 5DI8A 5E5MA 1R3JB 5GRWA 3QUKA 3H3KA 1MCHA 4LCWD 5HHOB 5DJ6A 3TN0D 3TBVB 3PQYB 1A14H 4G8GE 2CIKB 1A1OB 3HAEB 3ZTJH 2BVTA 2IFGA 3RBGA 3PDOA 3S35L 3IXTA 2YD8A 3C2AL 4GO6B 2JJTA 1X5HA 4UB0L 2ZP0T 5FGBC 3QUZA 3R0MA 1NGYA 5DJ0B 2EKSA 3CFKA 2ZJSL 4HUVA 3H8NA 4M5YL 4HK0B 2FDBP 4TRPL 3WFDH 1JZ8A 2JE8A 3M8OL 3A6OA 5D70L 1BD2D 5B8CC 3MXVH 2GK0A 1U9KA 3QULB 1ONQB 3S6CA 1AXSA 2ICWJ 4K3DL 1XF1A 4Z7VF 3DX8A 3SGJC 3LKQA 3OSKA 1MFDL 1YN6B 4YK4B 4WCYL 5DD1H 3B6SB 3K2UL 3GI9L 3Q48A 2F8XC 4UINL 1QVOB 2AK4D 3VWKC 4AMKL 4Y4KC 4JHAH 4AEEA 3V6ZA 1F3JB 1NDGB 5JR1L 3Q2CA 4HX1A 3S8WA 1UC6A 3E2HB 1CTOA 5T1KB 3MBXL 3S37H 2O61B 5HVHB 3RIFK 4FABH 3HPJB 3INUL 4FTVA 4YLQT 3QDGA 3S34L 1U8JB 2AEQH 1MIMH 2VLJB 1HWGB 4PPTA 3KPSE 3NACL 5TE4H 1DQML 1MHCA 2HTLD 1UB5B 3K46A 2VLKD 3EOYG 3Q0HA 4HLJA 2WMPA 3VWJD 4U1GB 3UZVB 3NVQA 2RFXB 2CMRH 5FYKL 1WT5A 2W0FA 3HE6C 4OUUA 3DXAB 5HGBB 4XCFH 2YD5A 1QSEE 4PY8I 2Q1EA 3T0EA 4KROB 4MLIA 2IAMC 4ZOEA 2GHWB 2FZ3A 5DJYA 4C56B 5C9JB 2APXA 5CKGA 5FV2A 4MAUH 3MLYL 5I8CA 4ZOAA 3M1BB 4X7EC 2AI0L 3OZ9L 3QHZH 1A2YA 1YPZB 2BC4B 4BQ8A 2BCKB 4ODUA 4JRWA 2APBA 4NQXA 2R8SL 4WW2B 1CE6B 2EDNA 2Y06L 5EBGA 5E1HB 2I27N 3L3OB 2D0FA 1NMBH 1WAAE 2G5RA 5DUBA 2R39A 3L9RB 4MVBC 2R2BA 4O2EA 1FE8H 12E8L 1FYTD 1J8HE 2OI9B 3ARDD 4J1UB 5J1AB 3AC0A 5CZXC 4ELMF 3D85A 3ZKXB 4H0GA 3VMOA 1SM3L 4KMTL 4HPOH 1UWXK 2C9AA 4WWID 5I76A 1UM4H 3D3VA 1LNUB 5D1XC 3LN4B 4HBCH 4NQUA 1ZT1A 2D9CA 4JN1L 2FB4L 3SBWA 4NYLA 5CILH 3A6BL 5C0RH 4CW1A 2OL3H 3BRFA 1JNHB 5BRZE 4TNWF 1TETH 1A4JA 3QUYC 3MYJA 1AD9B 5EULV 3V6FB 3ULUL 1JHLH 4OIIL 4E41E 4XNQA 4MLSA 4U7KA 1JNLH 4CBPA 1BZ7B 1M05A 5EU6B 5FGBA 5I8KL 5ISZB 5I1DB 1T20A 1LEGA 2F8VA 3R1GL 3LMJL 4N0UB 1OGTA 4GW4A 1IC4H 2R29L 4MD4A 2SEBB 4OT1H 5B8CA 5SWQB 4R2GC 3WD5L 4AY0A 4OTXH 5CSZB 3H3PH 4ZUVB 3JWDH 3EOTL 4F3FB 4Q9QL 2B1HH 3SGJA 4WUKH 3BMVA 4QGTA 3RTQB 2A6IA 4EI6A 3KWWB 1HKLL 4X7FC 1W8OA 3QIWD 1G6RA 2ZNWA 4JLRA 5DLML 4ORZC 5ID0A 1FC1A 3DTXB 1KIRB 4Y4KA 2Y7QA 1NGPH 3CK0L 1UWEH 3SDDB 1T22B 1E4XI 1LK2A 4JO2L 1Z6JT 4UOJA 5D1ZC 3MRCA 3MJ8B 2DBLH 4A6YA 4XP1L 4HIJB 2PW2B 1EHAA 5TDNA 1UXSA 3VFNA 3L3GA 4NQED 1BWMA 4Z18A 3WUWB 4PRPE 3IFLL 5F1KC 3SDXB 4PD4K 1XF5B 2NPLX 1KB5A 3RGVD 3K8MA 4YFEA 3V4PH 3TN0C 3MRKA 3BX7C 3OTTA 4J6RH 1MSPA 4G8IB 4ENEC 4LCCC 1P4BH 1CG9B 1HKFA 2EDFA 2ZPKH 3BUYA 2E9WA 1R5WA 2UWEA 4RSVA 5AYQA 5FDYA 3V6BR 5CBEB 3S96B 4X9BA 3CLEL 1BJMA 3EYSL 5SWSA 2DQHH 4ETQB 3BXNB 5I73C 3EUUA 3KXFA 4NFDA 1AGBB 4YNYA 3IS0X 3B5TA 2VXVL 5I1CL 3C09C 1XR8B 3K4ZA 1L9NA 3H7LA 2PO6A 1MH5B 3MLTA 3QO1B 1XF3A 1G6RL 1AI1L 5A1AA 3QRGH 2BX5A 3UTTA 1IGJB 1SVZA 1AXTH 5D7LE 4XCEA 2XWJB 1TJGH 4FG6D 1MIEL 2J88L 2IPKA 1F13A 4A6YL 4Q74A 2V2WA 5J11C 3V52L 1UGNA 1ZGLA 5I75B 1RZJH 4OCWH 4HUUB 1KB5L 1G1CA 3SGKC 3TIEA 3QHFL 5GZOD 1XF4B 1T7YA 5D1XA 1AGFA 1N6QL 3C6SB 4JAMB 3RQ3A 4WV1C 3P77A 5I1KH 1C8PA 4PRHD 5BXFB 5B38B 4OV5A 2R2EA 3O2DA 2MWCA 4NRYA 4HCRH 1FYHB 4D0DA 2HTLC 2XN9B 2Q76A 3VWJC 3MXWH 4NUGL 4ZFOA 1I7RA 4NQDB 2YBRA 3UCRA 1CE1L 5HHMD 1AO7A 1MCBA 4XB7A 4FQCH 3V5HA 3O9WB 3X3GL 5C8JB 4XCCL 2NXYB 3MBEB 3QA3A 2YRPA 3ARWA 5E9DB 1EO8H 4YEEA 3FAWA 4U1LA 4ALAL 1RK1B 1AJ7L 4DZ8A 2FEEL 3B8SA 3U9PH 3WN5B 4L8SC 1D6EA 4LAJH 2VQ1A 1BLNA 3PJSA 2X4SA 1ZWIA 1CLZH 1KV3A 3EYUH 4GG8A 1CIDA 2W9EH 3W5NA 4Z7WB 2OQJA 3DIFB 1FL5B 3LH2L 4HIHA 1RZKH 3SKMB 2CSPA 2NY0B 2AK1H 3QI9D 3UTOA 1KC5L 1T04A 3DVNA 4IBLT 4JKMA 1UWXH 1TENA 5IK3A 2F53D 1BP3B 4KQ3H 3RFZC 3H9SE 5T1DL 3HNTL 4JKKA 3O2DL 5D1ZA 1OQXA 1LD9A 1LEIA 4KDVA 4YFLF 4Q6IC 4ZFOL 3VI4F 2HT4D 5DC0A 2BFVL 1A8JH 1C7TA 1N0XL 1ED3A 3JV6A 3QBTB 4CKVX 4LCWA 4JZNA 3TN0A 2DJ4A 3HAEG 4JM4H 4LCCA 4DCQB 1NCWH 3OKEB 4RDQF 4X9FA 4NCC1 5CJ5A 1BFOA 3ZE1E 1BVZA 3STLA 3DSNA 3CSYB 3OR6B 2DQIH 1G7PB 3MRMB 1K8IA 1U0QA 3AAZA 5DJXB 5F7FA 4Z7UA 4PJEF 5D7IF 1BOGB 4X5WA 5GS0L 2OTUB 4OLEA 5IFAH 4KI5F 3L95A 1G9NH 2VDLL 1R5VB 2IG2L 1MCD