3WGUB

Crystal structure of a na+-bound na+,k+-atpase preceding the e1p state without oligomycin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
303
structure length
303
Chain Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
rcsb
total genus 60
structure length 303
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3wguB00
4XE5B 5AW6B 5AVZB 2ZXEB 5AW0B 3A3YB 5AW4B 5AW1B 5AW8B 3KDPB 4RESB 5AVSB 5AVQB 5AVXB 5AVWB 3WGUB 5AW5B 5AVRB 5AVUB 5AW2B 5AVYB 5AVTB 5AW3B 5AW7B 4HYTB 4RETB 5AW9B 3WGVB 5AVVB
chains in the Genus database with same CATH superfamily
3ZE0F 1RZKH 4QTFA 1QFWM 1RUML 3WLWD 3II2A 2PCYA 3SBPA 4F37F 3HRPA 1CLVA 3D39D 4AGNA 2Z7ZA 4WWID 4E36A 1RP8A 2J8UA 2XZCH 5I6LA 5KSAA 1FE8L 5E5MA 5DUJA 1ZLSL 2ENYA 5C2BH 5C07E 3LJ3A 4XNYH 5DLML 2RCSH 1WUZA 3V52L 4B7IA 4JX0A 2B4CC 4MAUH 1Z1WA 5TF1H 5MERB 4WDIB 1IJ9A 5JHMA 3GC3A 2HT3D 5HI4C 1TU2B 4MQSB 4X6DF 1IAII 2X2JA 4PJAF 5FKAA 3D05A 1IGCH 3WFEH 2QZQA 3QJRB 3BKJL 1TVDA 5ICXB 2PWFA 3HCVB 2FEEL 4PGDB 1XSIA 1JPGB 4XE5B 2N1TE 1OP3K 1U95B 4UT9H 2PPFA 4YSQA 3WFDH 5J6HB 3QB7C 5D7LE 3I9AA 1RZQA 3RTQA 1RZ7L 2YA2A 4FQXA 3TH3T 2VUOA 1NCBH 3AG1B 3AREA 3D39B 1ZIBA 2DW5A 2TSBA 4W9IC 1KIUB 5J6SA 1BIIB 3CFUA 3LNEA 4TKWA 5KSBB 2DAVA 3KGTA 4R90L 4HK3N 4Z5RA 3KHOA 4HBCL 1TITA 5A40E 3MLVH 4RETB 1MHCB 1SNRA 2P5WD 3CXFA 4PW9A 3L7FA 2CKBA 1XGPB 3QZLA 5E03A 2Q6WB 2EEXA 2XIIA 1BQHB 3IFNH 4P3WA 1D5BA 1DBKH 3GBMH 1JDCA 2QHRL 1O9WA 1NH6A 3AITA 4IK6A 4ZW7A 4HJSA 3QUXC 3EYSL 3TPUB 1GW6A 2TRHA 3GMNA 5EEUA 3QC5X 1PGRB 1HAWA 3UTQA 1EZLA 5IFAH 5JA8B 5L8LB 4PJDE 2J4WL 1I8MA 2GG1A 4WW1A 2XZZA 3P4LA 1OT1A 1NUDA 5HJ3B 1F11A 4YLCA 1XGYH 2MSPA 3SPJA 3W9EB 2WNWA 1NGPH 2P5WB 3D18A 2UY6A 4MJHA 3CC1A 2CBPA 4BIKA 4UYQA 4UT7L 3HC3L 4YH6A 4NZTH 3OVUB 3RA7L 3RVTC 5B7FA 5I15L 4NSKB 4HS6A 2XDHA 2IV9A 3X3GL 3NJKA 4ZW6A 4P07A 3ML9A 4YO0A 2JKSA 1HH9B 3P9LB 1KTDA 5CR1A 2ZOKB 3KCPA 1VFBB 5AVYB 4QRTA 4HIXH 4UM8B 4YVNA 4Z0BL 1ZANH 4TQ8A 4ZX5A 4IBVA 5D1QA 4IIQB 5IQOA 1RXLA 2VN4A 3C08L 1I3RB 1MIMH 4UTAL 5KVMC 4RA0C 2BC4A 2WZ6A 4QO1A 2FRGP 2K4AA 2XRAH 4A2EA 3SPVA 2CIIB 1JVLA 1QMUA 4NUGL 5DMIL 1NDTA 3HW7A 3A67H 3QCUL 4WI0A 3SCMC 1BQLH 3FRPA 1OCWH 1R34A 4HUMB 3UTZB 4IBLT 1OHQA 4N0CD 2FVNA 4XRCB 2AVGA 4PJ5D 1TO5A 1M56B 2PYFB 1MDAA 3IPBA 1EAPB 2OXGA 1EDHA 4HIHA 3V7AG 2CO6B 4MAZA 5L4MA 1FZJB 3U0PA 4RWHA 2IDSA 3BN3B 4PY8J 4Q9CA 1FVEB 2WINB 5E08L 2YOAA 2X3CA 3SDXE 4HEMA 3ULUH 5J12B 3CVHH 1ZT1B 1KB9J 4H5SA 4WNQA 5F7UA 1Q94A 4W6XB 3ZDZE 3BVDB 1V7MH 3G6JA 4QD2E 3DX6B 4KKZA 3ULVH 3H0TA 4M6AA 4N26A 3ZGIA 3FOLB 3ZKNC 4C56A 3ZRSA 2HJKB 1E50A 3QJOA 3MUGB 4JR9H 4OGXH 4B53A 5ISZE 35C8H 2AAAA 2V9TA 4Z7VA 2D0GA 4PJ5B 5ESAB 3ZQWA 3KNBA 4PB9H 4PJGE 4JZNB 2WJ7A 3LEVH 3RFRA 3ARVA 5I1CL 3HI6L 1I85C 1YNTB 4ELMF 3MGAA 3FTXA 5FEBA 1S7XA 2WAHA 2X2UA 5B8CB 5FDYA 4ONOA 3QUMB 3WN6A 4TM9A 2FJFB 1BQKA 4C4UA 3I9GH 4MKTA 3OKDB 4PU2A 1UOWA 4F8QA 2ZKMX 4PJ7A 5F70A 3NJFA 3OAZK 5HD8C 5FYJD 1CK0H 2NY0D 3BLBA 3L81A 4QY8A 5L4IA 3WUZA 5DC9B 1OGAD 1KCLA 4JCMA 4QRRD 1Q1PA 4OZHA 1YHPA 5FYLH 3WIAA 5IWLA 2QT6A 3HRZA 5DT1L 2DZEA 4TN9A 2Z8SA 3D48R 4BBWA 2E56A 4FQPA 5EPMA 1D9KC 1YMHA 3LRSB 4NZ8A 1JZ7A 5GRVL 4J12A 5H94A 5LKNA 3WXWL 2CCWA 5DQJB 1KWKA 4F2EA 4P59L 5C0RH 5HGGS 3TBSA 3FB7A 1M7UA 4FQCH 3UABA 3QXAB 1NDGA 3QXUA 4NB7A 4TSBL 1G6RB 1FFTB 2FD6H 3B2MA 1RZJH 2A9DA 2ICWA 3IXAA 1A3QA 4PRNB 3ZU8A 2GW5A 2VDRH 4EOWL 3BDXA 3BHBB 2PW1A 2NY0B 1DQVA 4HIEA 3U36B 2YD4A 2VAAA 1U8HB 1OGAB 1EJFA 1LD9A 3W0WA 1DE4A 1FO0B 3EBGA 1FFPB 3VRJA 2EKJA 5FYKD 1B90A 1SPDA 1T1ZA 4P9HH 2Z91A 4K4KA 3SO3B 5EEYA 2HAZA 3S8GB 4EBQL 4Y2DD 3IGFA 4OKVB 1XGTA 1CICA 1NBQA 1JZ3A 1I3VA 1OSYA 3U1SH 5IHZA 1ZGLA 3CZEA 2FWOB 2JJVA 3K6IA 5I8OL 3GSOA 3KPMA 5C09E 4AGLA 2MTPA 3N5AA 1Z32X 4XAKE 4GW1B 4CMHB 2EKSA 5EC1A 3B37A 1MQKH 2HG5A 1MVFA 3GZOA 2GTZB 1JNLH 3H55A 1AHWC 1WF5A 3OJMB 2X6VA 3LDBB 2R27A 3Q05A 2F53D 4L5FE 4XMLL 2DEXX 2Y7QA 3TV3L 1QP1A 4N5ED 4MXVF 3CSYA 3T6VA 2VXQL 4QT5A 5T5FH 4TL5A 1PLCA 3VGHA 3QEQE 5DDHA 5D1ZD 2VISB 4S1QH 4ZMWA 1CTNA 4XVUD 5EEZA 2OR7A 4NKQB 1R47A 2VLLA 4KH9A 4OZGB 4WTZA 5I76A 4Y2DB 3TEUA 4JO4H 1SDYA 1AACA 2AQPA 1GGIH 3CXDH 3SY0B 5L9DH 2MCPH 3Q6GL 1G0DA 2JJSA 2RMNA 5IB1A 4HG4J 3P11L 4NZUH 4S1RH 4YPGA 3QJZA 3PWPE 9CGTA 1MEXH 2L0DA 1T89C 3GZPA 2CLZA 4LU5L 2BRRH 2VZTA 3QWRA 3QR1A 5EIVA 2FJGB 2ZG2A 5ERWB 2F53B 4BK8A 1UXSB 4L4TE 4PJ6A 3DV6B 5E9NA 3IDMB 4OZIB 1RK0A 1HH6B 1O6VA 2D9QB 5D1ZB 1WS8A 3INUH 1PY4A 2OR8A 3O8XD 2FIKA 1OGPA 1U8PA 2P9RA 5MHSD 5E94A 2VM4A 1JHTA 4P2QE 4P2RD 3NDYE 2YK1H 3QPQC 3P2DA 2O1AA 2ZX6A 1HSBA 5KVFE 1CLCA 1ZXQA 4PRDB 1QQDA 2AK4D 3BJLA 3PP3K 1VKXB 1BG1A 3M86A 2CPUA 3BAKA 3LV3A 3B9KA 3D85D 4Y7MA 3W11D 4PCYA 5HVHB 3HJ0A 1EO8H 5SX5K 3T3ME 4PYHA 3EHBD 2PN5A 3MYZA 2ZJSL 1KIPB 4MS6A 2NXZC 2G2PA 4U1MA 1KZQA 4GQZA 4ZX3A 1Y6NR 3L9YA 5JR1H 3UTPD 1HWGB 4LCIH 4LHJB 5DS8A 3T8MA 4EIUA 3RU8H 1CE1L 2ZQKA 5ILTL 4FCHA 1H19A 4GBXC 4YHLH 4P2RB 4LPTA 3QIUA 2N56A 1DEEB 1KB5B 4JRXA 3K91A 1VGEL 1JPSL 1R3IH 2AK4B 3NJGA 4JRLA 1A8ZA 3FSWA 3V7AE 3FQ4A 1RJYB 4AT6B 5JLZB 2Z34A 6CGTA 4GI6A 4AUJA 1KENL 4OCYH 4LSRH 1LO0H 5IG7A 1LK3H 2AW2A 3CX5K 3EHBB 1MG3C 2CO2A 5E2UH 1KBVA 2BVQB 5D1XB 3SQRA 5AFAA 5LG6A 1MLCA 2MFNA 5DA0B 2YQGA 5B38G 4I0PC 3QJHB 2X4NA 4MCYB 4U7SA 3FQWA 3V0VB 4DUVA 3CSTA 4CBPA 1NJ9B 4Z7WA 3UZEA 4EKXA 5CSZB 4YDVB 3OGCA 3WGVB 4XBGA 2GK0B 2HA1A 2UWEE 1IARB 4KDTA 4BFRA 2MOGA 4YE4L 3S8FB 2WP3T 3LIZA 1P53A 1MOEA 3NJVA 1NL0L 4HUWB 4GAGL 4BJLA 1P5VB 4ANVA 2CKBL 2C3VB 1IGTB 1QRKA 5EIIB 1J0HA 4OGZA 1ZD6A 2DKSA 2WSKA 1UWXK 2OCFD 1FJ1B 1FN4B 1FRGH 1A6AA 3GT6A 2A0LD 1PZ5B 4JMXA 2L7UA 2FWLB 3KH4A 2A9CA 4I0CC 1KC5L 5ANMB 3W57A 1INQA 4B27A 4HJEA 2VLJB 1NBYA 3LH2H 1UXMA 3QRFM 4OV5B 4OY9A 2OJEB 3WIHH 2CRMA 3BI9X 2Z7YA 3KS0H 1F4XL 3BZEB 1QLEB 1JF1B 4WZ9A 2EXSA 3HAEA 2J56A 3B9EA 5EUOB 1YEDB 3WAKA 4U0RB 3CDZA 3VGAC 3H3KA 1KCUL 2DDQL 3QDHA 5GS1C 3SKJL 1OHZA 3VGBA 1K8IB 2BNRA 3OPZL 2JKLA 2CALA 2NSQA 5KVEL 4N2EA 2EUWA 3E6HA 4POZC 4HV8B 1BBJA 2NY6C 3FCSB 3BQUC 4OD3L 1OOAA 4LARL 1K9TA 3GJFA 2X1QA 2HH0H 4GAAA 4EXPX 4Z1PA 4YHKL 4OQ1A 3OC8A 4ONHB 3PAZA 1I7RA 3NSXA 2LV4A 4AGQA 2VLRD 2P5PA 3MKKA 4PGCB 2HT4C 3WGUB 4AYGA 1YEJL 1A21A 4EAEA 5KVDH 3GLZA 3VXOA 1WZMA 3I6LE 3HS0C 3S48A 3WN5C 4ZDHA 4OCRL 3L4UA 1UCBH 2IH3A 1RY7B 1X5YA 5F7BA 1IGYA 5AAWA 3QWOB 4FFVC 5GZNC 3NFNB 5EIQA 5CEYB 1RU9L 1H5BB 1NFDF 4DO4A 2DQDL 3BP5A 3U2JA 1P4BH 2H2SD 1T7YA 5IZ7A 2JSFA 2W65B 4P5KA 1LWJA 5MEQB 2ARJB 3QIBD 2VLRB 4TNWK 4Q7DA 2NY7L 3CPUA 1EPFA 2AHIA 5EA0H 1KGUA 5FW8A 1MNUH 3RGVD 1UM4H 3WU1A 1UQSA 2G5BA 2YEVB 5L2KD 4X8XA 2OSXA 3ISWA 4X5XA 3ZQ9A 4BUHA 3FOMB 5EORH 4J23A 1NEUA 1HWWA 3FQ1A 4JG1H 2Q2EB 3QE5A 2FX8H 3A6OA 4WU7B 5CWSA 3KZ8A 3L3HA 5B3SB 1A7OL 2AGJH 3O0LA 1JN6B 1GIGH 1E5UI 3LEXA 1KXTA 4H44C 3IDIB 3HVDA 2HN7A 3EYFA 1NCCL 3BP6A 3DROA 1EHKB 5G4NA 5SV3A 4BZ2A 4CDGC 3QIBB 2Z93B 4JO1L 4JGUA 1G87A 2V3DA 2P8LB 2FH6A 3QFJD 1IV8A 1X44A 4ZFZB 1RHHA 3RGVB 3RHWK 4NFDA 5I1GH 2XG5B 5L2KB 5LN4A 1JWSB 4U0QB 4KK8C 5E6IC 4HD5A 2R0KL 1RVFH 4TVSa 5AZEL 1PMYA 3P0YL 4FQLH 5E8DH 43CAB 1A3RL 1G7PB 2WZPD 1JF6A 5GZOD 1HQ4A 1A6UH 4XAKD 4XGZB 3FUEA 5F2FA 2JK5A 1RZGA 3ARDA 5CS7A 3N43F 2BIOA 4Y5YA 4GXUN 3P4NB 3DTXA 3JSSA 3U6RA 1M2VA 3RGHA 3IJHA 4J3OD 1RLWA 3AADB 3EO0B 3P0VL 3QFJB 1ZHBA 4PWHA 3GQFA 3DRQA 3EZ8A 1FL3A 2JQMA 3UJJL 4WWKC 4WEMB 3ECVA 1EZSA 1JDDA 1LO5A 2NY5C 4FNQA 4XBEL 2BHYA 3QZNA 3ETTA 3TCLB 4MX7A 2BLFA 3DSFL 4NKMA 5I1HL 1ONQA 1Q9KA 3LNFA 1EZVY 3B3IA 1LE5A 2XTSA 5I1LB 2CHWA 3EJPA 4U6XA 1M71A 3C5SB 4KFZC 3VFVB 1QA9B 3CZFB 5DHVA 2FUQA 4KJQD 2NXYD 3CX2A 3QA3B 2WTRA 5D7IA 1ILUA 5EZLA 4LSUL 2C1PA 1MCFA 3WL9B 4B9FA 1IC1A 1NAKH 2COQA 4V2CB 3A23A 4H7VA 5ID0B 3FT4A 5K9OA 4PV8B 2JCCE 3A6BH 1KBGL 4N0UB 3P4OB 3CZNA 1U4EA 2JXMB 4FNSA 4DF9A 2FIRT 2NLJB 4OCLC 3V5DB 4LVOC 3FB8A 1YPZF 4A7SA 1SBSL 2AC0A 4OI8A 3TIEA 2OKMA 1PX3A 5TDNB 4G8GE 3S98A 2QDVA 1SHSA 4LCYA 4BFNA 4QTHA 4BSWB 3X3FH 1JJUA 2NXYB 3KYMB 1QSFE 4O00A 4BZ1H 5E8OB 2I9LB 5BOJA 4ZOCA 2YGOA 3ZTCC 2G75A 3VWJA 4O5LH 1X7QB 3NZUA 1HN1A 4LKCA 4Y2NA 4QRSB 4NPJA 1FIGL 3N44F 3K71A 3IDYC 4FEMA 1P7BA 1G9NL 1S7SA 1A25A 2WXOA 1WEJL 2X70A 3T0EE 4Q6IB 5D72H 4LAQL 1A1NA 5BMFL 3D2UD 3IU4H 4PP1C 4LSVL 1TYRA 4M43L 3W9DB 2OTUB 2XC8A 4LEBA 4OCSL 3T0XA 5CINH 5CGMA 4CU7A 2GY7B 5E1QA 5EOCL 3HKFA 3P4MB 4GQ9L 2PPEA 3ZE2B 2IPKA 2RFXB 3R7RA 1Y0LB 3Q8AA 4DPBX 3SOBL 5I6KA 4RRPA 3HS9A 3KR3L 2QQNL 3DBSA 4FLSA 1WIPA 4N2GA 3VTTA 2PCFA 3ZE1F 2XZAH 4M4PA 4F57L 2H32A 2NTFA 1ERNA 1BBDH 4H8UA 4CGTA 3BEVB 1SHWA 5LNGA 1IBYA 1NBVL 1FSKC 2E9BA 3T04D 2JFCA 1QUNA 1NOLA 5C9KA 1FPTL 1N0LB 5CZXC 1DBML 3D2UB 3GMMA 2R23A 5BCAA 1X5JA 2XPZA 5C0ND 4B0MM 4JQVA 4RMVA 3NH7H 3VXUA 2YPLD 2FLRT 4OUOA 2HLFC 2Y1YA 4KMLB 4IYKA 4QOKA 1MH5A 1YVLA 4HT1L 5EC2B 5HDQL 1QW9A 4XHQA 3CN2A 4LMQI 3RVXD 2YQBA 3S88H 1BMZA 4Y0GA 3S3SA 1A6ZB 1GJWA 3T0EC 4EPSA 2YA0A 4H1LA 3SDDA 3QUZD 3QULA 3GHPA 3IJSB 4JZJC 5ID1B 5FCUL 5FV1L 1HHIA 4WHTA 1SLXA 3WO4C 5IOKA 5L2JB 4LQ1A 4KROC 1A7BA 1H6EA 4JKWA 2YPLB 3VWKC 4N2IA 5DXWA 2OCCB 2V2WA 3LIZL 1SF3A 2DQIL 1GTFA 4R4ND 5GS0D 1BZ8A 3LRHA 3MXWL 1T04A 4MB1A 4IDJL 2ZAHA 2LU3A 1RIHH 1T5XB 2FJSA 4MQ7A 3FCUB 1I8KB 1KELL 1NLBH 5DUPL 3WY4A 4WWNA 4QRPA 3TEXA 3V0EA 1EGJA 2EZ0C 3M8OH 2VDNL 3IGUA 1EV2E 1NPUA 2VABA 4LIQH 2IBZY 3V4PH 2E7BA 3L9RA 4AQ1C 1FFQA 4BQ9A 4KFMA 1Q90A 3KYOB 3IDGA 2A74B 3FU8A 3OMAB 4R7VA 2E9IA 5CJQH 1JGDB 1JSYA 3JUYA 3ELAT 1DN0B 2DIBA 5DD1L 3WTXA 1BQHG 4D3CL 4NKOA 2ZOLB 1QR1A 4ABWA 1NMBH 3VI3F 2O5ZL 2O6CA 3APMA 4B60A 4IJTA 1EEQA 3HUJE 2DWTA 5KBNC 3VQLA 4I9WD 1CTOA 1XDTT 4N9GB 4KPHL 5I6NA 2KC0A 3LKPB 1Z7JA 4IBUA 1CBVH 2CDEA 1JVOA 3NQKA 4K3EH 4FZEL 4MYPA 3T2QA 4OM1H 1PJ9A 5L88H 2YMOA 2P48B 3MRDB 4X42A 1OAZH 5IHHA 1I1AA 2ZP9A 3WHE1 4F7TB 3EH3B 4I9XA 5IQ9A 5AKSA 2PP7A 5L8KB 2A6DB 1TZAA 3FQTA 1ZT4A 5D7KE 1AS8A 3FCTB 2ZUTA 3OTTA 4LCCB 1H3PL 3FF8A 2CO7B 1ZLVH 2KUTA 2MPVA 4P23D 3WFCL 5KANI 4EJ1C 5DVOA 5I9QC 1W16A 3IDUA 3OKYA 4NN6B 1Z0MA 3DK0A 4P2OD 5JXED 5J3HC 3WTVA 4JG5A 3D4GA 1FYTE 1BVNT 1AGEB 3VGFA 2HX7A 3DSNB 3EJTA 5GIRB 2ZSWA 1H3UA 3QDGE 3UPRA 1LEKB 5F0MB 3M88A 4F2MB 2PCPB 2C9PA 3QQ3A 4EI5D 5B3JF 5CEZL 2BP8A 5LGKA 2Q20A 4LCVA 3UZVB 3NJLA 1ZXKA 3N55A 5I5RA 2YD5A 3BGFB 4YUEL 1A4BA 2HFGL 3MZTA 4OTXH 1ED3B 2C4XA 4MMYB 1F4YL 1H9DA 3UZQA 1TT6A 3B2PA 5I26A 2P5EA 2AEPH 3U2SA 4UQEA 1HHHB 1GYAA 2FBOJ 4RGMC 2TAAA 4M1DH 3RWJB 1MCJA 4LPCA 2AMUA 4U6VH 4P57B 4P23B 1FNSH 4YDJA 3OMNB 1SXSA 4W81A 3H9YA 3KPTA 2R69A 4P2OB 5FO8B 3ZKMC 1P1VA 4OLWH 1ZA6A 1IIIA 25C8H 2X1PA 3TCTA 4DGIH 4L0YA 2C4FU 1E9OA 2X1OA 4WJ5B 5AL8A 4C58B 4HJJL 4NT6A 1MRCL 3WBDA 5J5EA 5E23A 4EI5B 1CDJA 1P9MC 3EF4A 1N26A 7FABL 3T8XB 3BUYB 3DX8A 3ESOA 3M1OA 5I5IA 1E4KA 3CK0H 4NFBA 1AD9A 1RULH 1E5YA 2RALA 2XZQH 3PABA 2G4GA 4X8GA 4WI5A 2VO8A 4PS3A 5ITBL 2WIMA 1EBAA 1YYLL 3ZDYF 2AQTA 4BZ2L 5JPNB 4FLQA 3FPXA 1SHXA 4J3SA 2A4ZA 5F9OH 1I9JH 2P45B 2ZKYA 4FMVA 1QSEE 5BS0E 1VADB 2E47A 2GSMB 3IDXH 4QRQB 3UTSD 1HKLH 1RFDL 3K4DA 2BIQA 1UB5A 2NYZA 3E8UL 5BV7H 6PAZA 1EHAA 3DPBB 1U8MB 2IPTH 4N90E 4HK3J 3P77A 2AXJA 2BS8A 4X6FA 2CXKA 3H8NA 3VSQA 2OPCA 4U3HA 1XCQA 2OTPA 3Q1SH 4EUPB 2E8YA 3T1WA 5A16B 1DFBL 2V3FA 2GJ6E 1UEYA 3SHSA 4KV5F 1YEHL 2NCEA 3U7WL 2HMID 1R3HA 4P4RB 3HE6C 5FGBC 1T4WA 4H2CA 2XFXA 4NNYA 2NUPB 1HIML 4K71C 1YC8A 1UG9A 3CX5J 2D31A 5JOFB 5AYUL 1S7QB 1N2RB 2Z64C 3FZUC 3LVTA 1IT9H 1IAIL 3N9GL 5GRUL 1TTAA 5J06A 4ZX6A 2IAND 3MBEC 1AGDA 3UTSB 1VENA 2CHZA 4ZS6C 3S96B 4PJHA 5B39G 4CA4A 5GGUB 4LBEB 5A2FA 2VXSL 3ARBC 1JZ4A 4PY7B 1KPUB 4YSTA 4YHML 4ZUSA 3EGXA 3RZCD 4GG6A 3CNKA 4WK4B 1G7MB 3UFIA 5DI8A 2E4FA 1PZUB 4X7SL 2QVIA 3FMGH 3FAXA 3B4NA 2NR6C 2R8SL 2EP6A 5H37A 1AI1H 3VI4E 1I9IL 4G43A 5GGVY 2AKRB 3TTYA 4ZUUA 5T1DH 4B95C 3V4UL 2FEJA 3R19A 4JFEA 1QWUA 4HC1H 5GGSA 3TJEH 4JPIA 5F9AC 4LK4A 2IANB 2HG0A 5PCYA 4AVJA 2W9DL 1OIOA 4DP2X 3ROOA 4AYFB 1KCSL 2HVKA 3ES6B 5DRWB 2OP4H 2VXTL 3FFCD 3LIUA 3F5WB 4QHUB 5IIEA 1AGCB 4BXSV 3RZCB 1HCYA 3ZO9A 2YXMA 4PWGA 3EJSA 4U33A 1IO4C 1U8CB 1A4JA 3HC0B 4Z76B 1U41A 4AH2B 2EIZB 4P5SA 3MLSL 1OM9A 3PCYA 3ARXA 1SJVA 4JN2A 5HGHB 4ODTL 2HWZH 2OXHA 4ZNEA 4O02A 1YEGL 1E7UA 3QIWC 4F80A 4OFQA 3DX3A 4ZS7L 5JDJA 2R1YB 4CL7A 2WQWA 2AEQH 2J20A 4QXWA 1GOHA 2BCKA 4JPKH 3DJTA 5INDA 5DQ9A 5BVJB 4O9HL 2FR4B 4LT7A 4OGYL 3TM6A 4CADA 3L5JA 4TVPL 1S5HB 3VGDA 5DJYB 5B1JA 2DMBA 5JOPD 3FFCB 4FKKA 1NMAL 4A39A 3JTTA 4DP9X 5ACMA 4ZMVA 1EJ6A 5EEXA 1XGUB 1K6QL 3AS2A 3DIFA 1BFOA 3IJ8A 5LVEA 4XP9H 3CU1A 4PRID 1QI3A 1KACB 3L5IA 4DQOL 3QZMA 4HFUL 5TE7H 1YECH 3OXSB 5MEND 3MA9H 4HSCX 5E1GA 1ZTXL 2XTJE 2DPKA 5HI3D 3CFBB 1JBJA 1XF3B 4OLYL 3RWCA 3PDGA 4WUKH 3L95B 4JM2F 4YGVA 2MQ3A 1BVLA 1F0LA 3UJTL 3ESVF 4FG2A 5C3LD 4NM4H 4NJ9L 1M05A 3NN8B 5GGRY 1T0OA 3OX8A 3R06A 5DHEA 3FTWA 2C7UA 4H88H 1OSZA 1OXYA 4PRIB 3PHOA 5H8DA 3HR6A 1GCFA 1DN2A 1R9FA 1H3XA 3BX7C 5DJAA 3SE9H 3U1PA 3DO7A 5KOVC 5MENB 3AG4B 3PWJB 4XN4A 4TNFA 4ZPVB 5DA4A 1PAZA 3G6AB 1MHPH 1R5IB 1F3JB 3V4VH 4DKDC 4DKEL 2YO3A 4Z78A 4Z7QF 4GKNA 1PIFA 2CCLA 1FVDA 2FO4B 4O58H 4P04A 1ACZA 4AM0Q 2DMKA 1K5NB 3T6XA 4P5TD 2VDKL 3UYRL 4HIIB 1CLZH 2YPVA 3BWAA 3BH8B 3DX0A 5FR3A 1OAYH 1WT5C 1RUPH 3FU5A 1RQ5A 3FB6B 2YD0A 2PWDA 3TNMA 3WFHB 3BC9A 5GJSL 2DV6A 5D9SB 2XTJC 3L4CA 3ZZ1A 4ECNA 3DRTB 1V27A 4LPVA 2NYYC 4UYPA 4KZEH 5LCVA 1RK1B 3PV7A 5F1OB 3HMXA 5KSAD 1F18A 4M5YL 1DL7H 4Z0XB 4QAMB 1N3NA 4KUCD 1GAFH 1G9EA 1DBJH 5A6MA 4GW4A 2APTA 5BZWB 3T65A 4UQAA 5EMYA 4ZMTA 1I7ZB 4KY1L 2J88L 4AJVA 3CHOA 3UIYA 1IBGL 3I02B 1I75A 5EIIG 5FM4A 3C60A 1W91A 1IEAB 3OLEA 3PGFL 2WV3A 3IDJA 3RTQD 4FQXD 3IN2A 4AUYA 1BM7A 1BOYA 5F8RC 5GISL 2J8UB 3MRMB 4LLQA 4R0LC 4ZO6A 4Y5XC 5E5MB 4AITA 5KSAB 2KPWA 5L0QC 3FRUA 4Y16D 4HS3A 4YHIA 5AW2B 3UBHA 2DMGA 4J3WA 3LZFH 1H8SA 3T3PF 1CYWA 5FKAB 2QGCA 5I74C 5LUMA 1ROCA 5IB4A 2G60H 2EEFA 1A8JH 3BAWA 1DANU 5J12C 3DPDA 4G3YL 2ZUXA 2V7HA 3DOHA 4B3VA 2VUKA 1F00I 3FB5A 3RTQB 4FQXB 3BZDA 2YGPA 1UD8A 4ZRGA 4JY4A 3AREB 4K23L 4R26H 4TSAL 2ICCA 5MI0C 2R1WA 2XQBH 4H26A 3AABA 4Y16B 3VXPA 1L3WA 1GH7A 3VD5A 4XMUA 4MJ5A 4U6TA 2YIHA 4Z5RB 5IBTL 4TQHA 4MFHA 5JXAL 3U2IA 2CR6A 2L04A 5H4ZA 1U4FA 2CDGA 4Z3FA 2NZ9D 3C5XA 3H2QA 4NLAA 2CKBB 3RQ3A 4UBDD 2CRZA 4XC1H 1D5BB 4FQIL 1WAAF 3LS4H 5IBUB 4UT9A 1TFHA 3W1ZA 1ZJBA 1DO5A 3WEXA 5C3IA 2C9UA 2R69L 1XMWA 4JFFE 1JZEA 4PJIF 4L1DA 5DSCB 3R7QA 3GI9L 3WS3A 3GIZH 1WDAA 4XP1H 5D1QD 2YXFA 3VRLE 1I8MB 4WW1B 4A7GA 5HPMA 4Y4FA 2R0WH 1SEQH 1F11B 2FSDA 2VN6A 4A7VA 4NO2A 1DQQB 1IFGA 3Q1EA 2BZCA 2JELL 3D18B 1I4FB 2FUTA 2UY6B 4FFWC 4HGWA 4PJFF 4W9HC 4PRPD 5HHNB 3INOA 1KGCD 5J6GA 1HHJA 3QS3A 2JLPA 4HS6B 1YEKL 4RBPK 3Q8FA 2MPAH 4UDTA 1QFOA 1T7XA 4LKXA 3BE1L 1FCGA 4YQXH 3FPYA 1NM4A 2ZUUA 4YO0B 1SF5A 1L9PA 4WV1A 2C4FT 2ADFL 1KTDB 2EYSA 4A38A 2D7QA 5CNHA 2KI6A 1BSIA 3KCPB 2D7NA 4WUUE 4QRTB 1YY8A 2EIEA 2B4CH 4G8AC 5D1QB 1GJUA 3GXFA 3HMWL 1CVSC 3CQPA 3L8QA 3K4ZA 2BC4B 2YMXL 4QO1B 4Y4KD 1IC0A 1J10A 3NIFE 5KJRH 4J2QA 2ESVE 4S1SL 4XAWH 4XVJH 3T4AA 2QSCL 4R3SA 5HJDA 2E7CA 2F54A 4R2GC 5L6YH 4PRPB 4AKOA 3FRPB 3FL7A 5IESL 4FF9A 2HFFA 2JNZA 1DJGA 4KOCA 3WY2A 2OXGB 4M93C 4HIHB 4NC1E 1G7LB 2OBGA 2WSPA 3V5HA 3U0PB 3IMUA 3LDBC 4MQTB 4NENA 1KTKE 3BZFB 1RCYA 1DVTA 4LASH 4KXCA 4WENB 1H3GA 1GPOL 4D9RE 3DOSA 4IEFA 1R0AL 1IRAY 4H5SB 4WNQB 5IHWA 4LDEB 1D2PA 1Q94B 5DJ6A 4Z77A 1CZ8L 4Y4KB 1UTDA 5HYFA 3G6JB 3W2DL 4KJWD 3H0TB 1UWEL 1A2YA 2EDXA 1CB4A 4LEEA 3NIDB 4N1EA 4AC2A 4C56B 1Z9OA 1DZ0A 4M61A 3B5HA 3PJSA 4QLWA 2Q2LA 4Q8BA 4Z7VB 3KNBB 4F1SA 5KJ4A 4G8IA 3FO0H 3QGVA 4BFGA 3N85L 1PYWB 4AM0A 2NY3D 2APFA 4CMMA 1BQRA 1E90A 2JJUA 3BKMH 5E6RB 1AE6L 1S7XB 4NIYE 4AL8L 2VL5A 1OAXL 3FO9A 4OGQC 3POCA 2Z4TA 4X4XA 3TT3H 3OG4B 1F1DA 1Z3GH 5IROA 3VUAA 5FECA 4PJ7B 3TVMA 4XVUC 1BAWA 4BQ8A 2ZPKL 2A73A 2NX5E 3WFZA 4EF3A 5JQIB 1U92A 4JHWH 4R83A 4QR7A 3NJMA 4QY8B 1KCRH 2CO4A 3HEIB 1JGIA 4HWBH 4L9DA 4NC1C 2VDLH 3D30A 4O02L 1I8IA 2WK2A 4OZHB 1YMME 3RWGA 1QASA 3LKNB 3MJWA 5EPMB 2ED9A 5C71A 3LYRA 1JNNH 2CUMA 3Q5TA 4HUNB 1CICD 1CUOA 1DLFH 5H94B 1A0QL 3FB7B 3VG9C 1BVZA 1NDGB 1RUAH 3IXAB 4P9ML 2ICWB 2AJYL 1F45A 4H0GA 3TN0A 3SPHA 2PW1B 2APXA 4KO7A 4UV4H 4HIEB 1UWFA 1FFNA 1AKPA 1JGLL 2DQCH 4DUXA 1LLAA 1LD9B 2ZXAA 1HNFA 4ZTOL 4Z7UE 2VLJE 2NY1D 4Y5VA 1LO4L 3VRJB 2L7JA 4M7KH 1UXLA 1T1ZB 2BVTA 1NCTA 2Q8BL 4B9ZA 4M6OL 1UYWL 1BHGA 1NIBA 3LZLA 4LGPB 5SWZE 3T08A 4LVHB 1CICB 2PCXA 2XXGA 5GRXG 1ZGLB 5IHZB 5D1XC 2HRPL 3GSOB 1T21A 2EDOA 3KPMB 3M17A 4MJIA 2BVEA 4J8RA 1QLEH 1WIOA 2EKSB 4GFTB 4W9ZA 5EC1B 4ZSOE 2HG5B 2J6WA 5E99H 1YDPB 2XLLA 3QWRD 1HS6A 2X12A 3LPPA 4X9YA 1SM3H 4DP7X 3CSYB 4YL4A 1VIWA 4QT5B 3GSWA 4J3BA 4GQRA 3KPOA 1NZRA 2NY1B 3LN5A 5L7XL 4XMPL 5DDHB 1PEZA 3F7QA 3ZYOA 3KLKA 3PY9A 2VLLB 3EYUH 3MRCB 4JVUA 2QKIA 3FQUA 5K9QI 1BX2A 4OJAA 2Z31A 4ZFOA 3V6ZB 4HH9A 2X3AA 4CC4C 3EJQA 4J3TA 3H53A 2DKMA 4UV7L 3WY1A 3ZR5A 1PG7L 2KS0A 4NQCA 3LAFA 5E7FA 4XB7A 2O5YL 4DGUA 2YPVL 4YPGB 3ALXA 2VRQA 1BLNA 3B9KD 3PP4H 2QBWA 4KU1A 4PJEA 5IHUH 2CLZB 5D2LE 5AAMA 1NBCA 4HKZA 3OKKA 1HL5A 2F74A 3VD7A 5D8JL 5I17A 1A1MA 1WCQA 3DX9B 3B5TA 4JKMA 3W3BA 4XO4A 1RK0B 4RISL 2ZWLT 4AQEA 3AM8C 3NIGE 2ED7A 1GHFL 5LCVL 2UX7A 3J2PA 4IOIA 3HMXL 2FIKB 1G7QA 1U8PB 2CGRH 3ARGA 3ARUA 4B9JA 1SOXA 5E94B 4EE2A 1AC0A 1JHTB 5CUSL 5F3BA 1QAWA 3RDTC 4HJ0D 3D51A 1YEEL 3HBGA 4AQ8A 4HDIA 4RMBA 4G6AD 2DTML 1JRHH 1TQVA 1GOFA 3LV3B 3B9KB 3TZVC 4J4PC 3T6QC 3WDJA 1WJ3A 2XWJA 1FH5L 1QSVA 3F64A 1TJIL 1K2DA 3HZ3A 4MJ6A 3OAYK 4QGTA 1COBA 4LSPH 2PW2A 3PGCB 3TBYA 3V0AC 5AZUA 5CGYD 4GP5B 4U1MB 3U0TA 5KSUA 3NZSA 2DIAA 5DS8B 4KGJA 3E80A 4RFOL 3ARRA 3CDFA 4U4BA 1DJSA 2QV4A 1DSFL 4FXKA 3GTVA 4QCIA 1CXIA 2YZ1A 4O2EA 1V3MA 4HQQH 2HP4A 4JRXB 4J6RH 1IC4L 1SJMA 3PIQA 3UO1H 1SJEA 3U83A 5BXFB 1OARH 2DQTL 1Q72H 3OAZH 2O72A 4MMZA 2HRGA 5D5MA 1DQMH 1MCIA 5DD0H 1H5BC 3SZKC 5LNEA 4KK5C 4MA7L 1RIUL 1ZS8A 1EMTL 3RIFK 1FA4A 3TP4A 5FUOL 2FZ3A 4IS6A 5J9PA 1MLCB 4PVBA 3WIIL 5JZ7C 1J8RA 3O2VL 3PHQA 1RZKL 5JPMA 1OQOA 1FF5A 3FQWB 3T4YA 1U42A 3MACL 5CZRA 3P69A 3Q6FA 2XZCL 4Z7WB 1X5LA 3BZ5A 3OGCB 5C2BL 3O4LD 4XBGB 4JZOA 5KW9H 1INDH 1E65A 3Q44A 2RCSL 3IGAA 2YUXA 4XNYL 4MJJA 4MAUL 5TF1L 4K0OA 4FG0A 5GSVA 3AXIA 5F88A 2PXYC 4QHMB 1HKFA 5F1IA 1IGCL 3WFEL 3JWDC 1A7NH 4KKLD 4XXWA 3O3EA 2RD0A 4CILA 3RG1C 4DOHB 3ETBJ 1WK0A 2BNRD 4F37K 2VDNB 4UT9L 5C6PB 3WFDL 3G5VB 3T2PA 1M7XA 1A6AB 3NRPA 1FZOA 2WANA 3F62A 1NCBL 1EH9A 3UP1A 3ZE0E 2E7MA 4NPYA 2VC2H 3US0A 1I8UA 1MCRA 2WQ8A 3CFCH 3O4LB 3VU1A 3DVIA 4CU8A 5LBVA 1AO7A 5IGXH 4LSTH 3ZO0A 1TQBB 4L48A 4N0UE 4G6JL 4YSEA 4L5FH 3QQ4A 1TJXA 1CC3A 1BD2A 2HKHH 5HP5A 3MLVL 4J3OH 1DJYA 2CIKA 2PETA 2FWUA 2DYPA 4G6MH 1T66D 3HAEB 3D0LA 2RAMA 1BP3B 5JIPA 5I6XB 4PJAE 1S7VB 1PKQA 1FG2A 2WUBH 3SBQA 2B3IA 4WKZA 2XG4A 3FTSA 4U1KA 3QZBA 2BHFA 3ECUA 2BNRB 2G3ZA 3IFNL 4BCZA 1DBKL 3GBML 1R3KA 1T6WA 2J1WA 3LHPH 4O2FA 3B2UD 4RX4D 1N5AA 3MUJA 3E6HB 2KDGA 4PB0H 1BBJB 5D96B 3QUYC 1JXDA 5KYXA 1ZKAA 1OD7A 3EYVA 4PTUA 5K5YA 3UAJD 5IFAL 3RWHA 5D6CA 3RL1A 1MHEA 1I7RB 1NCIA 2DQMA 2GY5A 2XFGB 3P0GB 2V7NA 3WIHA 1XGYL 3QQ9D 2GTWA 1RZIA 5D6DC 5EOQH 4NNXA 4Q58C 1NGPL 3LKQA 2PYEA 3VXOB 4NZTL 4ZDHB 3ATEA 5AZ2H 1UUNA 3Q9PA 3KH3A 5DFVC 2IH3B 4ZFQA 5GPRA 4JKPH 3HTLX 1IGYB 3C9NA 4MXWH 2J5WA 2JE8A 4EUPG 4B5ZA 2EC9T 3S37H 5GGVH 1EJ8A 1E6JH 4ETQA 1J5DA 1TTUA 2XVKA 1D5ZA 4B5EA 4HIXL 3NA4A 1ZANL 5D4HA 3BP5B 3SE4C 2XJKA 3QI9C 3MNWA 4P5KB 1MIML 5KSVB 1VEOA 2ZICA 1J5CA 3QARA 4WTWA 4ZFFB 2XRAL 3BOVA 2JIXA 5F89B 3LZOA 4WWPA 2X53A 3FSVA 3BGAA 1ZVYA 1P7HL 1UQSB 2G5BB 2K7PA 3A67L 1KXVC 1BQLL 2QADC 4PI2A 1OCWL 5JA9A 3WNNA 5GRWA 3K81A 4X5XB 3RY6C 3L3JA 1T1YA 5CLYA 3LKSA 4S1DD 3QISA 2WQAA 3O3AA 1DSYA 5I18H 5IEKA 4EDWH 4GRLC 4E9SA 3WJJA 4L8SC 5A1AA 3FT2A 5CWSB 3L3HB 3ARDD 1PG7X 5DK0B 3PPSA 3OKOA 4HLJA 4KUZH 4YOKA 3ULUL 1FAKT 3WMPA 3LCYA 3CVHL 3EOTH 1JG9A 3BP6B 3DROB 2HLAA 3DX2A 1V7ML 1WFMA 5EU6A 4GT7A 1RJZA 1M42A 2AQNA 3ULVL 4JBSA 3QUGA 2DWDA 4F1ZA 4QHLA 5BUGA 2OULB 4CSPA 1A6WH 4FHBD 3TFKC 1R19A 4OGXL 4JR9L 5EULV 2WKLA 3G5WA 35C8L 2X4UA 3V0WH 3TTSA 4PB9L 2IOOA 2DBJA 3KPLA 3LEVL 3STZA 3B2VH 1F4HA 4N2OA 4XCFH 4MNQA 2X4RA 4H8QA 2JK5B 1RZGB 3ARDB 3F7RA 4XX5A 3VYPA 3ZN6A 3Q5OA 2O6FA 4Y5YB 1JNJA 1J5OH 3QCTH 4JG0H 3DTXB 3U6RB 3I9GL 2HTKC 3S9DB 3IJHB 5D93B 5AEAA 4M7LH 1O5DT 5J11B 1ZHBB 4IMKC 3TWYA 3DRQB 4X9GA 1CK0L 3PJLA 4XNUH 1FL3B 5BRZD 3ZZQA 5DRZA 1JZFA 3LH8A 4A63A 1VFUA 4JFDE 1XF1A 1D6VH 3CFMA 1LO5B 4F8TA 3VFSB 1L0YA 1TVBA 1UWXH 4LOUD 2UZIH 1D5RA 4N25A 4MX7B 4QXTA 5FYLL 1FNFA 1TQSA 2XN9E 3PHAA 4NKMB 1NCWH 1ONQB 1Q9KB 3B3IB 3OJDA 4R7LA 4F8PA 2EEBA 1P6WA 1LE5B 1NWPA 2VMEA 4U6XB 1M71B 2N7SA 5DURB 4JJOA 5IQLA 1TCRA 1LWRA 1U3HD 3G9VA 2BVPB 5DHVB 4BHUI 2IFGA 4ELME 3L5WA 4ZPTA 2V2TA 1G0XA 5LBGA 4I18A 4M5TA 4QWWC 4XN7A 5C0RL 5D7IB 4ZOBA 5EZLB 4FQCL 1KN2H 2C1PB 4KHXH 2FD6L 1RZJL 3GKZA 2HYMA 2VJ8A 4G71B 3SDCC 4F7MA 2VDRL 2YD7A 3WTUA 5F9WC 1TQCB 3ESNA 1J8HE 1NC2D 1PZSA 4P5RA 4U1NA 4YN3A 3UBFA 2E86A 5BRZB 5K9OB 3BT0A 4TVPD 5KTEH 5GSRA 3WOVA 5C08D 2NPLX 3FB8B 1P2CA 3KD4A 4P46A 4PJBA 3TIEB 5IFJA 3V0IA 4P9HL 3ZQXA 3R4RA 4ZAKD 5D7HA 3DECA 1VERA 4LCYB 4ZFOL 1U3HB 4U7KA 4QTHB 3WHXB 3CN3A 3K2UH 4P3DA 4R6UA 1X9RA 1Z9NA 3MRFA 3U1SL 4HCRH 3DGCR 2ORBH 5E1AA 5AUMA 2QSVA 3VWJB 3PS6A 3ALWA 4LKCB 1MQKL 3I75A 1JNLL 1FH2A 4IOFC 4DEPB 4F24A 4D9QE 4ODHH 2OMYB 3GK8H 3D08A 3K71B 5T5FL 3VO0A 1L9NA 2BVOA 1S7SB 3CPLA 2X70B 2H6PA 3U79A 5CCKH 4PRHA 4HSAC 1YAZA 3L9EA 1A1NB 1OK8A 2M2DA 3PYCA 4S1QL 2LQRA 2AV1A 4ZAKB 4YX2H 5DHXB 1BIHA 2D2OA 2ZUSA 3VXUD 5HYJE 2V37A 3U25A 4U1GC 4JO4L 2ZAIA 1JZ5A 1GW0A 1GGIL 3CXDL 4PH8A 5L9DL 4JL2A 1SQ2N 2MCPL 4AK2A 3V10A 1TR7A 4GFXA 2IPKB 5E8EA 4RDBA 3U46A 4BZ1A 1QFUL 4NZUL 1MEXL 3MV11 3L9BA 2BRRL 2X6BA 3HHRB 5CCHE 2PCFB 1RZFH 3LS5H 2NY5H 5BW7A 2IPUG 3L3DB 4UT6H 3KPRA 2H32B 2NTFB 3LN4B 3SE6A 3GMRA 3SDDD 3QDAA 2H1XA 1QUNB 1XGQA 4XMVA 4JLRA 3C87A 3INUL 3JV4B 4WW2A 2C3HA 3RVVC 3PGDA 1VB9A 3D2TA 3QYNA 3GMMB 2R23B 2C3GA 3BD3A 4UMSA 2WNXA 3VXUB 4XVTH 2CHDA 2XYBA 1E4WH 7CGTA 2X0VA 2YK1L 3C2SA 3HE7C 1FZKA 4DVRH 1MH5B 1P7QA 4HUUB 4Y9CA 3MO1B 4WTQA 3VXQA 2LOEA 5BRQA 1WICA 3RNQA 5ECJE 3VFOA 1EO8L 1LO3H 3PNRB 4Q14A 3O9WC 3CIAA 3ZDZF 3OMZA 4BDVA 4DPCX 2EDNA 2FNBA 2GUOA 3GD1C 3Q48A 3IB4A 3SDDB 2IH1A 3QULB 2E46A 4N0RA 5F6HJ 3ASOB 3ILQC 4WHCA 1E4JA 2VDKB 4OGAC 5JR1L 4LCIL 1HHIB 3LHAA 3RU8L 3ZL4H 4AIZA 1ZLEA 4YIQA 1IEBA 5C0BD 3W81A 2VB5A 4YHLL 3U30C 2V2WB 4XHJC 2WLLA 1QRND 1B4JH 1QLFA 1T04B 1P1ZA 1R3IL 2JTYA 2XOTA 3IMVA 3NCJH 3CU7A 4MQ7B 2UXGA 1JV5A 1TZHB 3BWUF 4GRWB 5FHAH 3SDAA 4KJPC 4OCYL 4LSRL 2D3NA 2RHEA 2XA3A 4PRBA 1LO0L 4QRPB 1MW0A 1LK3L 5HHME 3JYBA 1UJTA 2FK9A 1FG9C 1Z2KA 2VABB 5E2UL 3P1VA 3GBDA 4NOBA 3KPSA 4YXLH 1KJMA 3ABZA 3L9RB 1I1AD 4IRSC 2MNUA 1D5MA 4NJAH 4XXDA 5H2BA 5F7DA 1U8KA 2WBJA 5D2NE 5JIDA 3IDGB 5AALA 3TU6A 2LVCA 3ME0A 2OSLB 1F1AA 5C0BB 5T1MB 3VXRA 1QTPA 1IJNA 1IBZA 3V0FA 5HY9A 3SE3C 5ALBH 1QR1B 4N86A 5IBUG 4AV5A 3LX9A 5LAXA 1Z5YD 5EF0A 4H0IA 3RJQB 5CD3A 4AGMA 2QQKH 3BAYA 4NRYA 2FO1A 4RGNE 2X1WL 1K72A 4QRBA 2CDEB 4NP9A 5IBLD 4ANWA 4ZT1A 1H6FA 3HHSA 4AMXA 3V4PA 1FRGL 1I1AB 5GRVK 5IQ9B 1XEDA 1USQA 1NLDH 3DETD 2RB8A 2P5ED 4Z3IA 3PUCA 2Q7AA 3DJ9A 5CLZA 3VSUA 1ZT4B 1I8LA 5HDOA 2VZ3A 3LH2L 2ICES 2X9XA 3WIHL 1L0PA 4ZG1A 4HZ1A 4XI5D 4JRYA 4NO3B 3KJ4B 4RAVB 2OMWA 3H3PH 1UJ3A 3OV6A 3P40A 1J0ZA 2DYSB 2J43A 3PFQA 1NCOA 2ZSWB 4GSUA 2HMIC 2MCMA 1HCVA 3UPRB 4QKTA 5C9JA 1JXFA 1CE6A 1H3TA 2BP8B 4IKJA 2NNAA 3H6JA 2VIRA 3T77A 1MJUH 4N2FA 5D2NC 1A9EA 2CBTA 2PTUA 1QI5A 3UZQB 1QBMH 1LEGA 2P5EB 3FRPG 3U2SB 1BPLB 2Q3ZA 2HH0L 2D7TH 4C4KT 2MNJB 1E4XH 3L5HA 3SGJC 4YDJB 3UG5A 1XH1A 2LGNA 2GFBA 1LP9A 4RGNC 1C12A 1ZA6B 4PGZA 5B21A 5KVDL 5EO9B 2KKQA 1E9OB 4DWHA 3BVVA 4CSSA 4NLHA 4DGYH 4NT6B 3TJHD 4MD0A 4AEIH 3REVA 1UCBL 4Q9BA 4AEFA 2VTFA 4ONGH 4MVBC 5LAPA 3DX8B 2C9AA 3D12B 5CXPA 1LM8V 2EC8A 1AD9B 4PJ8C 3KLHC 1QPPA 1CGTA 3DLQR 3PABB 5KS9A 5HHPA 5AVZB 2WO2B 3H7BA 4N0YH 1P4BL 3ZT7A 4ELDA 3QH3A 4MAYA 4YDKH 1ZLWK 3CVIH 4N2LA 3FQRA 3B7UX 3NCYS 3X1FA 3ZRFC 1MJ8H 4W9CC 6PCYA 5EA0L 2H2PC 4DW2H 1MNUL 1C5DA 1UM4L 1UB5B 3WTYA 2XN9D 4L8BA 4X6FB 5CMAA 2KLTA 3HBPA 4KX7A 2BNUA 2K6YA 5EORL 1XCQB 1ZMYA 4QAWA 2OAAA 4JG1L 1PZ3A 5EBWA 2FX8L 1NGXA 5F9JA 5HI5D 2IPUK 1AMXA 2DQUH 4KKCC 4WRLA 3T3MF 4F9PC 1R3HB 2DKUA 4AEHH 2AGJL 1XWVA 3IF1A 2XFXB 4NNYB 3DURA 1GIGL 3TBCA 4RFNB 3II1A 5EO0B 2D31B 2KL6A 4F92B 1NFDE 3G6DH 1HX0A 5HJGA 3RJDA 2CLVA 3BWSA 5AWNH 3ZYIA 2QR0A 3H85A 5EU3A 1TZGH 2PTVA 1I7TA 1KF9B 3L3OA 4V1DE 1N8OE 5I1GL 4PFEA 4PJHB 1S7RA 3IGLA 1E9QA 4F8LA 1HSAA 2JI1A 1RVFL 5DCCA 3JVGA 1NC4A 5AVVB 4JQXA 4ZUSB 3EGXB 2C9XA 3D5OF 2I24N 3ESPA 4W70A 4GG6B 4FQLL 2VT0A 4N87A 2V3EA 5E8DL 4FL4C 1QHPA 5E2WL 4YSOA 2V4LA 2C9QA 2WTOA 1JRHI 2BY1A 5BQDA 1A6UL 2FEDD 2GI7A 3EJZD 5AOLA 4U6YA 4L3AA 1QKZH 1ZT7B 2UUDH 2FBJH 2V5SA 2BS9A 4G43B 3AY4A 1NCDH 2FLBT 2HX9A 5T5NF 1RZ8A 1MCBA 4JFEB 3BPLB 1Z9PA 3QORC 3CH8A 2D03H 1PVHA 5GGSB 5HDBB 4LPWA 4JPIB 1INEH 3O4OB 5DJ8B 1RMFH 4W4OA 5BPPA 1OO2A 5EZOH 3ROOB 2WBKA 4P2YA 1GS8A 1OCCB 2HVKB 4MNGE 1YYCA 4UNIA 1WUNT 4PMEA 4OD1H 1TLMA 5IIEB 6FABH 2ERJB 4GQQA 3CZUB 4I85A 1A4JB 3TURA 4UCFA 3BN9D 3FBKA 3U6XS 4JN2B 5TQ0H 5D70H 2OXHB 2O6DA 3LQAC 4IBSA 4XXCA 1BF2A 1O9ZA 3AWEA 3H4HA 1NAKL 2IEPA 4WTZG 3VVWA 4BWWA 5INDB 4HK0A 3VYOA 4HF5H 1K5WA 3A6BL 4CADB 1E8ZA 4FKHA 5KWYC 4EMZA 5GGTH 4NAMA 1OCRB 1GS6X 3MODH 3DJRA 1TEGA 1MXGA 2NMSA 4Y19A 1UA3A 3JTTB 1XH3A 2DH3A 5DMKA 1T2QH 4WFFE 3C8DA 4XNQA 3DIFB 1BFOB 4KQ4H 3MC0A 1GXEA 3BRFA 1PFOA 2Y69B 3X3FL 3DO3A 4KKAD 1JPGA 3ULSA 2YJQA 4BZ1L 1AYOA 3DGDA 3LNHA 5F7EH 4FTVE 5J6HA 5DJXA 5EO1B 2VERN 2NW3A 4DO5A 4O5LL 4LBAA 5FUCE 1A9VA 3RWCB 4HW6A 2WSDA 1BYNA 1E5BA 4G9FE 1BIIA 2ODIA 2WKOA 4YGVB 4H8HA 1BVLB 3QT2A 4YFDB 3TOPA 1HINH 5A2CA 3RTQC 5I75B 4WFED 2OJ1A 1M05B 2PTTA 2M26A 4ZW8A 1YZZA 2JQAA 3AREC 3OX8B 4GIPD 5D72L 3KLLA 3R06B 2BSRA 3IU4L 4NN5B 1E5AA 1YPZE 3BPCB 1OSZB 3DXAD 2WLZA 5CINL 5HSFA 2I5YH 3OF6A 1XGPA 5FFGA 5HDWA 4HPYH 2WQUA 1BXAA 5DJAB 3UMNA 3DO7B 4KRLB 3T0DA 3CFKA 5IVOA 3UGXA 4HX1A 4JFQA 5LXGH 3LEYH 5AW1B 4Z78B 3BFQG 1YUKB 4WNJA 1AHKA 4GKNB 1WWWX 1FVDB 2XZAL 2L8AA 3GHEH 5C7ZA 3MCYA 3SOTA 3B7YA 1XSKA 3R18A 4A7TA 2K4WA 4H2AA 2GYSA 3TESA 1BBDL 2FJUB 3VNZA 4B9IA 1A02N 4E41A 4PJ9D 3BVNB 4PN6A 4TNWF 4WI2A 1FC2D 4NQSA 3DXAB 4DP8X 3TNMB 3C60D 3NH7L 1YRKA 2CXGA 1NTDA 2FECI 4HEME 2WLYA 1U8LB 1AR1D 1OAUH 3JWNG 4JB9H 4PLJD 5ADOH 5FUCC 2YN3A 4WJKB 3F8UB 4NAJA 3UJIH 3EDFA 3KLSA 2XY2A 3F7VA 3U4AA 4X6CF 4QJ5B 3V4VA 4IKKA 5LBSH 4PJCF 1PD0A 5ELIA 3S88L 4C56E 3D9AH 1N3NB 3ARYA 2Y3AA 3N42F 3GGWB 3Q8BA 4KJYA 3ZE1E 4GW4B 4HOZA 3V95A 4HD9A 3T65B 4K55A 1GGCH 4HBQA 1ET8A 5AB1A 2B9AA 5DS2A 4PJ9B 1E28A 4C8XA 2CPCA 3C60B 1T83A 4LEOA 1TG8A 3L1OH 2DQ6A 4Z3JA 3V9CA 1AR1B 2BNQD 4FNPA 3IDJB 4F7KA 5A6LA 2Z1KA 3E2HC 5IMLA 2CO6A 1UHVA 3RVUD 1QPKA 2ITCA 1RIHL 4LLQB 1NGZA 3SEPA 1FVEA 2E7HA 2O5NA 3FRUB 1NLBL 2WPGA 4HS3B 4I3GA 3QFGA 4PG2A 5DJDB 5K1NA 3M8OL 4W93A 4LIQL 3V4PL 4OZHE 4ZMNA 3FNKA 1NA8A 2AXGA 2BWIA 3DVGA 4JGMA 4Z6AT 5IB4B 3DHUA 4BHUA 4NQDD 2GEEA 5CJQL 2V7HB 1GA2A 1DYZA 2BNQB 4RGOH 2WZ5A 3FB5B 4P4KA 7PAZA 3R8BB 3M07A 1NMBL 3APDA 5EV7A 4MA1C 3GS0A 1AG0A 2NNRA 1WFJA 4UQ2A 1N9PA 1PY9A 3C6LD 4WO0A 2R1WB 3VFPA 1UACH 4I1NB 1B4LA 4H26B 4ODUA 3VXPB 4R8WH 3B9VA 4MA8H 1FGVH 3EH5B 2IFFH 4K3EL 4MJ5B 4ORGB 4Y4FD 1CBVL 4OM1L 3WENA 5L88L 3EJRA 2AQ2A 2XPYA 3W0WE 1MCWM 2FE0A 1OAZL 3OKDA 1WLHA 2BOBA 3GLDA 4DKTA 2CDGB 3L3GA 5IEHA 5FM5M 3SJVE 2QPFA 2JCCF 3TFBA 5CLWA 1RI8A 4PLKC 3QDMA 2VKXA 3WEXB 1IGIH 1GZHA 3VI3E 3ARFA 3WS3B 4Q9RH 4PWJA 3D69A 4UINH 2NSXA 4Q9QH 4AXWB 5I8KH 5HPMB 4Y4FB 4A68A 5FPIA 4F58H 3ZIYA 1BXUA 5IWLC 3HRZC 3HFMH 4XNBA 4NO2B 3O6LH 2YD2A 1WZ1H 4NKIH 3ZTJG 4OTXL 4HGWB 2FBRA 5DZLA 4I3SH 5J6GB 4MA3A 1HHJB 1OTUD 3BHBA 4NBZB 2AEPL 4UDTB 3U36A 2Q87A 4LKXB 4M1DL 1OGAA 1NEPA 4X9FA 2HUHA 1A1OA 4HMEA 4U6VL 1CD0A 3A24A 4QRRA 4WV1B 4OVVA 1FNSL 1FO0A 4B6ZA 3HG1E 2EYSB 2BRQA 2Y7SA 5A2IH 1NKRA 4U1HA 5HHOE 4DGIL 4OLWL 1PW3A 25C8L 4O2CA 3WNOA 5ABDE 3P2TA 1YY8B 1CLYH 2YN5A 1IE5A 2VSDA 4WSGA 4F5CE 3TIDB 4ATTA 3IN0A 2WYIA 2VZ1A 4M7LT 3VXNA 1ES0A 5B3JE 3TLRA 2K45A 3BIAX 3CK0L 3AFLA 4KKRA 4L1HA 2Y23A 1RULL 4ZO7A 3EOBB 3T4AB 2F54B 4DFHA 3AGVA 4W9KC 2XZQL 5B4MD 3V55A 1GC1C 4LVHC 3X13A 2Y2WA 4OFYA 1BVNP 3MV7E 2ARJQ 1UXWA 1YN7B 1HL8A 2HFFB 4LOFA 1KUMA 4G9DB 5GS3A 3NEEA 4ZO9A 2VMDA 3CZJA 4NHCH 4PJXA 5F9OL 3V5HB 4AKPA 2VISA 1I9JL 1NIFA 1R5WA 4NENB 1LXMA 3IDXL 3O6FC 1HKLL 1AZBA 3T5WA 3CHQA 5BV7L 1CT8A 4B3EA 3DOSB 4OFDA 3PXHA 5CKAA 2IPTL 2KT6A 2EXWC 2MQGA 4Y2DA 4YL9A 4F3FB 2XKUA 5DJ6B 4Z77B 2XWTA 4FXGB 1T4KA 5IROD 2Y7NA 5G55A 3TVMD 2DI8A 3Q1SL 2M83A 3NZHH 2XYCA 1JCVA 3ESMA 4JRFA 1A2YB 1YNKH 3LTVA 4D8PB 3IRZA 3CHPA 5F1SA 2H9GA 4M61B 1CXLA 1HXYA 3PJSB 2AJXH 4UIMA 1RJLB 2JTDA 4XCNA 4JRXE 1IT9L 4X8CA 1CU4H 3ZDYE 4B96A 4BFKA 1BJ8A 1EDQA 4ES8A 1U30A 1L0QA 3T0BA 2VL5B 4KTEH 1YC7A 4M1GH 2KHAA 3FO9B 4KXAA 3MLTA 4X4XB 1NFIA 3CE1A 3C75A 4JDTH 3CVHB 3UACA 5FECB 3TVMB 1XXDC 4PRDA 3QJUB 3RX5A 2A73B 1VKXA 3TN0D 2CM5A 3FMGL 1RD6A 4KV5E 4TPRH 5AVWB 4XMWA 1L6ZA 2EH7H 4NERA 1AI1L 2X0WA 3HJEA 4UI2A 3RIKA 1P5UC 3WE6A 4JDZA 3FF7A 5FYLD 5T1DL 1EERB 3QUXA 3RWGB 5C07A 4HC1L 1HILA 4R7DA 3TJEL 4UQ3A 1KT2A 1M4KA 3O8XA 3SGDH 4HIJB 3RNKB 2D4FA 1DQLH 4MD5A 1S46A 3ZYJA 1F8TH 1H0DA 2OP4L 3E3QE 4GSQA 2YKKA 5IQ7H 2WBWB 3I74A 5ETUB 4HA1A 2AK4A 3T09A 2DQFA 1XQ4A 3TN0B 4LO9A 5JLZA 5ICZB 1QBAA 2RGSA 4XPFH 3D85A 1FFNB 4UOW1 3QIUC 1OPGH 3BAXA 1C9SA 4J3XA 2E7LA 1AXSA 4HWBA 3EJCA 2EICA 2HWZL 2VWEE 2V17H 3B7RL 3MTRA 4Y5VB 3UROR 1CXKA 2MEJB 5T3ZE 2VM3A 1XZ0A 2Y5TA 1PEWA 4QLRA 4BRVA 2AEQL 3HKZA 2Z31D 4JPKL 3TXAA 1NJ9A 1DUZB 1AZVA 3LB6C 3JWNC 3MCG1 3ECQA 3M17B 4MJIB 1X5AA 4J8RB 4G7YH 3WSQH 1SMDA 3GJFK 4RRPG 4LNRA 3UZEC 5E6YA 4FYRA 4XP9L 1E2ZA 2KDYA 2L7EA 3EJUA 4V2BA 4ZXBD 2C9RA 3KPOB 5TE7L 3LN5B 1YECL 3G7TA 1XB8A 2WXJA 3K2IA 3MA9L 4ODWA 5SWSD 3DV4A 4ZMAT 5JW4N 4PJDA 3MV8E 1FN4A 1GR7A 1CD1A 3CMOH 2QKIB 5TGBA 2MTAA 1KYOK 4JKKA 1BX2B 1G9HA 1PFCA 2Z31B 4TSCH 3X14A 4ZFOB 4WUKL 3E3QC 5ANMA 2QVMA 4HH9B 2Y5EA 5GRJH 5LB1A 2HT2C 3K1KC 4NM4L 5CEZE 2IH9A 4XCEA 1R24A 3QRGH 1BLNB 4PJEB 2PWGA 1JTTA 2EH8H 3NFPA 3V9FA 4HKZB 2F74B 3NAAH 5EUOA 4H88L 4ZUTA 4CNIA 1YEDA 5TDOA 5I17B 1A1MB 1WZLA 3ATBA 4Z7OF 4DVBB 4LHUD 2AJZA 3NCBB 1QG3A 3COOA 3CSBA 4P8QA 4XH2A 4AQEB 4H1LG 1K8IA 3SE9L 5IW6B 2ETWA 1IVTA 4K8RC 3TH2T 5SWSB 2DY2A 4MD4A 4PHZA 3UXFA 4KXDA 2LE9A 3GXUB 4NQXA 1MHPL 2B1OA 3V4VL 4D8OA 1XVSA 5EBLB 3AC0A 1JFQH 4YMPA 5F3BB 3EYOA 1VHPA 4O58L 5E4OA 4HH8A 4HDIB 1F6AA 4O4YH 1J5IA 1DUYA 1HI6B 1W6LA 3KGSA 1E4XI 4PGCA 4BKTC 1CLZL 4TNVK 2YUVA 2K1MA 5C6TH 1OAYL 1RUPL 3JQOB 5DRXA 2E0PA 3VGGA 3LRGA 3E7JA 2H4EA 3MCKB 4MKMA 3TBYB 1NGQH 4FXTA 4LHUB 3D3VE 3EXJA 3EADA 1Q9OB 4YSDA 3U0TB 4KK6D 4CSZA 3VMOA 5KSUB 3SDXA 4X4KA 4KZEL 4U6HA 3LNDA 3MXVH 2F7OA 1FI8C 1DL7L 1M57B 3RYMA 1Q0XH 2EDDA 4HCGA 3VQ2C 1BECA 2IAAC 3PIQB 1WSST 2ZT9C 4WHDA 4Z7QE 1GAFL 1SJEB 1DBJL 1XH0A 1KV3A 2ARJA 1MRDH 1HJCA 4URKA 4BQ6A 2F7RA 3PREA 2VLRA 4H8PA 1L9TA 4U2ZA 2DQGH 3BRDA 2EIBA 2KPNA 5D5MB 2IGTA 4OCNC 1C5BH 2NZIA 5E4AA 4PJGA 1ZS8B 1XD0A 1MFMA 2DBLH 2FZ3B 4KZCA 4IS6B 5J9PB 2X9YA 1I8AA 4AKQA 4AJYV 3PHQB 3QQ9C 1C1EH 4MDJA 3U4EA 4DN3H 2XWXA 3EW3B 2B7DT 3NPZB 3PDOA 1FP5A 3T4YB 1XIWC 1VSCA 3Q6FB 2YXWA 5D4JA 1GY2A 2BZDA 4JZOB 1AO7D 3ZSTA 4JM2C 2EDHA 5C97A 5I6PA 4BFBD 3IDIA 5DMYA 5A3IC 1SVZA 3LZFL 2GB2A 3DIDA 5GSVB 4X4ME 1J1OH 2A3TA 2CAKA 2Z93A 1AHWA 5F1IB 3CCHA 3BKYH 2G60L 2VRKA 4DK5A 3O3EB 3HG1D 4QHKJ 2UZYA 4MNHA 4M56A 5L2KA 1V8HA 4NQVA 2D2CC 1JWSA 4YHNA 2UYLA 1CFSA 5AL0A 2WYTA 2R9HC 4HJUA 4J3VA 4DETA 1FZOB 3WJLA 2I25N 4Q56A 1G7PA 3Q2WA 4R26L 3F85A 4ZX4A 3MRRA 4CU6A 1CFQB 2X2YA 4KOBA 3VFTA 2XQBL 5KSBF 1CGVA 1RPKA 4QGYA 1AO7B 5DHYA 1JTPA 2EVJA 3QQ4B 5FO2A 3P4NA 5IY5B 1BD2B 2X3BA 4JE0A 2G9KA 2B5IC 2CIKB 3PAYA 4K94C 4Y2OA 5BVPH 4CW1A 1CDYA 5HXMA 4OLUH 1SDAB 2QDWA 1PKQB 1FG2B 2LLLA 2YUWA 3BGMA 4WKZB 2XG4B 3O11A 4H8WC 4XC1L 3TWCH 4U1KB 1PY0A 3BSZH 1R3KB 3ETBF 2O6EA 3LS4L 1YJDC 3L1FA 4HAGA 4JO2H 4O2FB 4ZODA 5D93C 1AYRA 1KJ3H 1N5AB 5KVGE 1F41A 2MHAB 1OANA 4GW5A 2IGLA 1MFEH 3GIZL 1WA1X 3H42H 4Q6KA 4TQIA 5KYXB 2AI0H 3EYVB 4PTUB 4XP1L 3VTAA 5GZOA 3OQRA 3C5SA 2CHXA 1JVKA 5C09A 4XWOD 2BIMA 4Z23A 5D6CB 2GQHA 4UOZA 5FGCB 4BD4A 1MHEB 2R0WL 2J2ZA 3OKEA 8PAZA 1SEQL 2NY4C 2V7NB 2P8MA 3VXME 2GTWB 2JIXD 1RZIB 4NNXB 4HCIA 5HYQA 4FI6A 3D52A 2RBLA 4GB9A 3LKQB 2PYEB 3ILDA 3KWVA 3UTTD 1VACA 5ID0A 3NBNA 1ZJAA 3QEQA 3BDYH 2GBAA 3KAAA 5HBBA 2DLGA 2MPAL 3HI1A 1YO4A 2ZP8A 3KCWA 1LK2A 3P4OA 1DBAH 2JMRA 3C9NB 4YQXL 1BZ9B 5GRYA 5FK9A 3M45A 2NLJA 1WAAE 1E30A 3F12A 3X1EA 4ETQB 1TOXA 1D5ZB 4PJIE 3ZRCC 3GPEA 3UG3A 2B4CL 1CGXA 2C26A 3MNWB 4X5QA 5DZJA 1Q1JH 3PWPA 2OL3H 4UWQB 3Q3GA 2NTSP 3C5ZC 3JWDH 1CG9B 1RSYA 5EU6D 2JIXB 1NICA 5FYJU 4YFLF 4D0DA 5KJRL 4XAWL 4XVJL 5IB3A 4FXLA 1BW8A 5L6YL 3DMMD 1BCIA 4PJFE 2AJ3A 2VE6A 3FUNA 3WKMH 3OAYH 3L3JB 1T1YB 3ZKXC 2F7IA 1MW1A 2X4PB 3OHXB 3LKSB 4ZQKA 4CRPA 3O3AB 2DL9A 4OLEA 1NCNA 2J5LB 4ZK8A 4I0PA 3VWJC 5IEKB 1ZGLM 3TBBA 3MJGX 4QOKE 3B34A 1U33A 1PNDA 3NRFA 3NJJA 4L9LC 2OTUA 3WKNA 5E5LA 4LASL 4BK5A 3OKOB 5H37G 3DUSA 3RUGA 5C0CE 5LGJB 4AQZA 4J1UA 3P4MA 4G11A 3CJJA 2HLAB 3IDNA 4EZKA 2RFXA 5EU6B 2Q76A 1RJZB 2DWDB 2VLME 2VN7A 1G7IA 3D4CA 3OHMB 1UZGA 4JPWH 4QHLB 4ZJ9A 3T2NH 4DPAX 1RAMA 3M7FB 3T0VA 2IG2H 2X4UB 3QHFL 4N2CA 3BEVA 3FO0L 3MNVA 3KPLB 2Y25A 2X9ZA 3STZB 2QGDA 1YNTF 2BSDA 4HJ1A 4MNQB 2JKWA 2X4RB 3BKML 3MPCA 3E8VA 4XWGH 5EHFA 3TA3C 3LRLA 2GUYA 2ADIA 2M8XA 1T0PB 3F01A 5DZAA 3TT3L 4QRPE 2ICWJ 1Z3GL 1MUJA 3DJZA 2OJZH 3GNMH 4RDQG 4FJ6A 2L7QA 4M03A 3ORJA 3AACA 1TFPA 4JHWL 4JQVC 4I7ZC 5DRZB 3GYRA 4KNQA 1KCRL 2XBTA 4JFZH 3ENEA 1U58A 1TZOA 4HWBL 4X6EB 1REIA 2VDLL 4QXTB 1P84K 4NFCA 4P46D 3BQUA 3OJDB 1WIUA 3IJSA 2G0KA 4TV3A 2UWEA 1TCRB 1JNNL 2BP5M 3RBGA 3POHA 3HLAA 3L5WB 1DLFL 4ZPTB 2V2TB 2ZYIA 4I18B 4M1CD 3D33A 1QR4A 2N7AA 1OLZA 4FI8A 1RUAL 2IDCA 1IL1A 4F7MB 1ZSDB 3HS0A 4YXKH 4ILDA 4DCQA 4U1NB 1T5XA 3WN5A 3K6SA 2WP3O 4UV4L 3DTDA 1MVUA 4JFXA 5GGRA 1MAMH 2DQCL 3EH1A 2H3XC 2XWZA 1N18A 3FU9A 4A2MA 1E3ZA 3M46A 5AYTA 1LL1A 1IC7H 4PRHD 2Y1AA 1P2CB 1RPUA 4P46B 4M7KL 4PJBB 5IFJB 1O7VA 3QUZA 4YE0A 1EXUA 5JIIA 3K6FA 4Q52A 2UZXA 4OT1H 4GO9A 3KEHA 4K7FA 4Y1SA 4UQIM 4XNZB 4B7LA 1HQRA 1T7ZA 4P3DB 3EJYD 3WS6A 3MRFB 1NM9A 3PL6C 3THMH 1XL4A 5E1AB 5AUMB 2ZOLA 4JKNA 3KBPA 1QLEL 4OF3A 4NQTA 3FHEA 2OI9B 4C55A 3I75B 4QRFA 2Z92B 5E99L 4MXQC 3GSUA 2OW6A 2YMTA 1N4XH 2J21A 5E9DD 3VRLF 1OKEA 1SM3L 4FC3E 4KHTH 3LKPA 4OJDH 1KB3A 2Y36H 3KBFA 3KPRD 4CKQA 3P02A 4OIIH 2BVOB 2VYRE 3R4DA 4L3ED 4MJ4A 4XPTH 5K93A 2AK1H 4WKXA 2ITDA 3NSCA 2E76C 2H6PB 4BFIA 1GGBH 4PRHB 3LKOA 3CVBA 1DVXA 4WI9A 3TA4D 3KYNA 4U1IA 2AV1B 3EYUL 4OZGF 3MV9E 1ITCA 4S11A 3SZ6A 2ZWSA 1UWGH 3RKDD 5EOCJ 4A2LA 3DC0A 4KO6A 5KEZA 3NTCH 4LDLB 2VCOA 3HZMB 1P7QD 3U46B 3SD2A 4L37A 4HCRA 3QPXH 4WFHD 5JQHC 5IHUL 3PP4L 1CGYA 2X0UA 5CGTA 1AGEA 4GI8A 4OAWA 1WA2X 5GIRA 4I77H 3HNTH 5E6IA 1SVCP 2ZOUA 3KPRB 2D9CA 4OZIF 4L0PB 2MCG1 4MBOA 4L3EB 3GMRB 5DZVA 3CZSA 2QJDA 1CR9H 3UZVA 3HZKA 5JORA 4WW2B 4M9OA 2GBUA 3PGDB 2EEAA 1LDSA 1HU8A 5KAQF 2CGRL 2X7LA 4I0KA 3TT1H 4DN4H 3WYRA 4BUQA 3NDZE 4EI6A 1TJGH 5IVNA 2XJLA 1FZKB 3RWJA 2Q5BA 1P7QB 3DYPA 1VGKA 1OSPH 1SY6H 1JRHL 3PWNA 3VXQB 2CJ3A 1PPIA 2P80D 3RNQB 3VFOB 3KM1A 2X6UA 4OLZH 4WWKA 3L4ZA 2ZG3A 3S3PA 4EN3D 1Q8MA 3NJNA 3CSPA 4BDVB 4NUMA 4LSPL 4UT6A 2GUOB 2YQ2A 3KPSD 4BUGA 3BUYA 5J7CC 2IDQA 4YDLC 2BXZA 2LU5A 3QUKB 4AIZB 4YIQB 1IEBB 3VXRD 4HQQL 4M6NH 4JVWA 1FFOA 2VQ1B 3RVWD 3T0WA 4J6RL 2QPDB 5E5RB 2NUTA 2OTWB 3UO1L 2WLLB 3W5MA 1MFUA 1E4KC 1QLFB 2DM7A 1C7TA 1P1ZB 1ZTMA 1OARL 4WK0B 1Q72L 3RL2A 1EZVX 2W1NA 1JV5B 1DQML 3SDAB 4AZUA 1X9QA 5DD0L 4RWYL 1K8DB 4PRBB 2HTLD 1SYSA 4EN3B 3DPBA 3CWGA 3DO4A 3KPSB 1KJMB 3SPCA 2Z1PA 3J8F7 4IRJD 1D5MB 4XXDB 4L8DA 4JFEE 1UWYA 3FO1A 3M1BA 3QG6A 5F7DB 1U8KB 5H2BB 1A6PA 5EBGA 3LPFA 3ME0B 1MCQA 4DT2A 3ATAA 2WQSA 4TVUA 1OWWA 3VXRB 1JWMA 5KW9L 2P8PA 1GSMA 5HY9B 4NKDA 4RA3A 3VW3H 2CU9A 3QRLA 4APQA 1FUNA 3BT2H 3EOAA 4I48A 2X6CA 1F3DJ 4YPJA 4NRYB 1A7NL 4KTDH 3UTSA 1ZDQA 2B16A 1E3FA 3S96A 1JYVA 5AOMA 5FA3A 4LBEA 1UOKA 3MU3A 4NGHH 4HUVA 1CIDA 4KKBC 3G5YA 1NMCB 3HHSB 3V4PB 5HDRA 4FG6D 2ZZUT 2MWCA 3FAWA 1DFXA 2MOQA 5GHWH 2JJWA 1LJMA 1SFHA 2VC2L 1TCMA 1YEIH 4TNGA 1NSNH 1U93A 2VLKE 3CC5A 3CFCL 2OYLA 5IGXL 4LSTL 2H47C 4GP8B 2EXYC 2ODHA 3QYCA 4JFHE 4L5FL 2NY2C 4YHYB 2HKHL 1KXQE 1QYGH 3MRBA 4JRYB 2OMWB 4C57C 1UJ3B 5DVKA 2IWKA 4G6ML 4X7TA 5EUOF 2WUBL 4HLZH 5C9JB 2VW6A 1CE6B 1J9QA 4DGWC 3SGDI 3K1DA 1JWUB 3T77B 2VIRB 4OF7A 3LHPL 1UB6A 3X2QB 1H3WM 4HJIA 1IAIM 3O45A 1VA9A 3MHZA 4PB0L 1QSFA 1U8CA 1TJHH 2Y06H 1I31A 1LEGB 2JH2A 4J8QA 3UAAA 3HC0A 3TYGH 1NGYA 1OL0A 2AQQA 4MAYD 5FFOA 4BYHA 4ZW3A 4PS7A 2BMKB 15C8H 1DZBA 2F18A 2VDOH 1B4RA 1LP9B 5EOQL 1C12B 3ZTEA 4NQQA 5EN2A 4Y1AE 1CGWA 3ALPA 2FECL 3LH9A 1F6FB 1CGSH 4JO8A 4MD0B 3VH8A 2WXKA 1SXZA 5AZ2L 3REVB 2FR4A 4AIEA 4JKPL 2WXMA 4MXWL 5DJYA 1MRFL 4JZJA 3VD4A 1SN5A 1IFHH 3S37L 3PNWA 2WLIA 5GGVL 1E6JL 4W9DC 4BCXA 5KS9B 5HHPB 1N64H 3C08H 1AC6A 3MLZH 2H6OA 4HKBA 5JIHA 3VA6A 5KJ7E 3VWKA 3TF4A 2E5EA 3H7BB 4Y4HC 2A5UA 4X4YB 5B1JC 3QH3B 2VJ0A 4MAYB 2NT0A 3FQRB 2J7LA 2ZX9A 1G1OA 3JBG7 2DMCA 3BUQA 1UFUA 4LF3A 1C5DB 4I5BB 4FGMA 3B9AA 4XX1G 5E4IA 3OM3B 5EU5B 4L8BB 2W9LA 4OZFG 1HT6A 3FFDA 2Y72A 4ENED 2BNUB 4GYBA 2ZUQB 2I60H 1CURA 4S0HA 5I18L 1VFMA 3N41B 4ADGA 1FDLH 4EDWL 4AQ1A 1NFKA 5EBWB 2RACA 1NGXB 4KVCH 5C0AD 4QEGA 2OX5A 1BZ7A 3IF1B 2Z65C 3DURB 3GRBA 4KZ0A 4EDXA 5C0IA 4KUZL 3B5GA 3FHQA 4Z9KB 3EOTL 2VXQA 2IBZX 5G4OA 1AAJA 2CLVB 2HKFH 2QR0B 3FUMA 3NMEA 4N1HB 5EU3B 3WEAA 3HLKA 3TO2A 1KEGH 4LSQH 3QPKA 1KTCA 2XN1A 1R5IA 1A6WL 5BV7B 3II3A 1E9QB 1HSAB 1S7TB 2DS4A 4QIRA 2FO4A 4ZTEA 2FGZA 1NC4B 1P6AB 4XVOA 3V0WL 2MQCA 4MQXD 1G1KA 4FE9A 1HAUA 1IM9A 3B2VL 4XCFL 4OQTH 5C0AB 1EVUA 3SE8H 2WXGA 5IMMA 4GUPA 4JS7A 1KPRA 2Q9OA 4MLIA 4U6YB 4UZSA 4RSVA 3WFHA 4BM7A 4JNXA 1J5OL 2DOCA 3QCTL 4LLWA 5KANG 4JG0L 5C7XH 3TS8A 1RZ8B 3RIFF 5BRPA 3QSKB 1BQ5A 2ZOWA 4M7LL 1URZA 5JIQA 3D7PA 2IGFH 2FB4H 3GRWH 2R4SH 4XNUL 4OFKA 1MFAH 3FO2A 5FV2A 3EO1B 1BXVA 1XSOA 3UCRA 1D6VL 2UZIL 1BMGA 3L4YA 4MRCA 3O6KH 1NCWL 4NQEE 4P5TA 3CDYA 3EYQC 3WE1A 4FNLH 4JDEB 4CGUB 4PPTA 3IMWA 4N9OB 2LW3A 1HE7A 3IYLW 1XCWA 3I02A 3HUJA 5J13B 5E8NA 3L4VA 1WD8A 3GFUA 1KJ2H 1KN2L 4KHXL 3OZ9H 1HEHC 3ZDXB 3GS7A 1EDYA 4HK0B 3MRMA 2IQ9H 4RAHA 1CS6A 1AR1C 1G7HB 2OZNA 5KTEL 1CI5A 2E9WA 4OLXH 4M48H 4PW4A 4Y19B 1XH3B 2X4TA 5DMKB 3BFOA 1F2XK 2A77L 5FB8A 4XNQB 2B39A 5JQ6H 2OLDA 4I2XE 4XO8A 5SV4A 3OF6D 5EFIA 3SYPA 1I82A 3E9TA 1KN4H 1P4LA 3C09C 3K2UL 4TF4A 3ULSB 5JW5B 4TUUA 4HCRL 3FH5A 2ORBL 4WEUD 4X6BA 1F90H 5DJXB 2NW3B 4PBWD 4F9LA 3GS4A 3H3BC 5DWUH 1D7CA 4PBVC 3OL2A 4LRIC 4ODHL 4EQ2A 4E9WA 2FNWA 3GK8L 1JXJA 3Q2VA 4GH7B 4KI5E 1EXHA 4Z7NB 2LR4A 1T22A 4Y16A 4Q0XH 3IKKA 4LCWE 3S36H 5GGTA 4CSTA 3MSPA 2PTTB 3QJSB 2ZP0T 1H6TA 1S78D 1RZKC 2PABA 4E41D 4OD2A 1QVOA 5CCKL 3H9SD 2BSRB 1EJOH 5G5DA 4JN1H 5JW4M 1IMHC 3HE6A 5EEWA 4YX2L 3EDDA 3HB3C 3IFLH 4JJ5A 1JMZA 4PWKA 3SN6N 4DOHE 4F2FA 5I0VA 3VFUB 4CBZA 2LU7A 2VUYA 3ZE2F 2Y6SC 3CFKB 4L3CA 3TBWA 2VGLM 3MBEA 4HX1B 1XO8A 4JFQB 5DFAA 5DSCA 3QCVH 4PVMA 3N04A 4XBPA 3LS5L 1RZFL 5FX3A 2NY5L 3VXSE 1AS7A 1KBPA 4J5VA 4UT6L 5HJBA 2XQYG 5FF6B 3WTTA 1A7QH 1ZEAH 3DUHA 4ZMQA 4DK3A 3QWNA 3FU6A 1DQQA 4YSSA 4E41B 2GHWB 2GBVA 1B0WA 2IC2A 4R84A 1I4FA 4LMQE 4QTIH 2Z3FA 5I0YA 5HHNA 4NQSB 3LQAH 3OBAA 1C7SA 1E4WL 2AQRA 1QSEA 3H9ZA 1TNMA 1I1YA 3OG6B 4L4JA 5IVXB 5J57B 4DVRL 2P24A 4IKLA 4APXA 3TONA 5DO2D 5E4EB 5E6ZA 1OGSA 1GMIA 5DZNA 4KI5C 3F7VB 4WSJA 2YA1A 4HLEA 3V4VB 2OQJA 1LO3L 5JHDE 3S37X 1OT4A 4KJYB 2GJ6A 3QO0B 4A2HA 4Z7AA 2CUIA 3GF8A 5E2TH 1AQKH 1LMKA 3KPQB 3L1EA 5GGQH 1E28B 2MRYA 2F61A 4PRPA 3VB8A 3ZL4L 4RNRA 4LEOB 1CQYA 1BA9A 2QVFB 3A6CL 3QIWA 2VDQH 3I6SA 4P4KD 3ULUE 1B4JL 5IMLB 5I0ZA 2F9BT 1JE6A 1P84J 2YAPA 3NCJL 1G7LA 1I9RH 2ITCB 2G3NA 3IMSA 5I6MA 1NGZB 5FHAL 2D0FA 2ADJB 3BZFA 3ULVE 2FLMA 1IZJA 5LBSA 4FZ8H 1ETJA 3QDJE 4XVSH 2MIZA 3EZJB 2YLHA 3RX8A 2GT9B 4Y4KA 1FZMA 5T5NG 2B1HH 2DQEH 3CBKB 3QK0A 2AXGB 4P49A 4YXLL 4BK4A 3DVGB 5ADPH 4NJAL 1FL6B 1W8EA 3VI4A 2OR9H 2EDJA 1XB3A 1FHGA 3MFGB 2B59B 2A6KA 2UY7A 3QDMD 3HR5A 4P4KB 2FHCA 5ALBL 2F2HA 3WEOA 3HN3A 3GXNA 3DHMA 4UF7C 2YWZA 4WFGD 4ZUVA 5HYSA 4UQ2B 3ARFD 1PYWA 1BVOA 1HYSD 4K3DH 2QQKL 4UILH 3VFPB 5DYOA 4ODUB 3FU3A 3PFUA 3SIKA 3BYTA 3IM1A 3F84A 1YUHA 1GZQA 4UAOC 1TQTA 1ODAA 3HZVA 4CJ0A 4X8JA 2BOBB 3OQ3B 1JGVH 5IEHB 2K8MA 3L3GB 5TPWH 2AJVH 1NLDL 2FH8A 3CUPA 2B3RA 2EUVA 2DEYX 2PPAA 4JJHA 4WO4C 3ULUC 3JTBA 4QNPF 4PCTA 4NN7C 3QDMB 1BAFH 1A7PH 1PZDA 4MJIE 4UOW0 2ROYA 3ARPA 2R2HA 3ARFB 1R3LA 3H3PL 3LKNA 5IFHH 2Y1VA 3Q8EA 3ULVC 3D69B 4JGJA 3K46A 2UV3A 4X7CC 4X7DC 4N2DA 3NPSC 3LMJH 4QDGA 2K6WA 5CN1A 4XBMA 5IMOA 4LLVA 2B0SH 4OD3H 4NAQA 1MJUL 5LQBH 3S35X 1V55B 1KCWA 3GKWH 4MA3B