3LRSB

Structure of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG-16 Heavy Chain Fab
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 211
sequence length 211
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsB02
1S9XA 1MAJA 1JYXA 3QEHB 3MLYL 2GTZA 2BNQD 3P4MB 4BQBA 5IHBA 1PKOA 3DOSA 1T1ZB 4EI6A 4YXHL 1WGOA 4D9QE 1S5HB 4QXWA 3MRHA 4Y4FA 3RWIA 3TT3H 3G6JB 4P49A 2WQRA 3QJHB 5C7XL 3PWJA 5JDSA 4GKZB 4HXBH 2ARJA 1H3GA 1NBVH 2HJLA 4Y5VA 4HIEA 1CLYH 4HF5H 1FL3B 1EAPA 3KPSB 4MMZC 2DYPB 4GW5A 2X1OA 1RUMH 3T1WA 3NFSL 3TESA 4LIQH 2GHWB 5C2BL 4OCSH 1QR1A 4EI6B 4R9HA 5A2IH 1EMTL 3MRHB 4WEBH 3FQXB 5HGDA 5JW5B 3PWJB 5JDSB 4XCYA 4F15C 5IMMA 2B1AL 3UCRA 1A2YB 4UUJB 4KROC 4XGZA 1T7VA 3IU3A 3QEUB 5EPMB 3FFCE 3NCJL 4HMDA 1RVFL 4NJAL 4GW5B 1OP9A 1P9MC 1N6QL 5E8OA 2HTKD 4S1QL 5FF6A 1HSAB 4P4RA 2HLAA 1GGBH 4Q0XH 1UCBH 2F8OA 3RZWA 4HUNB 1IAKA 4P2QA 2FJFB 3RY6A 1CDGA 3VG0H 2OP4L 3F7YA 2R1YA 4RSVA 5T1KD 1V7NL 5C92A 1MCFA 5FYJD 3EYOB 5HGDB 2EXWD 5B38G 3K3QA 1A4KA 5E1AA 2CQVA 4XCYB 1PAMA 1IC7L 4XGZB 5HI4C 4Y5XA 2DQEL 5GXBB 1MPAH 2JLLA 4HUMB 3IU3B 5GGTH 4H20L 1MRCL 2BSSA 4EZMA 1SJVA 1AQKH 5IROA 4HULB 1YY9C 2H1PH 1NCAL 4Y4FC 5J6GA 5DVOA 5GZOC 2WUBL 5GS3A 3P30H 5FF6B 2WANA 4Z7NE 4P4RB 1A3LH 4FQCL 5FHBL 4Y5VC 4QEGA 1IAKB 1JWSA 4P2QB 2VNCA 4YBQD 2R1YB 2FX9H 1X5IA 3RTQD 4GAJL 1RURH 4RQQA 1TQCB 4QTHA 4LGSB 2AV1B 5J11B 3S35L 1F90H 5I1AA 3EFFA 3MROA 5HYSA 2BMKB 1UVQA 4PJDF 1INDL 1FBIL 5BO1H 3B6SA 4H0GA 3VGEA 4Z7VA 5J6GB 1HSBB 3G5XB 4RCAA 2ICWI 5I2IB 5DMIL 3V6OA 4J3TA 3ESUF 3R4DA 1JWSB 5DRXA 3U2SA 2P1YA 1I7ZA 2DM7A 4LSUL 3DSFH 1MFBH 1R3LA 4I4WB 4RQQB 2VZTA 4QTHB 1RU9H 3GEWB 1DQTA 5I1AB 4NKMA 1NLDL 5DJDA 3RY6C 3L3GA 3GSWA 3PQYA 3PWLB 1ORSA 3B6SB 4LLMB 1XF4A 43C9A 4LSRL 3D87B 1ROWA 4YFDB 4GMSH 3PV6B 4MXQC 5CEXB 5HYEA 1NJ9A 3I3EA 2Y07L 4PLJD 2HG5B 3HE7D 4MAYA 4Y5XC 2MQ0A 4B50A 5DRXB 3CXDH 3FB5B 3FRPG 2DQJH 3GSRA 3LMJH 3DVFA 1I7ZB 3P40A 4X9BA 5IROC 2GK0A 2VXUH 4WI8A 1DQDL 1KBGL 2PXYA 4WW2A 1G6RB 1WZ1L 4NM4L 1E4XL 4K3DH 5TFSH 3P9LA 3AVEA 5DJDB 4DKAA 3L3GB 3JWOC 2VL5B 5FA3B 4Z0XB 1XF4B 5IEHA 1P84J 3VMPA 3ZMRA 5D70L 1NFIA 2P8LA 5FKPA 2IPTL 2ED9A 4MNGA 4UOJA 2HFGH 5IR1A 5GSRA 4L1DA 3I3DA 1CG9A 4MAYB 5D1XC 3GSRB 5T1LD 1M7DB 3DGCR 4LCYA 6FABH 3L3JB 4CMMB 2PXYB 3C5JA 3M1BB 1YECH 1J12A 1C1EH 4KC3B 4TULL 2R0ZH 3P9LB 3V6OC 1HCFX 5KSAB 2Z31A 2V5TA 5DO2D 3V4UL 5EFIB 2MQ3A 3MV8E 2B5IB 4FZ8H 5FM4A 2SEBB 3CZJA 5IVXF 1NFIB 4JRXD 1C5BL 4MNGB 4ONOA 5IR1B 5GSRB 4NM8L 1CG9B 4W68A 1G6VK 5KN5A 3WSQH 2C4FT 1YNKH 2FATL 1FE8H 3AAZA 3AM8A 1F11B 4L8DA 3C5JB 1MHPH 2W0FA 2B1HH 4KY1H 5C2UB 3QUYA 4WI3A 3QUXD 3DROA 4MAYC 1CT8A 3LKQB 4YHNA 5DD1H 3PF2A 4XH2A 3CSYA 4ZXBB 1DBBL 3PWPE 4OQ1A 3SO3C 3ME0A 4U1LA 4WW2C 5FYLH 5IB5A 3BIKA 4PYHA 5I8OH 2QJDA 4MQXC 3QWOB 3ILQD 3ZDXF 1BQUA 4FQHA 4F8QA 5KN5B 2W91A 4O2EA 5GRWA 1RZJC 2QHRH 1DQJB 1GH7A 3D5OF 4L8DB 4PGCA 3QUYB 4PRHD 3SDDA 4U1NA 3MV9A 4EQ3A 4XVUD 3DROB 2VC2L 2Z8WC 4P5TB 1IGFH 4LEOB 2WSKA 5CSBA 4U6VL 1YEIH 2ADFL 3CSYB 4PGDA 5F9WB 3PE9A 4JFZH 2APVA 3EJJX 1XGUA 1NAMA 3BIKB 3UTTA 3SDXB 2Z4QA 1QFWM 2IJ0C 5C0IA 1A7RL 1FFNA 3U0PB 2Z31C 3MZGB 3KYAA 4FQHB 4FFWD 4O2EB 4GH7B 4MB3A 4Q9BA 4E41B 3MV01 2ZPKL 1QBML 1UWXK 1EZVY 3Q6FA 1YEFH 3NGBB 3LEVH 4KFZC 4UOW0 1T3FB 3ARFA 1GC1H 1PG7H 35C8H 2R4RL 3TNMB 4XPHL 4PGEB 1P6AB 1O5DT 4TOYH 2ICWA 3DUUA 3AM8C 4OF6A 3V0AC 3QUYC 3IFNL 1XGUB 4ZQKB 3UTTB 2XZQH 2YMXL 4ZPTB 1P4IH 4MJ4A 3UJIH 5C0IB 4BFEA 3MXVH 4KJPC 2Q76B 4GSDH 3RVVC 4Y16D 2AV7A 1XZ0A 3GSNL 1BVLA 1V7MH 1EJ6A 3B43A 5IKCA 3EYSL 3TFKD 1Y6MR 5CP3A 4HGWB 2DQHL 4ENED 1JRHL 3ARFB 5HVWA 5LXGH 1C5CH 1JWUA 2F54E 1AH1A 4RBPH 1RY7B 5JPMA 5F6IB 4XXCC 2ICWB 2VLRD 1B0RA 4OSUH 5AZ2H 1DR9A 3O4OC 4U0RB 4P2OA 4MJ6A 3S35X 1R3JA 4WFGE 5D7SH 3SDDC 4OD3L 4H88H 1U3YA 2NX5A 3PGCA 2Y7QB 3QQ4B 4X4MA 5IB3A 1OGTB 3EZJB 2UWEF 25C8H 1KELL 3HE6C 4YHOH 3CDFA 5DLML 3ZKMD 1QNZL 5IMOB 2EZ0C 3VH8A 3GHBH 3OKDA 4L4VA 4WEUD 1JWUB 5AWNH 3PQYE 5I8KL 2GSGB 2ZG2A 1B0RB 3MCG1 4P2OB 4MJ6B 4LU5H 1T4KA 1R3JB 1RUKL 4XPFH 2ZUVA 4NIKB 4BH7A 2J6EH 2VXSL 3PDOB 9CGTA 4ODVH 3SBWA 5IB3B 2DI8A 1NFDF 4K2UH 1XIWB 3ILPA 1QPXA 2D7PA 2X1QA 2B0SH 2IBZX 4NQDB 4ZOEA 3WIFA 3V2AR 2D0GA 3H3BC 3O6KH 1XCQA 4LCWD 4WFHD 3B9KB 1F8TH 5HGBB 5HBBA 4QXGH 1RI8A 1CGTA 3VH8B 1AY1L 4C4KO 2MKWA 1U58A 2F53A 3DYPA 3LCYA 4B0MM 3S36L 3BD5A 3GMMB 3TGXA 1XT5A 3QCTL 3CU1A 4EUPG 4UNVA 1ZA6A 4BH7B 2PYEA 1LEIB 1A21A 3L3HA 4YR6A 4WHYG 3MRCB 1DQLH 4X9FA 1NGWB 5ANMA 3HUJF 5CEYB 1GSMA 2WIIB 5D96C 3KLDA 4P3DB 4IRZH 2PN5A 2R56H 3BMWA 3ILPB 4YDVA 1MHHA 4YLQT 1ORQA 1CL7H 2X4QA 4P2OC 1F3RB 1XCQB 4YHIB 5EU3B 1ZLWH 4CVXA 5I1HL 4GW4A 3PWUA 4X6BA 1J1XL 4IRJD 4KQ4H 4ONFL 3D0VA 3GGWB 1Q9OA 2GAZA 3VXRE 3C9NB 2J3SA 1ZA6B 3G08A 4LEXL 3SDCD 4YAQA 1J8HB 1KPRB 4YR6B 4NBXB 3ECBB 3NIFF 3MRJA 2EKSA 2FGWH 4CL7A 5ANMB 3HG1B 2E9BA 2HWZH 2IQAB 5GS0C 5FO9B 4YDVB 1MHHB 4LF3B 2QV2A 1NGYB 4NFBA 2YC1B 1MLCA 2BHZA 5EU4A 1RUQL 4CVXB 3GO1H 1IE5A 1YQVH 4X6BB 3SBWC 5KANG 2OI9B 4BZ1L 4IMLB 3RA7H 2GAZB 5DJ0B 4HJGB 4OZHA 1OGAD 4L3AA 1MNUH 1CFBA 3GSQA 4YAQB 3STZA 5HVFB 3ZKNC 4NHUA 2MCG1 4DFIA 2DN7A 2FDBP 4X7TB 4O2CA 4KKNA 5FOBB 4G5ZH 1U3HD 4R2GB 4GAGH 2H41A 4I48A 4PB0L 2BNRB 5EU4B 3RZCA 4H26A 1GAFH 1FO0L 3VFPB 4JGUA 2ZOKA 3KG5A 2YPLA 1BFVL 3K2MC 2Z91B 5D2NB 4HHAB 4W4OA 4LBEA 1JVKA 5I74C 1CL7I 3RVTC 3U7YL 4DVRL 1ZHKB 4OZHB 5MI0B 2HFEA 4X9IA 5GRJH 4JFED 3STZB 4JFPA 1XF3A 4PB9L 4F57L 4I2XE 4OZGA 1OOAA 4UU9A 5IW3A 2BVEA 2VISA 3VFWA 1KN2H 4JO2H 4ZSOB 4EXPX 2ICEB 4I48B 4WI9A 5IIEA 4UQ2A 3GMPA 1KFAL 3O4LE 3KPRB 2ZOKB 3R0MA 4W6YB 2YPLB 3D39A 3TIEA 3UTPE 4DOHE 3INUL 1G9NH 3MGOA 1MLBA 3UO1H 2MNUA 3WDHA 4CNIA 1E6OH 2A6DA 5SWZD 2HFEB 2OYPA 2BRRL 4M1GL 3ZL4L 4JFPB 4YIQA 5GRVK 1P4BL 3G5ZA 1CGXA 5HGHB 4P9HL 5CUSL 1UQSA 2C1PA 1BZ7A 4UU9B 5KSBF 4PJGE 4UTAH 5DSCA 5IIEB 4UQ2B 5MI0C 1FQ9C 2YK1H 3ALWA 3N1GC 1CGSH 2G60H 4YFLF 2FECI 4KV5F 3QUMH 2NXZB 2AERT 4P2RD 1NAKL 2NPLX 4QRRE 2EDLA 1CU4L 2HLFD 2CUMA 5I8EB 5KSVB 3CLEL 4LNVA 4Z7OE 2IF7A 1D7FA 3WNKA 5D72H 4FQXB 3QHFL 3RZCC 1XAUA 2HRLA 1HHIB 5E56A 3G5ZB 2NX5E 5DURB 3W0WA 5EA0L 1HXMA 8FABB 2FBOJ 4X4ME 4W4OC 3T8XA 5CJOH 4RWHA 4KDTA 3PG2A 3MACL 4HK3N 3DX8A 4K9EH 5C8JB 1ZKAA 1A3QA 2VLJE 4M1DH 5B39G 3ARBA 5CD5D 3BUTA 2V7NA 3NAAH 3RL1A 4RGMC 3LH2H 5T1DH 5A43C 1EFXB 1W0WA 2ITCB 3QDMB 2NXZC 3VXTA 2HT4D 3ARGD 3SCMA 2X9WA 1HXMB 1A14H 3MNZB 1HNFA 1LE5B 5KVFL 3WLWD 3GBNH 4Z7WF 3GJEA 5C0DB 4PLKC 1CLOL 4KI5F 3T8XB 4JO3L 4JREB 3GM0A 5CGYD 5IF0B 5JOPD 3BPNC 4FFVD 1OSZA 5LAXA 3ULUF 1HKLH 4HWZA 2F53E 1PKQB 3DTXA 2IH1A 1LK3H 5ADOH 5FUZL 2V7NB 4WU5B 5D5ME 2B4CH 3I2CL 4NP4L 2AGJH 4M6OL 1UGNA 4JVUA 5ITFB 4G6KH 3PGFL 2YKLH 1S7QB 1TVHA 3QRGH 1W0WB 3O2DA 3G6DL 4H1LA 4ALAH 3S36X 1JNJA 4TTGA 1SMOA 3CFKB 2JB5H 4D2NA 3GJEB 4O02H 3QIUA 4PJ9D 5IBUG 1HHJA 3D3VD 3L3OA 4TTDD 4Z95L 2PYFA 1YEGH 4HW6A 4JO4H 4OCWH 4HWZB 4B7IA 5I1JL 5EOTA 3DTXB 4KHTL 4PJ5A 4G3YL 2XZZA 2J1KA 3LN5B 4F7CA 4KDTC 1T1YA 4PJHF 3QIWD 4UT6H 4PJFE 2XNAA 3CFCL 5GJSH 1MREL 2J8UF 2EH7L 4JJ5A 2XN9E 1MI5A 3ARBC 3RL2B 2D7MA 3RIAF 3K0WA 4XNZB 1DL7H 4PJ8B 1QSFD 1GZQA 3MRPB 3QWRD 4G6AD 3QIUB 3AS2A 5JUEL 1NCTA 1EK3A 3VXSA 1BFOA 5C08D 5MEQA 4FXGA 3JVGA 4O58H 3SCMC 5DK3A 5DQDL 2R29L 3RDTA 4XMKH 5HGGS 1R5WA 1RV6X 4AIZB 2FO1A 3M8OH 4XC3L 5K33A 3NCBB 1T1YB 2IALA 2A9NH 4I0KA 1LDSA 3R06A 2XNAB 3T0EC 1A6UH 5CILH 1L9MA 4R4BA 4Y5YA 3RX8A 3C5ZD 5E8EB 1DBMH 1NBYA 2UZIL 4QXUL 5CIPH 4I8DA 5KOVC 3UAJC 2V9RA 3Q5YA 4FXGB 3V7AE 5MEQB 4PUBH 3KYKH 4NQED 4Y4HA 4JZOB 4JANB 3ZE1F 4PLOB 4OIIH 4L29A 4RA0C 4KH2A 4IRSD 1EHLH 1P7KA 3QIUC 4EQ2A 1U8HA 3H42H 1T83A 1LK2B 4XP9L 3IDMA 5L88L 4PP2B 3QHZL 3SKMA 3QCVH 1A64A 3GHEL 3OAUH 4OZGE 4Y5YB 4Z7UF 5F9AC 1CXLA 1TDQA 4HC1L 4YUEL 3D6GA 1MJ7H 1L4IA 4JHWL 4M6NL 1Q9WA 4UIMB 2YS4A 3BWUC 1I8IB 5GS2H 4R8WL 4HDIB 5B3NA 4XCCL 4PJ7F 3G5VB 4ZO6A 4PJDA 1KLUA 3BT2H 1D5XA 4X9GA 3JVGC 3SDAB 3VFOA 4N5EC 3C6SA 3SKMB 2NY7L 2BY3A 5F96L 3RDTC 1Y18B 3DMMA 4KHXL 2ADIB 1CXIA 5FHAH 3KPNB 5ALCL 4MNHA 5BZDB 2ZOLA 4HH8A 3O0RL 1ITBB 1M1SA 2OX5A 2KDGA 1CDUA 4Y5YC 3BD3A 5KJRL 4RDQG 2HA1A 1UCTA 4LLUB 4ZTPH 4PJDB 3FHQA 5C07E 1PBYA 2GJ6D 4OM0H 3C60D 3IDYB 3KNBB 4PRBB 5J1AB 4HWEL 3RIFK 4Y4HC 1AXSA 3OKOA 4LP5A 3CAFA 3VXOB 5DDHA 5I71B 1K6QL 4ODUA 4I13B 1T83C 5EU6E 5HHOE 2P48B 1A6AA 4ZAKA 2NY1D 3EDEA 2Z0BA 3A6BH 2JK5A 2Q8BL 4NZTL 4OZIE 3QFJA 4M1CD 2HP4A 3WL9B 2APTA 1KTLA 4XNXL 3VXMB 5B4MC 1UKQA 4RGND 3TIDA 1EO8H 3IGAB 3KPLA 3LKSA 5IVNA 3QXWA 1A6WL 1CICB 3ET9F 1ZAGA 1IKNA 3OKOB 5F1IB 1MCBA 3GMOB 1KCSL 1T21A 4OFDA 2OSLA 5DDHB 2V17L 5KW9L 3OV6A 4NN6B 3HS0A 4ZAKB 4PJIF 1INEH 1XF2A 1I75A 4KVCH 3T0EE 3UJTL 3S4SB 3AB0C 3P9MA 2W59A 3BP5A 4LAQH 1W72L 2IADA 3DMMC 1A7PH 2CLVA 4OZ4A 1AXTH 3WFHA 5C0AD 5JR1L 3LKSB 1IBGH 3KJ4C 2DDQH 3VFGH 2OZ4A 4JQIL 2EEDA 3QCUL 2R8SL 4G8EB 5BW7A 1MIML 5IVXA 4KAQH 2DLFL 1MQ8A 3KYMA 1MH5A 1BZ9B 4JG0L 1NCNA 2R15A 3HRZA 3FQRA 2Y06H 3LZFL 1RFDH 2LU7A 2JCCF 3ARUA 3E2HB 1AC6A 1LP9F 4HWNA 3HS0B 3LB6D 1XF2B 4P4KA 3SEPA 2X89A 3FN0H 2FBJL 3IDIB 1CXHA 2CLVB 3N1QC 4WWKA 1AO7A 1PLGL 3S5LG 5JQHC 1EDQA 5HDLA 5B8CA 1WBZA 5F7EH 3OKNB 4KKLD 1PW3A 3MRIA 1EFQA 2YD7A 5IVXB 5ETUA 2VSDA 5D7KD 4H25B 1G6RL 1MH5B 1WAAF 3MJ7B 1AQDA 3F7PC 4DTGL 4JQVA 4XX1G 5JHDE 5D2LA 1JGVL 5CEZL 3VXSE 4XMPL 1QOKA 4IOFC 4XCFH 3WFDH 5ICYA 5IESH 4NN7B 4OIAA 2VZVA 4MXVE 5ILTH 2IMMA 2A9ML 3MOBH 3JTSA 3HAEA 3E2HC 1AR2A 5B8CB 1WBZB 1OCWH 4ZPVB 3ULVF 2FYYA 1IAIL 2WQ8A 2EIEA 2IBGA 1FYTA 1BVZA 1KGCE 2QSVA 1BBDL 5E5UB 1M6OA 4PRPD 1I3GL 4PR5B 1JNHA 5ITBL 2PTTB 1AHWA 2ZCHH 4NQUA 5J3HC 2LVCA 2CIIB 3SE8L 3NZ8B 3WHE1 4UDTB 1MEXH 1HXYA 2EDHA 3TV3L 4K71B 1OSPH 1U95B 5HPMA 3LRHA 3WIHH 1ZGLB 1VGKB 2G5BA 3JTSB 5HDOA 2NY5C 1CQYA 6CGTA 5J9PA 4GKSA 4K8RH 4FABH 4X98A 2ZKHL 1X5XA 3B8SA 1I7UA 5H37G 4P4KC 3NA9L 1JHTB 4WWKC 5BV7H 5HYJA 1RIHH 1KIPA 4OGYL 5M7QA 3AMKA 1HXYB 4KKAC 4KROD 2HKHL 4MD5A 1FVEA 3VGFA 4R4FL 5IGXH 3QNXA 1MFNA 1LD9A 4JQVC 4IOIB 2G5BB 2DMBA 2HAZA 2HYMA 1CIUA 3QDGA 2NY4C 3EDDA 3PHQA 4GKSB 1FRGL 5B3JF 2GFBA 3WNNA 4JDVB 4Y2DA 5DTFA 4HD9A 2KL6A 4A6YB 1WIPA 3BZ4B 1J1OH 3QO0B 4XVSH 3LKRA 1I3RA 4BSVA 2UWEA 1I3VA 1I8KA 2OR9H 5HI4D 5BZWA 5CIPB 1DUYB 3RVXC 1FVEB 4XPBH 1YY9D 3K4DA 4G43B 4Y4FD 2P5EE 2LTQC 4JJHA 5GRYA 1T7ZA 5HHQB 5IEKA 1AHWC 3U6RB 1I4FA 2V2WB 3PHQB 5KVEH 1OAXH 3W9DA 2E7HA 4Z18A 5E8NA 4L8CA 5JZ7C 3D18A 5EZOH 5DQ9A 1N0XH 3BKCH 5FYKD 1NFDA 3LKRB 3TT3L 5C0EA 2XTLA 4BSVB 3QSKB 2VQUA 4NCC2 5L2KA 4HXBL 2EDXA 3VFUA 5DC4B 4PBVC 1I1FA 1NBVL 4OJFH 1YQ2A 1CLYL 3UROR 4FMKA 2VDQH 4HF5L 3T3MF 1REIA 4KKBD 1XR8A 5MENE 3MO1A 1FZKB 2XY1A 1IEAB 1LO0H 4MSWB 2VL4A 3WIIL 1S5IL 1HQRA 4NWTH 5E8NB 1LWRA 4LIQL 3DV6B 4I3SH 4OCSL 5DQ9B 3R8BB 3P77A 1VEMA 1U8MA 4HZLA 4ELKB 4WEBL 3JWDC 5FO7B 3KWWA 5L2KB 3WFEH 2WZPD 1OF2B 2BOBA 3LKNA 4G8FA 4P2QD 1KJVA 1I1FB 5F1KC 4Y2DC 1S9WB 4M93C 4PY8J 4LHUA 4KK5C 2FGZA 2FB4H 2YWZA 5EG6C 4IIQA 1MJJB 1UH3A 4Q0XL 1UCBL 2Y5TB 3P73B 3VG0L 4WEMB 1R3IH 4AT6B 3HUJB 5IBTH 1U8MB 4HZLB 1SQ2N 3OX8A 1BREA 1IGMH 3KWWB 4NNPL 5CHNB 5IB4B 2OJEB 1B2WH 4YEFA 2BOBB 3LKNB 4KZEL 1VCAA 3BEWB 3BP7A 4M61A 1MPAL 5E6IA 1NMCC 5GGTL 1AQKL 3QQ9C 4LHUB 3WHXA 1AO7E 4ETQB 3BPLC 3CDGB 5FFLA 2PO6B 3P30L 3PWPB 3SE9H 2GCYB 5AD0B 2BC4B 3RU8H 1A3LL 4KK6C 1FN4B 5K59F 3LQAC 4GG6E 3KLAA 3U79A 2FX9L 2IANA 5AEAA 1UZ8B 3C8KB 1RURL 3JV0A 5D2LE 4LAJH 4BFBD 4HG4K 1EV2E 3TJHC 2C3HA 3FONA 1MAKA 3PNWA 1F90L 4JPWH 3BZEB 5KG9B 4HKZB 1MHEA 4M61B 4G6MH 5E6IB 4U7KA 5TQ2H 3WHXB 4YNYB 4MD0A 3FCTA 3QXAB 3FTGA 2IGFH 1FYTE 5CEZD 3FQWA 4TPRH 3C6LB 3BX7C 1JI1A 1QHPA 1R24A 5HXMA 2I07A 3DSFL 2NY0C 4LVOB 3B3IB 3FT2B 1RU9L 3MRKA 4IIQC 3FONB 3H7LA 1QPPA 4MAYD 1RHHA 4X9HA 2Z8SA 3T4AB 5GS0H 5EBLA 2K3TA 3QDJE 4Q2ZB 3RKPA 1AJ7H 3WKML 2PXYD 4MGXA 4G9DB 3LN4A 4GMSL 3FTGB 5SWSA 4JG1L 5KSAD 2VERN 3S97C 2ITDB 3CXDL 5E6IC 2DQJL 3LMJL 5C9JB 1R24B 2I07B 2VXUL 2MOVA 4FHBD 2P5WA 2EDQA 5C09A 5IB1B 4QNPE 5TFSL 1J88A 5K9QG 3E6FA 1Z9SA 5ENWB 1AP2B 3I75A 3EYFA 4GT7A 3RPIB 3P4NA 2D03H 4LVOC 2CMRH 3QDGE 3AFLA 5IVZA 1CD0A 4ODWA 2HFGL 1ODAA 3EO0B 4LCIH 2Z31D 1A0QH 1RHFA 5TJWK 4GFTB 4B41A 4ZXBD 3VFVA 3MLXH 15C8H 3MOAH 4NRXB 1CS6A 3SGKA 1WIOA 2FEEI 6FABL 4M3JA 5L8KB 5KSBB 2ED8A 1X4XA 1YECL 4HCRL 5EN2A 5C09B 2R0ZL 4GRLA 5GRVL 4M62H 4O5LH 3U4EB 4M48H 3O45B 4W4NA 2JJSA 1K8DA 3EYFB 1YN6B 4N90E 5EU5A 3QUYD 1CIDA 5IVZB 4L9DA 1QBBA 4YHPA 3TVMA 1OD7A 3CX5J 2CJUH 3DLQR 2ZSWA 3IKCB 3L9RA 3MREB 1WSST 3GKZA 2VIRA 1EEZA 3DGGA 1YNKL 4K94C 1FE8L 4ONHB 4KJWC 5A16B 4Z7WA 3E1F1 1MHPL 4KY1L 1MFAH 1HEZA 4GRLB 5BV7B 1OD9A 1CR9H 2OM5A 5DZLA 3T77B 4ZNEE 4HZAA 5JORA 1NCCH 5DD1L 3SE3A 4CJ0A 1EO7A 4E41D 4FA8A 1K8DB 2DL2A 4FQ2H 4OCXL 5EU5B 1EGJH 5FYLL 3SDDD 1J1PH 3MV9D 2VH5H 2J2ZA 2VDMH 5J57B 2WM0A 2UYLA 4YHPB 5I8OL 2DBJA 2J8OA 2HVKA 3AS0A 3QEQA 4GW1B 4YBLC 2AQ2A 5DXWA 3OKLA 2O61B 2QHRL 2R0LH 1OARL 4Z7WB 3UTTD 5IP4A 1BJ1J 5BRZA 1HEZB 4HUUB 3BW9B 1U9KA 1DEEB 4XHQA 1N26A 1IGFL 1YEIL 2K1MA 3SGKC 4G8GA 2M2DA 2AP2A 1H5BB 4JFZL 3KXFE 3I6LD 3O6LH 3VXRB 3ARFD 4GRLC 2UYLB 4PJHA 4LGPB 2HVKB 3QEQB 3SQBA 2JJSC 3OKLB 1LNUB 2AW2A 2DM3A 5TE7H 1QUNA 1ZMYA 2PCPA 1HDMA 1YEFL 3LEVL 1IAIM 2V2XA 1I85A 1B6UA 5JW4Q 3TVMC 4OLVL 5DD3H 1RJLB 3FAXA 1GC1L 1Q9LA 2DQIL 35C8L 2EDOA 4TOYL 5DHYA 2AJXH 2Y6SC 3P2TA 2Q1EA 3G04A 4ZFZB 4OM1H 5D9SA 4KI5C 2XZQL 4N0YH 3QFDA 1P4IL 4PJHB 2B7DT 3STBA 3DUSA 3NZHH 3UJIL 1GL4B 5I6XC 1RJYA 3MXVL 4PRIE 4GSDL 3SE3C 5DR5H 4QRPA 2UZYB 2EO1A 2J8UB 3JXAA 3ULUC 4P2OD 1NC2B 4EVNB 3B5GA 3ULSA 4NDMA 4AYFA 1HDMB 3NPZB 2V2XB 2WAHA 4ISVB 3K1DA 4CVZA 1RZ7H 1PFCA 5F9JB 1Q9LB 5LXGL 5T3XD 3SKJH 4UIKH 1C5CL 2GI7A 2L4OA 4WTZG 4M8VA 1ZV5A 5DHYB 1JUFA 4OSUL 5AZ2L 1H3VA 1KPVB 4PGBB 5JMRA 1MRDH 5D7SL 5D9SB 5L8JB 4H88L 3SGJA 3GK8H 2LU4A 4XPGL 4CW1A 4KRPB 2WWKT 3QFDB 4L4VD 1RJYB 2QADC 4QT5A 2EC8A 3EDJA 5D6CB 3C09B 4I2XB 2C4XA 25C8L 2BVPB 4YHOL 1R3KA 1UJ3C 2VRAA 4WDIB 1P5VA 3RIAK 4XC1H 5CJXA 3RGHA 2CK0H 1QSEE 3O4LB 4ORZC 5AWNL 4MYWB 1GGYA 4JFDA 5K9KA 4NQCE 4DOHB 1JUFB 5EWIH 3OXRB 3TO2A 3U0TB 3BXNB 1CLZH 1YEKH 2VLKE 4LU5L 1UT9A 5I0DA 4XPFL 1UM5H 1I85C 4CW1B 2KUTA 4ODVL 2DQTH 4Q74A 3VDBA 3WBDA 1BJ1H 2B0SL 4Z7UB 4YZFF 2AXJA 3O6KL 2PYED 4UV4H 1J8HD 1F8TL 2VN7A 4QXGL 3V52H 4Q6IB 3S3PA 3HG1D 4UDUA 3HNVH 3SKOB 3C09C 4JFYA 1VESA 4JFDB 5K9KB 3S88H 2ZUQC 4QRRB 1ZHLB 4JHAL 4OT1H 2BSRB 4PJ7B 2A83B 4NRZB 4H1LH 1XGQA 2F58H 1GXEA 1OTTC 2ERJB 1NLBH 1DQLL 1HIMH 5F1NA 5C0BE 4HK0B 4IRZL 1BOGB 2R56L 4JN1H 4OZFA 1CL7L 1RZFH 2ESVA 1NBZB 4S1DC 5DJ6A 1JK8A 3SGJC 3L5JA 2YBRB 4R2GD 4KQ4L 1U8QA 4QRSA 4D0DB 3VCLB 1JZ7A 4G42A 1DE4A 2VE6A 3B5HA 4AENB 1DQMH 4YHLH 2X5PA 2FJGB 2AEPH 3HR5A 4LSPH 3BI9X 5CJXC 3IDNA 2FGWL 4LLAA 5F1NB 1JN6B 4WUUE 3FRUB 5IJVA 2HWZL 1EO5A 3L3IA 4ZD3H 1FNGB 5L0QC 4RIRA 3CPLA 1M71B 5DJ6B 3HI6H 3GO1L 1YQVL 4R7NA 4TNWK 4PJIA 3MCKA 4E0RA 1CTOA 1U8QB 4QRSB 2COQA 4G42B 3RA7L 4WFED 5T3ZE 1ZT7B 3OB8A 5C0RH 3CMOH 5D5MB 4BZ2H 1U92A 1V3JA 2YPLD 1EJOL 8CGTA 5I1CH 1FZOB 2XOTA 1D5MA 5D7LA 3IXAA 5IJVB 3F8UB 4PTUB 2XXCB 3KAAA 4G5ZL 3GNMH 4ODHH 4GAGL 2BSED 2YA1A 1A4JA 2W0LA 4RWYH 4CKVX 3HHRB 1N6UA 3CPLB 3CSPA 1AIFA 3CC5B 1GAFL 5BRZE 3WNMA 1FVCB 1Z3GH 3ZTJH 5EO9A 1J0ZA 1N7ML 4PJIB 4WI4A 5LKNA 1E27A 5T5NG 4HS3A 3QH3A 3F7VB 4XP6L 1UEMA 1MAMH 5HHMB 3BE1L 3L7FA 5GRJL 2NXZD 2XWJB 4UBDC 2EYTA 1PQZA 3O3UN 4PJFB 5E2VL 1PYWB 2AEQH 2XN9B 5DHVB 1KN2L 1WAAA 2JKXA 4G6FB 4JO2L 2E3VA 3PP4H 4FQXD 5F89B 3K2UL 5DURD 5L8LB 2JCCB 3MX0A 1LP9B 5EO9B 2IBZY 4RMRA 3EGSA 1E27B 2VXVH 3RRQA 4HS3B 3QH3B 3LPGA 4XXDB 4HIHA 3P0VH 1E6OL 4U1MA 5F7DA 1PG7X 3TA3B 1KENL 3W82A 1SHMA 1MCCA 4AH2B 3DRQA 1YEEH 1BX2B 4X4XB 1J8KA 4F7MA 3OBAA 3WS6A 2YK1L 3QDMD 3BJLA 1CGSL 2G60L 5CZVL 1T0PB 5D1QB 3W0WD 2YD5A 1EVTC 4MQTB 1KSRA 4OCNC 1WTGT 2ATPA 3B9DA 4YXKL 4YWGH 4U1MB 1LEGA 3HZYB 4OF7A 1LDPH 2H45A 4R0LA 2GITA 5D72L 5BS0E 1F02I 2BVUA 4ELME 5FB8B 5I1EH 5JO5A 4MQSB 3ARBD 4MNQB 3X3FH 1U93A 1N4XL 3CVHA 1IM3A 2R9HC 1J0YA 3RNQA 1FC1A 2GUOA 3OGCA 1TNMA 5ABDE 5CJOL 5HGAA 5FO8A 2G9HA 1URLA 4GKOA 3LSOB 4MQ7A 1RULH 4K9EL 1GOGA 4JFFE 3SCMD 4C54A 1WK0A 1F3JA 1KB5A 5HYIA 1UWGH 3OAZH 1MCWM 4M1DL 4N8VA 1BBJB 3QUZA 3NAAL 1LEGB 4MJ5A 1IVLA 4R0LB 2GITB 5T1DL 5I16A 4KJYA 3BP6A 2O5YH 2A73A 1A14L 1U93B 4LLDA 4V1DE 4UV7H 4U6XB 1PDKA 1IM3B 3GBNL 3KPQA 4NN5C 2GUOB 4Y4KB 5ELIA 4QYOA 3UAJD 5DD6A 4ZTOL 3U36A 3HMWL 2C3XA 5F7KC 4J8RB 3UTSE 1KB5B 2O5XH 1QFOA 5FGCE 2AK1H 1HKLL 2DWDA 3EOYG 2X7LB 2EE6A 3QIUD 5ADOL 1J0IA 4TUJB 3WS6C 4GUPB 2AGJL 5IOPB 2OZ4H 2G5RA 1G7LA 4QLRA 5C07B 4ALAL 3WS3A 3TPUB 3KHOA 4KJYB 2YD4A 5B38B 4MX7A 2JB5L 5TPWH 4J3SA 4ERSH 4G7YH 2NY5H 4O02L 4HKBA 5DD6B 2ESVE 4R0LC 2ADJA 4QOKE 3B2VH 1S7TB 5EU6B 1MI5D 3RWEA 1KCRH 1T0NA 5C3TA 1LO5A 2OMNA 4OCWL 4XNMB 5E99H 3REWA 3BGAA 4LHJB 2OS7A 1MUJB 3TN0C 3ZLQC 1TQBB 3KPPA 4X6EA 4UT6L 2V7HB 2ZJSH 4HS6A 5GJSL 3RDTD 4HIJB 1KJ2B 1G1YA 3H7BB 5DGRA 4RDQF 1DL7L 4Q7DA 3QUZC 2NYYD 1YC7A 3CX5K 5TDPB 3L5XL 4ZUTB 4DGVL 4EN3A 3TYFA 3QDHA 3QT2A 1IZJA 2YPKA 4AMKH 4L3EE 2VQ1B 3VI4E 2A2QT 1Z2KA 4X80L 4XMKL 1GIGH 3K8KA 5FV1L 4QRUA 5ERWA 4B5EA 3HAEH 4EOWL 3M8OL 3FRPA 5IV2A 5D6DA 2A9NL 2D7QA 4A6YL 3HMXH 5IM7B 5DMGD 2NW2B 1QA9B 1A6UL 5CILL 2H32A 2VDNH 4XBEH 1D5ZB 5D7LE 3PJSA 3EOAA 1KIQA 3ARSA 5EORH 5JQ6H 1VEPA 1DBML 4WI5A 3EHBC 3OHXB 5C6TH 2XWTA 2AXGB 1NCDH 3VI3E 1TQBC 4ZFOA 3SDAD 5DGQA 3RKDC 3OR6A 3TYFB 4PUBL 3MA9H 3RI5K 3KYKL 1CXKA 4M5ZH 1FH5H 4OIIL 2XG4A 4FTVE 2VAAB 1T20A 1A9EA 1A02N 2HT3C 4M7LT 4P57B 3H42L 4HKXB 5DJCA 3WN5A 4H5SB 4QRQA 3MBEC 5IG7B 5DJXA 5L9DH 3QCVL 2ADGA 1FZJA 3OAUL 3BDBA 1NUNB 3PJSB 1VKXA 4KXZI 1D5IL 1G9EA 3DPBA 3VRJA 1BECA 1MJ7L 3NN8A 3OR6B 3PUCA 1WVZA 3RUGF 4N9OB 1EBAA 3MR9B 2QR0A 3DMMD 1AC0A 1QD0A 1LVEA 1RIUH 1S8DB 5I1LA 1T20B 2C1OA 2BVOA 2C5DC 3BT2L 1VPOH 5D93B 4EN3C 2ENSA 4R96B 4NNXB 2IG2H 2XV6B 5HHNA 1FZJB 3VXMD 2QKIA 3PHOA 5F71A 5H8DA 2XT1B 4FXKB 1GVIA 3WE6B 1P69B 3QHTC 1ZLUH 2NNAA 3MSPA 4F80A 5FHAL 3VRJB 2LAAA 5D6DC 3NN8B 2LV4A 1CICD 4YHYC 1CD9B 4X6CE 1YMMA 2FCBA 3KPOA 4EBQH 3NABH 2AK4E 2QR0B 3H6JA 4L4TB 1JGDA 5IFJA 2WWKO 2NY2B 1FP5A 1TENA 5FK9A 3UTOA 1Q8MA 4ZAKD 4OM0L 2HRPH 5SX4I 4XBGA 3QFJD 3BRFA 1M05A 4XPTH 5HHNB 4AM0A 1I9JH 4DFHA 1T04B 5GPRA 5E08H 5DJYA 1EZVX 1FG2A 4QGYA 3WN5C 2BERA 4ACPA 1XGYH 2X44D 1T5XA 4P23B 2HKFH 3A6BL 1QG3A 3LDBC 5JA8B 1Z0MA 4L1HA 3QXVA 3MOQA 4MA3A 3SDYH 2ZSVA 2EXWC 1JGDB 1WTLA 3V4PL 5IFJB 4LKXA 4JGMA 1EO8L 4V2CB 3HE7A 3D2UA 4W70A 2M1KA 3GJFA 3QA3A 2YZ8A 1U8JB 4XBGB 1NDMA 1HHHB 4BKLA 2HFFA 3CXHJ 4AZ8A 5SV4A 4TVPD 5DJYB 3HNSH 4MZ3A 3SOBH 5IJKA 1NKRA 1IEHA 4QY8A 3T2PA 1ZE3C 1T5XB 3CH8A 1INEL 2P7TA 5E00B 4GQPH 1DANU 3RTQC 4MA1B 4LAQL 5DUMH 4HUVA 1A7PL 1AXTL 3DETC 2WUCL 3D2UB 3MV7E 4JHBA 2DDQL 1WLHA 3GJFB 2VDOH 4KGLA 1A6VL 3QA3B 4KUZH 4MJ2A 4GXVH 1B4JH 1WFUA 3GIZH 4P4KD 2YOCA 4BKLB 3H9SE 4U6HB 4DZ8A 4KAQL 3DHMA 4HMEA 1XEDA 5E2JA 1H0DB 1JHLH 4WWKD 1KLGA 1TPXB 4I1NB 4S0SD 1IGJA 2Y06L 1X6LA 3MCLH 4LFHD 3FT4A 4K3GA 5CBEB 4QY8B 3MLRH 1OL0A 1BMGA 1T1XB 2P24A 4HXAH 2NY6B 3WYRA 3U0WH 1ONQA 4HIIA 4OKDA 4HUVB 1CBVL 4P46A 4OGZA 3S96A 1OQOA 2OL3A 4FFZL 5F7EL 2BNQE 2IPUG 4JFXB 4UI2A 3F65A 1QFUH 1D6EA 5CLWA 3TNNB 1KLGB 3MRNB 2GT9B 3HNTH 1NMAH 4K23L 2YZ1A 4XCNA 4CDHA 4PLJC 3QUXA 5JOFA 3HE7C 2Y36H 1HK6A 4M7LL 4QRTB 5IQ7L 4XCFL 5IESL 1I8MB 2CRIA 4X6DF 4KRNA 4KMLB 1DEDA 1S9YA 4TUOA 3PP3H 1TPXC 1XGTB 3JSSA 5KS9E 2P46B 3MOBL 4P46B 1UADC 5IQ9B 3V6ZB 4FOMA 3PGDA 2OL3B 2ATKB 1WQVT 4D0CA 1A9BA 3OAZK 3BH8A 2Z92A 1D6EB 4K7PY 5JZ7D 4JN2B 5FGRA 3S4SG 3TT1H 3ZT6A 1BIHA 3TCXA 1CFSB 2G2RB 4PRHA 4XCNB 3SJVB 4DK6A 2ZCHL 2XFXA 1MEXL 3TJEH 4KI1A 3GRWH 5FUOH 3WLBA 1IM9A 3D69A 3MUGA 4I18B 4PJAE 1QLEH 1OSPL 1UA6H 3ZDZF 1FJ1A 3WIHL 3STLA 5HYJD 4TUOB 1IJ9A 2EDEA 1YNLH 4B7LA 1XH3A 1G7HA 3VWJA 4LMQE 5J1TC 4LVNB 4XMLH 3RWCA 4K8RL 4FABL 5D7IA 2CKBH 3BH8B 3TPKA 1DQQB 3BEVA 1VACA 5FYJE 3NFPA 2EECA 4L9LA 5BV7L 1RIHL 4GG6B 4LVHC 2XFXB 4S1RL 1SEQH 2ENYA 2E7CA 1YDPA 4P3WA 1CD1A 4Y2DD 1IM9B 3MUGB 3UTQA 3WLBB 4PPTA 1FNFA 4EUPB 4JPIA 2HVJA 3FHAA 4RAVB 4CN6A 3BP4B 1F6AA 1FJ1B 4LLWA 3O81A 5IGXL 4GMTH 1AGDB 3BUYB 4KK5D 3VRIA 1HH6A 2ORBL 3QUXC 1XH3B 1G7HB 5EOCJ 1YEDA 1C16B 3NTCH 5ALBH 3T08A 4HH9B 3OKEB 3RWCB 2EEAA 4Y16A 3HZKA 3RVWD 5CD3B 2GJZA 4EIGB 3BEVB 1KB9J 2EO9A 1J1OL 1MY5A 3U30B 1ZT1A 3D0LA 4XVSL 3G6JF 4BFGA 4CU8A 1YDPB 3MMEA 4NO2A 4NRYB 4JPIB 1F6AB 2A6KB 3QR2A 1JL8A 1WITA 4XPBL 1N59A 3QQ9D 5DQJA 5I1IL 5LGJB 2YSSB 1PZ5A 4EJ1C 4N1HB 4JRYE 5L2KD 3QDJB 3UC0H 1QLFA 3AGVA 3ZTNH 3O3DA 4KK6D 5KVEL 1OAXL 4PIRF 1K8IB 1TVBA 2GJZB 5IBLC 3VRLE 4PREA 1A1MB 1N0XL 1ZT1B 1Z6JT 1AGCA 3D0LB 1H3WM 3VWJC 2WNGA 2AKRB 2Q8AH 5FDYA 1JZ5A 3HC3H 3G6AA 4NO2B 1XF1A 5JIHA 4OJFL 4W81A 2VDQL 1B0GA 4UINH 4NQVB 2FIRT 5T3ZH 3U30C 2Q7YA 4L9LC 1VADB 1PZ5B 1DLHA 1UB5B 4D3CL 1ZVSA 4DKEH 1ZGLM 1IL1A 4TQEH 2NLJB 2MKLC 1NC4A 5BMFL 5BXFA 4NWTL 4AY0A 5A2FA 4PREB 1JRHI 4LHUD 4I3SL 2C3WA 2NY0D 2EYRB 4PV9A 1AGCB 2VZOA 3IAPA 2W0KA 4P3CH 3WFEL 2EE9A 4MA7H 4Y16C 4J1UB 4KKCC 3PWVA 2LAGB 3IJHB 4W6XB 1VFUA 2UZXB 2FB4L 4OKVA 2GEEA 1TJHH 2PNDA 4X83A 3HB3C 1HZHH 2A6JA 5E6ID 3WNPA 4I9WD 3I9GH 2R1XA 2AJ3B 5IBTL 5C0CA 3HKFA 4IRJA 1B2WL 4DGIL 3CH1B 3EJZC 4R90H 3UPAA 5FEBA 4POUB 1QACA 5EOCH 2IAND 1MRFH 4JRXE 1KULA 4OLUH 4U0QB 1QRNA 5DF0A 3QDAA 4XNUH 1JF5A 1OW0C 4OKVB 2I60H 3RU8L 1ZXQA 1DDHA 4NWUH 2R1XB 4F7TA 4KRLB 4UILL 5EZLA 5B39A 3N0PB 4ONGH 4U31A 3V0VA 5KSUB 1GCFA 4LARH 1HCVA 3OQ3B 1MHCA 4Y89A 4NC1E 4G6ML 1OGAA 5TQ2L 5INDA 2XPGB 4JDZA 3VD4A 4Q9RH 1OT1A 2FEEL 2FH6A 1J18A 4CU7A 3MRRB 1WZKA 3RGVA 4FN0A 3LVEA 2APBA 3SGDH 4TPRL 4YDIH 1DDHB 3ARRA 4R3SB 3VDCA 3QG6A 4KJWD 4PRHE 5EZLB 4WHDA 5B39B 4RISH 2J8HA 2DAVA 4AEIL 3DV4A 1CE6A 3V0VB 1DBAH 4U1IB 4PGJA 1E4WH 1EEYA 4WI7A 3V8CA 5GS0L 5INDB 1N5AB 2JJWA 4JFEA 3ARZA 4HWBH 1Y0LB 2Q86A 4JDZB 5I73B 4BSWA 5C09D 4IRJC 1G7QB 3A6CH 5IHZA 4Y19A 4U1JA 5D7IE 2XKSA 1J86A 4J2XA 4PFEA 3MUHL 3FOLA 4UNUA 3FFDA 5DK0B 2UVFA 5LGHH 4N9GA 2X70A 4F7PB 3F12B 3S9DB 3BHBA 3DV4B 2IFFH 1SEBA 1MJUH 5E94B 5JA9A 2RQ8A 1KEMH 1TZIA 4K7PH 3QNZB 5DRZB 2Q86B 4HX1B 3WNLA 2CMRL 4U7SA 1HOCA 4JY5H 4GRLD 1N8ZA 3NVQA 4GRWE 5IBUB 2FR4B 3KVQA 5IHZB 4LCIL 4Y19B 3LEYH 2BOCA 3V6FA 2JIXB 3MLXL 15C8L 4KPHH 4MB5A 4XNYH 3FFDB 4X5XB 4OZFH 4Y1AA 3HC0A 2X70B 3O2WH 4N9GB 2YUZA 4DKDC 3O9WA 3BHBB 4P2RA 3S3JA 2F8VA 4ZDHB 3RGVC 3TVMD 3GSVA 3FB6A 2VTFA 4MDIA 4N1EA 2VLRE 4UOW1 1RZIA 1D5BB 1TZIB 3EFDH 4M62L 4O5LL 4M48L 2Y6SD 4NKDB 3UPCA 2OK0H 2OXHA 1QSEB 2ZUXA 3GSNA 2C3VA 3U46A 4NQCB 1JMZA 1HOCB 4KI5D 3FO9B 3MRQA 1D9KB 1N8ZB 2VLKB 4OF8A 4BQ6A 1AGBA 4OLXH 2IPKA 1CDIA 3PP3K 3ULUD 2VO5A 3FQUB 2YD8A 1ES0B 5SV3A 3U4AA 1OAYH 4PG2A 1MFAL 3GSVB 4O9HH 3I6KB 4WVRA 1K5NA 3E6HA 4MDIB 4WU7A 3TO4B 1CR9L 1RZIB 1U41A 2JB6A 3QEQD 4X6FB 1U8IB 5JPNA 1NCCL 3OG4B 3ZE0F 4FQ2L 4O4YH 3U46B 1EGJL 1J1PL 2W60A 3A6OA 1KIRA 5E2TL 3RHWK 4NUJA 1TMCB 5TDOB 1GOHA 3ARYA 4G8GD 4LCWE 5EC1A 4WFHE 5FYJU 1KNOA 2VSCA 3VWKA 4R97C 5HYSG 3NPSB 5C0BB 3TLRA 3PDDA 4RGOL 3MRDA 5HD8C 3BN9C 2H8PB 1LHZA 1R5IB 2CLRA 3GSUA 4OF0A 4N0UE 1K5NB 3DUHA 4PRDA 4WU7B 2JB6B 5JPNB 4FZEH 4S1SH 1VHPA 2P47B 5HDBE 3P4LA 3O9WC 3O6LL 3F62A 2CRZA 5KVGL 3CFBA 4AQ1B 2ZWLT 3F5WA 2HLFC 2ED7A 5DS8A 3OKMA 1HHGA 1OWRM 5EC1B 2QHLA 3VWKB 3O3BA 1SY6A 4WUUB 1K2DA 1JPFA 1B6DA 4KMTH 3MRDB 3UJJH 3QP3A 4KRPD 1K4CB 3H8NA 3WEXB 3IYLW 1WISA 5DD3L 5H94A 3F6IA 4QRPD 1EHNA 1KCUH 2R2EA 5EU7C 4PBWD 1P53A 1S7UB 3ZHDA 5ISZA 3L5WA 1V05A 5EOQL 1RZ8B 5L6YL 1G7JB 1OTTD 3F5WB 3LPWA 1P1ZB 4N0YL 1YPZE 1T0MA 3O4LD 4RNRA 2H9GB 5HTSA 2BY1A 5DS8B 2FSEB 4ZFGH 4M03A 3OKMB 1NKOA 4NPYA 5DR5L 1S9VA 3LQZB 3M07A 5CAYB 2HT4C 1JPFB 3ARGC 3LEXB 4PJEE 4F2MA 3WLWC 1RZ7L 4RMWA 4I0PA 2RGSA 3VDAA 5JNYA 3SKJL 1LO4H 3GIVA 1OGAE 4H8WH 2R2EB 3MLZH 3VWKC 5HHPA 4FFVC 3REVA 4ZUVA 1MRDL 5EIIB 2WBKA 3EYVA 4URTB 2QL1A 1MJ8H 2VWEC 3CVHH 3TBWA 4HPOH 1ZWIB 4JFDD 3BO8A 4NPYB 5I19H 5INCA 1NGPH 1HILA 4PJCA 1CDJA 4DEPC 3B2UD 4C55A 3OMZA 1JPTH 2XZAH 2A0LD 2BVQA 5IMLA 1AGEA 4XC1L 2PW1A 4I0PB 5BVPH 1BWMA 5JNYB 1XF5A 4X4YB 4I3RH 4GAYB 4TTDC 2AXFA 4AIOA 1YEKL 4Z76B 4I77H 1KJ2L 2XQBH 3REVB 1UM5L 1FO0A 3IVKA 4RA3A 4M00A 2DQTL 3I3BA 2X1WL 3CFDA 5T5NF 3QXUA 3V4VH 1Q9KA 4JFQA 5SWQA 1MCOH 4UV4L 1IARB 2EYSA 2X4TA 2W65B 3EO1A 3VGAC 5IMLB 2VUYA 3V52L 3EYUL 4Q97A 5LG1A 5E5MA 1J05B 2HN7A 3DBXB 1HWGB 3MNWA 3HNVL 4NJ9H 1NH6A 2RJMA 5SWZE 3RUGB 3S88L 2OTPA 3HLAB 2AXFB 2NR6C 4OT1L 3TC9A 2F58L 3BSZH 4QGTA 4TUKL 4GRMA 2JE8A 3IFPA 3GMLA 4YGVB 1HIML 1R0AH 4ELMB 4M7ZB 1FGNH 3DXAA 4KK8C 1RZGA 1Q1JH 1Q9KB 3IJSB 1T22A 2H6PA 4JFQB 4JN1L 5J89A 2H2PC 3JV6A 3FOMB 2WBJB 5EO0A 3MRFB 1KB9K 1J7VR 3C5ZC 3S5LB 2BSTA 5E5MB 4CJ1A 1WCBB 2HN7B 3MNWB 2P8MB 5K9OA 3N50A 3ARVA 1MCSA 1JGUH 3AY4C 2NXYB 3SKNA 1BOYA 4YHLL 5MEPB 3NBNA 4NNYB 2R23A 2ZNWA 5IW6A 4LSPL 4TRPH 3LRSA 2QQNH 5HHMD 2P49B 1VA9A 3EOBB 2BFVL 1GGCH 5D8JH 1FNEB 4Z8FH 1MOEA 1YN7B 3HI6L 3LD8C 4A2MA 4M7ZC 4V2BA 4RFNC 3UTSB 1X5KA 2YUVA 4P59H 3H9HB 5C0FA 4JAMA 5C0RL 3CMOL 4BZ2L 1JIBA 4LSQH 1MWAA 5IW6B 5L2JA 2WINB 5I1CL 1P2CA 2JJUA 1ETZA 3VW3H 1WWBX 2XZCH 2P4AB 4AQOA 5LQBL 5EBMB 4JLRA 3GNML 1F6FB 2F19H 5JHLH 5JOPE 1OHQA 2NY3C 3TA3D 5J1SC 4RWYL 3GMNA 5DJZB 3BGMA 4NKIH 1KOAA 3GB7B 5JXAH 1Z3GL 1T6WA 2ZUSA 2PF6A 5DJ2A 4X4ZA 2VWEE 3VXUE 4UQ3A 3V7MA 1KTDA 3D25A 5HPOA 1MAML 4JHZA 1BP3B 1MFDL 4D8PA 3PXHA 3HFMH 5D1QD 3L3DA 3MA7A 5FYJH 4P9HC 3HI5H 3KPMB 2W9DH 1YNTB 1JPSH 2ZP0T 2MSPA 3D3VE 2AEQL 5JW3H 2R2HA 2VDKH 1FVDA 1DN0B 1Z5LA 3LOWA 4IDJL 1SJEA 3PP4L 4PJBE 3GMNB 4X0KB 4PJEF 5GGVY 1VB9A 4U6TA 2V2TA 4MNQD 1Q38A 2DBLL 2X2YA 4JM2F 5K9QI 3ULVD 1T1WA 2Y9RT 4JE4B 4OUUB 5DJ2B 3RWDB 1XGPA 2VXVL 3OB0H 4F9LA 4L3EB 4MD4B 3D25B 5DEGB 1YMHB 3P0VL 4X6DA 3WUZA 1E6JL 1I1YA 3ZT5A 4D8PB 2VDRH 1V3MA 4UTBH 1RIVH 4RGNC 2HTLD 1QSFE 1L6XA 1YEEL 4CVWA 3T2OA 3P4OA 1EUUA 5C08E 2X4RB 5FCUH 3ZKQD 4OLYH 3DX6A 3N85L 4BFIA 4CMHB 2GSIA 1T1WB 2P43B 5DHXB 3BGFC 4YO0B 3TZVB 1TJIH 1BFSA 4N0FA 3RWHA 4Y4KD 4YWGL 1F58H 3MLUH 4FTVB 1JPGA 2KZWA 1II4E 1LDPL 2VKXA 1VENA 3NIGF 5I1EL 1OAQH 3IXTB 3X3FL 3UPRA 4HKJA 1KJ3H 3QUZD 1FCGA 3RWJA 2P45B 4LSDA 4LMQI 1JHKH 4PJCE 3U4BH 4NQEE 3OG6B 4BFIB 4FQJL 1C12B 1RULL 4ZODA 5IK3B 3IDGA 3QO1A 1UWGL 4HPYH 3TH3T 1VDGA 3EUUA 3WO4B 1ZTXH 1C5DB 1FLTX 2A1WH 1JPGB 3Q5OA 4J12A 1LEKA 5HY9A 1UZ6E 4CMHC 1WFNA 5FA4B 4BZYA 4JVPA 4WHTB 4BH8B 4WV1A 4OF5A 5GGUB 3UPRB 4UV7L 4F9LC 4YQXH 4KKLC 3K46A 1X7QB 3QEHA 2AI0H 3RKDD 4LSVH 1KCKA 3FMGH 2EIZB 3G6JA 1LO3H 2FLRT 2O5XL 3FQTB 2D3VA 2OQJB 5DD5H 3ZSTA 1UB6A 4OFKA 4X6CB 4HC1A 1BLNB 2HT3D 5DMJB 1X44A 1F4WL 3DO3A 1FL3A 1OVZA 5FUCC 3KPSA 2DYPA 3FN9A 3V7AG 2FX7H 3QYCA 2R0WL 4ERSL 4G7YL 4Z77A 2NY5L 4PRAB 1GPOH 1OPGH 3EIFA 4LCCB 3B2VL 2EE3A 3FQXA 1KCRL 2AEIT 5JW5A 3EBAA 4QXTB 2GJ6E 5GZNC 1UB6B 3NCCB 3MRGB 5FCSH 1A2YA 1JTOA 4UUJA 3VG9B 1GGIH 4EN3D 5CJBA 3QEUA 4PTTA 5EPMA 2WLYA 4AG4H 5E4IA 2ZJSL 4OB5L 1MY7A 3BIBX 2EDFA 5C0GB 3AU1B 3MLWH 2LVEA 1HSAA 3WO3B 4JZJA 1G7MB 4Z77B 1TVDA 2X4SA 2FJFA 3CIQA 4ZG1A 4RGNE 4AMKL 3EYOA 2Y5EA 4R26H 4WV1C 4YXHH 5GS1B 1GIGL 3VFSA 4DAGL 1YYMH 1IAOA 2VR5A 4PTTB 1NCUA 5DA4A 2ZCKL 3HMXL 1I1AB 5EUOE 3T3PE 4NCDA 4Z7QF 5JXEA 4X5WB 4XBEL 5DI8B 2BXZA 3H9SB 5JQ6L 5EORL 4FQPA 4JB9H 4JZJB 1ZS8B 3JUZA 5C6TL 1T89A 1NCDL 2X4SB 3IU4H 2XQYK 5K93A 4ZS7H 3KS0J 1U42A 4F37F 5D1ZB 5C2BH 2Y4SA 2V9QA 5C0AE 1FH5L 4KTYA 3MJ9H 2AV1A 4GBXA 3VFSB 5J12B 5FV2A 2BMKA 1IAOB 1RAMA 3RIFF 5L9DL 5C86A 1HSBA 2BNQB 1ADQL 1HI6B 3G5XA 4L4TD 1W72A 3NCJH 4NQXB 2A6IA 5I2IA 1N6QH 3E3QE 1N0LA 1S7WA 1K3IA 3P0GB 5J8OA 5CSZA 3GMRB 2DLGA 4Z0BL 4DK3A 4I4WA 1NCWH 1FGVH 4AIXA 3BKYH 3MLTA 4GBXB 5F7MC 3E8UH 4JZJC 1RIUL 3DETD 1JZ3A 1KXTB 1KCLA 3BIAX 4GRWH 4P23D 4CN4A 3PWLA 1CXFA 5KS9B 4N0CC 5D7KE 4EXKA 4LLMA 3P0YL 4KKBC 1YMMD 2DM2A 3UDWA 4NGHH 3DHJA 1F4XH 3PV6A 5CEXA 1W72B 2A6IB 3JZ7A 2C9AA 2Q87A 5CWSB 5J12C 2HG5A 4PV8B 1K4DB 1N5YH 4TSBH 1S7WB 4ZUWB 3FB5A 1M7XA 1MFEH 3C5SB 4PJXE 5FHBH 3GUTB 4Q9QH 2DKMA 5CSZB 4NC0B 5JXEC 2Y1VA 5LGKA 1G6RA 1X5ZA 4U1HA 2CXGA 4EBQL 4JKLA 1JV5B 4H1LG 4QHNA 3MLTB 4PJAB 4R6UA 4IJ3B 1T89C 5IFAL 4FP8H 5DT1L 4NO5B 4LRIA 2VL5A 2WLZA 5FA3A 4Z0XA 1JZ4A 5GGVH 4PRPE 4XPTL 4PD4J 1TQCC 3PL6B 1I9JL 5KTEL 5J11C 4GBXC 4LHQB 1CN4A 3RJDA 3ZO0A 5AG9A 3D2UD 2NZ9C 3TCLB 2HH0H 3BZDA 2M8XA 1M7DA 1XGYL 2HKFL 3L3JA 1ERNA 4NSKA 4G7VH 3ZZ1A 4CMMA 3M1BA 4LSUH 4U1HB 1S7SB 1PZUB 3SDYL 4QHNB 1VSCA 5KSAA 5EFIA 5A2JH 1N3NA 2F5BH 3MUY1 2NY6D 3L7EB 2SEBA 4ZUSB 5FKAB 3KS0H 5GGSY 1H8OA 2YPVH 3HNSL 4TSAH 5ESQA 1AKJA 1RMFH 4CGTA 4NSKB 2AQ1A 3V6BR 1F11A 4S11A 2ID5A 1DQDH 5DUML 5KVMC 1WZ1H 5DRNB 43CAA 3LKQA 4HFUL 1E4XH 3F7QA 5CS7A 1N3NB 2VDOL 4ZXBA 4KUZL 4JRYB 4APQB 1B4JL 1B90A 3GIZL 4GXUN 3ZE2E 2X4UA 2E7BA 3HC4L 1GGTA 1JHLL 4P46D 4Y7MA 3ZTJG 5I1DA 5ESQB 1AKJB 3MCLL 3QWOA 1KT2B 4LRIC 3MLRL 4PS4H 5CZXC 4HXAL 4R4ND 1DQJA 5GGRY 3U0WL 3MYJB 2ILLA 3SJVD 3RP1A 43CAB 4JFHD 4P5TA 4LEOA 4HUWB 4RMTA 3Q6GL 3NH7H 3TBTA 5GHWL 1BJ8A 1QFUL 2PXYC 4YDKL 5FYKE 2X4UB 1O7SA 4Z5RA 3EAKA 3SDXA 4IHOB 2XTJB 3HNTL 1NMAL 7FABL 5I1DB 5KSAC 3UZQA 3U0PA 2QQKH 2Y36L 3BISA 2B5IC 4RFEA 1TZGH 4E41A 4GQ9H 1T3FA 4DKFH 2Q7NA 3MQIA 4J6RH 1KG0B 3TNMA 4Y8DC 4S0TD 4DWHA 4PGEA 1IM9D 4OLEA 5JDJA 3DIFB 3TBTB 5BJTB 5IBLD 5T1LB 5AYUH 5GGQH 4NZUH 4ZQKA 1P4LA 4Z5RB 4Z7NF 4ZPTA 3VWJD 4NC2B 4P2QE 2Q76A 3ISWA 4ZXBC 3TJEL 1R6VA 5FUOL 3GRWL 4L5FH 4RFEB 1T03L 1OLLA 3VXPB 1QLEL 1UA6L 3D85A 5DWUH 4C56B 4HGWA 3MC0A 2XTJC 4ZFFA 2DD8L 1HHKA 2GKIA 2VC2H 4XMLL 2CDFB 3NOIA 1JTPA 2CKBL 4U6VH 2ADFH 5B21A 4MCZA 1IGIH 1P4LB 1KCVH 2CO6B 2W9LA 2D7OA 2Y7QA 3QQ4A 2JELL 1UFUA 4P5TC 3MFFA 5ID0A 1SEQL 5AUMA 4FG6D 3CSGA 1OGTA 5E9DA 5F9WC 5GRXG 3SE4A 4KKCD 1I7RB 4E42A 3CK0L 3D85B 4Y88A 5IMOA 2AJUH 4GMTL 4P2YA 1KN4H 2QQLH 1FNSH 5D7JB 4ZFFB 3MODH 4JM4L 1HHKB 3NTCL 5ALBL 3HB3D 3OAYH 2GSGA 3QQ3B 1U91A 4XPHH 4RZCB 1QVOB 4XVJH 4Z7VE 1UXSA 2B2XH 3MZTA 3NGBC 4MCZB 5GGTA 5MP6H 5I17A 3PDOA 5EULV 3VXNB 3GBMH 4U2ZA 5DJAB 3V6OE 1W2KT 2YMXH 3MFFB 3EJZD 5ID0B 4RX4A 1XIWA 5AUMB 3DARA 3MGTB 5E9DB 4NQDA 1J9CT 2DQUH 3B9KA 4E42B 3W11D 5HGBA 3GSNH 1FFPB 5I1KL 1NMBH 3FKUS 1F45A 3BZFB 2DQHH 2R4SH 2H3NB 2E27H 3TBSB 4JGJA 1RZKC 4JPKH 3GMMA 1U91B 3R1GH 4LSSH 3PHSA 1UXSB 5I17B 1F00I 1LEIA 1Q72H 1V3KA 3ARFC 3MRCA 4CVUA 1NGWA 5DEFA 5CEYA 2WIIA 4P3DA 1CDYA 5F6IC 4WWID 1AE6H 1NC4D 4U0RC 4O51B 4YHIA 1ZEAL 4UINL 5EU3A 5T3ZL 1QNZH 1VERA 1A5FH 4NO0B 4DKEL 3HPJB 3GGWA 4TQEL 3C9NA 3SE4C 3LS5H 1CFNA 2VMFA 3O3EB 4TNVF 1J8HA 1KPRA 4MNGE 2F74A 1V3LA 3ECBA 1WUNT 1YYLH 3VD5A 5DEFB 4ESKA 3HG1A 4G80B 3QPXH 4P3CL 2IQAA 5FO9A 4MA7L 4LF3A 1R5VA 3HAEG 1NGYA 2YC1A 2DS4A 2MWCA 4FRWA 2YHGA 4OQTH 4Y8AA 1F4HA 5C0CD 1HH9B 5I15H 4UT7H 1XIWC 1M4KA 4IMLA 1TJHL 4EIZC 5DJ0A 1CFNB 1G7PA 1HZHL 3B9KC 1NEZB 4HJGA 2PR4L 1MF2H 2K7QA 1SY6H 3I9GL 3FL7A 2F74B 3T0VA 3OZ9H 1QRND 3TBYA 2DJUA 4AEHL 3ARPA 4X7TA 5FOBA 4R90L 1R5VB 4JCLA 4XCEB 2BNRA 5EOCL 1MFCH 3MLVH 3VFPA 1A7OH 3WUWG 1MRFL 1MCJA 1EH9A 4OLUL 3HPLB 4CRPA 2V9TA 3ZSSA 2Z91A 5D2NA 4EDWL 4HHAA 4HCRA 3QBTB 1A7NL 4TVSa 2I60L 5TE6H 1G7PB 1ZHKA 3G9AB 3IS0X 3BPOB 1X4ZA 4X7EC 3AMLA 1U8OB 3SDXE 5HVHB 3J8F7 4LEXH 3TBYB 4LCWB 3MYZA 1D3CA 1BD2B 3RGVD 3UTZB 4RMVA 1MCQA 4ZSOA 2ICEA 4E41E 7CGTA 2JF1A 4JR9H 2X42A 3Q3GB 1QFPA 1KJMB 3KPRA 3MV9E 1OTSC 5HYQB 3NIDE 1T7XA 4Q9RL 4ODSH 1MCWW 3FO2A 2FD6L 3IDUA 3QRFM 4MMXC 4YDIL 1T2XA 3EO9H 2AJVH 3UTTE 3NMEA 4HAFA 5HGHA 4RISL 2OI9C 3L1OH 4X7SH 1CQKA 4Y19D 1G0DA 3QZWB 2CGRH 1NSNH 1E4WL 3BPOC 1B9ZA 4JM2A 3I6LE 3OF6A 4PB0H 5HVHC 2V6HA 4HWBL 1FO0H 4GLRH 3MNVA 3SDCB 1HNGA 3FO2B 4R2GC 4B53A 5KSVA 3DI2B 5I8EA 5IB2A 3H9ZA 3SN6N 1TITA 5F3BB 1BZQK 4YC2B 4FQXA 1OTUD 3U7YH 1YPZB 3RVUD 1HHIA 1JF6A 1U8NB 1VFBB 1L0XA 5LGHL 8FABA 1PSKH 5HD8D 1P7HL 3BN9D 5D2NC 3T0XA 1MCEA 2IFFL 2VLKD 4CN1A 1MJUL 4WY7H 32C2A 1FLRH 1KEML 2D9CA 4PJEB 4OD1H 4LDOB 2AJSH 3GSOA 4JM2B 4Y1AD 4K7PL 2EEBA 4RRPA 5SX5H 5C8JA 1U8LB 3O9WD 1G9MC 1KFAH 3MV11 3CSBA 3MNVB 4WTXA 4JY5L 1WICA 5DA0B 4K3JL 4QO1A 5IB2B 5KOMC 3MRMB 3LRGA 3O2VH 1MIEH 4NO3B 5FYKU 1EFXA 4KPHL 4UB0H 2ITCA 3QDMA 4XNYL 3FO0L 3MNZA 4F7EB 1LE5A 5E2WH 5T3XE 4AEEA 5E03A 4NZRL 1CK0L 5C0DA 4OV5A 3V9FA 32C2B 5CUSH 3BQUA 4YC2C 4HMCA 5T5FH 3GSOB 5C0BD 5IF0A 2OK0L 1X5AA 4L4VE 1PKQA 4WU5A 1NAKH 1YJDL 2R69H 1WC7B 5GISH 5F9DC 5ITFA 3LY6A 3QUKB 4JY6A 4OLXL 1S7QA 3CLEH 2R39A 5LJYH 3RY5A 4KVNH 5ADPH 4GLRI 1NPUA 2OJZH 3CFKA 1FFQA 3PABB 5EA0H 4O9HL 2ZUWA 4OV5B 3BQUB 1NGQH 4HUKB 1MCPH 4FQXC 1IEBB 3VWKD 4FXLA 4WUUD 3U9UA 1IGTB 1HE7A 4ZYKA 4MDJA 3MACH 5SWZB 3SKUD 4QHKJ 4EEEA 1MWAH 3LIZH 3RWFA 4N8PA 3LN5A 3HTLX 4KK9C 1ZK9A 4JY6B 2PYEE 1P84K 5ANME 3RL2A 2KQNA 1MELA 3HG1E 4PJ8A 1FZMA 3MRPA 1GRWA 4O2FA 4XWGH 1WWAX 1IGYA 4M4RA 5CJ5A 3U9UB 4ZYKB 2OCFD 4MDJB 4MJIB 4W6WB 4JO3H 2B39A 4GS7B 3NCFB 3QNYA 1H3PH 3RWFB 4AIZA 4XP4L 4MVBD 5C6PB 3ARTA 3UBXG 3BQUC 4L8BB 3X13A 2FWOA 5FUZH 4JREC 1T5WB 4S2SA 3QXTA 5ISZD 5E95B 4OGXL 4RBPK 3EOTH 1KPUA 3FZUD 1ZLVH 3UYRH 5E8EA 1FZMB 3S3SA 4G9FA 4XRCA 4FQQB 4O2FB 2HJFA 1FORL 1IGYB 2XIDA 1BQHB 4OGAD 1W0YT 3KYOB 1KCUL 4E5XB 2NR6D 4FQLH 2PW2B 4CUCA 5HHXH 4Z95H 4JZOA 3LQMA 4JANA 3ROOB 5KVDH 3U9PH 3QNYB 1OP5H 1VFOA 3GI8H 5I1JH 5MHSD 4I0PD 2OBGA 3X13B 3ZHKA 4ZFGL 1AR1C 2FWOB 4KK8D 4OZHE 1LK2A 1NQBA 4S2SB 4PP2A 2H2PD 1KTKE 5FM8A 4U1GB 3VD3A 3FB8B 1OAUH 1KPUB 3VFRB 1MREH 1QLRB 1VGEH 4G9FB 4QF1A 4XRCB 4XZUA 5GSVB 4ZSOE 1A1OA 2E5EA 2HJFB 4WFEE 1JPST 1ZA3B 2GYSA 5M95B 1J11A 2DJSA 3MLZL 4H8WL 1FNLA 3VXUB 4UIMA 2DTSA 1I8IA 2YPLE 4HDIA 3CDCA 4XNZC 4PJ8C 5DRWB 3G5VA 2CO7B 4P0DA 4WW1B 3TWCH 4G8IB 1MJ8L 4HPOL 2FO4B 5I19L 3SDAA 4PJ9B 4DJMA 1NGPL 2BK8A 2DLTA 4X8JB 3JV4B 1OAZH 2WK2A 5DFVC 1JPTL 4PJGF 1Y18A 2XZAL 3U1SL 3BD4A 5TDNA 4QF1B 4XZUB 2ADIA 5I66B 2FIKA 1JI2A 1A1OB 3KPNA 3OJDB 5BVPL 1C8PA 4YE4H 5F93C 5BZDA 3WXVH 4JKWA 1EERB 2WBJD 2R1WB 4PLNC 2XA8H 3D39E 4U1GC 4I77L 2XQBL 3ZYOA 2FNBA 4LLUA 5F7FA 4Z7OF 5GGSB 4KJQD 3AROA 4HS8H 1ZLWK 4M4PA 4F3FA 3KNBA 1QSFB 4PRBA 2PKDA 5J1AA 2D7TL 3AREB 2NY3D 2E9JA 2YN3A 4YEEA 3X12A 3VXOA 4TNWF 1XR9B 2J12B 3GHEH 5TDNB 3BRGC 2FIKB 1UH4A 3DXAD 2NYYC 3VFTA 1Q94B 4NJ9L 1FYHB 3FB7A 1H3UA 3THMH 3WL9A 2FLBT 4F37K 3VXMA 3BSZL 1UG9A 2Q3ZA 3IGAA 4DN3H 4K7PX 4WFFD 3IF1B 1FGNL 3H0TB 4F3FB 1CICA 5DMGC 3W0WE 4D9RD 5F1IA 3GMOA 2NY7H 3X12B 4NQEB 3RJQB 1YC8A 3BDYH 3VFTB 1DZBA 4IRSB 2YN5A 5DC0A 2EICA 1TNNA 5E8PB 3SDAC 3UP1A 1JGUL 1I9IH 3FB7B 4NFDA 5C71A 3S4SA 4M02A 5E8DH 3O3AA 5D5MF 5HVGB 2BHYA 1X6NA 2VDPH 5FYKH 1AD9A 2GTWA 4M5YL 4XNQA 3ZDYE 4TRPL 2QQNL 4OD2A 3MPCA 1QP1A 3OXSB 3ZYZA 4G8EA 3ALPA 2CLZB 3DRTA 1GGCL 3SHSA 2E9IA 4Z8FL 1BZ9A 4LLVA 2ICES 5IW1B 1F2QA 3IDYC 2D9QB 3SO5A 5CGMA 2OTUB 5IT2H 2IPUK 2J5LB 1AGFA 4MWFA 1L7TH 1U8KB 2RIKA 3O3AB 1DJSA 4HQQL 3CNKA 3IDIA 3QUMB 4LSQL 5I71C 3DX7A 4MAUH 3FQNA 1AD9B 2GTWB 2ZUTA 4I5BA 4XNQB 3VW3L 1HN1A 3OKNA 2XZCL 4OD2B 4PJFF 1WBYB 3DRTB 5JHLL 4J4PA 4X99B 4H25A 1VFAB 3EDFA 3MJ7A 4Z78A 5JXAL 4GJTB 4UZGA 4LLVB 2NTFA 3W39A 1WJ3A 1KCSH 1KLFA 3PIQB 1G0YR 3W9EA 2V17H 4OFYA 1CICC 5DYOA 4DN4H 3BH9B 1BM3L 2GJ6B 1CDHA 1AGFB 4KTEL 4MWFB 3C60B 3ZT7A 3VXQA 2VR4A 3IAGC 3HFML 4PJ5E 12E8H 2I9LB 2KBGA 3DX7B 3NFNB 3FQNB 4NN6C 3TZVD 4I5BB 4M43H 3HI5L 5BVJB 4ZPVA 3RWGB 4ZAKC 2W9DL 5SX5K 1JPSL 1KV3A 1BVKA 2VDKL 5JW3L 5AZEL 2J5LC 3JWOH 4D94A 1MI5E 1QBLH 2NY1B 5LWYL 2R8SH 4Z78B 1DBJH 4PR5A 2PTTA 2NTFB 4QWWD 2HJKB 3W39B 2CIIA 3B4NA 3NZ8A 3U48A 3WFCL 2EDKA 2R2CA 4UDTA 3TF7C 3W9EB 4ZOBA 2XACC 1KIUA 5DYOB 1U95A 1IKNC 5CGTA 5LCVH 3VXQB 2VDRL 3P9WB 4E9LA 1ZGLA 3B5TA 3B8YA 1N64L 1VGKA 5H2BB 3FFCB 2FBJH 5EUOB 4G6JH 1ACYH 3IB4A 4GXUM 1BVKB 5FCUL 3ZKXB 4OLYL 5DMKB 3Q1SH 2I9TA 4OZGF 4DCQB 5HJ3A 1TTUA 4I3GA 4K9EC 3WFZA 1JHTA 3HI1B 2XA3A 1E4JA 1G6RH 1U8PB 3I85A 5GZND 5T1MB 2WBWB 1TJIL 2BY0A 2DMKA 5CEZH 5BW7C 2V5MA 4XMPH 3MLUL 3MBXH 4U1KB 3GI9H 4C57C 4IOIA 4OZFG 1DFBH 1OAQL 1T6VN 2A9MH 2YA0A 4NQTA 1KJ3L 3PDGA 1G7IB 4EI5B 4JDVA 4NN7C 1UC6A 1IAMA 1JHKL 4F58H 2I9TB 3U4BL 5HJ3B 4A6YA 3BZ4A 5FAAA 2YUXA 5F88A 3QO0A 1BBDH 3K8MA 2E8ZA 2QEJA 5FGBA 5B8CC 3QI9A 4QTIH 4HPYL 4KQ3L 1DBKH 5ITBH 1ZTXL 5I30H 4N68A 2AEWA 3ZKXC 5CIPA 1DUYA 3T09A 2A1WL 1ZHNA 1CD8A 1RZJH 4G43A 1U36A 1QQDB 5HHQA 4PJDE 2AQ3A 2ICWJ 3U6RA 2V2WA 4HJJL 4YQXL 3D9AH 4K71C 5EO1B 4ZMAT 2AI0L 4LSVL 3KPSD 3JBG7 5F88B 2DYPD 3NA9H 1UYWH 3FMGL 2NW3A 4BQCA 1LO3L 3QI9B 5IWLA 1CTNA 4Z9KB 5CMAB 1CGUA 1ZHBB 5ESAA 4OGYH 2CR6A 2V5YA 4OZIF 1FL5B 1ZLVK 2BVYA 1ZHNB 1L0YA 2KQMA 2KH2B 3DURA 3K1KC 4R4FH 3N06B 3V95A 1FZKA 2FX7L 5DJ8A 1FIGL 1IEAA 1G0XA 4MSWA 1E28B 1UWXH 5I1GH 1FRGH 1I1AD 1GPOL 3RI5F 1OPGL 3DV6A 4LASH 3KJ6H 2QQQA 2NW3B 4ELKA 3OR7B 5FO7A 5LBSH 3K8LA 1A6PA 1OF2A 1CZ8H 5ESAB 2YD9A 1J0JA 5F21B 4YHZH 1S9WA 3QFJE 1GGIL 1FCCA 3ZYJA 4N0CD 1Z9LA 3DURB 3TYGH 4AJ0A 4OLWH 5FGBC 3MV8A 1GZPB 4PRNB 3C08H 2IMNA 5DJ8B 1MJJA 1RUML 3WCYA 3L6FB 1IC4H 2VXTH 2Y5TA 3P73A 2W92A 3CFJB 4KROB 4AT6A 4NQSB 5JXED 3HUJA 4TYUA 4R26L 5IB4A 5CHNA 5JW4R 2OJEA 1A6TB 4POYA 1MCRA 3BEWA 4OI7A 1YYML 5F8RC 4P5KA 1YY8A 4TVPE 3O6FA 4ETQA 3CDGA 3MV8B 1NAMH 4GBXD 5IWLC 2PO6A 4NUGH 3PWPA 5AD0A 2GCYA 2BC4A 3C8HA 1GGBL 1FN4A 4JB9L 1INQB 3VD7A 2NZ9D 5IVXE 3IU4L 3RVWC 1RZKH 4ZS7L 4UMGA 1S9XB 1QYGH 3WIIH 1S5IH 2CDGA 2GTZB 1UZ8A 3C8KA 4CBPA 3VGHA 3T65A 1SYVA 2EDNA 3MJ9L 4Y4FB 3RWIB 3FN3A 2WP3T 3BZEA 4OLZH 4HKZA 5KG9A 5T33H 2ARJB 4MXVF 2HJLB 4Y5VB 4HIEB 4P5KB 1YY8B 2EIDA 2H1PL 2RR3A 4LQ1A 3O6FB 4YNYA 3QXAA 1EAPB 3MLPA 4N8VG 3C6LA 2CDGB 1X5YA 4TNVK 3PL6D 1NCWL 1FGVL 4H0IA 3B3IA 3ZDXE 5CP3H 3FT2A 1QR1B 3T65B 3BKYL 1SYVB 2XQYG 3OJVC 3E8UL 4NNPH 2B20A 1HYSC 3DI3B 3T4AA 4KZEH 5IMMB 5BO1L 4Q2ZA 2VZ3A 4NGHL 4G9DA 1F4XL 1SJHA 2R0KH 4ZUUA 2L7JA 1FDLH 5E8OB 1N5YL 4TSBL 2ITDA 5T3XH 1GOFA 1UEYA 2HLAB 1MFEL 2DIAA 5C9JA 3K80A 5CZXD 4Q9QL 2DKSA 1MFBL 3O6FC 3F7YB 2P8PA 2PO6C 2GQHA 5IB1A 3DX9A 2OMBA 2WW8A 1QSVA 1A4KB 5E1AB 1CGVA 3OSKA 4FP8L 5ENWA 1AP2A 3Q2CA 4Y5XB 5GGVL 3RPIA 5D1XA 2F54A 2DQCH 4UAOB 2BSSB 5JTWA 1SJHB 2D2OA 3O6MH 2FZ3A 2RCSH 3EO0A 4ZUUB 2HH0L 4JRYD 4APQD 4NRXA 4XTRD 1PY9A 4MHHG 1TETH 5HYJE 4G7VL 2P8PB 5KSBA 4EDXA 3RX5A 2GY7B 4K3DL 3DX9B 4CADA 1AKJD 1DN2A 3C6LC 3LPFA 1GYAA 1FG9C 3EFFB 3U4EA 3MROB 3O45A 2F5BL 5HYSB 1UVQB 1YN6A 5D1XB 2F54B 4LOUD 1F13A 2FX8H 3WIHA 2AJYH 3WKMH 4Z7VB 2FZ3B 2YPVL 4FNLH 1Z9OA 3IKCA 3MREA 4TSAL 1RMFL 4JG1H 4FS0A 2W07A 2FH8A 3U2SB 4ONHA 4UAOC 5A16A 3GZKA 4EDXB 2X40A 1QHOA 2UWEE 1C1EL 2XTJD 1R3LB 3UMTA 4CADB 3T0BA 1WBXA 1PJ9A 3T77A 4ZS6D 5BCAA 1SM3H 2EDDA 4NKMB 1I1CA 4FZ8L 1JYWA 3GSWB 1JZ6A 3PQYB 1OY3B 1ORSB 43C9B 3IJYA 2R2BA 1ZGLP 4P5TD 1NJ9B 4GW1A 5GIRA 1K3ZA 3WSQL 1PVHA 4PS4L 2O61A 4J23A 1NFDE 2XXMB 2DLEA 4AK1A 5L2KE 2B1HL 1Q0XH 2GK0B 4XAKD 4HUUA 4RAHA 3BW9A 2RB8A 3SO3B 1WBXB 4WW2B 1DEEA 3L3KA 4HCRH 4FQ1H 1HINH 1SVZA 5CLTA 3NH7L 4ETYA 4MA8H 1H5BA 1ZT4A 4C56D 4BM7A 3VXRA 4JEGB 4PY8I 5IEHB 1G9MH 3IJYB 2R2BB 1FHGA 2P8LB 5FKPB 1B4RA 2D7NA 2QQKL 2X09A 3BAEH 5GIRB 3C8DA 1CE1H 1LNUA 1TZGL 3HUJE 5GRUH 4GQ9L 4LCYB 4DKFL 1RJLA 4J6RL 3L3KB 4LQFH 5C0ND 4NCC1 4K8RC 2Z31B 3D85D 5HYFA 1ZT4B 1EVUA 5AYUL 4ZFZA 4YPGA 5GGQL 4NZUL 2XICA 3NCYP 4OCXH 5D7JD 1J5OH 3DSNA 3F7RA 5BV7C 5E1HB 4GG6F 1NUDA 3NIFE 2J8UA 4EVNA 1NC2A 1H9VA 3P3YA 4L5FL 2FJHA 4HBQA 5D2LF 4XXCA 1QSZA 5DWUL 3AAZB 4ISVA 3WNOA 1OARH 2E6QA 2VDLH 2W0FB 1PG7L 5F9JA 3NCYS 5E9DD 4IS6A 3IDJA 3Q0HA 1Q0YH 5E70A 1CT8B 4YHNB 4I9WE 1KPVA 1TJGH 4PGBA 3QWQB 3H9YA 4XH2B 2NQCA 4YPGB 1IGIL 3C2AH 3HE6A 1KCVL 4U1LB 5IB5B 5D6CA 2WIMA 1CFTA 4I2XA 2BVPA 2IANE 2FJHB 1H5BC 4NKOA 2BJMH 5J0BA 1V7ML 1JP5A 4WDIA 1MVUA 2AJUL 3O4OB 1KN4L 2QQLL 1FNSL 3MODL 4PGCB 4RX4D 3O4LA 1XIWD 3SDDB 5JOEA 4U1NB 3MV9B 4IS6B 4OLVH 3IDJB 4NQDD 2DQIH 1JZ2A 4LNRA 3B9KD 1UH2A 3OXRA 3BXNA 4XVJL 3U0TA 1WT5A 3I6GA 2B2XL 5MP6L 4YHMH 4PGDB 3HE6B 1RUPH 3GBML 2HMID 4NO0D 5C1MB 4DGYH 1NAMB 2Z4QB 1MCHA 1CFTB 1FFNB 4NKOB 4Z7UA 2DQUL 4PJGA 5JW4N 2F5AH 5M94B 4QNPF 1MVUB 5F7WC 4Q6IA 3Q6FB 4WI6A 3GHBL 1NMBL 2A77H 3CMGA 2R4SL 3SKOA 4YBHA 2E27L 3MJ6A 4JPKL 4LNRB 4QRRA 3R1GL 1ZHLA 1ZVYA 2BSRA 4M7JH 2A83A 3I6GB 1DLFH 4LSSL 4NRZA 1I9RH 4PJ7A 2J6EL 5SWSE 3DUUB 1Q72L 2EH8H 5DD0H 1L7IH 2Y25A 4XPGH 4K2UL 4HK0A 1BOGA 5F9OH 1AE6L 4PJGB 2LE9A 5KSBE 2AV7B 1NBZA 2P5WE 1OTSD 1XZ0B 4XP1H 5C09E 4KRPC 1BVLB 5IKCB 2YBRA 1A5FL 1XCTA 4KV5E 4D0DA 3VCLA 2VLJA 4AENA 2HFTA 5D96B 5JPMB 3LS5L 3O2DH 2N7BA 2FJGA 1GHFH 1YYLL 3HCVA 1JN6A 3FRUA 3QPXL 2NX5B 2JJTA 3PGCB 1XFPA 3VU2A 4HEME 1WT5C 4HSQA 1FNGA 1QR4A 3IFLH 1M71A 4OQTL 5I15L 1BD2D 5HI3D 4UT7L 1XCTB 2UV3A 3OKDB 2VLJB 4L4VB 2BNRD 1ZT7A 2XY2A 2ARJQ 2CKNA 5D5MA 2BHUA 1MF2L 2OR8A 1SY6L 4JHAH 4Q6IC 1T4KB 3OZ9L 1FZOA 3N1MC 2AS5M 1BFTA 3HCVB 1UM4H 4PTUA 2F9BT 4YX2H 2CD0A 4Z7WE 3IFOA 1GJIA 1F6LL 3B2UC 1MFCL 3CC5A 3WIFB 3MLVL 1FVCA 1A7OL 1OWWA 4KI5E 2A0LC 2ERJC 4QHLA 2VLMD 4YXLH 3F7VA 1U58B 2F53B 3ULUE 1FFOA 5TE6L 1MNUL 3KPRD 2XWJA 2UUDH 3ZKSD