4WKZB

Complex of autonomous scag cohesin cohg and x-doc domains
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
NNAVINVDEMNEAFKDVPDLEGEGAHITLSNTTAKPGEMAEVTMSVSNADMQWNMCGIHIIYPDILKPEMKDPEERTVAFQKGDALEAATGIVCMEWQEGLPPVLTENKKGCLFLTAMFSGNQGGEGDMATFRFKVPDNAEPGAVYNLGYYYMNTDLFINEQNIPTYQKYAFTHMEGGTITVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Putative cellulose-binding protein
publication title Complex of autonomous ScaG cohesin CohG and X-doc domains
rcsb
source organism Ruminococcus flavefaciens
total genus 47
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2014-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wkzB00
1AOHA 5K39A 2BM3A 4FL4C 2ZF9A 3UL4A 1QZNA 4WKZB 4UYPA 4DH2A 2VN6A 2XDHA 3FNKA 5G5DA 3BWZA 4UMSA 4IU3A 1OHZA 2B59A 1ANUA 4IU2A 3GHPA 2O4EA 2Y3NA 4U3SA 1G1KA 1TYJA 5LXVA 4UYQA 3KCPB 5AOZA 3KCPA 1ZV9A 4FL4B 3L8QA 4WI0A 2W1NA 2VO8A 2OZNA 3F2LA 2JH2A 4N2OA 2VN5A 2CCLA
chains in the Genus database with same CATH superfamily
2V9UA 4F7CB 3HI1B 1YY8A 2QMKA 3ZTEA 4N0UA 4BZ1L 3KPSE 3SD2A 3AREA 3RVXD 3T2NL 5KG9A 1S7WA 3OAUL 1MZZA 2HKAA 5DT1L 3CXFA 1SM3H 4PH8A 1UG9A 4E9LA 1GKEA 4FQIL 2C7UA 4HFUL 1ND0B 5JYLA 2DLIA 3X14A 2NXYC 2YGPA 4KX8A 4UOJA 3CJJA 5J57B 2BNRE 2I07B 3KD4A 5DR5L 4XNQA 1JF5A 3BFQG 5D7IF 4GXFA 4JJHA 1N7MH 5C7XH 3OD3A 3MBED 5DA4A 3SPJA 5FF6A 1IFGA 4I89A 1AC6A 3MLTB 2A9NH 1OARH 2OMUA 3JTBA 3O2WH 5DK3A 1U8NB 3E8UL 1CGVA 3VGDA 1IBZA 1E9QB 4FFWD 1CDUA 5CBEA 1BJMA 1R17A 4AG4H 2AK4B 4WFED 4WHDA 3IDYB 2VZVA 2ZOKA 4JG0L 5HP5A 3QR0A 1JPTH 1AKJD 2NMSA 3OGCA 4RMBA 1E5UI 3SGEI 2NSXA 5KSBB 3PJSA 4RLDA 1UXSB 2J7LA 3W9DB 1S9XA 3GK8H 5CIPA 3CBJB 4IRZL 1S7QA 2X5PA 3WV0A 3ASNB 3DRQA 3GSRA 3MRQB 1I8LC 4TSBL 4YHNA 1M9SA 4OGYH 4CW1B 2CO7A 4U6VL 3GMRA 1YEEL 1B4TA 3MXWH 1SHWA 4MQ7B 2WP3T 1WBYB 1RZFH 2FATH 3L9YA 1BYPA 3M1BA 4K94H 5KBKA 3DUUB 3ZOAA 3ZTDC 2VE6B 2X4SA 3QDMA 5CUSL 3B5HA 1FNEB 1VERA 4ADIA 2UXTA 3K4AA 3ZQXA 4AJYV 1XF1A 3IXAA 2JI1A 4GUPB 2BIOA 4IBLT 3S5LG 4Q9QL 4ZQTA 2FT7A 3WE1A 2R2HB 1LEGA 4LLMB 4W6YB 3KZ8A 1FIEA 4QRAA 2D8KA 4MZIA 2VZTA 1CGUA 2BMKA 3KYOA 3L3HA 3P2TA 4QKTA 2UWEE 4JFDD 4ZMWA 2ITFA 2YD5A 4FYRA 4XBPA 1M05B 2DQUL 4J23A 4YQXL 4ZOCA 1UEMA 1IGFL 2BJML 4UI2A 2AJYL 4TNVK 1U91A 1BPVA 1DBML 1F6LL 2B20A 2P1YA 3JUZA 4O4YL 4OLYH 1DVQA 5D8JH 5DZ9A 5DK2A 5EF0A 5EOQL 4Z7VF 1A1OA 1ZEAL 2H0PA 4NUQA 1INQA 3A47A 1VPOH 2MOQA 4D9LH 1YHPA 2D2OA 3PP3H 1HTYA 1NIBA 4POZC 4YUEH 2ISDA 1KJ2H 1WZAA 4NO2A 3GZQA 3HW7A 5I30L 3IM1A 2BDNL 4DESA 3TEXA 1K4DB 1B0GA 1CPUA 2A83A 2ROYA 1ZGLP 1FHGA 4S10A 4LARL 4GSUA 1ZK9A 4HIXH 2NXZC 4MA7L 1VACA 4UNIA 3DJ9A 3BX7C 4ZNEE 1U8OA 3HUJE 3EDFA 1U9KA 2ZXBA 1XGYL 3BAXA 5EFIB 1UH4A 2DQIH 2TRHA 3GMOA 4OV5A 4OLZL 3TNNA 1MF2H 2DIAA 3Q01A 4PRDA 3WENA 3A6CL 4B9JA 4HGMA 1P7QB 3Q44A 5IVZA 1ZLUH 1AE6H 4XAWL 2XIIA 1I8MB 4B7LA 3HNTL 4UB0L 3ZKNC 1NCBL 4IIQC 4IRJB 3K8KA 4PRAA 2MOVA 3HG1A 3FQXB 4X6EA 5TF0A 4E9WA 4GMTH 3L4ZA 3FU9A 3LB6C 5DC9B 1I8IB 2DQFB 2IH1B 4U6YB 5GS0L 2EUXA 1U8KA 4PR5A 2QQQA 2XWJA 2OMYB 3VRJB 1PAMA 4UT9A 3RGVC 2E7HA 1R75A 4H26A 4P06A 5D7JD 3QJVB 4K8RL 3PQYE 3EZ8A 4Y8AA 4L4VD 4XTRC 3V9EA 2QHRH 1IBHA 4Y9BA 5GRVK 5CEZD 2E46A 3UGUA 3V8CA 5FPIA 3LYRA 1DSWA 2BLFA 1H3TA 2FWUA 1WFIA 5K9OA 3JYBA 3HC2A 4H8WH 2FX9L 5EOCL 3V9CA 1G7JA 3BVDB 2IANE 3S96B 2EH8L 3PWPE 1QSEE 4HJSA 1ZT1B 1VA9A 4LB8A 1GYUA 2CRMA 5D2NB 1CD9B 2X89D 4PJXE 5LGKA 4XXCA 5F0MB 5HJBA 2DTMH 5GZND 4UQEA 1T1YA 1Z3RA 3D69A 3OZ9H 3TP4A 4NKOB 3GM8A 1NAKL 1D9KD 2VLJB 3O2VL 2BC4A 3WIAA 3LXBA 3B4NA 1P6AB 2YAOA 4G6MH 2WPGA 1LWJA 1XB8A 25C8H 4O02L 5IJBC 4G9DA 4BDVA 1FE8L 3EYSL 4K23H 5ISZE 5AVYB 1TZAA 4FKKA 2ZWNA 1I1AB 4KXZH 1ZPUA 4PW9A 1OF2A 2PO6C 4IKJA 5FO9B 4KU1A 2MFNA 1JGUH 5BXFB 5MENA 1KFAL 1LDSA 2JKWA 5D6DC 3TPKA 3MYJA 3QIUA 3UC0H 4JFFA 4FLHA 1NPNA 4YFLF 4QXUL 2G2RB 4XGZB 1YA5A 2XG4B 4MJ5A 3NZ8A 5FKPA 1CFSA 3V52L 5IJKA 3BN3B 3MJWA 1EEYA 1N64H 3LKQA 3ULVH 3CH8A 2Z93B 5BS0A 2JJSA 1G7LA 4JQIH 4G6FD 3LKPA 3ZR6A 3U0WH 4MA3B 1RL1A 3QEUB 3VXSD 1KIQB 4ZUTA 3KNBB 2HFEA 3NFSL 2IQ9H 2NXYB 3HLAA 1TCRB 1G9NC 4I1PA 1YECL 4AGLA 4U3CA 4OQ1A 4UNVA 1PQZA 1H3WM 2WTPA 4G59C 2UVEA 3L2MA 3EYUL 1R5IA 4KDVA 3CBRA 3RA7H 3T3MF 2W91A 3LV3A 3DO7B 4NFBA 1U2HA 3V4VB 2EECA 2C9RA 3F7PC 4HEMA 1R3JB 2ZNWA 5D7LB 5LKNA 3HC4L 3BAIA 4HZLA 1SDDB 2NYYC 4OF8A 4QHNA 5FYKH 5D5MA 5CINH 3UGEA 1OVZA 3SE9H 2BWIA 1JPSL 1IEHA 4AKOA 4X5RA 2VDKL 3KWVA 4R5TA 5LJYH 3EXLA 4DCQA 5C0CA 4F8QA 3KLDA 3CN3A 3L5XH 2WYHA 2E7BA 4M3JA 3VRLF 3VM5A 4FQQA 2O6PA 4X6FB 3AJ7A 1I1YB 2VH5L 4IU2A 3FOLB 1ESOA 4K7PL 2WMPB 1AP2A 5C0ND 1DE4B 5DUBA 1G7MB 2VMFA 3V6FB 4JQVA 4K9EC 4DGVH 1Y1UA 2O5XL 4KMQA 3OTTA 5IW6B 5HHVH 3T0XA 1O6TA 3N9GH 3H9ZA 5FYKU 1NJ9B 1SJVA 5AW6B 2WWKT 3EDEA 3UO8B 3MLXH 1FAIL 2KMWA 4UUJB 2IO5A 4ZMZA 3IJ9A 5DUML 3FCSA 1ZJBA 3TPUB 3NP3A 4F7EB 3RTQC 4PJCF 4MKMA 4LSRL 5JXEC 1DDHA 4LCWB 1TO4A 4ZMPA 1TNMA 1HHHB 1OE2A 1TYJA 1SN5A 4P3DB 2WLMA 4XVTL 2QPSA 1E4XH 2FUTA 2WZ6A 2XXFA 3QH3A 4Y1SA 3WE6A 2RIKA 1MVUA 4L1BA 2Q10A 4GRMB 2UZIL 5DJDA 4NM8H 5H4YA 3EFOA 2AZAA 5D71L 1NCUA 3RDJA 1ZRUA 4ZXBC 4DEPC 4Q6YA 4GQQA 3AWEA 3TBSA 4NKMB 2BSTB 3C60D 4U3XA 5C0BB 3RIFF 3WFBL 5C0FA 1XCWA 4G43B 2FWOA 3SJVA 1HE8A 3JTSB 5DJCA 3M1OA 3EHBD 3TT3H 4UNUA 1E27B 4LRNH 4LHJB 3VD2A 4QF1A 5DEFB 1ZV9A 2NXZB 3M7OA 4HIQA 1W91A 5FOJA 2W9LA 3NJVA 4GXUN 3IETB 1FNGA 3DTDA 3SKOB 3B7SA 2XYCA 1CQKA 3F00A 2YN3A 3PXJA 3BD3A 4G3YL 3LPGA 5I1HH 5E5MA 4UILH 2WWMD 1IQWH 3B34A 3MCKB 3DIFA 1ASPA 4L5FL 4G8EB 1U3HA 2CGRH 4HHWA 5BRQA 4KAQL 4MB5A 1MCDA 5H37H 1QR4A 3KXFB 1JNNH 3L3DA 4HJ0D 4HK3J 4JZJA 1RUKL 2OTUA 4DOHE 4LHUA 5I0VA 3MRGA 3P3YA 5DD5H 4LSUH 1I3RB 3VXNB 3ENEA 1VGKB 4HIJB 4IIQB 1RQ5A 2JIXB 4AM0B 4OLVH 2EDJA 3OBAA 5F7KC 2GJZB 3FUJA 2R0WL 3WIHA 1OV8A 1CDCA 2Q8AH 2OMVB 3CX5J 1TNNA 4G7SB 2E3VA 1KLGB 4YX2L 3RGVB 1ZDSA 3P4NB 4X6DB 2WXFA 3QCTH 4AEHL 5DJ2B 4FFVD 4P46C 2X9WA 3TZVA 3V0JA 4ANWA 1TIUA 3BIKB 2VUYA 3NDZE 5KYWB 4HJJH 2VJXA 4PP1C 1SRDA 3SOBL 5IP4A 1OQXA 3BT2H 5I6LA 1QKZL 2O30A 3WFHA 3HC3H 3LEXA 3WNOA 4L3CA 1PY0A 2Q6WA 4G42B 4JM4H 3QDJE 4FNSA 4NP4L 1WGVA 1WIPA 2B0SH 1S7UB 2R8SH 1IFHL 1L9OA 3GRWH 2JNZA 4WHYG 2WD0A 3NAAH 5A43C 2H1PL 3FQTA 4MD4B 4XMXA 3JWNE 4Z5RA 1F6AA 4FQJH 1B2YA 3SKNB 4Z7OE 4KJYB 4XO3A 4P2OC 1O7DC 1RFDH 1DVZA 2Y1AA 4L05A 2ZCKH 3P9LA 5DS1A 1HXYB 1KPRA 2HKHH 3C87A 3V0WL 1VKXA 4ZTOH 4X6CA 3NBNA 1DBJL 5GRYA 5I1CH 1LNUA 3MLUH 2KZBA 3VNZA 4ZOEA 5DJ6A 3SO3C 5ACZB 4NYLA 4P48A 5EU6E 2PO6B 2EXYD 5L0QC 3QRFM 4CN6A 3LEVL 1ZVSA 4P57B 5GSRB 2BFVL 2GCYB 5HYJD 4HETA 4WUUB 1XEUA 1J8HB 2E0PA 1EXUB 4DW2H 2BVQA 2CK0H 3LCYA 3QWQB 4YHOL 5TE6H 4L5FE 3W38A 2NUTA 3ARFC 3BP7A 4JO8A 5JW4Q 2DQCH 1MRFH 2BOCA 4PCYA 5E8NB 2N1TE 5JTWA 3O3EB 3CFEA 2A6DA 2FJGB 2ZJSH 3MVSA 4FXKA 3VDBA 2XIBA 4P59L 2GSIB 3Q6GL 4HSCX 3HR5B 1PSKL 2VRQA 1QUNB 2I9TB 1OGAA 5DEZA 4X4KA 2A74C 2E27H 3MBXH 2VXTH 5DGQA 3KCWA 4M1CD 4OZIF 4JPKH 2TSBA 1EZVX 1NCAH 1QQDB 3FQNA 3N1MC 1CE6B 3FULA 2E5EA 4CGTA 5JO5A 2GITB 2F68X 5BZWA 1UADC 2Y07L 3HRPA 4RGNC 3ESUF 2FD6H 1AIFB 2LABA 2PWDA 1LO5B 2GEEA 4B6ZA 2IWEA 1YPZA 4BFFA 4EI5B 3U0PA 1WTGT 1U8JB 4JCWA 2R7EA 3ZKMD 5MEQB 4JRYA 4W9IC 5C6TH 4PJ9C 3DTUB 1A2YA 1NGPH 2HVKB 3II2A 4J8RB 2DOCA 3LHPL 3PL6D 1J7VR 4LPYA 2VM4A 3NCCB 3ALXA 3DMMD 5CEXA 2AK4E 4H0LC 3NABH 1WV7T 1DQIA 3TFBA 4JM2A 4ZK8A 2OYPA 3QQ4B 2Y25A 4H1LB 1BEYH 2HRGA 3GWJA 2D9QB 3QO0A 4N2HA 1NH6A 1ACYL 3ZVVA 5GJSH 3P69A 2Q87A 4IDLA 4F3FA 1QX1A 3WD5H 3B2MA 1YN7B 1JF6A 2C4FT 4AUUA 4X6BA 2RJMA 4NWUH 3TWCL 3GBDA 4UAHA 2XVGA 2GK0B 2PKDA 5GGTH 2B4CC 2R1WA 5DLML 3RTQB 1U95A 2K3HA 2CIIB 3E6HA 4OZFG 1YUHB 4LIQL 4C58B 4JKKA 4CRPA 5FYLD 1SMOA 3PYCA 3VI3A 2AEPL 4I88A 2W0PA 2XRAL 1ET5A 3FUFA 1W16A 3DVGA 4JN1L 4RDBA 3EH5B 1T7XA 2ZUTA 1Y18B 5FS5A 5JA9A 1LYQA 3O41B 2J8UB 3OMIB 4XC3L 4ZPTA 2J2ZA 4IBZA 2VO5A 4YNYB 4ZXBB 1CDYA 4DEPB 6PCYA 2VJ8A 1Q9WB 2DQDL 5JHLH 4BRVA 3K2KA 1R3KA 1MHPH 2K7PA 4CMHC 3V5HB 5EO9A 4CSZA 4EIZC 2NTSP 2DMCA 2DM4A 2C9XA 1F4WH 2BP8A 4XPHH 1TTCA 4XX5A 3C5JB 4ZDHA 3PHOA 1H8LA 5E5UB 1UYWL 1HZHL 4A67A 5CS7A 2OPCA 4GH7B 3VU2A 1RZQA 2K8MA 3HI5H 4C55A 4YHZH 1Q72H 2FEJA 3KGTA 3L4UA 3DTXA 1VFAB 3FT3A 4QAMB 4L9LC 2Y5TA 1XGQA 3PY9A 4J7RA 4AOFA 3U1QA 4Y4FD 2ICCA 4QRSB 4CC1A 2WIIB 2Q7AA 1T2QH 5LBSL 3NACL 1UHVA 3FO2A 2XC8A 4H8PA 2VM3A 4X5XB 3NTCH 3BP6B 5E8OA 5LGYA 5C0IB 1NCWH 1T03L 4P46B 1RZIA 4ZMTA 3VWJA 4NQCA 1TR7A 1IRAY 3BUQA 3IGUA 5AYQA 2Y06H 1AGCA 4E2OA 5KSAD 4AEIH 5GSVB 5IUCA 2APTA 5D2LF 1XX9C 4OM1L 3VA2C 5GXBB 3BHBB 4NO3B 4LSSL 3UTTD 4A1RA 3WTYA 2XN1A 3QUMA 1WWWX 3I50H 3SCMD 1WA2X 1MFCL 2ETWA 2QKIA 3H7BA 5B1CA 3WTSA 4X9BA 2EDLA 2FSEB 3AGWA 1SJEB 4WCYH 4AMWA 5JQ6H 3BSHA 3V4VL 3LVTA 2AABL 5A2KH 4QYAA 3F6JA 1DVXA 4HUUA 3RDTD 3QQ3A 4P2OB 2ZAHA 2D3JA 3JT0A 2XWRA 5D2NE 1YEFH 1SOKA 2PABA 1BEXA 4PJGF 5FYJH 4AC2A 5IROA 4DFIA 3RI5F 3ILDA 4PMEA 4KMTH 5HHNB 1SFDA 3GSQB 3SGKC 5FEBA 2WKOF 3QYCA 4JG5A 3SO3B 2X10A 1WYJA 2MHAB 3TCLB 2VLJE 5HYIA 3P0GB 3THML 4BSWB 3D85B 2G5RA 5L0QB 4Z7WF 3L9RB 3ISWA 1F1GA 4KKBC 1FH2A 1M57B 3BPCA 1WEJL 3VXOB 4W9EC 3JV6A 5AAPA 1UFUA 3GGWA 1PEZA 1LQSR 4YDVB 4Y2NA 4QRBA 1UM6L 4N6RB 4F8TA 3PWUA 4PJ7B 4YDKH 5KYYB 5JHLA 5ICXB 4U2ZA 1KPUB 1TQUA 2HAZA 4YMPA 3BUYB 3ARFB 5FYJU 2GVYA 3GMMA 5F6HI 1DUYB 2C26A 4FGMA 1FL3A 4OIBA 3L81A 1Q4NX 2H45A 2K0RA 3CMOL 5E1IA 4GINA 4P5KA 1N3NA 1IGIH 2P24A 1L7IH 2FT6A 4F33B 4RQQB 2DQTL 5IQ7H 1E6JH 2V5MA 2VXQL 2OR9L 2A74B 2UZXB 3JBG7 4P23C 5D70L 2GY7B 3M17B 3SDCA 2D03H 3WOVA 2ADGA 4PBWD 4YSDA 4MLSA 3MOAL 3SOTA 3QEQB 2YD8A 1UACL 1JIBA 5IB2A 1CURA 1NBZA 3WUWG 5I0WA 5BZZA 4RGNB 1P0SE 5JQIB 2F54B 3P02A 3VG9C 3LPFA 5E2JA 4I2XB 4MDJA 4YLCA 2O4EA 2ZCLH 4GAYA 2FB4L 4IOSA 3AS0A 4FFYL 3BVVA 5KYXA 3HVDA 4ABVA 4J6IA 3FXIC 2VXUL 1PD1A 2HUHA 4P5TD 3WFEL 3WLBB 1SHMA 3KJ6H 4PD4K 4PJ9B 5IY5B 3QHFL 5HVGB 3WSQL 4FXGC 4YE4L 2VN5A 4XHJC 1GA2A 2FZ3B 2VDPH 3VFPB 4LNRA 2F19H 3E9TA 3MRLB 3LSOB 4XCFL 4ZUUB 3GMLB 1MOEA 1XGRB 2CJSA 1AO7D 4U05A 1D5XB 3IXTA 3WAJA 2NSQA 3N85H 4OZHF 1JK8B 2D7QA 3FB6A 1J9SA 2VISA 3N04A 3MJ7B 5EBMA 4P4KC 4IMLA 3S37H 1A7PL 3AXHA 4NZTH 2Z65C 3CN2A 5E9DB 4ONFH 4X4YB 1IT9L 3VWKC 3CFJB 3OVUB 2IANA 5T1LB 1KB5B 3Q9QA 4OCNC 2X70B 1E5YA 3QA3A 2CDFB 2YD6A 3WMQA 1QI3A 2GJ6D 3T0ED 1PIFA 3IJHB 4DAGH 5F9JA 4ZFGL 4O9HH 2NY3C 1GGCL 1FYHB 4HCFA 3N6YA 1GIGH 2P8LB 4CBZA 4K5PA 1FPTH 3ZN6A 3BP5A 3BKCL 1G0XA 1TVHB 3HZYB 1DANT 4KKQA 3VXNA 1MCPL 4LCWE 3EG9B 3FCGA 4YHYC 3F12A 4PEEA 2V7HB 3FQWB 4GQ9H 4PWJA 2R1XB 4LSQH 4L0PB 3QZNA 3WL9A 1FIGH 3KLAB 2YPKB 3EDKA 3GKWH 3QS3A 4JG1L 5I18H 1OWRM 2JELL 6FABH 2ATAA 4CMHB 1IGCH 2EEAA 1ZLEA 5A3IC 3MNWB 5F44A 1HNFA 2CQVA 3HNVL 5C0BE 1KBPA 4TUKL 1XAKA 3TGXA 3L9EA 1IJ9A 1IEBA 3AW5A 1HHIB 1UXWA 3PJLA 3T2LA 1IEAB 3WEOA 2HX8A 4Y4KD 1CR9L 4PN6A 1MCWW 2BHFA 1W72L 5EZOH 3QQ9C 3CVHB 4IYKA 1JMZA 3TO4A 4Z76A 3BFOA 4FFZH 3I6SA 1TG8A 4L9LB 3G6JF 3TVMA 5EOTA 5E51A 3GRGA 4WV1C 1IBDA 2HYMA 5CP7B 1NC2D 4EN3A 1OAZL 2JJTA 2NDGA 2A6JB 3IN0A 5GRXG 4BCXA 4J6RH 3FMGL 3HJ0A 4WFGD 1WJ3A 4JVUA 5E94B 3UZQB 3X2QB 3CFDA 5T3ZH 4S1SH 3HZVB 3KXFE 2YUXA 5ESQA 1ZTXL 3D0LA 5CLXA 1FWXA 3I2CH 4WJG3 3WYRA 3AQXA 4QTIH 3OC8A 5DRWA 2R15A 1PD6A 2DI9A 2Z7ZA 4X5LA 2HRPL 5C92A 2R0LH 4WUKL 4NO5A 2B1HH 2DD8H 1OSZB 1W0WA 3LKNB 4JMNA 2LAGB 5KVDE 4PIBA 2HJLA 1G9NL 1Q1JH 2GY5A 5I1AA 1LDPL 1HWHB 4X6DE 1F0LA 4LLYB 3ARED 4QYOA 3QARA 1ZAGA 3FONB 1R3HB 2KPWA 3F7VA 1A21A 1KACB 2V2XA 1MZYA 4MBOA 1U21A 4HX1B 4ZMAT 4WHTB 5AOMA 4DVBB 1QHQA 5F70A 4TLUA 3TLRA 4U3SB 4X5WB 1JZFA 1MPAL 3MLWH 3I02B 4KJWC 3FRPB 3P30L 3IPFA 3NIDB 4N5ED 3KPOB 3CLFH 2G9HB 1YMHA 5JHAA 5IFAL 4AT6B 1F58H 4J2QA 1DLFL 4XXWC 3TIDA 2OULB 3HHSA 1OP5H 4V33A 1YMMA 4JFHE 5HHPB 4KK8D 4K9EL 5HHOA 3QULA 2BVOB 2JKLA 1HOCB 2OI9C 3RL1B 4PB9L 4H1LG 4NC1C 1MHHA 2JK5B 4HJ1A 2PNDA 3C8KA 5L6YL 1CWVA 3QE5A 4XCCL 4TNGA 2L7JA 4Q74A 5I6MA 2P8MA 2FBJL 3AUWB 5KJRL 5AB1A 1C1EL 1AHWC 1SLXA 1AMYA 1JXJA 3UL4A 3K3QA 3QDMD 5AG8A 1J8HE 2N01B 3O4LA 1VZHA 5ESAB 5EWIL 5B38G 2UVFA 2FX8L 3AABA 3S88L 3EOYG 3NRFA 1KTLA 2CUAA 2I7SA 2LFEA 3MLVL 4QRTB 3VG0H 1AFVL 2QGDA 4P23B 1FZJB 1RZGB 2CRIA 3L5JA 5EIIB 4UDTB 4R7VA 5CU9A 4WFFD 4C4BA 1NBCA 2Y36H 2WBWB 1CK0L 3MZTA 2IFGA 4A2HA 5B3SB 4EDWH 4K5MA 1HHKA 2VR6A 5DURD 3VG9B 3EYQD 3FFDA 3WHXB 4CC0A 1UA6L 3JV4B 3JWDL 4IU3A 4NNXB 1FN4A 2ADIB 2JQMA 5DD6B 3II3A 4LPTA 4E41A 2BSBA 4CSSA 4FXGB 1T3FA 1KTDA 1YAZA 2ZCHL 1NGQH 4ZAKA 1BQHG 3CCHA 3H4HA 5T3XH 1KYDA 4N86A 1T4KA 4YGVB 1A0QH 2H0EA 5D7IB 4HS6B 2P45B 1CLZL 3HG0A 2KYIA 2NW2A 4N8VB 5F89B 3ARDA 4P4KB 4NPKA 4WKZB 4H5SA 4LSVH 1MW3A 5C07B 4NDMA 5AKSA 3UMNA 1HL9A 5E1AB 4MMXA 3L2LA 5EUOA 2PTTB 3VWKB 5FUOH 4OLXH 2BVTA 2WV3A 3P3UA 2Z91A 3W9EA 4PGBB 2ZOUA 4U1IB 1AY1L 1L6XA 1WQVT 3KYMA 1DBAH 1FYTB 3HG1D 1TQTA 3OXRB 2NY3B 4FP8H 5D1ZC 2ATKA 4GSDH 4D3CL 3FFCA 3VD5A 1AZBA 4JKPH 1UTDA 1MCSA 1MCOL 3HG4A 4JRFA 4TN9A 4YHYB 3T4AA 1MRDH 5I8EA 2GAZB 2PPEA 2PWFA 1Z7JA 3RVXC 3A0OA 1N0XH 3HRZC 4A6YH 4JE0A 1E5BA 2V5TA 3P2DA 2X4NB 1PPIA 2M83A 3KM2A 3OKDA 2J8UE 4UIKL 3S4SB 3TN0A 4HXAL 3UMTA 4BQ9A 4F7TA 2L7EA 4GG6A 1K9TA 3OLIA 3NCJL 5IV2A 1KF9B 1LO3H 5EN2A 2VQTA 4GP8B 5IMLB 2IFFH 4Y5XA 1LEIA 3RJQB 2QVKA 4R0LC 4CJ1A 1D6EB 3NH7L 5IK3B 5KTEL 2CA3A 2ZKMX 1AGDB 3AWGA 3MBEC 4LU5L 3AU1B 4FG4A 4LCCA 1D7BA 1V8HA 2IPKA 3IU4L 1ZIAA 4FFWC 4X80H 5KVGE 4Z3GA 4G5ZH 3W2DL 3V4PH 4JREC 4Z7VB 5DD0L 1OAQL 2P5EE 5CGYD 5FGRA 4YHPB 4Z0BH 2BXZA 2QADD 2NX5B 4WV1B 1QLEH 5FGBC 2CM6A 1LEKB 2PCXA 1I7RB 5I8KH 3GD1C 4UDUA 3QO1B 2WVUA 4CAGA 4ECNA 3DUSA 3PAUA 5MEND 1TEYA 2F2HA 4WO0A 1DJZA 4BFGA 1MAKA 4D0DA 5L2KA 2QQKH 4OSUL 3QIUD 4JFFD 5IEHA 3V9FA 1LMKA 1RSYA 2AI0L 4NT6A 4MA8L 5JW4R 3VXUA 5JNYB 2E56A 3F64A 3G08A 2XV0A 2YD9A 3O8XA 5DJYB 3DVFA 4YN3A 1SYVB 1UJ3C 1A6TA 1E5CA 3D7PA 3UDWA 1BAWA 2FIKB 4MCYA 3D06A 1Q90A 1RZKL 3VXMB 4FZEH 1I7ZB 4WEMB 4RDQG 2CXGA 5BS0D 4HKJB 2PYEA 3DX7B 2OJ1A 4Y4HA 4X99B 2VSDA 2XPYA 3MRCA 4S1QL 4BINA 4QRPB 4HWBL 4WNSA 2VABA 1MWAH 2WVVA 2UYLB 1KGIA 2FX7L 4NHUB 1X4ZA 1T83C 2E9JA 5IB1A 3IDNB 2FSDA 3CSBA 1HILA 4HPOH 4AC4A 3WY1A 3VFMB 1BMGA 4ICWA 5B4MD 3VGBA 3F7RA 2I60H 3A67H 4XNYH 3NP4A 1YEIH 5TDPB 2W9EH 5CD5D 1TZOA 1KULA 3KBEA 3GBNH 4KFMA 1EO8H 1O6SB 4PGEA 2CKBH 1RUML 3MV9B 4LP5A 5DI8A 4J28A 2W9DH 2YRPA 3CSPA 3DV4B 3RX8A 4AQ8C 2ZP9A 1O7DE 4XB7A 1S8DA 5K39A 1DEDA 4OI7A 1ONQA 3LAFA 4I3RL 1GHFH 5C0CD 1I75A 1IM9A 2OI9B 4TPRL 3MV8A 1MNNA 3US1A 4HSAC 5DMJB 3ZXAC 1OHQA 5AW9B 2YEVB 1OWWA 2Z64C 1MVFA 3B2VH 3COOA 3N40F 3O9WA 3QK0A 4R7DA 15C8L 3HN5A 4PV1C 1FVDB 2B4CL 5AB2A 1K8DA 5D9SA 1NGYB 1HWGB 3DROB 5ANME 2YJLA 3D34A 3QPXL 2XUWA 3DX4A 1AHWB 2F74B 5JHMA 1OGSA 4M1GL 1D5ZB 3U6RB 1ETZB 3L1EA 4PJ7E 1XSKA 1CLYL 1BZOA 3K1KC 3CU7A 3R0MA 3VFTA 4OJFL 2P47B 3MRMB 5E8EB 3PFUA 1BMZA 1BIIB 2L7QA 2Z1KA 2DLHA 4HJEA 1ASQA 4MFHA 5HXMA 4AM0Q 1IV8A 4DGYH 5FO8B 1DSFH 1VF5C 2CLVB 4UAOC 5D1QA 1HYSD 3MRIB 4KK5D 4OGXL 1H0DA 1LP9F 1I8UA 3BZDA 3ECVA 2ERJC 2OSLA 4FHJA 5D7JC 3EJSA 5I23A 2B8OT 4WEBH 1BFSA 4JJ5A 5E0QA 1BX2A 5FA4B 3EOBA 1K6QH 4FFTA 2C9SA 1YEKH 3QG7L 4KRMB 2BS9A 4XN7A 1KEML 1OPGL 5FDYA 1IO4C 2Z9TA 4FABH 2XBZA 2VW7A 5IHHA 2DQHH 3KPTA 3OKOB 3QEQE 2ORBL 4NBYB 3S7GA 5T1DL 1YYMH 4N2AA 3VVWA 2E6PA 4WENB 5E99H 2Y1VA 4RGNE 5EBWB 2EDQA 1IL1A 1MFUA 1X5JA 2F54E 3BT0A 3HMXL 3QR2A 4WW1A 2VIRB 3SJVD 4UMSA 4EN2A 1CTNA 1MEXL 2Z35B 3CVHL 3MJ9H 1SOXA 3RWCB 1RZJC 1UWXH 3MRNB 5GZNC 2YPVL 5HHXL 4WDIA 4MBRA 1U2CA 4BBWA 1H5BA 3W5NA 5F9DC 4ZMNA 1HNYA 5EZLB 1A8JH 1D9KC 4YDLC 3ULVD 2H1XA 4X7SH 5E6RB 4G70B 4ETQB 1COBA 3LN5B 4JFQA 3T3MB 3OX8A 4Q14A 3UBHA 2KKQA 4I1RA 5KVEH 1U3HD 3ELQA 1J87A 3V0AC 1XIWA 4HLZH 1T5WA 2V9TA 3KS0J 1R33A 3CPLB 4F57L 4FI6A 4IEFB 2NSMA 4HOWA 1RULH 1P2CB 4DN4H 2Y7MA 3RGHA 3CUPA 4LHUD 4ENZA 5CGTA 2PXYC 4I9XA 5ICZA 3VYOA 5E9DE 3HAEB 3TESA 5D1ZB 3AACA 1QD0A 2UZPA 1JNLH 3WFCH 1DJSA 3GZKA 5B7EA 5HHQA 4QCIA 2LTQC 4K5NA 1GS8A 5HHME 4IW4C 2ZXAA 2NZIA 4N2DA 3TZVD 3K2IA 4YDNA 1MCKA 1EJ6A 1K4CB 1BQLH 2YO3A 1JHKL 3RWFB 5L8JB 4R7NB 2NR6A 1IC1A 2EE0A 3HRZB 3IJSA 3JWOC 3RWEB 1CFTA 2LU7A 1X4YA 1JGVH 2NUPB 2YMTA 3RE0A 2BNQA 3GI8H 2V0AA 4G7YH 3MRFA 4OM0H 4PJCB 1DQLL 1DVTA 1GL4B 3FRPG 5JLZA 1MJ8H 5IR1A 2FQEA 5L7XH 4R0LB 1X4XA 3MBEB 1A5FL 2CO6B 3STZA 4UTBL 4G8FA 3DHJA 5I6KA 1CC3A 4U31A 2GUOB 5ELIA 5IB3B 1D7DA 3P3SA 4NZRL 5GS2D 2EYRB 3I6KB 2ZXDA 1EJFA 1VEOA 5B1KA 4JREB 2Z8RA 2IADA 3ZIMA 3BWZA 4ICXA 2DLFL 4Q2ZA 1AKJB 4D94A 3P9WB 1HH9B 4HFWB 1NDGB 2AKRA 1XCQB 3UACA 2V5YA 4NO0A 5LXVA 3ZK0A 2K9UA 2ZOWA 2ZUUA 4PS4H 4Z3FA 3GB7A 1W8NA 3L3GB 5F3HA 1K85A 4B95C 5JDJA 5C0NC 3K1DA 3L45A 5KYUA 2WVSA 3IDMA 2QV4A 5GGSA 1Z0MA 3RWGA 4TUOB 2OXHB 2QQNH 4W68A 4J3OD 1UJ3B 4G8IB 2EVHA 5HYSA 3APNA 3MV7A 3BKYL 1QBML 1HH6B 1L0XA 1TETL 2HX7A 3MJ9A 3OL2A 2DM3A 4L1TA 4NN7C 5F7DA 1YEGH 2GBTA 4MDIA 5E9AA 1TOXA 2BP0B 4KPHL 2GUYA 1M2VA 1TDQA 4JFDB 2DQ6A 5GGVH 4POYA 2DKMA 4YZFF 1OGAD 2FGWH 4R7XA 1MJ7H 3U30C 3Q5YA 4RWHA 5BV7C 1KG0A 3ZE0F 3BO8A 3IN2A 4F20A 2ALWA 4GLRH 3CZUB 5AVSB 3ZYJA 5D7KE 3C60C 1GZPA 4H20H 5IB5B 3BWUF 4UZUA 3NIDE 3Q2WA 5GGRA 3GUTB 4XMPL 2WXIA 3EHBC 5JA8B 4JRYD 1KJ3L 4QRQB 5IREA 2ZUSA 2WLKA 4DKFH 1CFVH 5K9KA 2X0VA 5GIRA 4EIGB 1FLTX 1S9WB 5TJWK 3RGBA 2BS71 3K71B 2EINB 4M8VA 4JM2D 1P4BH 3RWDA 1F18A 4OIAA 2WWMC 2R1YA 2N7BA 2LVCA 3HFMH 1JXGA 1C16B 3GEWB 4ELMA 3L3KA 4GO6B 2HFTA 2GJJA 4KZ0A 1P7KB 2RGSA 4J27A 1YJDH 4YDJB 4GW5A 2NY7L 4HJ0C 3WFDL 4A66A 2EH7L 1KCSL 3BGMB 5B1BB 4X9YA 2JVUA 1GJIA 5IJVB 2ED7A 4M00A 1EIBA 2XTJD 4NPYB 1N9PA 1AGFB 5JYMA 2A4CA 2EJ1A 1OGTB 2LR4A 2V33A 2H32A 4P3WA 1HEJC 5DO2D 4UAOB 1NAMH 4JO4H 2AGJL 4RMUA 2VN6A 3G5XB 2ERJB 4GP4B 3OHXA 5D7JB 5F7LB 3SZKC 4ODUB 3S3DB 4FFVC 4B5EA 1OHZA 5DQ9B 1F11A 4L4VB 5CZRA 5IQ9B 3TU6A 4G1EA 4B9FA 1IGMH 3GMNB 4I9WE 1RHHB 2XBTA 2HH0H 3F6LA 2PPDA 5D5MF 2NY6D 1T4WA 4AL8C 3QJHB 2PW2B 5ERWA 3ECBA 4NJ9H 4ZO8A 2N0MA 1KXVA 5DDHA 3C6LA 2YGNA 3ZLQC 2QKSA 4R8WL 1SF3A 3HKZA 3D6GA 4NGHH 1J0IA 4X4MA 5HPMA 2COQA 4OZIB 1BF8A 2H0FA 1D9KB 4YDLB 5I8OH 2IH3A 3BSZH 2BIIA 3FQUB 2BOLA 4LPUA 4DKDC 1BIHA 3QQDB 2HJFA 1UWGL 1F4YH 4I3GA 5ECJE 2B14A 3MACL 2XV2A 1M71B 2BSEA 4V11A 5BQDA 5KJ7E 3EIFA 1PGRB 3FRUA 4KDTC 4HJTA 1HXMB 2EXYC 1YDPB 1D3CA 2NNCA 4LLUA 4WGWB 1Q0XL 3WXVH 2PXYB 3BUBA 5LVEA 5C07E 4XN9A 1SEBB 2OQJA 3WY4A 3DGGA 4HUVA 3MNDA 3TTYA 1HK6A 2BHYA 5IIEA 3BZ5A 2QPFA 3CZGA 3KH3A 2LTQB 4JFZH 3PABA 4JHUA 4JVPA 1A4JA 1KNOB 1UZ6F 3VWJD 2GBUA 1FYTE 3B6SB 4NQCD 3R06A 2FT8A 2WO3B 1EERB 1HSBB 4GOSA 3ZRCC 5CD3A 4G6FB 3T0WA 2ED6A 2OJEB 1XCXA 3LXAA 4IBSA 5JQHC 4MWFB 1SXCA 4JR9H 1TZGL 2RB8A 3VXSB 5HYQB 4OI8A 3SZ6A 3S36H 4EZKA 5IMMA 3IMBA 1YZZA 1PZDA 4AK2A 3RNQA 1R5VA 3A3YB 4E5XG 2XICA 4M1CC 2YD1A 1G6RB 1WD9A 4L3FA 4OF7A 4YHMH 4ENED 1J5OH 2DY2A 3WFZA 1HQRB 1XGUA 3ULVF 1OB1A 3W0WA 4BSVB 5EG6C 2WXJA 4U1JB 2J4WH 1BP3B 2PP7A 2RALA 2V9QA 1BREA 1OK0A 2DS4A 3ARVA 1OPOA 1U3ZA 3MRHB 5DFAA 4M62H 4XCNB 1Z9SA 1JN6B 2IOOA 3EGXA 3Q8BA 4JM0A 5EORL 5IROD 1NAMA 5I15H 1FGVH 3IMSA 4G6JL 4AQAB 3FCTA 3ZKMC 4PQXA 2PP8A 3APCA 3GSNH 3MLYL 3WY2A 2H5UA 1SDYA 3PL6C 5TQ2L 4HS3B 1ANUA 1T6WA 3LQAC 4ZYKA 5BQ7A 3DMMC 4ZUSA 4Z7VE 2CDEB 3B1UA 5I19H 2NX5E 1HIML 2H1LM 5IM7B 2HG5A 5GZOA 1UENA 1YNTA 4CC4C 43C9B 2HZHA 1BVNP 3RPBA 1AOHA 1OTSD 4Y1AA 1QWHA 4XCEA 5CJQL 1L4IA 3US9A 5DJAA 2DEXX 1FUNA 4YXHL 3VCLB 2JSFA 4H0GA 1M6UA 3MFGB 4G7VH 4AZ8B 4DP5X 2QLVB 5C0EB 3SE4A 3N0PB 2X6AA 2X2JA 4NN7B 2V17H 4WI2A 2ZQKA 4IMKA 2Y69B 1P7HL 2OZ4H 4M8UA 3RPKA 2XIDA 3I9GH 3CSGA 3VXME 5C9JB 1I9RL 4DUXA 1HCYA 1MUJB 3SDCD 4D9RE 4ERSH 5KVFL 3NOIA 2A9AA 4KHXH 1Z5YD 3U30B 3UYPA 2DQGH 5BV7B 4JDVA 4E9RA 4TQPA 4F2MB 5BVPL 3FYIB 4RRPA 4AITA 1XGZA 2F5AH 3ILPB 5EZJA 2XG5A 5LAPA 1BYOA 3C60B 2Q3AA 3FO0H 4OGZA 4X6CF 4ZODA 4X50A 2CKNA 1JDCA 1U92B 1CE1H 4OB5L 5D2LB 4ZRGA 4IOSD 2IV8A 2Y2YA 3EHBB 4J3BA 3LZPA 3SE3C 1MCQA 4HKXA 1CB4A 3RY5A 4APXB 2WVTA 3MV9E 4NI3A 4N2OA 4NXKA 3K2MC 3FOMB 3O45B 5ICYB 5CR1A 2ICES 2B9BA 2VR9A 4YJZL 2ICEC 4Z7NF 1MQKH 2D7PA 4PPTA 4QTHA 4J3OF 4ZO9A 5LXGL 2AERT 5I5JA 4XCYA 1Z3GL 3KLLA 4NC1E 2YRBA 5DD1L 2QT6A 5CBAB 4PJGB 4K15A 4LOUD 1S5IH 4XOBA 3U4BH 3WCYA 4DT2A 4ZT1A 1MFEH 1CT8A 4Y4FC 1HCVA 1TTRA 2VXVL 4U7SA 4B96A 3CHXA 1G1YA 3ABKB 4EKXA 5F8QC 4I85A 3MX0A 1C5CH 4Z7WB 2IAND 4AQ1C 1U8LA 1CU4H 3QNYB 3SYOA 4B9ZA 1NKRA 3REVB 2XVLA 4HGWA 4TL4A 5MEPB 3AQYA 2XQYG 3FYEB 1LO2L 5FYJD 4R5VA 1A7OL 3LRHA 5F7BA 3FB5A 5E2VL 1R34A 1R24A 4FLRA 3QHZL 1QFHA 3LHAA 4DVRL 5KSAC 4OFPA 3TV3L 1BDYA 1YPZF 4TNVF 4OT1L 2P5EA 4JY4B 2R23A 3SE6A 5AZUA 4X0NA 3SCMC 3H42L 1QLFA 3STLA 3IKKA 2WINA 5IW1B 3GDBA 2E7LC 1RK1A 4RMSA 4XP9L 4PGCA 1WBZB 4DZ8A 1QZNA 5G55A 5MHSE 1OAYL 1XFPA 4XN4A 3RDTC 4HC1L 1BM7A 4OIIH 4L8CB 3SDYL 4CA4A 1QRNA 2VLKA 2Y7QA 5BRZA 1UWFA 1I1FB 1J0KA 4N25A 2GQHA 4AVJA 1VFBB 3SBRA 2CNZA 2DM2A 5CP3H 3U4AA 1DL7L 1S5HA 3LEYL 1RUPL 3TO4D 5I2IB 4PRBB 4BFKA 1JL8A 2XKNA 2Z0UA 4XPAH 2ZX9A 1PBYA 5AOLA 3TVMD 3T4YB 5F1NA 3HPLB 5DHVB 2EDMA 3T3ME 4FQ2L 1MAJA 1Q8MA 3VI3F 4EN3D 5HYJB 1JI2A 3DPBB 1B4LA 2DBLH 5EU4B 3WTTA 1H3PH 5FM4A 3WXWL 3GUFA 1Y6KR 4JLRA 4XMKL 1JGEB 4QY8A 2IALA 2XZAL 4BUHA 3B5TA 1BZ7A 3CVIL 4OZHB 3VRLE 2P7TA 1HHGB 3BYTA 1AQKL 4FQ1H 1ECYA 2VDRH 2B39A 3P77A 4UT7L 1BXAA 3A22A 5J6HA 1H15B 4CDGC 3S2CA 5FFLA 5TFSL 3O6KH 4MNGE 3JV0A 2OYLA 2IPUG 1E4KC 1TKWB 4EBQL 4YSTA 1JAEA 3NN8B 3VXPA 4F58L 2X6MA 5FOBA 1W0VB 4HK0A 1NINA 2X9ZA 4ATWA 2OFQA 2HXAA 5CLTA 3NRQA 1B4JH 2ENYA 4OAWA 1IVTA 2WQVA 2DL2A 2W5PA 4MB1A 4WTZG 4I4WA 3MCLH 4XOEA 2F58L 5H37G 2P4AB 3D4GA 1N2RA 5AKVA 1E6OH 2AJ3B 3QI9A 2DYRB 3P4LA 4NS0A 4OD2B 4RFOL 5F7AA 3V6BR 4F7PA 1LD9B 3VE0B 3ZQWA 4PRNA 2F1EA 4PJDF 4PJCE 1XH2A 2MOGA 5L8KB 5ANMA 3CHSA 4RBPH 2J1WA 4Y19A 2CM5A 4O5LL 1F3DH 3KMDA 4OW6A 1NDMB 4H2CA 3SO5A 2LT9A 4M7JL 1JXKA 4P5TC 5F7EH 1ZV5A 4LEOB 4NUJB 4DWHA 5J1SC 2QQLL 3QZWA 3HNSL 3P9MB 4GAJH 1J5HA 1YMMD 1L7TL 2R9HD 4WLCA 3PL6B 3OKMB 2X1QA 1RIVH 4M56A 5DSCB 1LE9B 2YUWA 3DMMB 5HHOD 4OFQA 3MRRB 3PHQB 1KN2L 1WCBA 2K78A 4MCNA 1RMFL 2WUCL 1BFOA 2E7DA 4KTDL 1UT9A 2VKWA 3BD5A 5DZOA 4K7FB 1HQ4A 3LS4H 1XXDC 3BN9D 2JQAA 2N59A 2DF3A 1E67A 4OZ4B 3FO1B 3K4ZA 1GMIA 1U8MB 1UWEH 1KELH 1K5WA 1T0NB 1E4XI 3CLWA 3UP1A 4AXWA 1PYWA 4JQXA 1C08B 4M43L 4Z7AA 3MGOB 1PU0A 1DFBL 2EICA 1F90H 3G6JB 3O4LD 1QLRA 4KZDH 4OJCA 1RZ8A 5C0RH 1SMAA 2YA2A 5F9AC 1NIFA 3KLKA 3PCYA 5CNHA 1FFRA 3MUGB 3T0EC 5CEZL 5E2TL 1HL8A 1PS3A 4M7LL 4LLQB 3T2PA 1B6UA 2QSCL 5JORA 5HDBF 4GSQA 2V2WA 4OD1L 3ESMA 4NQSA 4TVSa 5HGBA 1Z6JT 3C75A 5E7BA 3AAZA 1NTDA 2AXFA 3H9HA 4JDEA 4JFDE 2PWGA 4G6KL 4UOW1 4XNMA 1CMOA 1XCTB 1CGTA 1VZIA 4PREA 3UPRA 1MH5A 3GIVA 4WU5B 1LJMA 2BP3A 2WOBA 3HZKB 1ADWA 1RZJL 1V7ML 5AKTA 4NIYE 4TSAL 3IDIB 4YSQA 3ET9F 3FHAA 4LKXB 4WWID 4OI9A 5EC2A 4CVXA 4BZ1H 3OPZL 5T3ZD 5IJCC 3B3BA 1MCNA 1PJWA 1QACA 3T2NH 2MRYA 3V0VB 4F9LA 3FT2A 4E41D 3OAUH 4JHVA 3ECWA 5DT1H 2MCAA 5ACMA 1UQSB 3NK4A 4KJQD 3X1GA 4ZAKD 5SWSA 2P5WA 4FQIH 4EVNA 2ICEB 4HFUH 2WCPA 1CN4A 4M6ML 3DYPA 4Y4KC 1T5XB 3FUKA 5DR5H 5KS9E 2C1PA 1A65A 3ARDD 4N2KA 2MQCA 4GIPD 1H9VA 1H3VA 1JWMA 5C8JA 1FO0A 3E8UH 4Y4FB 3VFVA 1N8ZA 2XY1A 3L3IA 2A2QT 4YAQA 1MFBL 4PWFA 1EUUA 1F41A 1BD2A 5E03A 3C9NA 1QA9B 2ITDB 3BYYA 4JG0H 4AQ1B 1RSFA 1DJXA 1TEFA 2DV6A 3L7EB 4HJIA 3JWOL 4NI6A 3JYCA 3V5KA 4OF5A 3ARRA 1X5XA 4MJ6B 4IRZH 5JUEL 3WJLA 1I8AA 1RPQA 3FFCD 2WY3B 1HEZA 3VH8B 3JV5A 1XVSA 4PWKA 4U6VH 1BW8A 1YEEH 4LDOB 5KSAB 3EYOB 3LVEA 3FTWA 4DP4X 3QNFA 5JPMA 1CL7L 3BVUA 4KI5D 3UTTB 3X3FL 1G6RL 2BVEA 2NNFA 3AREC 3VD3A 5CUSH 3SCMB 4L4VE 5EIVA 1G7HB 4HGKC 3WKNA 3L4TA 2A73B 3NJIA 3TN0D 5CEZE 2AMGA 5DO8A 2AITA 4Q9QH 1I4FB 3EJJX 3FC8A 5IGXL 2WO2B 1XR9B 2XFXB 1XHHA 2EIBA 3MJGX 5IBTL 3KH4A 3RDTB 1MFAL 4LF3B 3RU8L 2ZICA 4LCIL 4EKJA 3AG4B 1K5NA 3TBTB 4N5EC 4DHLA 1QFPA 1MDTA 4U1MB 1K72A 3ESPA 2DQUH 4YQXH 2YKKA 1IGFH 2BJMH 2AJYH 2EDYA 1DBMH 2V5SA 3MNZB 4XB3A 4OZIE 4O4YH 5E8PB 3PGDA 3VGFA 3ETBJ 4KK8C 1NCOA 5EOQH 1OM3L 1QR1B 4G82A 1ZEAH 2OL3B 2UY6A 3FT0A 3D1MC 3LKSA 2XWDA 4ZQKB 3WBDA 1Z32X 4GSXA 4PJAA 4L1SA 2WXOA 4WWPA 8FABA 4PY7A 3EYFA 1PZCA 5CU5A 4CMMB 2BDNH 1WBXB 2WSKA 3V0GA 2LLLA 1IC0A 1VEMA 1ORSB 3CSTA 4XBMA 5L2KD 5HVWA 4LARH 1IVLA 5D4HA 4MA7H 5DMIL 2UZYA 2ZKYA 3PWJB 2VDMB 4Y9GA 1U8CB 3VXUD 4OZGA 3O8XD 3MTRA 4YXLL 1WGOA 3UCRA 4ZFZA 1XGYH 4K3EL 2ZUYA 2EDEA 1NKGA 2ZWSA 4OLZH 5T3XD 2PYED 4Y4HD 3A6CH 5BV7L 3TBCA 2IDQA 1KXQA 3MC0A 1Q94A 4XAWH 1KCWA 4ZMOA 3N1QC 4X2UA 1U4FA 2BRRL 2EIZB 3HNTH 4UB0H 1NCBH 1KTJA 1X9LA 4BFOA 3BGFC 3VXSE 5L4MA 2ZSWA 2VQ1B 4M93C 3PLYA 5GS0H 3SN6N 4U6XB 3EYQC 4YK4C 3O6ML 1YEWA 5IMOB 3OJ2C 1TLKA 2ED8A 5L88L 1KLFB 3CC5A 4PSPA 4K8RH 4RISL 4W9GC 2GEQA 2ZT9C 2HVBA 3B9EA 3J07A 2XTLA 4D0BA 4P5TB 1R5WB 2K4AA 4F27A 1IAIL 2JTYA 4DPBX 4QXTA 5B7MA 2B3RA 1QPKA 4IRZA 4YIQA 3WHE0 5JOEA 4XRCB 1U58B 5EOCH 2FX9H 1TVDA 4JO3L 2ARJB 2R4SL 1IM9D 1AO7B 2VL4A 3BJ91 2EH8H 2JXMB 3CVCA 4I3SL 2VC2B 5CFHA 3MV8D 4JVWA 2GTZA 1J1OH 4HHGA 3UO1L 3O9WD 3S5LA 5AWNL 2AZUA 2G4GA 4NKIH 3VFGL 2E47A 1NAKH 5AD0A 3PWLB 4LNVA 3MCYA 5I9QC 4MCZB 3O2VH 5DRNB 2N7AA 2CPCA 3UADA 4KVPA 4JKLA 4WWKA 4H7VA 2GIMA 1KYOJ 5DQJB 4M02A 1UASA 3FL7A 1M3JA 2GJ6B 3CSYA 3EJQA 4LO9A 3T0EB 3ZRSA 1UURA 3EYSH 1OZTG 3GSXA 3JTTB 4RMRA 2DMHA 4LPXA 3EBIA 1PX3A 1F86A 3RYMA 3WS6A 5D1QD 1FAKT 2QGBA 3N91A 4AL8L 1OANA 4FS0A 1NBYB 1KFAH 2XA3A 1G4MA 1FDLL 1MXDA 1DLHB 3NZHL 2FEEI 4QXUH 4QD2E 4WJ5B 2A6KB 4E9YA 1U8HB 3F5WB 5DYFA 3MCG1 2W88A 4M61A 3FSWA 4MB4A 1YEDA 2VNCA 4XNBA 3V52H 3ATEA 5J9PA 1BPLB 3VGGA 5DJ0A 4JHWL 4FOMA 1JWUB 4PTUA 2F7PA 3AS3A 1X5KA 1FC2D 5D2LE 4NQUA 3OLGA 1NCHA 2D31B 4MYWB 4XXCC 5FWRA 3NFSH 3M07A 1E5AA 4Y4KB 5IG7A 1R4XA 5LBGA 5ITBL 2APWA 1YECH 3D52A 3F3HA 3TJPA 1U4EA 2VSKB 3QG6A 5GGRY 1VZGA 5KBNC 1GW0A 5CGYC 3MREA 3EYUH 5FECA 1EANA 4Y2OA 2JWYA 2QADC 2P44B 1NBQA 1XF4B 4YO0B 4KRLB 5INCA 1NC2B 3BWUC 1XIWD 3HC4H 1O6VA 3BWAA 2AK1L 2GFBA 1B88A 1JPSH 1M56B 4PJGE 2VDKH 4LCUA 1ZWIB 1KSRA 2CJUL 2NDFA 4WNJA 2UXGA 4V1DE 4AQZA 2XY2A 1YVLA 5FLVA 2EXWD 3D09A 1B2WL 3QIUC 2PW1B 1FVEA 4Z3IA 2AJZA 5F9WC 2VH5H 1QSZA 2B2XL 4N9OB 2X4QB 5EZIL 1NC4A 3LPPA 4K7PH 3U0TA 3GINA 4Z9KB 3EF4A 4XX1E 1V7NL 1YY8B 4N0UB 5IJKC 1A7RL 2NY1D 4ONOA 1MCFA 5J12C 2XKSA 5J3HD 2O5XH 3AREB 3B2XA 5IMKA 2AJVL 2DDQL 2NR6D 3KLHD 2JJSC 5KG9B 1S7WB 1EAPA 5I73C 4K71C 4KRNA 1GMEA 3W57A 3IDJA 1JPFA 4YHIA 1M6OA 2C7UB 5DUMH 5KW9L 2BNQD 1JZEA 3X14B 4QHPA 1D7FA 1WHOA 3T8XA 2Q3ZA 1ZT7A 5DUJA 3DKHA 3PGFL 4LSRH 4XNQB 3B9KA 5B4MC 5C0JA 1JP5A 5EF1A 4XVTH 5FF6B 1UKQA 5CD5C 3ISYA 4BA8A 1MIML 3EJUA 2OMUB 3LQAL 1ZK5A 2CHWA 4F91B 1ZLVK 3D2UA 3CHQA 5IESL 3S37X 3JWNH 3ERXA 3UBXG 2CMRL 1RXLA 4NAQA 5CBEB 1ERNA 3VGHA 5IT2L 1A3ZA 2UZIH 3L13A 5EUOF 5IVXA 5HPOA 5MERA 1L0PA 2ZOKB 5D71H 3U83A 3CN0A 5G5DA 3OGCB 2QR0A 3VXRA 1Z66A 3WFBH 3L1FA 3PJSB 4NO0D 35C8L 1S9XB 4XP1L 5CIPB 1F45A 2EZ0D 4HULB 1S7QB 4HWUA 4NM4L 3DRQB 3GSRB 4NB7A 4HUXA 2P28B 4YHNB 2H2PD 3HI6L 1NUDA 2CO7B 1Q9OA 4DKEL 3GMRB 5GGVY 3FPYA 1NIEA 3CV5A 3MRBA 3M1BB 4OQTA 4O00A 1I9IL 4JQVC 5HYJE 3U48A 4KI5F 2X4SB 5K5YA 3QDMB 2P42B 4EO5A 1A7BA 5LQBL 2D4DA 4G3YH 2MTPA 3IXAB 3MV7D 4YWGL 3OC5A 4L5FH 4RGOL 2N3JA 4GG6F 1EZSA 4OZHE 2KERA 5E7FA 3SQBA 1HU8A 2C34A 4PCSA 4KAQH 3D87B 1LEGB 2IMNA 5FGCB 1KDIA 2BSSA 1I8KA 1HYSC 1RUKH 5JIPA 3KYOB 2BMKB 4U0RC 3L3HB 1SQMA 1MG3C 2HUEA 1T04A 4N0FA 5FLUA 3WN5A 2CUHA 1JRHI 3RP1A 4Z95L 3IJEA 3BGFB 4XBPB 5DEJA 4A7GF 3GMQA 2R0WH 4U1KA 3NSFA 1IKOP 4M93B 2OSWA 3O0LA 5I0ZA 1U91B 1KZQA 3IK2A 4TKWA 5DURB 4YK4B 4CGUB 4YX2H 4MAUL 5DK2B 4AEHH 5J6GA 2EEDA 5CCKL 2OX5A 1A1OB 5GQBA 1TCMA 1WISA 2JFCA 1INQB 3PDOA 2P3YA 3ZDWA 3LIUA 1T0MA 4AGPA 5IF0A 3SOBH 4NO2B 2GHWB 5ACLA 1QKZH 1VCBC 5F1IA 3B3IA 2ZE0A 4W4NA 3TEUA 3DVIA 3AY2A 5DLLA 2AHIA 1B0GB 2A83B 1WPCA 5DA0B 2FDBP 4NP4H 4AE1A 4UTAL 5E2WL 1MLBA 1R19A 1UUSA 1IFHH 1VACB 3ULVC 1IAIM 1HN1A 1IZJA 1U8OB 3PUCA 2ENQA 4DF9A 2H1PH 4EZMA 4R96A 1FL5A 3FDWA 3UBXI 4JX0A 3TH4T 3X3GL 1II4E 3JZ7A 3DDGA 3GMOB 1J05A 1U3HC 2J1ZA 5I9QB 4OV5B 5C71A 3KLQA 3TNNB 2F5BL 1IBGL 1PZSA 4PRDB 1S7SA 2BWDA 4JZJC 5IVZB 2RTTA 4KKAD 1E9PA 3V0WH 1DBJH 2AW2A 3VFSA 3C5SA 3LZRA 4N0YL 2HKFH 4TV3A 4PRAB 2Q3XA 3H0TA 3HG1B 1L5GA 4X6EB 3TURA 2OKMA 3ZYZA 5DHDA 3EH3B 3P0YL 4XNUL 1BZ9A 1X9UA 1U8KB 3G6JE 3LEVH 3Q8FA 3V0IA 4PR5B 5ES4B 3WU1A 2XWJB 4POZD 2BFVH 4H25A 4H26B 3MA7A 4W4OA 5FYLE 1ACZA 3S9DB 2WQXA 3TZVC 3VAEA 4GRLC 3MV11 3FJTA 4GXUM 4NPJA 4YHOH 4F8LA 2OMWA 4EIBA 3ZE2F 3G6AA 3AU0A 1H8NA 1HI6A 5IBUB 5K9OB 3GEFA 2XN0A 1B0IA 1G7JB 1PLAA 2QGCA 4BFRA 1RIUL 4I0PA 4YL9A 2QPUA 4J1UA 3C6LD 1PFCA 2HCZX 3PF2A 1PKQA 2AQ3A 2X87A 2APBA 3AMKA 4P59H 3PHAA 3FF8A 3RL2A 3UH8A 3Q6GH 2Q1EA 5HDWA 1PSKH 1A22B 1ZS8A 3G9VA 3QC5X 4LGRB 4OR1A 1T1YB 3UTSA 4FQCL 2XDHA 3D69B 3RFZA 1DQQA 4LLDA 1Q9LA 4LVHC 1KWKA 1CFQA 3JSSA 3MNVA 1SXAA 1Z1WA 2BC4B 5F0JB 1NMAH 4GJTB 4MXQD 3ZE0B 1H6UA 2FJUB 4G9DB 2QADB 2Y07H 4Z23A 4BDVB 2ENSA 3VXTA 2BSED 1UUNA 3HKFA 4LOVA 3PV7A 4MNGA 2O5YL 2Q0ZX 1X7QA 2CHNA 4X42A 5FFOA 3WAKA 1OF2B 2L3BA 1SLVA 4XTRD 5TGBA 4L3EA 5KN5A 1S7TA 5MENB 1MY5A 3AT9A 2VXSL 3MYJB 5CKAA 2AAVA 3QIUB 4JFFB 3LHPH 3DLQR 1TZ8A 5JOPD 3Q2CA 4C83A 4MJ5B 4M6AA 1KCRL 1NMBL 4J3OC 3UBFA 1M1XA 2DH2A 3TF7C 3NZ8B 4UT6A 5FKPB 1CFSB 1KWGA 1MIEL 1EEYB 1ACYH 5J12B 3LKQB 3DHUA 5BS0B 1CI5A 3OG6B 1G7LB 3IAPA 4ZD3L 1NCDL 2ALAA 5I73B 3LKPB 2WLNA 1QW8A 3BVXA 4K71B 5AFAA 1QO3A 1CYWA 4FXKC 3TWCH 4ZG1A 3ZMRA 4OZFH 4ZUTB 2GK2A 2I69A 4TVPL 4KNSA 4AYSA 4Z77A 2APSA 2EDDA 4I5BA 2HFEB 4L8SA 1XZ0A 3QFJE 3UTTE 1HE7A 5DLMH 1DN0A 3HLAB 4KROC 2J6EL 4MVBD 4NKDA 4XHQA 1KBWA 4LIQH 4BK8A 1PQZB 3EOAA 2AEPH 1G7IA 1PD0A 1O75A 5CLYA 2XRAH 4JN1H 4JUTA 4DIXA 3W0WD 2EDBA 1WIUA 2E7MA 1R5IB 4ANXA 2HPTA 1TQVA 2X44D 2EE6A 3LV3B 3S8WA 2W0KA 4MSWA 5EC1A 3EXJA 2YAHA 4XC3H 1NGWA 5DRXA 3WEAA 4X98A 2PETA 4HZLB 2BY3A 4QHNB 5EB9A 2VZ1A 4PGDA 1Z9LA 5D5MB 2IMMA 5TH2A 4M9PA 1Z5LA 2WBXA 5FXCH 4F15C 3QUXA 4DCQB 1RIHL 5C0CB 1EV2E 2H6PA 2DQDH 5IFJA 1E8ZA 4FRWA 1P69B 3MGTA 3QR1A 4FQQB 3LX9A 5ID1A 4IU2B 4ZX4A 4N0RA 4PG2A 4RH4A 4XP4L 1AP2B 4JM2C 5DUBB 5GZOD 3D25A 1A7NL 2BSDA 3FSOA 2ZPKL 3ME0A 1FZOA 4UV7L 4RNRA 2G60L 1F1AA 2ZAIA 4Y1AD 1UC6A 1JF1A 1UYWH 1HZHH 4N6QA 3K91A 1AZCA 4LPWA 3D39A 5CSZA 3HZ3A 3MLRL 4JZNA 1NIDA 3VU1A 2XTJC 5EO1A 3FCSB 3H3PL 2OR7A 5DO2C 1C8QA 4U0RB 3ZT5A 1J9CT 1N70A 1DDHB 3KEDA 1TEGA 1ZA6A 2MPVA 3NQIA 3IWVA 1ZLVH 5BOPA 1QVOA 4S11A 3NACH 5LBSH 5KSVA 4HSQA 1U30A 3QH3B 2H6OA 3VA6A 3WE6B 1MVUB 2ZSVA 1WZKA 3OKEA 4N5UA 3X12A 4GRWF 5C1MB 5KS9A 4H8HA 3A24A 5DJDB 4KK9D 1T03H 3EFOB 2OCFD 3NT0A 1C12A 2NY6C 2KDYA 2EIKB 3QJTB 2FJHA 4KGJA 2Z7UA 3OAYK 1SUJA 2FEDD 3TBSB 4GKOA 4HMEA 1U0QA 1EHAA 2XPZA 5C0FB 1GJWA 2CG9X 3SJVB 1ADQL 1AS6A 1KFGA 2FWOB 2IDSA 5DJCB 4OM1H 2CR0A 3GXTA 4LSSH 2NQCA 3DK0A 3NYKA 4Q6IA 1ICTA 5DYOA 1MFCH 4QF1B 4Q52A 5CR8A 5ITFA 1TJXA 5E4EC 4HHAA 1AG0A 1OAJA 4X9FA 1FNGB 3V4VH 2C7FA 2H3NA 2AABH 1F4AA 4ZUVA 5E5MB 1NOAA 5EA0L 1J0YA 3H54A 3DIFB 1BBJA 1SF5A 1U3HB 4OZFA 2QDVA 2QVIA 3CSFA 4TS6A 2GBVA 3DBXA 3WO4C 4FZ8L 3L3DB 4JZJB 1BM3L 2OTUB 3ROOA 4BIKA 2RR3A 2V9RA 4LHUB 3MRGB 2AQ2A 2FWLB 3C2AL 4UQCA 3LH9A 3OKLA 4LMQI 2K7QA 3THMH 1RURL 1ML0A 1CXIA 3ARGA 3B9AA 1WEJH 3X17A 4N1EA 4NCC2 2Z31A 2GJ6E 3T6ZA 3TZVB 3T0EE 4JFXA 1UM6H 3VWJC 2D3VA 3QZOA 1WZMA 5DVPA 2BZDA 4PV9A 2DM7A 4JFYA 4AMXA 4H88L 1UD8A 1FV1A 1MREL 4P49A 3ZGHA 2JKIS 3WFHB 3WTVA 3LEXB 1YAIA 2P5ED 4ABQA 1Q9KA 4L3CB 3E6FA 5DZJA 2Q6WB 5EEZA 1QFWM 1RJCA 3EJCA 1U2YA 3O3AA 2QKIC 1UVQA 4OUOA 4ENEC 3UG5A 4RAHA 2JCCA 4LAQL 2XVBA 2DQTH 4FKHA 3FQTB 1NCGA 1RD6A 2OR9H 1F6AB 2VXQH 3T8MA 5D70H 2DAVA 4Z5RB 5CGMA 1NEUA 4LVHB 4NQVA 1QRND 4QRRA 4ELMF 2VLKD 3FTUA 5BRZD 1BG1A 3MOAH 1UACH 3P9LB 3PHSA 5IROC 1IAMA 2APVA 4FXTA 4F1SA 1KPRB 4JE4B 4Q7DA 1VKXB 4X6CB 1S4IA 4WSGA 1LNUB 1XD0A 2VERN 3MR9A 5HD8D 1E9OA 4YXKL 1EFXA 5BOZG 2J55A 5DJ6B 4NYLB 5LBSA 2FB4H 1KC5L 4FFYH 2WUBL 2XWBA 5M7QA 2IH8A 2VXUH 1ZVSB 3WFEH 4N4YB 1JNHA 4N28A 3KEHA 3QHFH 3WSQH 4YE4H 2WP3O 3DX9A 2DB8A 4A7QA 4JW3A 2BVQB 2Y7SA 1BAFL 3M8OL 2H8PA 5H94A 1OTSC 4WFGE 4XCFH 4A2EA 4Z7NB 4URKA 2NUTB 4DZBA 2EUWA 2CLZA 1KCLA 3BP7B 2BOCB 1B6DA 1XMWA 2GHZA 4GKLA 3QB7C 3EBGA 2F0CA 1CFMA 1P1VA 1A7PH 2ED9A 3CFEB 2A6DB 4XE5B 4MTMA 5F3FA 2DQMA 4FXKB 4DERA 4NRZA 1IMHC 2F7QA 2ZUWA 3RLSA 1V54B 1I1CA 1RJLA 4N0UE 1IT9H 1OGAB 3AG1B 4KROB 4MXVF 4Q97A 1AXTL 1SBBA 3SDCC 1R3LA 2HX9A 3DSFL 4HLZG 3L3OA 2Y9RT 3K5SA 3FQNB 1A1MA 4ZBJA 5CO1A 3QI9D 1ETA1 5JO5B 2BSCA 5BZWB 4ZFGH 4QXVA 1GGCH 4LSTL 2OLDA 4PJIA 2K45A 3BH9A 5LO7A 1QNZL 3BKCH 1MCCA 4Y19D 1YPZB 3U0PB 4HU8A 1MCPH 2VN7A 4BK4A 3QUKA 4F15B 2R7EB 5AAWA 4JRYB 3GS4A 3HN3A 3F04A 4UINL 4RFEA 1A2YB 1QBBA 3ZU8A 1F3RB 5EH1A 4JG1H 3X1BA 4CNIA 3Q48A 4B0MM 2JELH 1FRGH 5CEXB 1S3RA 3Q1EA 3BAWA 1NEZG 4JM2B 1WAEA 2PCYA 1NWPA 3WTUA 2N56A 3HNVH 3QO0B 3KDMA 4TUKH 1KXHA 4F3FB 1HZKA 2ADFL 1J18A 1EPFA 4LOUC 2BVPA 4X6BB 1CR9H 1T89A 1FFPA 4Y7MA 2BERA 1Z9PA 3PRZA 1W72H 4UM9A 5I1EL 1WD8A 2XTJB 1URIA 2XHNA 4MB3A 2J21A 3ZUNC 3QORA 2R1WB 3I9PA 4UT9L 5L4IA 1U95B 2VXQA 3QDME 3E6HB 3WUWA 2AEQL 3VI3B 4BKTC 3US0A 1ZA3A 1OAZH 3DVGB 3UJIL 3APDA 3DOHA 3FMGH 3MPCA 5JW3L 2VL5A 4KQ4L 5FGCE 4L9DA 3H6JA 3CDFA 3E9UA 3TONA 4ES8A 4ZPTB 1G1CA 2GC4C 2J2ZB 1ZTXH 4LESA 4MA1C 5D55A 1QWUA 2J3SA 1F3JA 2NY6B 4FFYA 4WFFE 1OSPH 8CGTA 4ALAL 2QGEA 5E6YA 2HRPH 1BBDL 4WUKH 4EMZA 4Z3TA 1J5CA 1XDTT 3E2HC 3NIGF 1G9NH 1LDPH 1R3KB 4DK3A 4HQQL 3U9PL 2BIPA 4X7EC 2OW7A 5EO9B 4CJ0A 3F84A 1EAQA 1T20A 3AY4A 3B37A 4OCWL 2BP8B 3S5ZA 4ZW6A 4V1DA 1YNTF 5CCGE 5E4EB 4ZDHB 1E4WL 5SWSD 2P5WD 3PHOB 1CO1A 1J11A 1SHXA 4PI2A 4L0ZA 1MPAH 2GABA 3L5HA 5HHMD 1RU9L 3H2PA 3P30H 1EBPA 1KN4L 4RMVA 5E4OA 4AYID 4GKNA 3DTXB 5CJBA 3A4EA 3FT3B 5D8JL 3SYQA 3WO4B 3RWJA 4GW1A 5MP6L 1NOFA 1XGQB 2Y5TB 2CBPA 3HB3D 3TVMC 4QR7A 3ZY7A 5IFAH 2OBGA 1DLFH 2CSPA 2ZYSA 1VPOL 2FNWA 2M26A 4Z3JA 2ZAGA 3L2NA 4EN3C 4BKSC 4AYGA 2JJTC 2IAAC 3ZDXE 5KAQF 3O6FA 1BD2D 4H1LH 3FO2B 4K9EH 2DYPA 1CGSL 5F96L 3ZW3A 4OCSL 3CDZA 1O5PA 5DEGA 4PB9H 5E8OB 3UGXA 1BLIA 3UPCA 4QXWA 2FQDA 1RZIB 1Z9OA 4X9GA 2EP6A 4I0CC 3VWJB 4NQCB 3HG1E 5L6YH 2PTUA 3IDUA 4XCCH 1AGCB 5HYFA 1OTTD 4XZ4A 1BWWA 2FBJH 4HUNB 5KJRH 4G6AD 5G2NA 4YDIL 1WZLA 1C1EH 4XOCA 1IIIA 3FUEA 1BFVL 1U8QA 3QUMB 4NQEA 5LDUA 4PJ6A 2QKIB 3H7BB 1EWHA 3A4AA 5EWIH 2B7DT 2FX8H 4IHOA 5C86A 3DHMA 2K9FB 3S88H 2DWDA 3MLVH 1ZXKA 1XBDA 1AFVH 1TO5A 5B3JF 1TPXC 5HDBB 4HUUB 3GSOA 1TQCC 3MQIA 1W72A 3QQ3B 3HLKA 1UKTA 4LP4A 1VCAA 4M6OL 5AQ0A 1CK0H 3B1TA 4YZFE 1F1DA 1FBIL 5CF3A 2JKRM 1AR1C 4UU9A 3RHWK 3JZYA 1UA6H 1QFUL 1JYWA 4JKNA 1NFIA 3UYRL 2A4ZA 5GHWL 3JWDH 3ZE0E 1ZGLM 2YA1A 3BPCB 1ZVHA 1EA9C 3AS2A 2X6UA 2XX0A 3GGWB 1RK7A 3JV6B 2VDNB 1Y6MR 3GMPA 2E7CA 4JBSA 2YMXL 3FQRA 2NRDA 1AACA 2ZCHH 3CFKA 3PWUB 4TNEA 5AB0A 5K9JL 4BK5A 3BN9C 3RBSA 5GS3A 3MJ8A 4HOXA 4N8UA 2E4FA 3GSVA 5LBVA 5MENE 4HS8L 1QPPA 5DZPA 3GMMB 5HSFA 1CLZH 2X3BA 3KPMA 4ADGA 1FL3B 4JFFE 3ZZ1A 3CQQA 1DBBL 3CFCL 2NNXA 2HTKD 4HCIA 2EUZA 4L23A 4P5KB 1N3NB 1K2DA 2EDFA 2P24B 4LVOC 4LVEA 4ACTA 3J2PA 1BLNA 1NCCL 4GLRI 4U0QB 1TJHL 3SDCB 4GMSL 5BS0E 2O6FA 2XTSA 1YYLL 4JANA 1JGUL 4HWNA 1SXSA 2ADGB 1AY1H 2WZ5A 2WXLA 3FH8A 3PDGA 3O2DL 5IB2B 1NBZB 3KWUA 1KYUA 4C56A 4D3CH 4J3TA 4EI6A 1EUTA 1MCOH 1LXMA 1SFHA 4MDJB 5ILTL 4GAYB 2B1OA 2OMXA 3UJJL 3ZSSA 3IFOA 5KYXB 1D5MA 2F1BA 5KANI 32C2A 5KWYC 2QSTA 3BAKA 3QUYA 4UIKH 5SWQA 3P3RA 3T6WA 1LK2A 4DFHA 4AGNA 4HXAH 4HEME 4LNRB 5CAYB 4KJQC 3KYNA 4ZAKC 1L3WA 3K46A 5D5ME 3NCJH 3IXTB 5C0CE 3H3KA 4Y0GA 3FB6B 5B38A 2VISB 3NH7H 5KTEH 3ARDC 5EBMB 3ULUH 4IMLB 4LU5H 4MJIA 4DTGH 2W92A 4XMLL 3ZDYF 4YEEA 6PAZA 5L4JA 3WIHL 3IU4H 3DV6A 2F08A 5A16A 4AV5A 4ZO6A 2YBGA 4ADJA 4MMXC 3GSWA 2J5LC 3W2DH 5DD0H 1ZLDA 1Y07A 1OAQH 2IANB 4WWKD 4HBCL 5B21A 5ABZA 3S36X 1V3MA 3QA3B 2C3XA 2R39A 1BVLA 2R69A 4O2CA 4XPGH 1PEWA 5SX4H 4W9JC 5F9JB 1CG9A 3CDCA 1I85C 4JZOA 4XE0A 1IKNA 4F80A 2D3LA 2J1YA 5DJ8A 2ZCZA 3BP5B 2VDOL 2WWOA 4Z7UA 4MA1B 4GIOA 4LE8A 4XHJD 1JHTA 4OSUH 5JHDA 3L3JA 3T4AC 1JZIA 3F12B 4KI5C 2AI0H 4MA8H 2ZX5A 1PG7L 3DJZA 4DQOL 3WL9B 1BQHA 3RIAK 4C54A 3EJRA 3E2HB 1CLOL 3TN0C 1MFNA 1VDGA 2HFFA 3UX9B 1RZKH 1XGTA 5J1TC 3TXAA 4OLUL 5MEOA 1UZ6E 3BPOC 1CLCA 2VLLA 1U36A 2WYIA 4P9HC 4JY5L 2X6BA 4M29A 4Y5XC 4S1QH 1DP0A 5A2IH 3H1ZA 4HWBH 4DEWA 2VMDA 2FX7H 3SJVE 1IEBB 4FDWA 3N44F 1UXWB 3JXAA 4LCCC 5GJTL 3C5ZA 4NNPL 3L9BA 5AL0A 1AYOA 1PLGH 1UEYA 1QBAA 3LTVA 2BFGA 2B1AL 2Y7NA 3KW8A 4KKLD 4K7PY 3TO4B 4Z76B 4JO2L 3ULVE 2NY3D 5DU7A 4TM9A 3TVMB 5I5IA 5EOTB 1NIAA 4ZSOA 1RUMH 4KNQA 4YDMA 4LDCA 4EN3B 1W8EA 3D9AL 1IZKA 3NCFB 3PG2A 4DH2A 4QRFA 3QFJA 2YARA 1PJ9A 3CFDB 5GS0D 4ODWA 4I3RH 2LVEA 2ZX6A 3VFNA 5ESQB 4TPRH 3D0LB 1NLDL 3MJ6A 3QRBA 4RX4A 5TF1L 3LJ3A 4JG9A 1C5DA 3MUUA 5BCAA 2X1WL 5DRWB 2WHVA 2J1KA 1R1CA 3HE7A 1NC4D 2X53A 1TU2A 1ZSHA 4NBZB 4NO5B 15C8H 1W0WB 3O8XC 2B4CH 3ILEA 3OJDA 2HJLB 2EO9A 3UDWC 4BFJA 5I1AB 1CIUA 3D0VA 1KXTA 3QPXH 3E38A 5BZDA 4HJUA 4KUCD 4QYOB 4M1GH 2WKLA 5D6CA 2JJVA 5C2UB 3F7VB 4Y4HC 1CLYH 2MKWA 2J88L 2V2XB 1IAOA 4XB8A 3OMNB 5LGJA 4OJFH 4LSUL 2CCVA 2NZ9D 1K8IA 2KUTA 4GO9A 4KOCA 1TPXB 3PFQA 1JJUA 1BV8A 1TQCB 3BVWA 2IOIA 1PCSA 4PJEA 3B9KD 3NQKA 4OGXH 1KT2A 5FK9A 3VFRA 4EUPG 3PP3K 1YMHB 4G8AC 2FLBT 3VSUA 3TIDB 5IWLA 2OCJA 3D2UD 4V2CB 3HHSB 3QG7H 3T6QC 4BXVA 5PCYA 1YMMB 1KEMH 1OPGH 1E5ZA 2YGOA 4P5MA 5C6WH 2BIMA 3SGEH 2ORBH 5HHOB 3WHE1 4NUPA 5T1DH 3QULB 3BKJL 3VXRD 1AGBA 4X6CE 1MHHB 2WAQA 3HMXH 2QJDA 3O3DA 1JZ7A 3C8KB 1P4UA 3O9WC 1MEXH 3CVHH 3FTSA 1ZJAA 3IJYA 2YPVH 5EU3A 1FF5A 2V3FA 4XP6L 2P8MB 1XH1A 5HHXH 3NA9L 2G0LA 4I13B 3UERA 4OLWL 3QJFA 1SPDA 3O4LB 1I9EA 5F6IC 4Z7NE 2WNGA 1KB9J 4LVOB 4P05A 1KTLB 2PF6A 1C7TA 1FCCA 3KYAA 1L0QA 1TQSA 1SXZA 4F57H 4KHTL 1ZDQA 5D1QC 4QI3A 4L4TA 2OAAA 5CLZA 4WTXA 4M7KL 1BVNT 2HLAA 1OD9A 2F9BT 4TQIA 4B3EA 1U42A 1BECA 2R29A 5GRVL 4X9HA 1HHKB 3IDXL 4M5SA 2DI7A 4U6HA 4D0CA 3FFDB 1MQ8A 3UG4A 3CFQA 5ICUA 4AI7A 4TULL 1WT5A 3D48R 4MD0A 3GDCA 1NSNL 5F7WC 2EACA 4IU3B 1JHKH 1FN4B 2ZXEB 3L4WA 4PJAF 4ODSL 1KLUA 2C3HA 4HALA 4E41B 2X4RA 4LL9A 1T3FB 1KTDB 2ATPA 1FNLA 1N5YL 4ZAKB 3HJEA 1YPZE 3T5WA 3CCHB 1S9KC 1A66A 2FHBA 2WB1A 3L5IA 3AVEA 1T4KB 4JRYE 1DQLH 1H5BC 3ABLB 4GY4A 2ZWZA 1PZ3A 4ELDA 2AXGA 2NW2B 1YYCA 3RWHA 5DZLA 3ARDB 2BW4A 1A5FH 4OZGF 4FKEA 4H5SB 4GB9A 4UTBH 5C0AE 1X7SA 3TFKD 4NDMB 2IH9A 1EK3A 2DJSA 1AIZA 3IFLL 4I87A 4NZRH 4Y16A 3FCUB 4MMXB 1XIWC 2J5LB 1ROWA 5EUOB 4A2LA 5GISL 2DLFH 2Z91B 3W9EB 2X4PA 3OKYA 3BAJA 2X0WA 1AGEA 3KYMB 4XC1L 2EXWC 5EU5A 2XTJE 3DX6A 3D2TA 2W07A 1EMTH 4QUOA 1BA9A 2ATKB 2DL9A 3FFCB 5B1AB 1ZLSL 2VQUA 3QUML 4AIXA 3TJEL 4UYPA 2XXMB 3GHBL 3UAAA 3VI3E 1BEYL 3T4AB 4AVKA 4Z0XA 3QPQD 4XAKD 2NY1C 5F2FA 4TTDD 5I8EB 4FEIA 5J3HC 2NR6C 3KLHC 1VHPA 3OKDB 3TN0B 4F7TB 3EJYD 3K0WA 3BKYH 4GG6B 1QBMH 1JWSA 3KAAA 1TETH 2EXTA 3OSKA 5IV2B 3BPOB 2ZXCA 5EN2B 1JFQL 2AEIT 4I0PD 4GUQA 1KCVL 1Z5HA 1WS8A 4Y5XB 1OAXL 4KPHH 1LEIB 5EUKA 5KSUA 1UB6A 3QXWA 3GIZL 3UABA 1QUPA 2KHAA 4A38A 4XWGL 5A1AA 4LCCB 3UTSD 2IPKB 2WN2A 2CWRA 1Z0NA 2XYBA 3HBZA 2I7OA 2O26U 4RSVA 1DJGA 2VDNL 2V37A 3AS1A 2CK2A 1GOFA 2NTFA 2BH0A 1U6AL 2UXFA 4PRIA 5K9QI 2OW6A 4R4ND 5JHLL 4HG4J 5IHZA 1UOLA 4DPCX 3GT6A 4UDUB 4R7LA 1JYVA 3DX3A 2EZ0C 1TVBA 4GI9A 1SOSA 1HT6A 3N41B 5A6IA 4ES9A 4XMPH 4IOFD 2A9ML 2H2PC 3DUSB 3Q5OA 1I31A 3OWEA 4L3ED 1KJ3H 4D0DB 5FC9A 5KBMA 5L2KB 1KGYE 2R59A 3CDGA 2CLRA 5IEHB 3VQMA 3BXNA 3FZUD 4FMVA 4NT6B 4GBXA 3BMWA 3VXUB 1KTBA 1A3QA 1ZHBA 3G08B 3O8XB 2Y72A 4G8GE 3ORJA 1A6TB 4YDZA 1ZLWH 4L4JA 4UQIM 4WF7A 1M3IA 4MCYB 4NXSA 1CBVL 1KCBA 4NN5C 3CGTA 5J0BA 2XOTA 3CZFA 2PYEB 3GLZA 5D96C 1IAKA 4NQCE 4Y4HB 1GZHC 5C0GA 2NY7H 3WFDH 1QSFA 1SN2A 3MRCB 2EH7H 1KCSH 1P5VA 1X5AA 2JI3A 4LEBA 2VABB 2WVVB 3RB5A 3LS5L 3S48A 1UD4A 5HGGS 4NERA 5IB1B 4UTBA 4Q0XL 1HILB 5TE7L 2AGJH 3EGDA 2F7OA 4PJ5A 4HAFA 4JPVL 5T33L 1PZ5A 4PGEB 2VMJA 2E4TA 5HI5D 5I1JL 1QYGL 3MXVL 5HDBE 5DI8B 3QAQA 5FDWA 3ZE2B 3DPDA 2Q7YA 2XN2A 1S8DB 1EFQA 1RZ7L 4I18A 4UIMA 5K39B 1OF0A 3D3VA 1ONQB 3N40P 5PAZA 4JHAL 3QUXD 2F8IA 1RHFA 1IM9B 1WH0A 2IPUK 3MV8B 1IGJA 1JVKA 4O58L 3NCMA 5CJ5A 4R8WH 3O9WB 1VADA 4L2YA 4R7DB 1RZPA 2VAJA 1MSPA 3U2JA 1BQKA 2IVFC 3ATDA 1SHSA 2Z1PA 1K8DB 2R0KL 5D9SB 2O93L 1DBKL 4JFSA 4M8RA 4FTVA 4DN3L 1T1XA 3N0AA 4KUCF 4FN0A 1FZKA 4EZLA 4NN6C 1UWGH 5F6IB 3VFTB 3D39D 3MACH 4KKAC 4FYQA 1X7TA 2YC1A 3RQ3A 4F7MA 3RRQA 5HGHA 5D1QB 4AGQA 2GJPA 1H0DB 4HIEA 2FQGA 3T1FA 1Q0XH 4POUB 2ZYHA 2OSLB 2IJ0C 3OHXC 4JMXA 2XQBL 1YLBB 4YLBA 3AITA 1GRWA 4JJ5B 1BX2B 5L2JA 3EOBB 4IGBA 1OCWL 3BSGA 4W9HC 4HZAA 4WNQA 4M3HA 1G7QA 4OCMC 2GC7C 5EBLA 4AYFA 4GPVA 3GXIA 2XNAA 3R4DA 2EVJA 2FYYA 3OKNA 1WFMA 1KXVC 1ZE3C 5DD3L 1W6WA 1IL1B 4WW1B 1SDAB 3C6LC 3E1F1 4YSRA 2AXHA 2JKTM 4AIZA 1TZGH 1B3JA 2MH4A 4MNQA 2Y3NA 4BQ8A 4YGAB 2VAAA 4WDIB 1H5BB 2IG2L 4Q89A 4X0KA 1TJIL 4OCYL 3TH3T 4Z8FL 4HF5L 4W70A 2EC9T 3TBBA 1DQJA 1F97A 1CGXA 2ZZUT 4MXQC 5HI4D 2ODIA 2IGFL 1O9VA 4JFQB 2PMZA 3F7YA 3CNKA 3IPBA 3L1OL 3OX8B 4GP5B 3G7TA 4H8QA 4LT7A 1CICA 1XIWB 5H8DA 1T5WB 2JB6A 5I1LA 1W0YT 4CN4A 3IRPX 2F8VA 5EORH 1XF5A 3Q8EA 1JRHL 1NEPA 4G6JH 5AW5B 1CDHA 4QWWD 3IBEA 1N26A 3CUPB 2G75A 4W1TA 3F7QA 4PV8A 3KJ6L 3MUHL 5ICZB 3KPLA 1WUZA 3MLYH 3MRJA 1TTUA 4YEFA 5TQ2H 3U1PA 4Z78A 3ARGD 4PRHA 5HHQB 4QCIB 3IS0X 1HIMH 1KENL 2Z31D 3TNMA 2NY1B 1IBYA 5FYJE 1G0DA 1GY1A 3IJSB 4KUZL 4QHLA 5TD4A 1CFTB 4RZCA 4BKLA 1LL1A 3IF1A 2ZD0A 4QMEA 4WWNA 1X5FA 5ALBL 4TOYL 4YXHH 5IOPA 3TCTA 3FH7A 2BNQB 2C9AA 2OCCB 4HOMA