1OIOA

Gafd (f17c-type) fimbrial adhesin from escherichia coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMBRIAL LECTIN
publication title The Structural Basis of Receptor-Binding by Escherichia Coli Associated with Diarrhea and Septicemia
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1oioA00
1ZK5A 3FFOA 2BS71 1O9WA 2BSBA 1ZPLA 3F64A 1O9VA 3F6JA 2BS8A 1OIOA 4K0OA 1O9ZA 2BSCA
chains in the Genus database with same CATH superfamily
1QA9A 2CO4A 2VZVA 3U0PB 4EUPA 3QZOA 4JFFD 2OPCA 3OZ9L 5KYNA 4WJ5A 4ZZFA 1Z3GL 2XA3A 4E5XG 1IC0A 1WFJA 5C2UB 2VMCA 4R0LB 4X5XB 1M4KA 1OD7A 3JTTB 4WGKA 4OZIF 1FYTE 4DEPB 4ELMB 5F8QC 1CFTB 1LK2A 2YUZA 2QQKL 3NCWA 4NO0A 2XXFA 3ECWA 2OMXB 3GSRA 4U05A 1KYUA 1CXFA 3QZBA 3MN8A 5D7IF 5ID1B 4OZHA 3EZ8A 4GRWB 1M6OA 3KDPB 4Z7QE 1LO0H 1I9RH 3LH2H 5J11C 1C5BH 2LQRA 4QT5A 2DL9A 2EDFA 1HQRA 3KW8A 5IOPA 5AB1A 5EOTB 5L4FA 4RGNC 2EKSA 1P0SE 4RA0C 4RMQA 1DSFH 1M7XA 4JPIB 1CLOH 1A4JA 4PRPE 1ERNA 2B59B 3BP5A 1PDKB 4HJGB 5E08L 1ANUA 4AOFA 4H0HB 2AKRB 3KCPB 3MRIB 4GUOA 3B4NA 3E3QC 2ID5A 4MMZC 5DVKA 2OMTB 4JL1A 4G7VL 3UG3A 5D96B 3VRIA 1PS3A 1JGDB 2D7TH 3ULSB 1IAIH 3B5TA 3TH2T 4JFYA 4F1ZA 4KC3B 4I0CC 1MPAH 2BP8A 5JHDB 5J13B 3QEQB 4YSDA 3D25A 4PJEB 5LGJA 4DOHE 2H3KA 2X6VA 2O5YL 2R1WA 4FQCH 1P84J 5K9KA 2VLKA 3CFTA 2B4CH 3VVWA 2BOBA 2N0MA 1YPZA 4JO3H 2VSDA 2UX7A 2J1KA 4XMZA 3RPBA 2HTLD 4ENED 2C4XA 4ZT1A 4LKCA 3L2LA 1CE6A 4FFWC 5C3LD 4KZ0A 2GAZA 4UM9D 4A2EA 4WEEA 4OW6A 2AXWA 2A6IA 2EUXA 4PS7A 3T8XB 5I76A 4PJ5B 5EH1A 1BREA 2CHDA 4YMPA 5I6NA 4E9TA 3OKNB 4QRSB 5CBAA 5KSBF 2ITDB 4HT1H 1T6WA 1MHPH 1P9MA 2VH5L 2WO4A 4PI2A 4NIKB 4I1NB 3VRLF 3R7RA 3MLSL 3GSOB 2J71A 3MLUL 5JA8B 3NIDB 1KFAH 1NSNL 4NPYB 3VGAB 3L3IA 3I6GA 3ILQC 1BZ9A 1J8HA 5J1AA 5CD5D 2IAMA 1HOCA 2FD6L 4OI7A 1UT9A 2YK1L 4G7YL 2CKBH 1E2VA 2EZ0C 4HS8H 5CR8A 2E7DA 5AZEH 2VRKA 1CGUA 4R0LC 2HFEA 1R17A 4OJYA 5EBLB 3TJHC 2QTEA 4M9PA 2ROYA 3GXDA 4M7JL 4MCZA 4DEPC 1AQDA 5C08A 3LB6D 2MQCA 2EH8H 4PHZA 3MXWL 3RGVD 1E28B 2ZOKB 2Z91A 4NBYB 4HWBL 4UILL 5D6CB 1RUML 3ARUA 2O26U 3DX2A 4NWUH 3ZKSD 4TXVB 1MCOH 4JS7A 3EJCA 3GRGA 1R5IA 7PAZA 3IB4A 3AVEA 5C09D 4P2RE 3MAWA 4QRPA 3TZVA 3GRWA 4PR5B 3DXAB 1NAMH 3VCLA 4QHPA 2MOVA 3QNZB 3NJVA 5EFIB 3TPKA 1YNTB 4N25A 4OFKA 2VDPL 4OUOA 3VG9B 2X1OA 1L5GA 2K45A 5MHSD 3M1CA 4JG0L 7FABL 1RK1B 3SGJA 1MI5B 1HXMA 2X4TA 2DQGL 5IBLC 3BPOB 2YLKA 4GKSB 2IDCA 3GSUA 2EDMA 3IF1B 2WJ5A 4OCLC 4QTIH 3C87A 5CMAA 4J39A 3QCTL 3IJSA 5D96C 1I8KB 2P44B 5INCB 5CZVL 4MB3A 1J0ZA 2DTMH 3L1FA 3JV0A 3H42L 4GG6B 3ZDYF 4XZUB 2XTJE 4YSEA 5J13C 4FERA 3MRDA 4WO0A 4LF3B 2NYZA 1CQKA 3R8QA 3BD4A 4FZ8H 1ROWA 4KQ0A 1QFWH 1TSHA 3RWGB 2ZICA 3S34L 4EDXB 4HEPA 2CDFA 2PTUA 4I48B 5JXAH 2BZ7A 2VM9A 3TT3H 2Z3FA 3BDYH 1JV2A 3V4PL 4N2CA 5HPOA 2NX5E 3DX9A 3EH1A 4MD0B 5JHBA 4HF5H 3SD5A 2Y07H 1GHFL 3EH5B 3ELAT 4HG4K 1XGRB 3GSNB 3KPNA 3M17A 5BUGA 3HZVB 5ETUA 5GRJL 4XVSL 4NHCL 3AUWB 3K2UL 4CBZA 5CAYB 5KZCB 2GVYA 2DJMA 1CFBA 3ZYJA 3T3PF 3B2UD 3QHTC 2ZAIA 3E1F1 3SKMA 3VG0L 1UJTA 4Y5YA 4UTBA 1E7UA 5FHBH 2DM2A 2HLEB 1Q9WB 3S88H 3SJVB 4QAWA 3VGAC 2FO1A 3IFLL 5B4MD 4FYRA 4WIQA 3DIFA 5DO2D 4X9BA 3RP1A 3UZQA 2R39A 3W9EB 3ZHFA 4A6YH 4LVHB 3NJGA 4NP9A 4DO5A 4L1SA 2WNKA 4WU7A 2JCWA 2O5ZH 3BE1H 1RUKL 3DX1A 3NAAL 3O6LH 4DEUA 2EUZA 1VB9A 1I53A 4M1CC 4Z77B 4Y4FA 3WY3A 5GSRA 4F7EA 2VLRA 4PM1A 4OGYH 5D7KE 2DQCH 4HIXH 2MCAA 3OPZH 2EJ1A 3FQWA 4KITB 5ISZA 1PGRB 1YEJH 4KKBD 1BP3B 3UDWC 4OZGA 1A8ZA 1ZA3B 3S5LB 1QYGL 4R84A 4KK6D 5TE4H 4LL1A 4DCQB 1BCIA 3GFUA 3PWPD 3BZFB 1M7IA 2Z7UA 3H2QA 4FTVB 4B3VA 3LPOA 3BD5A 5K39B 1TZHB 1J0IA 3L5IA 3SDAA 5KBKA 5ICZA 2XY1A 4GRWH 5H8DA 1GTFA 4FMKA 4UQAA 4ZX4A 4L3EA 4RZCB 1F86A 2DI9A 2PXYA 5F7KC 2R23A 3S3BB 3L3DB 3G6JB 4E0RA 3Q8AA 3L9RB 3OMAB 1U42A 3DOIA 3VG9C 2AEQL 4QY8B 1UEMA 5F7HA 2AEOA 1JP5A 2BSBA 2OCJA 3VH8A 4M1DH 4TYUA 4JFOA 5B22A 1JZ6A 5LHDA 3MDJA 3OMNB 3BPOC 1K3IA 1HESA 5T1KA 4NZRL 1RPKA 4AKOA 5BPPA 4NKOB 2FWUA 5F3HB 3EYUH 3T2NH 5C0JB 1DUZA 1T0OA 3BAIA 1OP5K 3V4LA 5KW9H 5IY5B 2ZUTA 2E7HA 1JPTH 2VXTH 4H44C 4I2XE 2H3XC 3O8XB 2O61A 1EXGA 4Z9KB 5J89A 3L3JB 4NX0A 2ORBH 2ZSVA 3W5MA 2EXYD 3T3ME 5F7DB 1BVOA 2BSSA 3L6FA 4FHKA 4M62L 2W8CA 3FT1A 2BSRB 3C2AH 2C9XA 2HH0H 1A66A 3QCVL 3H9ZA 1KBVA 2L7EA 4XN2A 5JIHA 1PCXA 3V5KB 4PLNC 1YUKB 1AKJA 1KLFA 1RJLA 4KJPD 1H3PH 5GGRY 3MBXH 1SNRA 5I19L 3IBOA 1W72B 4NQXA 1KCRL 3PL6D 2FATH 4L9LB 1EAPA 4HWEH 2LU7A 1IGTA 5KBMA 1IBYA 4QHLB 3QIBB 4L23A 1T1XA 3I6LD 3AW5A 4ODUA 1KSRA 2XWRA 4ZUWA 3BPLB 3DMMC 3ASWA 2QTVA 3RUGE 4WJG3 1HHJA 1A6VL 1FIEA 1MWAL 1QSZA 4LVHC 3D06A 5L2JA 3RB5A 3RZCA 4F2MB 3BP6A 4C54A 1AGDA 1F58H 3P4OB 4YSOA 4AG4L 3EJUA 2G2RB 1JWUA 2BW5A 4NN6C 2Y3NA 3TBSA 5E70A 4KJYA 5KUKA 3QQ4A 3PWNB 2ZCKH 3RWJA 5C07E 2H6PA 5KJRH 5K33A 1TJHH 2ZJSL 4PB0L 4XOCA 1PX3A 4MQSB 4C56A 5F21B 1J5OH 1AP2B 3CK0H 1F2XK 3RWFB 3FCSB 3O4LB 2IEPA 1ZGLA 1FL6B 2ERJC 3RYMA 3O0LA 3N85H 5DDHB 5GRWA 3RU8L 4JFWA 2F9BT 2QPEB 2NNAB 4LQFH 3EKCA 2ZCHL 2VLLA 2X6BA 3FQNA 4HMEA 3SYAA 4EZLA 4QXUH 5AVXB 2ED9A 2WQ8A 4WEBH 5J4MA 5D7JA 4DF9A 3U0WL 1NC2D 2FQEA 1IX2A 4WTWA 5ACMA 1E4WH 2AJZB 1R5VB 4QF1B 1L7TH 4AC2A 3Q3GB 1P4IH 3EW3B 3F6JA 4FQLL 2YBGA 2DIJA 3X14A 2VGLM 1UXMA 2JXMA 1VJSA 4GRMB 1G5GA 2X3CA 4WWKB 2G5RA 3U6RB 2GABA 3K81A 4KAQH 4TLTA 2VKXA 1F2QA 3VXOB 4CVXA 2KPNA 2A6KA 4XPHL 1E4HA 4BUHA 4M8QA 3CH1A 4XAWH 5FOBA 1FV1B 3O8XC 2K8MA 3FH7A 1OHQA 5DJAA 2XV6B 3DDFA 2HRHA 3V0EA 2B1AL 1RHFA 4PJ8D 3QULA 1GGBH 3VJ6B 1HHHB 4W6WB 3LZLA 1AACA 4NQCA 1EZVY 4U6YA 4RA3A 4MMXB 5DD0H 5E94B 2ILLA 3L08A 4KHTL 4XC1H 5CINL 3MOQA 3AG3B 4HVBA 4N9GB 4L5FH 4OLXL 4FFVC 1LE9B 1A7NL 1Z5LA 2Q8BL 3S6CA 3S9DB 3EJJX 3CXDL 1DZBA 5IG7B 4DGVL 1ND0B 1QSED 4H40A 4ZNEE 5KG9A 4AEIL 3O3AA 4QYOA 4L8SB 3JTSA 4U1NA 1PG7L 4W9KC 4QYAA 5LB1A 4B9ZA 5JW5A 5AVTB 2R56L 3KDMA 1Y6NR 2A0LD 3QFDA 3WS3A 4XP5H 3IXTB 1T22B 3BPLC 3RVVD 1U92A 4PP2B 5GS0D 2VDOL 1LO4H 1LP9F 3DRQA 3ULAB 1JFHA 1G9HA 3DIDA 3QI9B 3RWIB 1IM9A 1KWKA 4MS8D 3H7BB 2EIMB 3EG9A 4AYID 4Z7WA 1K2DB 1M1SA 2GFBA 3EF7A 3OKKB 3MX0A 1IIIA 1J88A 3X3FH 3TVMB 2CLVB 3VD2A 1QFWM 4IEFB 5DLMH 3CZFA 1HKLH 4JY4B 4F7MA 1A7RH 1REIA 2NY4D 3IDJA 5BW7C 5E9AA 1HZHL 5HY9A 1AE6H 2ZF8A 4XTRC 4BA0A 3FUHA 5FFOA 3BRGC 1AQKL 1RZIA 1T5WA 2MTAA 1S7XB 2WLIA 2WZAA 2G5BA 2V2XB 2LABA 5FM5O 5CILH 1JFQL 1K8DA 1XF4B 4P5TA 3UTSD 2HSIA 3BGMB 5CZXC 4HUKB 4WI0A 1IGFL 2K7QA 3H6AA 4MBOA 4AQAA 4TNEA 3LKOA 3IS1X 2GEEA 4RDQF 4ZTOL 3TBYB 1VEOA 2BSTB 3RHWK 3SBWA 1EMTH 3TPUB 2OMNA 3KPLA 1QR1B 1HE7A 1BZQK 3EIFA 4RFEB 1H8LA 1TYJA 4RLDA 1HDMA 4WTQA 2AXFA 1XR9A 4PG9B 4V33A 4WWKC 3C12A 3T8VA 3C9NA 3MRJA 3CX2A 1OGAA 4Z1PA 4AYBA 5DVNA 1DQDH 2W88A 2EILB 3CFDB 5EO9A 3HTLX 2X4NA 5CLXA 3GSQA 4FQ1H 1JXDA 2PYEE 1NM9A 4KI5C 3B7SA 3PV6A 2FL5B 1XZWA 2XVGA 1NUGA 2GSIA 3FUKA 5FAAA 2NTSP 5KN5A 5AD0A 3O45B 2W65A 3T4AA 1LE5A 1FZJB 3BCFA 4MMXC 5LWYH 2CDEA 4AH2B 3DV4A 4ZMNA 2JKXA 3NIFF 2BIMA 4UIMA 1BBDL 5TTRA 3CDZA 5C3IA 2N3JA 5CJQH 4P4KD 4ZMAT 5LNDA 2R4SH 1SGKA 4GAYA 5ECGA 2APTA 3PQYE 2IPUK 5CCGE 2O6FA 2ZKHL 1UCBL 3MOBL 1M1XA 4BZ1H 2P49B 3BH9B 4U1SA 1W72H 4PV8A 1U9KA 3BUPA 4HXBL 4L8SC 3U1PA 3KYNA 4NRYA 2AZAA 3BWUF 5CD3A 4LHUB 1TJGL 3LZPA 1LK3L 4JO4L 5L4MA 4ELDA 3NYKA 4N2OA 1UUSA 4JPWH 2N0KA 3KE0A 3NJMA 4GY4A 3EJYC 5D72H 2GIMA 1YDPA 1RURH 2BVEA 1AOHA 1EFXA 3QI9C 5ANME 1Z9MA 1AJ7L 3BHBB 1TTRA 4C4BA 1GPOL 2F61A 2R2BA 5TDNA 2E27H 4PRAB 2BC4A 3EYOB 3MROB 4JMNA 4LARH 5B7FA 3WJMB 1QQDA 2OULB 2JJTC 2ZPKL 1INEL 3TVMC 1NAMA 1HXYA 3LCYA 2WQXA 3ISRA 5JXED 2YSSB 3FH5A 5CP3A 3CUPB 2R27A 3D4ZA 3F85A 2YD4A 5FV1L 1CFMA 3IDNB 2R69A 3D6GA 1DBBL 4PREA 1U93B 3RLSA 1D3CA 4M9OA 4X6DA 4D9RE 3OKYA 5BUPA 1CDJA 1OLZA 1MRCH 2AV1B 5DWUH 2YEZB 1CD1A 2V8LA 5L2KB 5GZOC 2A38A 1JZDC 3H9HA 4GQQA 3S8FB 1HK6A 4W9HC 3WHE1 1RZJH 1KPRA 3ISWA 1GAFH 1TZ8A 2EEFA 1A3RH 3BPCB 1WBYA 2G4GA 4FABH 2V9RA 3QXWA 2AJSL 3JYCA 3V52L 4PPTA 3RVXC 3O41A 3QEUB 1GYAA 4LBEB 3ML8A 5CU9A 1DLFL 4XE5B 5SWSB 3U6XA 3UABA 3OWRA 4N4YB 5FIEA 4C8XA 4M3HA 4NQQA 2WM0A 2IH3A 1IAOB 2JCCB 2FB4L 4JZNA 4K8RD 5F7NC 2X3BA 3EBGA 5CGBA 5AAWA 2GI7A 1EIBA 1MCHA 4G70B 3VB9A 2DN7A 1QLRB 2FX9H 2HVKB 2BO0A 1J1OH 1JNLL 4XPGH 1AR1D 3JWNG 4M1GL 5IBTL 4CN6A 5DC4B 2VAJA 4Y2DD 4R8WH 5C0BA 2P8LB 4IHOB 1J86A 3H56A 4PJBF 2QPDB 1P2CA 1G1OA 5I75B 4AGLA 1A7OH 2R69L 5L8JB 1MCCA 4XNBA 4OCSL 2NXZB 4A6YA 4RRPM 4P2QB 4WHYG 3MLPA 4JCLA 1MFBH 4K2UH 1T0MA 5B3JE 5I1GH 4GKNB 1DVYA 5FYLE 4R0LA 2PP7A 1BXAA 2EVGA 1D9KD 2HVJB 3PV7A 3JTTA 1L4IA 2WXIA 1NCOA 4MNGB 3U1SL 4IBLT 4XH2B 1CFTA 3WEAA 1XBRA 1KTCA 4Y19B 3RWCB 3GXIA 2V17H 4URTB 4FXLA 2K8QA 4JPKH 4XXDB 2AQQA 1WISA 2OMXA 1H6FA 1RU9H 1IEAA 5ID1A 5IMOB 3I84A 1NOLA 3ZDWA 1B4JH 1ET8A 2VL5B 3RTQD 1VGEL 2UWEE 4M6NH 4B9GA 4U2YA 5EOTA 5D7EA 2J25A 2Z64C 3W57A 1NPJA 5CKGA 3MRCB 5CP7A 1GH7A 5K1NA 5MENE 4HJGA 2P5EE 4JY5L 2DQTH 4IGBB 4X7SL 4A7GA 5B39B 2J5LB 2AKRA 3KCPA 3MRIA 2NY6D 3WJLC 4ZQTA 1S6NA 1GZHC 1NBQA 3IETB 2P52A 1NINA 4DKEL 2KDGA 3VD3A 3INOA 4OGZA 1JGDA 3H7LA 1OO2A 5HYSB 1PTZA 2WQRA 1EX0A 2J12B 3GHEH 3IMTA 3KAAA 5GGSY 3K72B 4Y4HB 1OWWA 2BIPA 3OAWA 4Z23A 5JHDA 3DRTB 3QEQA 1M05A 4PJEA 5CU5A 1K8IB 1DDHB 4HV8B 1VZGA 1AXTH 4KZDH 2O6DA 4FQPA 2JSFA 2FIKB 3B7UX 3MLZH 5FO8B 3EYVB 5EU4B 5CEYA 4JFDD 1I7RB 2IBZY 1OTSD 4YLCA 3M1BA 3BESR 1OVZA 4MNQB 2AJUL 1UWFA 2A6DB 3CFKB 4H8QA 1U0QA 2APSA 2NQ3A 1FIGH 1TETH 1HS6A 3S4SB 4ZUVB 3D2UA 1IBGL 2XZCL 3HC4L 2JKRM 2XBTA 3GMQB 2DJUA 3OKNA 4JFSA 4QRSA 2OMVA 4Z7UB 4AV5A 1N6UA 3I9GL 1T2JA 2HWZL 2ITDA 4FLRA 1CVRA 2H1PL 4L1BA 4HUVB 1G6RL 1MAML 2WKOA 4ZPVB 3RY5A 3IMSA 1WIOA 5EZIH 3EXJA 4XOAA 2IADA 1YEFL 1F1GA 4NPYA 2NXZC 2FE0A 3HMXA 1FNFA 5EBMB 4OIIL 5EIIB 3HG1E 3UO1H 3S35L 3SD2A 5IHZB 3FFOA 3KHQA 5D1ZC 1AH1A 5DK3A 1FPTL 3LX9A 4I9XA 4Y2NA 3BVUA 4OLEA 1OP5H 5EBLA 4MSWA 1K4DB 4Q0XH 1U3JA 4G1MB 3RDTD 3UDWA 1NFDE 2XNAB 1E28A 2ZOKA 1IU1A 1WICA 4LGRB 2HFGL 3RURA 4AYEC 5D6CA 3REWB 2OR7A 2ZE0A 3H0TA 4J3BA 1MJJA 2VUYA 4PJDB 4JKPL 3VM7A 2YIHA 5FYLL 3ZX1A 4PR5A 3O0RH 2GTQA 2HX7A 4WNJA 5SWZD 3D18B 2A83A 3LY6A 5D8JL 3MYJB 5EFIA 1YNTA 3PHAA 3M46A 3QJFB 1DJSA 1UFGA 4UDTB 1TFHA 1CG9A 4IJTA 4NENB 1HZLA 1CI3M 5BZZA 3LKNB 3F2LA 3T77B 3V8CA 3CFBB 1RK1A 1MI5A 3SPCA 4UNVA 5JW4N 4IGBC 1RZ8A 1CLCA 3PFQA 3L1OH 1MLCB 2J5LC 2HXAA 2OL3B 4GKSA 2AK4B 4PJAE 4HU8A 4IMKC 2FNBA 4G11A 4ZS7H 5AW6B 3T3MF 4YSRA 4HA1A 5F93C 4ZUUB 5INCA 1UQSB 5EUOE 2VLMD 3UO8B 4N2LA 4X8GA 2JIXB 1EGJL 4YHZL 3MRLB 3ZMEA 1II4E 3ZO0A 1SYSB 4WI5A 3C5SB 3CU7A 4Y4HC 4F20A 4GG6A 4J7RA 4XZUA 5FYKH 4HPOH 4PGBB 4F2EA 3V6OC 3Q0HA 1UT1A 3EHBB 4WZ9A 1TKWB 3X11B 4Q9QL 4GBXD 3QG7H 4EDXA 4GIOA 4TULL 3TXAA 4LVOB 4ATWA 1KXVC 3H9SD 3KHOA 5CJ5A 2Y7SA 4PJXE 3EJPA 5HDLA 2BERA 1C12A 1IC7L 1UC6A 1KIUB 4HFUH 2QV4A 5IWLC 2DLEA 3B9DA 4JZOB 3NSDA 3LKRB 2XETA 3FZUC 1XGRA 3GSNA 5I71B 5FUOH 1HYSD 2Q7NA 4JQXC 3OAZH 3QJRB 2CHWA 4YO0B 3RUGF 3LRMA 5I2IA 5F7EH 2EYRB 4QPEA 2IOIA 4DH2A 2K9FB 4K7PY 5D5MF 4JPVL 5DS8B 1BBJB 2KYIA 4LDEB 3DMMA 4LVEA 4PJ9D 4TN9A 4ZFZA 1Q9WA 5JHLA 3SJVA 5I1HL 2HLAA 3W9EA 3SPHA 1PG7W 2PCXA 4PGEB 3L4XA 3K5SA 3BEVB 1ETZB 3D2TA 5LAXB 2TSBA 4M5ZL 3ABZA 5IROC 4ZPTB 4FNRA 4Z77A 5EU5B 4PRHE 1J9CT 3FSZA 1LEKB 4HH9B 4PCYA 1R3KB 3GF8A 5AVUB 4NQDA 3FTSA 4R90H 3QEGL 1ZA3A 3G04B 4H5SB 4PRIE 3S5LA 4CNIB 5C0FB 3PABB 4DUWA 3BGFB 3BZFA 2ZKMX 4GFTB 3VWJB 3M8OL 2CMRH 1BHGA 1JOIA 3GMOB 1TZHA 3ZZQA 3CVDA 3UAFA 3VD4A 4ZFGH 4V1DD 5B3SB 3QWOB 2YRBA 4YHNB 1WYJA 4PV1C 1MY7A 4K7PL 4RZCA 4YE4L 3GNML 4NM4H 2OZNA 3DOHA 2EACA 2Q9OA 1AYOA 5E6IB 1ICTA 4QY8A 4GSRA 1U3NA 4NNYB 2IXQB 5DUMH 4MQ7A 3OKEA 1BZDA 3BSZA 4HSQA 1JDCA 3GI9H 4LSUH 1CI5A 1D5BB 4QRQA 1EERB 2Z34A 1JZFA 3DJTA 4HP5A 2P24A 3ZZ1A 1EXUA 4NKOA 5F3HA 2NW3A 1DANU 5F1NB 1U58B 5AKRA 5C0JA 2WW8A 1MG3C 1TR7A 2B1OA 2CALA 3N2JA 4GP8B 4HJSA 2BVQB 3F58H 2IOMA 1JCKA 4HQQH 1H8SA 3O8XA 1AFVL 3P0GB 4NKDB 4TVUA 2A9DA 1S5IH 4DESA 4BM7A 2H8PA 2RMNA 5BXFB 4POZC 5ADOL 3EHBC 4FQHA 5MEQA 3CTTA 2Y5TB 4PJGA 4WQOA 2BSRA 3GMLB 4Y9CA 1O5DT 3LN9A 4Q74A 2MHAB 4PU2A 5EDXA 4XP4L 4LVOC 4L18A 1HH9B 3W2DL 4Z95H 3V5KA 4DW2L 1M3JA 3HJ0A 1P1ZA 1IRAY 1FNGB 5HYFA 3HFML 3ARBD 4G8IA 1ZSHA 3RGHA 3W0WE 2TAAA 3ARVA 5I71C 2PCFB 2PO6C 2MQGA 4KJQC 4QRRE 2D03H 4QHLA 1E9PB 2HX9A 1IIKA 1ZTXE 1SDAB 4LT7A 4ODTL 3MRHB 4AQ1C 2FZ3B 4ZO8A 1LTXA 5AEAA 1X5XA 2XTLA 2EAEA 4NZUL 3QQXA 1QG3A 1MJ8L 3DO7B 4DVBB 2A2QT 1IQWH 2VABB 1XWVA 4YN3A 1DQTA 4X7TB 4F2MA 4XMLL 1R34A 1KOAA 1NBYB 4ODWB 4R5XA 3D39B 4YFEA 2G2RA 3Q43A 5GGQH 1EUUA 1G7HA 1MFNA 3PWNA 2H2PD 5JZ7D 5IEHB 3VVVA 4M6ML 1IEBB 5BZXA 2AV7B 1AP2A 4LPXA 4Z76A 3RWFA 5BW7A 3FCSA 3P3UA 2X3AA 3O4LA 4CSTA 3UTTB 4R2GD 4P46D 3BGFC 4JKLA 3WLWD 1VEPA 4EBQH 2HLFD 3G5YA 1KBPA 1QFUH 3GLDA 1HNGA 2I60H 3MTXA 3O2DA 4WFHD 5DDHA 4ZJ9A 3VWJC 4N3TA 1CZ8L 3U46B 1KJMA 4UT6L 1MJUL 4PGCB 3MXVL 5HHXH 1H3WM 2DIAA 2NNAA 3RVWC 1JL8A 5IW6B 3II2A 1FNHA 3JWDL 1E27B 4NP4L 4FI6A 5E6IC 1F6LL 1WCBB 3CMOH 3UJIL 1OAZH 4C4UA 2AJZA 3VB8A 3IGKA 1GS6X 1KC5H 1Y18B 4X8JB 4QF1A 5AKSA 5JQIB 4MD5B 3Q3GA 1I31A 4OLZL 1VESA 4HOZA 2BXYA 3CHXA 3V0JA 1VIWA 1OE1A 3DDGA 3VFVB 1DUYB 4GRMA 4J3OF 4WWKA 4G8GD 1R3LA 4QEGA 1BVZA 5EWIL 3U6RA 4JO5A 4PWEA 1CXLA 3RGVB 4MS6A 3BVNA 2I25N 1PZ3A 5I17B 5A2IH 1EFQA 3ML9A 1FV1A 3WY1A 2VZOA 5I6KA 1PNDA 1MRFH 3KD4A 2VZ3A 2P5ED 2NZ9D 3GI8L 5IQ7L 4LOUD 1N6QH 3AROA 1NEZB 3MJ9H 4KK9D 1HHHA 4UTAH 3QRBA 3O6FB 4MMXA 5E94A 2VDQL 4LCWD 1IC4H 2YMXL 1P4LB 4N9GA 4HEPG 3ULVD 1R4XA 1I8UA 1JG9A 1XCXA 1LE9A 5BVJB 4TVPE 2AQRA 4G3YH 3LZRA 4S1QH 4JN1L 4LE8A 2ITCB 2C7UB 5FYJE 5DF0A 3UMNA 4YOKA 3O2DL 4UQEA 4Y5XB 2C3HA 3BWAB 3KPSD 3ILEA 5B38B 4L8SA 1KCWA 1F4XL 5JW3H 2RH0A 4BHUA 3LMJL 1FAIL 4K94C 4BUGA 4J2XA 3LQAC 2DQJH 1DFBH 3IXTA 5EORH 3DWTA 4YXLH 1WBXB 5KVDL 1SXCA 4K7FB 4QWWD 1B2WL 1FNSH 1NCWH 3RWIA 4APQA 1GMIA 3I9AA 2DKUA 2NR6C 4JFEE 4Z0BL 2X10A 5EU7E 5JTWA 3OV6A 2WWKO 1RUAH 4JHWH 3I6SA 1ZTXL 3TVMA 3D07A 2JJTA 2DWXA 2CBQA 3EXLA 1C9SA 3IJ8A 4CU8A 1SM3H 2C9UA 4HIEB 3SPGA 3WIAA 5I1DB 1YMMA 3ES6B 5LXGH 4G5ZH 1S7XA 3DVIA 2VXSL 2W07B 1BOYA 2C8NA 2JK5B 2XUWA 3LEVH 1UFUA 2V2XA 4XCCH 4JG1L 4WNSA 3WKYA 5JORA 4FI7A 1UADC 4XNDA 1MHCB 1XF4A 5CGYD 4TUJB 1Z6JT 2XPYA 2Z93A 3FQUA 5E1AB 4EVNB 2UVEA 2ZXQA 1MNUL 3HLAB 4KXZH 3LQZB 3VO0A 2ZONA 3RPIB 1ML0A 3O11B 3KLKA 3ARFD 3TBYA 5GZOA 1J8KA 2X88A 3UOAB 4I5BB 4H8VA 3TPUA 1ORSB 1SDYA 1MEXL 4K3DH 5EV7A 3AAZB 4H20H 3VH8G 4RFEA 3RNKB 2ARWA 3PGDA 1TJMA 4PG9A 4BFIB 3GXMA 3UTZB 3GB7A 2AERT 3LB6C 5BS0D 1A3QA 4IRJD 3TWCL 4OFQA 1KXTB 1N4XH 3SE9H 2DBLL 3PWPB 5JOFB 3CFDA 2C26A 3OGCB 2RGSA 1J8SA 1IBZA 1N12A 4LRNL 4C4KO 2BY3A 1BG9A 3OHXB 1H3TA 3UJTL 3LEYH 1ZVSA 4OZHE 3ZTNL 5KS9B 1OF0A 1RJYB 1KYOJ 3O45A 4QRBA 1E2WA 1KEGL 3O6FC 5DMYA 2V9UA 4AH2A 4RMVA 1WHOA 3CFNA 3SBRA 4DKFL 1RXLA 2MKWA 3JWOL 1QFWI 5F9JA 2ZYIA 3BKJL 1GA2A 1JDDA 1NEUA 5D7HA 1O5PA 2VDRL 1S9WB 1INDH 4QRAA 3DLQR 1A7PH 5FLVA 3BH9A 4Y5XC 2FQFA 2W9EH 4BELD 2QSQA 3TV3L 2NZIA 3KYKL 4XNYH 3B37A 4P9HL 2KZBA 3FXIC 4UUJA 1RKRA 1E6JL 4WUUD 5FA3A 3LQAH 5IMMB 5GRVK 1Z9SA 1CLVA 3PJSB 3WEMA 4MAYD 1TQSA 4G43B 1XX9C 3GK8L 1FSKB 5FYJL 2AQ1A 3NCEB 1HZKA 1XCWA 1LO2L 1T7ZA 4V11A 1KB3A 4ZRGA 3BHBA 3GSVB 3PWUB 3K0WA 3VXUE 4PRAA 2VLKE 5ICUA 3EYOA 3MROA 1U95B 1J05A 1AKPA 2RHEA 2UWEF 3WJMA 2WXRA 4M56A 1XGYL 1E67A 2YUXA 3MJ8B 5CJOL 2FGWL 2JKWA 3MLVL 2M8XA 5E8NB 4O2CA 2YSSA 3PGFH 4XCYA 3PL6B 3CUPA 3LRLA 2E7BA 2YGVA 4LCYB 3P4NB 2WLYA 4MLIA 2XPGB 3IDNA 3S0PA 1ORQB 3ARRA 4PY8I 5DHXB 4HD9A 4PBXA 1TCMA 3B2UC 3FAXA 3FU6A 5IUSA 1U93A 5D7LA 5GS3A 5HXMA 1N5YL 1PZDA 5E0QA 3LSOA 1XIWB 1M7DB 2B5IB 3VYNA 5J9PB 3QAZB 1IAKB 2NRDA 3NA9H 3GS4A 2PR4L 2XV3A 4B9JA 5GGTA 1T5XB 2WQAA 3L9BA 5DO2C 1ZT4B 4ZS6D 1GZHA 2AV1A 3WJLA 1Q38A 4PRID 5IJVB 1NLBH 5GHWL 1A4KB 3BRDA 3MOAL 3L45A 4M02A 4P06A 4GLRH 5B7MA 4BZ2L 4URKA 3IGFA 3PPEA 4FG6D 2BVPB 2WZPA 5JQ6L 5L6YL 1BYNA 3BPCA 3NVQA 2Q6WB 2EIDA 2X53A 3WKML 1P7KB 4RGOL 2ZWKA 1MAKA 4KKCD 3QJTB 3RWHB 4KKBC 3Q5TA 3QHZH 5JR1L 3QEUA 2CWRA 4XHQA 4KK6C 4LBEA 2LE9A 1D7CA 3MCKB 5SWSA 1UD4A 4M7ZB 4X99B 4YH6A 2VDKL 3CLFH 5IW3A 2X42A 4NZTL 2E5EA 3OHXC 3IDIB 2JCCA 3TBVA 4QGYA 4QRPE 3NFPB 3QXDB 1WUZA 4CJ1A 4OFYD 4JDTL 4G6JL 1GOGA 1NC2B 5F7WC 1AMXA 3FFDA 2W9LA 5FB8B 1QFHA 1M71B 3CV5A 1RZKH 1NCTA 2H0JA 5DRNB 1UYWH 1WG3A 3FU5A 4BH7B 5DD5H 4YDNA 3K6SB 2DJSA 2EICA 3BZEB 4P2QA 3BUDA 5D1ZA 1FL5B 3SE4C 5BQ7B 1NFDF 3EBIA 1S9VB 4GKNA 2ZUYA 4OBSA 4AUYA 4KK8C 2FUTA 4GPVA 2EXYC 2HVJA 2A9NH 4PJ8B 4MVBC 2JI1A 5CEZD 4MNGA 4U6VH 1FSKC 1J1PL 4XH2A 1AMYA 3HI5L 2LW3A 3KVPA 4G7RB 4W4OC 3LZQA 4A39A 1MIEL 3P2DA 3L7FB 4I8DA 4Y19A 5IFAL 5LDUA 1ZWIA 4YEFA 4XXDA 2DLFH 4HKJB 1VA9A 4AWJC 1JHTB 1G0YR 1OZTG 1X5JA 2OR9L 2VL5A 1QSEB 2X9ZA 3BAEH 3P9LB 2C1PB 5I1LA 1HHKB 3PL6C 1W8EA 3TC9A 3II3A 1G7IA 1WJ3A 3QUZD 3BISA 4AL8C 4Z3IA 1PMYA 1TQWA 3F7LA 4PJAF 2A9MH 1UENA 4IRSD 1MSPA 4XB8A 3MRCA 3GTNA 4M43H 4ODXB 4FP8H 2V2WB 4M6OH 4NQED 1XIWC 2B5IC 1CDBA 2AANA 3AMKA 3GEWB 3QAZC 4AK2A 2QDVA 4IGBA 5KVGH 5B39A 1PX8A 1AS7A 4P2OD 5LBGA 4IMKA 1UOVA 4LP8A 1SQ2N 2H0FA 3BVWA 1GC1L 4XODA 3VFSB 3IETA 3L5XH 2LU5A 2WP3O 5AG9A 3RTLA 1CFVL 3BVDB 4IW4C 1JSYA 4HHWA 4LPCA 5HYSA 3MV7D 2APWA 1BF8A 4KH2A 3AZUA 5E6SB 1BW8A 1E5AA 4RWHA 3B7TA 2Q5BA 2VSKB 3HMWL 4OJFL 2C34A 1MCNA 3DRTA 4F3FB 1CLZL 1K8IA 4XBPB 1DDHA 2NY4B 4PJXF 4AKQA 1KN4H 3F05A 3EJSA 2C9VA 3FOLB 3GBDA 4KKQA 1R3IL 2FIKA 4LSDA 3WN6A 5EU4A 1WPCA 4M7ZC 2VW7A 5HPMB 3CHQA 3VXPB 2YA0A 1KXVA 4MNQA 3T65A 4N2NA 5T5NF 2A6DA 1WA0X 3CFKA 5IMLA 5IWLA 3UTSB 4L3EE 4OD2B 3IRPX 4ZUVA 3S4SA 4JQXA 2A4ZA 1PJ9A 3GMQA 5M7QA 3HHSB 1QSFB 2V6HA 4KXAA 1BZ7A 2CCLA 1MHEA 4HUVA 1NFIA 3N55A 4PUBL 2WXQA 3QJSB 5EIIA 5FWRA 4YDKH 3OB0H 4UMGA 5D71L 2W5PA 4ZTPH 3PY9A 1KN2L 5IESH 3ABLB 1VSCA 4NUJB 5IB3B 1FGVH 1B2YA 3BUQA 2R8SL 1KJ3L 1A9EB 4LU5H 1A6AB 2XKNA 4XMXA 3CVIH 1K4DA 4W9CC 1NIDA 3GJEA 2F53D 1PZCA 4G1MA 1UACH 2XN0A 2XNAA 5GPRA 1G7QB 5GS1B 4LQ1A 4FQ2L 1RZQA 4K5LA 5E6ZA 4BFJA 3REWA 4P4KB 2XPZA 2NTFB 4NC0B 1CIUA 3B1TA 4W70A 1TLMA 1Z66A 1AZVA 2A7BA 1S3KH 3VXQB 4U0RB 3VNYA 1BMZA 3MYJA 2QLVB 1HH6A 3QJFA 4M7LT 1ZLSH 4KBPA 4AL8H 4ALAC 2X2HA 2FJGB 2A0LC 5A7BA 3P0VL 3LKNA 3A21A 3QNXA 2XFXB 2BSDA 3P30H 1D5MB 3Q2CA 3PREA 3OKDB 4G6KL 3CFBA 3QWRD 1E4XH 3RVVC 1YN7B 3F64A 2NY2B 4D9LH 5ADPH 5HP5A 2BNRD 2OL3A 1F4HA 2EDYA 2XJKA 4JUTA 2AK4A 5IT2H 1RZ7H 4XWGH 5BCAA 4FHJA 2CO1A 1N0XL 4MS8C 5HJ3A 1MVUB 1K6QH 2C5DC 4ZUUA 1UQSA 2RJMA 2JIXA 1LMIA 2DS4A 3MRLA 1ETJA 1SYSA 4TF4A 1XGTB 32C2A 4YLBA 3C5SA 3UTQA 4GMSL 4HCRA 1R3JA 2NY4C 4ZOCA 4P2YA 5IK3B 1TKWA 3FTUA 3F5WB 3RKPA 3X11A 1ADQL 4LXFA 3GSXB 4U33A 2Z0UA 5C0ND 4R7NB 5HGBA 1F13A 1XF5B 4P3DB 1UD8A 5LN4A 2FSEB 2XIBA 3ATAA 2ODIA 1YN6B 1CT8B 4EI6B 4KZEH 1KIUA 4N28A 1F0LA 4NYLB 4S1DD 3LKRA 5E8DH 1IJ9A 2L0DA 1OARH 5IMKA 4UB0H 2PO6A 3TT1H 3HNSL 3TCXA 3DTXA 3BD3A 4DWHA 1T7XA 2G60L 2WTRB 1M42A 3MRQB 4NO0D 1NCHA 4XXCC 4ZW3A 4I89A 4AQ1A 5DS8A 1BBJA 1IBBA 1L9OA 4GP4B 2XQYA 4HYTB 1EA9C 2GK0B 4KKNA 3OXSB 1TG8A 2EH7L 1GZPA 4UV7H 4FX5A 3MV8D 2DEXX 4PGEA 4HBCL 3BEVA 4KX8A 1ETZA 5LAXA 1ZVYA 1ZXKA 3ROLB 2HCZX 4X2UA 4ZPTA 5EU5A 4WCYH 1LEKA 4KUCF 4HH9A 4Y89A 2R2HB 3HEIB 1R3KA 4E5XB 1FC2D 2E56A 4AYGA 5ERWB 2A9AA 4MKTA 4P2AA 2IAND 1T04B 1NZRA 3G04A 4H5SA 5A6LA 3C6EA 4NQCE 5GS1C 4CNIA 5C0FA 1KEML 1TVDA 1OE3A 3PABA 1G7MA 5TGBB 3QYMA 2GHWB 4Q9RL 2YJQA 1JE6A 2EO9A 2ZG1A 4P4KC 4JLRB 3GMOA 1QI4A 3WTYA 4Y2DB 2HB0A 3P2BA 2HRPH 4KQ3L 1MCFA 3BAWA 2FEDD 4U0RC 4UIKH 4YHNA 4YIQB 5F6IB 4UF7C 1SF5A 3QWNA 4WTXA 3MV11 3Q5YA 5TF1L 1U91B 5E6IA 3UZEC 2G75B 4C59B 4ALAH 2YKKA 4NNYA 4I87A 2IXQA 2VLKD 3NQKA 2F7PA 5FW6A 3RI5K 2DIBA 4WI7A 1BF5A 2BNQB 1XCTB 4RBPK 4UT7H 1AZRA 1PCSA 2NY2C 2YOAA 2X09A 4Y1TA 1TVBB 4FQIL 4ZYKB 1P6AB 5FECB 5F1NA 4Z7VA 1GS8A 2PW1A 4N2AA 5CFAA 1OAXH 5KOVC 4XP9L 3GHPA 4I0PD 1ZLEA 2FEEI 3DURB 3AGWA 3CLEL 3O6KL 3DGCR 5EZPA 1HCFX 1RLWA 4Z7WE 3IN0A 5I6LA 1IKOP 3EFOA 2J1XA 4K3EH 1JGLL 5BXFA 5FHAL 3NCXA 1OE2A 4XCNB 5E8PA 3RTQB 3ENEA 5JXEC 3WIIL 5CM1A 1RLBA 1AYRA 2R2EB 4YC2B 5D1XE 2Y5TA 1B9ZA 3ZHDA 3KGSA 3V4VA 3S36X 2QSTA 2A1WH 4P49A 1LEGA 2IIJA 2MHAA 5I18H 1J8HD 1J9SA 2IAMD 3UBXI 15C8L 1HH9A 4XN4A 1G4RA 1CBVL 3DHMA 3K2MC 2QSCL 3WGUB 1FNGA 1MCBA 3C60D 2R7EB 3E80A 1S7QB 1MCSA 2NY6B 4MAUH 1HEHC 2GT9B 5DHVB 1SVBA 3LNHA 4MJIE 4BFFA 3OZLA 4AEHH 1JF1B 2EXSA 2PCFA 4PJCB 5C08D 3D12B 3FSVA 2DWDB 1E9PA 3NJXA 1RULH 2LOEA 4QHMB 3MRHA 2FZ3A 1Z9NA 3BC9A 2VAAB 2B1HL 3Q2LA 1TYRA 1YEHH 5E5RB 1G7PA 3VMNA 4E9LA 3W9DA 4PLOB 1EHLL 2R0KH 3TZVD 3BAJA 6TAAA 1AQHA 4DVBA 4YPJA 2J20A 3HZMA 3POCA 2VABA 1WC7B 1EZUA 3AG1B 3NUKA 2NR6A 2YKLL 3V0VB 1OGAE 2Z1PA 2ICWI 3I9PA 4F9PC 1NBYA 4ODWA 4FL4B 3D39A 2B7DT 4JFDB 2RTTA 4K9EC 4PJHE 2OSYA 4Q9BA 2BNUB 1X6LA 3JVFC 1MCRA 1WITA 4NCDA 5IEHA 3EOAB 3HB3B 4K8RC 3N9GL 1H15A 1T7WA 4NGHL 1IEBA 2AV7A 2XJLA 3UTTA 1U8NB 1CD8A 5L7XH 1MCWM 3BUIA 1CGWA 3ETTA 3D7PA 3TTSA 1UA6H 4OLUH 3B2VH 4Y2DC 3U46A 3GKWH 4PSRA 3EDFA 4PGCA 2MOGA 2HT2D 3UTPE 4G9FA 2R15A 3TF4A 3V4VL 3Q9QA 5F6IC 3SPJA 3ZQ9A 1TT6A 5IW6A 1JZJA 5IV2A 3EDKA 2ZXAA 5E4OA 4AQOA 1MFDH 2QVKA 3SDXB 4NN7B 5HHVH 4HZLB 2BY1A 1WCBA 1KCBA 4NBXB 5AKTA 2V5RA 4ZMLA 3NJNA 4Y0GA 2QFPA 3S3PA 4JHBA 5LKNA 1Y18A 2GTZA 1ZIBA 4MD5A 5LBVA 5IQ9A 4MYWB 4X50A 1UA3A 5EOCL 5GGUB 1N5AB 1S78C 3QRGL 1DUYA 2WBWB 1DE4B 3K2IA 3QUKB 1XB3A 3SDDD 3C75A 3NZ8B 4XN8A 1BA9A 1EBAA 5I17A 4UZSA 1OCOB 1FZKA 3ROOA 3VQLA 5EU6B 2BLFA 4NFCA 3H8NA 2WIMA 1NEZA 2AEPH 3D3VE 4XC3L 3RTQC 3D5OF 3CZLA 3O6FA 3BLKA 4YC2C 5SWZB 2FX7H 2XX1A 5HYQB 1OAKH 3OLGA 4KRNA 3Q8CA 2EO7A 3U9UB 3N5AA 5F1SA 5DJXB 4WW2B 1P4LA 3MPCA 4FXKA 4WO4B 1WBZB 2RFXA 5KJ4A 4E9VA 1WZLA 4M5SA 3D0LB 4Y4FD 5BVJA 4XCFL 2VLRD 5E2UL 5AL0A 4W9EC 2ITCA 2C7UA 5DJ8B 3QFJB 5ESAB 4Y5XA 2DI7A 3BWAA 5ISZD 4EEEA 2NY1C 1I9RL 3E3QE 5B38A 1C5BL 25C8H 4F57H 1P84K 4LKXA 2Y5QA 4HXAL 2ITEA 3RJDA 5IOKA 4DN4H 1NGPH 2VN7A 2WVTA 2EEDA 2WOYA 2WXMA 3D0VA 1HNFA 2Q20A 1OPOA 4K7FA 3RX5A 1PD1A 3DBXA 3SDAD 2JB6B 4UCFA 2ZCLL 2ENPA 1EDYA 5L9DH 1EZSA 3EO9H 2EDJA 1XD0A 2PXYD 4C83B 2MFNA 1OTUD 1YYCA 3GZQA 5JHMA 2OV0A 3FULA 1C7TA 3H9SB 4I85A 4K9EH 3WIHH 2D7TL 3K6NA 4LGSB 3UAJD 4B3EA 2FTAA 3F8UB 4PJIE 4J3SA 3HB3C 1DCLA 5EEYA 5L0QB 4K8RH 2N7BA 2WYTA 4AKPA 1MPAL 5T1KD 4HIEA 4PFEA 4YDIL 5I1DA 1Y0LB 3D34A 1QD0A 3ES6A 1VDGA 3WXVL 5L8KB 5A2CA 2Q7YA 3ASOB 3GS0A 1BLIA 2W07A 2B4CL 2EP6A 2ZX6A 1PFOA 2JK5A 4ODBD 2YLHA 1C5CL 2MCPL 3N50A 5C0BE 2CBTA 4PJ9B 3C8HA 1MHCA 4MZIA 5C0RH 1M6UA 3DVNB 5DYOA 1SOSA 1GKOA 2VJXA 4OSUL 5AW4B 2BOLA 4MX7B 4NN7C 2NQDA 4KH9A 4RISL 5E1AA 4EVNA 3HLAA 3O2VH 1A64A 1FH5H 3O11A 3MRPB 4KROD 4MASA 1UM4H 2UX6A 4UI2A 1FO0L 3J27A 2YS4A 1OSPH 4I5BA 4NKMA 1ORSA 5C0AA 1I1AD 3AAZA 1BZOA 4HT1L 4PVMA 5FM5M 3RNKA 5DT1H 1FFRA 4PMFA 5T5NG 1AKJD 1E7VA 1SHSA 4OM0H 3UTZA 2X38A 2ISDA 2KZKA 1T66D 5KVFL 4ELME 4BQ9A 3Q1SL 1KXTA 1H3VA 4UNIA 3PWPA 5JOFA 2QQLH 1JPST 1VFUA 3OGCA 1UZ6E 5FGBC 3BAYA 2CKBL 4MZ2A 3OHXA 1Z0MA 4HS8L 1MW3A 4GRWE 1RP9A 4V1DB 3FQ4A 5KS9A 1RJYA 2YAEA 1P5UB 2JJUA 1YQVH 1U6AL 4C57C 5I30H 2H5UA 1YZZA 2Y4SA 4GP5B 1OSZB 2E9WA 2F19H 1RIUH 4HJJH 4WW2C 3ULUL 4WO4C 4J1UB 1NGYB 3Q01A 1CU4L 4HK3J 2IVFC 4QCIA 4P05A 5EUKB 3KGUA 5KSUB 5KAQG 4X6CF 1S9WA 4PYHA 3WE6B 1MCOL 2VIRB 1BDYA 1HSBB 2AJVL 1PZ2A 4HMDA 4Y1AB 5DHVH 4YNYB 4C56D 4WDIB 4OLVL 4R83A 2YFOA 2NDFA 5DYFA 3FMGL 4LSVH 1HL4A 3HR5B 2ARJB 4XO4A 12E8H 3FRUB 3SE4A 4GQ9L 1PLAA 3FFCD 3AY4C 3ESMA 5F88B 5T8IA 1OOWA 3MGOB 5TH2A 1WT5C 3PJSA 2ATPA 2QHRH 4AIOA 4Z8FH 4G43A 3B9VA 1NA8A 3QW9A 3FU7B 5JHDE 3QEQE 4Q4IA 1F3JA 4U2ZA 4W4OA 3WFDH 3GSVA 3PWUA 4QHNB 1CD0A 5D7JD 3A6CH 1U95A 1CXKA 3QUMA 5AW1B 2ICES 1USQA 3MLRL 5B21A 1FFNB 4JQIA 4LOFA 4JM2F 3MJ8A 2OA9A 4MJ5B 2NY0D 1JVOA 3HG2A 4DGIH 5E8NA 5L0QC 3TEWA 3ARBB 2P9RA 2Y36L 1VACB 1OQXA 1ZHLB 1K3ZA 2OYMA 4AM0B 1T20B 3P4NA 1YJDC 2XPGA 4DO6A 4EXPX 1ORQA 3VD1A 3TYGL 1THAA 4PJ5E 2OMWB 1U8MB 2E6JA 3KR3H 1QFWL 3PNRB 1QUNB 4O2FA 1WGOA 3CQFA 2CAKA 5JXAL 2VTFA 4UOW0 1XIWA 1M7DA 5J9PA 1FRGL 4JY6B 1EHKB 1IAKA 1VZIA 2BFVL 3SDCD 5E5LA 1T5XA 3HFFA 3NIDE 1KCUH 1P7QA 3ARWA 1H9DA 4DTGL 1A4KA 3W5NA 4HF5L 4NQCD 3IDYB 2DTSA 5SX5K 5K9JH 2Y07L 3LZFH 4WSKA 3ALWA 2BVPA 4MRCA 2VE6B 4WKXA 5MEOB 4IBSA 2Q6WA 4ZMTA 1RH8A 1SY6H 3FTZA 4L0PB 3RJQB 4ZFOL 2DD8H 1SBSH 3ERXA 5FHBL 3QPQD 2BW4A 3FB7B 4RFOH 1U2HA 2D7OA 4MHHI 2OTUA 1UJ3B 3GXPA 5E51A 4R2GB 4P46B 3X12B 2NW2B 3P3SA 3NPSB 5FKPB 4JPQA 1I9EA 2RCSH 3CAFA 3BE1L 2B39A 3IDIA 5FCUH 1SF3A 3NFPA 3QXDA 4LFHG 1P5UC 5AKVA 3DXAE 3VACA 1HHGB 3QUML 2E9GA 3VQ2C 3HPJB 4FG2A 5CBEB 2WNWA 1EJOH 5A6MA 4UQ3B 2IDUA 5FB8A 1M71A 3ZMNA 2CIIB 4P07A 5AOLA 1J5HA 3P2TA 2JB5H 4BH7A 1MI5E 1YSOA 2H6UA 3EYFB 4BXVA 2KKQA 5CSBA 2W94A 3K6SA 2YXMA 4G8GB 2ZUVA 2Y6TE 1QRNE 3DX6B 1BOGB 4XR8C 3D4YA 3QUXA 1S7RB 5D9SB 1FL5A 3REVB 5HYJA 2OTPA 4OJEH 5BQ7A 1S9VA 3L2NA 4RMSA 3LNGA 4P5KB 4Q6YA 5K69A 3PU7A 1UM6H 3CN3A 3L8QA 1FVCB 4XP1H 2OI9B 4GG6E 1X5FA 4P5TD 5CGTA 5JMRA 3S98A 1T1WB 4BFGA 3EYUL 3L7FA 4LCWB 3T2NL 1DQJB 1DBKL 4NUGH 4TL5A 2CSPA 2WK2A 1O6SB 4L5FE 5KW9L 1ZK5A 1JHTA 3IJ9A 1BF2A 1HYRC 5MEPB 2E3VA 1F02I 2UXGA 3ARBC 4BWTA 4FQQA 1QSEA 5IKCB 2ORBL 1Q1JH 3FH8A 3P9LA 4A7UA 4LEXH 4LCCB 3KPSB 4M7LH 4X9IA 3S2AA 1YJDH 1EJFA 2IQ9L 4M3JA 4XBEH 4D8PB 4M3KB 4PY7A 4CMHB 3C2AL 2XXCB 3IT8D 4ODXA 2V2WA 1SJHB 3CQQA 4JUSA 4G9DB 4RESB 3CZKA 4KZCA 4HWZA 2DICA 4U3HA 5C2BH 5AZ2H 3SJVE 2OX5A 2CXGA 3MBXL 2PMZA 1JMXA 4NM8H 1TTGA 5F6HI 1I3GL 1QHQA 1CS6A 4G6ML 2X6UA 1LO3H 4PS8A 3W1ZA 4HWEL 4CVZB 3SDYH 2AFNA 4X6BB 2NY7L 1BYPA 2H2PC 2Z35B 5TDPB 5I8OH 1MWOA 1DQLL 2VN3A 3HNVH 3DHUA 4KVNH 4M8UA 3UTPD 3FYIB 2C9SA 4F3FA 4ONOA 5BRQA 1CVSC 1L9TA 4XBPA 4ZW5A 1WUNT 1UJ3C 2YWZA 5F1IA 4QOKA 4P46C 4R2GC 3WLWC 2HLFC 3AJ7A 4J6IA 5B8CB 3G5VA 1E8WA 1MJ7L 3NPSC 4N8CH 3VXPA 5E8OB 4CDGC 5HPMA 2BK8A 4FTVE 1Q1PA 2F58H 1BQSA 2W91A 2AJXL 3MV01 3UTSA 4BSJA 4HLEA 4OD2A 1TJHL 4HCFA 4AUUA 1IC5H 1EFXD 3HAEA 1J5OL 4KPHH 3G6JE 4U1JB 1BQKA 4LSTL 1QSFA 3RIFK 2Y3AA 3ARFB 3TX4A 1BM7A 2UYLB 2HRLA 4XXCA 1AGFB 1RUPH 1PSKH 3KXFB 5JOEA 3MJ7B 2KLTA 3P3YA 2ZOLB 3ME0B 4S10A 4RAVA 3RVUC 4RBPH 3Q05A 2YZ8A 2VQ1B 4IRJB 4AQZA 4OZFB 1G9MC 1DYZA 2FH6A 5T3ZH 1KBGL 5IB3A 2WCGA 4QXUL 4OT1H 2KH2B 3MNVB 1WTLA 4RGND 4OF3A 2DH2A 2XRAH 5F70A 3UGUA 4NAQA 2KHAA 2YBRB 3KYAA 3MLWL 2NZ9C 2OI9C 4HHAB 2JTDA 1L7TL 2ICEB 4KK9C 4EKXA 4GG8B 5TD4A 1QI3A 1X5AA 3QBTB 1P4IL 3VXRA 4ICXA 1G7QA 1OP4A 3AWFA 5GS1A 3TEXA 3ZE2B 2AXGB 2J56A 4Q9CA 2O93L 3DVFA 3GQFA 5D6DC 4KAQL 2A74B 3GTTA 2IJ0C 2MTPA 4P4KA 3ULVC 3THMH 2OSLB 2IWEA 5K59E 3IKCB 5DI8B 1X4XA 2ZP8A 3ARDB 4TL4A 1A14H 4LCCC 4WENB 5BV7B 3UZEA 2CH8A 2XZQL 2FJGA 4X4ZA 3C8DA 1G7JA 4XC1L 4CMHC 1KPUA 4PJFB 2XFXA 4MNHB 2GJ6B 3S3DB 3A67L 4JO2H 4WUUB 1WFUA 1YN7A 4K23H 1L0XA 4QWWC 3ZZSA 3HC3H 4MAYB 4Z7WF 4I7ZC 3GS7A 2QGDA 4LASL 2FQGA 1SPDA 2PN5A 2YXFA 1T2QH 1FNEB 1MVUA 3BLBA 2HG5B 2VW6A 1IT9L 4KXZI 1FF5A 4F2ME 2LGNA 3DGGB 4N0FB 4XI5D 4EMZA 1XGTA 4N2IA 5EIVA 4LNVA 4XP5L 3SYQA 5C0BD 5HHOA 3VFNB 4IHBA 4KRLB 4Q97A 4LSSH 3DETC 3U30B 5JXEA 5JLZA 4O02L 2PNDA 3CFMA 5IK3A 4AMKL 3F5WA 1JGUL 3K1DA 4WSGA 5EHFA 5IZ7A 3O4LE 3GSXA 2CGRH 3ILQD 4MJ6A 4Y5VA 2J73A 1XF5A 4P3DA 4WSJA 5DJCB 1BWWA 2FSEA 1N7ML 1JIBA 2EZ0D 3T3PB 1YN6A 1CT8A 4EI6A 3NFNB 2B9BA 4TUKL 3DHJA 4NYLA 5D7SH 3BI9X 3TU6A 3TJHD 4ISVB 5DLML 1LWRA 1OGTB 4JN2A 4G7QB 1KB5B 3AWGA 4PJ7B 1L9QA 5EBGA 4U3CA 2H32B 3ZDZB 2ATKB 3VXSA 3F01A 2Z4QA 5F7LB 1DVFA 3NH7H 3FUNA 3OXSA 3FT4A 4MYPA 4PJHF 5CILL 3QH3B 4IRJC 2AXJA 3AQDA 1PBYA 1CF8H 5ES4B 1G9MH 4DZ8A 2WGNB 2I27N 1IFHL 3EO1B 3FT3B 1GZQB 1H3UA 4F9PA 3TFBA 3ROLA 5IHLB 1KT2A 1QPKA 2P8PB 1AS8A 2R2HA 2J21A 4ZODA 1KCSH 3BVXA 3GINA 1C08B 5ITBH 1EMTL 3MO1B 5ERWA 3MBED 3LNFA 2EECA 3GMPB 1T04A 1NJ9B 5IBLD 2P4AB 5H94A 1YG9A 1U8LB 2DMGA 1ACXA 5TGBA 4M5YL 2YSTA 3CBKB 2A74C 4YHOH 3HKZA 5E9DD 1DQDL 1RUQH 3JV4B 3ULVH 1A2YA 2H2SD 5CO1A 1XAKA 3IGUA 4MXVE 1JN6B 2RB8A 3GRBA 4NO5B 1I9IH 3ARDC 1ZLUH 4RSYA 4NJ9L 5JHDD 5HHPA 4FNLH 1I1YB 1U91A 5BV7C 1TJIH 1RV6X 2VO8A 3ILPB 4MXWH 2G75A 2D3JA 3HI1A 5KYWB 4B7LA 1MKFA 2BNQA 5ITFA 4Q56A 5CJQL 4Y4KB 2WAQA 2R4SL 3BOVA 4MAYC 1F6AB 4G80A 5IB5A 1OGPA 1Y6MR 4ZYKA 1MFAH 5GJTH 2P7TB 3GKZA 4HSAC 1DJHA 2VUOA 3T6XA 3KPTA 4YHIB 3D2UD 2XN2A 2MKLC 2E0PA 2ADFL 1GSKA 2AJ3B 3QGVA 4EOWH 1L9NA 2DQEH 1URLA 1QVOA 2VNCA 3CJJA 2AK1L 3X2QB 3MUGA 5T5FL 4KU1A 4XVJH 2BZDA 2N7SA 1AY1L 3FTYA 3U30C 3ZN6A 5D72L 2R2EA 3HG5A 3N43F 4Y7OC 3OTTA 5BQDA 3QUZB 3OGOE 3EOBA 4YBQC 2WB7A 3V7AG 5JW4M 3HE7B 1ZS8B 2ZSWB 2X4QB 2ZZUT 4IRSB 3G7TA 2YD2A 1PLCA 1XGZA 5ILTH 5G5DB 4NQEB 4CW1B 1AQMA 2J4WL 1SMOA 1XCQB 2R7EA 4OGXH 4N0UA 3BN3B 1D5IH 1NMAH 2GT9A 4ZOAA 5DHVA 4ZS6C 4N90D 3U7YL 1IGIH 1JF1A 4PJCA 1AD0B 4HX1B 2WYIA 5H2BA 1XBDA 1IM3D 2JWYA 1UWYA 2DWDA 3SGEH 1XF2B 3H3KA 1F4AA 3GIZL 3JWNC 4QHMA 3MV7B 3OJVC 3PDDA 3APMA 3SHSA 5KEZA 1YEGH 4EZMA 3V9EA 1TDQA 3GYRA 3MNZB 3NMEA 1MN4A 3OL2A 1S7VB 1OT1A 2I32A 2KI6A 5E6RB 3WGVB 5T33H 5I15H 1FUNA 1WC7A 2I24N 3VI4B 5SV3A 4PJIF 4ZMVA 2HKHH 1MRCL 2GY7B 5DWUL 1JI1A 2FEEL 4IKJA 4JFDA 5DZOA 1E8ZA 2CZNA 1AS6A 3ECBB 3E8UH 4KTDH 1SDDB 2BNUA 4OLWH 5F7AA 1MQKH 1RZJL 4IRZL 3EOAA 4L37B 5F97E 4TNVK 4FABL 1MI5D 2ZXWB 2EQDA 2Z9TA 3EJTA 3TH4T 5JDSB 3WEXA 3B5HA 3MUZ1 3KPRB 3G08B 4F8PA 5J57B 1NBVH 1A6TA 1MFUA 1VENA 4HGWB 5ABDE 3V5DB 5C1MB 1NOAA 2BHZA 3HR6A 1KELL 3SPVA 4DK3A 4H8WL 3INUL 1W8NA 5ICXB 4LIQE 4UT9H 3SDXA 2WWMD 4HZLA 2VJ0A 1WD9A 4OFIA 4E9YA 4OD1H 3VTMA 2FX9L 1ILSA 4LCIL 1J1OL 1SLWA 2QVTA 4ELMF 4X4XB 4XPGL 1A7QL 4MFHA 2APVA 4Y4KC 2AGJH 2L7UA 4D0DA 4G8FA 4R8WL 1N5AA 3X13A 1UZ6F 2NNFA 1DE4A 3QUKA 2F53B 3STZB 3MRBB 3TBWB 3TIDB 4BFKA 2A5UA 1A7OL 3NZ8A 4GRWF 2E4FA 3WFCL 1RZGA 1Q90A 3VA6A 1DBML 5KZCD 3CQPA 5FGBA 5GRYA 1U33A 5EU6A 4GMTL 1TEYA 2CHXA 2X0UA 4UOZA 1MFBL 5DQJB 5IVZB 2VXQH 5IF0B 3N06B 3DMMD 2CK0L 3IXAB 3WMQA 2HKAA 1KYAA 3QUZC 4IU3B 5C7XH 5HYQA 3MFFA 3U9UA 4PGZA 3HE7C 4HETA 4WW2A 4WO4A 4IRSC 4LSQL 4O58L 4IYKA 2V17L 1YO4A 3B3IB 3KGRA 1FZMB 1HEZB 2DH3A 5DJ8A 2BNRB 3N3EA 1F4YH 3QFJA 5ESAA 1HHIB 1L0QA 4NQDD 1KDIA 3ZPDA 2M26A 2NY5C 3JUZA 3ZKQD 1ACZA 5JZ7C 3NTCH 3S37H 1KB5H 2XKUA 3C8KB 1I3RB 3LS4H 4AGNA 3HRZB 4KQ4H 5L2KE 1G84A 2AJYH 4RWYL 1G4MA 4U1IA 5EN3A 3AY4A 5SX5H 1EJ6A 2H32H 5IW1B 1DTUA 1XL4A 2XQBH 1WT5A 2JB6A 5FYKE 3GJFK 3HS0B 4QRUB 5AVWB 2DQTL 4QXGH 4HIIB 5I8EA 4C83A 4FG4A 1SFDA 4KUZL 5JHAA 3WNJA 1LVEA 2XU9A 4WHYH 4XX5A 1W6WA 3BWSA 2CQVA 4YPGB 1QA9B 3L3HB 3O81A 3RBSA 5I1KL 2ESVA 2DQDH 4KTEL 4NCC1 1NAKH 2I5YH 3OF6A 2D9QB 5D93B 5EF1A 3PDOB 1RD6A 2LLNA 2WBKA 4O00A 3ZR6A 4OVVA 2JCCE 1JNHA 4JDZB 1EANA 1M57B 4LPTA 3FK3A 3LKQB 1FG2A 1IZKA 4HBQA 5TFSH 3X3GH 3W39B 4WUKL 1CYWA 2WKOF 2Q8AH 3WNKA 4KZDL 4CGTA 2DB8A 5TF0A 4NO0B 5BMFL 1UWXK 5B1AB 5ICYB 1KTLB 2MPAH 1TTFA 3TBBA 3DVNA 1PQZA 3PP4L 4I9WD 1E5CA 3MV8B 3HNTL 1FIGL 1N6VA 3FT0A 1I3VA 4P2QE 3Q9PA 3MRPA 2Y1VA 5C6TL 3CHRA 6FABL 1OW0C 1ACYL 4F15B 4XBGB 2HJKB 2LVCA 4FFVD 3H1ZA 9CGTA 1E4XI 3WO4B 1PLGL 3MRRB 3FN3A 2IANB 5DS2A 2ED6A 5CEZH 1QW8A 4MNGE 1UOKA 3G9AB 3V7MA 5D2NA 4XX1E 1NCCH 3UO1L 1WK0A 4Y19E 4P59L 2C9QA 2IPTH 1JAEA 2ZXGA 3NFSH 4TS6A 3P02A 1EZLA 4I77H 3WV0A 2VJ8A 4V1DA 1A1OA 1ODUA 1P5UA 2CXKA 3NJFA 4L0YA 4Q52A 1FFQA 1L9SA 4E9RA 3UAAA 2VSCA 4NO3B 4FA6A 3DJRA 1NGYA 5C0CE 3HI6H 5KSUA 2CUAA 4G6FD 4R5VA 5FFLA 2FJHA 5I26A 3KL0A 2CKNA 3AQZA 2VDPB 4K5NA 1HSBA 1G0DA 4GINA 4LKCB 3MQIA 4Y1AA 3SE8L 3WL9A 4YNYA 3AUVA 4JFPB 1F5WA 4WDIA 4HC1H 2NY5H 2GAZB 4I0PB 1M2OA 4DP4X 3TWYA 3O4LD 2A6IB 4GG6F 5J12B 3HR5A 3HRZC 4XTRD 4BKTC 3LZOA 4JM4L 4ECNA 5LQBH 3NT0A 4QO1B 3MGOA 2XT1B 3ZDXF 2C3VA 1SHWA 1T83C 2EC8A 3HS0C 3MBWA 2YPVH 4R4NC 1VPOL 3BZ4B 5FKAB 5HVGB 3UADA 1OM3H 5CZXD 3V6OE 1LILA 3L3IB 4GKZB 4K15A 1KTRL 1SXNA 1S9KC 1BZ9B 1J8HB 2Y06L 3C5XA 3JT2A 2H6OA 2IAMB 4K73A 4F91B 3AWEA 3HBGA 1FFNA 4E41D 4ONFH 5AB0A 2Y9RT 2AABL 5D93C 4MJ5A 2WY3B 1H5BB 1HL5A 4H0IA 1V55B 2XZAL 2HFEB 3ARBA 3C60B 4S1DC 1SMAA 5FYKL 2NCEA 4HPOL 4JKNA 1T20A 4AM0A 2Q3XA 2YA2A 3IKKA 4WWKD 5C08B 5IVNA 3V4PB 3T71A 2OMWA 3GPSA 4CN1A 4Z7UE 2ZG2A 2Z91B 1QUNA 3V5HB 3QG7L 1QWNA 4MA7H 1I7ZA 3R4DA 2WSDA 4JY6A 3T0WA 3QJQB 4KI5D 3VFWB 1I8IB 3OQRA 3POHA 2I85A 3US9A 5T3XE 4LFHD 4N6RA 2UY7A 4KY1H 4D3CH 4HFUL 5DEJA 1YC8A 1BD2A 3VCLB 3C08H 4A7SA 3N44F 3QORD 1P7HL 1MFCH 4PSPA 3KBPA 5FUOL 3V79C 4F15C 2VE6A 5E5MB 2NQCA 2QL1A 5MEOA 1K72A 1QNZH 1L5GB 5F7EL 1R6VA 2CJUH 4N2HA 3WO4C 1GIGL 4ODHL 2E75C 3FB7A 2Q86B 1IMHC 2FK9A 4TRPL 1UJ3A 1Z3GH 5F72S 4P46A 3X12A 5CMAB 2NW2A 3UL4A 3TN0B 5FKPA 2G0KA 1ADWA 1A22B 5D2LB 2V5YA 1TUPA 1EWHA 2ZKYA 1IARB 3G6JF 4PJDE 4QNPE 3IN2A 3QS2A 3UBGA 3UAEA 2QQKH 3EJYD 4PJBB 5TK2A 1HHGA 4P5MA 3MRDB 3QIUC 4APQD 3DUHA 5CBEA 3A23A 1LGVA 4UQ3A 4I13B 3SODB 2CIIA 4RZKA 5DJDA 1MUJB 2J55A 4DGUA 5HGDB 2CMRL 1DLHB 1RMFH 3ECQA 4JJOA 3L4WA 1PEWA 2EE0A 3QO1A 3TVMD 2Q10A 3DX9B 1CYXA 3CFEA 4ERSL 5F9WB 1DO5A 4ACTA 3SDDB 3DX6A 1BOGA 1IFGA 1ZOXA 3L5HA 4I0PC 5EOQH 1DVXA 5J12C 4EI0A 3M17B 1YMMD 4XPAL 4NM4L 5D9SA 5ETUB 3Q13A 3REVA 4A37A 4AI7A 4L4TB 5I1AA 1AO7D 4BSVB 3GMMA 4YBLC 5DUML 3S36L 1FVCA 2OP4L 5F7UA 3KYMB 1TLKA 2BMKB 5D7IA 3CSFA 3LHPH 3A4AA 4TQIA 2R4RL 3EUDA 5K59F 4JFHE 1FL3B 2DWSA 5D6DA 2IAMC 4BQ8A 1L6XA 1O6SA 1XF1A 1PNCA 5GZOD 4R96A 2O5YH 1WO2A 3VGDA 1H5BC 3C60C 1S5IL 2HZHA 5IKCA 3BIBX 5ISZB 1H0DA 3RVXD 1PAMA 2CPCA 2YAMA 1KYDA 3RILA 4TKWA 1M7IB 2WO2B 3WENA 1J5DA 1SJHA 1CC3A 4G9DA 1YA5A 4X8XA 1N8OE 5ICZB 2YAFA 1I7TA 4FJZA 2YUVA 2R2CA 3EOYG 2PXYB 2R23B 3GJFB 1U30A 3MLSH 1JXGA 3ZK0A 3MLUH 1NSNH 1MWAB 1OAYH 2D03L 3MMEA 2X9XA 3R1GL 4X6BA 4NQSA 2Z35A 1QHOA 3GBLA 5PCYA 2A9BA 5TDPA 3VH8B 1KWGA 4JFOB 2FD6H 5AALA 4OCWH 2YK1H 4G7YH 4E9XA 1D5XA 3Q48A 2FGZA 2VERN 4GNKB 1PKQB 3QC5X 3JVGC 3TN0C 2WKLA 3QP3A 5CUSH 4M7JH 1IGML 5KSBA 1JDAA 4HKBA 4MB1A 5JIDA 2HT2C 5GGQL 3MXWH 4KHXL 5TE6L 2O61B 3RWDB 2ZSVB 4HWBH 3ASNB 3KPQA 1RUMH 5DJ2B 3LS5L 2WB1A 1OB0A 2P43B 4HH8A 4KROB 2BP0A 4EBQL 4Z7NE 3CH8A 1SRDA 1UKTA 1QFUL 2UYLA 1I1AB 2ZTBA 3KXFA 4NI6A 4NIYE 2JJVA 1KPVA 4OKDA 5AYQA 5E1QA 2VDPH 1O75A 5HHXL 3ME0A 4KX9A 4W6XB 2VQ1A 4U1MA 4IRJA 4NQXB 4OZFA 3N42F 4JG0H 5F9WC 3SDDC 3QJOA 5ESQB 3LZNA 1DJZA 2DQGH 1DQQA 5DZNA 1EAPB 4WLCA 3HUJF 1MZYA 3I02A 5D7LD 2K6ZA 2YBRA 4FNTA 3R7QA 2XIIA 3QCTH 2J8UF 3NPZB 4HHAA 4ODUB 3X1EA 1AGCA 4PRNB 4GG8A 4PBWD 3UGEA 5CZVH 2FX8H 4FCHA 3T0EB 2M83A 4MXVF 3M1OA 4W9GC 4MA1B 1G9NH 1V7NL 5E24E 2V5MA 5L2JB 5E6UB 1PLBA 2D2CC 3BP6B 2J1ZA 3FOMB 4BFOA 1AGDB 1DBJL 4JVPA 3BUTA 1CBJA 1FE8H 1JWUB 2WZPD 4OCYH 4KJYB 5DI8A 1WGVA 2QZ5A 3QQ4B 5T1MB 1UD3A 2G3MA 4H8PA 3S34H 1MRFL 3ARDA 4OQTL 5ID0B 1AANA 1N6QL 4C56B 4DP8X 4UTAL 3U4EB 4XNAA 1ZGLB 2F5AH 1R33A 4KMLB 2Y72A 2IV8A 2ZWYA 4PJFA 2NOYA 5FOJA 1IBHA 2GJ6A 1IC4L 2VRQA 5SWSD 3FFCB 3L9EA 4WUUA 3WNPA 1WA1X 1GL4B 2GJZA 5AW2B 4XVSH 4NHCH 4XZ4A 1DQMH 3IMUA 4MAYA 3K2UH 4Y8DC 4YDVB 1ILUA 4S1QL 3GRWH 1UOWA 2PXYC 2WLKA 1FNEA 4PWHA 2HG5A 1OTUC 2W0FA 3G6AB 2VDOB 3PCYA 5D7JB 3HBPA 4N0FA 4JHVA 3N0PB 3E9TA 3D39E 3IFLH 3UAJC 2QKSA 3QDJD 2XG4B 3DKHA 4ONHB 1F3RB 2NY0B 4DJMA 1A7BA 3R4RA 3P54A 1RUKH 3CHSA 2GUYA 2VMEA 2H1XA 3NAAH 4W68A 2DJ4A 4OIBA 2XHNA 5LNGA 1FNSL 3UTTE 1PVHA 4P2QD 1ZIAA 2W80C 1ULVA 3TV8A 5D1ZD 2K6WA 4ZFQA 1PU0A 4M8QB 3IPBA 4AVJA 3KG5A 4WJKB 1QYGH 4WI8A 1LDSA 1JNNH 1VHPA 2ZXBA 3NFNA 1RUAL 1HTYA 4XPBL 3AXLB 1ZTMA 3FPYA 4JHWL 1BSIA 5DJAB 3SDCB 1UD2A 4XMWA 3ZJAA 5D5MB 4ISVA 3MRKA 4ES9A 1JUFB 2CLZB 3FKUS 3PPSA 4FGMA 4U6YB 3S5YA 4KROC 3WNNA 4AM0Q 4Y19D 4W81A 4WY7H 4JPSA 5LXGL 1OD9A 4G5ZL 4DUVA 1UD6A 1S7WA 5DMJB 1I1AC 2H32A 5TE7H 2ATKA 3L3OB 1Z5LB 2NNXA 4XCCL 5HGAB 4I3RL 5GRXG 3QH3A 1T66C 4PYGA 3NP4A 1RZPA 4JMXA 2JQMA 4HCGA 3EO1A 3UYRL 1X5GA 3O3AB 3FT3A 3JTSB 4RAHA 4U1NB 4A2GA 3BFWA 1F18A 4NZRH 3T1WA 3F84A 3D30A 1EPFA 3QFDB 2YD3A 4HKZA 3STBA 3AACA 5GJSH 3V0GA 2X4SB 4K3DL 5C09E 3GMPA 2QR0B 1NJ9A 4OFYA 3T0EC 1ES0B 3H2PA 1TO5A 3WNIA 4MA1C 4KRPD 3P3TA 4AXWB 4FA7B 2X89D 3DX3A 2GKIA 1OCRB 4QHKJ 4DFIA 1N4XL 3SE9L 3JZYA 4QKXB 2GFBB 5MHSE 1MREH 4WFED 1JN6A 5KBDA 4M62H 1DHKA 3O6ML 4GXVL 3SGKC 4NO5A 5DA0B 3QCVH 3ARXA 2JKLA 1AZCA 2OYLA 3HCVB 1I1YA 3E6FB 3ILPA 4X4MA 2AQ3A 5ALBL 2HFFB 5KYWA 5I19H 2CPUA 4LEOA 2WIIA 4ZMZA 1KCRH 5F9OL 1X7TA 5LAPA 3KZ8A 4GSUA 4Y4KA 1WAAE 2G5BB 4LLUB 4MNQD 1R3HA 5ANHA 1MDTA 1BZEA 2P7TA 4OLYH 3FAWA 3T0BA 4AYSA 3O3UN 2D73A 2SODB 4F8QA 3NCMA 3UBFA 4XPFL 2VZ1A 3FZUD 2VLJD 3M45A 4AQAB 1GOFA 3NJIA 1NKGA 3GJFH 5D7JC 3WIFB 3WFEL 4K55A 2AJ3A 4XNYL 1P53A 1MWAH 4N8PA 5CHNB 3GGWB 3KPLB 3QR1A 3R06B 4AJ0A 3MV9D 5T3XD 2BVOB 2AXFB 4KKPA 5DVMA 2CHZA 3QUZA 2XVKA 5FX3A 2GJRA 2R29L 3HE7A 2AF2A 2ZSWA 3WI9A 1AC0A 2X4QA 5CNHA 4X80H 1N59B 4N2KA 4IRSA 5AVVB 4OF7A 5EO9B 2Y7LA 4NQEA 4CW1A 4J5VA 1HWGB 5AOZA 2X4NB 3SDCC 1XCQA 9PCYA 5KVGE 2ZX5A 2FT6A 2OCFD 2JNZA 3PV6B 4BE6A 2Y0SA 1VF5C 4HC1A 3FJTA 4HX1A 1UWXH 4Y9EA 1LM8V 4TLKA 3PGFL 5D70H 3IJHA 3DV4B 3UMTA 1XF2A 3CDGB 3HAEG 3AGVA 1YQ2A 4U31A 2ZCHH 3HG0A 2OMUB 1DQKA 3ZKXB 2VC2L 3L3OC 4QJ3B 4GAYB 5DJYA 4TQPA 3MNZA 3U0WH 1TMCB 2DBJA 1UT2A 3QPQC 1FYHB 4HAGA 5BZDB 3KEHA 4I4WB 3BUYA 3VI4A 5GISH 4L1DA 3WTTA 2QSVA 3VXMA 3KYNB 4P3WA 3PWPE 2CCWA 2ZNXA 4BQ6A 3JYBA 3ECBA 1YY8B 1SDDA 4ZOBA 4J3TA 1DJIA 1ASOA 4L37A 5F0LB 5I28A 5KS9E 4BK8A 3SSGA 2AC0A 2AK4D 2OZ4A 4GAJH 1YDPB 4BDVB 1MOEA 3KPRA 4JRYA 1EFXB 2LAAA 2B1AH 1KJVA 4CBPA 5IP4A 4U7MA 2R2BB 3F7RA 2EYSB 1JNJA 1R5WA 2JIXD 3P0YH 3CLFL 2RBLA 5CINH 1FFPA 4HPYH 2VSMB 4HAFA 5ICXA 3MODL 1E43A 3BT0A 4OLXH 2VISB 4YBHA 5JYLA 4UMSA 1IE5A 2FT7A 3EHBD 4JFHD 2Q8BH 4O9HH 3CXDH 3OG6B 1QBBA 4DGVH 1OW0A 3P73B 4X4XA 1E42A 3U4BL 2OTWB 3MRNA 4AEIH 3SBPA 2B0SL 2J6EA 2QGEA 1PG7H 1EXHA 1RZKL 4PWIA 4X0NA 4EN3C 3TBWA 2F53A 1Y1UA 3DJSA 4ORGA 3STZA 3TIDA 5ENWB 2F1EA 5DD5L 1A25A 3NZHH 1QW9A 3IBEA 5TPWL 4ZUSA 2PO6D 3L1GA 2VDOH 2VT0A 3Q7JA 4KJQD 3CPLA 4DQOL 4CMMB 2P5PA 5LG6A 5DQJA 3IDXL 5IF0A 3VX1A 3IXAA 1USZA 1QTYT 4X7CC 2X6CA 3LEXA 4GRLD 4IU3A 4W4NA 4MJ4A 4UBDC 2ROXA 3O41B 4JE0A 2CGZA 4XO9A 5INDB 4JRXB 1B0RA 3HPLB 3ETBF 4WAFA 2HMID 3N04A 2WLMA 4AY0A 1T6VN 4P9MH 1HZHH 1ZKAA 3I6LE 1AXIB 2XA8H 4GSDH 2Q76B 4XVTH 1C7SA 2IH3B 4YGVB 4ZW8A 3E7JA 2R0WL 2JKNA 3V10A 3P11L 3BAEL 4Z5RA 1U2YA 4DO4A 5JDJA 2VDNH 1I3RA 1AAJA 3HRZA 1ZJBA 1MXDA 1NCJA 3ZKXC 3DSNA 3MFGB 3FRPG 3Q6FB 5IW1A 1CXEA 5ESVB 4ORZC 4KO7A 4FP8L 1OAUH 3HS0A 3RVWD 4QRUA 3CMGA 2FDBP 4ZTOH 3CZJA 3ZOAA 2VN6A 4PH8A 2WCSA 5DMKA 2IBGA 3ZU8A 4GW1B 4YPGA 3L3HA 4ZZKA 5AYUL 4U4IA 3DK0A 3JQOB 1T0MB 3BYYA 2E8YA 3BWZA 3PDOA 4K71C 4JFZL 4IKKA 4JDZA 4Z7UF 2MRYA 5SWQB 3LKQA 1F3DJ 3KLDA 3T9WA 1NIAA 3TO4D 3W39A 3I75A 1T89C 4RSVA 1F45A 4CL7A 4ZTEA 1EEQA 4KMTH 3RHWF 2DLTA 3O3DA 2Z31B 1SOQA 2N01B 3C6LB 4FNPA 2OK0L 5ICYA 1IEAB 3LPFA 5HI3C 1KTLA 4XNMB 1BBDH 3PAZA 2XVLA 3U9PL 2GHZA 4HIHB 1B3IA 2Z0BA 3MV8A 1VCAA 5DRXB 3QJHB 4YXKH 4J3OC 1G6RB 4GIAA 3LPWA 4GS7B 5AG8A 1F00I 2ZKHH 1S5HB 1SXSA 2I07B 5GGSB 4XBGA 1DVZA 1NANH 2HJKA 3CVHA 4HXBH 1ZT1A 1TZGL 3L3KB 4KO5A 5CP7B 4NN5C 3MRRA 3MBEB 1R0AL 4G7SB 2YN3A 1LK3H 2IANA 4F7CA 3TEZA 2CHNA 1JZ4A 4X4KA 1D7FA 3QR2A 4K07A 4ZAKA 4PJDF 2A73A 3MLYH 4U6HB 4YDKL 1CQYA 3EGDA 5IESL 3UYOD 1FGVL 2DKMA 5E9DB 2ZF9A 3IFOA 1OCZB 1BXUA 4Z78B 1AJ7H 4LU5L 1GPOH 1A0QL 4HWBA 4V2BA 3EH4B 3F83A 4YFLI 1QSEE 5ECJE 3UBXG 1M05B 2E7MA 1JGVH 2F54D 1ROCA 2Y2TA 3QIUA 4FZEL 4ZX5A 2K4AA 1INEH 2ZPKH 4NKIL 4NO3A 1UH3A 2NR6D 2NZ1A 2G2NA 5J0BA 3GZOA 3SZKC 3S5ZA 3D39D 5CEYB 1FYTA 2BWDA 1E6OH 4OJDH 5GXBB 4HALA 3M1BB 3VGBA 4KGJA 2X40A 1KLGB 3U7WL 1DBBH 4JFPA 3MA9H 5AAWC 3CZNA 1J18A 1GGIL 5IREA 3FW6A 3VFTA 4AQEB 4I0PA 3LH9A 3D2UB 3UTTD 4PS3A 4XI5C 3MUUA 2EDQA 2OMVB 4QLWA 4QO1A 4MA8H 3ZYIA 3KPMA 3B34A 3P30L 3W82A 2HT4C 2EVHA 4JBSA 1Q0EA 4OB5L 1E4XL 1FORL 4G9FD 3C5ZB 5ADPL 2YGQA 3BZ4A 5FKAA 3WNLA 4D9LL 1AXSA 2IADB 1NGQH 3BAKA 4GKZA 1RZ7L 4XWGL 3VDAA 3QEHB 3CVHL 2MPVA 4PRPA 1CDUA 5EMYA 3QJVB 5MENB 2AJSH 1EK3A 3V52H 1E9QB 3QA3A 2ZWSA 4XMKH 1H5BA 1T0NA 3C60A 1KXQA 5I16A 4MSWB 4ZUTA 3UTSE 4YSTA 3DX7B 1J0JA 3V4PA 1BQHA 1IM3B 4Z6AT 1JPGA 3SCMD 2FB4H 1SMDA 1KV3A 2Z31C 1QSFE 3V5HA 3C6LC 1HOEA 1E90A 2CU9A 3H0TB 1MJJB 3VFWA 1JNLH 1I8IA 5FGCE 3UJJL 1W2KT 1MCPH 4M1GH 4NBZB 3IVKA 5IBTH 1NBZA 3O6FD 4L1HA 4M29A 5E8DL 2QVFB 2A83B 4GS7C 1A6PA 1OARL 3FO2A 5CP3H 3QVAA 1WAEA 4YHPA 5E5MA 1CG9B 3WFHB 2R69H 1ED3B 1M9SA 3KPPB 4KOCA 1KGCD 4MDIB 3MBEC 3BP7A 1RZ8B 4ZG1A 3ILDA 2Q86A 5AZUA 1FHGA 3LVTA 1B0WA 2XDHA 4UV7L 3JVGA 3W3BA 3TN0A 5D2LA 2H2SC 2EUVA 4EIUA 1ZV5A 1LYQA 1A3LL 2FSDA 5E6YA 4WVRA 4X0KB 4Q6KA 4J12A 4PJBA 1ZHNA 1T03H 2MNUA 5AOKA 4XP6H 3PUCA 3GBEA 3ARQA 5AW5B 3E6HA 3EDDA 1I7UA 4KGLA 1MUJA 1RPQA 3CD4A 1VGEH 5HGDA 1DLHA 5G4NA 3T4YB 3B7YA 4HUUB 2DMBA 1Z1WA 3ULUD 3FHQA 1ZGLM 1F90L 1C12B 4LLQA 3SDDA 2WO3B 4JY5H 4I1RA 1YNKH 3SGEI 4AVHA 4L4TA 3TCTA 4BSVA 4WGWB 1NWOA 1C1EH 1JZHA 2DYPB 4ALAL 5IB4A 5I2IB 2VDML 4RQQA 4Q7DA 3KYMA 2BMKA 3L13A 3C5ZC 1ET5A 4HU2A 1QATA 3DMMB 4ZFZB 4L8CB 5GS0L 3JZ7A 2F5BL 4MQXD 1E8YA 2HLAB 5KYYB 1FL3A 4WHCA 1OAXL 5AYTA 4F1SA 1TNNA 2OKMA 1LQSR 2FAUA 4TUOA 3KM1A 3FBKA 4N3UA 1P4UA 4NN6B 5C0AD 3B6SA