1OIOA

Gafd (f17c-type) fimbrial adhesin from escherichia coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMBRIAL LECTIN
publication title The Structural Basis of Receptor-Binding by Escherichia Coli Associated with Diarrhea and Septicemia
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1oioA00
1O9VA 2BS8A 1O9ZA 3FFOA 2BS71 2BSCA 3F64A 1ZPLA 1OIOA 1ZK5A 4K0OA 3F6JA 1O9WA 2BSBA
chains in the Genus database with same CATH superfamily
1A6TA 3GZPA 3LYRA 1CL7L 1P7QD 3LZFH 1OTSC 3FCSB 4RAVB 4BE5A 3RQ3A 2PLTA 3L5XL 3ZT7A 2E3VA 5J3HD 2VLKA 1N67A 3FFCD 4Z7UB 4L18A 3QUYA 1EZSA 2AK4D 3CXHJ 1MELA 4HJ0D 1URZA 4LP5A 1XIWC 1M42A 5BZZA 3IDIA 2NY0B 2NY1D 1F3JB 2VSKB 3KH4A 3UTOA 1DSFL 3TBYB 4GUCA 5A6IA 4RBPH 2PXYB 4N9GA 2EYRB 3LN4B 4YQXL 3QISA 3K2IA 4N8CH 3MRRB 3QIUB 3ZDZB 4ZMOA 5JA9A 1B90A 2YXMA 1NLDH 3F85A 2EUZA 2E5EA 2NYYC 3V5HB 1A6TB 4Y1AE 5DD6B 1GSMA 4FNTA 5CGBA 3CFIC 2BVQA 4WI7A 2D3LA 3FTVA 4BZ1L 2WXHA 5JR1H 4XMKL 5J3HC 4L8SC 5L0QC 5AEAA 2VLKB 3LXAA 1GW6A 3A4EA 2F54A 4HJ0C 4KHXH 4NRXA 1K5NA 2D9CA 4KXZH 4PS3A 1GPOL 1H3TA 2NY1C 1GGIL 1PCXA 4IRZH 2Z4QB 3QZBA 5GGUA 3EYUL 5IM7B 3ULAB 5EB9A 2YMXH 3BDXA 1T83A 4N9GB 5SX5K 2E8ZA 1FL3A 6TAAA 2Y5TA 3CH1A 3HS0A 5DWUL 4R97B 3EYQD 3SDDA 4KZEL 1FFTB 43CAB 1OAZL 3H9SA 1NIDA 1QZNA 5FECA 3PNWB 2BVQB 3S4SG 1MFAL 2QLVB 1W0VA 4WHCA 3CC5A 3N3EA 3MV9E 4L5FH 1N0LB 2BERA 3KWXA 3ZRFC 5BS0A 2A77L 3LZLA 3ULUD 1PU0A 1SXBA 1YNTA 2F54B 4HUMB 1PFCA 5J13B 2BHZA 5KSAC 1OAJA 1KYOK 4JZOA 4MQSB 1CLCA 4NRXB 2MCG1 1K5NB 1FNSL 2WWNA 3NYKA 4I2XB 4IMKC 4N2KA 1OAYH 4BK4A 1A7PH 1SBSH 4FDWA 5GGUB 4Q0XL 3PRZA 3P4LA 1NMCB 1BEXA 2GY7B 1FL3B 2Y5TB 3CH1B 3K4AA 4LPVA 3HS0B 2V3FA 1TTUA 3EYQC 1BGXH 4FFYH 4X99A 2FH8A 3L13A 3DVFA 4P2OD 4X50A 3QZPA 5FECB 5GS0D 3CTTA 3GK8L 2CR0A 1W0VB 3CC5B 5F1NA 4ZT1A 5BS0B 1YMME 5CSBA 1BFTA 3VE0A 4I77L 1YNTB 3SBWC 2HFGL 4R7XA 4OFYA 5I23A 4L1HA 3R18A 5K1JA 4JZOB 1ET8A 4Q2ZA 1T6BX 4UV7H 2PO6D 5TJWK 4IKIA 4P5KA 4N90D 5I0XA 4PSRA 4XRCA 1DE4A 1KXVA 5DMGD 3CDGB 3JWNC 4XTRD 4IRJA 2F58H 5MENA 4PVLA 3DECA 2YPVH 2MHAA 2YAOA 5FAAA 4X99B 4GBXA 1M2VA 2MKWA 4I18B 3P77A 3QEGL 1DVFB 4F1ZA 1RSYA 4FTVD 4ERSH 5GZOD 4WFFD 1JZ5A 4EJ1C 5M7QA 5F1NB 3H8NA 1IEBB 5JHAA 4J3TA 4X4XA 5AOIA 3DVGA 4FRWA 3VE0B 2ZKHH 4DPCX 2YBRB 4D3CL 3H7BA 5DJ6A 1G43A 5LGKA 3I9GL 3VDAA 2ZX9A 5EBGA 3QEQD 3L48A 1UCTA 1HZLA 4XRCB 3KPRA 5EDSA 5I66B 5DMGC 4MJID 1UYWH 3EJSA 4F8OA 2R4RL 4KJQD 2IJ0C 5D55A 1MHCB 1H8NA 4FQXD 4Q4IA 4MQXD 5MENB 2VXUL 1MHPH 2XG5A 1M2VB 2XXFA 1FYTB 3AXLA 4WSJA 3T3ME 3V7AG 2DEYX 12E8H 1AQDA 5BV7C 3P77B 1IZKA 2EVFA 3HAEB 3O6FD 4LSRH 4AVHA 2XZAL 3PREA 5IV2A 1J5HA 3WSQH 3DUHA 4XR8C 1Q90A 4LEBA 1A6ZA 3UZEC 5JW4R 1KCKA 5AVWB 1P5VA 1R0AL 5DJ6B 2V5TA 4PJDE 2BMKA 2Y7OA 4C8XA 4ZPVB 3O3BA 2OLDA 1NCTA 3KPRB 3AG3B 3KS0J 3OL2A 3CFTA 4Z5RA 3EJUA 2ALAA 2Q8BH 5KTEL 2VJXA 3A6BL 4GYBA 2WZPA 3BVDB 4L9LC 4K7PX 4MQXC 4M43H 4QRRA 4M7ZB 1NM9A 2XG5B 3AXLB 1FO0H 2QSTA 1AQDB 1K8IA 2X3BA 4U0RC 3VD7A 2BFVH 3QH3B 3MA9L 1TFHA 4XP5L 2FQEA 1FIEA 4NO2B 2RR3A 5JUEH 3DDGA 1P5VB 1PJ9A 3GNMH 1FC2D 3WY4A 1CLYL 2RBLA 3ARWA 1QR4A 2BMKB 4CMHB 4DEPB 3OKMB 3O3BB 5IVOA 5LUMA 5J89A 2VDNL 5JLZA 3ULUL 2CO4A 1QLEB 2EDQA 4IRSA 4Z5RB 3SYOA 5C09A 4A66A 4HPOH 1UM4H 5L2JA 2F7PA 5HDLA 3X11A 4BRVA 5E99H 3ISRA 4WY7L 5KOMC 3C6LC 1HDMA 1WYJA 2Z0UA 2ZUUA 5AG8A 1QW9A 3K4DA 2WYIA 4N8UA 2P9RA 2F5AL 4PJBE 1ADQL 3H56A 3LXCA 3RVWC 1JRHH 5LDUA 1QEWA 3DROA 4R7DB 2EEBA 3MGAA 5JLZB 3DO4A 3MN8A 1NQBA 3GZOA 2ZYIA 4FXTA 5C09B 5DF0A 4WHTA 1QYGL 3QUGA 3ZIYA 4QXTA 1UWEH 5L2JB 1BMZA 1M4KA 1YN6B 4OKVB 1QBLL 2CBOA 5B1JC 3IXAA 2XTSA 2G2PA 4EVNA 1WGOA 2NW3A 4CVXA 5KEZA 4IEFA 5KVEE 5D96B 2Z0BA 2B08A 4ODXA 1HDMB 4EIUA 1CT8A 1QO3A 1AYRA 3A67L 1CF1A 3H3PH 1QUNA 2HRLA 1S46A 4X9BA 1R75A 2Q7NA 3IXTA 1I9JL 5SX4H 4NKOB 2IDFA 3Q6FB 3L3KA 3K4ZA 3P9LA 5BZWA 2PABA 3ECQA 4JFPA 3QR2A 1QEWB 3DROB 4QHUB 4HAKA 4QRPB 5DJCB 2ZCKH 5CLWA 4KZDL 4I0PD 2X2YA 3S4SA 1XL6A 1PW3A 3MUZ1 2IDUA 3WL9B 4DGIL 5K9OA 2HSIA 4WHTB 1V3JA 1CWVA 1BBDL 2CU9A 4P5TA 4R90L 4X9HA 1E4XI 2RTTA 5IEHA 1L7TL 2R2CA 2WZ6A 4ZD3L 4AEIL 1RZFH 2NW3B 2BWIA 2X4RA 4IEFB 4CVXB 1KYUA 1B9ZA 4ODXB 5C0IB 5HVFB 1CT8B 1QO3B 1CU4H 3CFCH 5CINL 3V4VB 1ZT1A 4XMLL 1C12A 5F72S 5KVDL 5I1LA 4G8EA 4UZUA 4OLZH 2R0ZH 5CSGA 4KKRA 3KWTA 1MDAA 3L3KB 4K9EH 1J10A 3O0RL 3P9LB 4PJEF 5BZWB 5SWZA 4JFPB 4EQ3A 5F9WC 2PN5A 2Y69B 1JZEA 3DRTB 4FMVA 2CH8A 3DX1A 4KX9A 3N40F 4I0PC 1OEZW 5GPRA 2NSXA 3S4SB 3MLSH 3ZKXC 4OIFA 3Q2CA 5K9OB 5DUBB 1WFNA 3RVUC 4OCXH 4XXDA 2J6EA 2Z35B 1H15A 5IEHB 3U9WA 5GSRA 2IDTA 1NCOA 1SFDA 2X4RB 1NANI 3QDME 2V2WA 5IVXF 1EIBA 4LHUB 1QLRA 4CKVX 4JFQB 1ZT1B 5I1LB 3DI3B 3S8FB 4NDMA 2FWSA 4K7FA 4WEBH 1YEGL 4PD4J 5ILTH 5KVFH 5TE4H 1JUFA 2A4EA 5SWZB 3PAUA 4KK5D 4XVUD 3SPCA 5C0BB 1JV2A 2GJ6D 3MUY1 4LIQE 4NWTH 2XU9A 3HPJA 5I5RA 3MLVH 4NC1E 3FQXB 1W0WA 4IRZA 1FNLA 2CJUL 1H15B 3MNWA 3NJMA 5GSRB 4CKQA 1PPIA 2YS4A 2ITCA 1M1SA 1BVKB 1DUYA 1CFVH 3JTTA 2JJWA 3I3BA 4X6CF 4ZFGL 2WJ7A 2WBJB 2C4FT 2UZIL 2WAHA 1QLRB 2QGCA 4YDJA 2KLTA 4MDRA 2DQHL 4FP8L 1ZV5A 2E9BA 5E4OA 4NDMB 2FT6A 3DVNB 1I4FA 2WOYA 4K7FB 1WZMA 5JHDE 1JGVL 3SE4C 3L9RA 3UTSE 3WO3B 4PRNA 3U7WL 2R56L 5KAQG 2AEQL 2V5RA 4XP4L 1JUFB 2HRPH 3LKRB 4LP8A 4QRFA 4TSAH 4JFWA 4UU9A 3LDBC 1JV2B 2VABA 5CWSA 4HKBB 1TYJA 3ZUNC 1KJ3H 3HPJB 2WXOA 2OMTA 3KGTA 1W0WB 5AOMA 3MNWB 5F97E 2YGQA 4WFED 3T65A 2ITCB 5I9QB 1DUYB 3FUKA 3ETBF 3ZJAA 1B88A 4QXWA 1N0XL 4D7PA 3B6SB 4E41A 2GTQA 3Q7JA 4HIXL 4FFYA 4P9HC 4FNQA 4Z77B 3O6KH 4AJYV 5C0GB 5MERA 4GRWE 3FQWB 2J25A 4OB5H 4ONOA 1I4FB 4OCWL 1DBAL 1GSKA 1BFVL 4PRNB 1JNHB 2WB7A 3FCTA 3HZVA 4U4BA 4UU9B 2QADD 3GMRB 2ADJA 3V0WL 2VABB 1P53A 4X6EA 4RH4A 4FZ8L 3H7LA 2OMTB 3BPLC 3SDAD 4MTMA 4I9WD 2GK0A 3DOHA 2J44A 5E6ID 4PWGA 3W56A 3T65B 9PCYA 3JTSB 4O58H 1ZA6A 1HSBA 3PJLA 4YHKL 4E41B 4M5ZL 1IM9D 3O8XD 2YPVA 1WTGT 3AS2A 4X6FA 5T1KD 4EUPH 1E8XA 3E2HB 4U3CA 4M7LH 4KXAA 4N0YL 5E08L 2B4CL 3IK2A 1E3ZA 3QCUH 3ARRA 2KBGA 3QDGD 1JV5A 1KN4H 2ADJB 1SY6H 4BGDA 3LEVL 3FU5A 2X1QA 5DRZA 4J3OH 3M17A 5JIPA 3WHE1 4PGJA 1SXSA 4G7YL 2X4QA 3MKGA 3VFOA 4Y16B 1WGVA 4XPAL 2ZWLT 5E6IC 3PQYA 5HGGS 1MAKA 2VSCA 25C8L 3ISWA 3RVVD 4W4OA 1ZA6B 1QFHA 3RX8A 3O8XC 1TSHA 5DEGA 1HH9A 5IK3A 2ICWI 4ODTL 5D1ZC 5F2FA 3WKML 2VLKE 2VH5L 1NCGA 5EUOF 4PY8J 5IB2A 2QKIC 4PB9H 3KYMB 4EDWL 1UTDA 4R83A 1ZE3C 1JV5B 3HB3C 3FFDA 2LVCA 2NOYA 4ZFOA 4KQ3L 5G55A 1NC2A 5DRZB 3M17B 2NXYC 2YMTA 4LBAA 2AMGA 3VFOB 5DJYB 5D4JA 2HFFB 2IDQA 1XCWA 4BWUA 4LLDA 2Y7NA 3PQYB 2BNUA 2X9XA 1J8HD 3TA3D 4ALAC 4AVIA 1FZJB 4YE4L 1N5YH 2O6PA 2OR9H 1MRFH 5BMFL 2X89D 4MS6A 1PY4A 2Z7UA 2MQCA 5DEGB 1HH9B 5IK3B 2WWKO 3GDBA 1FO0A 1LD9A 5KBLA 5IB2B 2F54E 3LQZA 3L4TA 5LKNA 4IOFC 1E2WA 4PI2A 3TZVD 3T2NH 4MCMA 1EQWA 4LLQA 3WG7B 3C2AH 4OZHF 4HJUA 4PGBA 1A9VA 1NC2B 1KULA 4QR7A 4K73A 1YQVH 4X7FC 1MI5D 4KROB 3FB6A 2VMDA 3ZZLA 1IC4H 1Z32X 2DN7A 4WVRA 4EUPG 2YZ8A 4OD3H 4LLDB 4PJCF 2YD0A 3Q3GB 2BNUB 3ARDC 4RDBA 4CSPA 4UOZA 3H9SE 1DBKL 2NNAA 2NR6A 4LOEA 4QRAA 1GY1A 4M6OH 2G9HA 1FO0B 2I69A 1LD9B 2EZ0D 3X3GH 3ZQXA 5BS0E 1CCZA 3KYOA 5I0VA 4N6QA 1OSPL 4YPGA 2C4FU 1E5CA 4EXPX 4J3OG 3KM2A 3Q5OA 2QSCL 3GM0A 4C54A 5B21A 4LDOB 1NEZG 1YECH 1NWOA 4LLQB 2X2HA 3RFZA 4HX1A 2VR5A 1AANA 2NY2D 3DX4A 4AX3A 2GIMA 2VXSL 4YIQB 3VMOA 2ZAHA 4ZO6A 2P42B 3FB6B 1THCA 4G9FB 2W0KA 4FQCL 1PLCA 4MMYA 2CHDA 2BJMH 2DBLL 2WXMA 5KJRH 3DX9A 4TUJA 1AS6A 4F9LC 2WTRB 2BVYA 3VD2A 2G9HB 3HC3H 3KYOB 3N42B 4YPGB 4LESA 5LAPA 2I9LA 1NUDA 1JDCA 4YK4B 1K4CB 3DNKA 3MJ9A 4HIEB 5E4AA 3GBDA 2V5YA 1XGPB 5DHEA 4IHOA 3FQRA 4A2LA 4MGXA 3UIZA 4HX1B 5C2UB 3NCYP 4YL9A 1TJGH 5HSFA 3RFZB 3IGFA 4CDGC 4MAYC 5E03A 4NCDA 5B38G 5J6GB 1H3PH 1MJUH 1B0RA 5E00A 3A21A 3SPVA 1ADWA 1UM6L 2GJPA 2XZCL 2P48B 4KV5E 1CE1L 2P47B 5MENE 4JREB 2WO4A 2VDQH 4H0GA 4OJFL 1ZS8A 3TTSA 3IDMA 1XSOA 3DX9B 1TG8A 5TF0A 1QW8A 4TUJB 4U2ZA 5B7EA 4NKMA 2Q3ZA 1UA6L 1NM4A 2N7BA 3EGDA 3W5NA 2Y7QA 2UX7A 3ASOB 3CSFA 3NMEA 4FQLL 4CSSA 1XGRA 3SQRA 2ZCHH 2F08A 4G6FB 4RFOL 5FOBA 2I9LB 3VTAA 2MH4A 5IGXH 2P26A 5L8KB 3GSNB 4N8PA 5DURD 4IHOB 3FQRB 2FR4B 4FFWD 3MRPA 1KIQA 2KPWA 4WI9A 1YMHA 5D7IB 1JZ8A 3KPRE 4AGMA 5FX3A 3FW6A 3N40P 1J11A 1B0RB 3VUAA 3ZMRA 2ORBH 2DYSB 4MCYA 3SOBH 3W9EA 5FYJH 3RHWF 1ZS8B 3MZGB 4MJ6A 3IDMB 4UNIA 5FLVA 3Q8BA 3GT6A 1QTSA 4NKMB 4XPBL 4XZ4A 5I26A 3CX5K 2A9CA 1I9IH 1OAKH 3EGDB 2Y7QB 4R96B 3HNSH 1H5BB 4NERA 3KHQA 2VAAA 1XGRB 1P69B 3TJEL 1MH5A 5FOBB 2G5BA 3QR0A 5CD5D 1QFWL 5D2LA 3OGOE 3ECBB 4Z6AT 4E9WA 4LCVA 4XPGH 1SYSA 2WQUA 4WDIA 4PBWD 2ZUQC 3CZKA 2EH7H 4JDTL 1GOFA 1IC5L 2Q10A 4PVMA 3WNPA 3MRPB 1KIQB 1YMHB 4TVUA 2X1PA 3QUML 2YJQA 1HZKA 4HJEA 3STZB 3VXSA 1VACA 3TWCL 5IFHL 4MCYB 3MXVL 4QRRE 4TOYL 1I31A 3W9EB 3F8UB 3I2CL 3WKQA 3HRPA 4I3GA 4G1EA 4MNQA 3L6FA 3CQQA 2QPFA 3FUMA 1P84K 2VAAB 4DN4L 3WI9A 5CM1A 3II1A 4QWWC 1ITCA 4OGXL 1TVBA 1IVTA 5D7HA 1IGJA 3ESVF 5AWNH 1SYSB 1A0QL 4WDIB 4DP1X 5E8EA 1UEMA 2DJSA 1NGPL 1INEH 3ZBMA 4C4KT 1E4XH 3IMUA 5C09E 1GYUA 5K1NA 3VXSB 1P9MA 1KPRA 1VACB 3D6GA 3L4XA 3NIDE 4JRYD 4NZDA 4YDZA 1FE8H 1UASA 1XF4A 3L6FB 3SGKA 4YAQA 5AL8A 3RE0A 3OF6D 4J1UA 1AYOA 5GGTL 3GSXA 3H55A 4GRLB 1G0XA 5T1DH 2G2RB 2AFNA 3LS5L 4Y2OA 1IGJB 4LRNH 4XB7A 4C56A 3QCVH 3VRIA 2HKHL 4MXWH 2WNWA 5EEZA 3WJJC 3E1ZA 3HBQA 4K3DL 1ML0A 1KPRB 5HHNA 2F7IA 2NY3B 1UVQA 1NANH 4HALA 5CJQL 5A16A 3WTVA 1FLRL 4MB4A 3B8YA 1YJDC 5D1QD 1XF4B 4Y9EA 4F80A 4YAQB 4MD5A 2R0WL 3LN5A 4J1UB 3ARFC 2WPGA 4KNQA 3GSXB 4NAMA 2JKWA 4X4KA 5D72L 4MFHA 4HJTA 3OC5A 4EUPA 5CZKA 1NBZB 1EBAA 1F86A 3FN3A 3LB6C 2J43A 5F96H 5HYJA 1LEGA 4HMEA 3VRIB 3D0VA 2CDFA 5TQ0L 1X9LA 4L4VB 4MXQD 4OTXH 3HJ0A 3AG2B 4JQXC 4DEWA 3ZL4L 1HWGB 1V8HA 4N24A 1MCIA 3TBCA 5BOZG 1Q72L 1FZKB 1AXIB 5C9JB 4XB3A 4H88L 3FT3A 5GS1A 5A16B 4JPVL 1KPVA 4HA1A 3F12A 1ETZA 3ARPA 1NEZA 3CVBA 3NEOA 3BQVA 4KKPA 3QG6A 4HXAH 4P5RA 4MD5B 4P2RD 3NH7H 4AMKH 4PGDA 2AI0L 4E9TA 2DLFH 1RFDL 1KG0A 4PCKA 2W0LA 4WWKD 1YSOA 2E59A 4EUPB 1PL3A 5HYJB 3D9AL 3Q06A 1HHKA 3D0VB 5SWZE 2CDFB 1RIHL 3LPOA 4R7LA 1SJXA 4MXQC 5C0BE 3MFGB 4Y19D 1T5XA 4NZTL 2VDMB 3H0TA 1EXUA 4FYSA 4EMZA 3FT3B 5GS1B 2YBGA 1KPVB 3LPWA 5D93B 1O7DC 4BKSC 1SZNA 1RUMH 4R6UA 4UQ3A 2H1PL 1EFXA 5B38A 3WNOA 4PPTA 4WWKC 1KG0B 2R0KL 2N59A 5HI4D 1C5CH 2V33A 3L1GA 3L5WA 4X6DF 2DM7A 2WWOA 2WLYA 2ZWYA 4QLRA 1HILA 4G6AC 1N64L 4J8QA 1KJ2H 4P04A 2HJKA 4L2LA 4YLQT 1GYVA 3QUZD 4WWID 4YLBA 5I0ZA 1I8MB 3QW9A 3NSFA 2CA3A 4PTUA 4S1SL 1KPUA 1HYRC 3H0TB 3HLAA 3DKHA 1Z3RA 5C08A 3CVDA 5I71C 2DY2A 1A02N 1DO5A 1BF2A 4TN9A 1WLHA 4UQ3B 1EFXB 4IMLB 1HQ4A 4HCRA 4JN2A 3VA2C 1EGJH 5B38B 3UTTA 3QVAA 4JRXA 3HCVB 1YEEH 3L5WB 2ICEA 2UXVA 5GJSL 4HH8A 1HILB 3FTZA 3TCXA 4GKZA 1QSED 3AXHA 3V7AE 5CMAB 5GHWL 4JFOA 3TIEA 1YEDA 3EOBA 4MA1C 4NFDA 4OGAC 4LLAA 1JF1A 4MA8L 1J1OL 2RA1A 3FQTA 1OV8A 5ISZA 3S9DB 2I07A 4IU2A 4QXUL 1KPUB 3HLAB 5ABAA 1YY9D 3UX9B 1CBJA 4B5ZA 4YX2H 4XNDA 5JW4M 3ZHDA 3JV6A 1MN4A 2VM3A 2JKTM 3DYMA 1QFUH 2ZOKA 4E41E 1UOVA 3TFKC 3FT4A 4JN2B 5AVRB 1FFPA 1G9HA 2DEXX 3UTTB 2R23A 4JRXB 1PKQB 1UD4A 2EXWD 4Z7NF 5E5RB 1J8SA 2EUXA 3ARGA 5I28A 2ICEB 4KX8A 3MBEA 2FYYA 4GKZB 2LU3A 5DWPA 3RX5A 3V55A 5IQ7L 3SDCC 4BFRA 1W16A 3TIEB 4YBLB 3MZTA 1EHKB 1YEDB 1SXCA 3EOBB 3KPSA 1JF1B 3O2VL 1EDYA 1QHOA 3FQTB 2RD0A 3FBQA 3NJIA 5ISZB 2XWTB 4KY1L 3S48A 5C71A 1YY9C 2CIKA 2YRLA 2Y7LA 4KMQA 4TTDC 5I1KL 5I8OL 1Q9KB 2BX5A 3JV6B 2JV6A 5BO1H 1A3LH 1DQDL 5C0RH 5D7JC 2FRGP 2ADYA 3FT4B 2FVNA 5CU5A 3RKDD 3ZKSD 3IN2A 1BZQK 2R4SL 3NK4A 5A2AA 1FFPB 1I1YA 1CXIA 2R23B 3MGTA 3ARGB 4NQDA 4XNBA 3MBEB 1B4TA 2CRMA 2FYYB 3AXIA 2OYPA 4LPUA 3WMQA 5I18H 1UFUA 3V6ZA 5FYKL 4NUQA 3A47A 4AQOA 1TJHL 5KW9L 4GIAA 3KPSB 3A0OA 4DKDC 5DJZA 5AW9B 4ANKA 3L3GA 5T5NF 4KDWA 4EKJA 1MIEL 1N5AA 3LN9A 4B60A 1BSIA 1JJUA 5I2IB 3PQYE 2MCAA 3CV5A 4KFMA 1Z3GL 2E76C 1BYPA 4HHGA 2V17L 4MSWB 1XTMA 4UQBA 1IZJA 3QORA 5HJDA 1IBFA 3G9AB 2X4OA 2XWCA 4X80H 1PG7W 2UUDK 4OI7A 2Q9OA 4TVPL 1FAIL 1OGSA 3MGTB 4ZMXA 4NQDB 4ZZFA 4LSTH 5CAYB 2X3AA 1KYAA 3V6ZB 2EIJB 3QNZA 5KG9A 1N18A 5C2BH 3FOMA 4OR1A 3II3A 2IV9A 5DJZB 5I17B 2HZHA 5F7LB 1JGIA 2OP4L 2IAAC 3GBML 3UADA 3QJTB 4JUTA 4U49A 4F91B 3LQAL 4O2FB 5KVEL 2ZUXA 2D7QA 2OW6A 3N43B 2DWYA 2NDGA 3BSZH 3QORB 4GAYA 4K3JL 3ULUF 3T8XA 1OTUD 3ZPDA 1U8NA 2HLFD 2X4OB 2IV8A 2A6JA 5CZXD 1OLLA 4ILDA 2X4SA 3H85A 3WGUB 1X5XA 1ZT7B 4KQ4H 1YEKH 2PR9A 3CK0H 2WXRA 4HSAC 1JDAA 2NUPB 1J87A 3DOSB 4FJZA 4OCSL 2FD6H 4PJ7A 3MA7A 4F7PA 1RZQA 3QNZB 3U9PH 4Y4FA 5C9KA 5KG9B 2FWUA 2JI2A 4Q6IC 1IAII 5JPNA 2JJTA 3QWOA 2GFBA 2LTQB 5KUKA 2GSMB 3NRPA 5BZXA 4YEFA 4WENB 4YDIH 4WUUD 4B3VA 2DQDH 1JXKA 4AQ8C 5TQ2H 3QIBC 5E2UH 1T6WA 4ZPTA 5BXFA 3GMLA 3IN0A 1OGPA 1U8IA 2B0SH 2R1WB 4GAYB 4J3VA 2KYIA 4LSDA 3S37X 3LAFA 3T8XB 5BVPL 5JMOC 1T22A 1MFDL 1U8NB 2HLFC 4L0PB 1QKZL 2A6JB 1MREH 3HRZC 2X4SB 3S35L 3SIKA 1AC0A 1U92A 5CUSL 2X2IA 1H9VA 4PJ7B 3PWPA 3S5ZA 1MFBL 1MQKL 1Z0MA 2HJFA 3MA7B 4HHAA 4JHUA 4F7PB 1H6TA 4Y4FB 1AE6L 1N12A 5AD0A 1VFMA 5DDHA 5JPNB 2PPCA 4OZIF 3KWVA 4TSBH 2GFBB 3NSXA 4FI6A 4H44C 2JKNA 5C0FA 1C8QA 2Z65C 3F3HA 4L1TA 4ZPTB 3A4FA 3CX2A 5BXFB 3OB8A 2Z3FA 1U8IB 3ARBD 3THMH 2CGZA 3BVXA 1XR9A 5EOCH 4Y7OC 4Y5VB 3QGVA 3TGXA 1T22B 4HKJA 1T7VA 2R15A 3ZTNL 2QTEA 4XO9A 1AFVH 1Y1UA 1JOIA 3GTNA 1CGSH 5H37H 2C1OB 1U3HA 3PNRB 5AOLA 4DN3H 2PCFA 1QD0A 3ZDXF 3PWPB 1YEJL 2HJFB 4HHAB 3TNNA 1NIBA 4FTDA 4J4PD 5AD0B 1AP2A 4JM2F 5DDHB 2WUCL 2AJSH 5FA3A 4TQHA 3ISYA 4QGYA 5C0FB 2YD1A 1FCGA 5FC9A 2GTZA 1E5UI 1LK3L 4KDVA 4Z78A 4XO8A 5BUAA 1CZ8L 1N68A 1ZTXL 3ARBC 3B2DC 1IJNA 4WWPA 1XR9B 4FXKC 2JMRA 4HKJB 4TPRL 3SKMA 1NOFA 1U3NA 3HBPA 4ZW6A 3VFGL 5C0AD 3X1EA 5F9DC 4UT9L 1JZJA 1YNKL 1U3HB 1BZ9A 4F92B 5CR8A 1VGKB 1V5JA 1QZ1A 4PN6A 3S36X 5IR1B 2JB6A 2VN5A 1S6NA 3NQKA 4J4PC 4KI5E 4NN6C 1NUGA 3ULVL 3HE7A 1GGCL 5JYMA 5FWQA 1CMOA 4U1IA 4YXHL 4J2XA 3P0YH 3CZUB 2C34A 2GTZB 3D12B 4Z78B 2AQ2A 4KO6A 3IKKA 1NAKH 2WGXA 4AUJA 3T3PB 1T80A 5IB1A 3R8QA 3SKMB 1EJOL 2CKBH 2YUXA 2VN7A 4IJ3C 3ILQD 1O75A 5D2LE 1NOAA 1BZ9B 1JGEA 1U2CA 1MFEL 5EUKA 2Z93B 4LCWA 3M8OL 1EJ6A 2JB6B 3D4ZA 3HZ3A 2QSQA 3AY4A 2AV7B 3CG8A 3JSSA 5KVFE 3O9WD 2VWEC 2WMPA 1MCOH 4P4RA 3VXSE 4OGYH 4GG6A 3WIHL 2HH0H 5CEZD 2MPVA 3ZHNA 5GISH 1HS6A 4W4NA 1TNMA 3RWIA 3ABLB 4JFXB 4MNQE 1JZFA 1BYNA 3UMTA 2IH9A 4YN3A 5H37G 1O9VA 4ZUTA 5D2NC 1RURH 4ODHL 5IB1B 2CA4A 1HK6A 1F1DA 3T8MA 3RNQA 2P5EA 1MCFA 3B37A 3BO8A 3EJQA 3VWJA 2B2XH 2IAMB 1O7SA 2GBTA 3TVMC 4I9XA 2BIHA 3ILQC 2DM3A 3WOVA 2R2BA 2A9NH 3BKMH 5E70A 1JGEB 5AB0A 2AVGA 4MDJB 1S7QA 1B2YA 2DQ6A 2WIIB 2ZUVA 1OF2B 3DA0A 2Q76B 3BFWA 5D1ZI 4B97A 5DVNA 2E27H 3O9WC 2WMPB 4P4RB 2NZ1A 1DQML 1L0PA 1BDYA 1YA5A 4GG6B 5E4IA 2GBVA 4PY8I 2J88H 1MWAH 4P3CH 4PHZA 2L7UA 4N1HB 2NQ3A 1KLGA 3RWIB 2EINB 1M7UA 5HGHA 4ZUTB 2VXTL 4OFIA 3F62A 1OM3H 2I7OA 4PJHA 3RNQB 2ZXCA 3LSOA 2P5EB 4GQ9H 4M6MH 3LIZL 1MVFA 2R2BB 4RFNB 4J12A 4C56E 4MKTA 3UOAB 1OD7A 4BEIA 5E6YA 3QHZH 5IBTL 2JQMA 2X6BA 4KNTA 3UPAA 3KDMB 5FHAL 3INUL 4GOSA 3SYAA 3QARA 3AJ7A 4GSXA 1RZ7H 1KLGB 2UZXA 2D3VA 1QSFD 5HGHB 3JWNH 3N9GH 3MUHL 1EX0A 2BSDA 1KTLB 4MHHG 2DLTA 3LSOB 5TPWH 2IAND 1CXKA 4GSRA 5GS0H 5HXMA 4J8RA 4WRLA 5HYJE 4B41A 1O6VA 3IM1A 3KJ6L 4TF4A 3EFDL 5FPIA 1DZ0A 4Y4HA 2P7TB 1YC8A 2E75C 4EOWL 1GIGL 4WJ5B 5I1IH 4J39A 1LP9F 3X13B 5C0CD 1A1NA 1OP3K 3CFNA 5JZ7D 1IC7L 3N5AA 3GB7A 1ACCA 3CFJA 2I60L 3EJYC 4G1MB 1IT9H 4TS6A 3C6EA 3BUYA 2UZXB 2PPAA 1ED3A 2DWDA 1MAJA 2QFPA 4PGCA 3BPOB 2ICES 4Y2DC 4ZMYA 4ZX4A 1NBYB 1UM5L 5J9PA 4LOFA 2E4TA 5BV7H 4GQZA 3FSZA 2VXQL 4HC1H 1WFOA 4J8RB 5JOPE 4JZNA 1U3YA 3SY6A 3ZGHA 2AJ3A 2NNXA 1H3XA 3ABZA 3MNVA 4M6AA 4CW1A 3EZJB 3RTQC 5FO8A 5ICZA 1OY3B 1QFPA 3RDTC 2J6WA 1UENA 2Y36L 1HXMA 4M4PA 5AG9A 3BUYB 4E5XB 1RZGB 4L3EA 3GBNL 4KVCH 5F7HA 1ED3B 1L6XA 1RPKA 2DWDB 2F1AA 3KS0H 1WIPA 3UEQA 1ROWA 5LXVA 4F8LA 4PWJA 2EUVA 2LLLA 1RK7A 4OY9A 5JQ6L 4BYHA 4JFSA 3BSZA 2B9AA 4N22A 3QXWA 4JZNB 3VYNA 2AJ3B 3IT8D 3RFRA 1KEMH 3X1NA 3NAAL 1QI5A 5EOQH 2DJMA 2J5LC 2F8VA 2D0FA 5FO8B 5ICZB 4LNRB 3RUGF 3FB5B 5ALBL 5C08E 2KZWA 3VYPA 1PG7H 1EEYA 4KX7A 4TRPH 1CFQA 3DTXB 3L3HA 4WHYH 4JANA 4L3EB 2E47A 5EBWA 1RULL 2VC2L 3BE1L 4NWUL 4X83A 4EN3B 1THAA 4G6KH 1D6VL 2NXZD 2CBQA 5TF1H 2XICA 3UTTE 5LWYL 4JRXE 1EUTA 3IU3B 3FUJA 4J3SA 4F2FA 3DMMC 3U36B 2P43B 3ZDYF 4RIRA 2VDOH 5HJGA 1F58L 2C1PA 2OCJA 1SM3L 1DLFL 4NBZB 2AJVH 3MRMB 4LF3A 4JFHE 5HYSG 2DWEB 3UABA 5FYLH 3HBGA 5FM8A 5ISZE 4NP9A 3WJMA 4OLWH 1JWUA 4D0CA 4UQIM 2E0PA 2NTFA 3IJ7A 3L3HB 3LCYA 4JANB 5AW7B 5EBWB 2RGSA 3O4OB 4PW4A 4U6XA 4XAKE 3QPXH 4ZQTA 3JVGA 1EMTH 4F7EA 4DH2A 2GHWB 3A23A 2NXZC 1Y0LA 4Q14A 4OKDA 4UINH 3U1PA 2CK0L 4OSUL 4Z7OE 5AW4B 3WMPA 3M07A 1XD1A 4RIRB 5F93C 3T1FA 3MUGB 5D7LA 1ONQB 2C1PB 1QPXA 2JH2A 1JGUL 4G42A 3V4UL 1FNFA 4XNZC 1N59A 1L4IA 2OSWA 1IX2A 5H37A 3MLPA 3KPSE 4LF3B 1QLEL 2XY2A 1KCVL 3DTDA 1EH9A 3PPSA 4OCYH 4NO3A 1AZVA 2FJGB 5E1HB 1A64A 2ZPKH 1GZPA 3D69A 1A6AA 4FXGA 3UPRA 2DDQH 2NTFB 1CQYA 1XGUA 3TF7C 3L1FA 1RLWA 2BZCA 1PS3A 4U6XB 1KV7A 1L9NA 1TZGL 2X44D 4H8WC 4YSAA 1A7RL 5EDXA 3HE6A 2DQJL 1D9KA 1PLGL 2EH8H 1VA9A 3BD3A 4OF7A 3L7EA 3MLZL 3QWRD 4NQDE 3W81A 5D7LB 1IAIH 2ITDB 4OQTL 4G42B 5AVSB 3DJ9A 1EPFA 2QHLA 5CKGA 4WHYG 3ZSSA 5LBSH 4NO3B 1I7RA 3HZMA 1HKFA 2E7CA 1SLXA 1NH6A 2YUZA 4LVEA 2VR6A 3D69B 1A6AB 2YGOA 2WW8A 5AALA 4FXGB 1CD1A 3UPRB 3FBKA 1XGUB 3BVNB 1PZSA 4YHYC 4Y4KD 3RLSA 1U8CB 1HCFX 2AAVA 4Y5YB 2ZT9C 2N01B 3W39B 1ACYL 5EORL 4Y9BA 1FV1B 4P23C 4QRSA 3HE6B 5L2KA 4M8UA 1HHIA 1D9KB 2Y07H 2VZSA 3BMVA 2DLHA 3EO0A 3WNLA 3L7EB 1XWVA 1MFVA 1OT2A 2WKLA 4D9RE 2WNKA 4Z7WA 1LO4L 2H7WA 4DQOL 4AYBA 1P7QA 3R7RA 3X1GA 3QPQD 1T2XA 5FGBC 5FCSH 3UAAA 3FFCA 1I7RB 3KW8A 1NDGB 4H1LG 2AK4A 1NCDL 1CD1B 2F19H 4FHKA 4OLXL 2DICA 1E0OB 3LH2L 1KYOJ 1Q1JL 4ZTOL 3J07A 1OSEA 4ABQA 3V4VL 1QNZL 2OYKA 3TBBA 1NCCH 2PP9A 5L2KB 4XNQB 1DR9A 1HHIB 3BKJH 3GTTA 2V2TA 3FRUB 4BK5C 3EO0B 3DETD 4JG1H 1DVYA 3DSNA 1N8ZA 4PJ7E 5KSUA 3V9CA 4AK1A 4Z7WB 5GXBB 1AQHA 1GXEA 1TZOA 4NJAH 1P7QB 2LV4A 1G6RA 2DQTL 2MCMA 1CLOL 2EEFA 4CBZA 3TYGL 5BO0D 3IDXL 4RESB 2DMGA 3VNZA 3IFLL 3SCMC 3INOA 1DN0B 2AK4B 2EO9A 4LDLB 2DW5A 2DD8L 4OAWA 3VSVA 3QQ3A 5DJXA 2FLBT 2QPDB 4HWNA 4KRMB 1DCLA 4IMKA 1MWAA 2B1HH 4QHKJ 4PJEA 3IF1A 1GL4B 2DKSA 2MEJB 4X0NA 4I48A 4AL8C 2ATKA 4KH9A 1Q38A 2V2TB 3D52A 4XVSL 4DO6A 2G0KA 5GZND 4APQC 1E6OL 1WK0A 2Q7YA 1FPTH 1N8ZB 5KSUB 1F11A 2PR4H 3PWPE 4P9HH 4BCXA 1OLZA 4AYID 2C9RA 2AGJL 4PLKC 1G6RB 1LEKA 5ADOL 5D5MF 3H6JA 2CLRA 1DQQB 3MLXL 3CH8A 2EDTA 2PPEA 2J6EL 5F7DA 2J72A 4W9JC 4OAWB 1G7JA 5DJXB 2NY5H 1EV2E 4PJFF 1MWAB 1FG9C 2HKAA 3CLEL 1R1CA 5DK3A 3ZR6A 3U7YH 4KDTC 3IF1B 4PJEB 2ATKB 2V9RA 2WQXA 3MLUH 5HI5C 2XBDA 4MB3A 2AQQA 3VWKD 5KYXA 2CHZA 4Q9BA 2Q7YB 1ZLWH 1F11B 4PJ8D 1L5GB 5EF0A 4P2OA 2KL6A 5AYUL 2A3TA 2P8LB 5CGTA 1YZZA 4ZMPA 1IQWL 1FSKB 1O6SA 2CLRB 4X6CA 5IVXB 4LSUH 1S3KH 3G6AA 3BWAA 4URTB 3O3AB 4WW2F 2XWEA 1KZYA 4PUBL 2PTTA 4DFIA 2H3NA 3ARUA 3FN9A 2GTWB 2PO6A 3T3PE 4OW6A 4R3SA 1WH0A 5I1JH 3QIWB 1JGLL 1JTTA 4BD4A 5HYSA 3JT2A 4DUXA 4OBSA 1NGZB 1VZGA 32C2A 1IGYA 2E9GA 1I3VA 3JWOL 1PZ2A 5CKAA 5KYXB 3WFDL 4DPAX 1S5IL 2ZXWB 3ARED 1JYXA 4P2OB 4K2UL 3SDYL 1A6UH 1XH0A 7FABL 3VD9A 3QUXB 4DP8X 4FTVA 5GZOA 2TRHA 3HG3A 5EF2A 5DR5L 4LFHG 1WICA 3S2AA 1O6SB 1UKTA 2OZ4A 1ZE3H 4X6CB 3PV7A 4NHUA 1DLHA 3RIFK 3K71A 1J0JA 2QL1A 5F0LB 3U6XS 5BUPA 3FU6A 3BWAB 1J9RA 4K23L 5ADPH 1IC1A 1WFIA 4YFLI 2XN9B 2H3NB 1TZAA 4JHBA 2PO6B 3QEQA 4UAOC 5FA4A 1PEWA 4R3SB 4EPSA 5FF6A 2IH3A 2VDRB 4MJIA 5HYSB 2OA9A 4OVUA 2D4FA 4PRHD 4ALAH 4L0YA 4DZ8A 3BYTA 6CGTA 4L9LA 1J1XL 5D7KD 4FQXA 3VXUD 1D5IL 3CFQA 1ZWIA 3GSQA 2CHNA 3APDA 1HYSD 4QNPE 4OM0L 3K46A 4LCWE 4YDNA 4BFNA 5C97A 1DJYA 1RZKC 2ERJB 3O6FA 4FTVB 1MF2L 2K78A 1JWMA 4QXGL 4G59C 4LSQL 3KWUA 1BZDA 4GG6E 1ZK5A 2XXMB 1TYEB 4NHUB 1S9XA 2IPUG 1DLHB 4RDQF 3K71B 1R5WA 2WNXA 2XTLA 3ROLB 1YUHA 4GXFA 4HXBH 5EO0B 4P0DA 3QEQB 5C86A 1J05A 3FNKA 5FA4B 1W8EA 3GSRB 1AHWB 2P5EE 4WI2A 4JPKH 2A74C 3O4LD 3QZWG 1B6UA 5I1HL 4DZ8B 2VQ1B 3ZHFA 4RMVA 4FQXB 1ZWIB 3CSPA 1U2YA 1OP4A 3ARQA 1HYSC 2DQUL 2XRAH 2K8MA 4TNWF 5JW3L 3S88H 5IQNA 3C6LA 3GHBH 1I3RA 3O6FB 1KZQA 1JWMB 1D7FA 1B0WA 3B9AA 3DYPA 3RWDA 5IJVA 1X4ZA 3AQYA 3O6LH 4DGYL 2ED6A 1S9XB 3UP1A 3RA7L 3PXLA 4P8QA 4PJDF 4F24A 3NPSC 3D4CA 1R5WB 2HG5A 3RIKA 2N3JA 4MYPA 4M1CD 1YUHB 3VQ1C 3MFFA 3K72A 3F58H 4PJHE 4JY6A 1PAZA 5B1CA 4E0RA 5EMYA 5MEOA 1S9YA 5I30H 2NSQA 4FFVD 2BCMA 5D6DA 4LCCC 4NT6A 2NZ9C 4H1LA 1TTAA 2QFRA 2N7AA 2NQCA 3EJPA 1A7OH 2DYRB 5CSZA 1I3RB 3REVA 4FNSA 3DX8A 5I19H 2JB5L 3RWDB 5IJVB 4JN1H 5HGDA 2BSSB 3GSUB 1XO8A 2AZUA 4UQ2B 1S7RB 3OZLA 1J5OL 2B39A 2IQ9L 1GZQA 4MLIA 1S4IA 5LBGA 1OGAD 5EUOB 1ZGLB 3MFFB 4DKFL 3K72B 2R1YB 4E0RB 4KKNA 1S9YB 3NEEA 3T2PA 2Y24A 4FGMA 4YSRA 4PU2A 4NT6B 2EILB 4H1LB 4JKKA 1Y6KR 3H2QA 1IGTA 2NY6D 5CSZB 4HWBA 3PE9A 4P57A 4G80A 4GMTH 4JBSA 5FUZL 1X7QA 3REVB 3SE3C 4KK6D 3DX8B 4RZCA 3B43A 5CJ8A 3GJFA 1RVFH 5HGDB 3HR5A 1JZ6A 1AXSB 4ELKA 4PJBF 1F02I 2KLRA 3FAXA 3CFKA 3MROA 5DQJA 2G2NA 3ZKND 5EU4B 1GZQB 1TQVA 2BSRA 4I3RH 5L6YH 5L88H 4QPEA 3U30C 4YSDA 2FNWA 3OAYK 4YHLH 3K0WA 2P4AB 4I0PA 5FCUH 4UUJB 4OZHB 1A4BA 4IOIA 2Y6SD 4ORZC 1UB6B 5IMLA 3RNKA 2ARJQ 3FO0L 5DRWA 3BWSA 1IGTB 3B1TA 3SKNA 1N19A 2JWYA 4P57B 4QJ4B 3OZ9H 3BRFA 1X7QB 4PJCB 3GJFB 3VFMA 3HR5B 5T3ZE 1L7IH 2V9TA 1OPOA 4ELKB 4XPFL 2Q2LA 4A63A 3CFKB 2J12B 3MROB 3BDYH 1NJ9A 3CIAA 4GPVA 5E8NA 1TJIL 4L3EE 1F4WL 5G2NA 3WUZA 5C0EA 4JMXA 2NCEA 3R8BB 3UG4A 4M62H 5CZVL 1G4MA 2NY4D 1PZ3A 1UUNA 2VZUA 3CVHA 3SKOB 4K7PH 1YEHL 4XN1A 3MR9A 2DQEH 2EXYC 1AZBA 4P3DA 4IOIB 3IGLA 3MJ9L 5LNEA 3M1BA 3M45A 5DEZA 4JAMA 3RNKB 5DRWB 2CLVB 5IMLB 3GSNL 1OCWH 4NRYA 5TDNA 5I8KH 3RDJA 4IYKA 2FZ3A 1I53A 5IBLD 4A2EA 5E5MA 1MJ8L 3OJVC 3CE1A 4ZTPH 3VFMB 5I76B 1CTNA 1HKLH 2NY7L 3HNVH 1NJ9B 4GAAA 5E8NB 5T1LD 5C0EB 5JQHC 1RUQL 2OQJA 3S97C 3BAEH 4K5LA 4PWIA 4AVKA 2BIIA 3ZYIA 1HFUA 1Z9MA 4UDTB 2NY4C 3X17A 2Z31D 3CVHB 4QHLB 4S10A 4BFBD 3RTLA 2GJZA 4LCIH 4K3EH 1T5WA 1JPGA 2HTKC 3NFSH 4P3DB 1XXDC 1ZLSH 4BFOA 1A5FH 2QV4A 4JAMB 1G7HA 4NRYB 3U48A 5TDNB 3QNXB 2N4IA 4F57H 3IAGC 2LAGB 4PIBA 2DQIL 4OZGF 3KPOA 2EICA 2LLNA 2CE6A 1JG9A 4KKLD 5HHXL 3CZJA 1YYCA 4WO0A 4UIMA 3D0AA 3PF2A 1I1AD 2NUTB 1MZZA 4DETA 4M1DH 2HT2D 1DQJA 1GJIA 3DO3A 1NL0L 3KBFA 2H6OA 4BQCA 4O4YH 5JW5A 2GJ6B 2PYFA 4GNKB 1KENH 2HFEA 4CUCA 1T5WB 1YJDH 3DK0A 1JPGB 2NZIA 2IOIA 4FFZL 4JQIH 3AITA 4H7VA 5D7LE 4WU7A 1JPEA 5C07D 4F20A 1CIUA 1EEUA 4AGOA 3L3JA 4HWUA 4BELD 1WC7A 1WA0X 5DUMH 4JZJC 3DXAB 4JE0A 1IBGH 1TU2A 3KPOB 3RKPA 4KKLC 1N7MH 1JF5A 5FDWA 4UIMB 4B3EA 3QZWA 3F04A 2CG9X 4PJ5B 2FGZA 4AV5A 3AAZB 5J7CC 1BG1A 3EGXA 3NCYS 2CR6A 2FO4B 4BBWA 3BD4A 5T33L 3V0FA 2E7LC 1DSYA 3QI9C 2X9WA 1TOXA 4FQHA 2Z4TA 3PGFH 1KY7A 1EFQA 1PY0A 3NIGE 1DBML 3RY6C 2VTFA 4Y9FA 3K1KC 3SDAA 3SE8L 3U9UA 1CBVH 4GT0A 5E6IA 1Q0XH 3B34A 2D7PA 3L3JB 1S78D 2ZZUT 3OAUH 4XOAA 5E95B 4IBLT 1IM9A 3O8XA 3P3TA 3RB5A 2QDVA 5T1KA 3ZQ9A 1RIVH 1DO6A 2XV0A 4XP1L 4KI1A 1U8OB 5FDWB 1DBJL 4GRWF 4UTAH 2DMCA 3A6CL 5E2TL 2QKIA 2IFFL 3QZWB 5F6HJ 2EDMA 4NPYA 4BSVA 2ZCLL 4XAWH 3CU1A 2HXAA 3QO0B 3EGXB 3QDGA 4IS6B 4M6NL 3D85D 2QADB 1VFBA 2E6QA 4FQHB 1CFSA 1EZUA 3G6DL 5L2KE 2HVJA 4PG2C 2IMMA 1KIPB 2BW4A 4LKXB 4RBPK 1USQA 3SDAB 4QF1B 5D1XD 3U9UB 3VH8G 3IAQA 4Z7WE 2YUVA 4ZI8A 3NRQA 1S78C 3RGBA 2CBMA 3U4BL 3ZTEA 1WVZA 4QAMB 1IM9B 4X98A 3OPZH 3D39B 2DKMA 4HKXB 5T1KB 2FEEI 5ESVA 3N85H 3FFCE 3FPXA 2W9DL 1AGFA 2QSVA 1KT2A 2AK4E 3KPPA 3OMAB 3DGDA 4HQQH 4NPYB 5DQ9A 4ZJ9A 4BSVB 5I6XB 5LDSA 4UV4L 4H0IA 2QPSA 4C83B 1NBVH 1G87A 3GLZA 2F53D 1VFBB 2ADGB 4MNGA 4ZAKC 2LT9A 1AXTH 1CFSB 2KKQA 1XQ4A 5F3FA 2KMWA 2LVEA 5HGBA 2HVJB 2HUHA 4ZXBD 1AOZA 1T0NA 4LL4A 3KPMA 3L8QA 2W60A 3EOTL 4NN5B 1FDLL 2Z7ZA 4C47A 3TA3A 1J8HA 3KH3A 4ZYKA 3GHEL 1QPKA 3LPFA 5FHBH 2X89A 1L0YA 2VE6A 4JPSA 2APVA 4ODSL 1RUAH 3DVIA 1BIIB 1NCIA 3WN5A 4FQIH 2A1WH 1IIIA 1FORH 2VDML 5F7YC 2PYEB 3KPPB 1KT2B 1M71A 3GC3A 4V2CB 4L8CA 5DQ9B 2FX9H 3TZVA 2NSMA 4Y1TA 1INQA 2HAZA 1P7KA 2NLJA 3BLPX 2WLHA 4POUB 1W72L 4MNGB 4TUUA 2E74C 2IDSA 5JPMA 1UWGH 1MI5A 4PJEE 5HGBB 3Q05A 4ENZA 1E3FA 1T0NB 2H0EA 3AG1B 3KPMB 3WY3A 2IGLA 5IOKA 3MRHB 1BBJA 4YC2B 3ZZQA 5CCKL 3TA3B 1J8HB 4ZYKB 1KIRA 2C9VA 4P5TD 2EDHA 3FMGH 4EQ2A 4POZC 2VE6B 4FQJH 4KKBC 3LNFA 2QEJA 3ULUC 2J1ZA 3WN5B 5CJXA 3W5MA 2DIBA 1M71B 4L8CB 2XOTA 1GAFH 2H6PB 3TZVB 4GLRH 4AW4A 1INQB 5DZ9A 1I8IB 1P7KB 1V7NH 3DHJA 2WZ0A 5DJ0A 5HDQH 4ZFZA 1LO5A 4H2CA 1MCJA 4XNUL 1E4WL 1UFGA 5JPMB 5L9DH 3CLFL 1UD8A 4S1QH 3AUVA 1OKEA 1MI5B 3LNEA 1PSKL 2G30A 2OSLA 1ECYA 4Q74A 4G9DA 3BUQA 3IDYB 1FAKT 1BBJB 3T0EC 5F7EL 5HHVL 1W6LA 1KIRB 3U0WL 4F2MA 4YLCA 1WZKA 5DQDH 4HFWA 4QTFA 1JP5A 1F2XK 3CX5J 1A7BA 2PETA 3B9KD 4P99A 3GRGA 4YR6A 4X6CE 1YNTF 3WBDA 1EUUA 4PYHA 4LCYA 3ILPB 3VU1A 4WK4B 5DJ0B 3ABMB 2IFGA 1HHHA 4ZFZB 1FGVL 1LO5B 4OT1H 1TKWA 2NY2B 2YK1H 2WOBA 3FXIC 4MJJA 4HCRL 3NCMA 4N90E 5DFTA 5I74C 3TBWA 5FUCC 2VXVL 3QEHA 4DVRL 1Z6JT 2BP0A 3GMQA 4FQ2H 1H3WM 1U8PB 2OSLB 2BHUA 3CCHA 3KWWA 4GAJH 4LARL 4NAQA 5FO9A 4G9DB 3IWUA 5TFSH 3MACL 3BUPA 3AS3A 2B3RA 1DFXA 4F2MB 4HFWB 4FTVE 3GINA 5B22A 4WFFE 5I1GH 2EE3A 2JLLA 1LE9A 5E1QA 4EI5B 5I1CH 1P84J 2GT9B 4YR6B 1MKFA 4KK9D 4ELDA 3JBG7 4LCYB 3NOIA 4KGJA 5A6MA 5EIIB 5JDJA 1JPTL 4PJ9D 4TNVK 1BFOA 2PWFA 4GFXA 1IUZA 3IRCA 3KYAA 3QEQE 2CRYA 1GC1L 1TKWB 3CQPA 5BZDB 4U1NA 3QEHB 4MJIE 4PLJD 1T7YA 3E8UL 1BVNP 4WO4C 4MQ7A 3V0VB 1YYLL 4KV5F 4KVPA 4MAUL 4U1GB 3CCHB 3KWWB 1ZOXA 1NMAH 3WE6A 3RU8H 1KBGL 2AEPL 1O6TA 4M5SA 5GGVH 2XYBA 2PNDA 5CGYD 4BGLA 1R3IL 4KU1A 2ZSVB 1NCHA 3HNTL 2DH3A 2PCPA 4LASH 2Y1AA 3TEZA 3B7YA 3I6LD 4R8WL 3VQMA 3EJJX 3O3DA 5FW6A 4M1GH 1Y18A 5EZIL 4AKPA 5DURB 3HTLX 2YD2A 3W1ZA 4BCYA 4YXKH 1YEFH 4FA8A 1BAFH 1UZGA 1CF8L 2Y5QA 5HDBF 4U1NB 5I8EA 4MCZA 1I8KA 1CICB 2IWEA 2GKIA 2OM5A 4MQ7B 2F8OA 1KB5A 4FXLA 4HW6A 3WE6B 4RA0C 5J1AA 4ZX5A 4QJ5B 1RIUH 4KGLA 3KPQA 3IJEA 4YDMA 1JK8B 4ACPA 3V4PH 3VQ2C 3UJTL 4U3HA 2VDPB 1ULVA 5GGRY 3N2JA 3BRDA 4PB0L 2BOBA 2W8CA 1BAWA 1Z5YD 4ADJA 1M7XA 2HX8A 4X4YB 5EEYA 1JPSH 2AXHA 2QZQA 3VH8A 5DI8B 3O11B 1Y18B 4KVNL 3BJLA 4BHUA 1WCQA 4HF5L 2ENYA 2OL3A 1OT4A 2D9QB 3DJZA 4MCZB 4AK2A 4CC0A 1TCMA 2FBRA 4OD1L 2F74B 1KB5B 2KQNA 2M8XA 3HZYA 1J1PL 1BF5A 2YSTA 4J6RL 4JRYA 3WD5H 3IJEB 5DD5H 4TNEA 3GXMA 4GUOA 3PDOA 4RZKA 3T08A 2WCSA 1AJ7H 2I7SA 5IP4A 3OF6A 4CILA 3DK2A 3F7QA 3BQUD 3G5YB 4J5VA 1FZOA 1LO2L 3L4YA 1NCWH 2BZDA 4ZUUB 3VH8B 2OCFD 3TPUA 1M7IA 1N6QL 5EWIL 3BGMA 3B3BA 4U1KB 4OLYH 3WIIL 3C60C 1HL5A 2OL3B 1AS8A 4JQXA 3QP3A 4AH2A 4MA7L 1MEXL 3X14A 3D07A 2VLRD 3HZYB 3NACL 4M03A 4B9IA 4LO9A 5C3IA 3NIDF 4AIEA 1G0DA 4JNXA 4JRYB 5B3SB 4Z7VF 2EIDA 1YG9A 4LKCA 3N1FC 5D1QA 4JFZL 4HS3B 1H3VA 3PDOB 3OV6A 3R06A 2BNQD 4FNRA 4BIKA 1EBPA 1B9KA 3BQUC 4FF9A 1VPOH 1FZOB 4AG4L 3KL5A 3ARTA 1WFUA 4NJ9L 1LLAA 1CR9L 5KYYB 4X5XA 3OJDA 4UTAA 3SKJL 3TPUB 1M7IB 4GB9A 1CXLA 3LHPH 2F0CA 4LEOA 5IJKC 1PDKA 5PAZA 2VM4A 3R1GH 4YHOH 3X14B 4NKIH 5D9SA 1GTNA 2QQLH 3H9HB 4KPHH 4RSVA 3PGCB 3Q6GH 2B4CC 2FBJH 3GWJA 4TMPA 2P5PA 5D1QB 3T4AC 2B1AL 1UACL 3OAWA 1A3ZA 5CD3A 3WEBA 1G5AA 3QCTH 1KCUH 1P4LA 4P2RA 5JXED 2VUOA 3T2OA 6PCYA 3HVNA 4NNPH 4WWKA 3ZVVA 5D6CA 1UJ3C 1ZSDB 2DQFB 2HCZX 2IPTL 4XCCL 3UC0H 4O5LH 5D70L 4YSQA 4X5XB 2LGNA 4H20H 3FFOA 3KYKH 3QEUA 5EU7E 1M3IA 1XB6A 4ZRGA 3GPEA 3TEYA 1XGQA 1PDKB 2WD0A 3VCLA 4Y19A 3ESOA 4JM0A 5D9SB 4HMDA 3VMPA 3WO4B 1U4EA 3FUHA 4DGVH 4O02H 1KFAL 1JNNH 1K4DB 1XF3A 2BRRH 3D7PA 3P0GB 1XCXA 1MPAH 1OO2A 3BT2H 3N41F 3RGVD 5CD3B 4KXBA 4P2RB 3TN0B 1P4LB 5JXEC 1K6QH 1HZHL 1GTFA 5IW6A 5BRPA 1NCBH 5D6CB 5IVNA 3TJHD 4B5EA 1D2PA 2IGFH 3WXVH 2KHAA 3VGDA 2MPAH 3QUZA 2XVKA 1GA2A 1XGQB 3FQ2A 3QRLA 2W88A 3VCLB 4Y19B 4ZQKA 1F4XL 2J20A 2DL9A 1INDH 3NH7L 1XF2A 2WVTA 2X0VA 5DD1L 3LRSA 4JM2B 2AQ1A 5AQ0A 4JFEB 1XF3B 1JS4A 2FX8H 4G6JH 4X7SL 4FD0A 5BW7A 3O2DH 3OB0H 3GDCA 1E67A 1I3GH 2AEOA 3LZNA 2VDKB 4X0KA 4DAGL 5IW6B 4N8VA 2OX5A 4PS4L 1TVDA 3LKNA 3TJHC 5FUOH 5HD8C 5LG6A 4S1RL 1QSEA 2JQAA 2WQRA 1J0YA 2O5XH 3OGCB 1DANU 4L4TD 3QUZB 4XNYH 1G7IA 2VMEA 3S35X 3DDFA 3RPKA 4RGOH 2FJHA 4MMXB 2O5YH 3WXWH 3P0VL 5F9JA 1H6EA 5LXGL 1XF2B 3LRSB 4WFEE 1BOYA 2LHAA 1T04B 3TJPA 4BQ9A 4UB0L 2YA0A 3TC9A 1LWJA 5INCB 1HE8A 5BRZD 4X0KB 4N8VB 2C9AA 3MLYL 2OX5B 3ZZ1A 4EDXA 3T6QC 4XVJH 1G9ML 4Z1PA 3MRLB 1X5FA 1PD6A 3A4AA 1T0PB 4LSVH 4HCFA 3OX8A 1NLBH 4OCMC 4N0UB 1F90L 4N87A 2OULB 1PYWB 1TQCC 1G7IB 2BZ7A 1IL1B 2FJHB 5JHLH 1IAIM 2Y2YA 5GGSA 5F9JB 4I9WE 2B15A 2QMKA 4DF9A 5IJDC 2QHRL 4LU5H 5HYQB 3VGAC 2VJ8A 4FQQA 5IHZA 3I50H 4LZKA 1J12A 5H35A 1Q9WB 3G9VA 3GUTB 4PJAF 3WS6A 2KQMA 2DMKA 1H9DA 5GIRA 2CGRL 1N4XH 1F1GA 4HHWA 3LEXB 4EBQH 2O1AA 4Z0BL 1KNOB 4UBDC 3QDGE 1PCSA 1SUJA 4AITA 3IPBA 4Z8FH 3BLBA 3OWRA 3OX8B 2R39A 3WV0A 4AEHH 3LKOB 4TLUA 1J7VR 4OVVA 3ES6A 1AQ8A 4LMQI 2ODIA 3F7VB 5GGSB 1KTBA 3GMPA 5I24A 2FWOA 4S1DD 1II4E 3L3OA 4M4RA 5EU6B 2HKFH 1NGYB 5B8CB 1R3KA 1VGEL 2O30A 4YUEL 4L2YA 4JY5H 2F9BT 1QRND 3L2NA 2VUYA 1BQKA 4JM4H 5H35B 1CDJA 3HPLA 2C4XA 5GIRB 3ELQA 3ZSTA 5LQBH 3HJEA 5CIPH 2YAPA 3UYOD 4CC1A 3CHQA 4LP4A 4NFBA 2OBGA 2WTPA 4HU2A 4DTGH 3AG4B 3B7TA 4PRAA 4MNGE 2EDOA 1ZGLM 2XIBA 3PS6A 3H3BC 4Q6IA 1FNGA 3GBEA 2VKWA 1TQTA 3ES6B 5EN2B 5J56B 2I5YH 3GS4A 1UWYA 3GMPB 2FWOB 4HUCA 1LP9A 3L3OB 4OIIL 5DMIL 4AQ8A 4Q9RL 1J8HE 3VGGA 2VLJA 2Y23A 4WGKA 1R3KB 1SOKA 2CXKA 2K7QA 5E2WL 3RG1C 1IJ9A 4AJ0A 1OPGH 4TYUA 1T1XB 4GMSL 4PVNA 3HOGA 4HBQA 4YBHA 3MI6A 4OI8A 2CRZA 3EFFA 5CBEA 3MYZA 2WP3T 5J12C 3PHQA 3V4PA 2V2XA 5K1VA 1QEXA 3COOA 3EJCA 4JLRA 3I3DA 3ETSA 4E36A 1UZ8A 1WD8A 4GKSA 4RMQA 2XI9A 3ALXA 4PRAB 4XMXA 4YHML 1H3GA 3B9EA 3FPYA 1BOGA 3PP3K 4GXVL 5CLYA 1JTOA 1A3RL 1MI5E 1FNGB 4AYDC 4JKMA 4XC3H 1U93A 4DHLA 4O2EA 3J27A 4WUUA 2RIKA 1FI8C 5IIEA 1LP9B 2N7SA 2OK0H 5H4YA 5E4EB 1I82A 2C9PA 1CL7I 4WNSA 4ZDHB 4HIIB 1NGQH 2IXQB 4LVNB 3DX7B 1TJMA 2QR0B 2DI8A 2A6KA 1FNAA 1NIAA 3PHQB 1A3QA 5T3ZL 5J0BA 2OMXA 4KXDA 2DI9A 2OMUA 4JLRB 1EO8L 4OF0A 2FIKA 2WLMA 3G5WA 4OI9A 1U6AL 1UZ8B 1JZIA 2WVUA 4FKEA 4GKSB 6FABH 3WTYA 4FNLH 5GS3A 3MCLH 3B2VH 1BOGB 4N25A 4NUGH 4GFTB 1FIGL 4JB9L 3S5LG 2EC9T 3FO9A 2YFOA 2ZOLA 3WU1A 1NIEA 3BSZL 2Y2WA 1U93B 1X4YA 2ARWA 4H8WH 3MLTA 1ZA3B 3D2UD 4NQTA 5E0FA 4F2ME 3RUGA 3ARBA 2ZUWA 5EBLB 1CVSC 3BW9A 4FXKA 3N42F 2BVEA 4V1DD 2A6KB 3V5DA 4S11A 5C7XH 1IFHH 3LMJL 1ND0A 4KKCC 3ZZSA 2OMUB 5FW7A 4MMZA 3K2MC 2FIKB 2HUEA 1VENA 2VO5A 5AVXB 1NDTA 2E4FA 1KJMB 1ITBB 2AK1H 2G0LA 3RB7A 3K91A 4J4PA 4NQXA 3D51A 1TITA 5A3ID 3OKKB 1U8LA 2XN0A 4G8AC 5DYOB 3LHAA 3FO9B 4U1SB 2ZOLB 3ML9A 1DL7H 3I75B 3PIQA 2BCKA 2GHZA 3CMOH 3MXWL 1KOAA 1T7WA 4U6YB 5C6TL 1J8RA 1KEGL 5E94A 1MREL 3MLTB 4GS7C 4KMTL 1EDHA 3HI5H 2F7RA 3RUGB 3II2A 2EP6A 2XQBH 3LIUA 4K07A 3ESPA 3BW9B 3APCA 1FRGL 1BLNA 4N2AA 3V5DB 1FLTX 3C08L 4GEIA 1ND0B 5C0AA 2AKRA 5BZDA 1M05A 3NA9L 4MMZB 2APBA 2R69H 1PTZA 3IFNL 3TF4A 2E56A 1KCSL 3QRGL 1VB9A 1R3JA 5A3IC 2MCPL 2WINA 4E42B 3W9DA 3ZDYB 1U8LB 4FS0A 1O9WA 4XVTH 1AY1L 3WTSA 5D8JL 2Z1KA 2H3KA 4HEPG 5IHUH 3N0AA 5E24E 3TT1H 1G94A 3DIFA 3ZMNA 2BCKB 4RGND 1GJUA 1U41A 1WS8A 1B0IA 1UH3A 2QGDA 5E94B 1G7MB 5AW3B 1XGTA 5KAQF 1MSPA 1KXTA 1ZLDA 4NGHL 4IM8A 5D2NA 3POHA 1ZPUA 4HSQA 2GBAA 3P40A 1MCQA 2DIJA 4IBTA 1BLNB 3TCLA 4GXUN 2O26U 2YPLD 4H8HA 2F61A 5TH2B 4E2OA 2AKRB 3L95A 2RJMA 3PFUA 3ZQWA 3V95A 5DMKB 5ETUA 2YRBA 3Q1SH 1WWBX 4KI5F 1P4BH 1R3JB 1UD5A 1SYVA 3R0MA 1GS7A 4M5YH 1IM3D 3W9DB 3VSTA 4I3SL 5D4IA 4KAQH 3U2SA 3O9WA 4C55A 3TONA 3NZHH 3LZQA 1Q9LB 4WI0A 1EHAA 1KBWA 3DIFB 3V0EA 1AKJD 3HKFA 2HT4D 5F6HI 4Z95H 3S37H 5AKVA 2ESVD 1KXTB 4J2QA 4LVHC 5CJOL 2CMRL 4AL8H 4OM1H 4NKQB 2AAAA 5D2NB 4IBSA 4IBYA 3Q43A 4YNYB 3EBGA 2ZG3A 3TT3H 5IW1A 3TCLB 4NNXA 1OE2A 5D2LF 3AU1A 2VRKA 1YYML 5ETUB 1GHFL 4LQFH 1H8OA 1B2WH 4LK4A 4Y9GA 3MODL 1ZEAL 1JCVA 4FABL 5ALCL 5F9OH 1QWUA 3ATDA 2R0LH 4WI0B 5M95B 2VISB 3N50A 4YDLC 5I15H 4JRYE 4EI6A 1U95A 4IOSD 4WKZA 4HGWA 5ACLA 4A6YA 1EEQA 3HKZA 3IWVA 2APXA 4H8QA 2EAEA 4YHPA 3GRWL 4LL1A 1KBVA 2FJUB 5IW1B 3CDCA 4HBCL 4NNXB 1XAUA 2AQ3A 3QJHA 3HC4L 3AU1B 5FYJD 5DLML 4RCAA 2YIHA 1KB9K 1M57B 2WO3B 4YSEA 4P49A 3BP7B 3T0VA 5J1SC 2RCSH 3W0WD 1OWWA 1S9VA 1H19A 4WUKH 4UZSA 1I9RH 3ZL1A 5G5DA 4M3KB 3BAWA 1RZJL 3ZDWA 3FULA 1L9SA 3ZK0A 2K9FB 2EC9U 3MJGX 4HUXA 4PJXA 4AGNA 3HG1A 4PGEA 4EI6B 1DQLL 1U95B 3VXPA 3LVTA 1XH3B 4WKZB 4HGWB 5D1QE 4A6YB 5JHLA 1QSFA 3NCJL 1A6VL 4JG0L 4O2CB 2X4UB 5FYKD 3L45A 3RURA 5JA8B 5F0MB 1G6RL 4UQDA 2BO0A 4YHPB 2IANA 1JHLL 5DZVA 4P05A 1Q1PA 2B3IA 5C0DA 3S3SA 2DM2A 3QJHB 2W0FA 1OHQA 3UJJH 3S36H 3ZE0F 2MNWA 1EANA 3GZKA 2OJZH 4GRMA 1MWAL 1LDPL 4NQVA 1S9VB 3RTQA 5G5DB 5C0CA 5KVGL 4TVPD 2IEPA 4HULB 2O93L 2G4GA 1AI1L 4NPKA 2WBKA 4BZYA 3ATAA 2ED8A 3QAQA 1G1YA 4PGEB 4PJXB 1VSCA 5FKPA 1E90A 3RWHB 1O7DE 5D5MA 3VXPB 5K69A 3GI8H 2VNCA 1BEYL 1QBAA 2OTUB 4MVBC 1ZHNA 1U8HA 2XTJD 1S7SA 4P2RE 1PBYA 2M2DA 3VX1A 2IANB 2BW5A 1U8JA 2H26A 5C0DB 1SEQL 4PJFA 2W0FB 1RZKH 5CS7A 3ECWA 2YWZA 5J4MA 2IVFC 4HOWA 1KF9B 4ZMTA 4GRMB 5CGMA 2NYZA 1Z9SA 5AAMC 2G3ZA 1QTYT 4NQVB 4P4KD 4XO4A 4Y9CA 3BCFA 3CBKB 4P5MB 2L7QA 4Y19E 1UQSA 4XCYA 5C0CB 2X4NA 4QYOB 3V52L 2CDEB 3FH5A 4J3OF 2H45A 5I75B 1AGBA 4Y8DC 4KTDL 5AOKA 1RUKL 1EHNA 2BC4A 3NSJA 5D5MB 2X4PA 1NKOA 2VB5A 4FLQA 1ZHNB 2K45A 1XCQA 2J2ZB 3QXTA 4PAZA 1AS7A 3CHXA 5E2VH 3MV7D 1U8JB 3BGFC 4X9GA 4WW2A 5DLLA 4U1LA 5CNHA 4X5WB 2YSSA 3KPTA 4G3YL 4PJFB 3WHXA 2AJUH 3LQAC 4Z76B 1ZV9A 2IWFA 4R2GC 3L2MA 1C9SA 3BPNC 2IWGA 1IAOA 1ET5A 1Z9SB 4P4KC 3FO1B 2VDRL 1NCAH 1UQSB 4XCYB 2X4NB 5B7MA 1XH2A 4G7QB 4HS6B 2V7HB 4XX5A 1AGBB 1AH1A 4ICXA 4JRWA 1E9QA 4UM9D 3EHBC 2BC4B 4E9SA 1P6FA 3MRDA 4LRIC 3FOLA 3AUWB 3TS8A 1T20A 3RZWA 1ZHLB 3NSCA 3ECVA 2R8SL 4Z3TA 4IIQA 2OZ4L 4WW2B 1H8LA 5TTRA 4HEPA 1YC7A 1KBKA 4NZUL 3EDEA 4NRZA 5TGBB 4ZS6C 3ROOA 3WHXB 1RMFL 1G7LA 1QSEE 2IBZX 4P59H 4DKEH 5AVVB 3C5ZD 2KPNA 3RZCB 3ZRSA 3F65A 5LJYH 3NCCB 5H8DA 4NM4L 1JHKH 5A2FA 1OTTC 3FH7A 5CJ5A 1QHPA 2BSED 1E9QB 5SV3A 4PIRF 1YMMB 1UXLA 1ASPA 1UCBL 3FOLB 4UT6L 2LABA 4HJIA 3QJFA 2YC1B 1U21A 1V7MH 4IIQB 4NOBA 3C09B 4HJ1A 4JEGB 4W9KC 4A7TA 1RHFA 4NRZB 1CC3A 3ROOB 2BVUA 3FUEA 3CIQA 4HS8H 4WQOA 3UTPD 3F6IA 1IEAA 5GRUL 4Q9QL 3K6DA 3WDHA 2B1OA 3DSFL 4H5SA 1FN4A 1I1CA 4UF7C 4BFGA 2R29H 4DP7X 5DC0A 3TO4C 1WTLA 3TV3L 2DPKA 3MV8D 3FO2B 4U7SA 1HAWA 1IBHA 4XNXH 4YHNA 4G70B 1RXLA 4HGMA 4AJVA 1GH7A 3EJTA 1OGTA 4J3WA 3FRPB 2H0FA 3QJFB 3MOAH 3ULVD 1E7UA 1YN7B 5CP3H 1MLCB 3LZRA 4Z7OF 4K0OA 4GY4A 1I7UA 4X7CC 5C8JA 4AQAA 5F7UA 4KJWC 4GAGL 2WVVA 4G83A 4EO5A 3IETA 2X6AA 2D73A 5AZ2H 3QWRA 3V10A 2GPZA 3ZXAC 4K9JA 1UD2A 2A5UA 4H5SB 4H40A 4NHCL 1JNJA 5E23A 4BZ2H 2R69A 2HTLD 1QP1A 3Q13A 4AQ1B 2DL2A 2MQ0A 4GSDH 3ZU8A 3Q2NA 1CL7H 4ZOAA 4XOBA 5KYNA 3VG0L 5DTFB 4YHNB 1BQHG 3NCEB 4YHYB 4Y4KA 3H2WA 3L5XH 2Q86A 3GD1C 1SMOA 4OUOA 4PJDB 4M9OA 5JIKA 3I6SA 1I7UB 4DESA 4YGVA 4AQAB 1HCYA 2WVVB 4BA8A 4BK5A 5IROC 3IETB 3LEYL 1DSFH 1UURA 3M1CA 3RYMA 3MBXL 1FFQA 4R7VA 4YQXH 1MVUB 5E1IA 3WNJA 1K8DA 1R5IA 3QYMA 5F89A 1P7HL 4XZUB 1TXKA 4ZW5A 1X5MA 4N1CA 1OAQL 4OZ4A 3ECUA 4G72B 3SCMA 5EZJA 1J0ZA 1LP9E 2WLNA 3MRFA 2VLJE 4M61A 1BM3L 3SPIA 1FZMA 3HZKB 4Y4KB 4BZ1H 2XWJA 4HWBL 4XMKH 4P46B 2Q86B 3RJQB 4TULL 1A6WL 4NQSA 1TQBC 1NAMA 3DUUB 3V6OA 4YGVB 1QVOB 3QIUD 5KJ7E 1GPOH 1XAKA 1GGIH 3BOVA 3RILA 2QQNL 1VESA 3EYUH 3G6JA 3IMRA 4M8VA 4HVBA 4NP4L 4NOFA 3T4YA 1YQ2A 4ES8A 1K8DB 1DDTA 4OZFH 5DWUH 1TZHA 5F89B 4JO2L 4WI6A 1N3NA 3SDXF 4KZEH 1OAZH 4OZ4B 4RNRB 1QWNA 3OR6B 4WUUE 5EZJB 1OALA 3PL6B 3TNMA 2ZOOA 1EWHA 1MFAH 2DOCA 3MUUA 1DJWA 1A14H 2XWJB 5CCJA 1FJ1B 5FR3A 2A77H 4N2FA 4PJBB 2WZ5A 3B5TA 3I9PA 2XFXA 3OAZK 5DZPA 1KXQA 2D4DA 2GSGA 2PXYC 3ZE2B 4NQSB 1NAMB 3QIUC 5GZNA 4PY7A 3G6JB 4Q0XH 3VA6A 4B7IA 2WWMD 2A0LC 1CFMA 3T4YB 1LK2A 3CVHL 4Y0GA 1ZVSA 4AEEA 3GXDA 4FNPA 4ADIA 3QZLA 1TZHB 3ABKB 1QX1A 1N3NB 1YPZA 1ZJBA 4PP1D 3BEVB 3SB3A 4R26L 2BINA 1SDYA 3PGDB 3IS0X 3GK8H 4Z3GA 4N0FB 3RUGE 2XQYG 1M3JA 4I77H 2K6YA 2XFXB 2HFGH 3DRQB 2GSGB 3I02A 3VFNA 3CUPA 3VWKA 2GITB 3BESR 4R97C 3UYRL 4PY7B 4PJ8A 3WLWC 5B39G 3WFHA 4DJMA 3DHUA 2WWMC 4OCLC 2I25N 2BOLA 3CZSA 1E8ZA 1LK2B 2CUAA 1ZVSB 1ZLEA 3ZDYE 3C87A 4UM8B 3HUJA 4FLSA 1DTUA 1YPZB 5A2JH 5J13C 4RFEA 4OZGA 3BPCA 4DK6A 5BJTB 2FLRT 4UT7L 4MA3A 1IC0A 3JV0A 5H94A 4ONFL 3AW5A 2C9XA 1ZSHA 1MCCA 4AIZA 3F05A 3CZNA 3CHSA 2OXHB 4D3CH 3B7UX 4FA6A 5A7EA 4ZW8A 1NMCC 3I9GH 4MAZA 3I02B 1FFRA 5C0AE 1BZ7B 5BPPA 3VFNB 4OZFG 4OFDA 3HS0C 3CUPB 3VWKB 4XBEL 1HNYA 2YQGA 4PJ8B 3WLBA 2C7FA 2PMZA 3AREA 3BKYL 1WZ1L 3VXMD 4DVBA 1DVFD 1O0VA 2R4RH 2QGBA 1HNGA 1C5DA 1FWXA 3FU0A 3CFEB 2N0KA 3OJ2C 4UYQA 4YJZL 4OLVL 5LVEA 1KGYE 2VXUH 2WSPA 3HUJB 4RGMB 3QDMB 2OMVA 3GSWA 4N85A 3ESMA 3SSGA 4ABUA 1FBIL 3PWLB 5IEKA 4OZGB 1J0IA 2XZAH 3BPCB 1R24A 5EC1A 4RISL 1R6VA 4MA3B 4ZK8A 1A9BA 5H94B 4R4ND 3T3PF 5D2NE 3MLUL 1M6UA 4AIZB 4U7KA 3RX7A 1R0AH 1MW3A 3ILEA 3R0NA 4PRHA 1JFQL 2W9LA 4R0LA 5FS5A 3ASNB 1CDGA 1L3WA 1D5BA 3VXUA 3ZX1A 1GJWA 4IHBA 4XP6L 4GAFB 1CGXA 1FYTD 4RWYL 1U8QA 3AREB 4E9QA 4I18C 4OLUL 5KTEH 3QJRB 1DVFC 3A6BH 1CDUA 4G7SB 1OSZA 2UZYA 5DS8A 2OXGA 4OUUA 1C5DB 4JQVA 4O9HL 2R2EB 1CYWA 4ODBD 5MI0B 1KCRL 2IMNA 3QT2A 4NXSA 2OMVB 3GSWB 2K3HA 4IGBB 3CFMA 3HW7A 5CEZE 2HMIC 1PF3A 1HNFA 4P06A 3MA9H 3NCXA 4XP5H 5IEKB 1D5ZB 3P4OA 5EC1B 2JKLA 5FB8A 1BMGA 1A9BB 1IKFL 4LQ1A 4R4NC 4GO8A 5HDOA 1BECA 2AP2A 1KXVC 1CLYH 4MCNA 1A6UL 1I85A 2IADA 3O4LA 4R0LB 4J3UA 4LCCA 3EO9L 5HPOA 3IJHA 2ILLA 2KDGA 2VDNH 2X70A 1XTLA 3ULUH 2KT6A 5I73B 5GRJL 4S0HA 4RMTA 3IMBA 3E80A 2UZYB 5DS8B 1BD2D 7TAAA 2OXGB 5IF0B 4HKZA 3ENEA 4WY7H 2QGEA 5AZUA 1OTSD 3WFBL 1G84A 1CDCA 2V5MA 2VERA 4XBPA 3W57A 2J73A 3MRCB 3P4OB 5FB8B 3UBXI 1Q8MA 4GRWB 3NA4A 3KG5A 1CG9A 3OKNA 2F5AH 1XIWD 4HJJH 4TSCL 5K9KA 1BF8A 2FX7L 3VXRD 4G5ZL 3O4LB 3IFPA 1ADQH 1QFWI 5L7XL 4ONGL 2ZKXA 3VI4A 3IJHB 3D4GA 5EZLA 4M7ZC 2X70B 3F5WB 3JT0A 1MNUL 3UCQA 4ENEC 3V6FA 3LKSB 3P69A 3P73A 1IGML 1QBLH 4M7LT 2H5UA 3TXAA 1MCHA 4PRDA 2XWBB 4FYTA 5SWSD 4PJXE 3HG1E 4I8DA 4PBXA 4XI5C 2R29A 3A4DA 3A67H 2E9JA 2ENSA 4CMHC 1QSFE 4DEPC 2YAFA 2ROXA 1OGAA 4PJHF 3BVTA 1I9JH 1CG9B 3OKNB 2IANE 4U6VL 3W2DL 1CI3M 5DHVA 1Q9OA 5ANMA 1TCRB 3VI4B 1EJFA 2W95A 3WELA 3LS4L 4KZDH 1A4AA 4LOVA 2VN3A 2DF3A 4DGIH 4LBEB 4M3HA 2FWLB 5FGSA 3V6FB 1BBDH 4P07A 4QDGA 2WO2B 4R90H 2A6DB 1UXMA 1UJTA 1L7TH 3FJTA 5C0CE 4L0ZA 3WNNA 4ZD3H 4AEIH 4M56A 1CGYA 2YN3A 3F58L 4BZ2A 4Z7AA 1AQKL 5D5ME 3WFCL 1MQ8A 5CINH 4XMLH 5KVDH 1PVHA 2YKLL 3QUYB 4WTZG 1OGAB 2M26A 3HMWL 4X7EC 5KSAD 3PWJA 4QRPD 2IC2A 3IDIB 3O0RH 3GJEA 4LPXA 5DHVB 1Q9OB 4PJFE 5ANMB 1VKXA 2WM0A 1OW0A 3LX9A 4HSCX 2YO3A 1EAQA 1TNNA 2P52A 1HIML 3MTRA 2NY6B 4MZ2A 2XQYA 5D96C 3D06A 3P3RA 4L29A 5D4QA 3MX0A 4XBMA 2QQKH 2X1OA 4CA4A 4NYLA 2OTPA 1HJCA 4PGZA 2HRGA 1IMHC 2HG0A 2P24A 4YDVA 3Q2LA 4HU8A 5B39A 3AM8A 2WCPA 3SGJC 3PWJB 3RAJL 3CC1A 3ASWA 1YEGH 2EEDA 2UVEA 4YSCA 4BZ1A 3GIZL 1NWPA 1B4JL 3GJEB 5DYFA 5CZRA 1VKXB 1CXHA 1X5ZA 3DTUB 1A4JA 1MLBA 3P3UA 4L23A 2A4CA 2ZTBA 4DKTA 3TU6A 1NDMA 2K1MA 4TL5A 4HD5A 2E6PA 4LHUD 4L29B 4XNAA 3SDDB 3A22A 2CJUH 3MX0B 4QTIL 5AKSA 3H9SB 4NYLB 4ZFGH 3UCRA 5EEWA 5FXCH 2DIEA 2FHCA 4OZFA 2UZIH 5T1LA 2GVYA 4YDVB 3ZKXB 3T0DA 2DQHH 3HHRB 4FP8H 5B39B 2GEQA 1OAUL 2Z31A 3KDPB 4XWOC 3BIBX 4PRPD 1JGVH 4JFDD 3U0PA 1G9EA 3UXFA 1E30A 1PZDA 2D7MA 3U7WH 2R56H 2BIPA 2AEQH 2YXVA 4XP4H 4YWGL 5EA0L 2XACC 5J6SA 1AD0A 1U8MA 4WFHD 1WISA 1NDMB 1X4XA 4P2QD 2XG4A 1AO7D 4B6ZA 1DJGA 2WBJD 3FQUA 4TNGA 3DBSA 1UXSA 1F13A 2CJSA 3QZNA 3FB7A 3TESA 4LVOB 1R33A 1ORQA 5E0QA 4IDJL 4GQQA 5CLZA 3UZQA 5DGRA 1BXVA 1I1AA 1N0XH 3QE5A 2VT0A 4HIXH 5T1LB 4WGWB 4FL4B 1ZT4A 4DGWC 4MZ3A 4EIZC 4F9PA 4K8RL 3VVVA 2E7LA 2VDPL 2Z31B 1M9WA 1LVEA 1KELL 4OCWH 1DBAH 2IOOA 3U0PB 1JK9A 1BFVH 1RH8A 4Q2ZB 4Q97A 1ZTMA 1EHLL 2CSPA 4UTBA 2CIIA 2J1YA 4P5KB 1T3FA 1YO4A 3NP3A 1DE4B 1U8MB 4H0LC 3V0WH 5C07A 1YAZA 1UA3A 3DHPA 3LH9A 5EOTA 4IRJB 4FZ8H 5HDWA 4PG9A 3TURA 4KITB 1QACA 2MHAB 2K4AA 2WBJC 3BWUC 3GJFK 3KJ4B 4GBXB 3FQUB 1UXSB 2HYMA 3CSTA 1QBML 3GFUA 3M7OA 1KB5L 1ORQB 4YXLL 5EU3A 1P6WA 5IUCA 1T66C 4YHKH 1I1AB 1P5UC 4M5ZH 4WTQA 3R4DA 3FTWA 3I84A 3AWGA 4X4XB 3LNIA 4NN7B 1ZT4B 3DVGB 4PP2A 1UGNA 3H7BB 4N0YH 5E08H 5F7NC 1JK9B 2B4CH 5FLUA 2KLSA 3M7FB 4JHAL 2VQUA 3IYLW 4ZO8A 1GGUA 4NO0D 4PG2A 2CIIB 1T3FB 3OLEA 4WEUD 4HH9A 3VD5A 2YRZA 3LEVH 5HDBB 1IQDA 1TEFA 5C07B 5I9QC 5EOTB 3HI6L 4PG9B 4G7YH 2QZ5A 1CGWA 3SE6A 5T5FA 2OL3L 5BVJA 3K7UA 4XPAH 5SWQA 2EDFA 1KY6A 3L9BA 25C8H 1FH5L 3C6LD 3GRBA 5EU3B 3V9EA 4D7BA 1R4XA 5E6RB 5IV2B 3K81A 3JWOC 4W9EC 1PZUB 2MKLC 4ODTH 1A6ZB 3L4VA 2B5IB 3WKMH 3D85A 2DTML 3JXAA 2VH5H 4ZAKA 1CD8A 1MJJA 5FYLD 3DO7A 4PW9A 5SV4A 2WUBL 3I9AA 3N1GC 1XXFC 3RVWD 3NIGF 4GI9A 4D9LL 4EDWH 1MAML 4Y16D 3OG6B 1AD9A 3ATEA 4HH9B 2C3HA 5D1XA 3GM8A 4KQ3H 2BSTA 2K6ZA 1IQDB 1HINL 3ARXA 3VGBA 1PEZA 5LNGA 2XIIA 2ZX5A 4QRRB 2WSDA 2W07A 3MUJA 1HI6A 2YOCA 1K8IB 1KFGA 1CN4A 3E2HC 1WHPA 4Z7VA 5AW0B 5E8OA 4YE4H 2ZUTA 5BMFH 3VGFA 5DA0B 5T3XD 3UO1L 4CN1A