3WGUB

Crystal structure of a na+-bound na+,k+-atpase preceding the e1p state without oligomycin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
303
structure length
303
Chain Sequence
b'MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
rcsb
molecule tags Hydrolase/transport protein
total genus 60
structure length 303
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3wguB00
5AVSB 5AW5B 2ZXEB 5AVYB 4HYTB 5AW0B 3WGVB 5AVUB 4RESB 5AVRB 4XE5B 5AVTB 3KDPB 5AW8B 3A3YB 5AW3B 5AW7B 5AW4B 5AW9B 5AW1B 5AW6B 5AVVB 3WGUB 5AVZB 4RETB 5AW2B 5AVWB 5AVXB 5AVQB
chains in the Genus database with same CATH superfamily
5IMLB 4I7ZC 1DSFL 4KJQD 2ENQA 4NHCL 4JRFA 1SXNA 4MD0B 4XMLL 1AGFA 1T6VN 3NZHL 1CF8H 5LCVH 2Y1AA 3GZOA 3B2UC 3MUY1 2DLFH 2ITCA 1BFOA 3QC5X 2VSMB 5BXFB 4YAQB 5HSFA 2V2WA 4ANVA 4L8CA 1P53A 1Q9WB 1IBHA 1XD0A 3FTSA 4FQHA 1HL4A 3JZ7A 4DGVH 4DKAA 1BV8A 1H6UA 4RQQA 5TQ0L 3TTSA 2VDOL 2CMRL 3QZPA 4FF9A 3FT2B 3W5NA 2RCSH 5E99H 2OMUA 2B59A 4HJ0D 3ZKMD 3LB6D 4OD3H 3M45A 3R4RA 1RURL 3FT0A 4RZKA 3DVNB 5DO8A 3T09A 3VFGH 2BPBA 4G83A 4Z1PA 5FOBA 3OD3A 2PNDA 2RMNA 4WI7A 1PD1A 1NCTA 2DJ4A 5FUCE 1TJGH 1F3JB 1W0YT 4NWUH 1ID5I 5CKGA 2FEEL 1LDPL 4ZTOH 5D1ZI 3KGUA 4WWNA 1WPCA 2WLKA 1UASA 3CH1B 1AG0A 3VFTB 1KB5H 5DWPA 2F5BL 2RFXA 1LM8V 5DMKB 2BSSB 2P46B 1ONQA 2W65B 3GSVA 2NNXA 5I71B 2CZNA 2XPYA 1IM9A 4OIFA 2ED6A 2YPLA 2BOBB 5E24E 3TT1L 5DLMH 5K59E 4XC3L 2NXYC 3G08B 2VRKA 3MI6A 2ZWNA 2ICEB 1RPUA 3PGDA 3WY1A 1LLAA 4M4PA 2DW5A 4HX1A 2R29L 1CFTA 1OZUA 2X6CA 3EO9L 1AR1B 3S37L 1CFSA 2K4AA 1E9QB 3VFOA 1SDDA 4NYLA 5BMFL 1O6VA 1FVDB 2FK9A 4G5AA 5KVEH 3B56A 2FWUA 5I6XB 3N1GC 2AK1L 1MFDH 2R56L 3U4EB 2NY0B 5D4QA 1A14H 1XV8A 4OLUL 5CWSA 4DKFL 3CZSA 4R7NA 2QSTA 4XOBA 1N6UA 5E9DB 3MXVH 3QIBB 4NQSA 4WI2A 3ZDYB 3QHZH 5ID1B 1JZGA 2I5YH 3EGDB 3DURB 5MEPA 3VXMD 15C8H 2V3EA 3S4SA 1S8DA 2WLIB 2X70A 2JK5A 4CRPA 5IUSA 2BHZA 1V7ML 3QWOB 4MZIA 2HX9A 4I5BB 3MV9D 5LLIC 3HHMA 4JLRB 4FFYH 4UAOB 2ZOKA 4AEHH 2X2YA 3EBAA 2C3HA 4DH2A 1X7TA 1F3DH 2QR0A 2VR6A 5T1DL 1A25A 1GGUA 2XACC 1TKWA 3HB3B 1GY1A 5KSVB 4UQ2B 3ERXA 4M93C 4X80L 4NGHL 3RWGA 4OB5L 1YDPA 3WFDH 1ZOXA 1ZV9A 4G9FA 2VABA 1UEYA 1R0AL 4O2FB 4PJ6A 3GSRA 3QP3A 4AH2B 1TJIH 4LAQH 5HJ3B 3PY9A 3ORJA 3FO0H 1CE1H 5D2NE 4Z7UF 4KRPD 3IMVA 4A2DA 5ALBL 5GS1B 5JHLA 4E41A 1CS6A 2GSIB 2QLYA 4Y1AA 3SBQA 4XPFL 4FL4B 5TF1L 2P5EE 3QDMA 4HOXA 5IY5B 1Q0YH 3LN4A 4HIEB 4I0PD 4MAUL 1JF1B 4ZODA 5E6SB 4QY8B 4F8PA 1B3IA 1NAMH 5FV1L 5ESVB 5I0VA 2CO7B 3C6LD 4S10A 5DD0H 3KPPA 5CCKL 3NCYP 2Z91B 2VDRH 3PQYB 4JFHD 4A6YA 5D2LE 3LZNA 4IGBB 4Z7WF 4IYKA 5A6IA 4OVUA 3VXRB 3WO4C 3FTWA 2NZ1A 1ANUA 1FDLL 12E8H 1QZNA 2C3VB 3D30A 4NOBA 4PJGE 5GJTL 2Y3NA 3RILA 1M3IA 4XNBA 4EBQH 4L1DA 1N70A 2NY5L 1RSYA 2BWDA 4LOUD 3VFWA 1LEKB 1HH6B 2P8PA 3A67L 3G5VB 3QJOA 4NM8H 1VEPA 3WJMA 4RSVA 2NW3B 2D7TL 4DVBA 5KBMA 5CHNB 2XLLA 4BFJA 4JDTL 1MLCB 5DMGC 3HVDA 4PJ7F 2HKHL 4LHUG 4WHTA 2BIHA 3TIDB 1MVUA 3JZYA 3ARPA 4QWWC 2X4QA 3VXSD 3CZGA 1BYNA 1KBWA 2FQDA 4LSVH 5EIVA 1UM6H 1BMZA 4WLCA 1W72H 4XPBL 3RUGE 4ZYKB 5KSBA 5BCAA 2UWEE 4JMXA 3DOIA 1G9EA 3P9LB 4P2RE 2XZZA 1KC5L 5T5NG 2X3BA 4J6RH 4P07A 3O6FD 3JV5A 4JFOB 3MLYL 3RL2A 4BFNA 4RCAA 3WENA 3IGLA 4KKBC 4P23B 3ZX1A 1B2YA 1CQKA 2Y1YA 4FERA 5DLLA 2NYZA 4UT7L 5KVFL 1K4DB 2FNWA 2XSKA 3PWJA 4EZJA 4N2HA 3LEXB 5DSCA 2YAHA 1OHQA 2X41A 3PJLA 1Q0EA 5H37H 1HL8A 4FLOA 1C12A 3MACL 4NWTH 1L9MA 4ZZFA 3GIZL 3WUWG 3RZWA 5ADPH 1XZWA 4B9ZA 4Q6YA 1HFUA 3T3MF 1AZRA 2ZKXA 2FIRT 4YHNB 2O26U 2O6CA 3ZE1F 2JKNA 3DHMA 2AVFA 5DRNB 3HJEA 5AVXB 3QCTH 1ZV2A 1AIZA 1WFUA 1BZ7B 2N1KA 3CFDB 1UOLA 1XXDC 2WIIA 3OKOA 4PJIA 4ETQA 4WFHE 1J05B 1DQMH 1S7WA 4RAUA 2OW7A 4OCLC 4K9EC 3QEUA 5ETUB 1ACCA 4CADA 4HFUL 1KBGL 4B9IA 5AUMA 2YMXL 4HWBH 4NRYB 4NQVA 1FVEB 5JORA 1L0XA 4PJHA 5E0FA 4FXGC 4GBXB 1T0MA 5E08H 1AVAA 4WI3A 2VW4A 2E3VA 3K8KA 4ZO6A 2VMEA 2APXA 4M7ZB 3VQ2C 1UJ3B 2PTTB 2H0EA 2P4AB 4J2XA 4YJZL 1DJXA 2DQJL 1KPUB 4FXGA 3N1FC 3NACH 1KZQA 3D34A 4H1LG 2VZSA 4Y4HC 4XN2A 2XN0A 4MA8H 5KYWA 2VM4A 4QEGA 1NC2B 2M1KA 4TVUA 5FKPB 2ZYRA 3CFBB 3L3DB 4FN0A 4TNVK 1U8MB 4S11A 1SYSB 1L9PA 2UY6A 2HN7B 2OTWA 2VXTL 2NY4B 4JY4A 2YFOA 4S1DC 3IFOB 3C8HA 3ABKB 2OMTA 4Z3HA 4YC2B 3RWCB 4OD2B 3WELA 2LABA 2KLTA 1GGBL 5F3HB 4FTVB 4YFDB 1GC1H 2QTEA 1D5BB 1CFNB 4MZ2A 1S4IA 2N3JA 2IFFH 3US0A 4WDIA 3EGSA 1P7KB 2ZUVA 3ATEA 3NSYA 4FQQB 3HC0A 4NSKB 3V8CA 3QE5A 4NQTA 1L5GA 1NSNL 2YD7A 4M5ZL 4NAMA 3FTGB 2BNRA 1RUQH 2HVKB 3IK2A 1MCSA 3RVVD 1E4JA 5I6KA 5HDQL 1BBJB 3CZKA 4NBXB 4O02H 1FFNA 2YD4A 3EYSL 2BSCA 1PAMA 3IRPX 4HQQH 1U8LA 2LR4A 4HPYH 1X9LA 3PABB 2RACA 4MA1B 1JSYA 5FECA 3OVUB 3ULUF 1CIDA 4X8JA 4XPAL 4PBWD 3QZNA 4H2CA 2XQYK 1BBDL 4IU2B 5DK0B 1F4WH 3SE4A 2EC9U 3WIHL 3B5HA 2MCAA 1YCSA 3VE0A 1PDKA 3HHRB 3HS8A 2ZF8A 3EG9B 5CEYA 5ID0B 5DT1H 1Z7JA 1J9QA 4NT6B 5BZDA 1KTLA 3RJDA 2OQJB 3QG7H 1KXQA 3D6GA 1NLBL 3BAJA 3NABL 2QGBA 5ITBL 4K3EL 1MFVA 3O2VH 5E6IB 5HDWA 4FXLA 5SX4I 1NUNB 5A16B 3T3PF 1KLGA 2VNCA 3SKMA 4EIBA 3GKWH 3LDBB 4MXQD 1BMWA 1T22B 4XO3A 3HE6B 4M03A 1MREH 4I3SL 4PUBH 2LFGA 4XN5A 4WTZA 1IBZA 4GSUA 4U6VL 2JELH 1ETB1 2WBJB 3V9EA 4B60A 4BGLA 5I5RA 4K8RC 1S5IH 5CN1A 5IJVB 1Z3GL 1NCNA 4MDJA 4P9MH 5AW0B 4X7FC 4CVXB 5JHDA 3SDAB 2AQ1A 5TDNB 3MNWB 4ERSH 4IS6A 4YN3A 4C56E 4KUCD 5TGBB 3BT2L 3HFML 5EORH 1MN4A 5MHSE 2AW2A 1QSFD 3BSHA 1QPXA 2GTWB 2PW1A 3WHXA 3N44B 2EEXA 1JIBA 2ZTBA 3CFCH 4OTXL 5F96L 5HHMB 4CMHC 5T3ZL 5GSVA 5CO1A 5AVZB 1WWWX 3J27A 2FD6L 3BIKA 4D9QE 1U3NA 4YSOA 5HVWA 1T2QL 2X4NB 2QVMA 1S9VA 3V4VL 1I9IL 3IEAA 4HKBB 2WUCL 4HCFA 4WJ5A 3E38A 1V3JA 2XRAL 5CGYD 4X6CA 2FBJH 1I53A 3H0TB 4BUHA 2PCFA 1U8PB 2O5ZL 3UMTA 2X4UA 3LV3B 4MD5A 5CBEA 2ZUQB 4ZQTA 3MCYA 4KNTA 1NMCB 2B0SL 2JQMA 4NQDD 4ELMA 4W9DC 1XCQA 1ZGLB 1T0NB 4N0YL 4RH4A 5JW3H 2K3TA 3MRKB 4IEFB 1N2RB 3VQ1C 4XGZB 2C4FU 4Y0GA 1FNHA 2H3XC 1I1FB 5J6HA 1G7LA 5IGXH 2NSQA 3H4HA 4F58H 2HG5B 3DX9B 3P3SA 4ODTL 3B9KC 5D72H 3UCRA 2W59A 5KW9H 1DHKA 1PX8A 1ZANL 2BNQA 4MQXC 4LMQE 3ZDZB 1ZSDB 3OF6D 2QADB 2W07B 3MJWA 1H3PL 3VXUB 2XPGA 3B9KA 2GFBA 3H8NA 4Y7MA 1TEYA 3LKRB 4K3DL 4TUJA 3RX5A 3BO8B 3HRZB 1CICD 3N06B 4NUQA 1YO4A 4RDQF 3SYCA 4OF6A 3TO4B 1G6VK 1KGIA 1BQHA 5I26A 3MZTA 6CGTA 4ZMOA 1R1CA 2IBZX 3ARFB 3KPSB 4UCFA 1XH0A 2HAZA 2GI0A 3FUMA 4ZS6D 2O93L 2X09A 4XZUA 3HAEA 4GJTB 3KLDA 3CN4A 3FQ1A 1TPXC 3KXFD 3OKEB 4PJCE 2YKLH 3LPWA 4L4TA 4NRZB 1FSKC 1AY1L 1J18A 3VRLE 4Z7QB 4CKQA 1TO5A 3BQUB 1PYWB 1TTAA 2FEEI 2BC4B 4JFFA 4AYSA 5C0BD 3T6QC 2ID5A 5C9KA 2CHZA 4XBEH 4APQB 4P2QA 5I1EH 3V4PB 1I31A 1G87A 3A3YB 5DQJA 4FD0A 5KZCB 1BAFL 4P8QA 4J3TA 1NA8A 4AYFA 1NC4A 5ACZA 1CR9H 2CLVA 1CVRA 1P5VB 4JY6A 1OEZW 5IB2B 5HY9A 4HUKB 2FHCA 4XXDA 1A1MB 4EIZC 2VR3A 4PBVC 4H5SA 4EO5A 5D1QE 1TQCB 2DQFA 5C97A 5DA4A 2WLMA 1IFGA 5EBLB 5ICXB 3RBGA 1M53A 2Y3AA 3BZ5A 4FA7B 5AVUB 4LPTA 2B2XH 3MCKA 3ZKXB 5FUZH 5FO8A 2IH3B 5K39B 2KS0A 3L2NA 5J9PB 5DUPL 1EGJA 1EMTL 1UCBH 3EYFA 2RTTA 3A6CH 4PV9B 1O9WA 3CK0L 3IRCA 5I74B 3ALXA 3O4LA 1E6JL 2UZYA 3ILPB 1NGZA 3OMZA 3UACA 3D18B 2AXWA 3MJ9L 5ITFB 3MLTA 4G7SB 4IRJC 2D7PA 3SDDD 3AU0A 4JFED 5IFJA 1MCEA 4X7EC 2AEPH 4KUZH 1YNLH 4JPIB 3B8YA 4IRJA 1I1AD 1IGTB 3HBQA 1ZVHA 1HH9A 4ABVA 4DETA 3ZKNC 1LO4H 1AKPA 2FO1A 1YSOA 3LXBA 1BM7A 3CDZB 1N26A 4J3WA 1NANI 2F19L 5MEND 4GXFA 3DPBB 2V7NB 3L48A 4Y2DC 1FL6A 4N0UB 4R0LC 2GK0B 3FRPA 5K9QI 1S7VA 4KTGA 1A8ZA 4G9DA 2PYFA 5T33L 3OAUH 5C0AE 1BM3L 2BINA 1LNUA 4GAYB 4Y2DA 4R0LA 1BIHA 4GY4A 3EOAB 3QFJB 4JFDE 5EIIB 3SE9L 4Z8FH 5LB1A 3W2DH 3ASWA 1GYVA 4OGYL 1AQDB 3INUH 4HPOL 4HJSA 1C08B 3HPLA 3C08H 2DRUA 3WCYA 4P46D 1J0JA 4R7DA 4NWUL 1F02I 1MIML 3EH2A 3FB7B 4Q6IB 1NBZB 1W0VA 2NY2C 4JREC 4KZ0A 4JFPA 5TDOA 2IV9A 1B4JL 1AI1L 4PRPE 4WKZA 3D25A 4EUPH 4QR7A 1J5HA 4A68A 4P4RA 4KU1A 4U1MB 2DQDL 3FOLA 1G9NC 1ZA3A 3OTTA 4OZHE 2DM4A 1PG7H 4Z7OE 1HIML 4LAJH 2JTDA 4TQIA 2Y07L 3DMMD 4MJ6B 4OF0A 3UH8A 2IWEA 3FB8A 4PRBB 4ZMZA 2VW6A 4GSRA 5E6YA 1BG9A 2NLJA 2ZD0A 2IBBA 1RK1A 4KMTL 5C09A 4YDJB 3QCUL 3U79A 2HT3D 4YK4B 4DN3L 3V4PL 3IF1B 2AK4E 1AXTH 1IZJA 1EFXD 3DI3B 4NO5B 1I9EA 5E4EC 3UTQA 4ZMTA 4ZS7L 4KY1H 2VLLA 4O58L 2PCPA 3VXQB 1NCUA 2Q8AL 3B3BA 3MRGA 2YD9A 4GO6B 3NJMA 1TJMA 3MCG1 4Z0BL 4PU2A 1OPOA 1NMBL 5L4JA 2PR4L 2BWQA 2AAAA 4PTUA 4W9KC 3ZRCC 4LLVA 4TVPD 3QUYB 2LU5A 3MRNA 5KVGL 2V2TB 3F7QA 3IS1X 1KBBA 4AITA 1NEZB 1QATA 2X2UA 3KGSA 4PAZA 4WNQA 2NDGA 3P9MB 4P5KB 2BS9A 1K5NB 2ZICA 1YEEL 2DQIL 3TA3B 2C9RA 4U2ZA 2GYSA 3QUZB 2XV0A 4EI5C 1GJWA 4XRCA 5I1AA 2AHIA 3FU6A 2IANE 3E8UL 5J1AA 4RA0C 2GPZA 4U7SA 3A23A 2PCYA 3E6HB 1G9MC 1NM4A 3CZLA 4RMVA 3RYMA 3D2UD 3T0EE 2ZWSA 3PU7A 5IVXB 3HPJA 4JCWA 4R83A 1KWKA 4EI5A 2H0PA 4OFPA 3US9A 4X4ZA 4NC1C 3JWDL 2AQRA 1ZHLA 1DVFD 2P8LB 3TPUA 4OZGA 3ZE0B 2F74A 4Y5YB 3JTSA 5BV7C 4J3OC 5AVSB 2FB4L 2FJGB 3RWIB 4RGNC 4XNUH 5L0QB 4HJUA 3RGVB 3VW3H 4LL4A 1BZDA 3FZUD 4WU5B 5L2KE 3I84A 1YECL 4LP4A 4TSAL 3O4OC 3T6XA 1RP9A 1AGDB 5AYTA 2MQ3A 4OM0L 3QWNA 3AU1A 2PCXA 1TFHA 3I6KB 1GR7A 3G6DH 1D5IH 2XJLA 5L2JB 2OYMA 3CFKB 4HUUB 5IB5B 5IHUH 3C2AL 5EN3A 4MB1A 1F8TL 2AI0L 2IPTL 4ODUB 4AT6B 2GITA 4N3TA 4H26B 2EDOA 1QZ1A 2JKRM 3IETB 4XWOC 4H8WC 2NYYC 4W93A 1DVYA 3LKNB 5JIDA 4PP1C 4LSRH 1RUPL 1BYPA 1IC7L 4LSUH 3QXTA 4HBCH 4UDTA 2WD0A 2A77L 3HKFA 1JD9A 4L3EA 5T5FL 4DJMA 4HUWA 1TNMA 2DJMA 3GIVB 1FC1A 3MKKA 4QYOA 5EZOL 4XHJD 3V4LA 2K1MA 3V0VB 3THML 1EZVY 5EN2A 2YBRA 4XPTH 2UVEA 3MFGB 1U8OA 3BSZH 1BFSA 2F9BT 1EDHA 2R9HC 3DLQR 3D51A 5GS2D 4M7KH 5AKTA 4RMWA 5T1JA 3G7TA 4DO6A 1EH9A 2YGVA 1QSED 1N5AA 1MXGA 4JN1H 1XR8A 1XDTT 3ARRA 3QNXA 4C83A 1MKFA 5BOJA 2DQUL 3TCTA 1NAMB 4JQIH 1D5XA 2X4TB 3DX8A 1YHPA 3U4KA 2H7WA 1RJZB 2VDRB 1R5IA 4U1JB 5DEJA 3MOBH 3WDJA 3DTXA 3PV6B 4BZ2H 5AD0B 2ENJA 5K1JA 3ZOAA 5E00A 4RWHA 3H7BB 4I48B 4DNLA 1IM3B 1KXVC 3SKNB 5FF6A 3LIZL 4NQCE 1FBIL 5D2LF 4G1MA 2K9FB 1U58B 2WXFA 5GHWL 3VSTA 1ECYA 1KXVA 4TYUA 5IR1B 5GGRA 4DEPB 8CGTA 1EVUA 1ZK5A 3WTSA 4LOFA 2ARJA 2AQ2A 2Y5QA 2F58H 4G8GD 3QUXC 3KPRA 4UT9H 2FX7L 2EVJA 1YPZE 4XAWH 1WBYB 2KZWA 2XVLA 2XNAA 4NI6A 4QCIB 3UZEC 1OOAA 2CCWA 3MJGX 3OSKA 4F91B 5M95B 1T4KA 1W72B 4ABUA 3G5YA 3D3VD 3QUXA 2X0VA 5D1ZB 3I02B 3ZMRA 2DB8A 1ZGLM 2EYSA 3UZEA 4JO2L 4HU2A 4JPQA 5B7EA 2NZIA 4HUVA 3NCEB 1X44A 5J1TC 4ODBD 1JWUB 4U0RB 3FO1B 3GJEB 1K2DA 4ZTPL 4K4KA 2J43A 3V55A 5HHVL 2VZ3A 2OL3H 1UKQA 4UUJA 4UOZA 3VD4A 3RUGF 3TURA 4BWWA 4Y5VC 5KYYB 4PH8A 3MNZB 1JGEB 1R5VA 2ERJB 3DIFA 1T66D 2WLJA 4IOSD 4FJ6A 4JS7A 3UTPD 3LRSA 3QVAA 3CDYA 3IFPA 2VISB 4I4WA 1JRHH 5LGHL 3KJ4B 3UYPA 5CLTA 5K1VA 2IAMC 3NIGF 4Y5VA 5BUGA 2JKJA 1F4YH 1HWGB 1F13A 1S78C 2UYLB 3S97C 4ZUTB 1KN4H 3NA9H 3SE8L 4QKXB 3CCHA 5L6YL 1Y6NR 3NCBB 1D6EA 1RIUL 2IAMA 3BKJH 4GRLC 3IDJA 4K5OA 3HW7A 3T8MA 2PPFA 5I9QB 3RVTC 3A4DA 3K46A 1KCWA 1E28B 2DQ6A 1GSKA 1B9KA 3BN9D 1TQUA 3EO1A 3ZSTA 4GIPD 4GRLA 3IDMA 2VQ1B 3MRCA 4KK8D 3T77B 3DTDA 5EUOB 5IMOA 4PY7A 1WWCA 4LRIC 2ADIA 3AXLA 4M7LH 2ZSWA 4KY2A 3SZ6A 4U0QB 4ZW5A 4L37B 1KTDB 3NFSH 1GC1L 5AVTB 5MEQB 4LRIA 2ZX9A 1TETH 5GIRA 1KXHA 5CJXC 1OY3B 1ZA6A 1KXTB 2E4FA 4F7KA 1E3ZA 3LKSA 1ZJBA 2LLGA 3SO5A 1MFAL 3OJ2C 4HZ1A 3LZFL 3MREA 3PWPB 5CJXA 1G0YR 1LK2A 4WI0A 2E59A 3BPNC 4PTTA 4UYPA 4NKDA 2B4CL 5E8OB 4DFHA 5FW7A 1MDAA 4NO0B 3MV8B 3VI3B 1WH0A 2YOCA 4AK2A 5FDWA 2O5YL 4A7VA 1UEMA 4NZTL 5FC9A 4LF3A 4PRDB 1J1OL 4X6BA 4FI7A 4HK0B 1I8IB 5C0IB 5D8JH 2X53A 4LRNL 5T5NF 5CGTA 1J1PH 2JI3A 4JRYB 1NCWH 4AQ1C 4U6HA 3A4AA 4QGTA 1U4EA 1OP5K 4GMSH 3A22A 5GGQH 2W9EH 3L3HB 3H9SA 5SWQA 1B0IA 3EH5B 5F72S 4AQ1A 2QBWA 4U4IA 3E6FB 2NY3C 1R3KB 3GUFA 1BCIA 4B9GA 3MUZ1 4QRTB 4JANB 3LQMA 4NQEA 2HRPL 2YA0A 4ONHA 1KFAH 4WWPA 4JQVA 1WFTA 1CLOL 4JPKL 4ALAH 3M8OL 4N1EA 4IHBA 3ARQA 1QLFB 1BD2B 5F7AA 4JHAL 1OAXL 3IJYB 4O02B 1I1YB 3RLSA 5GRUH 1GS7A 2KH2B 4JN2A 5EO1B 5GS0C 5EUKB 2BOCB 5IEHB 3R4DA 5KG9B 4X99A 5AAWC 4M48L 4PS7A 3ZGHA 1MIEH 5EIQA 1AQHA 1WWBX 3NJGA 4GAFB 5D7JC 2MIZA 3U30B 2OSYA 3RA7L 5AAWA 3G5XA 4XXCC 3OKLA 4I89A 1LDSA 1T83C 4NCC2 1BGXH 1OSZB 3IFLL 3QJQB 4W9CC 3TJPA 4DGYL 3OGCA 5D7JA 3KMDA 5HHOB 4S1SH 3GUTB 4XXCA 1UD6A 3QEGL 4LCWD 5FUCC 2OP4H 1HYSC 2YPLD 5FYJD 1T83A 4HXAH 4G7YL 5KJ7E 3P0GB 4GP8B 32C2B 4Z7IA 4JRXD 1P5UB 2OBGA 1JTPA 3U7YL 5I1LB 4FQIL 2HLFD 3MXWH 2WCPA 3PLYA 3LIUA 5IMKB 3P4MB 3QRLA 5B3JF 1ZLUH 1A6TA 3SPVB 1CXLA 1LEIB 1HSBA 4KX7A 4RFEB 2NXYD 3F01A 3RX7A 4IBWA 1SFHA 2DYSB 1DBJL 3K8LA 4YBQC 2P5WB 4KXZI 5JDSA 5B39B 1GYCA 1J8HA 1AO7D 1R3JB 2AJUL 5IB1B 3PAUA 5CR8A 3SSGA 3A21A 3WLWC 2MQ0A 4B9KC 4EPSA 1GPOL 4D94A 4FFWD 2HTKC 1J12A 3MBEB 2WXGA 4LCYA 4EQ2A 5KYXB 3IJHB 2FQGA 2VDMH 5HGAB 5JW4M 4ZPTA 4F2MB 1MFBL 4MB4A 4GSDH 3CUPA 2BZ7A 3ILEA 2YXMA 1FYTE 1RIHL 4MWFB 3BW9A 4NUMA 3WY4A 3WBDA 1NBCA 1E65A 1RMFH 5BRZD 1L3NA 3IDGA 4PJ5B 1RZ8B 3CFMA 4JHWL 1PCXA 4PQXA 4FFZH 3ZGIA 4UNVA 5AKVA 1NFDB 2WZ6A 2XZCH 3ECVA 3PNWB 3X13B 4X6FB 1HHJA 1VERA 3QPXH 1RFDH 4LLWA 2IPKA 2JKTM 4WTXA 2VLRE 1GAFH 1JZ4A 3S5LB 4JZNA 4MXWH 1JYNA 5IOKA 1QRKA 1NIAA 1AZCA 1A6VH 4GAGH 3WD5H 3QZWB 4A39A 1YRKA 2F7PA 3PAVA 4JPVH 3NEXA 1HOEA 4PLKD 2D0GA 1YMHA 2EXTA 1Z32X 2MPAH 4AJVA 3LMJH 2J44A 1JCVA 4KJWC 4A7GA 1WP6A 4YS4A 3T9WA 2DQCH 4GW1B 5FK9B 2IO5A 4WWOA 2VKWA 1A7QH 3HIZA 4NPYA 4ZAKB 3VGEA 5JZ7D 1EPFA 1IFHH 3HUJE 4I3RL 3C6SB 4PGBA 3RAJL 1ETJA 4W9JC 1NGXB 1SEBB 4A7SA 2DWSA 4E42A 1T1ZB 4E41D 4RZCA 1FNGA 5C6TL 3VXOA 3NQIA 4L8SC 3SKOB 4Q0XH 4G8IB 1QYGH 1TEFA 1RERA 4N8CH 4BJLA 4M00A 3L7FA 4GRMB 4TTGA 3F6IA 3EFDL 4RFNC 5D93B 1A2YB 1OTTD 2AQPA 4L8SA 4K23H 1NOFA 3QXUA 4WFGE 2X89A 5FHBH 1E8ZA 3WGVB 1OPGH 1I85C 3SN6N 3BWZA 1BP3B 1JZ7A 3D33A 1QEWB 4UTBA 4FULA 5A43C 1FNSH 1QUNA 3MR9A 4XWGL 3QXDA 1CL7L 4P3CH 4FA8A 3OR6B 1H3WM 1NBYA 1SM3L 1I85A 1W6LA 1QTYT 2P5EA 3TBYA 4L1LA 3ZDXE 5MERB 2HG0A 3BD4A 1UA6H 1WG3A 2E9BA 5HYIA 3BAEH 5DS8A 1AAJA 1CK0L 3I6SA 1FV1A 2PYEE 5AW5B 5T3XL 1TFPA 1JGDB 1MFNA 5J1SC 4IDJL 2P44B 4V1DE 1Q0XL 2BP0A 4DGWC 3W0WB 5BVPH 1INDH 4PJGA 3RJQB 3VRJB 4QOKB 3EHBC 4MMZC 4DZBA 5IHHA 1CD8A 4HLJA 1JF5A 3QFDA 1TQTA 4JM4L 3LOWA 3QDGE 4LP5A 4ODHH 3W9DA 4UQ9A 4MMZA 2MNJB 5A7EA 3RP1A 1BLNB 4YL9A 5KVFE 1U3YA 1OV8A 3BCFA 4TRPL 1OE3A 2P45B 4FZ8L 4LP8A 4N68A 2CPCA 3QO0A 2QZ5A 3B37A 4F7CA 2WLYA 2D7NA 1ASOA 4ZW8A 1I8LA 3GSOB 1U8QB 2DQMA 3FB5A 5MI0C 3VFSB 3LXUX 3RUGA 5TE6H 3VRLF 2AQSA 1WTLA 2UWEA 3MLVH 4ZUWB 3TZVC 2IALB 1DSYA 2DD8H 4U3HA 5BS0A 1JV5B 4G7VL 2VLKE 4UBDC 2CNYA 5CUSL 4P2RA 1JNLH 4N8VG 4HZLB 4ZO8A 3MLWH 4Y8DC 3V2AR 3S98A 3TZVA 1QABA 1IE5A 3U0TB 3P3YA 4M5YL 1EEUA 3VFVB 3ULVL 1BVKA 5F21B 1HEZB 1GJUA 4IOIA 4NO3B 5TQ2L 5AL0A 3D85B 2OZ4A 3OAUL 1ZT1A 4K94C 3AS2A 3S5ZA 5J3HD 5KAQF 4LLYA 2HJLA 2A73A 5EOCL 1Z0NA 3D4GA 2BIQA 3WHE0 3FT1A 2V17H 2GCYA 4U31A 2AZUA 4X5PA 3PXJA 1PW3A 1URZA 3MZGB 2XG5B 1FO0H 3KS0H 2VLJD 3D69A 4JM0A 1JPSH 2C7FA 2XTJD 3G5ZA 5K9JH 1W91A 4TQEL 3IE4A 5LBSA 1KY7A 4QI3A 2E46A 3FULA 3BPCA 3FYEB 2DEYX 4GKSB 3IXAA 3BZFB 1TCMA 2NY6C 5CNHA 4CGUB 1SYVA 1WFJA 2DWTA 2G5BB 2PTUA 3QULB 4OLYH 3CIAA 5FR3A 1XAKA 3IBEA 4P04A 4WF7A 4LHUA 3ZE2E 3O3DB 2KLSA 4OBSA 2UZIL 3UTSE 1OAUL 4HH8A 2WNKA 3LS5L 4PJBE 4KK5C 1FIGH 2ADYA 4D7PA 4ENEC 3WTWA 2GJJA 2DQTH 4L4VE 2BSDA 3GNML 4OT1L 4YHKL 4HCRL 4PLJC 4LL9A 4EDWL 1CFVH 1U8JB 3HI1A 3ZUCA 1D9KB 3CTTA 1OGTB 4PN6A 4BE6A 1OTUC 4S1DD 1PZDA 1NAKH 2GJZB 1KLFA 4R90L 2X4PB 1DVUA 3GMMA 3DC0A 4FABL 4LGRB 4UQ3A 2VC2B 3VRIB 3JV0A 2YRPA 3OSVA 5C0CE 5HBBA 3UC0L 2ZSVA 2PXYD 1AG6A 2MFNA 3DETD 4Y9BA 5C8JB 2C7UA 2YD8A 2AF2A 1OB1A 3AT8A 1QUPA 1BWWA 2XT1B 5E2UL 1HZHL 2JLLA 1ZVSA 5IMMA 1UZ8A 2YC1A 5JOFA 2DICA 5F0PB 4KKLD 3HE7C 4U1GC 5L9DL 5LO7A 5DA0B 4CC4C 2VRAA 5I76A 4OZHF 4Z7OF 2H6PA 1A66A 4RX4D 1WZLA 1XGUA 5E2WH 2AS5M 1KIQB 2YN3A 5I8EA 5I16B 5DUMH 3HE7A 4DO4A 5F89A 3VD9A 1QRNB 1J5OH 4CC4A 5SX5H 2AJZB 2J5LB 3BAWA 4QAMB 1OP3H 2JV6A 4EI6B 1MHEA 3FSOA 1AOZA 1AOHA 4C4KT 4F7EB 1CGSL 4Q4EA 2H6OA 3L7EA 4KI5E 4DAGH 2PN5A 4YHML 5FXCH 4TUOA 3QT2A 3VW3L 2BM3A 4NNYA 3IWVA 3VXTB 3MGOA 2CRYA 2XWJB 4QHMA 3MV01 1LO0L 4IHOB 3I6LE 4Y16B 3VI4E 2C1OB 2NR6C 1J7VR 2GY7B 1HKFA 2WSPA 1EXUA 3MKGA 2N56A 2OFQA 5I75B 1L0QA 1TTGA 4DZ8B 4H1LA 3CDCA 4PB0H 2NR6A 1XSIA 2Y5TA 3LNGA 2XN9B 5GGRY 1DZ0A 2X6VA 5ECGA 1FJ1B 1T5KA 3ULAB 5T1KB 3BZEB 1BXAA 1B0RA 1SJHB 1U8NB 2HCZX 4N5UA 3HZMA 8FABA 3R1GH 1DQKA 1WUNT 3P9WB 4U3SA 4CL7A 3IFNL 4G6AD 1I3VA 4RVBA 2CR3A 4K8RD 4MQTB 3VXUE 3ZPDA 4ABWA 1RH8A 1ZE3C 2EIEA 3PNRB 1X6NA 4PRIB 5A2LH 4A6YL 1IGIL 4AW4A 1P84K 3QDJB 3RURA 4Z7VB 4MNQD 5E0QA 1WZKA 4FG6C 2V5SA 3UBXI 5B38B 5BOZG 1IE4A 4YHLH 4LLDA 2XFGB 3DA0A 3GC3A 1G6RH 1N64L 4NN6B 5H4ZA 1UM5L 2X0UA 4CBZA 2DMGA 5E1HB 2FATH 2WB7A 4XN4A 5J8OA 1YY8B 1U30A 1RAMA 4UTAA 2DL9A 1Q9OA 4F2EA 5I66B 1HINL 3DRQB 5IQMA 5J5EA 4R97C 3US1A 2IWGA 5E7BA 2MSPA 3WFEH 3VVWA 3DV4A 4C56A 4JGUA 1Y7VA 4YNYB 2WLNA 4FTDA 3CMOL 1CTMA 1YN6B 2ZCLH 1MJUH 2GJ6E 2OW6A 2LW3A 3UZVB 1MJ8L 2V2XB 3FUJA 4LVNC 5ESQB 4BKLA 4P5TC 2X4SB 4NZRL 2BSTB 3KNBB 1ZTXL 3KEDA 5C08A 1VESA 2UXGA 3N42B 4NQXB 1W16A 4PRAB 3LPPA 3Q05A 5CZVH 2FE0A 3SOBH 4PJ8C 1RZIB 4P5TA 3ZL4H 3QEQB 3B3IA 1XTLA 4U7KA 4HJGA 1PKQE 2P43B 3CZFA 1F18A 2BNQD 5I1GL 2IGTA 4PJ8A 1EQWA 5E8PA 5FV2A 2Q8BH 1CXFA 2APBA 2AJYH 5IVOA 2B9BA 1F6LL 4Q2ZA 3JV6B 1TZGH 1FZJB 3B9KD 4KXBA 3ZTDC 5FCUH 3DX6B 1YEDA 4NZ8A 3MRIA 1IL1A 2DIAA 3MRLB 4EKXA 4BFGA 1UB5B 1UGKA 2ATPB 5IK3B 4BUQA 1UCTA 1TZAA 3H3PL 2PPCA 1SBSH 5DFVC 4AUUA 4WEBL 1WLHA 4ZG1A 2BHYA 1R3HB 4MAYB 2AXGB 3CBJB 5LN8A 4NN5B 2VR8A 3UERA 3VFUA 3L95B 4Q89A 5C71A 5ANMB 3TFBA 3EADA 4B5EA 4WHDA 2DS4A 3ZSSA 1AACA 1C5CH 4NN7B 4JW3A 4MLSA 4ZOAA 5ICZA 4OUUB 1XQ4A 2VXQA 1MZZA 3PF2A 5HGHB 1DEEB 3DUUA 1KY6A 3ZTNH 4L4TD 3FCTA 2AABL 4LO9A 4WUKL 2MCPH 2Z8WC 3O2DA 2B7DT 4JVUA 1OALA 2XBTA 4Y5XB 2HMIC 2I69A 4MASA 1IAMA 3WAKA 5GGTH 1GOHA 2OXHB 1QKZL 2NW2B 2GUOA 4JG1H 4NENA 1VGEL 4P2QD 4PWEA 1WBXB 1UVQA 4LNRB 2D03L 2G9HB 3NCWA 2EKSA 3IGFA 5EOTA 3OX8B 4D2NA 4TL5A 1YPZF 4FQPA 2XG4B 3NJLA 2Z65C 1OANA 1A3LH 1SGKA 2LE9A 1HDMB 4KH9A 2MH4A 2OL3B 2R4RL 2Z35A 3DHPA 5E2VL 1S7XA 5FW6A 4R3SA 4PJCA 4GINA 5EMYA 3WFZA 3T4AC 4QRRE 2BVEA 4JDZA 4LCVA 3NFSL 2WTRA 3V52H 2R0WH 2VDQH 1QWNA 4EVNA 1RIVH 3LD8B 5CAYB 3V6ZB 1FG2A 5I0YA 3W57A 1YMME 4YWGH 2WVTA 3T4AA 4N1CA 1ADQH 3VYPA 5DC0A 3CG8A 1NH6A 5SWSD 3SBPA 3IS0X 3SQBB 3AREC 3EYUH 2ESVB 2B3RA 2BMKA 4DKEH 4JJ5A 2A3TA 3N41B 5D1QC 2FTAA 5IB4B 5K9KA 3OKKB 4QJ3B 1QVOB 1A4BA 1A4JB 1GZPB 3D52A 4MCNA 4FAAB 4LARL 3AREA 3DGGA 1FORH 3EYOA 2CSPA 5D1QA 3PWVB 3OQRA 1KPRA 4HS8L 5GS3A 2B5IC 3TVMC 4PJEE 1QI4A 3GXMA 4UT6H 4P2AA 4IRJD 3C5ZB 2CDGB 1E9PA 3HG5A 4PJ9D 4D9LL 4Y19D 3RB5A 3L3IA 4OJAA 4UQDA 2J1ZA 2E27H 3CAFA 2BCMA 1IGMH 3BXNA 4JJHA 3TVMA 4QRPD 4PP2B 4YQXL 2OJEB 3QRFM 5C2UB 2Q6WA 1P84J 1OGAE 3WFCH 4UDUA 2NSMA 4Y4KC 3ZKND 3S8WA 3UCQA 3VFPB 3HR5B 4FFTA 4B0MB 4MLIA 2TRYA 5HJDA 4J4PD 3KYNA 3EO0A 4C55A 1XFPA 3VFRB 2CO4A 5G4OA 3BSGA 4Y4KA 2LTQC 1JE6A 1HKLL 2M8XA 4NZUL 3VB9A 4CSTA 3DX7A 4NKOA 2A9NL 1S7SA 3FUHA 3ARBB 1WAAF 5FHAH 3VU1A 4HH9B 1TG8A 4G43A 3R8QA 4U6XB 3PHOA 3UPCA 1WAPA 4Y4FC 3BE1H 1FE8L 1Y0LB 4MNHA 4MNGB 4QHLA 4AGLA 2BSBA 4KZEH 4MBOA 4CSPA 1MCDA 1FGNL 4J3XA 2Y7OA 1OIOA 5ISZA 5CZXD 5I1HH 1ML0A 3REVB 1ILUA 2R2HB 3IAPA 1B4TA 3APNA 2WWNA 4N2NA 4OD1H 4TVPH 4YZFE 4Y4FA 3PWUA 1FNEA 3O3EB 4PSRA 4I77H 4XTRD 4ODSH 2OMWB 3ARGB 3KBEA 4U1KB 5C0AA 1Z9MA 4HC1A 4C4KO 2H0FA 4FMVA 5IQ9B 2QSVA 4XP1L 4IIZA 3W3BA 4UOQA 1UJTA 2BVOA 4S1SL 3C5SA 3VGAB 4URTB 4N2LA 2CHDA 1DVZA 4PJFE 2Q7YA 5E9AA 5C09D 4A2FA 3D39E 1CL7I 1KYDA 1V10A 4DHLA 1UACL 2P5PA 1GW0A 3RDTB 2G2RA 3ZE0E 4K7PY 3N9GL 1A4AA 4F7MA 4NM4L 4AUJA 4LVEA 4WIQA 3NFNB 4XAKD 1GIGL 1HHIB 4PRPA 2ZJSH 5CEXB 1G5AA 3WXWL 3FONB 2FLBT 1ND0A 2BS8A 2VUOA 5DD3H 5EG6C 3MBXL 3X12B 3KPMB 3ULUD 2WQUA 5KVGE 5JOPE 1FFQA 2DDQH 5DQ9A 1AS8A 4ES9A 4P2OC 2WCSA 3K6DA 1KENL 1BEYL 3N2JA 1U0QA 3O9WC 4LB8A 1EHXA 1EEZA 2IMMA 2A6IB 3QORB 4OLZH 2J6EA 5DJ8B 2HFFB 1S3KL 2NY1B 3FFDA 4X9FA 1DUYA 5DD6B 5EEUA 3TLRA 1RZJC 4RAVA 1NPNA 4HIHB 1CDIA 4P2OA 4WUUD 1HCFX 5IOPA 1XF1A 3IJ7A 3ISYA 1Z9LA 1CB4A 5AOIA 3RPIB 2AK4A 3V10A 2F2HA 1I7ZA 1T3FB 4JG5A 1TVBB 1NQBA 4L3AA 3UAFA 1TENA 2CKBA 3WNLA 3BJLA 2C9PA 4NP4H 3D05A 1JUFA 4M9PA 4OCWH 1CWVA 2ZWLT 2CDFA 3SGJC 1FC2D 2V4LA 4QD2E 4JFWA 3ZIMA 4HS6A 3Q1SL 3O11A 1INEL 1BQRA 4XP9L 3GMPB 5H35A 1AR1D 4ZMQA 4ZMWA 5IKCB 4AM0A 1E5YA 2JXMA 5JYMA 2GTZA 3RZCC 3BPLC 4MAZA 3BH9A 3SGJA 1P7QA 3NUKA 2NZ9C 4QXGL 1S7UA 1E4HA 3S35L 1JXJA 3D0AA 1KJ3L 2EVIA 2X1XR 4P4KC 4YDVB 4D0DB 4LCIL 5C0DB 3OKNB 4Z0XA 1I8MA 3FH8A 3RZCA 2BIOA 3PJSA 1H5BC 5CP7A 3LSOB 3L5WB 3N43B 2VDMB 4L1HA 3UO1H 3T0EC 4P4KA 4B50A 2O4EA 4M29A 5IEKB 4XN8A 1H5BA 1ZLWK 2YSSB 4Z7VF 5GS2H 4FQCL 4DGIL 3T0EA 3IGAA 4I0PB 4TF4A 2WXRA 5IZ7A 3QG6B 4FNLL 5HJGA 1ZPLA 5BUAA 1U8HA 1N3NB 4YUEL 1UZ6F 3C6LB 2GT9B 1HTYA 3CFEB 2GEEA 4NNPL 4N90D 4X6DE 3DX1A 1F5WA 2VXUL 3FQWA 1PL3A 5HDBE 4L8BB 3I9GL 2F61A 5SWZE 1DQJA 1SXAA 2VSKB 4YGVB 3K6SA 2BSRB 5HI3D 3GLEA 1OT1A 4AVHA 4ZX3A 2H2PD 2I25N 3TO2A 5DJ6A 2D2OA 2BDNL 3QIWB 3ARXA 1E8WA 3LHPH 3ZY7A 1CFBA 5L2KA 1QBAA 3NJHA 2WN2A 1TXKA 4ZFFB 3V4VB 1N6VA 1U91B 5TPWH 4OJEH 4MCZB 1TU2B 1F90H 1CT8A 3O2WL 1MCHA 3KWTA 3QXAA 2NQ3A 4M8RA 1SOSA 4L3ED 3RTQD 3HC3H 1NEUA 3PDGA 4BFIA 3BESR 1U93B 3MRPB 3WMPA 1I9RL 3BQVA 3VXSB 1AS6A 4GW4B 5I6NA 4LQFL 2FH6A 3D0LB 5GRWA 2ZUYA 3QJHB 2Z1KA 5BUPA 3HHSA 3HNVH 1ZAGA 1I9JL 4JZJC 4L2LA 4UV7L 4OKVA 3VXRD 3FS9A 1MCFA 2NNCA 2P8MA 3LKPB 3UBXG 1NCBL 1RZKH 3QUHA 3RWEA 1ZEAH 4OCRH 3D12B 5ERWA 2NXZB 4MJ5B 3BVNA 4JZJA 3DGCR 2VLME 2C9AA 2BRRL 4RGOH 3SO3B 1NPJA 1EX0A 3LNIA 3QRGH 3ARDC 4NRXA 4YOKA 5I1JL 3STZA 2OCJA 4RIRA 2NUTA 1Z9SA 1L9QA 1N7ML 3UG4A 4Z18A 4XI5C 2EKJA 3POCA 3FMGH 1OK0A 5MEOA 2JWYA 1T7WA 2YMTA 1T89C 1CD1B 1EGJL 1I82A 1IGFH 1PY0A 3ARDA 4LLMB 5FO7B 4BFEA 2ZX8A 3AAZB 5IW1A 3KPRD 3B6SB 4L8DB 3AG3B 2Z7WA 3NVQA 1G7JA 3QUMA 3ETBJ 1T89A 4D3CH 3BDYH 1DJHA 3VA2C 4LEXL 4ZW6A 2NX5B 3S88H 3REWB 1HX0A 3CDGA 1N0XH 5BZWB 4NQCA 5D7LA 4KZDH 1O0VA 4J6IA 4WW1B 2O72A 3U9UA 3U4BH 4WAFA 2Y7QA 4C54A 1B3JA 1U3HC 5KJ4A 1FFRA 4F15C 2FWOA 1KJMB 3T0VA 1CLZL 4GMTH 4J39A 4WK4B 2AGJL 3VWJC 4XP5L 1N9PA 2YPVH 1U3HA 1YPZA 1CC3A 1M3JA 5IJDC 4UNIA 5C2BL 2PWHA 1UT2A 3VWJA 3RVXC 4B3EA 4BM7A 3O6LH 3UG5A 3ZO9A 3U83A 1A3RH 1FN4B 4UV4L 4MJIE 1DBBL 1TYRA 3CFUA 1X5LA 5A2BA 3LQAC 3RWJA 1S78D 2KLRA 1VJSA 4N0CD 3ARZA 3DDFA 3B9DA 3IAGC 3RKDC 3B2VL 1IT9H 5EU6B 3OKYA 4AG4H 3FC8A 2VSDA 3AXIA 3BJ91 3FCSA 3T4YB 3RVTD 1U92A 3ATFA 3ULSB 3OG6B 2DEXX 4HGKC 4E9WA 2OMYA 1WSST 3QJZA 5CGBA 4YIQB 2AVGA 3R19A 4BCXA 3GZKA 3MLXH 5HDOA 3STBA 4MXVF 4LQ1A 4TSBH 4LFHD 1WFOA 2IWKA 3CHRA 1T1XA 2YHGA 2WKLA 3H42H 4OFYD 1FO0B 3X11B 1OM3L 2VUYA 4GBXD 1UQSB 3ZHDA 1G9NL 2KDGA 4PJDB 4R4FH 1JPGB 1KTRL 2R2EB 3WMSA 4MD0A 4BK8A 5F7DB 2WP3T 2R69L 4M8VA 5D5ME 3X14A 1F86A 5AZEH 4DPCX 2VL5B 1A6WL 1MFCH 4ONFH 2GIYA 3C09B 1NC2D 1G94A 1XCWA 2PF6A 2OI9B 2QL1A 3A24A 3UFIA 2X1WL 1NCHA 4IKJA 2W94A 4JAMB 1LO5A 1PU0A 3TF7C 5E8DH 3RVWC 4AMKL 3CVHA 4XNYH 1HQRB 2FX9L 3CQPA 1EWHA 2J88L 5F1IB 5DTFB 3GJFH 3FHAA 4LBAA 3H9SD 3I75B 2AERT 5E5RB 3QDAA 3T2QA 1PSKH 2D31A 5HD8D 2X5PA 2FJFB 3GRWA 2W5PA 2QQLH 4YBLB 3MFFA 5FYJH 5C07B 5D7KE 5DRWA 2BP5M 4I2XE 3T0AA 3PAZA 3O8XC 4JFZL 1FZKB 3BYTA 4YHZH 4XMKL 1DLFH 3UJJL 4OZIE 5CSGA 3VFTA 4DQOH 1X5FA 1ZY9A 4XO9A 2BSSA 1SXBA 2ICEC 1O5PA 3O8XA 2UZPA 3ARSA 3AVEA 3SHSA 4F33A 4MRBA 3TBTA 5HYJB 3BUDA 4OQTH 2AQTA 1OWRM 1ZS8B 1I3RA 2NMSA 2QPSA 4OFDA 4XCCH 4G6FB 5DRXA 2ICEA 3NFPA 4PI2A 5FA4B 3V7AG 1MJJB 1P1ZA 2GSGA 1J0KA 1NCDL 2ROYA 3KGTA 4O5LL 1NFDE 4U6YB 4ORZC 2YSTA 3HS0B 2NY0C 1IC4L 1RPKA 2TAAA 4XX5A 2OTUB 3CLFH 1ZKAA 2WXHA 3UYRH 4WWKC 3QIBC 3TS8A 4QTIH 5D7JD 5A7BA 4MCYA 1J0YA 2XKNB 3K74B 2EVHA 3U4EA 4WJKB 2AFNA 1FG9C 2VCOA 4CW1A 2JKXA 1QFWH 4EXPX 5J4MA 4Y1TA 2L7JA 4WWKA 3QIBA 4XVOA 4AE0A 4PBDA 4WO4A 3DURA 4UAOC 1R5WA 4M7JH 1NCIA 1HYSD 2WLIA 4XN7A 4XNXH 3SKJL 1ZLSL 3C75A 2CRIA 3O6KH 3QWOA 4NDMA 4EOWL 1KDIA 3BKML 7TAAA 3FT9A 3HB3C 3NCCB 1YNTA 4TXVB 1JXDA 1W0WA 5HTSA 4TPRH 3OAZK 1DANT 1SZNA 3ATAA 1SOQA 3HNSH 4KI5F 3UAAA 2MMXA 3UEZA 3C9NB 1GHFH 4G11A 4UQ2A 5JHLH 5E4OA 4QRUB 2WBJD 2R29A 3IN0A 4ADJA 3VI4F 4F20A 4PMEA 3DOSB 3BP6B 2E7DA 5DYFA 3BP4A 3SDAD 3HNTL 1E9OB 2WXPA 2QVTA 2WO2B 1BVLA 1ZCRA 1DBMH 4N2OA 2ODHA 1ZWIB 2PUQT 5HHNB 3QIUC 4KJPD 2G0LA 2G3NA 5A3ID 3V7AE 1A8JH 1DE4A 1A6ZB 1JS4A 5K9OB 5IROC 4GKOA 5F70A 3SGKC 5IQ7L 2DLTA 4DP2X 3QIUA 1D5ZB 4G6MH 5BQ7A 4IGBC 1DQTA 4YHIA 1G6RB 3O45B 1G7IB 1V3MA 2EYRB 5LAXB 5IROA 4IBZA 1JK9B 2HJKB 3TONA 3PQYA 4OFQA 3SGKA 4IKLA 4OV5B 1EZSA 4PS4L 3RU8L 3RWDB 2BNUB 1CFQB 3WS3A 1IX2A 4JPWL 1IC1A 2E7BA 1VGKA 1JXGA 4X5RA 3QJTB 2ISDA 3AROA 4OFKA 1DL7H 4WU7B 1L7IH 1D5MA 2R1YB 1V54B 3WLBA 1FHNA 1F56A 1NBQA 2VLRA 1E5AA 4OGQC 1LEKA 1ES0A 4KTEH 3AT0A 4YE4H 4CJ1A 5JQIB 1C5BH 1TF4A 1U3JA 2LLNA 4NBZB 4FNUA 1KIUB 1YEKL 2A74B 2VDPH 4HFWA 4XO8A 3LCYA 4PJXE 1F6AA 3FU9A 4PGDA 2MKLC 3DVFA 5I1CL 1R3LA 1TT6A 1NBVL 2F53E 1QBLL 3DO3A 2D7QA 3BKYL 3NP3A 3HUJA 3BUYB 1L9TA 1RU9L 3TEXA 3VSUA 5C0BB 1J0ZA 5T3XE 3DX2A 1U42A 3L2LA 3QQ3B 2XTSA 4HKJB 1RSFA 1KV3A 1P6AB 3EOTH 4PGZA 2H32B 4HT1L 4P23C 4XCEB 2J1WA 2NY5C 4RFOH 3TO4D 3X1NA 1PD6A 4JFOA 1A4KA 1NCCH 2ZCKH 1WICA 3MGTB 3QR1A 4FZEL 3BT0A 1W2KT 4P23A 2Y22A 3KR3H 4BQBA 4EUPG 5JHAA 3FQNB 4CU8A 3B7SA 2X2IA 1ZHKA 1FUNA 1KBKA 3G04B 3LY6A 5HI4C 2GB2A 5IBTH 1T2XA 1OAKL 4UOJA 1KTJA 1OP4A 5HYSG 1BQLH 1JOIA 2YGPA 3SJVE 4MDIB 1HHGB 5HPOA 4QT5B 5AVRB 5ICYA 1NGWB 3EHBD 4P3DB 1WEJH 3BQUD 1JK8A 4G6KH 2V3FA 3OXRA 2E47A 3DJ9A 3FUIA 1WC7A 4P5MB 4JFXB 2PYEA 1TYJA 1QG3A 5KVMC 1KIRB 2EABA 5KZCD 2J55A 3SDDB 4E0RA 3BPOB 1FORL 1B90A 3HEIB 4V1DA 2VR5A 4HKZA 4BZ1L 1K5WA 1S7RB 4K9EH 1RVFH 2YK1L 3MRRA 2H47C 3DO7A 1ZDSA 5INDA 3TBBA 5HDRA 1J05A 2VDKH 4JHUA 1T21A 3GXNA 3LX9A 2RBLA 3GMQB 3ULVE 4R8WL 2HA1A 1NLDL 1KDJA 4LASH 4NRYA 1MUJA 2RA1A 4R2GC 1M7XA 1V8HA 4G2AA 4QHNA 1IJNA 2WP3O 2VDQB 5KYUB 3WKML 2LLLA 1HSAB 4XVJH 4OJDH 4GS7C 2PTTA 4LDOB 4BFBD 2KPNA 5C0RH 3OHXC 5FWRA 4D0BB 2H3NB 4KJYA 1OAJA 4F8NA 1DFBL 2Y0SA 2NY4C 3QRBA 1KV7A 2G3MA 3M17A 4KMQA 3SDCC 3OHXA 5EEZA 2JH2A 4F8QA 2ATKB 2VLKA 4R5TA 3S36L 5E94B 4GPVA 4AJWA 2WB1A 5DHVA 4P46B 2GIMA 2Q86A 2UZXB 4S1QL 4P9HH 1AGEB 2ADJB 3PGCA 3SDCA 3GS7A 3IFOA 4XPHL 2ZAHA 3CH8A 3O0RH 2E56A 5L88H 2KZBA 5I6PA 4BQ6A 1MCPL 1JZFA 4F8LA 1KJ2L 1V5JA 5TFSH 4OD2A 3NTCL 3B8SA 4DOHE 5C7XH 1P2CA 4ADGA 4AEIH 1VCBC 3F04A 3RY6C 2I60H 4Q97A 2GABA 5DMYA 2WYIA 4MX7B 1W15A 4M43H 3DMMB 2DWDB 3WXVH 4GEJA 4M6MH 4XH2B 1MI5D 4GT7A 3EZ8A 5LGYA 4BCZA 2FGWL 2K7PA 1HI6A 5CXPA 25C8H 1I7UB 3QA3A 3RY6A 4Z76B 4ZMVA 3DXAB 3FTGA 4GB9A 5JPMB 1BZQK 3PDDA 1BBJA 3QFJD 5GS0L 1HU8A 1OGSA 4FP8H 1I7TB 3ETBF 1XGTB 4I9WE 5FOJA 4BXVA 2A38A 2ICWB 4GP5B 4U1NB 2CJUH 5D1XE 2EH8H 2ZWZA 4Z3EA 3FUEA 4GEIA 4Z78A 1WGVA 2W0FB 5CILL 3F2LA 3EJQA 5DWUH 4GKNA 2JJTC 4DVRL 2COVD 3UTSA 4ZNCD 5F7YC 1A7PL 4PJBA 3V4UH 5GRJH 4IJ3C 5KTEH 4L4VA 3TU6A 2X6AA 1KELL 2JJTA 4ZSOE 1MQKH 2MNWA 5KBDA 5DK2B 5E6IC 2WAHA 3U0PB 1E5ZA 3TNNB 3WDHA 2WAQA 2VIRB 5FKAB 4YZFF 5AAPA 1G7PB 2ZNXA 2Y4SA 2O61B 5E6IA 3E1ZA 1YAZA 3D2UB 4PFEA 3HLKA 2WXKA 1VEMA 2L7UA 5DVPA 5FW8A 5C0CA 4TUKH 1V7NL 5L7XH 2AV1B 4KK9D 4OLVL 2OXGA 2ZQKA 3SD2A 1PIGA 1BSIA 4ILDA 5CCGE 4F9PC 2LAAA 1CXHA 4HEME 3JV4A 2ZCHL 4JR9H 3QAZC 4K8RH 1HXMA 4DW2L 1VZGA 4YO0B 1XGYL 1ED3B 3CC1A 4KFMA 2WO3B 4MS6A 3QUYD 1A7OH 2ARWA 4F9PA 4UILL 4QRSB 1FLRH 4GKZB 4CVUA 4TN9A 4TSCH 1A4CA 3IJ8A 4G9FE 3VFNB 1FF5A 3QQ4B 4QRAA 5EO0A 1JXKA 1JTOA 2EEFA 1ZT4A 4AL8C 4N9GB 4PRHE 3MNWA 1EA9C 3JTTB 3EJRA 2CIKB 1VEOA 4L5FL 4FQJH 4GUQA 4JE0A 3ALWA 4JDVB 3L9YA 5C9JB 1CE6B 3QDME 2JI1A 4AQAA 5AW9B 3NZ8A 4IRZH 1HK6A 3N40F 4E9LA 4N6QA 1KPVB 4H13C 3GSNH 4K7PL 3BWSA 3ZMEA 2IFGA 3MAWA 3ISWA 5AVQB 4O51A 2IH8A 4UINH 3LHPL 3LEYL 4FNSA 3S3BB 1CCZA 3TH4T 2OMNA 4NUGL 4WFFD 4GT0A 3VI4A 5BPPA 5J11C 4GW5A 3RGVD 2H0JA 1UYWL 3H0TA 3ZIYA 5KJRH 3PHAA 1JVLA 4MHHI 4POUB 3U2IA 2I7OA 3Q2WA 2CHXA 2R23A 4L3CA 5IFHH 2XZQL 5EU3B 5L4FA 1P4LB 4UTBL 4CNIB 1JGLL 3SGEI 1ZT7A 4IEFA 1JFQL 3K4DA 5F3BB 1WT5C 4YSTA 4YDLB 1UM4L 1J1XH 1QSEB 3V6FA 2WWMC 3H9YA 4Q9BA 2YARA 2QADC 4X7TB 5CJOL 4I9XA 3P1VA 2X3AA 1JFHA 2L3BA 4OVVA 2E7CA 2J56A 1A7BA 1WT5A 2B1HH 3I3EA 4CA4A 1IEAB 3AGVA 3FUDA 1SBBA 1XH3B 2PLTA 3P73B 3GHEL 3MV7E 2J3SA 3VXUA 4XNMA 1T04A 1PY4A 4RRPG 2EXYC 2JE8A 1S9WB 3BN3B 4X0KB 2VAAA 5AKSA 1T0OA 2BOLA 5AZ2L 1CTNA 3S2CA 4RMBA 3UL4A 2WQAA 1VKXA 4YDZA 1SXSA 4IU3B 4L23A 5HDBF 3ARFC 2NUPA 4R4BA 5F9JB 2Y36L 4N22A 3GSUA 4L0ZA 1OOWA 4MMYB 4XBPB 3K80A 2I85A 5AYQA 3KWVA 2FEDC 3AACA 4ZFGL 1LEGA 3Q6FA 2ZPKH 3ARFA 3KPSA 4PJ8D 1A9BB 3DVIA 5J13B 3HG1E 4EAEA 4TLUA 3APCA 5TK4A 4HIJB 5I17B 4JNXA 4JEGB 4F7TA 2GJ6A 4Y89A 4LIQH 5EOCJ 2VM9A 3VSVA 4IBLT 3CSYA 5CLYA 3GEWB 4AEFA 2DIJA 1DLHB 1DJGA 4F93B 1PZCA 3AADB 3L5XL 4N2GA 4APQC 5HXMA 1K8IB 4LKCB 2CGRL 1LE5A 2HFEA 4JO5A 1OSPH 4NKMA 3FT3A 1KCLA 3L1GA 1WS8A 1IM3D 5DD1L 3WNNA 1PKQA 5DFVD 4ZFQA 1C7TA 4APQA 4DO5A 3KDPB 3N0AA 4ODXB 2YPVL 3VYOA 2FECI 2EDYA 4R96B 5EV7A 2CO6B 5CD3A 4FX5A 5GGVL 3LEVH 4PHZA 1ZVYA 3KBHE 2OZ4L 3NBNA 3ZRSA 5DEGA 5FYKD 4ZFZB 4X9BA 2VITA 3FO9A 3C6EA 1P4IH 1U6AH 1G1CA 5LGKA 2VDLH 1N0LB 5ICXA 4WI8A 4LPUA 2XFXA 4ZOBA 1CF1A 2BSED 1OE1A 2C9SA 5D1ZD 3MRMA 3OXSA 2IDFA 4HIIB 5K39A 1YYLH 3KWXA 4Z5RA 5CZKA 3WL9A 2V5YA 5D6CA 3ILPA 5DFTA 1LWRA 4OIIH 4WW2B 3HN8A 3STLA 2QV4A 4L29A 3W39A 2PO6C 3EXLA 5EB9A 2X40A 2ZE0A 4P2CG 2ZXCA 4GXVL 4LLUB 5E1IA 4OBRA 4GQ9L 3WE1A 1XF3B 1GGIL 2Q76B 2X4RB 2F08A 2PO6A 3V79C 5GZNC 3LYRA 3G6JB 1IGTA 3SDXE 1WCBB 4Q14A 3QQ9C 4TTDC 4PJAB 3ZKSD 2QHRL 2EH7H 1FL3B 2NYKA 5GZNA 5DGRA 1AIFA 1R24B 3DPBA 3IU4L 3ZDWA 2NNAA 3F7LA 3GZQA 3P2DA 4JQXC 1M4KA 4M6NH 2BNRE 3QQNA 3TBVA 1BXXA 4KAQL 5TE4H 4ZDHA 5D1QD 1WD8A 3IXTB 2CLRB 2YEQA 3D0VA 5DQDL 3TYFA 1O7SA 3DIDA 1SHXA 1DN2A 1I3GH 4JQXA 4Y88A 3EGXA 4JFYA 4FQLL 4X7SH 3KAAA 3MJ9A 2Y6SD 2I26N 3V0JA 1YMMA 4YLQT 4JO3H 4M6OL 1AGFB 4PGJA 3TVMD 5CD5C 1YC8A 1MWAA 4FG0A 1BFOB 1GRWA 2EXWD 1TTBA 4RBPH 1BJ1H 2V2WB 1G84A 1R4XA 4R26H 1FH5H 2NSXA 1B4RA 1CI3M 4WV1C 1L0PA 1CGYA 4WHYH 5K93A 2ZAIA 3PWPD 4FQHB 4U1MA 1MRFH 2A2QT 4KQ3H 3B5TA 2BJMH 4TLTA 5CBAB 1DBKH 2B59B 4YK4C 3MV8D 4MJ6A 4WV1A 2ADFH 4PJEA 2Y24A 2WBKA 5IQOA 3UO8B 3AM8C 4B7LA 2R0LH 4FQ2L 1VSCA 2X1PA 3APDA 3LH2L 3VXME 4NUPA 5D5MF 3TBSA 1IBGH 2Y5EA 2X4OA 4JRYD 1OGAA 3KCPA 3SQOH 2A5UA 3MV9E 3UXFA 1J9RA 3VXQA 2Z31C 3DROA 1XBDA 4LSDA 5I8OH 1QEXA 2G9KA 3VYNA 5CEZD 4K0OA 1KCRH 4FQ1L 4JFDD 1ONQB 3GSVB 2X9WA 4IIQC 2BRQA 2ADGA 1CYGA 3B43A 3ESVF 2Y2TA 3U36A 1I7RA 3V8OA 2YPLB 2Z31A 3IDUA 5ALCH 2D9CA 2YEVB 2J72A 1AC6A 3TA3C 3MOAH 4LGSB 5EH1A 4DESA 4JRXB 4L4JA 4IIQA 4HHAA 3P9MA 3S37X 5DMIH 3PGDB 1BD2D 1KB5A 2Y7SA 3F85A 4NAQA 4NJAH 4HX1B 5G2NA 3S8GB 2OPCA 2Z7UA 3GBDA 1CFSB 3LJ3A 4NP9A 3TA3A 1MRDL 2NXYB 3VFOB 1G9MH 5C7ZA 1SDDB 1ZMYA 4NYLB 2R0ZL 3U4AA 1BQHG 3T1WA 1AO7B 1QFUH 2E6QA 1KT2A 3IJ9A 2YWYA 2FBRA 2JSFA 3GBNH 1NDTA 5IVXA 4DF9A 4OZIF 2BW4A 3IDNA 2APFA 1NINA 3FAXA 1KLUA 1FFTB 3LHAA 3LRLA 2D7OA 4R7NB 4PJFA 2PKDA 5BV7H 4J3OH 3D39A 4NQSB 3P3RA 1N6QL 4Q9QL 1ZXQA 5CJQL 2NCEA 1KTBA 3SOTA 1HOCA 3S4SB 4I87A 1S8DB 2F54D 3E9TA 5HHOD 2JK5B 4Q9RH 4M56A 4X6CE 4RDBA 2FJGA 4PIBA 4XO5A 5KS9E 1DBML 2GHZA 3HMWH 2ZOKB 4UTAL 2Q20A 3GF8A 3CVBA 3Q5YA 2QR0B 1Q8MA 3TEYA 4WU5A 5DD5H 3B7RL 1TKWB 1QW8A 2P28B 5FCSH 4EQ3A 3ECBA 4GRWB 5DJXA 4UYQA 1OARH 2VZUA 3OB8A 3RWGB 1XX9C 5AB0A 1YDPB 4K5NA 5JO5B 4FFYA 4KVNL 3D06A 4P49A 3NJVA 3BD3A 1AQ8A 2VABB 3AB0C 3DV6A 3RZCD 2QVKA 2AQ3A 3ROLA 3K1KC 5EEYA 3L6FA 1OF0A 4YX2H 2BS71 4HUUA 2HKAA 2DZEA 2HXAA 2FL5A 4H8WH 2OMBA 1RZFL 2Z1PA 1WUZA 2HTLD 4E41B 5B21A 3CFJB 2IAND 4Y1AB 1OHZA 1WZ1L 2OX5A 4PJ5D 4ONGL 4RA3A 3B83A 3ILQD 3LN4B 3VTMA 1UTDA 4UAHA 1QD0A 2X38A 1KBVA 2EZ0C 4BEIA 3AY2A 3KPPB 2KBGA 4GI8A 4UB0H 4A6YB 1O6SB 3W81A 4PG9A 1AFVH 4WSJA 5D70L 1WAEA 2YEZA 2BH0A 4DQAA 4HLZH 1UXLA 1QO3B 3WFBH 1RUMH 3K5RA 3NSCA 4YR6A 1ET5A 3Q8FA 5L2KD 4KKRA 3WO4B 5DO2C 3BGMA 3VFWB 2P8PB 3NJJA 2VW7A 2XYCA 3WJMB 3D1MC 1EJOL 1O7DE 3ARVA 1X7QA 4MQ7A 3RPBA 4DVBB 5IBLD 4YXHH 5JPNC 1HQ4A 1IGYA 4M1CD 5J57B 3OMNB 4JG0L 4WHTB 1MVUB 1IEBA 1UH4A 3H55A 4JFTA 4X6DA 2X4QB 3O2DL 4W4OC 3WKNA 4DEPC 5AOZA 5SWZA 3RVUD 4E5XG 2J8OA 5PCYA 4ZX4A 5JPNA 1UWGH 3QWRA 3AG1B 4A04A 1IJ9A 3PPSA 3EXJA 3FQ2A 1LHZA 3MX0A 5KSBB 4W9ZA 1SF5A 1WFNA 1TMCB 4W4OA 4DTGL 3UTOA 2OR9H 5T5FA 2WMPB 2VT0A 4IM8A 2GBVA 4MHHG 1NFKA 3W56A 3OAWA 4UM8A 2R8SH 5F7EH 1WBYA 2RHEA 2ZF9A 1OF2A 1O9ZA 2F8IA 4QCIA 5M94B 2B1AL 1B0WA 1BECA 5EA0H 2W9DH 2ED8A 2WWOA 2QSCL 4U0RC 4JB9H 4PG2C 2QPDB 3C60D 1Y6KR 1AQMA 4Z77A 4JY5L 1LL1A 4PJXF 1RK7A 3ETTA 2JCCB 4G6JL 1IKFH 1C1EH 2ERJC 4PG2A 3S34H 4MZRA 3FFOA 3K6OA 4M62L 5JIPA 3DPDA 3PWJB 4ZBJA 5TJWK 1N4XL 4B9PA 2DBLL 1BPVA 3ARDD 4MRCA 1QACA 1X4XA 2J5WA 1IGJA 2GW5A 3LIZA 2HWZH 3KCWA 1XAUA 4QOKD 4OI9A 4OCSL 2VISA 5IESH 1NCJA 4LVOC 1IQWH 4NQCD 3QAQA 2P80A 3FCBA 5B3SB 3OKOB 2C26A 2WIIB 4PJIB 4ETQB 5DJZA 3PP4H 8PAZA 2E7LC 1C8PA 3QC6X 2L7EA 4RAUB 1KEGH 3AUVA 3MLSL 4N8PA 5JR1L 3FXIC 3QEUB 5FEBA 5KBPA 1NGPH 4CADB 2EIZB 5CMAA 3V9CA 2VMJA 1YEFL 2VN3A 1E4XL 1U3HD 5AUMB 1NDGB 2Q2LA 4NQVB 2E7LA 5JORB 2B8OT 4N5ED 4PJHB 3PHQA 2YGNA 4GLRI 1QLEH 1T0MB 4LSSH 4JM2F 5B4MC 2ZKWA 1M6OA 3G6JF 2VDKB 5I19L 2YZ8A 5T1LA 4PGEA 5E23A 2K0RA 1PX3A 1MG2C 5D7IE 5DZOA 4N24A 2OTPA 5KYWB 3RVXD 5B3NA 3TEWA 3QCVL 3UGXA 5LWYL 4HUMB 4YSSA 1JZ3A 1VB9A 3BAYA 1F4XL 3D85D 3CU7A 2FYVA 2OTWB 35C8H 3KW7A 4JY4B 1VFAA 1E6OH 3KYKH 3Q9PA 5IBUB 1XIWD 2OMTB 3P4LA 3PUUA 2E0PA 2HRHA 4HK0A 4XE0A 2GTQA 3V7MA 2H1PH 3VDAA 5EZIH 1MCKA 2BVTA 1YYML 1JYVA 5DUJA 3BP5A 4WDIB 3DOHA 3HC0B 5JXAL 1GC1C 5CFHA 4JO4L 1UOWA 3EJYD 3NJKA 1L5GB 1DQDL 5ABAA 1HE7A 5EWIH 4F8OA 4AKQA 3W11C 5HYQA 3QUKA 2R27A 5I1IH 2QEJA 3DYOA 2YUZA 2XC8A 2AV7A 4G3YH 3K6IA 1R3KA 4N0FA 4P57A 2BIIA 2J1KA 1V3KA 2ZOUA 1CU4H 5FYLD 3QJVB 2P24B 5FECB 1RUKL 3NCJL 1HESA 5JLZA 4RGMC 4FLRA 4X8JB 4CSSA 3FN0H 2QTVA 3PHSA 4HV8B 3TN0C 3U0WH 1JNNH 4F3FA 2VMDA 2WZPA 4GXUM 5DUBA 5LJYH 1QSFE 2VN5A 3IJYA 5HHQA 2OCFD 1EO8H 2BOCA 2XIDA 5D5MA 5KG9A 3TN0A 4YSPA 1PDKB 3L1OH 1TLMA 2J8HA 2OSLA 4PR5A 3NRPA 2AJSH 4BSWA 3EJZC 5BZDB 4N2IA 3TV3H 3IDXH 1AMXA 1A21A 5F9AC 1DDHB 2Z7ZA 2X10A 3TL5A 1SJMA 4QTHA 1P9MC 1OE2A 2A9MH 2K8MA 3KH4A 5JIKA 4GG6E 1X9QA 1CDHA 5JHMA 4FFVC 1P5UC 1X6LA 3MYJA 4NC1E 3S9DB 2LAGB 1IBDA 1KLGB 3SKMB 3MNDA 2J4WL 4HMDA 1QNZL 1P9MA 4Z23A 5CIPA 2XV2A 3A47A 5I1KH 5I1LA 1P5UA 4NQDE 1IMHC 1IGCL 3N91A 4JKLA 4F5CE 2GEQA 5AAMC 3LS4H 2IOMA 3SPVA 3HN3A 1LEIA 3Q43A 2F5AH 3MBEC 4Z7NE 3VQMA 2PW2B 4I2XA 1QRND 1BFTA 1PZSA 4E9SA 4N2EA 5IB1A 1Z2KA 3GMOA 5AAMA 5JHDB 5DJAA 3L3OC 3MBEA 4IS6B 4U4BA 4KO6A 1NGQH 3Q13A 4F2MA 1FZMB 4JFUA 4Z3TA 3O3AA 2PW1B 3MUGA 5J12C 3CPUA 3L3OA 3WHXB 4WO4D 3U1SH 3CXDH 2OK0H 3MLRH 4ZXBC 2CA3A 1JV2B 2JCWA 3F65A 5F8QC 5GSVB 2JB5H 1LO3L 3BIKB 5DZ9A 4NJ9H 1FI8C 1JPTH 1NFDA 3C8KA 4GRWF 3H9HB 5EC2A 6FABH 1OCWL 4ZXBA 2F7RA 4X6FA 4HAGA 1FFOA 1S9VB 1E4WH 1XEUA 3WN6A 4CMHB 5ADOH 3AZUA 1WE5A 1N5YL 2XN9D 3BEWA 3RFZC 1RZ7L 3V9FA 1MNUL 5C6WH 4DP6X 3TPKA 5T1KD 2PCFB 3QHFL 4XB3A 1AJ7H 4MD5B 5CBEB 2HH0L 2EE3A 1ORQA 1G7QA 4NPKA 2AKRB 4F7PA 3RFZA 1P4BH 3U2JA 3H7LA 1JN6A 4ELMB 1EHKB 3FSVA 3KXFE 1XCQB 2EE9A 4H4NA 1TVHA 4LVHC 1F2QA 4YXKH 3ZTCC 4GW1A 5MP6H 3L4TA 1W9XA 1AHWC 3QI9C 2ZOWA 4PRID 2XZAL 4QRQA 3SGDI 4LNVA 1LD9A 4R4ND 5J6HB 3QDJD 1G7LB 1F11A 4QAWA 5F7UA 2Z4QA 1NGXA 4KHTL 2Y2WA 2OM5A 1BQUA 2GBAA 3IMSA 4YHOL 3DWTA 1U2HA 1AHWA 1X5HA 3QI9A 1EZUA 3BOVA 5I15H 1WK0A 3NAAL 2BNQB 3QIUD 4G8IA 4OFVA 3POHA 5F9OL 1SUJA 4K3JH 2WCGA 2XPGB 4NUJA 2APTA 4RISH 3B9KB 1U2CA 4ANKA 1FYTD 1SHMA 3WFHA 4TUJB 5HI5C 4Z7WB 1CI5A 4AI7A 3VD1A 2F1AA 4KNUA 5EOQL 2AJXH 2QHLA 3VCLA 2ORBL 1SMOA 1XB6A 3GMLA 1E43A 4KPHH 1MCNA 2VXSL 3IE9A 4XP4H 2XA3A 5EBMA 4MB3A 4ORGA 5H94B 1KYOK 5DZLA 4V2CB 3CFNA 4V2BA 4CC1A 2VLRD 3BD5A 1MF2H 5DJCB 3G3LA 5CSZB 4HIXL 4DKTA 4H20H 5CP3H 3QB7C 1RL1A 4CAGA 4JCLA 4PJ7B 2BIPA 2XWDA 4UNUA 1KJVA 1KCSL 2VN6A 3WI9A 1BFVH 3P11H 1A6UH 4OU3A 4XZUB 3WUZA 3HAEB 3H3BC 4Q8BA 2PWDA 1R47A 4JFEE 4QXTA 3QHTC 5C0FB 4XPGL 4L4TB 4WCYH 1GMIA 1F1GA 4Y9EA 4AZUA 5JTWA 3HC4H 3S2AA 4WQOA 4IOFC 3U1QA 3W0WA 4JO1H 4JFFB 1LQBC 2JJSC 4KX9A 3VD2A 3NH7H 1TPXB 4QF1A 2F8OA 3VXNA 3T2NL 1KGCE 4N85A 5FGCB 1M7DA 4H88H 5F7LB 4MJ4A 4P2QB 3WHE1 2IQ9L 2YUWA 3ALPA 2OLDA 3P2TA 2NOYA 5DQJB 3I2CH 5E2TH 4BXSV 4AYFB 3JYBA 2JJSA 5MENE 2Z4TA 1NC4B 5ACZB 3TWCH 2CLVB 2K78A 1QWHA 4AYDC 1SN5A 2IJ0C 4WFGD 3BH4A 3PGFH 4PJXA 4XXDB 4YPGA 2OMVA 2Y9RT 2OYPA 2BY1A 4H5SB 3NA4A 2DQFB 2F53A 2VMFA 4YMPA 3ML9A 3MLZH 4XOAA 3P4NB 4HWUA 3MCKB 3EIFA 5FO8B 4WY7H 4J2QA 3LQAL 1YEIH 3K72B 4OCNC 2HLAA 2QGCA 3EYFB 4G72B 5SWSB 3S48A 3MLPA 1XB3A 2FBOJ 3K91A 3O4LB 4B95C 2AITA 5LNEA 1G5GA 1Q72L 2UZYB 1NGZB 2VDNH 4XP6H 3U0TA 4N1HB 3ELAT 5JW4Q 1IVLA 4K94H 3MLTB 3I50L 3T3MB 3VNZA 2DQGL 1IARB 1XF5A 3ZE1B 4X5WA 4X7CC 5AOMA 5IFJB 3X3GH 1JGUH 2UVFA 1NCAH 3IYLW 2EDQA 4OCXH 4PBXA 1Q1JH 3CN3A 5FUOH 5LBSH 3S3JA 4PJHF 4AMWA 4IRJB 2OYKA 3KLLA 4PB9L 4JM2C 3N0PB 5H4YA 3F58H 1HH9B 4UU9A 4OI7A 3HI6H 1PZ5B 2JVUA 1ETZA 3QDGD 4MB5A 1WITA 3VMNA 3HI5L 4HKXA 3MODL 4JM2A 4RWYH 4CSZA 1PNDA 5DZNA 1QI5A 3FRPB 1Q9KB 1S7VB 3P30H 5DS1A 4G9DB 2YQBA 1HHHA 1YNKL 4H8VA 2CWRA 2PYFB 4HWZA 4LSPH 4ELDA 1BF5A 3QXWA 3BZFA 1LO2L 1GGCL 2ESVD 4Y2DB 4FA6A 4LL1A 3CVHL 5E70A 3ULVC 2YRBA 4R0LB 3BGAA 3FQRB 1TJHH 1FGVL 3KPLB 1UG9A 4S1RL 4OZ4A 4TVPE 5AW1B 1DR9A 3ULUL 3WTXA 1ROWA 2GIXA 1D9KC 4A63A 3GRWL 2VB5A 4OLWH 1PEZA 4R7DB 3LNDA 3L4ZA 3MYZA 4ZMLA 5ILTH 2FDBP 1EJFA 4UWQB 1W0VB 1F0LA 3IAQA 3C5ZD 2DLEA 4JFPB 5TDOB 3UAJD 4YEEA 2JI2A 2DQHH 3D25B 4WKZB 1AMYA 4OAWA 1D9KA 5ABZA 4P4RB 1E40A 1INQB 3RNQA 1ZA3B 1KN2H 2NY2B 4Z95H 4R9HA 3MRHA 2CLZA 3U9WA 4TOYL 5BOPA 3FB8B 5FA3B 2NLJB 2EACA 3QQDA 5E4AA 1HXYA 1RK1B 3L17A 5C09B 2D0HA 4EUPA 3CVCA 4MA7H 5F1SA 1F1DA 3D9AL 4AOFA 1FAIL 2O5NA 2X6MA 3BZDA 2YAOA 4LMQI 4OSUL 1TQBB 4KKNA 1BOGA 1VFOA 1XF4A 1AE6H 3ARBD 1U3ZA 3QUGA 4WEMB 3UTQB 5HYSA 5LUMA 5I5IA 1XHHA 4XMXA 2Z6FA 4ZNEE 2FX8L 2VLLB 2W38A 2YD3A 5DVMA 2MQGA 2R0KL 2ZKHH 5GJSH 2ZT9C 2MCMA 2PCPB 4J12A 3ESPA 4HALA 1TOXA 2XVBA 3MRGB 2J2ZA 4KKAC 5F9DC 5GPRA 4BCYA 3FUFA 1AZBA 2OULB 1TNNA 4HCRA 5F9WC 1KYOJ 1QNIA 4NKIH 4PTUB 2J5LC 4LLVB 3ARGD 5I16A 1MCOL 1J8HE 5GRXG 2YD6A 4NB7A 4WUUB 3IDIA 1O9VA 3ME0B 5D1XC 2F68X 2R2CA 2YA1A 1NOLA 3PCYA 5I0ZA 4WNQB 1X5MA 4UOW0 3DK2A 2E86A 2ZAGA 3FU3A 5FO9A 3AQXA 5F7MC 1BXUA 1YEGL 1CUOA 2IG2L 2BX5A 3I9PA 5D1XA 4Y16C 4LSTL 3TYGL 5I2IA 3CVIL 4H1LH 4XRCB 2HRGA 2ZG3A 4YXLL 1P7BA 3BAXA 3RDTD 5I1AB 3F84A 5J1AB 4JL1A 5C0EA 4H8HA 4BFRA 2P52A 3T3PB 4Y16A 3HPJB 4ODVH 1QLRA 5FS5A 4EI5B 5IW3A 3WKQA 4ABQA 3NIDF 1JBJA 4A2GA 3OZ9H 3GBML 1ZHLB 2K6WA 3TPUB 3N85H 4OZGB 5JHBA 1G7HB 2F74B 2PWEA 5EF1A 4ZSOA 3QORD 5AYUH 1X5KA 3BUQA 3SBWC 4Y2LA 2NY1D 1AD0A 3X3FH 4L5FE 3WEXA 3BZEA 3NJNA 2NCMA 4KGLA 1U8NA 4NCDA 2B39A 2RALA 2C9VA 5BV7B 4IBVA 1MPAL 1CD0A 4ZUVA 3SBWA 5DHDA 4RGNB 4GH7B 3TT3H 3NSJA 3VJ6B 4F57H 3VMOA 1MCQA 1L7TL 4K7FA 4K71C 1MWOA 3ASOB 4G71B 5IUCA 1UWEL 3AU1B 4D0CA 3KJ6L 3O4OB 2ICCA 1FCGA 1ZK9A 1MRCL 1MW0A 4HGWA 5B38A 4KQ0A 4HEMA 1HHKB 1E4XI 3UJIH 4LSQH 1C7SA 3WJJC 5AB9A 5E8EA 5HHXL 3RNKA 4OZFG 4X6CF 2VH5H 3IU3A 2MQCA 3AS3A 2GITB 2Z7YA 3BAKA 4KI5D 5KS9F 1RUAL 4XHQA 2Q5BA 1XH1A 4XVTL 5AW7B 4OJCA 3WJJA 2MNUA 4KVCH 2CK0H 5I66A 3WSQH 3NRQA 3P0VH 4G8GE 3UJTL 4ELMF 5HVFB 1JHTB 2YPKB 4PRHA 3BFWA 3I6LD 2TSAA 4XMPL 1X3DA 1NJ9A 1YN6A 2JKIS 4UDTB 1YEJH 4L3EB 3RTQB 3TESA 4HUWB 3D3VE 1MSPA 4QYOB 1GS6X 4KK6C 3MLUH 5ESQA 5EN2B 2YBRB 4HCIA 2ROXA 3GI8L 1U8OB 3U7AA 3MA9H 4NQXA 2FLRT 5HHPA 2DYPD 3U82B 3DVGA 5GISL 1MEXL 1PCSA 1T7VA 3VFMA 4O2EB 5KYNA 1XR8B 3CZEA 3QNXB 4C83B 1MHHA 5HGBA 1D5XB 1CBVH 2OMZA 3DX8B 4E68A 5LBVA 3AITA 1R5IB 5T3ZD 1EXHA 3DJSA 3BSZA 2O5XH 2WQ8A 4XVUC 3UTPE 3QIWD 4AJ0A 2F8VA 2XWEA 2QZQA 3DX6A 1DDTA 4KTDL 4PGCA 5E00B 3VUAA 5BVJA 3MRLA 3BVWA 4QNPE 4MAYC 4JQIA 5IG7B 5FF6B 5IK3A 2N0MA 2FJHA 5G5DA 2EXYD 4G1MB 3NCMA 1R3IH 3FFCD 2XWCA 2VXQH 3IJEA 4MAYA 2CK2A 2AXGA 5JXED 1RJYB 5FYKH 4PVMA 5GGRB 1FPTH 2H2SD 3PIQA 2ARJB 3EJJX 4G8EA 2IXQA 3WEAA 3KPRB 3NN8A 1MJ7H 1IC5L 4AUYA 1HCVA 1XCXA 5A6MA 3VH8G 1TTUA 2XNAB 2QVFB 3MV7A 1G0DA 4NBYB 4TLKA 3GK8L 1YY9C 5BS0E 3G5YB 2EVGA 4KHXH 3QUXB 1AGBA 5LXGL 1DEEA 2EYSB 2A1WH 3A0OA 4ICWA 4HUVB 2CAKA 4UT9A 1MCWW 5BNXD 2I9TA 2NXZD 1K2DB 2HFTA 3LKOA 4K2UH 4LDEB 4DN4L 4ZFOB 4EN3C 4UUJB 1LK3L 1NCOA 3MA7A 1PQZB 3NGBC 5IM7A 4G42A 4B9JA 3ESNA 3GHBH 1KFGA 2A0LC 1JD7A 1R5VB 4OLEA 2PP9A 3DIFB 2P26A 4LNRA 5HGDB 5KSAC 3NIFE 3HG1A 4K15A 5EBWA 3LRSB 4EN3A 3IFPB 4I4WB 2CBMA 3UYPB 3OJDB 1K8DA 1Q90A 3SDYH 3HA0A 1CJYA 4YFLI 5KSAA 1JHLL 2R1XA 2LOEA 4AVIA 1VFMA 3CCHB 3DI2B 3FAWA 4DWHA 1D6EB 2DH3A 3BKCH 2CPUA 5AB1A 5JOEA 2F7OA 2NX5D 2HVJB 1KSRA 1SQ2N 3MNMA 3EO1B 1KCUL 4BDVA 3GI9H 4RMTA 3BZ4A 3OQ3B 4GRLB 3IDMB 3MRCB 2ETWA 4TULH 4UQAA 4YDKH 4QDGA 4IW4C 1JMXA 4JKPH 1BZ9A 1U8KA 3B2XA 1RI8A 1R6VA 5IMOB 4YHPA 1LXMA 2ADIB 3JWOH 3I9AA 5DU7A 2ZSWB 2DQEH 4FI6A 5IJBC 3HRPA 1HNFA 4HF5H 3M1OA 4HJJH 2YS4A 4CVZA 2A99A 4HEPG 5G4MA 5GIRB 1A0QL 3MQIA 4RRPA 2IVFC