3WGUB

Crystal structure of a na+-bound na+,k+-atpase preceding the e1p state without oligomycin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
303
structure length
303
Chain Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
rcsb
molecule tags Hydrolase/transport protein
total genus 60
structure length 303
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3wguB00
5AVZB 5AW2B 5AVQB 4XE5B 4HYTB 5AW9B 3WGUB 5AVUB 5AW5B 5AW6B 2ZXEB 5AVVB 5AVSB 5AVTB 5AW0B 5AW3B 5AW7B 4RETB 5AW4B 3WGVB 5AVWB 5AVYB 5AW8B 5AW1B 5AVRB 4RESB 3KDPB 3A3YB 5AVXB
chains in the Genus database with same CATH superfamily
4KDTC 1WK0A 5IM7A 4GSDL 3D18A 3UBXG 3MROA 2EC9U 2PP8A 3NIFF 1E8XA 3H9HA 5E08L 2VLJB 2PW1B 4NUMA 3SE8L 4B9YA 3KPSD 4JN1L 4LPXA 4TSCH 1KELL 3GBNH 4F2MA 3I02A 3ECQA 1XF4A 4PHZA 4TSBL 3U4BH 4YHYC 1SQ2N 5DJZA 4LLUA 1WD9A 1OP9A 2BNQE 4XNZB 1DL7L 1YUHA 2ZSWB 4PB0H 2J3SA 3NSYA 1MCEA 4U1GB 1D9KA 3TT1L 3CSFA 3HBZA 2E7HA 3N91A 1G9HA 3CZEA 4PVNA 1MREH 2HRGA 3E9UA 4F9LA 1KMGA 1Z9LA 1XAUA 1AO7B 4EDXB 3DBXB 4XBEH 5F70A 1FIGL 3STLA 1J1XH 2HUHA 1T20B 3M1BB 3D0LB 4YHNB 2BHFA 1KC5H 3LRMA 1SJVA 2J1KA 1FN4B 5LG1A 1YEIH 5HYQB 4IBYA 4OLEA 4PSRA 4O00A 5AL8A 5D1QA 2BSDA 4ZO8A 3O2VH 1FVEB 1NLBH 4LLDB 5DK2B 2WAQA 4ZW8A 2A5UA 1PLBA 2XX0A 3LNHA 4OZGB 3T8XB 2B14A 1E4WH 3C5JB 3VFNB 4MYWB 2NRDA 4YVNA 3MQIA 4ORGA 1PBYA 4HBCL 4PREB 5T5NG 2XV6B 2J1WA 3DSFH 3QVAA 4XP9L 3DX3A 2J12B 4NM8H 4FXKB 4YR6B 4MMXB 3A67H 4HETA 5JORB 4LCWA 4RIRB 1KBBA 1LO5A 4JFEE 3K0WA 1U3HA 4KTYA 4EOWL 1HAWA 4X6CA 1KXQE 3TJEH 1YNTB 4WI4A 3ZY7A 4GMTH 3E2HC 4JAMB 4MA3B 1E5UI 1MY7A 4HCRL 4PN6A 3FO1B 3QRFM 2IOMA 4WFED 1S7XA 3H3PH 3ZLQC 2A1WL 2Z31A 4UTAH 3ETSA 4DF9A 2GI7A 3RJQB 2OQJA 4MMZB 1EA9C 3Q2LA 4H1LG 3MRGB 1EWHA 3LH2H 3DLQR 5GGTL 2BM3A 3WJLC 1JNNL 1CB4A 1KBPA 2BNRB 3IXTA 2P8MB 4IK7A 5JPNA 2JJUA 4IOFC 4LLYB 3REVB 1TEGA 3GDBA 2XBTA 2ZD0A 4JRXD 4K3EH 1NFDB 2N3JA 3HG1D 5EO1A 5K39B 3ZTDC 3D34A 1M7IA 3D4GA 3QQ4B 4HJTA 3DO4A 5C6PB 1X5XA 3PAVA 1JUFA 1RSYA 4UTAA 4YZFF 2XZAH 2GEQA 5KJ7E 1CF8L 1T1WB 3O4LB 2I5YH 3WN5C 5DURD 4ZSOE 3LNFA 5IIEA 1EANA 4FOMA 5I0WA 1OW0C 2BY2A 2EVJA 2ZOWA 2ENYA 2OULB 4PJ8A 4YHZL 1GGBH 3KPLB 5F0MB 1OM3L 5HI3C 3L6FB 1IGYB 3IJHA 5TDPA 2E27H 2DL2A 4MDIA 2J2ZA 1UWGH 4PRNA 1K9TA 4Y2OA 3KPOA 1RJZA 4IOFD 4HIEB 4IBWA 5FA4A 1KLGA 3UYRH 2CIIB 5KVGH 2OI9C 4LLQA 2J25A 3W37A 4MASA 1ASPA 3EJCA 1UB6A 1W0VA 1NANH 2DS4A 2P5WA 2PR9A 4IBLT 3REWB 1K5WA 1HXMB 4H8UA 2YRBA 2X4RA 4I3RL 5KVDL 5K9QI 3QUZC 2Y06H 3DX7A 2VL5B 1HDMB 2B20A 4L4VA 2QQNL 5A6LA 4EN3C 5HI3D 4WWKC 3FUFA 1NCHA 1XF1A 4AEEA 3HZVB 4Q0XH 3EYOB 1L0PA 5DTFB 3IPBA 5PAZA 2A6IB 5IHBA 4O51A 5IG7A 4XXCA 1O5PA 4RGOL 4GXFA 1IC7L 4E9VA 1VFBA 1AXTL 2OL3L 3EBIA 4K9EC 1XGUA 5EIVA 4A2EA 2W07B 5AB0A 3O3EA 3Q8BA 5A16A 3FUHA 5BRZB 5A3IC 3DPBB 1DJYA 3BGMA 5EEWA 3PYCA 3QUZD 3IU3A 2K7PA 4ZUSA 3ZT6A 1T7WA 2Y36L 4ZMOA 4Y2DC 4JR9H 3PAUA 2AJ3B 4EN3D 3T08A 4WWKD 4PFEA 4CGTA 2G5BA 1WAAA 4MBOA 2FLBT 3RB5A 4UQ3B 1CFQB 3MTXA 2W80C 2DMGA 4U6YA 3T3ME 2J8UA 3V9EA 2IWEA 3PDOA 4NQSB 3FF7A 4FKHA 2AERT 3TBTA 1YZZA 1JL8A 2QVIA 5CZKA 5L9DL 1LNUB 3I85A 4NZTH 2AEIT 3QDMD 5A3ID 3F00A 1MSPA 4Z7OF 1YLBB 3AUVA 4RA3A 4W9GC 4AEFA 3LHAA 4DNLA 4Y2DD 5MHSD 4WHTB 1IMHC 4PS4L 4JVWA 4WKZB 5JIMA 4LARL 3QUYA 2EKSA 4IIQA 3QUMH 3U30C 4XCNB 2W95A 1KBKA 4PU2A 3D85B 3Q8AA 4X7TB 1MHEB 3D0AA 4MZRA 5TE6H 3INUH 4XI5C 4GW4B 3TA3B 2F15A 4BSWB 1NAKL 2NUPB 1IGML 1A9EA 3MCYA 4GH7B 4R5VA 1AKJA 2PW2A 1ZT7B 3AGWA 1FHGA 2OMXB 2DLFL 1K8DA 4PRDA 1BZEA 4NQEB 4UAOC 3H85A 3Q9PA 4XOBA 3M17B 4HQQH 4HWEH 4BIKA 1RHHB 3EUUA 3KM1A 1AD9B 1MCRA 1J0ZA 5AW9B 4FNLL 3H6AA 4N8CL 4PVMA 1OZUA 2M2DA 5AG8A 2V2TB 4F33A 4MCNA 5F7LB 4G8GB 3I9AA 1DO5A 3SPHA 1M6OA 3LN5A 4I85A 1DEEB 3EZJB 1UM5L 4QY8B 4XI5D 3E6HB 2CM5A 1FNGB 2NOYA 2EXWC 3WTXA 1RY7B 4KQ4L 1UVQA 5D1XB 4Z7WB 4XMZA 3HI5H 1VEMA 1W72L 3ATEA 4PGBA 5GGQL 2X4NB 5GJTH 1XGQB 5LAXA 1U8HB 5GSVA 4AQ1C 5D7JA 5D93C 4S1DC 5CMAA 4FF9A 5C08B 1HL5A 4Z7QB 2DY2A 2V2XB 2GYSA 2V7NB 5BO1L 1YAZA 4WWNA 4EDWH 3TEZA 2NNXA 3E8UH 4Y89A 1IC4L 4PMFA 1WQVT 5AWNH 5BS0A 5C0EB 4Y19B 1FSKC 4RISH 1I75A 4C83A 1EMTL 1OK8A 3SQRA 3P30H 3WSQH 3PHQA 2CKBL 2XZCL 1TYJA 3VRLF 4CSSA 2EXWD 3GHEH 1EGJH 2KQNA 2OLDA 1DBAH 2GK0B 3WL9A 4MCMA 1YEGL 2P1YA 2N0KA 3EYFB 4JPIA 1LWRA 3HTLX 8CGTA 5IOPA 1NLDH 1OOAA 1TCRA 2GJ6E 3D4YA 4S1DD 4NQCA 4YHIB 1JRHL 3HEIB 1E8WA 2FEEL 3LVEA 3VFVB 2NR6C 3FULA 1KCSH 4N2AA 4IEFB 3HIZA 4APQD 4QXUL 2YHGA 3FFCA 3PJLA 5DVLA 2MNJB 3OZ9H 6PAZA 4NUJA 4DPAX 3ASNB 1R24B 3FH5A 4HSCX 5EBLB 2EZ0C 3GJEB 4P2OC 4HIHA 3T0EA 2VDPL 4JFFA 2YAFA 4TKWA 5DD5L 1EGJA 1CFTA 4RVBA 5DEJA 3RTQB 4JFOA 2J6EL 5ESQA 4FA6A 2DLTA 5KVDE 1VKXA 5FGCE 5LB1A 4GG6F 3U6XS 1DBKL 4MJ6A 5EU5A 3P4MA 4E41E 2A77H 4EAEA 5D71H 1CUOA 1UD3A 1KEGL 3NCFB 1JK9A 1T66D 2NR6D 4NUQA 3TH2T 1BLIA 2WP3O 3V0JA 1BDYA 3MO1A 1NEZG 4XHJC 3F6IA 4I0PB 3FO9A 4NZUH 4C57C 4PRBB 2DLEA 3WE1A 2MKWA 2Z4TA 3B34A 3QZWG 5DLLA 4NQVB 4GO9A 2EZ0D 4JY5H 1NC4A 1ROCA 4P2OD 2F19H 1BZOA 4L5FH 1S8DA 1BQKA 2XFXA 3S37H 1T1ZB 2NNRA 2CIKB 5DQDL 1SHXA 1Q38A 4FLHA 3QORB 3CC1A 3QUKA 1U8MA 2I85A 3F7YA 3GTTA 5MEPA 2ZKMX 3IGKA 4C56A 3QH3A 3ME0B 5T5FH 4ZW6A 1CLVA 4EVNB 4J2XA 4LDOB 3D2UD 2YKLL 4JMNA 1T0NA 3T65A 4R9HA 1JAEA 2QZ5A 3BCFA 5JDSB 3OKDB 3SY6A 3X3GL 1U8QB 2GSIB 5T8IA 4AGQA 4XHJD 2CBPA 4A55A 1Y07A 3UCQA 2EDXA 1QEXA 2R0LL 4AQEB 4N8PA 1KPRB 1R3LB 4LEEA 2XQYA 2OXGB 1NMAH 4JVPA 3FTVA 4EUPG 2B0SL 1X7TA 3N1MC 2VISA 1U8OB 3TN0A 5T5FA 1YA5A 3GSNA 4BDVB 2EEFA 1YECH 4PJEF 1IKFH 2NY1D 1AI1H 3GMPB 4XGZA 3UBFA 4LPTA 3MUY1 4HFUH 1K5NA 1MCPL 1MJ8L 2CDGA 3UAJA 4PJXA 1YYCA 3FW6A 4R90H 5LXGL 1ZEAH 3MGOB 5JYMA 3WIAA 2UZYA 3RX9A 1Z9PA 4FL4C 5AW1B 4AYBA 2O5ZL 3BKML 1NBZA 2AEPL 4PYGA 5EN2B 3TCLB 3MV7E 4JREC 4JQVA 1OPOA 2H45A 3UCRA 3ZDZB 1JN6A 2FH6A 3APFA 3FT2A 2WK2A 3IBEA 3X1FA 4B9FA 3VX0A 3VG0L 5DS2A 4YNYA 4V33A 5JNYB 4QXTB 1Z6JT 3ESMA 1KIQB 2NUTB 2A4EA 5E6IA 4ZNEE 5KSAC 3BZ4A 2NW2B 1GA2A 3SGEH 1CGTA 3B7YA 3KYMA 2X2UA 3ZO9A 5EEVA 3VXRB 3L3HB 2ATKA 1OCRB 1XR9A 2CDEB 3HS8A 3ILEA 4YHLH 3K2UH 5FGRA 3KDPB 3RKDC 1WG3A 4LCUB 1X4XA 4LVOB 2OCFD 2ZUVA 1NCIA 3OR6B 1DN0A 1AR1C 3C5XA 4KH2A 4OD3H 1IBBA 1BCIA 3FU6A 4PJ7E 2QQQA 3F01A 1UD6A 1LMIA 1TETH 4JS7A 1PEWA 4JO3H 4PRPA 4BUGA 5DHVH 4QWWC 2OYPA 5DS1A 3PLYA 3II3A 2R56L 4ZFQA 3UG4A 4U2ZA 3DNKA 4J3SA 1UA3A 5KSAD 3LS4H 5E2TH 5AKSA 5BW7C 2BOLA 1F45A 3C8KB 5CIPH 3U1QA 3WN6A 4YHYB 5BVPH 2QQKL 5DWPA 1H0DA 1ZHLB 3N5AA 4U0RC 5D7EA 2ADJA 2VIRB 1OM9A 3B9KA 3B6SB 3G6JE 5GRJL 2RCSL 4OZHB 3RKDD 2JSFA 4RMBA 3ECBB 5FGBC 1UT9A 4WQOA 1OAKL 1IM9B 4JDEA 4P9HH 3UPRB 4MS8C 1GHFL 4QHNB 1UA7A 2CUMA 1AP2B 2OMVB 3IJSB 5CHNB 5CJXC 3WKMH 3MLVH 4U1NB 3QFDB 4X80L 1PQZA 2WUBL 3QEQE 3KWVA 5G4OA 4QWWD 4DHLA 1I8KA 5BRPA 2YJQA 4Q7DA 4G43A 2X1QA 1L0XA 3CFKA 4UM9A 2H2SC 4LL9A 4K7PL 1B4RA 3C6LA 1I8UA 4QTHB 1HEZB 5DGQA 5CIPA 3U7AA 1CU4L 2OYMA 5EZJA 4QAWA 3WFHB 3THMH 5I76B 1G0DA 2V17H 3V0VA 4KUCD 3WFEH 5ESVB 3WV0A 2EDBA 5KVEH 1INDL 1YEHH 1A6VL 1IJ9A 2VR3A 3BT2L 4P99A 3RU8H 3H0TA 3KJ6H 3SKNA 1QRND 5I5MA 3BEVA 4LLMA 4MS8D 3QFJD 2DTML 3BAYA 3B2VH 5JW4R 4HAFA 5C0AB 5CP3H 2R1WB 4U1LB 4UMSA 1FZJB 4PRHA 3TZVA 4JPQA 4KNTA 5DJDB 2X6VA 1TKWB 5HYJA 5KS9B 5DYOB 4KX7A 4NQDD 1BYOA 4QO1A 5DK0A 3PY9A 2H2SD 5BQ7B 1IT9L 4DTGH 5CWSB 3GMOB 2COVD 4W4OC 1ZS8A 4GAYB 5I1DA 4GIAA 3RL2B 2VLJE 1MVYA 2KLRA 3QUXA 3BAEL 3E3QE 4WSJA 4DETA 4HIIA 3X3FL 2BK8A 1D5IH 2VLKA 4Q4IA 3V95A 2R2CA 2OW7A 2ORBL 2KUTA 3HG1B 3KWWA 2AV7A 5ID1B 3LZFH 5CP3A 3E2HB 1XF2A 3IFPA 2RAMA 2F18A 1A64A 4BYHA 3NH7L 3F5WA 2I07B 1K8IA 1TTFA 2XPYA 3D9AH 4HFWA 2JJVA 2W9DL 1S7UA 4LOFA 5D4JA 5DURB 4FCAA 5T3XD 1AO7E 3ULSB 5L2KB 4JFHD 2HH0L 1QFWL 1TQBB 4M1GL 4BH8B 5FCUH 1BECA 2OR8A 4K71C 5GGSB 2DQGL 2QMKA 4UQ9A 5AKTA 5EH1A 3E7JA 1EEYB 1BGXH 1YN7A 2JNZA 2WOBA 4Y7MA 1MNUH 2R1YB 2QLVB 1P4IH 4AM0B 2DI7A 1AGCB 1SXBA 2XKSA 4AM0Q 4PLKC 3Q05A 5B38A 2OSXA 2ZT9C 1CXLA 3GEWB 3MV9A 2I9LB 1ED3B 4HH9A 3GIVB 1RZGA 1INEL 5DEZA 3V6ZA 3CLEH 1T22B 4OZGE 4YWGL 3WN5B 1OAUH 2O4EA 1MG3C 4AGNA 3O6FC 4TVPD 4BXSV 3U7WH 4WFGD 3QFGA 4PEEA 1BIHA 5A2CA 4TSAH 3HZYA 3PNWA 2XC8A 4TXVB 4O4YL 5EIIG 3BVNA 5CS7A 3EO9H 2QGBA 1TFPA 4JRLA 1FFNB 2Q3AA 4QCIA 3QIUC 4PLKD 1GS8A 3VD4A 2YPLE 1J9RA 1VFAA 3LIUA 4F2EA 3NFSL 2OMBA 4XCYB 5C8JB 2XKNB 1IEBB 2E7MA 2P8LB 4GG6A 3X1BA 1BA9A 4KDVA 3DX6A 2CRIA 3K3QA 3T2NL 2Z7WA 4M4RA 5ICXB 2A9NL 1IM3D 4GRMA 4YFEA 4AZ8B 4HZLA 3O6FD 1JV5A 2A74A 1PU0A 3WAJA 3HNSH 4ALAL 1TLKA 3KBPA 1R34A 4PW3A 2WWOA 5E2VH 1Y18A 2QSQA 1BOGA 2UZPA 1F90H 4GW1A 3UGXA 5DRXB 5MEND 4X6EA 1JZ5A 3QIUD 5GIRA 1ZPUA 3GSQB 1Z5LB 2NMSA 4E5XG 1JV2B 4AYEC 4R4BB 4F9PC 3FT4A 1ZT1B 2O6FA 3FB8A 3GMNA 1NFDE 4OTXH 3NSCA 4HVBA 3QDMB 3QISA 4Y8DC 2VMDA 2GB2A 4Z7IA 4J4PC 2R2EA 4IS6B 5D2NA 4DUWA 2PYFB 1DVFD 3DI2B 3MU3A 2GJZB 3CSTA 1GKOA 4Y2DB 3O4LE 1C5BL 5C09D 5TF1H 1G1KA 4NFBA 3QA3B 3FFDB 5EC2A 2D3JA 2PXYC 2EABA 5CLTA 3CCHA 1VZIA 4KHXL 3UO1H 4NHCH 4Y1AD 4CNIA 2CJUH 4DSYA 4W6YB 1E3FA 1NIBA 4LHQB 4TPRL 3RPIA 1VCAA 4TUJB 2D9CA 2GHZA 1T04B 4PJEA 2HVKB 3VTAA 5EZIL 4Z3TA 5J5EA 4HG4K 4J4PD 1G7IB 5HHQB 3VI4A 4UQCA 3IDXH 1XB3A 5IVOA 1QFHA 3KM2A 1GMIA 1ZA6A 2CO7A 4ZTEA 1F56A 1VRSA 2AW2A 3BQUB 3KDMB 2PXYD 2BWIA 1MCCA 3NSXA 5L6YH 2X1WL 3U30B 2FSEA 3DK0A 1EFXA 1AC0A 3MXVH 4DW2H 5FPIA 3IDMB 1L9TA 3ARGA 4N68A 4JHWL 5I15L 2E59A 2GJPA 5IHZA 4N2EA 4HKJB 2LR4A 4U33A 3D4ZA 3APDA 4YHKL 2OFQA 2ZNWA 1NEPA 1OGAA 2P44B 4XE0A 2DQMA 2BRRL 3RIFK 5HGAA 2HRPH 3CFBA 3FB5A 1OGTB 3FSVA 4XNYH 5IBTL 1AHWC 3PWPE 1A6WH 3K6FA 2VLLB 5GJSL 1J9QA 5BRZE 4IQHA 1IC5L 1QABA 1YCSA 2HJFA 4QUOA 1NFIA 3E1ZA 5SV3A 3S8GB 4GAGH 2MHAA 1PIFA 3CN2A 4L8DA 4NNYB 3GZPA 5GGVL 1N6QH 1CDUA 2VO5A 4U6VL 4NZRL 3T3MF 3VB8A 3TBVA 3KWTA 1I9RH 5F7EL 4IRSA 3ABZA 1R3KB 1RK1A 3KPMB 4GQ9H 4JY4B 4LGRB 4XN7A 2B08A 2FJFA 3BWZA 4AQ1B 5D93B 5JQ6L 2K78A 4K2UL 1WA2X 3HRPA 4Z18A 1P9MA 3L5XL 3DXAD 3IYLW 4M7LH 4OJFH 4A2GA 2XN1A 4YX2L 5SX5H 3VM7A 4RRPG 4MLSA 1FSKB 4KZ0A 1MJ7H 3ZL4H 5ISZD 1JF1B 4AUJA 4TOYL 4LPVA 5IW1B 2XXMB 1XXDC 2ALAA 4NWUH 4H8WH 2CSPA 2R4RL 4IW4C 3D2TA 4IJ3C 1JWSB 1CXFA 4G1MB 3BPNC 3BPLB 4ANWA 2UUDK 4ZOEA 3QGVA 2CJSA 3HG2A 5CP7A 4FQLL 4XB3A 1IAKA 5F96L 2Y7NA 3NAAH 4NRYA 5F3FA 3KXFD 1HIML 4NQEE 4OCNC 4N9GB 5HP5A 1T03L 4BZ1H 2WVVB 4FQCH 4KY1H 1YPZF 4FMFA 5KYWB 4UINH 2Y5TB 5CBAB 1PZSA 4DZBA 3DX8B 3M7FB 4P2OB 2VSKB 7FABH 3DJTA 1FRGL 5F1KC 4JFVA 4P2RA 1D7BA 2ZWLT 4G8GE 3PFUA 5DWUH 2FECL 4ELME 4LKCB 1OWRM 3G5ZB 2F58L 3AM8A 1JF5A 1P2CA 1W15A 2RFXB 3T6WA 2EDFA 3U0TB 5HD8C 3BE1H 3N9GH 4H0LC 5AFAA 1E2VA 4CRPA 4P2CG 3IKCB 5D1XE 2BIMA 1U8NB 5ERWB 1YEFH 2LAGB 4HS6B 1DCEA 4XMKL 5A2IH 5I71C 3BH9A 1OP4A 4BZ1A 4HW6A 3V4VB 5DVPA 4CUCA 3RFRA 3EJUA 1YYML 4OQ1A 4E0RB 1YY9C 3DUUA 4IU2B 1WZMA 3H42L 4FQJH 3DDGA 5IQ9B 3U6RB 3VFRA 4QHMB 1QLFA 1KCRL 5I1HH 25C8H 2WSKA 1JK8A 4ZJ9A 1XAKA 2WXPA 4K3DH 4PBWD 3X14B 6FABH 4Y19E 1L3WA 3S3CB 5DEFA 3RPBA 1DJXA 3D50A 3WTVA 3BPOC 3U2SB 4XNUH 3UTZB 5KZCD 1DFXA 1VZHA 3CHPA 4MAYC 4MQXC 4XCEA 5HD8D 1YMMB 4OT1H 1TO5A 2FJGB 2VDLL 2GJJA 1WP6A 1DQJB 5EUKB 3CXHK 1WITA 4KWUA 2D0GA 4JGMA 5C2BH 1QBML 1HILA 1BQLL 1YJDC 4FQ2H 4MNGA 3U1SL 1QEWA 1U8CA 3FQNB 1YY9D 2D7OA 3AXLA 3TEUA 4BH7B 1F6LL 5HGGS 3S88H 3PGFL 2KBGA 2GUYA 3L1EA 4KZCA 1N68A 5JXEC 4DN3L 2CLZB 2GIYA 3FCBA 3DETC 4JM4H 2ISDA 3E80A 3S3DB 1QLEB 1TJXA 5BVJB 2NPLX 4F80A 4G8EA 3OKOB 4MAYD 4MQXD 1BVKA 1ACXA 4ZPTB 5I6OA 2GTQA 2BSED 3HZ3A 2H1LM 4HAGA 2EH8L 4GIPD 4XZ4A 3CDZA 2ZG1A 3FQTA 4N0FA 4M7LT 3O3UN 1WBZB 4YDIH 1F4WL 2A6JA 2R7EB 5I66B 1OTUC 2MTPA 1TUPA 5HJ3A 1UEYA 5DHYB 2E9WA 4JFEA 1SHMA 1G5GA 1KN4H 3NCEB 3INOA 5FYKD 4N24A 1KXQA 1C16A 2X4OB 4RZCA 1JG9A 3FTUA 4MHHI 1M05A 1TZIA 2Y7QB 4JLRA 3DETD 5JXED 5AVUB 5AD0A 1YEJH 1N0LA 3HPJB 4L9LB 1AGFB 2MCAA 3W2DL 3GMRA 5I1CH 2MOGA 1MRDH 2YD2A 1ZWIB 1NOFA 1G7HA 4WDIA 4WI2A 3J07A 3FSAA 1GSMA 4OQTH 4QRRD 4O5LH 4ZS7L 5C6TH 1S3RA 4LSTL 1CICC 4OKVA 4PJ9D 4TF4A 3RLSA 4AIEA 3TYFB 1W6LA 1OTUD 4F7MB 1IFRA 4HHAA 5JHDB 1X5AA 3OAYK 2YK1L 5BOJA 1MFDH 2FD6H 1VFUA 1XCQB 3WUWB 3DVIA 1AR1B 3M1OA 4WTZG 1IGFL 5JIHA 4X99B 4NNPH 5LBVA 1GZPB 4M5SA 3V52L 3U82B 2EIMB 5CM1A 1RPUA 3LTVA 3QEUB 4M6MH 4XNQB 5IBUB 5DC2A 4Q2ZB 4KGJA 5AUMA 4ZSOA 2FX8L 3PXLA 2ZX6A 2LFEA 1EHNA 1OSYA 1O6TA 1CICD 1QBBA 5C3TA 1MRCL 2F54D 4U0RB 5IV2B 3O8XC 2G9HB 2P24B 2Z0BA 2YS4A 5B8CC 3VQ2C 3SKUD 1QRNB 3SDYH 1I8LC 3DURA 1XGZA 1H15A 2BDNH 1BQHG 4CILA 1J7VR 2WBJA 2C5DC 3TJPA 3TJHC 1A4KB 1JZ7A 1RVFL 2EXTA 3ABKB 4QTIL 2VMCA 1NPNA 4WCYL 3UJIL 5MEQA 1PFCA 2E7CA 4GSDH 4JE4B 5C0JA 4NQDB 4FFYL 3L13A 4Y5VC 3MOAL 3MODL 4LOUC 3CN0A 3QQ3B 1WDAA 5E08H 3US0A 2NXZC 5GRXG 2IPTL 2BVOB 4JO2L 3SE8H 4WJKB 4MJID 1A6TB 1KCKA 2W38A 4JN1H 4KJWC 1RUML 1SXAA 1KELH 1PKQE 2BP3A 3K91A 1IAIM 3KPSE 3L5HA 3PL6A 4N90E 4P23C 4PP1C 4QHLB 4TSBH 2AF2A 3O8XD 3CFJA 1ADQL 4XNMB 4BGLA 2FZ3A 1M7DB 1AGEB 1DL7H 3N55A 4PJGA 3W5NA 3TT1H 1GW0A 3DUHA 4H5SB 4R0LA 2CA4A 4ZFOB 3TJHD 3K2IA 3CTTA 2Z6FA 3WFBL 4R96A 4PJ7F 5D6DC 1FIGH 1PS3A 2I7SA 4RQQA 4LOUD 3IAPA 3NP3A 5DJCB 5FK9A 2NXZD 4ES9A 4HIJA 1DQDH 1TSHA 3DUSA 1O6SB 3CZLA 4KJWD 4MMYB 4DFHA 4P23D 4PP1D 4E2OA 5CJ5A 1HCYA 3FN3A 4HX1B 1SF5A 4W9KC 1SLUA 4GAAA 3B7SA 5HYSA 2ZX8A 1N59B 4P46A 1UTDA 3RKPA 3G6JF 2AABL 5IFJA 4L3EA 2X3CA 1CFBA 4AYID 1WIOA 2R23A 5EA0L 2IOOA 4AYFA 2GG1A 4LLWB 4QOKD 5C0NC 4LPCA 5I5RA 4L0PB 1R5WB 3AROA 1WWWX 4HBCH 2OMNA 1A6AA 4RX4A 3ZKXB 5IEHB 1S9YB 1AS6A 1FYTB 4HWNA 5D55A 4UV4L 4LVHC 3U2IA 2AQQA 4WSGA 1T2QL 5FEBA 1L9QA 5FF6B 1D7DA 1CJYA 2C1OA 3FJTA 4NO0D 3HN8A 5HGBA 2ZE0A 1C5DB 4XRCA 2QTEA 4EOWH 3WKYA 3OLGA 1NM4A 3CX5J 4OAWA 1MWAB 4ZQKB 3K8MA 4YFLF 4HCRH 4KMQA 4HPHA 3N44F 4DKAA 1IM3B 5C0ND 1UACL 2A1WH 4MCYB 4WFEE 1BBJA 5F1NB 4ZOAA 1G7LA 1SJXA 1KOAA 2DWTA 5KOVC 5KS9E 4HK3N 4TNGA 3LQMA 3QJXA 3B9EA 1ES0A 1FZKA 4JX0A 5GGTH 2OJZL 3WJJC 1JNNH 1OLZA 2ZAHA 1AQMA 3Q48A 1U8LB 2IH1B 5LGJA 1OY3B 5MENB 5DZAA 5FB8B 3IXAB 3QIUB 5F97E 4U1IA 3GM0A 3HCVB 4BV1A 4CC4C 4F27A 4ODTL 4R3SA 3FBKA 3HG1E 4YEEA 5K9OA 1IBYA 4JJ5A 1CF8H 1SNRA 4GINA 4WNJA 4L2LA 4W1TA 4H26A 3QEHA 5C09B 1QVOA 1FFQA 5GGTA 1L9NA 4I9WD 3WELA 5L2KE 1KGCD 4PLOB 4YHZH 4ZYKA 2MQ3A 4OFPA 1OM3H 5IW6A 1HCFX 4X6BB 4N8VG 4X4XB 2XPGB 1CCZA 4M6AA 4B5ZA 3KBEA 1CIDA 2J1XA 2WYHA 4BFIA 5KG9A 4WNSA 3D33A 4O2CA 1QSEB 1JGDB 2XQ0A 4GUPA 3WNPA 1W9XA 4LB8A 2EDWA 5HJDA 4PJIA 3ZGHA 2ZKWA 3QXDA 1VPOH 4YDVA 4XMXA 3V0HA 4GOSA 2C3VA 1NPUA 5HI5C 4I3RH 5KVDH 2WQUA 4S0TD 3QNFA 4FI6A 4OZGF 4PCKA 1Q1JL 3FU9A 5I74C 2GJ6A 3WKQA 3IVKB 2X4PB 3MNMA 3Q5TA 3LPFA 2PXYB 3C6EA 4JKKA 4XP4L 1A14L 1HN1A 4FTDA 3BGFC 3CXDL 2NSQA 4LAQL 1YC7A 3BJ91 3O6LL 4JCLA 5E00B 2R2HB 4W9IC 3BWUF 5I0ZA 3WEAA 2H3XC 3P9MA 4HK0A 5D8JL 5FKPB 4RGOH 3PWUA 1IC7H 3CMGA 1AXTH 2OL3H 1I7RA 5A6IA 3KBFA 1XH3B 1CDJA 4M03A 3HS0B 1YNTF 4GKOA 5HI5D 5TQ0L 5EORL 4FXTA 3ZQ9A 1GPOL 2CH8A 2Y36H 1KCUH 5B39G 3L48A 1FL5B 4PY7B 4HF5H 3M46A 5DRWA 3W3BA 4ERSH 3V4VL 4AVHA 1XDTT 4S1SL 5CJOL 3WIFB 4HJGA 4K7PX 2OL3A 5JA9A 3APMA 3NCWA 3BYTA 1XTMA 3RWIB 4HUUB 2OJEA 2FX7L 4NKOB 5L9DH 3SDAC 1SY6L 1R46A 5C0DA 5JLZA 3GT6A 1NFDF 3T2LA 2VUYA 3KGRA 3QDME 4Y2LA 1XCTB 1TVHA 3MRNA 4IGBC 5E4OA 4HPYL 1M3IA 2Y07L 3R4DA 4APXB 3HA0A 4N8UA 1PD1A 1P5UA 1XO8A 3OKLB 3ZDWA 4UANA 5F7YC 5MHSE 1Z0NA 5BUGA 5MERB 4PS4H 1TTRA 4LARH 2XUWA 3UL4A 4XXDB 1MCBA 4S1QL 3BDXA 2QT6A 2VRQA 3BIBX 4NENA 4J8RA 3E6FB 1I1RA 1UZGA 3UDWA 3WY1A 2O6CA 1EZLA 1YMHA 5KVFL 1NAKH 1S9XB 1IGMH 1CC3A 3QUGA 1AZVA 2QSTA 3SDAD 5J13B 5I23A 1QLEL 2NW3A 4GUQA 4JKLA 2VAJA 3BKYL 3JV6A 2IFFL 1NQBA 4IGBD 1C5CL 5F71A 3FRPA 3MLPA 1NGYA 3DHPA 4NHUB 1A9BB 1UZ6E 4X4ME 1EJOL 4G80A 4FNLH 4N8CH 2X4TB 2CCWA 1YO4A 3BMWA 4DP2X 2JKNA 3L3GB 4RAVA 4R7LA 5BRQA 3MCLL 1AD0B 3DOHA 4Y4HB 4RFEA 1UM5H 5H4YA 5L4IA 1FI8C 3VE0B 2YBRA 5AAWC 4IRJB 4WW2B 2OX5B 5B7EA 2YC1B 5KSBA 2WGNB 5EULV 1W72H 3ARTA 4ONFL 5GGQH 2ICWJ 2QJDA 3FTGB 3HBPA 2X2JA 3F04A 2JB5L 7TAAA 1RPKA 2A9CA 2VKWA 2VO8A 5BO1H 1KJVA 3LPOA 3NIDB 4ZX5A 3G9AB 1Q72L 3D39B 1IC4H 4Y7OC 3ZK0A 3OL2A 4FMVA 3C5ZC 3SPJA 1EMTH 2WLIA 1QHPA 4MRBA 2P80D 5IK3A 2VE6B 4LRIC 3VYNA 2CKBH 2XZCH 4PJ7A 5G5DA 1NPJA 2Z64C 3QRGL 4IDLA 4R7NA 4IKKA 3DECA 1D9KC 4Y9BA 5AW0B 4L18A 1W72A 5PCYA 3LXUX 2YR3A 1YEGH 2Z0UA 3AY2A 2ZYHA 3I6KA 5JPMC 4IHBA 5KN5B 5F3BB 1T3FB 3W0WB 3GSXA 1VGKB 1JRHH 2WXHA 1G6RB 3ISYA 5D9SB 5H35A 4F7TA 2LW3A 4DVRL 1T0MB 3HFML 2WANA 1ZHKB 4QXUH 2ZX5A 4EZKA 1U8KB 3G6JA 3Q3GB 2YEQA 4ZTOL 5CFAA 3G5XB 1GZQA 4GPVA 1FNHA 3C5ZD 3BUBA 4MDJA 4JFPA 5CLXA 5D1QC 1HH9A 3FOMB 2VDPH 3KPNB 3QEQA 1D9KD 4XBGB 5HDLA 2J6EH 2BVPB 3V9CA 4WWPA 2IALB 4OBRA 4N0CC 1DBKH 3NN8B 4DGYL 4BCXA 3EAKA 1DBJL 4OU3A 1KEGH 1UWXK 4RNRA 1P7QA 1T1YA 4I4WA 5H37H 1GAFH 2XLLA 3WLBA 1FJ1B 3P54A 5DUML 3UOAB 3EKCA 1F5WA 2XI9A 4E42A 4MWFB 2B5IB 1N70A 1ORSB 1RK0A 3KYNA 4KX8A 1AH1A 4LK4A 4QT5A 2UX7A 2FSDA 4ETYA 3WHE1 2JCCA 4XMTA 4M00A 1PD0A 5D1QD 4OJDH 4UDTB 4KXCA 4AEIL 5DQDH 1HZHL 3LDBB 3HZMA 1F41A 5C0IB 4TQIA 3EOBB 5AOLA 1LTXA 3SDXA 4KKAC 4QRRB 4AIOA 2D2OA 1BLNA 3FU7A 1ET5A 2YKLH 5T3XL 3QDJA 5H37A 2VR6A 1B0RA 5CD3A 4QRPD 1N8ZB 2DICA 2YSSB 4G7YL 3X3GH 3QC5X 3MRJA 2O6DA 3WFCL 2F1EA 5GS3A 3W57A 1BAWA 2L4OA 4B6ZA 4P5KA 2R0LH 4YS4A 4Q8BA 4Y4KB 4ZNCD 4Z7QF 4D0BB 4N5UA 4NJAL 5A6MA 5FO9B 1OP3K 1S7RB 4HPOH 4Z76A 5JPNC 4NSKA 2B0SH 3GSWA 5E4IA 5EUOB 1TEFA 2BX5A 3MI6A 1F4YL 2WC7A 3T2OA 3A4EA 2AQRA 4KKAD 4BK5A 3K71A 1OSEA 1WIPA 1HT6A 2A73B 5F9WC 1CICB 4DKTA 1JHLH 2EVGA 5DC9B 3D0LA 3SN6N 2XBZA 3X11A 4YHNA 2ATPA 2J43A 4TVPL 1QQDB 1MCPH 5B3JE 3UAFA 5EFIA 4BINA 5LXGH 1A4JA 1AXSB 2DH2A 4Y9FA 2O5ZH 4JFXB 2Q7YB 3BKMH 2AEPH 3CH8A 4W9FC 4QRQA 3IRCA 4Z6AT 1U8PA 32C2B 1LDSA 3U9UB 2X6MA 1X5IA 4I1NB 3ES6A 5KVFE 4G8FB 4XN4A 2OK0L 1JMZA 3VG0H 3CDGA 3T8XA 3C5JA 4OJAA 2X41A 5IW3A 3ZZ1A 5A2BA 4H0GA 4FA7B 4MXQC 5EZLA 2MQ0A 3O8XB 3UX9B 2XOTA 3PE9A 5DMKA 1RFDL 5B8CB 3G3LA 4G9DB 5AW3B 3R06A 5I17B 1FZOA 3ARSA 1U8IB 3IPEA 1PZUB 2YPLA 1TJGL 4OJEH 2X3AA 1YNTA 1HWWA 4YGVA 1OQOA 3EJQA 1HFUA 1UURA 4XNXL 3VJ6B 4Y5VB 4MA3A 1JGUL 4ANVA 2R56H 3MRCB 3QUHA 2NXZB 3P0VL 4L8BB 3KR3L 4P23B 5DJ6A 4MXQD 5DFTA 2HLFC 3O3BB 3LEYL 2AEWA 4MMZA 2FECI 2E7BA 2QQKH 3MRGA 4KK9C 3HE6C 4PSPA 5E2WL 5ECJE 1NBYA 1ASOA 3B2DC 5GRJH 1A1MA 1YUKB 2M8XA 2RCSH 5E7FA 5ABAA 4PG2A 4C55A 5DI8A 1OAKH 4L4VD 5FCSH 5JHDE 1GHFH 2F7PA 2K8QA 5C0BD 4U1HB 2JK5A 4X83A 1AHMA 4ZX6A 3V4PB 4PS7A 4X80H 2WUBH 1GOFA 4TNWK 5JW5B 3D3VA 5SWQB 5B7FA 3M86A 4K7PH 1I1AA 1ID5I 5ICYB 4KQ0A 3QYNA 4XC1L 4HWUA 3L54A 1QSZA 3N43B 1VLXA 2HLFD 4ZQTA 1KENL 1CU4H 2E9IA 5AKRA 2IEPA 4NO0B 1DLFL 2WTRB 1LL1A 3FFOA 3O81A 4KK9D 3BH8B 3HE6D 4PJFB 4TVUA 1INDH 1A6VH 1FF5A 5F9OL 1TIUA 1TQVA 3BT2H 2DQFA 3F64A 3NJKA 4FULA 2VDOL 3LY6A 5HPMA 1KSRA 3EYUL 3N40F 1OEZW 5KANI 1QRNE 1U2HA 2EDEA 2YN3A 3QFJE 1RI8A 2HJLA 1KTKE 1WUZA 5DZVA 5AOJA 2MNWA 3ZDZF 3TM6A 2UY6A 4X2UA 1QFOA 1IT9H 1H19A 1ZPLA 4NQDE 3T1FB 1BXAA 3EADA 3ZYJA 1C7SA 5ICZA 4XPTL 3W11C 1TLMA 3QNYB 3BAEH 3OXRB 1HDMA 3FNKA 4OR1A 4X4YB 2B9BA 2BFVL 3X3FH 5EU3A 4WUKL 1Y0LB 3LOWA 3LKNA 3ZHLA 2XU9A 2ORBH 4FFZA 2JKWA 3GPEA 2GT9A 1WF5A 3RURA 3EYOA 1NGXA 3EBHA 2GSGB 2D9QB 3NH7H 1NH6A 2BIHA 5EU7C 4CSTA 2EECA 2W9DH 5E8DL 2AXJA 2P43B 3BSZL 3MLWL 4CA4A 2XYBA 5IB4A 4OZIB 3PWPA 2HH0H 5T3XE 1QFWH 4M1GH 3C2AL 1EIBA 4NC0B 4JFHE 3DPBA 4PMEA 4Y88A 5AYTA 1BIIA 4DT2A 1CK0L 2DQGH 3ZJAA 3ZO0A 3MRBB 1IL1B 2PCYA 5D7JC 2COQA 2QGEA 4NC1C 4NO2A 3HRZB 1BPLB 4U1KA 5IMKB 3ZE1B 2VR4A 4UQ3A 5IMOA 3GMLA 4I2XB 3S96B 5DU7A 5EU6B 2EIZA 3K72B 4OZHF 1INEH 3ZBMA 3V6FB 2J7LA 3HHSB 3TIDB 1KFAL 1L9RA 3MRMB 5CSZB 4YWGH 2CDFA 2O5YL 2QPFA 1L4IA 1LNUA 4YZWA 4IM8A 3MR9B 2NZ9C 5GISL 3N1PC 3L9BA 2F08A 3BAXA 4AITA 4TVPE 3S4SG 2F74B 5FWQA 2OMYA 4WFGE 2OMUB 1QI3A 3QO1B 4O4YH 3BJLA 3ZKMC 1TMCB 5EU4B 1Z5HA 1FUNA 5FS5A 4AV4A 2QR0B 5I6XC 1KBGH 4HV8B 3NFNA 4Z77B 4X5PA 1FGVH 4DJMA 3V4LA 1FZMA 3DSNB 3SGKC 3WFDL 4ZXBA 5L0QC 3NFSH 4MJJA 5F88B 3QR0A 5HHOA 3TA3A 1OP5K 1PFOA 1E4HA 2WLLB 2FHBA 2BZ7A 3T2NH 5CSGA 5IQ7L 2A9NH 5IB3A 5TK4A 1A6ZB 3IKKA 5KEZA 1ZT7A 2Y2WA 2NZ9D 3Q8EA 1KYOK 3VU2A 1W91A 3AQDA 4TULL 2XCMC 4ALAH 2Q8AL 4NQEA 3B8YA 1TCMA 4M56A 4TYUA 5KS9F 3IDNA 2FWOA 1M9WA 2ARJB 2AQ2A 2ARJQ 3BGFB 2BSTA 4OGQC 3EDKA 3C60A 3EJZC 5F8RC 1W8NA 1MCWW 4X5LA 4WGKA 1AD9A 2XT1B 3VXTB 4FQXA 3DA0A 4QXWA 3W9DA 4B5EA 1KLFA 2D31A 4RH4A 5MENE 3FFCD 3MRFA 1T4KB 1GS7A 1FAKT 4OZFG 4ELMA 5AALA 1G7QB 3HE7A 4WJ5B 1DEEA 5DUJA 1T7YA 3D52A 4W6XB 3K6DA 3VXSB 1HHIB 1FNGA 3IN2A 3ETBF 4A6YB 3CH1A 3CUPB 3L3KA 4X5QA 5DS8A 4TQHA 3QIBB 4G6FB 5GHWL 3VFUB 1JNJA 3R18A 1V7NL 4FYRA 1C5BH 3DARA 4GIOA 5IBLC 5TE7L 5C09E 4DK6A 1SDDA 2EE2A 2YEVB 2YLHA 3EJZD 2GFBB 2X2IA 1G6RL 1P4BL 2PR4L 3ENEA 4KHXH 4RWYL 1KTDB 3RWDA 2VR9A 3DO7B 1F97A 4G1EB 4P3WA 2WNGA 4Y1AE 1I3GL 4TPRH 3PJSA 3BUYB 1DUZA 2CK2A 1EO7A 3MRIB 1N7ML 2YA0A 4PGEB 4P4KA 2CGZA 3LNGA 2J1ZA 5EZIH 3AU1A 3IT8D 2G3NA 5AL0A 4KJYB 1TF4A 4BHUI 3MJ7B 2DYPA 2X2YA 1TQCC 2K3HA 3TN0C 1HQRA 2G75A 1EHAA 1MAKA 4MNQD 4C56D 5IBLD 1ACYL 1E9OA 4YHIA 4RDQF 4NCC1 3MXWL 1KNOB 4IRZA 1YJDL 4PLNC 4LDEB 1FVCA 3UAJC 3O3AB 4JHWH 5I15H 4JHVA 3VXMD 2R0KL 1EZSA 5FYKL 2LFGA 3TBSA 4DCQB 1R24A 4LCYB 4U6TA 5EBLA 5FAAA 3TPUA 3MRKB 4FTVB 4R7VA 1DJSA 1ETZB 4JQVC 2JIXD 1BYNA 2ICEA 2RBLA 3WEXA 4YHKH 1XEUA 2Y0SA 2YLKA 3O41B 2BRRH 3PGCA 1E27A 3VCLB 5IBTH 3MUHL 4PJBB 1IGCL 5GJSH 1ZKAA 2B1AL 1QO3A 4IKNA 3SZ6A 3ECUA 4NNXB 4HKXA 1CD0A 3TN0D 3WHXB 3SOTA 2RH0A 5EZPA 4X5WB 1IC5H 4YHML 1MF2L 1ZS2A 2AVFA 3KPRD 1C1EL 5D2LB 2J57A 4IBVA 2WUCL 2V33A 3UAJD 2HTLC 2OXHB 3TU6A 2ADFL 3O45B 4NQVA 5GGVH 5CEZL 1LE9B 1WWAX 4NZRH 4U6VH 1UWXH 4NX0A 2BMKA 3QWOB 1RIUL 4PJDB 5F7EH 2PTUA 1PZBA 2W8CA 3TVMB 3ZMRA 3LZOA 1EXGA 2IANB 2DKUA 3LKPB 3QORA 5IM7B 3D18B 4OLWH 3MROB 2BXYA 4K2UH 3GS0A 5JQ6H 3HI6L 4L05A 4EVNA 3L5XH 3H9HB 4F7EB 3AXIA 3TTYA 4A7GA 1EAPA 3N04A 2V9RA 1AQHA 3DXAE 2ZXEB 3I02B 4YX2H 3KCPA 1XF4B 2X09A 3IF1A 3ZTJH 4AKQA 5IR1B 3MN8A 1FG2A 3HI1A 1O7VA 2HTLD 5KYXA 4X9YA 1JWUA 4J3BA 4EIGB 4TOYH 1YUHB 4AQEA 1FV1A 5DQ9A 5ISZE 2B7DT 1KPRA 1ZXKA 1D9KB 4RRPM 3K6OA 1F1AA 4KO6A 1H8OA 1EHKB 3ABGA 2V5SA 5JPMB 1BXVA 1IIIA 5I1IL 3STLB 4FQLH 4KXAA 5F96H 2Q7AA 5LLIC 1FAIL 1T03H 5ESAA 3WXVL 1TTAA 2Z93A 3GMPA 4C59B 2FLMA 1MJUL 2J88L 2BSCA 2UX6A 1JXDA 1UZ6F 3MGOA 4P2YA 4FNUA 2NT0A 3FF8A 2HJKA 2JE8A 5D1QB 1FRGH 1RZJC 1ZVSA 5I9QC 4OIAA 1A3ZA 3SYQA 3L4YA 5HGHA 1UD2A 3PWJA 2HPTA 1G9MC 5I0XA 2F58H 2TSBA 1T89A 4NQUA 5F7DB 3SBPA 3ZX1A 3TC9A 3P73A 4MBRA 5JUEL 1JZ2A 4C8XA 4ORGB 2NUTA 1S5IL 1PKQA 2NDFA 4QRPB 3KPSA 4XMKH 3MLRL 1PCXA 4UM9D 3PPEA 1YYMH 4LNVA 3BUIA 1DP0A 2CBQA 4FHBD 1IE5A 3H42H 1MCQA 4LESA 1BXXA 4LCWB 3NIDE 1NDTA 1QBLL 1KCRH 5HVFB 9PCYA 1LO5B 1AMXA 1GGCL 3R19A 2VZSA 3LNEA 4G7RB 4X6CB 3IFLL 1JI2A 4PV8A 5JOPD 1TFHA 4KDTA 4YOKA 2G5UA 4N2HA 3V4PL 2VDLH 5T1JA 4IHOB 2AJUL 1S7XB 2R51A 4PRHD 5H2BA 2Z31B 3ULUC 3CIQA 1QATA 4ZRGA 5HYJD 3F58L 3QPXL 5H4ZA 1QBMH 2OQJB 3D4CA 3DBSA 4HUCA 1BQLH 4J3VA 3U1SH 3SYAA 4PGCA 4E9RA 1ZHLA 4AJ0A 3PGFH 1NKOA 1M6UA 3IXTB 3B1TA 2VIRA 4LSDA 3B6SA 4M1CC 3UPRA 1K85A 5JPNB 1XCXA 2F61A 5K93A 4AY0A 2FGWL 4EI0A 1MLCA 4OCMC 2NYKA 5EO1B 2DL9A 2AITA 3MZGB 4U1NA 5HHPB 1CYGA 3H7BA 3AFLA 4M6NL 3HR6A 3QFDA 1M7IB 1NUDA 3L4VA 5F9WB 4HUXB 2EH8H 2RB8A 3OWRA 1JUFB 3NJHA 4KAQL 1Z9MA 2AJSL 5FWRA 3ULUD 1SZNA 1CD8A 1Z1WA 4QTHA 2VXTL 5D6CA 1F4WH 5IIEB 2BSRA 1J8KA 1CZ8L 4PJ8B 1R5VA 1OT1A 2AANA 5FO7A 2DJ4A 4FRWA 5GRVL 3WEBA 4EO5A 1E4KC 1T80A 5TDPB 1WLHA 5FYKE 3U46A 3N0AA 4M1CD 4MDIB 2OBGA 1DUYA 2J2ZB 1IKNA 1SHSA 3NCYP 4PRNB 3KPOB 4Y2OB 1RJZB 2IDTA 3MJ9L 5FA4B 5GZOC 1KLGB 3W2DH 5L2JA 1FGNL 4LOEA 3A21A 4LLQB 4KTDL 3GXDA 3BP6A 3ESPA 4U1LA 3BRFA 4R8WL 2A9DA 1TKWA 1ZA3A 2P5WB 1DEDA 1MKFA 5KYYA 5E1HB 4ZS7H 4LSTH 2H1PL 4NN6B 3MX0A 4QRRE 3GMOA 2X4RB 4HIXL 5AYQA 3DX7B 3GJFK 1G4MA 3OD3A 2YK1H 4MJ4A 4P05A 4L4VB 3PREA 3KAAA 4WNQB 1J11A 1YC8A 3GKZA 3RIAK 3FONB 5TGBA 5DD6A 4HLEA 5CEZE 1CE6A 4JRXA 1IGFH 2DI8A 5EOCH 1KULA 5F1IA 4ZUWA 4WW1A 5AZ2L 3UBHA 1CYWA 1UKQA 2VAAA 3NCBB 3V52H 4O51B 5IG7B 5GZOD 4M48L 4P06A 1VFBB 2N1TE 2N7SA 4OI8A 2ZJSH 2MEJB 3KYOA 5EUOE 3O3EB 5BZWB 2FX8H 5A16B 3SO3C 3CSGA 2WXMA 4KROC 1MRCH 3BGMB 3WJLA 5D2NC 3LB6C 2X5PA 3IU3B 4EIBA 2DI9A 4GJTB 4ZUSB 4RFNB 4KKCC 5B3JF 3JZ7A 3L4ZA 3NYKA 4K73A 4NKMA 3QAQA 2YFNA 3LV3A 3STZB 2G5BB 3CX2A 4BD4A 2YMOA 1UUSA 3GLAA 2EO9A 1RVFH 4QTIH 2P7TA 3ZDYB 2IFGA 2XZQL 1QW9A 1DSWA 4WCYH 1P7BA 3UJIH 4U6YB 1PG7W 1A7RL 4YK4C 2J8UB 3IMBA 2CU9A 4FFYH 3PDOB 3MOAH 3MODH 2WCSA 3K4AA 3N2JA 5JHLA 3LQAC 5HBBA 3TBTB 2EINB 3M1CA 2IPTH 2IPKA 4JO2H 1T22A 3PP3K 3WN5A 5BMFL 4AK1A 1RUMH 3BT0A 4MJIE 4UQAA 4KROD 1ETA1 5ALBL 5IB1A 3LB6D 1ADQH 1SDYA 4HCFA 4G71B 2C9SA 4KKCD 4R7DA 1O9WA 1BMWA 2ZOOA 4ETQA 5IHWA 5IHHA 3GB7A 4QRAA 2CPCA 5AOZA 5TTRA 3VTMA 2JKLA 3DIDA 4IIQB 1JZ6A 4KPHL 1ZLEA 1EFQA 2C7FA 3ARGC 3WFBH 2WD0A 4FFYA 5CU9A 4K9EH 3FQ1A 4U3SB 2MSPA 1N0XL 1AHKA 3IMTA 2P8LA 3C09C 1A9EB 1AKJB 1AOHA 4NIYE 5ICXA 3QUZA 3JYBA 1KWGA 4TNVK 1K8DB 4PRDB 1OIOA 1ADQA 4NM4L 4BZ2L 3QCUL 1FC2D 5KYUA 4EXKA 5C1MB 4EN3A 4WWKA 3QZOA 1OP5H 2RTTA 2J5LC 4K15A 2O61A 4I3SH 2NY7L 2AABH 4BKLA 1ZXQA 3GFUA 2WXKA 1DBBL 3WDJA 3L5WA 4FXLA 1D6VL 3I9PA 2JKSA 2IGLA 3FQRB 5EA0H 1M6OB 3LEVL 3ARGD 4WV1C 3SYPA 3T0EC 3LN5B 4XZUB 4AYMC 1KYDA 5EO9A 4QOKE 5E5RB 1TMQA 4WGVB 5LGHL 3U7YL 2GK2A 3QDMA 2OYKA 1UVQB 1YHPA 5H94A 5LN4A 4UV4H 4L1SA 1X5KA 1OGAD 1T2QH 4W9JC 5E4AA 2YQ2A 4Y2DA 5GSVB 4LLVA 5D7JB 3SE6A 3KPPA 1T21A 3I6LD 5CMAB 3ZZQA 1BMZA 4PJFE 4ZODA 1T2JA 4KUCF 1XV8A 2CUHA 2QVTA 1E5CA 1TQWA 4Y0GA 2R8SL 3SPCA 3VXOA 5F93C 4FEIA 2G0LA 4M8QA 5BS0B 5ABZA 2YN5A 2ZOLA 4C83B 2MOVA 3O9WC 3T0ED 3PHQB 4JHUA 1NKGA 1UACH 4TUJA 3RRQA 1ODUA 2FB4L 3O4OB 3UG5A 1E6OL 3QDGD 3U25A 1SHWA 4HLJA 3WL9B 1R6VA 2OJZH 1BZ8A 3ZRCC 4JPIB 5HHQA 2DD8L 5IOPB 2X4QA 4X4MA 2E9BA 1AS8A 5E9DD 1MG2C 3Q2VA 2KLSA 4G5ZH 4NQCB 3BXNA 5I6XB 2XWZA 4WVRA 5T1LD 3W81A 5F3HA 5CF3A 3QZMA 3KDMA 3FFCB 1BG1A 1CL7L 4KFZC 4YDJA 3IDMA 3KVDD 3FTZA 4NUJB 4ODTH 5L0QB 4HCIA 3PAYA 3P2DA 3O9WD 4HIHB 3EW3B 2R1XA 4NP4L 4QEGA 4JFFB 4KRPC 1CGSL 3H8NA 3D8MA 4FXGA 4WO4C 1CFTB 2K4AA 3PFQA 2K0RA 4JFOB 1BEXA 4LXFA 4BRVA 2ZXDA 3ATFA 4OZIE 5HDRA 3HG5A 4I9WE 4MKTA 1KGCE 5EU5B 1IZJA 3P4MB 4NJ9L 4HGKC 3CFEA 3D51A 3H1ZA 2DTSA 4HU2A 5HTSA 1JK9B 1P6WA 3GXMA 3MO1B 3FO9B 1KY6A 5EZOL 3D0VA 3VD1A 3MBWA 4OLUL 2W91A 3QXVA 3VNZA 4A66A 3O11A 5TQ2L 4PP2A 1NCOA 3AAZA 3LKQB 4B3VA 4NIKB 4KK8D 3ZE1E 5B7MA 3FK3A 4B9ZA 4A2MA 1S8DB 4I5BA 1F4XL 2XFXB 4KRPD 3AQZA 2WCGA 5CKGA 2KPWA 3GS7A 2AEOA 2J73A 3A6CL 4WO4D 1Q1JH 2WKLA 3QUKB 1FL3B 1U8MB 2MCG1 4MNQB 4C56B 3N42B 5FFLA 2ZOKA 3QH3B 4JN2A 1KPVA 3LKRB 4YSRA 4NO5B 4XP4H 1A14H 1T0NB 2Z9TA 3T65B 4APQA 3TFKD 3B2MA 3CXDH 3TEYA 1MH5A 4LAQH 3O6LH 2KLTA 4GBXA 4R4NC 1GZHA 4WK2B 3K6NA 5D8JH 5HHMD 4B9IA 3JTSA 4UIKL 1BJ1J 2VJ8A 1L7IL 4DZ8A 4X0KB 3EOAA 1B4TA 1QMUA 3QCTL 3M45A 2OTWA 5TQ0H 1JWSA 2W9EH 5EORH 3RBGA 2VISB 4FYTA 3TN0B 1ICTA 1GPOH 3G6AA 2DYSB 3GSNB 3QZPA 3ZYZA 2NR6A 4XGZB 3VAEA 4YBHA 1K5NB 2CDGB 3IETB 4NWTL 3V4VH 4PJXB 5CJOH 2QVFB 2UZYB 5F89B 1Q9KA 1TZAA 3QS3A 4BGDA 3F7LA 5JZ7C 1NBZB 4HOWA 2W60A 3CHXA 1GYVA 3O2VL 4YL4A 2AZAA 2FX7H 4S11A 1JN6B 1OGSA 4A2DA 3FT2B 2NY5C 1SY6H 1CQYA 2IDSA 3GZOA 3HC3L 3EYQC 4I89A 4YNYB 2VDNL 3D2UA 4HPYH 2Y07H 2FQEA 5E6IB 1MHCB 4E9XA 3BZ4B 4MAZA 1WBYA 4HS6A 5A2LH 2PP9A 3KYMB 5I28A 5DRZA 1L9SA 1PLGL 3JTTA 4ACTA 3KLQA 3ZDXE 1XR9B 2R0ZL 4NM8L 1XZWA 3JV5A 1L5GA 4IU2A 4S1QH 2PPDA 2V7HA 4KH9A 2N4IA 4O58L 3QHZL 3BLBA 1GVIA 3MFFA 5JZ7D 3HNVL 3OGCA 5BNXD 2NLJB 1LP9E 2WLZA 5KVFH 3MOQA 1SY6A 1DN0B 1JD9A 4F15B 3LKOA 1N12A 3BZFA 1QLEH 4PRPB 1RQ5A 4FS0A 3BKYH 3EYQD 4TUUA 2IFFH 1JXJA 4HG4J 1IQDA 1C5CH 4HA1A 4G2AA 1KTBA 3H3PL 1OCOB 3V8OA 3WI9A 4N26A 1EJOH 2KZBA 2R0WL 2YQGA 5CGTA 5JOFA 1Z32X 4JFUA 3NT0A 1H0DB 4ZOBA 1RJLA 3FQNA 2ADJB 4FG4A 3MCLH 1H3XA 1MJJA 1RU9L 5E4EC 5LG6A 3CE1A 2APWA 5E03A 4HULB 4WWID 4JDEB 4DGVL 1A3QA 4JK0D 1KF9B 1P6AB 5J3HC 2NNCA 5SWZD 2MCPL 3VM5A 2RGSA 4ONFH 1WD8A 1EH9A 2YQ3A 5BVJA 4J3WA 3MNDA 1I8KB 3NP4A 1MHPH 3ISRA 4HEPA 2JB5H 3CFKB 3O0LA 1B9ZA 4UM9B 1WTGT 3C6LB 4PJBE 4WEUD 2L8AA 2Z91A 5AVWB 5CIPB 2AJZB 4DEPC 3D7PA 5EZJB 1SOKA 1Q72H 3V0VB 3ARWA 3E1F1 1YEEL 1DVSA 5D2LE 1BWMA 1ZAGA 3H0TB 3ARUA 3OC5A 2E27L 3SKNB 3BEVB 3AB0C 3QRGH 4LLMB 1LK2A 2FCBA 2CO1A 2XDHA 2W88A 5J3HD 4X6DA 4N3TA 2FUTA 3QNXA 2Q10A 3QULA 1HZKA 3QWQB 1KT2A 4WU7A 4PRHB 4PJDE 3TZVB 4GKNA 3FU0A 5HYJB 5KSAA 1KFGA 4QO1B 5DK0B 2EEXA 5HHVL 3UC2A 3H9SD 3N1GC 4DVRH 2Y9RT 3HFMH 1ZS8B 1SJMA 5I1DB 2V5YA 2B77A 1RUAL 2YD3A 1JCKA 5C07A 2CRZA 3ZQWA 4ZTOH 2R39A 5JHDA 1KGXA 4HIIB 43CAB 4BCYA 4GQZA 4RGNC 4CSPA 3VDBA 3KWWB 4BUQA 2AV7B 3OSVA 2FGZA 4EF3A 1XF2B 1F13A 4N2FA 3MBEA 4A38A 4PWEA 3ESVF 3MLXH 4LKXA 3KS0H 3F5WB 4HAKA 3QEUA 4DGYH 4HFWB 1DDHA 1S7UB 1UOVA 1DBJH 1FPTL 2NY2C 2V5MA 4M62L 1HKFA 4W9DC 3S5LG 3WNMA 1AGDB 1ZGLM 3NJLA 4HP5A 1H3TA 3EGDA 2E6JA 1YN7B 1F42A 3DX9B 5HDQL 4RGND 1MY5A 3MA9L 3QFJA 5KBPA 1QA9A 4KI5F 4NCDA 1J9SA 3KYKL 5D1QE 1ZJBA 4AEIH 4ZX4A 5LGYA 1Q0YL 3GJFA 1HNYA 3MV9B 5EC1A 4AMWA 1HZHH 4OM0L 4HH9B 3UJJL 3ZVVA 3GS4A 1RZGB 5HYSG 1DSYA 5CJBA 3DWTA 1TZGL 5I8KL 4MCZA 4NT6A 3V6ZB 5T3XH 2CGRL 4QJ4B 1TQUA 3I74A 2FT7A 2NY2D 3S8WA 2CK0L 4G7YH 4RX4D 4QRPE 4BZYA 3WFCH 4AKPA 1LLAA 2KPNA 2HPOA 3HZYB 3MTRA 3PNWB 2RIKA 4UF7C 3A6BL 4NZDA 1X6LA 3W5MA 4CBZA 2X7LA 4NJAH 2XTJC 3NIDF 4LCWE 1M42A 5E1GA 4QCIB 4XTRC 2IG2L 2XV0A 1FLRL 2IWGA 4X6CE 1VFAB 5D70L 5INCA 1F4YH 2VZOA 3U36A 5TE6L 2DQCL 3T77A 1RP9A 3DX6B 3MUUA 4M4RB 4NAQA 4W4OA 2AXHA 4IYKA 4GRMB 5HVGB 4TVPH 5J1AA 2B3IA 4HZLB 3C12A 1JV5B 2A74B 3CXHJ 3VMOA 4A7UA 4D9QD 1JDAA 1QLRA 2YKKA 3W39A 4ZW3A 3VFPA 3SE3C 1XCWA 3MLZL 2GTWA 3KLHC 3FQ4A 4HQQL 1Y18B 4F3FB 1Q8MA 1BOGB 4I77L 3RGVA 4GW1B 5SX4H 1X4YA 2XV2A 4X6EB 2WLHA 4XTRD 5GIRB 2OK0H 2ALWA 1KYAA 2JTYA 1HWGB 1F00I 1E4XI 4TQ8A 4A67A 4LLWA 3SO3B 3FT4B 3GMNB 3PHSA 1JZ3A 5HYEA 1BOYA 2E0PA 3BEWA 4KROB 2FUQA 2R2EB 5D2NB 1UXLA 1S3KL 1RFDH 4XVUC 2K9FB 1GRWA 5IJCC 1BAFL 4S10A 3UERA 3DRQA 3OF6D 2C3XA 5GS1C 1TZOA 4N2CA 1ZIAA 1KN2L 3KLHD 2R59A 5EC2B 4J3OF 2DH3A 1TJGH 1UJ3C 3ESNA 4U1MA 4ZO6A 3CCHB 2GI0A 3VRJA 2V8MA 3R1GL 4ONGL 3ZE2B 1HOCA 4YK4B 2KQMA 4XNXH 1NAML 5FOJA 2VLRA 3HLAB 5F44A 2GY5A 1JGUH 4P5TC 5J1TC 4BSVA 3RPIB 3P30L 3L4UA 3KR3H 4LBEA 3O6FA 3OM3B 1A0QL 3LEYH 1D5RA 4X9BA 1KCLA 1KJ2L 5FV1L 2GC4C 3VI4B 4XVUD 5E2WH 4Z7VA 2CPUA 4LHUA 2CE6A 2IH1A 1VCBC 1ZA6B 1UYWL 1SXCA 3BSHA 4Z8FL 4L4VE 2FSEB 2M83A 1J8SA 5C0BE 2Z3FA 3ARGB 3AMLA 1J8RA 4LP8A 5IMMA 2EE3A 5IHZB 2DQEL 4GFXA 2VN7A 4P5TD 5KVGE 4UQIM 3UG3A 2XKUA 2WXFA 1G7MA 2H5UA 1DVFA 3A24A 4XC1H 3S3PA 4CVWA 3QYMA 1OGAB 1KENH 5EUOF 3FB5B 3CFBB 5HGAB 2F53D 4E9TA 5JW4N 1LM8V 1DLFH 4NPYB 1MQ8A 2Z8RA 5F9OH 1LGVA 4X6BA 3BVDB 3V4UL 2J5LB 2VDOH 5CZXC 5MP6L 2WP3T 4G6JL 1JPSL 1JP5A 2F2HA 4PIBA 3EYUH 5DJAA 1I7UA 2HJFB 4Y1AA 2OAAA 1NFIB 1FORL 2FQFA 2MHAB 1WAAE 4F9PA 4L8DB 4PHXA 3CBJB 3ZDYE 2VN6A 3GSOA 3FTSA 3FYIB 2CR6A 1H3PL 4L37A 3QDGB 2J8UE 4J4PA 3TBVB 2XX1A 1RK1B 2FBOJ 4ZPVA 4XPTH 4HXAH 5E9DB 4QF1A 1S7WA 4MB5A 3JVFC 2BFVH 2IBZX 3DYMA 3GSNL 4WUKH 2PXYA 3HUJB 3T5WA 3T09A 4JO5A 4OKDA 5CZXD 5E5LA 2O6PA 3PWVA 4PB9L 2J71A 4XOAA 4N2DA 3K7UA 1LEIB 2ZWYA 3HMXA 1TZHA 3O9WB 4LSUL 2PKDA 4LLAA 4FQQA 3SGDI 1KGIA 2X4UA 5E8OB 5E1AA 2K7QA 5E8DH 3RWCA 3MLWH 3S5YA 3NJGA 1NMAL 1LDPL 2GW5A 4ZS6C 3C2AH 2MMXA 1WAPA 1CK0H 4CGUB 2NQDA 4I18C 5LKNA 4R7XA 5F9JA 1PNDA 4AW4A 4DEUA 2Y69B 5CP7B 1QWNA 1IGIL 1IAKB 1G4RA 1T6BX 4NRYB 1A9VA 1X9RA 4B97A 5DD0L 4J1UB 1IC0A 4KJPC 5TH2A 4KNQA 5I18L 3OLDA 3BESR 4IU3A 3TH4T 2QHRL 4P2RB 1TG8A 3RWIA 1KFAH 4P2AA 4XNDA 2O5YH 3QIWC 5EU7E 2FDBP 5L4FA 3LSOA 5GISH 1P2CB 1T7VA 4ZS6D 1AHWA 1P4LA 1N10A 3L4XA 3DMMA 1XCTA 3HAEG 3DXAA 5CO1A 3OKLA 3BH9B 1ZANH 3N43F 3SIKA 4NC1E 5HHMB 2WLYA 1GTNA 4PJFF 3WS3A 3DUUB 2VERA 3B5TA 4KJPD 5ISZA 3TS8A 5KYNA 3QG6A 3VFRB 3WFDH 3OLEA 1QLFB 3RUGE 5I1GL 3E6FA 1JK8B 1BSIA 4WLCA 5IQ7H 1PZ3A 1E5AA 5DEFB 4HWZA 4N0UE 3QIWD 3UZVA 5BOZG 5E2UL 4POYA 2B2XL 5K9KA 4GQQA 4XCEB 2NZ1A 1VB9A 4TULH 1HL9A 1XF5A 3NJJA 2Q8AH 3KVQA 3QT2A 3KXFA 2VZTA 3TNNA 4AQ8A 3AT8A 3FU8A 1HILB 1JCVA 2DIEA 4MZ2A 3VWJC 3W9EA 3FSOA 2D3VA 1Z9SA 4MNGB 4B60A 5DHDA 1QEWB 2C9RA 2HG0A 2X4TA 5T1DL 4AE1A 3AXLB 4F37F 1IILE 4PGZA 4Q9RL 4LDLB 3L3GA 2IDUA 3FFCE 4QIRA 1RZJL 3OMZA 4GW5A 3SKJL 1BP3B 5EOQL 2V6HA 3U6XA 5JIIA 1G9ML 3QB7C 1GGUA 2ID5A 4G8EB 3MLVL 4ZX3A 5CN2A 2FL5A 1OXYA 2DIAA 1BVKB 1V7NH 2CJTA 5KOMC 2WN3A 2QPUA 5TE7H 4MNHA 2O1AA 4CBPA 3IJ7A 4OZIF 4PJ5D 4TUKL 3CDZB 3FQTB 4N0FB 1G6RH 1P4BH 4WENB 2A6JB 2PR4H 3DYOA 3VWJD 1NDMA 1Z3GH 4YDNA 5HJ3B 1A66A 4JM2C 4X7FC 1M9SA 4YDLC 2PWFA 1X5GA 3KWUA 4KZDL 4QRTA 1ET8A 3X1NA 1I3GH 4RZCB 3CC5A 1M05B 1TZIB 4JLRB 1N7MH 5AD0B 2XIIA 3NA9H 1N0LB 4KFMA 1H3UA 3UBXI 3ZE1F 1AQKL 1IAII 3GMRB 5DJ0A 3V10A 4TTGA 1IEAA 2K70A 5ES4B 2L7EA 2OTUB 1G7HB 4WDIB 2D3NA 1ACYH 1MLBA 3AS1A 2XPZA 3ULUL 1PLAA 1JFQL 4MNQE 4C56E 1VGKA 4OKVB 5D9SA 3QDJD 3MXWH 1YEKH 4LL1A 1YJDH 5BV7C 3Q7JA 4J3TA 4JBSA 1XGRA 3TBCA 4HHAB 3W1ZA 2R0KH 4JM2D 4DH2A 5E24E 1GKEA 5FYKH 3G5XA 1P53A 3VB9A 3VXME 1IO4C 4CVZA 3L7FB 2VT0A 1RZQA 4ZFZA 1DZ0A 1VAHA 3CN3A 4NN7C 3FOMA 3MPCA 3HNTL 1N2RA 2VZUA 3KPNA 2IPUG 2D73A 4MAYA 4N2BA 4UIMA 5CJQL 4KK5C 1IGCH 2EADA 1CBVL 2BSEA 1P1ZA 4C47A 1VGEL 4FJZA 4J3UA 5T33L 5DSCA 5AUMB 4ZSOB 1UWEL 3KH3A 1T5WB 1MF2H 4YHMH 5FO8A 1EHLL 2ZICA 1C1EH 2KZKA 3ZMNA 5DVKA 4Q9CA 1CURA 3A5VA 2WUCH 4MJ5A 4MYPA 5JXEA 3S7GA 4PJXE 2ADFH 1BGXL 3DURB 2Y4SA 2ZSVB 1H15B 1D6EA 4OCLC 4EQ3A 3NZUA 1PKOA 2WBJB 1RIUH 5HDWA 4ZMQA 1CFVL 5MEQB 5C0JB 4KK5D 4FLRA 2LAAA 2FE0A 3HI6H 4N2KA 4QRRA 4HEMA 1BF5A 3A3YB 4PJ9A 2NQCA 4ENZA 3CFNA 3HJ0A 3RHWF 4YSPA 4DEPB 1YDPB 5A2JH 1E2ZA 4ZDHA 4L2YA 1KZQA 3PL6B 2YSSA 4ESKA 5HJBA 2O5XL 3CFJB 2C9QA 3VFTA 2QPSA 4QHPA 2VZ3A 1DCLA 4R5XA 5IQMA 4PJGB 3AB0B 1FC1A 1TPXC 4R0LB 1LP9F 1Q9WB 4Z23A 4KXDA 1C08A 4DK3A 1L0YA 4H8HA 5BZZA 1AFVL 3HC0A 4X9HA 4R96B 5EUOA 5I1IH 4RMTA 2B9AA 1BD2D 2I60L 2JKRM 2PWDA 4K5OA 2VERN 2XWCA 3JWDC 1FAIH 2C9AA 1CICA 3U9WA 3WXVH 1SGKA 1PX8A 2F54A 1I1AC 3DUSB 2W94A 3MMEA 3P3TA 4HIJB 5BCAA 1A1OA 1MJUH 2AAVA 2J88H 2VITA 3AGVA 3K2KA 4KZEL 2VDMB 4RSYA 2K8MA 2F0CA 2LOEA 4RDBA 4Q6IC 1L9MA 1F1DA 2I26N 1VEPA 2PTVA 3OB0H 4D3CL 2WNKA 1UASA 2GPZA 5GS2D 5JXAL 1TTGA 4LU5L 1OTSC 5IFJB 2NCEA 5AG9A 4L3EB 3P02A 1O75A 3FCSA 1XF3A 2R23B 1SYVA 4AYFB 2B4CC 5JUEH 1TR7A 5KVMC 3O0RL 3LQAL 2CLRB 2NY2B 4MJIA 5D1ZI 5A40E 3ML8A 3MLRH 1A6AB 1UC6A 3BZ5A 2KZWA 5DYFA 2E7LC 1I1AD 2MKLC 3I75A 2N56A 4PJBF 3EH3B 3G7TA 3BN3B 5B8CA 2ZX7A 2C1OB 4MA1B 1I8LA 1QBLH 4QJ3B 2FRGP 2ZXAA 4XRCB 1GGCH 1AYRA 2AS5M 4ZK8A 1U8IA 1AACA 3GXFA 4JW3A 3IFLH 4KRNA 5D2LF 1GXEA 1OTSD 4OAWB 4DFIA 2X6AA 2EE6A 4WKXA 3BWSA 4OUUA 1J1OL 1MVFA 3V4PH 3RI5K 5C6WH 4RFOH 1SOQA 1I3UA 2WWKO 3BIAX 3F58H 3QPXH 4PJDF 4PRHE 4A2FA 1G7LB 4MD4A 3GLZA 3BO8A 3DGGA 3GPSA 4FZEL 4P23A 4D7BA 4G7VL 4DOHB 5HYJE 4H25A 3UZQA 1QP1A 1WGOA 3PGDA 3S9DB 1XIWA 2XTJB 1JZ4A 5B39B 2YUXA 1AVAA 1CXKA 2HSIA 1QTSA 4U1IB 4R3SB 3HJEA 4QOKA 4M6NH 1UADC 2CQVA 4LFHG 5HDOA 3V4PA 2XY1A 4PRID 5K9OB 2Q3XA 3FUIA 3Q2WA 4YSEA 5SWQA 3BMVA 4KAQH 2AJSH 4JJ5B 1T2XA 5CAYB 5HDBB 2DM7A 5ANME 4E9SA 1XT5A 4H26B 2VXTH 3QEHB 3ULUE 1XD0A 1QVOB 3VXNA 3G5VA 1DANU 1CZ8H 3BZDA 2ZONA 2EUWA 4LSSH 2JI2A 4ZYKB 1M1XA 2P5EA 5IW6B 4AE0A 2BHUA 4LF3A 4WUUD 2AP2A 4NPJA 1JZDC 4BFIB 5KG9B 5JHMA 2CNZA 2DQHL 4O2CB 2EYSA 2EUZA 1G9NC 3MJ9H 5IJDC 2WKGA 4KX9A 4WI9A 1FGNH 3H2QA 1CF1A 3TASA 1B90A 4KTDH 4PJIB 4MD0A 2DJMA 4R8WH 3QXDB 2FQDA 4ZXBC 1VFMA 2Y72A 4H8QA 4YDVB 1BYPA 2H1PH 2C3VB 1XMEB 4L48A 5SWSA 1PNCA 1ZV2A 4HIXH 1OAXL 4QNPE 1MI5A 4WY7L 3LZLA 1X4ZA 2CZNA 5E1QA 4XPFL 2XN0A 1UJ3B 1DQTA 2BS71 1RZ8A 5L8JB 3MJ9A 1WZ1L 5AZ2H 4EI5C 2FATL 2X38A 3BHBA 3JSSA 3P9MB 3QJFA 4HK0B 1BX2A 3PWUB 4M48H 5K33A 3TTSA 1DFBL 2X87A 3NMEA 1I7RB 3ZHKA 4ZXBD 4X6CF 5C3IA 3HE7C 3TIEA 1NJ9A 5HHOD 2GY7B 5FGCB 4XWOC 3VH8G 3DGDA 4X98A 2ICWI 2WZAA 3CFTA 3V0EA 1IAMA 4U2YA 1J0HA 1J0YA 2DKMA 3MRBA 5LBSL 1HXYB 1DQLL 4NXSA 1D5MB 5E8PA 3NAAL 4NZJA 2EDMA 4LEXL 5DRWB 1EJ6A 4GFTB 4CC4A 4XVJL 3AG1B 3L2NA 4EI5D 2XZQH 4K5LA 4ZO7A 5L7XL 4HJGB 1A7RH 2OL3B 3WKNA 1Z7JA 5K9JL 4KUZL 4F5CE 4AX3A 4PTUA 3CVBA 4K7FA 1QG3A 2FYYA 3V6FA 2Z8VC 1HWHB 1XSIA 2OJEB 2XJLA 3JWNC 3PU7A 2YZ8A 4KVPA 2EIEA 1BFTA 3C6SA 5DWUL 5C0DB 5JLZB 3IRZA 1KIUB 2FIKA 2V0AA 3CFCL 4XWOD 1G1OA 3B43A 4J12A 5ALBH 1TVHB 3MRNB 1BZ9A 3OMIB 4HUNB 4HHGA 5D2NE 2ZKHL 2BCMA 2OMUA 4UTCA 4NQQA 2NY6C 3CQFA 4LIQL 4W9CC 2C7UA 2AXFA 1E40A 4RCAA 3VQ1C 3R0NA 2WTOA 4KPHH 5CUSL 3UTSA 3LS5L 2XVBA 4NENB 1FLTX 4J8RB 1M71A 1L0QA 3S5ZA 1QNZL 3ZE2E 1N0XH 2UZIL 1IQWL 1NDGB 1YMHB 4Q56A 4HGMA 3LXBA 3EDJA 1EAQA 2ZCKL 1NMBL 3IDUA 2NW3B 3DKHA 5F9AC 4AMKL 2E47A 3K1KC 4NM4H 4ZMPA 2DMKA 3QCUH 4OT1L 3JV6B 3UH8A 4BZ2H 1RV6X 3LD8B 1U21A 3FRPB 2H0JA 1NGYB 2ARJA 4D0CA 1ZHNA 5DJ8A 3VI4E 1XB6A 2CRMA 3NEXA 2NY6D 3SE4A 4G80B 2NY7H 5F0LB 1WV7T 1DBBH 1FYHB 2AQTA 1IGJA 4MB3A 4RAVB 3J7HA 1PX4A 3LEVH 2VDKB 4RFEB 3FCTA 4AGLA 3BUTA 2JVUA 2YBRB 3ZW3A 2A83A 5LGHH 3U7YH 3B37A 2NY5L 5KSBB 1BFVL 5ELIA 4HUWA 4BZ2A 1GYUA 4A7SA 3MNVA 3SDDD 3RY6C 2WIMA 1OGAE 1GJUA 1M1SA 3UBXA 3I6LE 1RZ7L 1WZAA 2DWYA 2IXQA 1KJVB 4KRLB 2LV4A 2GFBA 2R8SH 2BVQA 1LP9A 5K5YA 3SSGA 5LQBH 5AOKA 4GRLA 1V27A 5IK3B 2DN7A 2WLIB 3KL3A 5ACMA 2Q2LA 4ZAKC 4D9LL 1WAAF 2PPAA 5G5DB 3T0EE 2K4WA 3MRIA 3SDAA 1BXUA 4OCRL 3PWNB 4R7NB 4PGEA 1BQ5A 2QFRA 2FB4H 3BFOA 3P2TA 1J8HD 1W72B 3QXAA 5AKVA 3ZDYF 3BOVA 4J28A 1E6OH 5F6HJ 3GUTA 4IGBA 2NTSP 4X4ZA 2J8UF 1SBBA 1R75A 1F4AA 1XXFC 1D5ZA 2A9BA 2R83A 3I6KB 2DD8H 3QDGE 2A9ML 3C75A 4GMSL 3ZHDA 2AQNA 2W0FA 5E9DE 5H35B 5C6TL 5IJVA 2AK4D 2AGJL 3GRBA 3MLYL 1CL7H 1E9QA 1KNOA 4LT7A 3G6JB 1GMEA 2YOAA 3HUJE 4K23L 5GGUB 1KACB 2WWNA 1GZQB 1E42A 3V0DA 3CLFL 4JFPB 4YIQA 1BVNT 2WIIB 5CR1A 1EUTA 4ZAKD 3OKMA 4NP4H 3QBTB 2ZUQC 4M7ZC 4X7CC 1BJMA 3QEQB 5IQNA 3VACA 1W8EA 1T89C 1UFGA 2VR7A 2Y5EA 3JUYA 4I7ZC 4BUHA 1I4FA 4NJ9H 3WHXA 1K3IA 4RNRB 3VWJB 4XB8A 1P7QB 2AC0A 4I4WB 4UBDC 3WLBB 1XH0A 5TD4A 1DBML 4YSQA 5EZOH 4E42B 2AMGA 3ARDC 4OLUH 2VDRL 1RK0B 2P80A 3KYNB 5TQ2H 2OXHA 4H1LH 4JGUA 1LK3L 2JCCB 3CQQA 1AKPA 3Q6GL 1SUJA 2NTFB 4WI7A 2DM4A 1F4XH 5BZDA 5AVYB 2J55A 2XG4A 2VXVL 4ODWB 4PJDA 4TL5A 4XNBA 3A6CH 3ZTNL 1Z9NA 3GZQA 4B53A 3SDXB 3ZHFA 5BPPA 4TVSa 5JIKA 3RZCA 1AMYA 5IWLC 3G5YA 2EDNA 1BLNB 3FU7B 2F8IA 3PIQA 2A4CA 3QDJB 1FH5L 4FQIL 4F7EA 1XR8A 4N5EC 1B0RB 2XY2A 4XH2A 5D7KD 2CO2A 3ZQXA 5CD3B 4UOW1 5I6PA 4JM2B 3C9NA 4UBDD 4ANKA 3H6JA 4H2AA 4YDLB 3MRJB 1G0XA 5IR1A 4H1LA 3C5ZA 4UIKH 3ARDD 2ZYSA 1L7IH 1NIDA 5HHME 4LRIA 2VDML 4P5KB 4RBPK 4XAWL 1FE8L 1HYSC 5EOTA 4WHCA 2WXOA 3NEOA 3RUGF 4ADJA 4BCZA 1YSOA 3QCTH 3FMGL 1RULL 4Z76B 4NSKB 2GUOA 3GSWB 3JUZA 4RWHA 3VFGL 5JPMA 4NFCA 3K71B 7PAZA 2P8PA 1KYOJ 1THAA 1JZEA 1UOWA 1NBCA 2UYLA 3SQBB 2CXGA 3SY0A 3X11B 2ATPB 3GIZL 1UD8A 5BV7B 1DQDL 4N5ED 4NWTH 5EFIB 3R7RA 1D2OA 4LIQE 5F2FA 2JFCA 2WXIA 1A4JB 2BY1A 2E75C 5D1ZA 5T1KD 3CSYA 3KLAA 1JMXA 3PHOA 4DERA 2ZWZA 3DVGA 4GKSB 4MNGE 1B4JH 3DPDA 2CR0A 4NN7B 1IX2A 2KL6A 4QRQB 4Y9EA 2ITDB 1HYSD 1U8PB 4GSRA 5EF3A 3HMWL 5GS0C 2HFGL 3ES6B 1IKNC 3HC3H 5F7DA 4GI6A 4M5YL 4QTFA 3CDGB 4OIIH 2VDNH 4QHUB 1I1YA 2ROYA 1DVUA 4PCYA 1OAYL 4QRPA 1KB9J 5EZLB 4PAZA 1GJWA 1GY2A 5DMJB 2W81C 1PLGH 2CM6A 4R5TA 3MRQA 2HCZX 3PV7A 1U6AL 2R0ZH 5DMKB 4X7SL 2BWQA 3WNNA 3BKCL 4O58H 3QHZH 3R06B 4RGMC 4WI6A 3HNVH 2V2WA 1FZOB 2DLHA 4LO9A 5AW8B 1ZLWK 4LL4A 2KMWA 2CXKA 2YPLB 4WU5A 5J12C 4X8JA 1DE4A 5GS0D 4YGVB 3QRLA 4R97C 4W68A 3FN9A 4N6QA 4AT6A 2FVNA 5EEUA 3MKGA 3LRSA 1FIEA 1WTLA 3P1VA 4IHOA 3EFFA 4IOSD 5DJ6B 4U0QB 1P0SE 2R0WH 3RPKA 3N42F 3WD5L 2ZWNA 4FLQA 3ZRSA 3H3KA 1PY9A 1NBYB 1WAEA 3OJDA 2WYTA 1RU9H 4WWOA 1A1MB 1PSKL 3SPVA 1TPXB 5DI8B 3VD7A 3ZTCC 3FT3A 1LWJA 4DGVH 3ESUF 4R2GC 2JK5B 4U3CA 3T1WA 2BOCA 2MCPH 1OB1A 4P5SA 4WI0A 5IVZA 5SWZE 3WY2A 3VX1A 5HHPA 5EEZA 4UNVA 2Q76B 1NKRA 1JNHA 3D3VB 2TSAA 4HUXA 2VXQA 4CDHA 1I1AB 4U31A 2LGNA 3BP7B 3KHQA 3APNA 4HSQA 1ZLUK 2HTKC 1JVOA 1S7QB 3ATBA 4XO3A 1WH0A 3BISA 3OLIA 5AENA 4Q6IB 1T7XA 4L4TD 3AWGA 1SN5A 3UABA 4I87A 3WDIA 1YEEH 2DQFB 1UOKA 3JYCA 2JELL 1EUUA 5HPMB 4PJXF 3AS3A 1UH4A 4HDIA 2CJ3A 4R2GD 2QSCH 4IKLA 1AXIB 3FU5A 1LWHA 3P3RA 4PH8A 2HJLB 2IC2A 2NNAB 1WHOA 2ENQA 3OAZK 1SVZA 2HN7A 3DHJA 2UY6B 2MPVA 1VPOL 1D7CA 4ODXA 5HHVH 1FL6A 3T6VA 2YRZA 4H88L 3D30A 4G8AC 2EDRA 2HTKD 1RUAH 5ICZB 2ERJC 2EEAA 1K3ZA 2NT1A 2UVFA 1TNMA 5DZNA 4TNFA 4YBLC 3EHBB 4X9GA 3L9EA 5EU3B 3UP6A 4WNQA 1KV3A 5C0BA 2ICWA 3LKNB 4U05A 3ASWA 1JJUA 2VKXA 3FONA 2GT9B 4L0YA 4PJGE 1NGXB 2WW8A 1NGZA 5ADPL 2ZP0T 1JGEA 1UM4L 3F65A 1HC1A 2FEDC 4XO9A 2G2RA 3AG2B 4OZFB 4X8CA 3VMNA 2BIOA 4EKJA 3TESA 1FPTH 5IB4B 5BZWA 2BFGA 3I2CL 3PWPB 2YD5A 4M62H 4ABVA 2FO1A 3D69A 1BIIB 2B8OT 4UWQB 3HE6A 3TLRA 5DR5L 1MUJB 3RDTA 1UGKA 3KGTA 2I24N 4UT9A 5JW3L 4N3UA 4WK4B 1G7JA 5HDQH 1KCUL 5I16B 3MA9H 1TDQA 3STZA 4QYOA 1SF3A 4HF5L 4NO2B 3AY4C 4RGNE 3TYGL 3KYKH 5IESL 4F8NA 4ERSL 1IKOP 3LHPL 3IMRA 4U1KB 1Q0YH 5IMOB 3GMLB 4OM0H 3R8BB 3UJJH 3MJ6A 4GI8A