4WKZB

Complex of autonomous scag cohesin cohg and x-doc domains
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
NNAVINVDEMNEAFKDVPDLEGEGAHITLSNTTAKPGEMAEVTMSVSNADMQWNMCGIHIIYPDILKPEMKDPEERTVAFQKGDALEAATGIVCMEWQEGLPPVLTENKKGCLFLTAMFSGNQGGEGDMATFRFKVPDNAEPGAVYNLGYYYMNTDLFINEQNIPTYQKYAFTHMEGGTITVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cellulose-binding protein
publication title Complex of autonomous ScaG cohesin CohG and X-doc domains
rcsb
source organism Ruminococcus flavefaciens
molecule tags Structural protein
total genus 47
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2014-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wkzB00
2O4EA 4UYQA 4FL4C 2VN5A 3BWZA 1QZNA 3KCPA 4N2OA 5AOZA 4DH2A 4FL4B 2JH2A 2W1NA 2B59A 4WI0A 2VN6A 1G1KA 1OHZA 5K39A 4IU3A 4UMSA 3F2LA 2ZF9A 3KCPB 1ZV9A 3UL4A 1TYJA 2XDHA 5G5DA 2VO8A 3FNKA 4WKZB 2BM3A 3L8QA 1ANUA 4UYPA 4IU2A 2OZNA 3GHPA 5LXVA 2Y3NA 1AOHA 2CCLA 4U3SA
chains in the Genus database with same CATH superfamily
2EXYD 1U6AL 3IS1X 1Z5LA 1CXHA 2CK0H 2I9TB 5CFAA 1J5OL 1HDMB 3W0WE 4XCFL 2XC8A 3OMIB 1VDGA 4I4WA 1OE3A 4E5XG 1CE6A 3TVMA 2OMVB 1A1NB 4YBQD 1NIFA 2ADJB 2LGNA 2O6EA 4Z3TA 1R75A 1YYML 2WNXA 3FJTA 4QRRB 2QSVA 4NO5B 2Q8BL 1NCGA 3M1BA 9PCYA 3L4WA 4JDEA 4Q6IA 3OZLA 2AK4A 3DYOA 1JYVA 1P5VB 1M05B 5AOKA 5I16B 1RJYB 4AQ1B 2I25N 1EGJH 3INOA 4OZ4B 3TJHD 5LNDA 2XETA 2HKAA 1ET5A 2ITDA 5DVNA 5HI5D 2XG5A 2A74B 1RIVL 2JF1A 1RZKL 3KDMA 4OZFB 3EXJA 4KK8D 4GRLD 1J1OL 1KZQA 3E6HB 2DWEB 3MRNA 2NX5A 4Y9FA 5FCSH 4FA8A 2CR0A 3S5LB 3RJOA 3RJQB 1DQLL 3FZUD 3KGTA 1MIMH 1NCNA 2HVJB 1LEIB 3HC0A 4YL4A 4F9LC 1CVRA 3A3YB 4RAUB 2DV6A 3WIHA 4UDUA 2E4FA 4JFSA 5EIVA 1DHKA 4KQ4H 1OTTC 2QGCA 2WKLA 3ISRA 3F7RA 4FG4A 2CIKB 1MZZA 1WA0X 1N0XH 5L2KB 2CKBB 4E42B 5IGXH 5T33H 1A65A 4KGJA 5CO1A 2DH2A 2N4IA 5JIHA 3U4AA 2C9QA 5KYNA 1EXUB 2HJKB 3TESA 2GTWB 3DC0A 1C5CL 1CPUA 2R15A 3BGMB 2V2WB 3C5ZD 3BIKB 4H4NA 5IVXF 3L9RA 1B4JL 1EBPA 1VA9A 1P1VA 4WUUB 4CADB 3MUGA 1E43A 1YNTF 3D4GA 3O4OC 2WPGA 1EAJA 5BS0E 4L2LA 1LNUB 2D31B 3LRKA 4HFWA 3KYMA 3U36B 3T9WA 1N2RA 5DMGC 3ES6A 4MMYA 1HCZA 2H2SC 2QADB 1HAWA 1MUJB 4JFOA 2XA8L 3L2NA 3D0VA 4LEEA 4U1KB 3QH3A 5BRZA 4D9QD 3HC3H 1LO0L 1NPJA 2WZ6A 4BFNA 1QASA 4KZDL 2LFGA 2XZQH 4L8SC 4MX7B 3VI4E 1OP4A 1PSKH 2CO2A 3LRLA 1E9PB 4G9FE 2EEDA 4KKLC 1O7SA 3C9NB 3PL6C 2YD2A 3CFQA 3QORB 3LEVL 2FSEB 4YNYA 4UTAH 2Y72A 1HJCA 3QEQB 4G6FD 3DRQB 4AVHA 1GHFH 4P2RA 5ABZA 1MJJA 1B2WH 3RZCA 2YRLA 4FNRA 2P5WD 1BOGB 1PZ5B 1A4BA 4Z7WE 1QPKA 2N56A 43CAA 1Y0LA 3N06B 4IRJD 2EO7A 1BQHA 1QSVA 5AYUL 1TMQA 2EICA 1T22A 5CBEA 1ZHNB 3OB8A 1FORL 5IVNA 2FO8A 5KVGH 2WP3O 4QHUA 3ZDXE 1P7HL 4DZ8A 3S3BB 5E4AA 4U31A 2RGSA 4LF3A 3ZTNL 5FGCE 2OYMA 3E8UH 2H0PA 5C07A 1GW6A 1FFOA 4UQCA 3IVKB 4KROC 2ZXAA 3QNYB 3LKOA 1JNHA 4IRSA 2V7HB 3RY6A 3GINA 1SOKA 1NCDH 1PZDA 4AK1A 3DUUB 1RMFL 4M7KH 5DA4A 4EKJA 2XZCH 1FNGA 3GB7B 4RSVA 5JW4Q 4G7YH 5DK0B 4Z7OE 4E5XA 3M1OA 1L7IH 3F65A 2XN9A 2I5YH 2LFEA 2P24B 4LCUA 4BSWB 1G6RB 3PQYB 1YLBB 4MKTA 5KN5A 1MSPA 5JPNA 3ZE0F 5KSAB 1QLEB 2FJHB 1DBBH 2B59A 5EN2A 5T5FL 2R0LL 3ZYIA 3LN4B 1LK2A 5CJOL 3TT1L 2XXMB 2BVPA 3V4VB 5HYJB 3MV8B 4K2UL 3ET9F 3ZKND 1ADQH 4H0LC 3ZDXF 1FYTD 3FSOA 3QQ3A 3UBFA 2XKUA 1XF2A 4UU9B 3PAZA 3X3GL 4NSKB 4YN3A 4PBVC 1TTUA 2RQEA 5D7KD 4ODVH 2EIEA 1NGWA 5I15L 2VDPH 1NCIA 3GMMB 3IFNL 1IEHA 3KNBB 4UYQA 3RVWC 4IS6A 1RZ7L 3C8KA 43C9B 5INCA 1S78D 1CK0H 3BMWA 4K3DL 3QHTC 2N7BA 4F8PA 1J9RA 3IJHA 3JV5A 1OHQA 4XO3A 1EAPB 4P23C 4PRIB 4UM9B 3ENEA 4FXKA 4N8VG 4QHLB 4QXWA 4Z7OF 1B9KA 3GIVA 1VKXA 2WYIA 4PWIA 4X7TB 4MB5A 3U0TA 2ED7A 2EIZA 1S9VA 4C83B 2JK5B 4OZIE 3KR3H 1T80A 4X4MA 3W0WA 4KJWD 4ODTL 4LFHG 2YS4A 4PBDA 3TCXA 4XCNA 3JUYA 4N4YB 2EYRB 4ZYKA 2QPFA 3F7YB 3Q0HA 2YPVA 5TFSL 3OM3B 2GIXA 3MCKA 2FB4L 2CK2A 5I5JA 5ANHA 4R84A 3BEVB 3I85A 2MQCA 1VZHA 1QSEE 3A22A 5ESAA 1KOAA 5HY9B 3H6JA 1VPOH 4UQIM 4GAFB 4EI5C 3BFWA 1UXSA 4M43H 5CIPB 2ZCHL 2APSA 4J6RH 3VYOA 1S7RA 3RBGA 1F86A 1F8TH 4NDMA 5DSCB 5DHEA 3UMTA 3IDIB 1ZV2A 1Q0YL 4KKPA 4I13B 1TCRB 1FN4A 4Z18A 1OP3H 5FA4B 1K6QH 3ARFB 1U3HD 3VRJA 2Y5EA 3FT2B 2H9GA 2HTKD 3NA9L 4OD3L 2LU3A 5HHPB 1OAUH 3NQKA 2Y7QB 5FOJA 5I75C 3NIDE 5JW5B 5DD0H 5MHSD 5E5UB 4AGLA 5F7HA 3U6XA 3KL5A 4BH8A 3MJ8A 2IH3A 4YDLC 2B2XL 3FCTA 4L3EB 3WY2A 1N0LB 3L9BA 3DSFH 4K0OA 4CSZA 1REIA 2MKWA 3WTVA 1NEZG 5KG9A 3OKNB 3NZ8B 4LMQI 4JGNA 4HIHA 4NQED 3TFKD 3ERXA 1YY8B 1MWAB 2E9JA 5EF2A 1TQTA 3MC0A 3OAZH 2FX8L 1ROWA 4JHUA 4P46B 5TE7L 1CICA 5E2WL 2AJVH 3FQ2A 1IZJA 3QEGH 1Y6NR 2R27A 2XX1A 4OLVL 3X1EA 3T2NL 5KBDA 5FA3B 2WZPD 1L6PA 3TNMB 3VI3E 5D9SB 3I2CH 5CZKA 4OIAA 2A9ML 4NKIL 5BS0A 2OZ4A 2KERA 5HP5A 1F6FB 1AR1C 1ZLSL 5E1HB 3GS7A 3KS0J 4PGBB 4WFFD 1N19A 2ZX8A 3R18A 3K4AA 1HH9A 1VGEL 2FDBP 3WMQA 3HZKB 1B6UA 1S9XB 1VFAA 5DMKA 4YXKH 3PJSB 2WOYA 4N0UE 5D2LF 4MTMA 1DANT 1C12A 2KZBA 1F42A 4U7KA 1NZRA 2IADB 2XWDA 3K6SB 4QF1B 3LH9A 3NIDF 4XNBA 3RNQA 1SHSA 2MPVA 2V8MA 3OJVC 4M3JA 3VI4A 4L37B 5D1ZD 3GSRA 1NEUA 4G9FA 1FH5L 4KO7A 2XNAB 4Y4HB 2WLYA 2GBTA 3QRFM 1ZGLA 3JVFC 3WFCL 3K81A 2WO2B 4N0FB 5HI3C 1UKSA 4MQXC 1L9PA 2WGNB 4PJ8B 3LN5A 4QRSB 5JIDA 4HC1A 4Z7WA 3OLGA 4PJBE 3GXPA 1W8EA 2EEBA 4OGYH 1WO2A 3VI3F 5HDQL 1T4KB 4AYGA 5KYUA 3UERA 3EYUH 2V2TA 2MNWA 2X4PA 1UCBH 2AEOA 4UQEA 4LO9A 3FB8B 3RWCB 2Y36H 4FTVD 5KSVA 3SIKA 3RTQB 1BLIA 4KQ3L 3CBJB 3QDGB 1E5BA 4D9QE 2AJYH 4ALAL 3DHMA 2X1QA 3MRGB 1IM3A 3T2QA 3NESA 2F1AA 4XN5A 5DD6B 5DLML 2DF3A 4PJFF 4FI8A 1KFGA 4J3XA 4OLWH 4E36A 2WANA 1BYNA 4JW3A 4FFZA 4X4KA 1LJMA 2E47A 2H7WA 1I3RA 4GMTH 3U2SB 5DGQA 3UAJC 1KENH 3QEUB 3QUXA 1RLWA 2P5WE 3BZ4A 1KCUH 1OGAD 1Q0XH 3EOBB 4GT7A 1JK9A 4N90D 1YEDA 3QQ9D 1HJBC 4NRZB 4B9GA 5DO2D 3WNIA 4RWYL 3MO1B 3JYCA 5B7EA 4YSUA 4PJBF 4HBQA 4ODXA 1IAII 2PO6C 2BK8A 2OM5A 1OM3H 3MRDA 4PLKC 2VL5A 3OJ2C 4XMKL 5BO1L 5FK9A 1NC4D 2FECL 4OF7A 3ECUA 2ZCKH 1H19A 3AC0A 4EJ1C 2ORBH 3FCGA 4U3XA 2R56L 1TJHL 1UQSB 4MWFA 2QTVA 1K5WA 3NCCB 5F71A 5AW3B 3WFEH 2OQJA 4WEMB 5IQNA 3ZE2E 3QI9D 1W0WB 5E2JA 4P57B 4FLQA 3P77B 1SQMA 5E5RB 5AYQA 2O72A 1OAKL 2FO4B 5IJDC 1RUMH 5IW1A 3DIFB 4F8NA 4LHUA 1TOXA 2Z0UA 1KELL 2W80C 2A73A 2DLFH 3DA0A 3BVNA 4DJMA 2XPGA 4JFDB 4IIQB 3SD2A 2WXGA 2ESVD 1HNFA 4OKVB 4AV0A 4WTXA 3GHBH 3UDWA 1SEQH 2BIQA 2VC2B 1OLLA 4OZIA 3TT3H 1YEWA 3Q2CA 3OKEB 1OAJA 2H1LM 2P26A 3FPXA 3VQ1C 4KRPB 4B53A 2PPFA 3A47A 3D25B 3S3DB 4MDIA 2R2HB 1JV2B 4P4KB 1L0QA 3OXSA 5AL0A 4Z76A 3KYNB 4RNRB 3HKZA 3UADA 1DVFC 2XWCA 3BT2L 4L8DB 5HYEA 2QR0B 3FUFA 1QSEA 1XGPB 2KT6A 2P8MB 1TT6A 1D7CA 2H6UA 2VWEE 4MNQE 1MVUA 3ZE2F 4DZBB 5KUMA 1U8HB 3QUMH 4BCYA 1YN7B 5DHXB 1VFUA 1YVLA 3CUPB 3D08A 2Q9OA 3NJLA 4HDIB 4O5LH 1MNNA 1OARH 3QPQD 4GXVL 3MRPB 2ADYA 1R6VA 4WUKL 5IIEA 2LE9A 2VZOA 4XNQB 3CLFL 3UJJH 4UOZA 1BQRA 4OF0A 3TCLB 4WIQA 4ZMTA 3H3PL 4HUNB 1MW0A 1E6OH 4N20A 4D0DB 1WFIA 5FKPB 2FT8A 1OSEA 4HCIA 4KKAD 4UQ3B 5CILH 4BE5A 5KW9L 4HUKB 5KVGE 1MAML 3VRLE 1WFJA 1T6BX 5EZIL 1SY6H 1KUMA 1X5IA 4UT9H 4H8WL 2HLAA 3CN3A 4AQAB 2OSLB 3T8XB 2DQ6A 3O3AA 1P9MC 3TH4T 2WUCH 3S37H 5J3HD 4UYPA 1MLCB 4IBQA 5HVWA 4QYAA 2K6ZA 4GS7C 1C1EL 1CUOA 5DURD 4K9EC 4N9OB 2DQEH 4UILL 3N55A 3FTGB 4G6KH 2FJSA 1OSYA 4ZNEE 2EIDA 3SDCD 4L2YA 4GRLA 2KMWA 3UG4A 3UTTE 3VI3A 3T77A 5FO9B 1E4HA 2FBJL 4HZLA 1E3XA 5I1JL 2DQIL 3U4KA 4AVJA 1XEUA 2YZ1A 2R7EA 4FFYL 1LO4L 3T4AA 1CFTB 3P3YA 3UPRB 2WQUA 4Y7MA 2UYLB 4Y2OA 4Y88A 2VDQH 3WKQA 1FL5B 1QLRB 1NSNL 3R06A 3AREC 4FNQA 5MHSE 2ZXBA 5CEXB 4YK4C 1EJOH 4NHUA 4TNEA 1BF8A 2X5PA 2Y6TE 2HP4A 3AY4C 3QFJB 3LSOB 3ZDYB 4ZPVB 3WXVL 3ULUH 1ETZB 5TK2A 1AQKL 1NFDE 3EJYD 4NQEE 2VMDA 2VXSH 3MGOB 5IWLC 4GXFA 3ZDZF 5EU5A 2JKTM 1Z6JT 2YK1L 1I9JL 4ZMNA 2XWBB 4G8GB 1XH2A 5DRWB 1IBGH 2D73A 4HPHA 4YSQA 2JTYA 3X2QB 3C5ZA 1NAMB 2Y9RT 1AKJD 4UM8B 1GMEA 4JFZH 5EZJB 1KCSL 1DUZA 1XF5A 3QJFB 3QWRD 1OAXH 2L4OA 4NJAL 2W95A 3KJ6H 3E1F1 4UANA 5ADPH 1M2VB 4HQQL 4PJBA 5JDJA 4WFFE 4HZAA 2HFGH 3M8OL 1KC5L 5D1XC 2H2PD 3HC4L 5AVYB 4BIKA 1GCFA 1V7MH 3OXRA 3ETBJ 1CLCA 2OTUB 3ME0A 4UIKL 4FI7A 4G6JH 2A1WH 1CLZL 3IT8D 3CXHJ 3QT2A 1ZIAA 2DQGH 4Y4FB 3RZWA 5IW6B 1JWMA 3FT9A 1FNSH 4YDIH 1K4DA 3GMNA 2OS7A 1WZLA 3DVGB 4Q2ZA 2ZYSA 2Q86B 2EIMB 1ZVYA 4HIIB 1YPZE 4NN5B 2RALA 4OFIA 1NM9A 3PNWB 5IROC 3M6DA 3S4SB 3VH8B 4N6RB 2DIBA 4F7CA 2ZSVB 1NFDF 1NINA 1UT9A 2NTFA 3FQNB 2YA1A 4NZUH 4YZFF 1H3VA 1ML0A 2XWJA 3GK8H 2HJFB 5ECJE 1EZSA 4HJUA 4XX5A 1CFBA 4KY1L 3HG1D 2P5WA 2X89D 1EGJA 2IBGA 5FM5O 3ULVL 1VGKB 4ZFFB 4XVUD 5AW4B 1XSIA 1SJEB 4BDVB 1O6TA 2IPTL 3S3CB 3GSNL 5EBLB 1TQBB 4FTVE 3HE7C 2H0JA 1IVLA 5DR5H 5BV7C 1TO5A 1NMAL 3UGEA 1EPFA 5AW2B 1B0IA 3CK0H 3OV6A 2EDRA 5GGTL 4TTDD 2DRUA 4NKMB 4ODUB 3CVDA 4XXCC 1O5PA 2YUXA 1FDLL 3MRBB 3TPUB 2BPBA 1JGLL 1I7ZA 3TURA 2B4CL 3EBAA 3Q3GA 4FJ6A 5F6HI 3NTCL 3VSUA 2G0LA 4D8PB 3PDGA 1YPZF 4H0GA 1WUZA 4UTBH 1G1KA 3OAWA 3ULUD 3W37A 4ICWA 4JUTA 1I75A 3CFIC 2P47B 5I6LA 5AVXB 4YDVA 5DGRA 1FVEB 3SDDB 3W39B 1Y18A 2ITFA 1TDQA 1KN2H 4JREC 5F7MC 3KBEA 4OUOA 4IDJL 2G3XA 2NY4B 1CQKA 3TBSB 5AG9A 1A6VL 4CDGC 2PCXA 3G9AB 4OSUL 5B8CC 5CJXC 1I1FB 1COBA 3QZLA 2PR4L 4KKCD 3D9AH 3ECQA 4HS3A 1BX2B 2ZNXA 4QHMA 1IV8A 5GZOD 1BFOA 4JM0A 4NT6B 4ZS6D 1N26A 3G5ZB 2H41A 3MJ9H 2FE0A 4Y1TA 5FYLH 4XGZA 5I1IL 3FO9A 1PEWA 3OR7B 4NP4H 4YSOA 5FCUL 3V4UL 5AENA 2BSRA 2V0AA 3CPLA 4BZ1L 5C0JB 1NH6A 2FIKB 5J1SC 1F41A 2H0FA 5FYJH 4MB3A 3PWNA 4OFYD 1DJHA 1HSBB 4PJ6A 2RFXB 4UINL 4V1DD 3I50H 1N59A 1ACZA 4X9GA 3WY4A 3SPGA 2AFNA 5I18H 3UEZA 1QHPA 1A6AA 4MNQA 4PJIE 4RDQF 4UTAA 1A9BA 1OP5K 3AQDA 3RX8A 5I28A 2E7LA 5DJCB 2DLTA 2X4RB 3BHBB 2VR9A 5DFVC 3TBBA 3WE6B 2NSXA 2ZAGA 3NIGE 1PF3A 1ZMYA 3Q8EA 5D2NB 2DQFA 1KEGL 2Y6SC 2WBWB 3RL2B 2O61B 1JPTH 3ATAA 3OHMB 4RDQG 2H26B 4UOW1 5DZVA 5D1QD 2J1KA 2C7UA 4ZSOE 2VLJB 5KTEL 4XP5L 1J9QA 2OJEA 4R4FL 5JUEL 1IGCL 3RKPA 3QYMA 3Q05A 1PZAA 5FKAA 3L3GB 4IGBB 1J8RA 2C9XA 4GO8A 3QZPA 4PY8I 3S3PA 2COQA 1MLBB 5EOQL 2FNWA 3IBOA 3QULA 3K2KA 3VFGH 5HHVL 3V0GA 5GS0H 3V4PH 3F12B 2DH3A 5EUOE 2DQMA 3F7LA 5AKTA 3HUJB 1ZT7B 3GRWL 4NHCH 2MCG1 5KVDH 2Z35B 1F56A 1ZS8A 2BCKB 3O4LD 1EANA 3ARXA 3KYAA 4ZNEA 1U8PB 4KZEL 4WW2C 3UTTA 5DD1L 3GMOA 4WI9A 1Q9LA 2AEPL 4GW4A 5D72H 4YFEA 3BAEH 4XBMA 4Z7VB 3F7VB 4OZGE 3VMPA 3RIAK 1U3HA 2B9AA 4YDMA 2CDFA 1EMTH 4ABUA 3CFNA 1WPCA 2GSGA 3T65B 3FQUB 1VEPA 1Z32X 1Q9OA 1E30A 4HV8A 3FU5A 3O81A 1KXTA 2M1KA 1B3JA 4X6FA 5AW0B 4TLKA 2K4WA 2NY1D 3WUZA 1NFDA 4H88L 4ZW3A 2J2ZB 2H3NA 1MFMA 2KC0A 2GBAA 4NQEA 4OIFA 3MLYH 5FYLD 1K5NB 2Q6WA 4X9YA 1ADQA 3IETB 4APQD 2ILLA 4PJ9C 4X4ZA 2AEWA 3T0EB 1OZUA 3FXIC 3K7UA 3JWNH 5I5MA 4FFVD 5MEOA 3R7RA 4OB5H 2WYHA 2XQBH 4JFTA 4YGVA 2WZPA 3F7QA 2W9EL 3CZFA 4GKLA 4LSSH 5JXAH 4BK5A 1KYAA 2IAMC 3KE0A 5D93C 3MLVH 2GKIA 2LU5A 5AZ2H 1TLMA 4MJ6B 2Z4QB 4WTQA 1R24B 1XB6A 2XTJC 5DJ8A 2X4UA 5E99L 3U0WL 3LPPA 1O7DC 2NNRA 1Q1JH 1JF6A 5C86A 3B9KB 5HJ3A 4F3FA 5E9NA 5H2BA 3X12B 5DEZA 5DRXA 2WOBA 3H9SB 1JV5B 1QYGL 2B1HH 1AE6H 1V3KA 1WZMA 1ZK9A 5CJQH 4XNAA 2ICCA 1MFCL 3NJVA 3P73B 3MRLA 5D1ZA 1YPZA 3MA7B 4Y2DD 4UOJA 4HVBA 5J13B 1J18A 3E0GA 3SDAD 3MJ7B 2NNAB 4OZFH 1ONQA 4Z7IA 2QDVA 3GM8A 1T4WA 1D2OA 1YUHA 4KK5C 5F7UA 4V33A 1MCPH 2XG4A 5FFGA 5GSRB 1IRAY 3OF6A 5IBTL 3P11L 1M7UA 4TLSA 2FBRA 1DEDA 1QSFB 5DEJA 5IG7B 2XQYA 3ARVA 4XPAH 5GGQL 1S7WB 4BKLA 5B1BB 3H85A 4B9FA 1H5BB 2NT0A 4FTVA 4YFLI 1P84K 2AQ3A 2GUYA 3DPBA 3LVTA 4CMMB 4QTIL 4TPRL 2Z8WC 4UQ2A 3P4MB 5T1MB 5JIQA 2AANA 1TLKA 1IC5H 2CKBH 2D3NA 1JNNH 2VR8A 1U8LA 3FN0L 4ZFGH 4LSRL 1IKFL 2AJSL 2WXLA 2X42A 1HCVA 2XWXA 3LH8A 3L6FB 4Y5YB 3OHXA 2R83A 5A6MA 1AD0B 2V5TA 2VMFA 4BUQA 4ZXBB 1YA5A 3KPNA 4A7VA 4KAQL 1OTSD 3QRBA 2NXZC 4NC1E 5EA0L 2V6HA 3ZZ1A 4N25A 2LW3A 3HG1E 3EO9L 4XTRD 3EOAB 2CU9A 2E7MA 1KTJA 1H3GA 4R3SA 2ISDA 2HLEB 1N3NB 3LKPB 4NNXB 4BFGA 3VU1A 4RAVB 2Y0SA 5E6IB 1IIKA 1LDPL 2XSKA 3UZEA 1R46A 5A2LH 4I1PA 4I3GA 1MCIA 4CVXA 4JPIA 1NCAH 1HXYA 3UAFA 4OCMC 2ZWNA 4N85A 2QQNL 1NC4A 3ZIYA 3DROB 3P9MA 5JHAA 3NCBB 1ZWIA 3SGDH 3V0WL 4N2OA 5L4MA 1BGXH 1FP5A 2YD4A 1X5LA 3BWAA 5I1KL 3RWHB 4P5KA 4ZFOB 3SQOL 4BFJA 5ITBL 3ULUE 3NSXA 5FS5A 3IPEA 4JFHE 1C16B 4RFNC 1JWSB 1KIRB 4Z7QB 3QI9A 5ERWA 2MFNA 3ALPA 1WEJL 3MUUA 4LARH 3VDBA 2WGXA 3UYPA 2HT4D 1I8LC 4PJIA 1JN6B 2WBJB 5E8NA 1MJ8L 5EO9B 2YN3A 3JWOH 2WSDA 3KS0H 4NO3A 1R34A 2DBLL 1P6AB 3RZCC 4NZTH 4QYOB 3TCTA 5IFHH 4EKXA 3L45A 4O4YL 2QELA 3VFPA 2NYKA 4PJEB 5D55A 2D03H 4HKZA 5A2FA 3KVQA 3TN0B 2VLKB 2WKGA 3FQWA 1YEIH 4NPJA 3QUZA 1FNHA 1FA4A 1UUNA 3V10A 1AGEB 4ZSOA 1QMUA 2X1XR 3QCVH 1A1MA 4NQCB 2OMBA 1ZD6A 4OGAD 3EO1A 3PXJA 2VSMB 3QDAA 2IGFH 3GUTB 2ZG2A 4JHVA 3WLBA 2CRZA 2D0HA 2OL3L 4IRZH 3FFCD 3O8XB 2DBJA 2YJLA 2FT7A 4XMVA 4V1DE 1L9MA 3MRKA 4HUXB 4WQOA 2BNRB 1T66C 3KGUA 2JLPA 5EUOA 4TQIA 2OMUA 4F57L 1JERA 1RK0B 2AVFA 4PJAE 3CN4A 5EU4B 3ULUF 4IRSC 3SGKA 1MHPL 2HX8A 2WINB 5IEKA 4UT7L 3RY6C 3GBDA 3M1CA 1A4AA 5EUKA 4YHOH 1G6RH 1IUZA 4EN3D 3MMEA 4WUUD 2J5WA 3CDGB 3GSOB 1GGBH 3AACA 4JRYB 2WWKT 1QLEH 2X2JA 3L8QA 4GNKB 5KBLA 4JKNA 4OZGA 3WS6A 4RSYA 1T7ZA 2BP3A 3V4VH 1NJ9A 1TPXC 2BNUA 3C6LB 3ULSB 2ZG3A 2QADD 2D2CC 2WO4A 3K71A 3L1OL 5B1AB 1EVTC 3US1A 1QFWH 3K6IA 5AVTB 3P0YH 3BFQG 2AJUH 1KLFB 2F7RA 4PW3A 3QWOA 1HEJC 3UC0H 4KKBD 2N1TE 3UMNA 1UOKA 1JUFA 3AVEA 3WN5A 4L8SB 1E9QB 5KANI 2R8SH 3FUJA 4ZX3A 3M7OA 3QJVB 4NZFA 5IQ7H 3ZZQA 1HINH 5DRZB 2W59A 4FHJA 1H3XA 4ZZFA 5DUML 3PL6B 1GSKA 2R0KH 4M6OL 3O4LE 4LPYA 1MCLA 5F93C 4PJAF 1DBAL 4JFXB 1WTGT 1RZIB 4W9CC 5K9QG 2F68X 1JWUB 2YD7A 4H5SB 3BQUA 2PKDA 2O5ZL 2X12A 2VYRE 3SE6A 4ZZKA 3BEWB 1C5DB 3TV3H 3W9EA 3RGVC 1G7MB 5IBUG 1TFPA 2CLVA 3K2MC 4KNUA 2WNGA 4XAWL 5DO8A 4ZNCD 5L88L 3QR0A 4JY6B 2R9HC 3HBGA 4MS8C 3U9PL 4OJFL 5FYLE 3Q6FA 5FYJU 3ULAB 4A2EA 4L5FH 5CIPH 2J43A 5CR1A 4Q8BA 3CX5J 1EHLL 3JTSA 4NUPA 5FYJE 3U7WH 1AKJA 1CFNA 5A16A 4ONGH 3R4DA 1Q9KB 5HI4C 4YDNA 1JNLH 3QWRA 3O0RL 1J8HB 1RIUH 5D7LD 1G9NC 4DTGH 1ZHKA 1MCDA 4D0CB 1GJUA 3VNYA 4WFGD 3GXFA 3PQYD 3QUMA 1ORSA 4WY7H 3NT0A 1C7SA 2CSPA 5F3HA 3TBWB 3QIBD 4L1LA 4M03A 4LSQH 4HJSA 2DDQL 2MQ0A 3SBPA 5KSAD 4AG4L 3D5OF 4HD5A 4P9MH 5T3ZH 1YAZA 3CWGA 1NIDA 2R0WL 4A7QA 4ABVA 5KVFH 3N42F 3AWGA 4UDTA 2ED9A 5D7JB 3C6SA 1MWAH 4LVEA 3CVIL 1S7XA 5E9DD 1BD2B 3NSJA 4KPHL 3DO3A 3EGXA 4QOKE 4XMTA 2AQTA 2QMKA 4KK9C 5SX5H 3H7BB 3TBVB 3GMRB 3UJTL 2YGNA 1XGRB 1SY6A 2PYFB 3U9UA 2G5BA 3DBXA 3WHXB 3KDPB 5B3NA 2VIRB 3HG1A 3MNVB 1IEBB 2X89A 4ZOAA 4ELKA 1YY9C 1CICC 2JSFA 1YEEL 3NACH 2HZHA 4Y19E 3D87B 5LDUA 5KVDE 1JDAA 4ODWA 1QFUL 1BREA 2VITA 4DPRA 3F6LA 1N5YL 4UM9D 1PD0A 4J27A 5KJRL 2R1WA 2CXKA 3KHQA 3MHZA 4YIQA 1RZFH 1T5WA 1MFVA 1T89C 3JT0A 1FBIH 4IHOA 2OP4H 1HNYA 2L7UA 3SKNB 1XCTA 2J88L 4JFQA 2ZYRA 2OJZH 4X6BA 4LGSB 4JHBA 5D7EA 5T3XD 3MOAH 3H9HA 5BQ7A 2QPUA 1MFDL 3TV8A 5HBBA 1A3ZA 5JLZA 3SODB 3MRIB 1YMHA 3TIDB 3LQZB 1UM5L 2X9WA 2QPDB 1AG0A 3RDTA 5J0BA 1IFHH 2YMXL 3CZKA 2N7SA 3T3MB 4PHXA 1ZSDA 4LIQH 3BH9A 3JWNE 5BJTB 4TYUA 5ICXA 1LMIA 2YKLL 4KC3B 4KOCA 2F54D 1S7TA 1W0VB 3QJHA 5AOMA 4ZX6A 2H47C 3EUUA 1JDDA 1EEYA 3ARQA 3NGBB 3QNXA 2XWTB 5IB4A 1HQ4A 1I1AA 5IMKB 2L7JA 2ZXCA 4LCYA 1X7QB 2VKWA 3BKJH 4F80A 3TF4A 2QFRA 5TH2B 1VCAA 2F1EA 2ATKB 5GZOA 5GSVA 3IAQA 3L3DB 2WLIA 3VFRB 2MPAL 4HH8A 4UT6H 1CFSB 1MCKA 4N2KA 2EDXA 4BZYA 3EJTA 1R3HA 1G7QA 4YOKA 3TJEH 1J9CT 1QI3A 2CO4A 3HCVB 3RX7A 3STBA 3WD5L 2C34A 4QRRE 5FC9A 5HHXH 1WBZB 1A6PA 4QO1A 4JG1L 5T3ZD 5IHBA 5E08H 5A2JH 5FLVA 2HFEA 3EFOA 4OFYA 3HI6L 3HN5A 3DWTA 2OBGA 2WQ8A 6CGTA 4V1DA 5JYMA 3IFOB 2B5IC 5IJKA 5ICYA 4PJAA 1SM3H 5I6XC 5E24E 2BY2A 3FRUA 2ZKYA 1W6LA 1PG7H 3AWEA 1D3CA 4ORGB 1QTYT 3OB0H 5SWZB 2FGWL 2X6CA 3QHFH 5CEZL 5F9WC 3EYFA 2EH8H 3HNVL 3CH1A 4FMVA 4A04A 1TZIB 2CGRH 1IM9B 3RGBA 3O3BA 4NP9A 4X7FC 1T2QL 4Z7UB 4DP2X 3IFLL 1DQMH 5D1QA 1A6UL 3L3HB 1AR1B 5FPIA 2VMJA 3VCLB 3QIWC 1CXFA 3JWNG 3KCWA 4LLVB 1I9IH 2W65B 4H2AA 5L2KE 5SWSB 3N44B 3EGDA 2MNJB 5GGVY 1FJ1B 2XPYA 3ARDD 3ZTCC 3HHRB 4IKJA 4LCIH 1GGIL 2CCWA 3GXTA 3ISWA 4XRCB 4JQVC 5IQLA 1KIQA 4O9HL 5AZEH 1CGYA 2WTPA 3NZUA 4JN2B 4PMFA 4AUJA 4HK3N 2PWEA 1IL1A 3ETTA 4BA8A 1E6JL 5B21A 4UTBA 3O4LA 4FNUA 3LD8B 3PDDA 4WUUE 1OO2A 4I0KA 5GHWH 2GPZA 1Y6KR 4LL4A 1AIFA 4YHML 1A0QL 3NSDA 1FGVL 4G1MB 5KOMC 3VXMD 1EQWA 4PP1C 2VC2H 3LB6D 4H1LG 1RHFA 2QJDA 4P5MA 3KPMA 3WDJA 1B4RA 4OQTH 2JKNA 1QHQA 3IFPB 1AZNA 1J0JA 1SMAA 1ZVHA 3SKJL 5IJCC 4WWKC 1UWYA 4RZCB 3K72A 3UDWC 4JFEB 1P0SE 3H8NA 3MJ9A 4JVWA 5DUPH 2GEEA 4K5OA 5IM7B 5IFAH 3D50A 1V05A 5IB1B 1NBYB 2WSPA 4U1JB 1NC2D 3D39B 3VFNA 2O6FA 3HI1A 4I87A 1OY3B 2FJGB 4HJGB 3CSYA 1RJZB 1INEL 3QEQE 4F1SA 4B41A 3L3KA 1DJSA 4Y9BA 4OVUA 2IIJA 4LKXA 3RLSA 4OCRL 4WJG3 5DT1L 1T2XA 4N9GA 1Q9WA 1NCOA 4OJAA 2O26U 5CFHA 3N04A 1SEBB 2LLGA 1OVZA 2AW2A 1JRHH 1S7VB 3CSPA 2YPKB 4FAAB 2LABA 3LQAH 1Q4NX 3MA9H 3BAXA 5FO8A 2VMCA 3EZ8A 5DZAA 2E9WA 1II4E 3SCMB 3F04A 3KAAA 2HFFB 1VHPA 2F0CA 4I3RH 1S9WB 1UOLA 3FT4B 4HIXH 1P1ZA 2G2RA 3L4CA 2WY3B 2VTFA 3L54A 4XXWA 4YHKH 4U6YA 2FR4A 1BXVA 2FLBT 4FP8H 4JE0A 3ZMRA 5HYSG 4QOKA 2CR3A 2CIIA 1ORQB 3TFBA 5DI8B 4NO2B 1K8DB 5CR8A 2GK2A 4V11A 3WEAA 3G08B 3HJ0A 4LP4A 5LXGH 3I3EA 4PCSA 1CDGA 1XDTT 3FAWA 3FRPG 1IBHA 1CJYA 3S96B 5IHHA 3K4ZA 3SQBB 1KTDB 4TUKL 2Y2YA 4NQVA 4Z95L 4WU5A 2B1AH 2ICWI 4WFHD 3V4PA 2QQQA 2Z9TA 1LXMA 3PRZA 2M2DA 4XMPH 5KYXA 3MRJB 4HS6B 1L3NA 3VFSB 3CJJA 4X5WA 2NR6C 4ISVB 4IMKC 4Y19A 3ZRSA 4WFGE 2N7AA 5CMAB 3PQYE 2XXFA 4J28A 4WHTA 5FECA 5J11B 2HCZX 4NC0B 4O58L 2ZOLA 4GKNB 4JG0H 3QUYB 1D6VH 3R7QA 3T4AC 3TASA 1ZV9A 1LO2L 1ZCRA 3L9EA 3MFGB 5HYJE 2WBXA 4OV5B 3CVHL 1I7TA 5B7MA 1S5IH 2X28A 4M48H 1ID5I 1RD6A 3BZFB 4ZX5A 5FGRA 5EIIA 3GFUA 4KRPD 3BE1L 3FC8A 4BKTC 4S1QL 4TNVK 1KXVA 2HJLA 1ROCA 3BD5A 3S8WA 1EDYA 3OG6B 1CTMA 2DM2A 1HZHL 4B7IA 4BQBA 5IQ9A 1DQVA 4DH2A 4UAOB 4PRDB 4K8RD 3WHE1 1DVFB 4UF7C 1JMZA 2IBZY 5F2FA 4MLIA 1NDMA 1KGJA 4AEHL 4HHAA 3C5ZC 2PP9A 4KXZI 1XZ0B 1F90H 5EULV 3C08L 4UQ9A 4A7SA 1JHKH 3AG1B 4XXDA 5IKCA 3DV6B 2E4TA 2W07B 4YHYC 5L2JB 2GBUA 1KBBA 4GAJL 2J57A 3O6FD 4KOBA 2I9TA 2OCJA 1HDMA 4PYGA 2FYVA 1MH5B 1GKOA 1RERA 2DQCH 3GBNH 3ILDA 5EHFA 4FKHA 1IT9H 4QRRA 4FQJL 4I18B 4NO5A 4XPHH 4BGDA 4PRBB 2GB2A 5IMLB 4XODA 1BYOA 3VQMA 1KFAL 2APWA 2XACC 5DD5H 5I16A 5HDRA 1RJYA 5D5MF 5C08B 3LEYH 2FQFA 4OZ4A 3VGDA 1XAUA 3PU7A 4L5FE 4TXVB 4U6HB 5DQDH 2H0EA 1UD6A 1A7OL 2R39A 2FX9H 2JJSA 2A74A 2ZONA 4XNMA 3CU7A 4OZFA 1F11B 3V95A 3E6HA 2DWEA 1AGDA 2F54E 4HP5A 4AZ8B 3D7PA 3TH3T 3I3DA 3C5XA 1RVFH 2ERJC 4XVSH 4C56D 4BFKA 2A4EA 5EV7A 4AJYV 5I76B 2IQAB 2HVJA 3ROOB 4AYFA 1LEIA 1MFNA 3EHBC 1JZJA 2VDNL 4JO2H 1E4XH 4KXAA 4RAUA 1RHHB 1G7IB 5GS3A 1LWJA 3H0TB 1G4MA 5I82A 2CIKA 1ZDSA 5DQJB 5T3ZE 1CI3M 2RIKA 3ARPA 2PWHA 2CKBA 5KVFE 3WJMB 4KUZH 4PVMA 4XO9A 1BM3L 4X50A 4YO0B 4OM0H 2WVVB 1EXUA 2HJKA 3MAWA 2GTWA 3MXVL 1JGVL 1AGCB 1QAWA 3PJLA 4B0MM 1P4LB 3LXAA 2ED8A 3BGMA 3CDFA 1GZPB 2XXCB 1Z9SB 3FTYA 2QVMA 4EN3A 4WUUA 3ZJAA 5CXPA 2NQ3A 2X41A 5J9PA 2G0KA 1GIGL 4K7FB 1LNUA 1RU9L 2D31A 3V6ZB 4ZW5A 2HLFC 1JMXA 1M9WA 3U36A 4JPWL 4O00A 3WXWH 2FECI 3DXAB 1MUJA 3FRPA 3RFRA 4JZOB 1I8MB 3QE5A 4U1KA 1A02N 4R2GB 5FR3A 4RGMC 3NFSL 4WEBL 3PGCB 2MOVA 1YEGH 2XN0A 4IJ3B 3CFUA 2ZZUT 1RAMA 3B2DC 4JPVH 2ZOOA 1DSYA 3NK4A 3HVNA 4FNLL 1E9PA 1P6FA 2FTAA 1ACXA 2XQYK 4TUOB 3ESMA 4S0SD 3C9NA 4DN4L 3I84A 2CK0L 1JS4A 4PRNA 3DRQA 4JB9H 1LM8V 2XN1A 1OP3K 3RIKA 3FONB 1E9OB 2ZYHA 4CSPA 1G7HA 1IAMA 4FYTA 4Y9EA 3RHWF 5F9OL 2Y07L 1BOGA 1NCCL 4N68A 4TQPA 1I8IA 4XWGL 2WXMA 5EFIB 4YBLB 4O2CA 2VWEC 1AR2A 4JFFB 3S8FB 3SJVB 2Q87A 4LIQE 1DLHB 1PMYA 4JZJB 2E7LC 3VXUB 2DS4A 3ARGB 4NJ9H 1G9EA 1ZHNA 2F5AH 2ZKWA 5BMFL 4M6MH 2VM9A 4M02A 1JPEA 1XFPA 3QDGE 4GMSH 4ANVA 1DVXA 1HHIA 1BVKA 3O9WD 3MLUL 2EH7H 2GT9B 1CFQB 2NY0C 2WQAA 3OAZK 4LGRB 1OPGH 5IB2B 1V10A 1RZPA 2KI6A 3IVKA 3AS2A 3KPRB 4H13C 1XSKA 4M8UA 4AYEC 4DUXA 1JPGB 5K69A 4UCFA 2V7HA 4JEGB 4BWWA 1B9ZA 1RZJL 4F7EB 3Q8CA 4HT1H 3DUUA 4IRZA 4K55A 3H55A 4O02L 4QLRA 2YPLD 3ASWA 4XC3L 4HMDA 2VUKA 4QCIB 4CMHB 3GB7A 5JO5A 2OMYB 4JO3H 3EJZC 4U1LB 5DK0A 1OGSA 4NUGH 2B7DT 2KLRA 1HE8A 2ROXA 4GUCA 3WIIL 5FXCH 3RTLA 1UASA 1G6RA 3PQYA 1NEPA 4KX8A 5I73B 4LBEB 1G9HA 5KSAA 4O2FA 5ALCL 1MEXH 4O2EA 2VXTH 1WBYB 2ZIDA 1FYHB 3LN4A 5DJDA 2AZUA 1U3HC 4JHWL 4APXA 4LPVA 4P59H 4KJYB 3V4VA 5HYJA 1JPFB 4MJHA 2QV4A 1ILSA 1CD1A 4PGCB 3TIEB 1WCBA 3LRGA 4PMEA 5CCHE 4L8CB 4H8QA 4NSKA 4CC4A 1B0WA 1D5ZB 4EF3A 1BXAA 4PUBH 4QWWC 1S3RA 1HL4A 3GMMA 2X4NB 4WFHE 1MFAH 1MDTA 1L9QA 4UB0L 3P3SA 3MNZB 4MA7H 3DVFA 3LZOA 4GT0A 1V55B 4OLYL 2FO1A 1EAPA 3SQRA 5F1KC 4I1NB 4UM9A 4HU8A 4Q52A 5HGAB 4IOSA 2IG2H 3L7FA 4QHLA 2CBQA 4M5ZH 1UM6H 4X7TA 4KK6D 1ZA3B 4JPKH 1GHFL 4I85A 3EGSB 4DCQA 1NFAA 1OGPA 3KBPA 4C83A 2YUZA 2D7OA 3ETBF 2KPWA 3OWRA 2ZF8A 2FH8A 3A4AA 2VDRL 2UXGA 4JRFA 1EJFA 3S8GB 1BAFL 1JJUA 4DAGL 3WLWD 2EYRA 1BBDL 4L48A 3T5WA 4QNPE 3DOHA 3F7YA 4P2OC 4MCZB 1ZANH 2UZIH 3IM1A 1NGYB 3T8MA 3WDIA 2NSQA 5D1ZC 5CLYA 4A63A 4Z7NB 1ERNA 2DTMH 4PWJA 3ZRCC 5HY9A 2LTQB 4HUVB 2EE9A 3ZTJG 5C8JB 5CIPA 3K5SA 4H8WC 1WAAE 4YSEA 2GTZB 5DSCA 3IDIA 1PPIA 2F54A 4RBPH 4XCEB 1TCRA 4WW2B 5FAAA 3BUDA 3Q9QA 4OD2B 3PDOB 3FT2A 5LAXA 5HHPA 4M7KL 1RSFA 2ATPB 1OT1A 2F6AA 2Y7QA 1H3TA 5JW5A 4NZ8A 3I9GH 1L7IL 2ZOKB 3BAIA 4QHKI 2P80D 3TL5A 1N0LA 1QPPA 2GI7A 4LSTH 1G84A 1PX3A 3NZ8A 2NY6D 3OKNA 3SGEH 4PWHA 3Q1SL 4KDTA 3INUL 4X2UA 1MWAA 5I9QC 5HPMB 1G5AA 2VN4A 2BOLA 4QNPF 5TJWK 5IZ7A 4P46A 1T21B 2NYYD 4K7PY 4CL7A 4GAGH 2HMID 4EI0A 4RX4D 4YC2C 3RVXD 3VXSB 2R4SH 4KH2A 4GPVA 5FOBB 2Y7MA 1ADQL 4GAAA 2PCPB 4X7SH 2TSBA 5FA3A 1U4EA 1YQVL 1SN5A 4ODHL 4BGLA 5D9SA 3WUWB 2WIIA 1QW8A 2TSAA 2P52A 5DMIL 1PZBA 2F58L 3BP4B 3HFMH 1WAAF 2Q2LA 4TQHA 2YOAA 1TMCB 1NUFA 4N8CH 4P06A 2VDPL 1SHMA 2CHZA 4PGBA 3ZGIA 1ESOA 3HZKA 3MV9D 1S9XA 5DO2C 3WE1A 4ZPTB 1SXNA 3PJSA 5I6NA 4KO9A 4JM2D 3D2UB 3VRIB 3TEWA 1CK0L 3UZEC 1U9KA 2CHNA 3QFJE 3ZDYE 1MVFA 2IADA 3BSHA 4J5VA 1BJ8A 4IBYA 1TZOA 4J6IA 4F93B 1UACH 4L37A 1JF1A 1EFXB 4DVRL 1T0MB 2P3YA 4YXHH 2XNAA 1TJXA 3R0NA 1SLUA 3UIYA 5AOLA 2YHGA 3F2LA 5IVZB 4Y4HA 4Y16B 1AQMA 1EIBA 2ZCLL 4JKMA 4HWBL 5E2VH 3US9A 2IANB 5DVKA 5K33A 2AJZB 4JFPA 4R7XA 3DECA 5AW9B 3JWDH 3NJNA 1UVQB 4PJ8A 4QRSA 1QUNB 1GC1C 3CG8A 4PIBA 3TA3B 1NKOA 1FO0L 2J71A 1RULH 4G6ML 4ZFQA 1T4KA 4U0RB 1Q90A 4UV7L 4A68A 2QGBA 2CUMA 4PHZA 5DCCA 3RWCA 3FHQA 3FB8A 2WV3A 2DI9A 3BGAA 4AXWB 3TZVD 3RTQA 3ATEA 2IJ0C 3QDGA 3NCEB 4DW2H 1ZE3H 3MRGA 1XWVA 2HTLC 4PJ5D 3B5GA 4NIKB 1DVZA 1WISA 5E9AA 1JHLH 3Q01A 5DD6A 3QUZC 4UT6A 4W9JC 4X9FA 3UTSB 3WFDH 4JMNA 3ZDYF 4DP1X 2OW6A 3PAYA 2DLIA 4S0HA 3H4HA 4ZTPH 3NH7H 3QXTA 3U2SA 1HAUA 4PJHB 5I66B 3OMAB 4L1HA 3VXTB 4JRXD 4YHZL 5IESH 1NCWH 3HR5B 4HH9A 3QEUA 1IGTB 5TDOB 3EOBA 4IIZA 4H2CA 4NUJB 2Y25A 5JA8B 1VADB 4L0YA 4FQLL 3SGKC 3KYKH 4KNSA 2PTTB 4HCRL 3W9DA 5MEND 2KDGA 3MO1A 5F6HJ 1KY6A 1MCWW 2ZWYA 1EHKB 2ZUQB 5E6ID 4ZFZB 4DERA 2VXQH 3VD7A 3ARWA 3QPQC 4CU7A 3KLKA 4PJCB 1N7MH 4WTWA 3WS6C 1KB9K 5AW8B 1EK3A 3RFZC 1QBBA 3ZOAA 3UO1L 3T0WA 4M29A 1T6VN 5J12C 2IBBA 1YEHH 1EZVX 1FSKC 1UQSA 2VDMB 3GTVA 4KKAC 1AXSA 1KPRB 5KBMA 2HKFL 3BP7B 2Y1AA 1T1XB 1F00I 2YPLE 1XQ4A 1W0WA 3K2IA 1LGVA 5E4OA 5AAMA 2CBMA 3T0BA 1IE4A 5GXBB 2K6YA 2OR8A 3T8VA 5E6RB 2FO4A 4BK4A 4LLUB 2WBJD 4AZUA 3DIFA 3Q5YA 3GIZH 3UP6A 3WV0A 5MEQB 5I6PA 2OMTB 3MNWB 1P2CA 3LAFA 4IIQA 4KH9A 1FVCB 3PLYA 4AW4A 3FN9A 3N41B 1YEFH 1JGDB 1EBAA 3BQUC 4KQ0A 2H3KA 3T3PB 1Z9OA 4LVOB 4X7EC 4YX2L 1UADC 3ARBC 3ZUNC 2B0SH 3OKEA 4TSBL 3CHQA 4OQTA 3ZIMA 1WZ1L 2X9XA 4R90L 2R1XA 4PB9L 4UZGA 3D25A 2DQDH 1FHNA 2OMXB 2OLDA 2R2HA 1JV2A 1OTTD 4P4KA 4PD4K 2VOTA 3KYNA 4RNRA 4L8DA 2BNRD 1PD1A 2AJYL 3MZGB 3QW9A 4MD0A 2P8MA 1XGPA 2HT2D 2L7EA 2Y2TA 1TG8A 1ZPUA 2ZNWA 3PHQB 1H3PH 5K1JA 3BGFB 1WAAA 3G9VA 5E6SB 1U8HA 1YN7A 1GA2A 3CUPA 2H5UA 4H8VA 3HN3A 4JRYD 5DQ9B 4HDIA 5D2NE 2VXUL 4GMTL 3LXCA 3PAVA 3X11A 2V17H 2XZZA 2VLRB 5GRZA 3O6FA 1XHHA 5JPMA 3GGWA 5C0RH 2ITEA 2NQCA 5F21B 2H2PC 2DOCA 2VLJE 1Q0XL 2HWZH 4YR6A 1T1YB 1X7SA 4D0DA 3O6LH 4L1SA 2NY3C 5DMGD 1LMKA 5FKPA 4UQ3A 2H2SD 3MNMA 4HF5H 3ZLQC 2VSDA 1MPAH 4AQAA 2OSLA 1CLYL 2VSKB 1HHKB 5EOCL 1WGOA 1D7FA 5FUOH 1MLCA 3SY0A 3HUJE 2P44B 1GZQB 2EQDA 5G4NA 4KKLD 1QD0A 2JE8A 3MRFA 5AB9A 3PL6D 5B3JF 1HSAB 3FTGA 1U8CA 3UZQB 4PBXA 1ACYL 4LRNL 1SOSA 3DOIA 4NC1C 3JXAA 4CUCA 1D6EA 3O6MH 4ZJ9A 4QEGA 3NFNB 5C0AD 1GGTA 3D3VD 3LH2L 2AXGB 4OFDA 4ZDHB 4Z7VE 2FL5A 2QT6A 3WFEL 1CFTA 1JGUL 2AQ2A 2VM4A 3KPQA 3VFMB 3QIUC 1FL5A 3VG9C 1SQ2N 2EDNA 1X5GA 2XY2A 5CEXA 3RAJL 1IBYA 4TM9A 5FUZH 4E9QA 3H54A 4EIGB 4MJID 1WTLA 3QFJA 4ZPVA 3JSSA 4XPGH 1ETZA 1J1XH 3RGVB 3MGOA 4NBYB 4W6YB 1MFEL 3CIAA 2XWBA 1UB5B 3GHBL 5I1HH 5DRWA 3T0EE 2ZTBA 2BP0B 4NZRL 3L5XH 2A9NH 4U49A 2CHDA 4UM8A 2EILB 5EZJA 5KBNC 3HUJF 1PBYA 4H25B 3WJLA 1NMBL 5DWPA 3RDTC 2G5UA 3CFMA 4Y0GA 3CHXA 5CZVL 1M2VA 1UHVA 2GUOA 1EO8H 3O2DH 4M93B 4N1HB 5F3BB 2ZOTA 5ELIA 2OTUA 4Z7VF 1CE1H 1UEMA 4FX5A 5L8JB 3EJPA 1E4KA 1I1AC 1WHPA 2FJFB 4Y4FA 5IW6A 4Z7AA 4X9HA 4HAKA 3QUML 2QHRL 2HX9A 4KKCC 5H35B 4DQOH 5KSBB 2QVKA 4AQ8A 5GZOC 3DVGA 4PIRF 2Q86A 1BD2D 3FUEA 2Q8AH 5JR1L 4BFBD 3IGAA 3PNWA 4PS4L 4WCYL 4N6RA 5F7BA 3CCHB 4W1TA 2ZSVA 4HETA 2AK1H 3UJJL 1W72H 1BZ7B 2EDOA 3HRZA 3ZT7A 3IJEB 1AZRA 4KRLB 6FABH 4KI5F 1FPTL 4GY4A 3SE8L 3DOSB 3TWCH 2HJFA 4XNYH 3BT0A 3UACA 5C09D 4PJGB 4K71B 2EO1A 3A6BL 5J56B 1EH9A 2VZ1A 4J3OH 5FEBA 2Z1KA 5IJKC 1B88A 1DSFH 1PAZA 1VGKA 4YVNA 4YQXL 4HWZB 4M5SA 3RVWD 2BLFA 1QSFE 1SJEA 1WZKA 1HQRB 4BDVA 1EHNA 2WUCL 1X5JA 4XH2B 5EBLA 2WCGA 4K3EH 1PAMA 4YWGL 4GAYB 2DQEL 2NZ9C 3JBG7 1UT2A 4D8OA 4M6NH 1CGSH 2YQ3A 2XWRA 5AVZB 1NIAA 3O9WA 3GXNA 1WF5A 9CGTA 4JM2F 4ODUA 4OTXL 5T1DH 3N43F 4EI6B 3MRBA 3TPUA 3C60C 3Q48A 3IMRA 1J10A 4UTCA 2R2CA 4XVOA 3FT1A 2NY7L 4LASH 4YE4L 2O6DA 3MCYA 4HWNA 4ZO6A 3VFVA 1RIHH 1EFQA 1OKEA 3WIFB 4E9LA 4YLCA 2IQ9H 4D8PA 5TDNB 1QOKA 1WIUA 3KLSA 2IPKB 5DJXB 4DK5A 2AEQH 2LOEA 2WLNA 3IK2A 4RGOH 1LE9B 2YPLA 4XX1E 2VISB 5F1IB 1AO7D 1O6SB 3W56A 3ULUL 1FVEA 4PBWD 3LHPH 1FCGA 3W39A 3EOYG 4MMZA 2CBOA 1RI8A 4HCFA 3LPGA 3N0PB 4C4KT 5CWSB 4GI9A 5AALA 1BHGA 3MOQA 1WAPA 1IBGL 4JANB 4GIAA 3L3IB 3LPFA 1BX2A 4U0QB 3KM2A 5J1TC 4NT6A 1TVDA 3G5ZA 5ABDE 1MFBL 2ZWSA 4R9HA 3SDYH 4OFQA 3PIQA 4GUQA 1U30A 2HFGL 5C0JA 1Z5HA 2FIKA 1LILA 1AI1H 1V7ML 1GVIA 2R0ZH 3CZGA 4ZAKB 3TNNB 5D7SH 1HSBA 1LP9F 5GGSB 1FGNL 2CWRA 1QEWB 1KJ3H 2RFXA 3AT8A 3QZWB 4OBRA 4Z7QE 1P4BH 3ASNB 4L3AA 5K9OB 1R0AH 4GBXB 4NM8H 2IV8A 2B5IB 3FUHA 4I7ZC 1UYWL 2HG5A 5FO7B 1GS7A 4FFVC 2X4RA 5E7BA 3BHBA 4ANKA 4G7RB 3WE6A 2HVBA 4EO5A 3BVWA 2GYSA 3NJJA 5D2NA 3NABH 1OHZA 2DWDB 3G5XB 4IM8A 1KBGH 3RL2A 4CSTA 5FFLA 1T03H 2O61A 5AVWB 5JIKA 4NKDA 5JHBA 3WNOA 4WI0B 2O30A 2H26A 3VA6A 2X6AA 1AR1D 5KVEH 4JY4B 3RY5A 5FDYA 2VLJA 2XV6B 3MLRL 1AG6A 4NQCE 2WQWA 4ABWA 2AQSA 2EE0A 2WSKA 3L3GA 5E00B 4IGBA 5T1KB 4EDWH 4LEXH 5FIEA 4RMQA 3D18B 4RWHA 4BD4A 4FQ2H 5CZXC 4I8DA 5DR5L 4LU5L 1JZ8A 3HE6C 4WV1B 4XXWC 3F12A 2BNRE 4ZUSA 3H7LA 4YDJB 3TTSA 4F27A 3HUJA 3VD9A 1ZT7A 3MSPA 4XVTL 1BMGA 4I0PB 1UD8A 4P99A 2Z35A 2OFQA 3KPTA 4FZ8L 2JKXA 2BCKA 3OL2A 4YSSA 3S48A 3VGEA 1F0LA 2WZ0A 1XTLA 2VDOL 5AB2A 2WUBH 1GSMA 4JRYE 5GS0C 5TF1H 4Z6AT 2ICES 1KXQE 5HI3D 2X70B 3F7VA 4YXLL 4Z7VA 4OZHB 4R5TA 2WC7A 3WSQH 2Z31C 2BIPA 5AOZA 4YHPB 3T65A 2YARA 3FQUA 1NBQA 4KJQC 3VX1A 2AAVA 2CNYA 1C5BL 2J6WA 1ZLWK 3V55A 4JN1L 3SE9L 3GSWB 2WTOA 5C7XL 3L9YA 4YEEA 3KPSB 4E9WA 4LHJB 4IDLA 3NMEA 2EVGA 2J2ZA 5J1AB 2BVOB 4AC2A 4JY5L 1K5NA 3N0AA 3VXNB 1MG2C 3D30A 4RFOH 2BRRH 3FFOA 3IETA 2VQ1B 1DBKH 3CFTA 2DWYA 1NPUA 3MJ9L 4B0MB 1OANA 4K94L 4XBGB 4RX4A 3FQRB 2KL6A 3T0EA 2ICEB 4NQSB 1CXLA 1KXVC 3KPOB 2ZJSL 1DVQA 1HOCA 1JD7A 2F53B 1CGTA 3UAJD 5C0AE 2COVD 4ZOCA 1R24A 1ZLUH 3RA7H 1SJMA 3QXAB 3K2UL 4PV9B 4A67A 4YSTA 5INDA 3NDYE 1N4XH 3LMJL 5AWNH 3MTRA 3B9KA 5CEYB 4X0KB 4Z0BL 2FLRT 5I18L 3X12A 4LQFH 3SCMD 1JV5A 4OAWB 3RWDB 3LIZL 2PO6D 4C47A 5DD3H 3CSGA 4JM4L 3MACL 2PWFA 4PLKD 1UM4L 3P73A 5HSFA 1ZLDA 1JD9A 4DQAA 5BZZA 1NAKH 1MI5B 3OSKA 4P4RB 2EXSA 4X8XA 4WGWB 2EDTA 5LBVA 4DO5A 1N67A 3B2VH 4DF9A 5C0CB 3MJ7A 5JMOC 1SXAA 2NNAA 4IBUA 3LXBA 5IEHA 4PYHA 4G8EB 4HKXB 3DX0A 1MREH 3ATBA 4KXCA 1N8OE 1Z5YD 1J8HE 5DHDA 4AQ1C 3HBPA 2DM3A 4KKRA 1KV7A 3BQVA 5GSRA 3RQ3A 3GPEA 3VFGL 1QSFA 1VESA 3V4PL 5IG7A 1XBDA 2JJSC 3A23A 3HNSL 4NEHB 3V7MA 1S7WA 2V9TA 4WO4B 3TO2A 3OR6B 1H5BA 2DI7A 4BQ6A 5EEWA 4CMMA 2E0PA 2XIBA 5GRXG 1DQDL 3P4MA 1BDYA 3D0LB 5T1MA 3N9GL 5I5RA 2X3AA 3NG5A 3SE4A 3ZK0A 3ZYJA 1E65A 1AP2B 4F8OA 4HXBL 3ZT6A 5KZCD 3ZGHA 2GABA 1BD2E 2QSCH 2NUPB 1TQWA 3L6FA 4XPTL 4Y5YA 1UEYA 3NJKA 4MCNA 4XP6H 1EMTL 1C8PA 1AD0A 5DZ9A 5CINL 1MCHA 2ZWZA 1T20B 3GTTA 3OBAA 5EU3B 1FFNB 1KN4L 1OF2B 1RY7B 2YWZA 5HDLA 2G3MA 3V7AE 4OJCA 1DQQA 4PCTA 2DYPB 2MTAA 2QQLL 1A22B 3RI5F 1RURL 3OKOB 1PIGA 3P1VA 1BVLB 1DVFD 4OF5A 2CJUH 1H0DA 2CO7B 1J9TA 2D3LA 1N3NA 1QRNB 1QWUA 3LKPA 5MENA 4K5NA 5E6IA 4FXTA 1TZAA 1HKFA 3QQDA 3PHOB 5FF6A 1F3DH 4G3YH 3SBRA 3UG5A 3DROA 2IFGA 4HK3J 5GISH 4FXLA 2ICWB 4ZUTA 4EXPX 3C2AH 4F7KA 2QADC 2EUWA 2CJSA 1M7IB 4I48B 3RWHA 4ZFOA 1TVHA 2OYPA 1XGYL 1C16A 1GS6X 3VACA 1A7NH 4L9LB 1KIUB 1A25A 2B1HL 1AE6L 1VACB 1K9TA 3FH5A 4O51B 5CJQL 4X6CE 1RUAL 3QORC 2QHLA 1BZQK 2WBJA 1GS8A 3HI5H 5EO9A 5CD3B 1FL3B 3NK3A 4FQIH 4RRPG 4QYOA 2EVJA 1D5MB 3F84A 5LGKA 2EDKA 3B7UX 1YCSA 2C1OB 3K6DA 5GGRY 4HPOL 1G9MC 2CHWA 5SX5K 3KLAB 4AM0B 2BOCB 4X8JA 3ESVF 3WL9B 2YGVA 3GI8H 3E3QC 3AQXA 4NQCA 4QKXB 5LKNA 4W81A 3RB7A 4BV1A 3TBTB 5E8DH 2D7TH 3ARED 4GUPB 4XPAL 4DT2A 4C55A 5LXVA 3O8XA 2GK0B 1F6LL 1E2VA 1TQVA 3K1DA 1XGQB 2FYYB 4HUXA 5ENWB 2BNRA 1AQDB 1YEJH 5KWYC 4TSAH 1CXIA 2K3TA 4Z0XB 1RK0A 1GYUA 5EU4A 3WTTA 4M5YL 1JNNL 4HK0B 2WINA 5LGHL 4W93A 1TETH 1WK0A 3MBXH 1XIWB 1DFBL 3A24A 2A6JB 3S88L 1FZJA 5SWZE 1E27B 4FQCL 2L04A 4X6CF 3W57A 3ZBMA 4JRYA 1D5BB 1BFTA 1LD9B 4QUOA 3HRPA 5EORH 4A38A 2LLLA 4MD5B 1IC4L 3P2BA 1KXQA 5DEFB 2B8OT 1N18A 4NFCA 3L16A 1CS6A 2NYZA 4Z7UE 5SWQA 4GKSB 5L9DH 5D70H 3C6LA 3RWEB 3ULSA 3DXAD 3ZKMC 4LPXA 4RMWA 5D1XD 4Z3FA 1S7SA 3MODH 2GAZA 3QAZB 3D6GA 4GG6E 3MVSA 4X5QA 2VXQA 3CC1A 5KSAC 3U6RB 2OXHB 2QV2A 4ETQB 5AAPA 1QABA 3JTBA 5SWSE 4RGMB 2XV0A 3AZUA 2YXVA 1NQBA 2ZAIA 3X1GA 4L8SA 4HJJH 4WI6A 3TF7C 1E9QA 1IBDA 3G5WA 1WVZA 5BVJB 1MRCH 3MBWB 2JIXB 1SUHA 3CHSA 2DTSA 1Q72H 5AOJA 3PL6A 3OLIA 4ELMF 5DJYA 4F7TA 1BGXL 1GPOL 4EDXB 5I8CA 2ZXDA 3LZFL 4JFXA 1F97A 2XU9A 2W9DL 3B9DA 3SKMB 1RZIA 3DHUA 1C7TA 3IDJB 5C0AA 4TOYH 4CVZB 3NJGA 1K2DA 4E9YA 5HYFA 3QB7C 1OAZH 2MSPA 1SDDB 1JWUA 1L0XA 4XOBA 2LU4A 4JHAL 4GIOA 4U1GB 4S10A 3F8UB 1MCEA 1M7DB 2E8YA 3MBEB 4OCLC 3TP4A 3B7YA 2IDTA 5CP3H 3BEWA 4MFHA 3FQ4A 1C5DA 3HHSB 3AGVA 5D96B 5I6MA 4Z3IA 1G7MA 2G75B 3IDXH 3GRGA 3JWOL 3HMXH 3K8MA 2VMEA 3VQLA 4L8BA 4NZTL 5IFHL 1KIPB 1OSPH 1QVOB 5CSZA 1Y1DA 3GO1L 4GG6F 4MA8H 3FMGL 3RG1C 1EHAA 2D03L 1BAGA 1QEXA 2GBVA 4PP2A 1CZ8H 4NWTL 5IHUH 5E51A 3OB0K 3ZO9A 4AEFA 4HX1B 5F88B 1R5VB 1W6WA 2H32B 1YAIA 4K15A 3CXHK 4PRPB 4Y8DC 1Q9KA 2IGFL 4JGJA 2CMRL 4XCCL 2QDWA 5F7YC 5GGVL 2N3JA 4WTZA 4D0CA 5I24A 4JRWA 4Q74A 3BDYH 2H3XC 3DURB 2HH0H 3TBWA 2MIZA 3VCLA 2ZPKH 4OIBA 1T0NB 3DIDA 2PTVA 3ARFC 3BVVA 2ICWJ 3QO0B 4QJ3B 2OMZB 4LSUH 1HIMH 2DQJH 2AMGA 4OGZA 3S34L 2ZP0T 4J8RB 3DX4A 5D7JA 3BCFA 2PW2B 1BD2A 3W1ZA 5KVEE 4B9PA 2EVIA 3G04B 4MJ2A 3SZKC 2JB5H 3L5WB 3QGVA 3H7BA 2WNWA 3BI9X 3DI2B 4XVJL 4X6EB 5DJ0B 5BVPL 4GRWF 2XDHA 3GMRA 3HNTL 1GL4B 1VZGA 4KXDA 4AUYA 4DKEH 2EIBA 2PYEB 4TV3A 2PYFA 2DPKA 1HN1A 4PJ7B 4U1NB 3GUFA 5E1QA 5DVOA 2AJUL 2VIRA 3MNVA 3GXMA 3NOIA 1BP3B 4P46C 3SDXB 1JTTA 1MF2L 4D3CL 1D5IH 2C4XA 3BN3B 3FULA 3MLWL 2R8SL 4FQPA 4DN3L 2JKSA 1HINL 1ETJA 4ETYA 5A2CA 5DFVD 1YO4A 3OJMB 1UOWA 5E1AB 1YNKL 2UVEA 2Y6SD 3FPYA 3SKNA 5LJYH 1THAA 3T2LA 2Y7OA 3O6KH 2GHWB 4XPFL 5FM8A 3K0WA 3MV7B 5AVSB 4G7SB 1GY1A 3I74A 4K5PA 4WI7A 2CLRB 1L9NA 1YNLL 3LN9A 3MRIA 3TIDA 3LQZA 3TV3L 4FCHA 1KCVH 3N6YA 5TQ2H 5T3XL 4PR5A 1PS3A 3OAYH 5E70A 2X2HA 3UGUA 1B0GB 2FATH 1JVKA 2UXFA 3Q2VA 1NCBL 4LP5A 4X6CA 5GJTH 2FD6H 1I3GH 4OLZL 4HULB 4FABL 4Y4HC 5GRJL 3ARRA 4OGXH 1Z3GL 2V2XB 5E1GA 2F7PA 1OXYA 5JORB 5ILTL 1UZGA 3GC3A 1HHGA 1NCTA 5IMKA 1QR4A 4MDRA 2XWTA 3HLAA 5CGYC 5DZLA 4PJ8C 3BP5B 4ONGL 3C2SA 4JQIL 3L3DA 4KZ0A 2Z8VC 2AGJH 4F58L 1CFSA 3O2DA 4OIIL 5AKVA 1XL6A 3VFTB 3MXWH 1RUQH 3L4ZA 3MFFB 5BQDA 4WI3A 3DGDA 3HCVA 5E5MA 3N2JA 4FS0A 3RTQC 2BIIA 4QY8B 3FAXA 1ZGLM 1JIBA 5K9JH 2YGOA 4J8QA 1U95B 1RZGB 4DPBX 2X3CA 1NGPL 3VG0H 1IAOA 3E8VA 2JKIS 3X13B 1OGTB 5C08E 4P5TB 2DJUA 4P9ML 5T3ZL 4CJ1A 5CN1A 1I1RA 3RU8L 4BZ2L 1W72A 3D07A 4FNPA 2AVGA 4P2CG 2Y2WA 4URTB 4AOFA 4PJ9D 3ZL4L 2Z64C 3OC5A 1ZKAA 4ORGA 5SWZA 1FNEB 1KBKA 3WHXA 3P30H 3DRTB 3MUZ1 5F7AA 4I9XA 5LHDA 1GH7A 3CBRA 3JV6B 2IAMD 4AQEA 5I74B 1TZIA 3GKWL 1AC6A 1IM9A 4GSXA 1ODAA 4Z7UA 1MNUL 2XTJD 5MP6L 3L3HA 4CW1B 3NACL 4K7PX 1AHMA 2BH0A 2VDMH 2ZCZA 5DC4B 4GG6A 3RVTD 4FERA 1OSZB 4W9FC 3VWJB 4DHLA 5HHNB 4R7NA 1FJ1A 1JTPA 2ZXQA 3IMVA 3P4NB 4PM1A 3ZPDA 1BYPA 1RZFL 2A2QT 4TL5A 4XRCA 1DBJH 3DSNB 4JN2A 5GRVL 1ASQA 1J0IA 1JHTB 3B4NA 4PRAB 4QIRA 5EF1A 4LLWB 5GRWA 1KGIA 5AKRA 4DP8X 4PS3A 2OJ1A 2V33A 2QPEB 2ZUSA 3PHSA 1R3KB 2IAND 4ZO7A 2JCCF 3RWGA 3D34A 5AAMC 2VAAB 4KK5D 1IX2A 3CAFA 3HZYB 2Z8RA 1E3FA 1MY5A 4G2AA 4NCDA 3LZLA 3DXAE 2YO3A 3IU3B 1PZ2A 2WVUA 2IDCA 5DYFA 4M7LH 1FIGL 3IFPA 1FCCA 3KWVA 4IIQC 2ZOWA 3WAKA 2NX5D 4PEEA 3FQYA 1DJGA 4JLRB 4OCSL 3FKUS 4LOUC 3U0PB 5IM7A 1PZSA 4X98B 3GSNB 2YJQA 2YSSB 5IB1A 1NBYA 4XC1H 4U1JA 4XP9H 1TQCB 2A4ZA 4ONFL 1KYOJ 1INDH 1MRDL 2VABA 1DFXA 2GSIA 1NLDL 4UT6L 4HJGA 4HJEA 1RJZA 2K45A 4QXTB 3RB5A 5B39G 2XWEA 4P4KC 1G7JB 2X1OA 4R0LC 2PPEA 2NXZD 1M56B 3UAJA 1SEBA 1TITA 3ZZLA 4EBQH 2X4OB 3AT9A 2YPKA 4JFFE 3V6FB 4YE0A 5F8QC 4U1MB 3VXUE 1Q1PA 1M1XA 1KJ2L 2LQRA 4WWPA 2KYIA 5FHAH 3SCMA 2HFFA 1EAOA 3BAYA 1XCQB 3D0AA 1S9WA 3FT4A 2HXAA 3Q9PA 3QHFL 2DW5A 1MDAA 1PLAA 2E9BA 2AI0H 3BLKA 5E2UH 1WITA 2HG0A 1XH1A 3VWKB 3KPRE 1BQSA 3CQFA 1ORQA 4HJTA 5DI8A 4ERSH 1K8DA 1LEKB 4MB4A 3G08A 4KV5E 3T09A 1FAIH 1BPLB 3POCA 4OUUB 4HU2A 3DYMA 5BRZD 3CZLA 3I9PA 3L3OC 1KTDA 3KXFB 1IQDA 3S96A 4NENA 3UIZA 4R4BA 3S9DB 4HOZA 1I9IL 1XTMA 2WQRA 4HS6A 5JOFB 3VFSA 4R4NC 3ZXAC 4AMKH 2RCSL 3QRLA 4P2QB 2IWEA 1ZA6A 5JMRA 1CFVL 2X9YA 3WGUB 3ZHLA 1IGIH 2Y3NA 3S6CA 4DGUA 2C9AA 4P2RD 4G43B 1DUYB 4GKZB 4GKNA 3KCPA 2W0LA 5GHWL 4A66A 2WHVA 3WU1A 1YYCA 4OV5A 3GSQB 2WIMA 1SYVA 2HX7A 4YPJA 5E2TH 3Q2WA 1JZFA 7PCYA 1E2ZA 1KGUA 1XO8A 4N2AA 1YECH 3J27A 2WQSA 3GEWB 5I1GH 3KWUA 3T08A 1PLGH 3PPSA 3OMNB 5DHVB 2ADIB 3RPIB 4HKJB 4TNWK 4XP4H 3SSGA 3BW9B 1Q8MA 4PRDA 2VERN 3CFEB 4DGYH 1DVFA 1T66D 2CLZB 5JOPE 2VDKL 1L7TH 2BY0A 3CZNA 1G87A 3DK2A 4IRSD 1BZOA 4K8RL 1XZ0A 4ZS7L 1J7VR 4HPYL 1WWAX 5IBLC 3CDCA 4KO6A 3ETSA 2CA4A 3AY2A 4BE6A 5E8OB 4AM0Q 5ACZB 2UX6A 3LKNB 3D2TA 3C09C 1FL6B 2YD3A 4OD1H 3BYYA 2DD8L 2K7QA 1KNOB 5GIRB 5CM1A 3BOVA 2BSTB 1MH5A 1V7NL 3EDEA 2XN9D 1YDPA 2CNZA 5HTSA 5FUCE 1T7VA 3RVUC 1IGFL 3S35H 3IDYC 1QNIA 1NUDA 4I18A 4Y4FC 3LQAL 5IMLA 2FX7H 2K78A 1N64H 3I3BA 2E3VA 4AQ8C 4BH7B 1FUNA 5HGDB 2BFVL 4BRVA 2GQHA 1AGFA 4WI8A 4Z7NE 2PP8A 1NMCB 3GSXA 4NN5C 4I3RL 4XMUA 2VQUA 5EC2B 5C08A 1MJUL 1BAWA 1P9MA 3AT0A 5ACLA 5IR1B 1FRGH 1O9ZA 4W9IC 2NY5H 2DQHL 1DBML 2UY7B 1F11A 5KAQF 4LL1A 3QUGA 1PDKB 4XNZB 3BPOC 2HAZA 4Z77A 2XV2A 5EEUA 5KSUB 5TTRA 1M1SA 2NPLX 1DDHB 3CFKB 5I76A 2IQAA 1FZOB 2J8UB 5KAQG 2KLSA 2W60A 35C8L 4XMPL 4CILA 1RHHA 3MLXH 3P0VL 1G7IA 1LVEA 1TQBC 1MQKH 2JI1A 3H0TA 3LQMA 3N1PC 5E5LA 5B39A 3VG9B 3X14A 5D7IB 4LCWB 5DQJA 3RGVD 1U6AH 3V6OE 5CKAA 1OT2A 5I1CL 1KPVB 3WJMA 3AY4A 4L1DA 3ZE1F 4CA4A 3MLZH 4OVVA 5HHMB 4YO0A 4PU2A 4ZTOL 2SEBB 4OW6A 3NCMA 1QLFA 5C2BL 2R9HD 5LWYH 5IWLA 2WVVA 1OAYL 2BC4A 4XMWA 1AGCA 3ZL2A 2P46B 3VXSE 1P4LA 1TCMA 2Q8BH 4BCXA 1GZPA 3NPSB 1S7UB 3RNKB 1Z9SA 4M48L 2V8LA 1AD9A 4EVNB 3CBKB 2YBRB 5DFWH 3RUGB 1JYXA 1U8NB 8CGTA 2UXVA 2APVA 3V6ZA 5HI4D 5FGSA 1H6FA 4M4RB 3TYGH 3SDDC 4RVBA 1KJMB 1M7XA 4I2XE 4B9YA 8FABB 5M95B 1RZKH 3PHAA 2XTJE 2P5EB 2NY4C 4WW2F 1J1OH 3DXAA 4PS7A 5C0FA 5DS8B 4JZOA 1O7DE 2DN7A 4QTHB 3TEUA 1U92B 5EO1B 3CMOH 4FGMA 2UX7A 2Z6FA 2FEJA 1DQLH 3PGCA 3PAUA 2VXVL 5A2AA 3MJWA 1D5RA 5EPMB 2OI9B 2FRGP 4FLHA 1AGBB 2F61A 1JDCA 3LJ3A 4RBPK 2UWEE 4DGVL 3RILA 3ASOB 3CFBB 3BWUF 4L4TD 4DO6A 3JVGA 4HBCL 1ZLVH 2IANE 1E9OA 1I7RB 1AS7A 5F9JB 5AVVB 1GZHA 3MLTB 5EFIA 5L7XH 3LIUA 4PRHD 2WYTA 5DD5L 2L8AA 4JFFA 4TRPL 1YY9D 1CICD 1DLHA 1JF5A 2AV1B 3VXUA 5A2KH 4I77L 4K7PL 4QRFA 3FOMB 2R23B 1NGXB 3T6XA 1ECZA 3O41B 5D2NC 3WTUA 3CX5K 3HA0A 5KS9B 4UMGA 1XXFC 3C87A 2GT9A 5BS0D 1CFQA 2CGYA 3OKMB 5DXWA 5IB2A 1GXEA 4ANUA 4MD4B 3BKYL 2BNQB 1IBFA 3UTSE 1ILUA 3GDCA 3KPRA 4JGUA 1E4WL 3AU1B 4N3TA 4XVSL 4BQ9A 2XA8H 5DC2A 1JPGA 3C60B 1LO0H 5FO2A 3V0HA 2VH5H 4IGBC 4JO2L 4PJHE 1E4XL 4KZDH 4MXQC 1JOIA 1CI5A 1I9RL 3P02A 4AH2A 1PY4A 3LZPA 1X5XA 2AV7A 3OZKA 4DP7X 1RV6X 3QZOA 4QCIA 4J2XA 3G5VB 2IO5A 5IMMB 2UWEF 2OMYA 2ZKXA 4U1LA 1J5HA 4HIPA 3LEVH 1G0XA 3QQNA 3TVMB 4A7TA 5JTWA 1TQUA 3MREB 3FCBA 2F19H 2RTTA 3VFWB 4LBEA 5J5EA 3PV6A 1OB1A 3M1BB 1R3IL 1WBYA 2AKRB 4Q6IB 2AK4B 3D52A 5HVGB 5AYUH 4KJYA 5AD0B 3EOTL 1JPFA 1RP8A 1S3KL 1R5WA 2ITDB 4PGCA 4J1UB 5BOJA 3TIEA 4RMBA 1EO5A 1D5XB 2W38A 5IMOB 3WXWL 4ZAKD 2XV3A 5EWIL 1D5ZA 3ZTNH 1MCWM 3E9TA 3UTOA 2X4NA 1IM3D 4U1IB 4OF8A 4J3BA 4BFEA 1G7LB 5T1JA 3T0EC 3RVXC 3MNZA 4RMUA 2CQVA 3MROB 2OL3B 4ZMOA 1A14L 4L29A 3BUPA 1SXCA 5HGAA 3OSVA 3BKML 4X8CA 3NJMA 4A6YH 2A7BA 4JB9L 1AIZA 1ZA3A 2CDEB 4GI6A 5LVEA 3D48R 3GLEA 3ALXA 4NIYE 3T3PE 1ID2A 3OKDA 1HHJA 4QGYA 5CCKL 3B9KC 5CP3A 4GQRA 2E59A 2D0FA 5JIIA 2R0LH 3L9RB 3QIWD 5CJOH 4MCZA 3TT1H 2GIMA 3WGVB 2IALB 3HMXA 4OLXH 1NGYA 1FNAA 4M6ML 3SN6N 5DFAA 2BHFA 4XN7A 4UNTA 4QT5B 3KYMB 5J13C 3IU4L 1X9LA 3IMSA 4HUVA 5C8JA 1E5UI 3X3GH 2GTZA 1K4CA 5I15H 4RQQB 1YZZA 1VEOA 1DDTA 3BVDB 4XCEA 5TQ0L 1QNZH 3HTLX 1FI8C 4WW2A 3JTTB 4M1GH 3FSAA 2VLRE 4K3DH 3PDOA 4OD2A 3F62A 1SJXA 2P4AB 2APBA 1AZUA 2CZNA 1QR1B 2ATPA 4JO5A 3KLLA 2F08A 4PP1D 1HI6B 1H5BC 5I17B 1SUJA 2YZ8A 1OAQH 4OCXL 4LHUD 2ZOKA 2X1WL 4EOWH 1JXGA 3SE4C 3IXAB 1MJJB 3V6OA 1XX9C 2EUZA 4WWKD 3OJDA 4A2LA 4ODTH 2AERT 2VXTL 4WSGA 1Y0LB 2D7PA 4A2GA 2CE6A 4CJ0A 2EVHA 1T0PB 1BQHB 4M56A 1C08B 1BJMA 3MOBL 3VXSA 4NYLB 4ZXBC 1HHHA 1NLBL 4ZQKA 5TFSH 2E56A 2FB4H 4PJ9A 2PCPA 2DIJA 3EH3B 3S7GA 1AOHA 4MNGB 4QHUB 3WUWA 4GSDL 5FDWB 3BP4A 3DMMB 1ODUA 2EO9A 1SBBA 3DGGB 2FEDC 1I1YB 4PTTB 3V9FA 3KBFA 1QX1A 2OSYA 1RP9A 4I2XA 1QSED 2AJXH 1FFOB 2BOBB 1MFAL 1JNHB 3QO1A 3VRIA 3D2UA 5C0EB 4MXWL 4KTEL 3AM8A 3E80A 4KDVA 1PKQE 1TTBA 1AS6A 4OD3H 3NA9H 4JCWA 4OCYL 1X5AA 4LVNB 2VZTA 1EFXA 1UM6L 4IKKA 3DIVA 1T0MA 5LN4A 3BWZA 5C0CD 2B2XH 2DQUH 4QRUB 5IVZA 1S46A 2BSEA 2QKIC 2AMUA 3FF7A 2UWEA 4FQQB 4Y16A 1B4TA 2E9IA 2JV6A 1TJIH 2IANA 3T4YA 2YIHA 5TE7H 2AF2A 1UVQA 2UZIL 1QUNA 3BAJA 5E2WH 2CUAA 3M88A 4EQ3A 4EZJA 3MI6A 4OLVH 4HSCX 2WBJC 5DJZB 3T2NH 4HCGA 4U6VL 5CJ8A 1M6OA 4WO4D 2DTML 2NR6D 4AXWA 3QRGL 5AW5B 2A9MH 2HPOA 4N0CC 3CD4A 3WFZA 2ZXEB 1FWXA 3JWDC 2B1OA 5KSBE 3FOLB 1ZIBA 1ZJAA 2EYSB 4E41B 3T1WA 4KXZH 3TN0C 5BW7A 1E67A 4N2FA 1VGEH 4ZT1A 1TFHA 4ZW8A 5J57B 3UTSA 1ES0B 5INCB 3IE9A 3FQXB 1NA8A 3V4LA 4TMPA 5K9QI 3UTQA 3L2LA 4PJHA 3V0FA 5I66A 1BVZA 2WAHA 1ZE3C 3LNHA 4FXKB 1YG9A 4L4TE 3F05A 3GIVB 4FN0A 1DO6A 4OT1L 3O8XC 4W9EC 1VKXB 3QCTL 4PJGE 4ES9A 1IGTA 1X5MA 3O2VL 4ADGA 2G60L 4KJPC 4N2NA 5TDOA 1RH8A 4FNSA 4NUJA 2HT2C 2YXWA 3V0VB 1VADA 1U8JA 3VAEA 1X5YA 4PRHE 1WA1X 1DEEA 1PD6A 1W91A 2FWSA 3WFCH 5F6IB 2DB8A 4GAGL 4FA6A 2YXMA 3T04D 4G8FB 4U33A 4Z5RB 3NEEA 2DYSB 1GGCL 3ARZA 5ADOL 3U6XS 1DO5A 5HDQH 4AY0A 5IVXB 2Q5BA 5ESAB 1CGWA 2CPCA 2VN7A 3EJSA 3C6LC 3EDDA 1YNTB 1MRFL 1XMWA 1UXSB 4KQ3H 1JYNA 2QLVB 2XZAL 5JW3H 3B5TA 2XYCA 2Y5QA 3KJ4C 4AGPA 4ALAH 4FKKA 1DQJB 1M71B 4PJXE 1PIFA 4OKDA 1ZV5A 4L1TA 4J2QA 3MZTA 3FUDA 1UD4A 1NCHA 1UACL 4LEOA 2FUTA 2HN7B 3B2UD 2CBPA 4LLUA 1TIUA 2C9VA 3GZKA 2A38A 4AKPA 3MJ8B 1S6NA 1I8LA 4NFBA 3KW8A 5MEQA 2OMTA 2C5DC 3MNWA 4HS8H 2BSDA 5KG9B 1FVCA 5TE6L 1VCBC 5E2VL 3IBEA 3PNRB 4FNTA 4RWYH 1O9WA 1Q38A 3LKRB 5SV4A 2DYRB 1X4XA 3OG4B 3EHBD 3AXIA 3L1GA 4MAUL 1UD3A 2OMXA 4XMKH 5BO1H 4TULH 3WY1A 2W91A 1FZKA 1T83C 1HXKA 3QG6B 4DW2L 3JQOB 3PHQA 2R56H 4WJKB 1TJHH 4PJXF 3UROR 4FLRA 3VXRB 2J6EH 2VSCA 3WFDL 1P53A 4HXAL 5E95B 3VI4F 1JBJA 2J5LC 3EF7A 5DQ9A 5HHOB 2PPCA 3WNJA 3UXFA 1TTCA 4ZMXA 1JFQL 2C9RA 1CXEA 2VLRA 5IFJB 1OAKH 3ELQA 3NVQA 3SO3C 2XA3A 4NBXB 1AKPA 4XHQA 4AW7A 3QWQB 1MCRA 3GSRB 4WKZB 2CO1A 1JGEA 1UH3A 2HLFD 2XYBA 1M57B 3OPZL 5AW7B 2WXFA 4HIEA 1JK8B 1T1YA 1KELH 3F00A 3V9EA 4AVKA 1ZGLB 1PNCA 5J4MA 4Y4KB 4Z7WF 5L4IA 3RVVC 2ENSA 5D7JC 4HHGA 4WNSA 3W5NA 3LNGA 4HGWB 3M86A 5E56A 4FADA 1N7ML 2IWGA 5AW1B 2Z4TA 3ZE0B 1GZQA 4X8GA 4F24A 2EDWA 1H8SA 5KYUB 1F18A 2X4PB 4ZD3L 4QD2E 1HSAA 1L6XA 3IDMB 4JCMA 3NP4A 3UZQA 5KSVB 2HPTA 3BT2H 3IF1A 3ZDXB 1NL0L 3QVAA 2X4SB 3NFNA 4K94C 2AXGA 4M3HA 4C58B 3S3JA 3W82A 4CNIB 1CDJA 4NERA 4OZHE 3FYEB 5L4FA 1KCWA 4TNFA 4GRMB 3BUIA 3VFMA 4MNQD 5DYOB 3ZKXB 4N8VB 2IDSA 4GXVH 3DETC 5LCVL 3PWJB 5FM5M 1PKQA 1M9SA 2PPDA 3M07A 2GVYA 3GIZL 3ZSTA 5JHLL 5JA9A 3RGVA 2BXYA 3CLFH 4DEWA 3VFUB 3VFOB 2X0UA 1PW3A 4GW5B 4NN6B 3SZ6A 3QUXB 4LVHC 3H3PH 3QHZL 2NY0D 3UTPE 4XN4A 1YEFL 1UB5A 3ZW3A 4AKOA 4C4BA 4FYQA 3EH4B 4MJ4A 4ONOA 5EZIH 5T8IA 3KM1A 1UOVA 2YSTA 2B0SL 4H8WH 4JDVB 4H25A 3MRDB 1OPOA 3CFCL 4Q4IA 1EZUA 1QKZL 1C1EH 3DGCR 4UILH 4LCCB 3EJZD 1J5OH 3FH7A 3THML 1CDCA 3EYOB 5DUJA 4ECNA 4LSVL 4HJIA 5F3BA 2PWGA 2ZXWB 3NRPA 2WLHA 2FBJH