1OIOA

Gafd (f17c-type) fimbrial adhesin from escherichia coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FIMBRIAL LECTIN
publication title The Structural Basis of Receptor-Binding by Escherichia Coli Associated with Diarrhea and Septicemia
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1oioA00
2BS71 1ZPLA 2BSBA 1ZK5A 1O9ZA 3F64A 3F6JA 1O9WA 2BSCA 1O9VA 3FFOA 1OIOA 2BS8A 4K0OA
chains in the Genus database with same CATH superfamily
2BVPA 2OV0A 2ZYHA 3QDGA 1P5VB 2A6JA 4NSKA 2XKNB 1ADQH 2DM4A 4WFGE 2IC2A 2BY1A 1QEWB 3EGSB 4JY6A 4KDTA 4X9IA 3C60A 1ZAGA 5HHOD 5IFAH 3DVNA 1U3JA 2EH7L 4KH9A 2R2BB 3BMVA 5EZOH 3C9NA 2R2CA 3Q44A 4L5FE 2ITDA 4U1NB 2DIEA 4LCYA 4H8HA 1MCOH 1CDYA 2GUOB 3R8BB 3DMMB 3IGAA 5BXFB 4PD4K 1A7OH 2NDGA 2D73A 3QR1A 3BAWA 5I73C 4JNXA 1J1OH 3AABA 2O5XL 2A6JB 3QDGB 4NSKB 4X5LA 3OAZK 3SE6A 1KEML 5AB9A 3L08A 3WJLA 4PRIA 3OGCA 2CJSA 4FI7A 2IPKA 4JY6B 5FA3B 5LJYH 1W6WA 3RBGA 4Z7NE 3DVNB 3J27A 3JT2A 5CJ5A 3C9NB 2OSYA 4U49A 3T3MB 2ITDB 4O2EA 4LCYB 4CNIA 4UT7L 3PL6D 1BQHA 1JWSA 3SPJA 3IGAB 2C34A 2NX5E 3GYRA 4R26L 5AVXB 2A6DA 2WCPA 5E9DE 2YQGA 1GPOL 4PRIB 4ODSH 2IPKB 1J1PL 3KYMA 4XCFL 5T1MA 1QG3A 4ACTA 1FRGL 3TVMA 2LTQC 4NJAH 1PD1A 2VDPH 2XIDA 1OWRM 4LBEA 3KEDA 5JIKA 1WT5A 4J2QA 4CNIB 4M9OA 3EG9B 1WE5A 4BQ6A 1Q0EA 1HE8A 2RH0A 3T0EE 1KYOJ 1BVZA 5FCUH 3QARA 2R0WL 4K5LA 1BAGA 4MMZC 3RA7H 3FO2A 2A6DB 1J8HD 4WI6A 3M17B 4FTDA 4FG2A 4YDLB 4IMKC 3IJHA 4LRNL 3TEYA 2CXGA 3TVMB 1VENA 4Z5RB 5EU3A 2AVFA 4ODHL 2HRLA 4LBEB 4MJ6A 3UG3A 2ZOLA 4OW6A 3C5ZD 1XAUA 3E3QE 2B08A 5DVOA 4ZPVA 3MRNB 1NCWL 5C6PB 3P9MA 5E08H 2WQ8A 1HWWA 1M57B 2BIPA 4Y5VB 3HJ0A 4RBPH 1ZLVH 3TC9A 3BKJL 3RZWA 5HD8D 2VDLH 3HMWL 4ONOA 3WFEH 3IJHB 1KNOB 3MSPA 4KPHL 2EE2A 4X5QA 5INDA 4GAFB 5EU3B 1JNNL 1WIUA 2BZ7A 4MJ6B 5DHEA 5GJTH 3VFGL 4N87A 3NJJA 3LRHA 2Z93B 1NCGA 3QJOA 4XNUL 2F1AA 4ZPVB 2QQKL 3ECWA 3P9MB 5IMKB 1IC7H 4X6DF 3O8XC 2WLZA 2DJSA 4EI6B 1ACZA 1I1YA 1WITA 3FQXA 3NP4A 1IFHH 4FABH 1EGJH 4B9GA 3MRBB 2CO2A 3C60D 1IC4H 3EXLA 1GVIA 2FQDA 3QEHA 1A6WH 5INDB 1A9VA 3FQ4A 4W70A 3E2HC 2GJJA 3WD5L 1EJOH 1F3RB 1U33A 4PY8I 3SE8L 2AKRA 5JHBA 1N64H 4DKTA 1CD8A 1W0WA 1ODAA 2GC4C 1I1YB 1MJJB 2Q9OA 2XBDA 1C9SA 2LFGA 4PRID 1VLXA 3DVGA 1Q9LB 3EDJA 5MEND 4L3FA 5EULV 3PFUA 1EBPA 4XP4H 2BXZA 5AZEL 3QEHB 3V5HA 5DD1H 5F7MC 3ULUF 1RH8A 2P5WE 1IGFL 3MRDA 4UBDC 3E9UA 4NWUL 3KPMA 5BZDA 4ZQTA 1JDCA 2ALAA 3GXUB 1G6RL 4JM2A 4ZUTB 1GGIL 2YRLA 2PYEA 1WGOA 1CICA 2E46A 3P4OA 2DYRB 4CC4A 5LCVH 3S35H 4AIEA 2WXKA 3DVGB 1N10A 3KPRA 2P5EA 5D96B 3QZMA 3FTWA 5DQ9A 5JXAL 5SWZB 1IU1A 1PG7W 4TUJA 2DLFH 1CLVA 3PV6A 2J6EH 4MXVE 4OGYH 5G55A 1IILE 2A0LD 2DQEH 2XA8H 4MD0A 4OD1L 4UF7C 5TE7H 3PHQA 2EVFA 1L9RA 1QSVA 3OZ9H 5IFJA 1N0LA 2PYEB 3CVDA 3QZPA 2H32A 4O2CA 3HNSH 1CFQA 3P4OB 4PB0H 1F4WH 1H6FA 3HC4H 4LSUH 1KTLA 4LPVA 2YGOA 1HJCA 5D7LE 2F61A 4KTEL 1ASPA 2C9QA 3GRWH 2X4TA 3PV6B 5ILTH 3HE6C 4MD0B 2R4RH 2AQRA 2NQ3A 2R1WB 1JZEA 1RZKH 2B3IA 3PHQB 5KS9A 1PZCA 1DFBH 5IFJB 2VW4A 1N0LB 4J3OH 1Q8MA 3DXAA 3ATEA 2H32B 1VFBB 1V7NL 3ARBD 3F62A 3HG5A 1HH6B 4KV5F 4XC3H 3Q43A 2Q8AL 3UBXG 4E9SA 2QKIC 1MNNA 3DSFH 4AJYV 2Q76A 1KTLB 1AHKA 2YN3A 4UMGA 2MEJB 3WGVB 4OKVA 3HS0A 3CFMA 1JXFA 4FFYA 1YYCA 1DQJA 2X4TB 4H1LA 4X9FA 1JI2A 3SQRA 1RZFL 1AGDA 5KS9B 5I6PA 4DGVH 3CFBA 1DSWA 2NY5L 3G04A 1HJBC 1CURA 2OXGA 2B5IB 2Q20A 4PG2A 3ZT6A 3FU7B 4BFBD 3U79A 1CLYH 2DBJA 2Q76B 3EFDH 4OF6A 2FT7A 1L3WA 1VZIA 2KBGA 2WD0A 2R23B 3HS0B 4OKVB 4AYDC 3LIZA 1JZ4A 2XI9A 4AT6A 1DQJB 4H1LB 4QRAA 2ATKA 5I6KA 3T4YA 1ZCRA 1WWCA 3PWVA 4O51B 1AGDB 2JKIS 1A5FH 4JQXC 4U4BA 5E8EA 4L2YA 3S37X 3X3FL 4NPYA 3CFBB 3WDIA 3G04B 5E5MA 5DD0L 3GT6A 5FM5O 4R84A 4APXA 4LU5L 5KUMA 3JWOC 4R7LA 4JHWL 3WMQA 5CKGA 2ZYIA 3QW9A 3VG9B 1F90L 4WI0A 3RYMA 4NC1C 1INEL 5C0GA 3T4YB 1XH1A 3ZL2A 5I8KH 3PWVB 1DQLL 1HVXA 4JM2D 2VQUA 4M7ZB 1FPTL 3ZN6A 1SLUA 4NPYB 1AZRA 3IDMA 1RJCA 4KRPD 5E5MB 1AGEB 1CICD 5I9QC 2O6FA 4PJFF 5GRYA 3F7VA 1DQDH 5HJ3A 3LQMA 1I3VA 1XB6A 1HEHC 3QO0A 1KEGH 1VACA 3KPRD 2P5ED 3I84A 4A63A 1WICA 1MCNA 4HWUA 4QWWD 1MI5A 1KJ3H 1A1MA 1J7VR 4ZOCA 4WI0B 3B9VA 4ZMNA 4JM0A 4FFWC 4JM4H 5C0GB 3UBHA 1AY1L 5CZKA 1BQKA 5HI3C 2F7IA 2HKHH 5D7SH 2VR7A 4AYID 3IDMB 5BO1L 4PWHA 4JRYE 2AK4E 3RWJA 3F7VB 1RURL 1VGEL 5LN8A 4A2HA 5HJ3B 5ITFA 4E9RA 1KJVA 4KNTA 3QO0B 3WIIL 4PH8A 3MX0B 1VACB 4FQXC 5DWPA 2A9NH 5IB3A 4NQXB 4PGDA 5EDXA 1MI5B 3X3GL 3WKML 2YMTA 1A1MB 3DROA 3FB8A 3PP3K 4HPYH 4NCC1 3T65A 3VI3A 4E42B 3U30C 1FO0A 5L4FA 3AREA 4GAGL 3VX1A 2FTAA 2PMZA 3DXAD 3FTZA 3RWJB 5I8EA 1TQSA 4ETQA 2J5LB 4L1LA 1RZ8A 3NIGB 1T03H 1KJVB 4XNYH 3KVDD 3VJ6A 4YDIH 2N3JA 4HIPA 5CBEA 4QT5B 3KPSE 4J4PA 5IB3B 4PGDB 1YYML 3DROB 4DTGL 1HS6A 3VI3B 1E4WL 5FHAL 4BSVB 1T4KB 3FHAA 2E75C 4UOW0 4DK5A 4ETQB 3R1GL 1LM8V 2K0RA 3G08B 1RZ8B 1YN7A 5CBEB 3WFBH 2WVSA 4V2CB 2CJTA 3A4AA 4LNRA 5ERWA 2WXNA 1QP1A 3GMQB 5C09E 3CVHL 2GJ6E 2L4OA 3K2UH 2CE6A 2F08A 5CU5A 4OZGF 3APDA 3VM5A 4KKBC 1SY6L 4LO9A 3BUQA 1OM3L 3QG7L 3D51A 4E68A 4I87A 3DJRA 2EAEA 2JELH 2G3MA 4W4NA 1O9ZA 3S4SB 4WCYL 1ZA3B 5AG8A 3BGMB 3I6LE 1YN7B 1EUTA 2Z31C 3BQUD 5B1JA 3RB7A 5DMIH 1ZHLA 3T2LA 4LNRB 5ERWB 5I1IL 4YSUA 1FDLL 3ZRSA 4OUOA 1J5OH 4M56A 4QHLA 1MREH 1V8HA 4C54A 4XBEH 1IAIM 4QRSA 2V7HA 3HNTH 3OHXC 3BPOB 3G5ZA 4X8JA 3CVIL 5IFAL 3V4PB 3OMZA 1H5BC 1ZHLB 4MVBD 2AMGA 4U1IA 4BD4A 4IOFD 2N01B 4FI8A 1MW0A 2R56H 3CSFA 3WXWH 3I3BA 4QHLB 1A7OL 2CGRH 1IUZA 1J1OL 2V7HB 1XCQA 5I1JL 3OAUH 1AMXA 3AADB 4X80L 3G5ZB 4X8JB 5D7KE 3GRGA 1DQVA 3QUZC 5AKTA 3VXRA 1IBDA 4GT7A 5F0JB 2XWTA 2D0HA 4PRPB 4LQFL 4HGMA 1QFUL 5KJ7E 3TO4A 5KW9H 1WK0A 4N3TA 5I16A 1PKOA 4FJYA 3QULB 1EEYB 3CCHA 2LHAA 4GH7B 4JRWA 1HSAA 4GG8A 2YA2A 2CIKA 4ODTL 3ARED 2OW6A 3CFCH 4IU2B 4YGVB 4NN7C 2VXTH 1WTLA 1XCQB 1A9EA 2VLME 1T66D 5LGHH 2VMJA 1ZHKA 4ODSL 2OL3H 5DJ2A 3UDWC 1A6UL 1AGCA 2J20A 4GO8A 5AZUA 2XWTB 3IJ7A 5JOFA 1UB6A 4NJAL 3I74A 4XO8A 2K8MA 4M6ML 5IIEB 1DCEA 3CCHB 5CN3A 1GYCA 5DC0A 1YA5A 2D03L 3UGUA 5FCUL 4GG8B 5F7WC 1K6QH 4ZI8A 4TS6A 3OMIB 2VDMH 4XP1L 1A9EB 3BUBA 4H0HB 5DJ2B 1AGCB 4XPGH 5H37A 4WY7L 1E6JL 4Z7WF 3KLDA 5BS0A 5DHXB 4NHUA 3T0VA 4R7NB 1KC5H 2BSRA 4YO0A 2JCWA 1Q72L 2ZX9A 2A9AA 5AZ2L 4PJ7F 5K33A 4MDIA 4WVRA 2YQBA 4FZ8L 1HL9A 1MAMH 2QHLA 5E2VH 2CK0H 5DGQA 2AERT 2B9AA 1E65A 3DX2A 1IBYA 2APSA 5D55A 3IKCA 3S98A 3US1A 3MBXL 4HOXA 1ANUA 2VJXA 4H0LC 5BS0B 4NHUB 1EAJA 4TQPA 4YFLF 2BSRB 4PJ6A 4AIZA 4XWGH 1BMWA 3S6CA 1UOVA 2QGEA 2ZQKA 5ALCH 4MDIB 4MD4A 5FYKH 2ICEA 1IC7L 2NNCA 1KOAA 2ESVE 3LH8A 3QCUL 5KYYA 4ZS7L 4OCRH 4Z9KB 3EOBA 3LKPA 3HBQA 3MUZ1 1BQSA 4HFUH 1B4TA 4DOHB 3PWPA 5JW5B 4NEHB 4EZKA 2YUWA 1CIUA 1D7BA 3M1BB 3MV8D 1UYWL 1QTPA 2KYIA 4ODUB 4UAOB 2V9QA 4HCGA 1ZVHA 3UO1L 3LKRA 2NY5C 4FA8A 4NZRL 3RKDC 1SLXA 3CUPA 1YEJH 4KI1A 3G6JE 4KKAD 4PI0A 4EZLA 4QHKI 4Z7NF 1EJOL 2CKBH 4YDMA 2KUTA 3L3JA 4MD4B 2ICEB 3JV6A 1HCVA 3RLSA 1KIPA 2F19H 4BUHA 5JHLL 1ZLSH 4WZ9A 5EUOF 1IGCH 1ZPUA 2CM6A 3LKPB 3PWPB 3WKPA 5HI4C 3DX0A 3VXRD 2GCYA 5ESAA 2VDKL 3UGEA 3FUFA 3TO4D 2X28A 4PJIA 1OAUL 3CUPB 3KPQA 3SBRA 1TEYA 4IDJH 4ZW8A 4PYGA 3WFZA 4N6RA 3ROLA 3JV6B 2CUHA 4KWUA 3ROOB 4U1JA 1KIPB 4QOKE 3BUYA 1FWXA 4FMFA 4KKZA 1IAII 4QYAA 3DURB 4XBPA 1VEPA 2JKTM 4KVPA 2OZNA 1ID2A 2COVD 3PPEA 4DP8X 4NQTA 5ETUA 1HK6A 5F2FA 5CBAB 3SE3A 2GCYB 5ESAB 4XMKH 2ZKHL 1F5WA 3R8QA 4PJIB 1PLGH 2MTAA 3KPQB 2WOYA 3SYPA 1LO4H 3D12B 1KB9J 3QEQE 4N6RB 5TE7L 2NXYD 5BUPA 4X6EB 3ROLB 4M5ZH 3MLXH 4KKCC 3ZDXB 4U1JB 4MB3A 3BUYB 3HNSL 4PB0L 4XBPB 4FG6D 2BK8A 4YBQC 4FP8H 4RFEA 3ARZA 4N5ED 2DWEB 3BKMH 4LSUL 1ZIAA 3QRFM 4JGJA 2J21A 4L8BA 4PV1C 4TTDD 3PY9A 4F92B 2ED6A 1DVFB 2JE8A 1KWKA 1I8LA 5T3ZH 1RZKL 4FNRA 4CJ0A 4UM8B 4ZUVA 1FCCA 4YFLI 4G1EA 3US0A 3HNVH 3II2A 1OV8A 3GIVA 4WTXA 4LCWE 4Z78A 2DLHA 2E5EA 1KT2B 1SMDA 1HCFX 3B4NA 1F97A 3DSFL 3QH3B 1C08A 3T2NL 5KTEH 4RFEB 4OFKA 3MCYA 3KYKH 4FYQA 2R0KL 2ZSVA 3MUGB 3KWUA 4AC2A 5JMOC 2V5SA 3ABZA 3ARPA 4GPVA 4YL9A 3VI4B 2V5MA 2DS4A 4QPEA 3RZCD 3OVUB 5BZXA 1ORSA 2OULB 4G1EB 1KYAA 3GIVB 3H9SD 3HC2A 4Z78B 3WNKA 4U7MA 5L9DH 3V7AG 3OBAA 1VERA 2ITFA 3L4CA 1C08B 5JUEH 1CLYL 4YE0A 1HNFA 1KCSH 2DKSA 1L0XA 2ZSVB 4W4OC 2BOLA 3FQYA 4X7EC 2QADC 2HJFB 2HTLC 3FO0H 1MHPL 3G5XA 2PPAA 3VFPA 1QHOA 1DBKH 1QKZL 2BOBA 3EJYC 3FTXA 4TQEL 4HH9A 2EVIA 1RZ7L 3RVWD 1A5FL 1ORSB 3U0PA 3IGKA 1Q90A 1FUNA 3IF1A 4EMZA 1A4CA 2LLGA 2UX7A 2WO3B 2WTRB 2RMNA 5EZJA 2HT4D 3CTTA 4YZWA 1TNNA 4AL8L 3AB0C 4OUUB 4OQTA 1KBVA 4K3DH 4XWOC 3IDUA 1MWAL 3G5XB 4YC2B 4UQCA 3VFPB 1AOHA 1MRFL 2VKXA 2BOBB 3MZGB 3O6LL 4KVNH 4M6AA 4NS0A 3NCYP 1JD7A 4OIAA 1V10A 2Z8WC 5C6TL 2YA0A 2HT2D 5E24E 2GQHA 4MXVF 3WIAA 3IF1B 5KSAA 1UWEL 3FUNA 3QEGL 2ADGA 2XPYA 1DQDL 3DWTA 4U0RB 5EZJB 2D7PA 2OI9C 4IRJD 5D1ZA 5T5NG 3BRGC 4LSQL 5IROD 1CXLA 1IGYA 1TIUA 5C0AE 4EEEA 3G6DH 2OYKA 1RPQA 1KJ3L 5IF0A 4P2OA 3C8HA 4TL4A 2CWRA 3NGBB 5AOJA 3DHMA 2RGSA 3N40P 2ZX6A 1IBHA 3JTSB 1ZIBA 3NTCL 4H1LG 3BO8B 3MNWB 2ADGB 3LPWA 3R7QA 1N0XH 1C12B 1LP9E 1HDMA 1SDYA 1XQ4A 3KCPA 4XPAH 5D1ZB 3W3BA 4ABUA 4A55A 1A7QH 1IGYB 4RLDA 3MGTA 2A9NL 2XV0A 1OXYA 3DYPA 3GSUB 5D1XE 3IK2A 2PO6D 3I3DA 2WVUA 3IFOA 4QD2E 4U6XA 4AIOA 4RDBA 3VRJA 1FGVL 3RTLA 1E4HA 2W80C 3BGFC 3CDYA 3GMPB 4NM8L 1YEGH 3T0DA 2C9VA 3SDDC 4X4KA 3QZWA 2J57A 1KCLA 4JFFB 3DI2B 5B3NA 1E30A 3KXFA 2DMCA 4XI5C 5CIPB 1NGPH 3E1ZA 3GO1H 5J57B 4MXQC 2ADFL 1CBJA 4B5ZA 4KQ4H 4OU3A 4V2BA 1NFKA 2LU5A 3HA0A 3IFOB 4AYBA 3UH8A 3VRJB 1EXUA 3GSOB 5E8DH 4AUJA 4NHCL 4BQCA 4MNQE 3QZWB 3ESOA 1CDCA 4XN8A 3GMOA 3KXFB 2QV2A 3HI5L 2ODHA 3CIQA 4BA0A 5HYJD 4N3UA 2BP5M 3IDYB 3RIKA 3ZE0B 3OWEA 4QUOA 2YD1A 4NP9A 3CZGA 3QQ3A 3J7HA 4JHBA 3FK3A 3MRPA 4N26A 4OLUH 1HE7A 4PWGA 1EXUB 4I9WE 4YR6B 3B83A 3MRRB 2RTTA 1F4HA 4YSDA 1NCBH 4CVZA 1QPXA 2VWEE 1HILA 3GMOB 2YSSA 3ALXA 4RWYL 1LTXA 1CZ8H 1H8LA 3ETSA 3MV9B 2BY3A 3QQ3B 1RIUH 1Z3GL 3NESA 1J5OL 2UWEE 1MREL 1OAJA 3SPVB 4D2NA 4S0SD 3MRPB 3NZSA 2DLTA 3CSGA 4ZS6D 1CMOA 5KSAD 2WO2B 3I75A 3MNMA 3QR2A 4YEFA 4CVZB 3D4CA 3OSKA 3ZZ1A 3FCUB 3KM2A 4D7PA 5EEUA 3UYOD 2CHXA 2YSSB 2GI7A 1B2YA 1YRKA 4UOW1 4G6KH 5E2UH 4AW7A 2OJ1A 2A99A 4ENEC 5BVPH 5MHSD 2VXQA 3UMTA 1MY7A 1CG9A 4HJ0C 3NCCB 3UL4A 1FHNA 3AMLA 1A7RH 3LX9A 1SHMA 2R56L 2YGQA 4P2OD 4V1DB 2G5BA 2NUPA 2WM0A 4X5XA 3OGOE 3FB7A 5D71L 3GUTA 1EXHA 2WLJA 5CUSH 3QXUA 4FQJL 4TULH 1S46A 3OAUL 2HLAA 4ZTPH 4P3DA 3OQ3B 2VDPB 2R83A 2XPZA 3OXSA 4Y4FA 4WHCA 2Z8RA 3VTAA 2Y1YA 2F0CA 3HUJA 1HL5A 3S4SG 1CG9B 2PYFA 2QHRH 3U36A 3NIFB 3N43B 4HKZA 3F05A 2FH8A 4NJ9H 4ZODA 2DL2A 1OK8A 3D6GA 5J6SA 4DHLA 2YD2A 4JG5A 2YPKA 2CR3A 4PS3A 4X5XB 3LZQA 1AG0A 1DLHA 3GUTB 2VXTL 5CCHE 2KZ1B 1ET8A 3HZMA 2VL4A 4HP5A 1TF4A 4P3DB 5ADOL 3GZOA 3QDMA 2XWRA 3OXSB 4I13B 4P23B 3WIFB 2DKUA 3FXIC 4Y4FB 2P1YA 2GABA 4LARL 1QWHA 4AEIL 1M71A 3WTUA 3APFA 4DPCX 4QY8A 2PYFB 1UG9A 1M7XA 3ARRA 3U36B 1Z0NA 3CQPA 4YHLL 4KZEL 4DK6A 4UT6H 1N2RA 2BOCA 4FHKA 4GNKB 2WZ6A 3K71A 2YPKB 4JN2A 2Y7MA 1EDHA 1I7ZB 2YPLE 4MAYA 1DZ0A 5E8PB 2DJ4A 3HZMB 1MFAH 3TO2B 4EI5C 3QDMB 3QUMA 1D5RA 1UA6H 3R7RA 1Z66A 3V6FA 1DEEA 5EOQH 4TQ8A 1QI3A 2BRQA 5HDLA 1ZT4A 2MNWA 4QY8B 1MJ7L 3RB5A 3EIFA 4LSSL 1YYLH 3Q7JA 5E2VL 1MAML 2BOCB 3TA3A 2W65B 3K71B 2CK0L 4JN2B 4RQQA 1UWXH 3KR3L 5E1HB 1S4IA 5MEOA 1Q94A 4MAYB 3TBCA 2X4QA 4GSDL 2R29A 2F53B 2NSQA 1CFNA 1T0MA 1TDQA 2N7SA 3GSNA 4Y2DC 3GM0A 3RGHA 3QUMB 1E4KC 1PQZA 1RZKC 3P30L 4UNVA 1R47A 4DN4H 3NJGA 3V6FB 2WMPA 1DEEB 5CILH 4C83A 1R3HA 1ZT4B 4XWGL 1I8AA 3V9FA 1YZZA 5ALCL 3BD3A 3WLWC 3AU0A 3TA3B 5HHNA 1S9KC 5HHPA 2D7TH 4RGOH 2XVGA 4I0PB 4RQQB 5FWQA 3V4UL 1MFBL 1Q94B 2J1KA 5MEOB 3FZUC 2X4QB 1PLBA 2EUZA 3HS9A 1T0MB 3OB0H 3GSNB 4PW3A 5F9JA 5T1KA 2ZE0A 1DCLA 1PQZB 4QKTA 1H19A 1QLRA 1GR7A 3CLFH 4MA3A 5KN5A 4D9QD 2WMPB 4R4NC 2ZKMX 1YEJL 5FPIA 2ZXCA 4LOVA 2XV2A 2VLKE 3HKZA 2CKBL 3CFUA 4DVRH 1VSCA 1EO5A 1UD8A 4E2OA 5HHNB 3UAJA 2P44B 5HHPB 4O02H 4HBCL 3VDAA 2F19L 5EV7A 1BCIA 1ZJAA 2Y25A 4WRLA 1IGCL 2BFVL 1M1XB 1MXGA 3BIAX 4Z3HA 5T1KB 3ARFD 5AB2A 3UAAA 1NGWA 4PTTB 1QLRB 3S3CB 4MA3B 5KN5B 5A2KH 4KXDA 5EU7C 5DVNA 5C71A 3OPZH 2FATH 3ESUF 4XAWL 2VABA 1JGIA 4KJQC 4R7DB 3CHQA 2YOAA 1BQLL 2KKQA 1E90A 3B9KA 4AL8C 1R24B 5ECGA 2DM3A 3KLHD 3D0AA 4IBWA 1I53A 5IFHH 2NQDA 3IPFA 1ES0A 2G5UA 2W9LA 1AKPA 5DA0B 3FU0A 3P3UA 3CPLB 3QUYD 1JHLL 3QDMD 1EFXD 5DXWA 2IFGA 4XMPL 3RVXD 4IHBA 4FGMA 3W9EB 2J8UE 4Q56A 1M7UA 2VABB 1G7JA 3B9KB 3MLXL 3L4WA 5E23A 4I85A 3Q8CA 4OCYL 4S1RL 1DANU 1OCRB 5D1QA 1ES0B 1QHPA 1G0YR 3BKML 1U8QB 1MDAA 4HSCX 2VL5A 1T22B 3V8OA 1KN2H 5IVZB 1P4IH 4FCHA 3NJFA 5IP4A 1WZLA 4JN1H 3TCLA 3ZSTA 2KLSA 3CK0H 1G7JB 4LCCC 2XQYK 3QDGE 3HNVL 3BAKA 1CC3A 2IADB 1YUHA 5BRZB 4QXTA 3WENA 1AQKH 5D1QB 2R1XA 4MS6A 2B1HL 4R5VA 1LWHA 3PRZA 5HXMA 1U58A 3QUKB 3WBDA 4E9LA 2ZCLL 4KK8C 4OCSH 2VL5B 5DR5H 3T3ME 4F91B 4LASL 4EN2A 1BJ8A 3BUIA 4ZUWA 4HUVA 3FS9A 3CFKB 3TCLB 4QXGH 1SHXA 2C7UA 2ADJA 4WENB 1VESA 4W6YB 5B39A 2YK1H 1JUFB 3QNYB 3SZ6A 5EDSA 4OV6F 3TESA 3VD1A 4PY8J 2R1XB 3R06A 3ZTJG 5JUEL 3DPDA 4EDXA 3N9GL 1G7IA 1OALA 4JHZA 3GMLB 2OS7A 3DOSA 5IGXH 3MJ8A 4ZUWB 5LBSA 5GRJH 3RQ3A 2UX6A 5A7EA 5GGRA 2X2YA 5I5IA 1CYWA 1CGYA 3Q3GB 3UAJD 5B39B 1QFWI 2VM4A 5IV2A 5JPNA 3TBVA 4EDXB 1TXKA 2Q7AA 2M8XA 2FK9A 3GI8L 3FHQA 1LVEA 3NFSH 1G7IB 4PLKC 4PJ8B 4K3DL 4MAZA 4G7YL 2F58H 2F18A 3DOSB 1NAKH 4E9YA 2KL6A 3T8XB 2DI7A 3V7MA 2OX5A 3KH3A 1EHLL 3TZVA 1UD5A 4PJBA 1AR2A 2CZNA 8FABA 4LEXH 2VRKA 3OKYA 3VXQB 4ZTOL 5IV2B 3RL1A 1IVLA 3VACA 5JPNB 3ARUA 1JZFA 2XTSA 3TBVB 2VR6A 3HEIB 2MQGA 1N18A 1O7DE 5FGSA 1GZQB 2JNZA 3TTSA 4B9PA 4K3HA 2YMXL 5EPMA 4YPJA 3G6DL 3RPIA 1XF2B 1UT9A 3EHBB 3LHAA 2KQNA 2OZ4L 4P2YA 1YCSA 2MPAH 3DIDA 3N85L 1U3HA 2PCXA 2OX5B 2ITCA 3TZVB 4PJBB 3EF7A 1F45A 8FABB 2WBJA 4L05A 4Q6IA 4QXUH 4H44C 1CTMA 3U0WH 4NCC2 5LG1A 1KXVC 1S7SA 5KVGE 2VDOL 3QFGA 3S88H 1KBGH 5DYOB 3RPIB 1AANA 2V3DA 3EF4A 5KJRH 2GK2A 3SKNA 3PL6C 4XO5A 1W15A 1BEYH 2V5RA 3RP1A 1U3HB 3LD8C 3O4LA 2WQUA 4JZJA 3D5OF 5EBMA 2WBJB 4Q6IB 3B6SB 3O0LA 2YXFA 5DEGB 3C5XA 5DVLA 4XH2A 3QIBA 1I31A 4Q9QH 5JXEA 1NGPL 4HXBH 3SKNB 4IOIB 1X9QA 4KQ4L 2DIAA 5KANI 4WWOA 5CWSA 1M42A 3MA7A 1Y0LA 1HZKA 3O4LB 2A9BA 3ZQWA 4JZJB 1IEBA 1DUZA 1ZVYA 3DYMA 4NKQB 5E8DL 5EBMB 3VD0A 1THAA 3TTYA 2ZXAA 3FUDA 1DYZA 5TGBA 4LDEB 2VZUA 4XH2B 2K7QA 3B9DA 4OLYH 1ROCA 5SWZE 15C8H 3P2BA 3Q8FA 2C9PA 5JHDB 3RX9A 2MCMA 5LKNA 3V7AE 5IREA 5CWSB 5GGUA 1B2WH 1Y0LB 4LVOB 3HOGA 1IEBB 1DUZB 4P4RA 4NQEA 2ZX8A 3DX9B 2PYEE 3C6LA 3M46A 1REIA 2HRPH 2F68X 1I8MA 4JDTH 3VE0A 2GY7B 5TGBB 1S9VB 5BRQA 4XX1G 3QJFA 5EEYA 2ZPKL 3ATBA 2B1OA 2X3BA 5HVGB 1AXSA 2B39A 1GL4B 2FO8A 1M6OB 5CJXC 1UEMA 3BT0A 4P4RB 3TZVD 3GXIA 4NQEB 2EKSB 1XF3B 1F8TL 3A24A 3BT2H 3P54A 4PRNA 3ZKNC 3C6LB 1QWNA 3B34A 1IIIA 3SBWA 2O61A 4J39A 4WUKH 2P28B 3VE0B 4KDTC 5DF0A 1F00I 3C60C 5E2UL 3WKQA 4BUGA 3QJFB 4G6KL 4KI5E 3QHTC 1GJIA 3UTSA 1AXSB 3QZWG 4GKLA 2DMKA 1A7RL 3OC5A 4NZJA 5KS9E 2OXHA 3UC0H 2FE0A 3P3YA 1BOYA 5DZLA 3TBYA 1RY7B 4JFDB 4NAJA 4F2MA 2O61B 2WBJD 1Z5YD 3RDTD 4HU2A 4P2RA 4ZTPL 3TYGL 2BP8A 4YEEA 4YHYC 1FO0L 2D7MA 5I5RA 3NPSC 3Q5YA 4IHOA 3SPHA 3E8UH 4Z77A 1SJVA 5DEZA 5KZCB 2Y07L 3NCJH 3RX7A 2QHRL 1T6BX 1S7XA 2ITEA 2VDMB 1CI3M 4ZYKA 2QSQA 4NQSA 3REVA 4BQBA 2WWKT 2BJMH 3G6AA 1SEQH 4JFXA 3IPEA 3TBYB 2J5WA 5G2NA 1LD9B 4P2RB 1PJWA 4DWHA 1JOIA 3QIBD 2YLHA 4IHOB 2DBLL 1KYDA 4Z7QB 4UM9A 1P1ZA 2GT9B 1FAIL 4FERA 2JTYA 2WNWA 2ZZUT 1MLBA 3TJHD 1WT5C 5E56A 2A0LC 1Z0MA 3AQZA 1S7XB 3LKSA 4CBPA 1YEFH 2X9YA 5BQ7A 4NQSB 1Z9LA 3N5AA 4A67A 2R2EA 4D7BA 1SOSA 3G6AB 1BIHA 2KT6A 2W88A 3PIQA 1D6VH 1NAMA 3TWCL 5CJ8A 2P42B 1PD0A 4X8XA 1O7DC 4P8QA 4UM9B 3BI9X 1P1ZB 4R2GD 4HEPA 4JHUA 5EOQL 7TAAA 4IOSD 1TJIL 2JJTC 1WV7T 1K85A 5BQ7B 3RILA 5KBLA 2HVBA 2QVMA 3I6GA 4A7SA 5EIVA 5IJKC 4TVPE 2R2EB 3GMMA 3CZLA 2FGZA 2W92A 2RAMA 1WCBB 4N9GA 4IS6B 5K59E 1JL8A 4R6UA 3PIQB 3KD4A 1OWWA 2BY0A 1NAMB 1NMAL 4YNYA 2GITA 4NQVA 4PJ5B 1W72A 1MI5E 4RMSA 1DQKA 2BVQB 5CILL 3UMNA 2QMKA 4OT1L 5DJ6A 1MCWW 3FPYA 5F44A 3UJIH 1WUNT 5B3JE 2IFFH 5DU7A 3I6GB 2D7TL 4RGOL 3T8MA 2BSTA 3GMMB 4UNUA 4CGTA 3EYFA 4X50A 1YNTF 3NIGE 3UIYA 2AJYL 3RWIA 3OMNB 4B0MM 4KOBA 1I7RB 2NZIA 3SDXA 5J6HA 5IR1A 1U42A 1UOLA 1W72B 3UTSD 1GSMA 3VWJA 5DRXA 5EN2B 1IKFL 5I15L 2EUWA 2IBZY 3QRLA 1FN4A 2EEFA 3RUGA 2F6AA 4M9PA 2OSLA 4WI2A 2BSTB 3HAEH 3MODL 4IIZA 1QFPA 5DMYA 1S7RA 3K6SA 3QT2A 3EYFB 4UQAA 5HVHB 3RWIB 3BKYH 3U9UA 2EZ0C 4LB8A 4NRZA 1BBDH 5D96C 4OF3A 5I0WA 3SDXB 4ELMB 2C9UA 5J6HB 5KAQF 5K9OB 5JW3L 3EO0B 4JPWL 4LZKA 3VWJB 5JW4R 1KPUA 2FATL 3VXPA 4YS4A 1GTFA 4TSAH 4JM2C 4TLSA 4G5AA 1UZ6E 4KRPC 2MCPH 3RUGB 3VSQA 1WAAA 3V55A 1CICC 1TJHL 3K6SB 1JGEA 1S7RB 4P2QD 2F2HA 4CC4C 2AEWA 3QORA 1JTOA 3MUY1 1XTLA 3QZBA 2H1XA 1D3CA 5CEXA 4K4KA 3LB6D 3N06B 4NGHH 2BSDA 3VMNA 2J12B 1J8KA 3B7YA 4HCRA 1IAIH 4PCSA 1KCKA 2P8LA 1UUNA 1U3YA 3BFWA 3K72A 4TUUA 3DSNA 4AQ8A 4Y4KA 2WZPA 1KTBA 4UANA 3QORB 2W07A 3DYOA 3GMNA 2O6EA 3RIAF 4DW2L 2N56A 2PLTA 3WDHA 1ZKAA 1KN2L 4OIBA 4U0QB 4WK0B 3IBOA 5GSRB 5JDSA 3MCKA 4BGDA 4JN1L 1VZGA 1KWGA 1PCXA 2P8LB 2QFPA 3K72B 1X5HA 4L4TA 3O3AA 3DSNB 1BXVA 2ZNWA 4Y4KB 3KZ8A 3CNKA 3U7YL 1UJTA 4CDGC 3I9GL 2I9TB 1YEWA 2VKWA 4PRPE 3VUAA 2W07B 3EBIA 2IANA 5DR5L 2ATPA 4HOZA 1PZ2A 4P99A 1LO0H 4WFEE 3WKYA 1E7UA 3UEQA 3QFJA 2IG2H 4P3CL 3DIFB 5JDSB 2GEQA 2AMUA 1GGTA 1PZ5A 4X4YA 4KRNA 2RBLA 4L4TB 2WGNB 1B4LA 1AQDB 2PWDA 2YK1L 4QHKJ 4RCAA 4J3OG 4PG2C 4GT0A 5EMYA 1E50A 1U8MB 2AHIA 3RNKA 1UADC 3BPCA 5DGRA 2IANB 2PUQT 1QHQA 2ATPB 4AV0A 5FLVA 3ZMNA 4EOWL 5JR1H 4Y5YA 4UIKL 4GQPH 5JQ6H 4RX4D 1LNUB 2EEDA 3DPBA 3DTUB 1EZLA 4M7ZC 1PZ5B 4X4YB 1FI8C 4GIPD 3BFOA 2I9LA 2P7TB 5D70H 4ELKA 4NKMB 5IB2A 3M8OL 2VYRE 1EEZA 3UJJH 2BZDA 1GXEA 1JI1A 4PSPA 2QFRA 1EUUA 4HFWA 1JWUB 3BPCB 3N55A 3NFSL 2Q6WA 3V0DA 5K1NA 1QW8A 2V7NB 4ABWA 3ULVE 2AAVA 2A2QT 2F58L 3HE7D 4Y5YB 7CGTA 4R4FH 2DTSA 3DIVA 5A2AA 5EUKA 5JIIA 4C56A 1MCSA 1MHEB 1ZMYA 1HH9A 5D4JA 4PJXA 5AEAA 5JIHA 5HHMB 2I9LB 3FNKA 1MCFA 5D4QA 4G3YL 4MJ4A 1A4AA 4OJEH 3HFFA 4G9DB 5IB2B 4E9WA 5SX4I 1EEZB 2XN9A 1G5AA 4HFWB 1EA9C 1U8OA 3PHOA 4TTGA 2Q6WB 4NB7A 5BS0E 3W11D 2NTFB 4IOFC 2XSKA 4Y89A 2EIBA 1ZD6A 3WN5C 2MPAL 2VXSH 1JFHA 2VDRH 5EUKB 4PJDA 2TSAA 4YXHL 2ID5A 4J27A 4K94H 4BH8A 3FL7A 3WEXA 4GSUA 3CH8A 4WW2F 3U0WL 5B21A 1UM5H 1OAXL 3ZK0A 2YGNA 4DOHE 1LYQA 5HGBA 3OKEB 1YNKH 1B88A 4N0FA 3PGCA 2XN9B 4NM4H 5A3ID 5LXGL 5JW4M 2O93L 1U8OB 3PHOB 5B39G 4LFHD 3TL5A 1BX2B 3IMBA 1NFDF 4QGTA 3MBEB 2XYBA 1SJHA 4WLCA 5CMAA 1W0YT 3TN0A 4PJDB 1ZTXH 3BDYH 2AABL 3W0WA 1WEJH 3GHEL 3AREC 4BH8B 3IN2A 2C4FU 1OAYL 2NY7H 1Z3RA 1T66C 4OF8A 5IW6A 3TCTA 1JTPA 1JN6A 3PWPE 3H3KA 4GLRI 5HGBB 2NY1B 2JKXA 2NNAB 3PGCB 3QJUB 4N0FB 1RIHH 4Q9QL 5FYJE 4B9IA 1NIFA 2BLFA 5KSBB 3AAZB 3VMOA 5BOZG 5CMAB 3TN0B 3U4BH 3QFJD 1AZUA 3EOTH 3W0WB 4E41D 3K3QA 4BSJA 5L6YH 2Z4TA 1L9SA 5BW7A 5TE6L 3OSVA 2D7QA 3OJVC 2I7SA 3JBG7 5IW6B 3SY6A 4ACPA 4ES9A 5I19H 4J6RL 1ZLUH 5DS2A 5F88A 3IXAA 3WSQL 4PJIE 2FB4H 3RIAK 5E95B 3QDJA 4QYOB 1B2WL 2F7PA 3T0WA 5TQ0H 3B2UC 4OQTL 5F3BA 4HKXA 4PLJD 3ZDXE 4KNUA 2ICWJ 3D48R 4F5CA 4N0YH 2P49B 1MJUH 5CLZA 5T3XD 3BH8A 3J8F7 5LAXA 1JZ7A 5B1JC 3P4NA 4E5XB 4UI2A 5F88B 4YDVA 3IXAB 2FWOA 5DZAA 5GS1A 1HESA 3QVAA 3H42H 3QDJB 4LLQA 5AKVA 4C56D 5FCSH 4HKXB 1F42A 2QT6A 3CHPA 1JHKL 3L48A 5MEQA 5FGBC 2G9KA 3UZQA 5FO8B 1MEXH 1M53A 1BFTA 4OF5A 3BH8B 2YRPA 5LAXB 3QQDA 3VU1A 1X4XA 2HJKA 2HWZL 4YDVB 1DJXA 2XC8A 3UFIA 3M07A 5EU4A 3LHPL 2FWOB 2IGFH 4ABQA 3VI4E 3NFPB 4IBZA 5IVXF 1I7UA 4LLQB 2YD7A 3QBTB 5I1KL 1JDAA 2GY5A 3CZJA 5TK4A 4Y1SA 3UC0L 5ICZA 3QRGH 1F4AA 2R9HD 3EYSH 2I5YL 4K3JL 3UZQB 4J1UB 3Q2LA 1R3LA 1F3JA 1QAWA 3ZKSD 1HQ4A 2FUQA 2YLKA 1YY8A 3QQDB 1GZPA 4NN6C 3NCYS 5INCB 3TO4C 2HJKB 3OKLA 3NCJL 1IAOA 5EU4B 5F1SA 1LGVA 2WIMA 2OMXA 4L8SA 3NABH 1I7UB 3T1FA 3D2UA 3GBMH 1G87A 5ICZB 3S3BB 1SEQL 4L0PB 5JIMA 3MHZA 5L8JB 3QJSB 4UT9H 4WU7A 1W2KT 1CWVA 1EPFA 1R3LB 1F3JB 2I32A 1CL7I 4MMXA 3D1MC 4WEMB 5HDOA 1E5YA 1HQ4B 3WEAA 1YY8B 1GZPB 1G1CA 4U4IA 3IAPA 5DT1H 5DTFB 3MDJA 3OKLB 3ES6A 1IAOB 2APVA 3S5YA 4Z7AA 4L8SB 3T1FB 5IOKA 1BAWA 5LLIC 1EO8L 1P84K 4I1RA 1TCMA 4N8CH 2QGCA 5DZ9A 2E56A 1NPUA 2VN6A 3U48A 2XUWA 3GRBA 3DUUA 4FG6C 4PM1A 3BSZH 3CXFA 4WU7B 4N5EC 1NBYA 1PFOA 1QPKA 3MBWB 4MMXB 1BAFH 3WIHL 2ZG1A 1WC7A 4Y9CA 5DJCA 2ERJC 1YAIA 1G0XA 4ZMOA 2Y2WA 3H6AA 7FABH 1AKJB 3MR9A 4FNLH 4WV1A 1SDAB 4HH8A 2K3HA 1G7MA 5TD4A 3DUUB 5IB1A 3LN4A 1CXEA 2K78A 4FRWA 2NXZB 1NBYB 5IESH 5JIQA 3MXVL 4DP2X 3L5IA 4ERSL 5E8NA 1WC7B 4GXFA 5DJCB 1AAJA 2FDBP 3HRZC 4JO3L 4UAOC 2E3VA 3KPNA 4B27A 3WTVA 4O02B 4KI5F 2K3TA 3C5SA 2XKUA 4QMEA 4C4KT 2HKAA 3MR9B 1GIGH 1YEKH 4XX1E 5TPWH 1F6AB 3CN3A 3LRKA 1KB5A 4WV1B 2WVVA 2OMVA 2PP7A 4KZ0A 3V0WH 1HQRA 1AMYA 4ZDHA 5KYWB 4JFFE 5IB1B 2ISDA 3LN4B 5PCYA 3GSWA 3HB3B 2DM7A 5E8NB 2P47B 2N1TE 4LEOA 3RY5A 3GBNL 1KELH 3CFQA 3QDAA 5JPMA 5H2BB 3KPNB 4ZFQA 3RVWC 3C5SB 1Z9PA 4F9LA 1AD9B 2H0EA 2WVVB 2OMVB 4JPVH 1HQRB 1INQA 4ZDHB 3DBSA 2HT4C 3BDXA 3QO1A 3KXFE 4JG1H 3BKYL 3GSWB 5DC2A 5EORH 3F00A 1EDYA 2HX8A 2O5NA 2ZICA 2NY4B 3ZE0E 4I4WA 1E5AA 4LEOB 4GMTL 4PREA 1JNHA 4YX2L 1BZ8A 4D8PA 3D0VA 5JPMB 4H8UA 3NCEB 2W9EH 4OIFA 3LNIA 3L1EA 5KBNC 5F1IA 2HT2C 3FUJA 4RMRA 3D2UD 3HFMH 2C1PA 5JORA 4PY7A 1IGIH 2MCPL 4HEPG 3LQZA 1HHHA 5JMRA 1KJ2L 1INQB 4RGNB 2FECL 4IRJC 1HCYA 4G5ZL 3QO1B 4UQ9A 3HMXH 1G9HA 5HBBA 5IROC 2X2UA 2FT8A 3SE3C 3CX5K 3IDGA 3G9AB 4I4WB 2FO1A 5E7FA 2C9RA 4ZZFA 3MV9E 4PREB 4GS7C 3SOTA 3GJEA 3PNRB 1ETB1 4CN6A 4X6DA 1ZJBA 2ZXWB 1SDDA 1F02I 3QUML 2FNWA 4DGIH 3C09C 5JORB 4PY7B 2CAKA 3FN0L 1AVAA 1HHHB 5LXVA 1E67A 1MLCA 4FULA 1SOKA 1TITA 5FF6A 1SXZA 3QFDA 4PEEA 2E7MA 3PDDA 1AXTH 4A2EA 1E8YA 5DMKA 3IDGB 1H8NA 4IM8A 4ODVH 2WBWB 3V0JA 2R29L 2CA4A 5ECJE 3CSBA 3GJEB 2EJ1A 4YHOH 4X6DB 3GSNL 1OHQA 3WNNA 2R69H 4V1DE 1SDDB 1OAZH 1NGYA 5KBPA 1UASA 3F6LA 4CKVX 3O2DA 2J1WA 5GIRB 1RFDH 5EZLA 3S9DB 3IT8D 1TZHA 5AKRA 5B3JF 2NMSA 1CDIA 2J2ZA 3QFDB 5TFSH 4HHWA 4H88L 4AK2A 1WVZA 2BW5A 3EGDB 3IJEA 3NIGF 5DMKB 2WP3T 3C8KA 3L95A 4PSRA 3OQRA 1LO0L 2B9BA 3NIFE 4WQOA 4UUJA 4N20A 4PJAF 3FCBA 4H7VA 5CR8A 1NGYB 5DK3A 1V3JA 4PJGF 1CLZH 1MFDH 5EZLB 1XBDA 4XMUA 2M2DA 4APQA 1TZHB 1D2PA 2IQ9H 4BKLA 2ZXEB 3MNVA 3VH8A 2J2ZB 1WFNA 3IDNA 5LAPA 3IFLL 3RDJA 3EFFA 3ZDZB 3LEVH 3OHMB 5CJQH 5JOPE 1RD6A 2AQSA 1PTZA 5JQ6L 3EJSA 1AS6A 4HEME 1L0QA 4FAAB 4TSCH 3H2PA 1BJ1H 1FF5A 4OCXH 4P2CG 1BOGA 3MJWA 2QVIA 5E1IA 3RFZC 2G3XA 3HIZA 4WKZA 1X5JA 4HWBA 3FQ1A 4DPBX 4APQB 5JW4N 4AVHA 3K8MA 4NQQA 2GPZA 5I75C 5J4MA 3GSVA 3UJJL 4BKLB 3BN9D 2A74C 3MNVB 4X6CF 3VH8B 4D8OA 2R4SL 3EFFB 3F58L 2CPUA 2ZXBA 1JDDA 4I7ZC 4WGWB 1T4WA 2EO7A 4QAWA 5T5FA 3MRJA 4WK4B 1BFOA 5I18H 2YUZA 4QRTB 5JHMA 2PXYB 2B16A 2VR8A 2KZBA 3QAQA 4WKZB 5I30L 5KSAC 2P48B 4UQ2B 2F53E 3GSVB 2VH5L 2VERN 3WCYA 1CFTA 1CFVH 2XNAB 4ONFH 2ICCA 4DP9X 3AJ7A 3PREA 4UTCA 3BIKA 4R7VA 1JSYA 2IALA 4P2OC 5HGGS 4HUUB 2EXWC 3TLRA 4EO5A 3MRJB 2NUTA 1BFOB 4GUQA 4ODXA 2WC7A 3KYNB 5I6XC 1RP9A 2DDQH 5IJDC 1BVNT 1MN4A 1UM5L 3EO1A 1AZZC 4AMKL 4GSQA 4LVHB 1YNKL 2BDNH 4QXWA 5C0BA 1J5HA 4UTBA 4OJDH 4OVVA 4GAJL 3WL9A 1TTUA 2VC2H 3BLKA 2NPLX 1OSYA 1KBPA 3BIKB 3CFTA 1NL0L 2CK2A 4M7KH 1UHVA 3GTVA 3ZLQC 1T1ZA 2YPVA 5FYJU 3BDYL 1LE5A 5IEKB 5B1CA 2YWYA 4ODXB 2ODIA 1DDTA 2NY7L 1QBAA 1D9KA 1TPXB 1YY9D 3EO1B 4ZG1A 3JVGA 4YZFE 3ZTEA 3RWGA 2NYYD 2CMRL 4P2AA 1RIHL 1KPRA 1N19A 3O3BB 5C0BB 4O2FA 5I1LA 3ULUD 3MMEA 4X6FA 1SRDA 4ONGH 1BJ1J 3IDYC 5DWUH 3VFSA 5E5UB 3WL9B 3JWDH 4IRSA 3UXFA 2CBQA 3GZKA 3QUXB 3WTTA 3ZIMA 2WLHA 2R0ZH 1YDPA 1JZDC 3QIUA 2W1NA 4G1MB 1T1ZB 3RE0A 4PJFA 4OFYD 3L5WA 1LE5B 4XOEA 1SFHA 1QR4A 5L6YL 4G2AA 1NIAA 3HG1D 2JMRA 3AUWB 4G8EA 4S10A 3HR6A 2BCMA 3I2CH 5LBSL 4AM0Q 4Y9EA 3NJXA 4LGRB 2WKGA 2D9QB 3RWGB 3D39D 3KDMA 4O2FB 3MMEB 2B3RA 3O6FD 4HIXL 3VFSB 5I76A 2CNZA 2FEDD 4IRSB 5T3XH 3SYQA 1QRND 3MRCA 3O81A 1YDPB 3QIUB 4Y16D 5E99L 5CEZE 5TQ0L 1OW0A 2DYPD 3INOA 4IIQA 2JI2A 2LU7A 3L5WB 4PJFB 3S37H 3TJEH 2C3HA 3RTQA 2EC8A 1QR1A 1ZVNA 1GMEA 4KUZL 3U0TB 3I9IA 4JFZH 3GF8A 3FB5A 3B43A 3LKOA 4BYHA 1J0IA 4P4KB 4AM0A 4R5TA 4L0ZA 1PF3A 4RFOH 2K70A 2UY7A 1SVCP 1I1AA 1AQMA 3BE1H 4CADA 1I7TA 1QATA 2EDYA 3P3SA 3ZR5A 4IIQB 4MCMA 5LDSA 4NO0B 2WLNA 1FFNA 3RTQB 1QR1B 5BRZE 4WFFE 2BY2A 5D1QE 4DP4X 2ED9A 3IE9A 5L2KB 1JPFA 1RZJH 2IDFA 3FB5B 3QIWD 3LKOB 1T1YA 1URIA 5HJBA 4AM0B 1CTNA 3F7RA 5FUCE 2MQCA 4UZUA 1G9MC 2MMXA 5JNYA 2XQBH 1I1AB 4YHNA 4TKWA 3V9EA 4CADB 4BCXA 1I7TB 4MQSB 2CO4A 2QR0B 3RWEA 3WKNA 3KYOB 4W9ZA 1LL1A 3OAZH 5E94B 1QUNA 4NYLB 1CQKA 4XB7A 2WQVA 3NQIA 3EJPA 1JPFB 2ZXQA 3ARFC 1T1YB 4Y4FC 4Z76A 1DJWA 5E9AA 4MB1A 4WHTB 5CP7A 9PCYA 4D3CH 5JNYB 3EXJA 5CGTA 3VXMB 4WO4B 4YHNB 2IBZX 3HKFA 3RWEB 1FYTA 4F9PC 3U82B 3KLHC 3GBML 4E5XG 4HMCA 4XCEA 3LCYA 3CG8A 4YPGA 5LGYA 4LKXB 3WS6A 1D9KD 1QUNB 3B9EA 4UT9L 2FX9L 3NBNA 3ZVVA 3U1SH 3QUYC 5C6WH 1X5ZA 1A7PH 2AQ1A 4E9QA 3J07A 4Z76B 3RVXC 1YO4A 5AVUB 5CD5D 3V5DA 3X17A 3KWVA 2IDSA 1IQWH 3S2CA 3ZTDC 2VISB 4RNRA 1Z5LB 5C9JB 3VO0A 1IQDA 1NANH 5I1GH 1YECH 4XCEB 5CKAA 3MRKA 4EXKA 4YPGB 1RJYA 1JPST 1QNZH 5F7BA 2EDQA 1S2EA 1JGLL 4EN3A 1E40A 1OARL 1BLIA 3QE5A 4LHUB 3HI1A 4CKQA 3IJ8A 2VDQL 3CN2A 1TVBA 4FXGB 2A9MH 3DO3A 4Z0XB 3PLYA 4P59H 4M43H 7FABL 3Q8AA 5C8JA 3M1CA 1SZNA 2JXMA 3SDCD 4FNLL 4OCWL 4PJBE 5I1HL 3TA3C 3B8SA 4XNZB 3MRKB 1JP5A 2J71A 4XPHH 2WXGA 4OF7A 1OE2A 5D4IA 4G6MH 1JGDA 2AQ2A 2CRZA 4EN3B 1T5WB 4XAKD 3MLTA 3P3RA 3V6OA 3HI1B 4A7TA 5C08A 4GQQA 1TVBB 2L7JA 3FFCA 3GTTA 3FCTA 3LDBC 5HHQB 1GJUA 2CD0A 1M7DA 3HAEB 3L9YA 4LNVA 5C8JB 2JXMB 1R5IB 3HHMA 4GBXB 1GIGL 1E4XL 1YEKL 3PFQA 4OIIH 5DRZA 5DUJA 5TPWL 3UTPD 3NH7H 3VI4F 1BLNA 1VEMA 5KVEL 1HL4A 5CAYB 3ZL4H 4JFEA 4YDKH 5EEXA 3B2VH 1JGDB 5AVRB 1ZA6A 5I24A 3MLTB 5FKAA 3RKPA 5C2BL 3NVQA 3KPTA 5J89A 43C9A 1E42A 5C08B 3GWJA 1Y1DA 1KELL 3FFCB 1D5XA 3FCTB 5GS0D 2O26U 3O4LE 4OY9A 1M7DB 4EKXA 1DQIA 4MNGB 3WNIA 2E4FA 3BUTA 5FYLE 3UAJC 3UP6A 4BZ1A 1QSFA 4FS0A 2FAUA 4JFEB 2FQGA 4K5NA 4Z7WA 1TR7A 4JG1L 4MRCA 5EORL 5L7XH 2ZP8A 1ZA6B 3KYAA 5FKAB 2AV7B 5F0PB 4PJ7A 43C9B 1LE9A 4NCDA 5JHDE 2VUYA 4KQ3L 4BXSV 4GO9A 1D5XB 4BXVA 1PYWA 1FYTD 3INUH 4WEBL 2BHUA 3B9KC 3JWNG 3NSDA 1IGIL 4G71B 4U2ZA 1IBBA 2BIIA 4DPRA 1QSFB 4ZAKA 2Q8BL 2J1XA 3H54A 5HY9A 1AI1H 1GRWA 4GEJA 4R97B 4Z7WB 2W0LA 3U7WH 4BEIA 4LGSB 3TT1L 5CFHA 5AQ0A 4XNQA 3LKNB 4RRPM 4S1DD 1LE9B 1P4LA 2Y0SA 4WEEA 5FDWA 3ARQA 2QSVA 1KGXA 2FJGA 2VITA 3BCFA 1AZVA 5CZVH 4NQEE 5AW2B 4YE4L 3B9AA 4JUSA 5SV3A 3F85A 3KJ4C 4NX0A 2XJKA 5CR1A 1PMYA 2UY6A 2WQSA 2CLZA 4ONHA 4GUPA 5DK0A 1NIEA 4MAUH 2WB1A 2IXQA 3SYCA 3ZHKA 1WF5A 3ETBJ 1QSED 3A6BH 3O6KH 5FDWB 4MX7A 4RWHA 1C8QA 4ABVA 2VITB 2FJGB 1OAZL 1H3WM 2DTML 4G7QB 2ATAA 3SYAA 5EUOA 2NNFA 2YQ3A 4JFDE 3GJFA 1DSFH 1KYUA 5AL0A 1UJ3C 3T0AA 1OCZB 2A77H 2ENJA 2UY6B 1WBZB 4L1HA 4ONHB 5E6IB 1SLWA 4GUPB 5DK0B 1GW0A 2LLNA 4CVUA 1RVFL 2JV6A 2R2HB 1LK2A 2ZF8A 5HHXL 4GO6B 4W9DC 4ALAH 4WHYH 4RFNC 5EOCH 5EUOB 2BSEA 3S5LA 3GJFB 2B20A 2X38A 3FQNA 5GRWA 4AQAA 4TOYH 4P2RE 4HHGA 3AWEA 3BAIA 2E7LA 3HG4A 4P46A 3MACH 2IIJA 4Z7QE 3IDJB 3LEVL 2FQFA 2O5ZL 2DWXA 1LK2B 3A4DA 1QTYT 5LHDA 5PAZA 2F54A 2GJZA 3DJ9A 3ZE0F 4WFHE 4OCXL 4R90L 4F7KA 5FV1L 1B4JL 2IPUG 3S5LB 2VDNB 4MB4A 4QO1A 4UILL 4DUVA 2XZQL 2BVTA 4BFOA 3QEUB 4F7CA 5BVJA 4HISA 4AQAB 3U1PA 4EUPH 1JZ3A 5BPPA 2VDRB 3EHBC 3BP5B 4XXDA 5FYKE 4F33A 1N6QL 4NUGH 4UTAH 1D5IL 4LIQL 4HG4J 1IM9A 3X12B 1Y6KR 2F54B 2GJZB 4OLXL 3TZVC 1I9JH 3AGWA 5I18L 4ZPTA 1E28B 2CBPA 5CFAA 2IH1B 2Z65C 2FX8H 5BVJB 3BZ5A 5HSFA 5B22A 4D9LH 3FH5A 4ZAKD 2LR4A 4HCRL 3ZW3A 5L88H 2YQ2A 4WFGD 1QACA 4PJ5E 1X5FA 4AVIA 2AJXL 1CFVL 1UM6H 5DO2D 3WFHB 5LNDA 4XXDB 4F33B 1ESOA 5TE4H 3SGDI 1IM9B 5F9WB 4ZBJA 5KBMA 1YHPA 2V3EA 5FO2A 1PY9A 2WBJC 3RDTC 4ODBD 2XX0A 3QYNA 3HCVA 2C7FA 1FVCA 3EZ8A 4RSVA 1O6TA 5AWNH 2LU4A 2Z1PA 4M1CD 1EZVY 4M6NH 5EC2A 3KWTA 4KBPA 1J5DA 1CK0H 2VC2L 3RWDA 4PGJA 1EMTH 4LVNC 3CHRA 4OD3L 3PP3H 1OIOA 4AYEC 4HJJL 3S3DB 3VH8G 3O6MH 4J3XA 3GBLA 4JZJC 2DEWX 1S7WA 4TVUA 3REWA 3NIFF 3N43F 1AQ8A 1BF5A 2NX5D 1A3ZA 3BESR 4M29A 4N2EA 1YJDH 5DD3L 2VLJB 5E9DD 4JVUA 4LXFA 1PAMA 3QIBC 4LCVA 4GW1B 3SDXE 4ELME 2IAMA 5EC2B 4HVBA 5DWUL 3TJHC 5IB4A 3RWDB 1HYRC 3MRGA 1MFUA 1KTCA 4I1NB 3UYPA 5DJ8A 4MFHA 3CLWA 3MI6A 4LVOC 3RUGE 3T0ED 1L3NA 1S7WB 3REWB 3AQXA 2IH3A 3RIFF 2BSED 1ZE3H 1XGQA 3QR0A 5AENA 2CCWA 2DH2A 3QZOA 2OYLA 5SWSA 1RUPH 2WAQA 5DUPH 3NCFB 4P46D 2IAMB 2ZWKA 4R3SA 5T3ZE 5IB4B 4TUKL 3MRGB 5T3XL 3UYPB 5DJ8B 5CINH 1TTAA 3ERXA 4ICWA 3S37L 4KKPA 1WAAE 2IH3B 4LLYA 5BV7H 1B4RA 2ZAIA 3OJDA 4A37A 2O1AA 1XGQB 3IS1X 4YUEL 4JFZL 4JO4L 4Z95H 5DRWA 2Y5TB 1T7YA 4LIQE 3TBTA 1IBGH 2O30A 5EB9A 4XRCA 5SWSB 5KSUB 4HXAH 2IH8A 2J7LA 1IX2A 5SWQA 3NJMA 4R3SB 4GW4B 4W9HC 2XDHA 3FJTA 5CD3A 3TASA 1E8ZA 3GB7A 3W9DA 4B41A 4KROD 3TV3H 1ZVSA 2X6UA 2ZCZA 3ECBA 4TNWF 4ZFGH 4PRDA 3B7SA 1KULA 1IEAA 4PFEA 3QC5X 4HT1H 1RZJL 1IGJA 4BQ9A 4AWJC 3TBTB 3ASWA 4AG4L 1T3FA 1XCXA 4GRLA 2P9RA 4FQXD 4NBXB 4Z3EA 5SWQB 3CE1A 3KHOA 3D4YA 1GOHA 4OJCA 4GEIA 4BE5A 1CT8A 4ZX3A 4IGBA 1QA9A 5ICUA 5CD3B 3GB7B 3FT2A 3W9DB 1VFMA 3CZFB 4G42A 1E5UI 1IC5L 4NI3A 5I0YA 4L4TE 4E9VA 2BVOA 1O0VA 4G7SB 5ICYA 1BM7A 3EGXA 3MLYH 5EF1A 3RJOA 4PBVC 4WTQA 1IGJB 3B7RL 4U6HA 1F11A 1T3FB 1A1NA 2IANE 4NFCA 4Y7OC 4ZO7A 3T0XA 1CE1H 4A7GF 5DFWH 4D3CL 4L18A 1QABA 2DEXX 4XB3A 3V6ZA 2JFCA 4HZLA 2P5WD 1QA9B 2GTWA 4IGBB 4QHNA 1MFCH 3FT2B 3EO9H 3MROB 2V2WA 2CQVA 4G42B 5FHBH 1X5AA 3CFJA 1II4E 2WLIA 4PB9L 2BVOB 1XGUB 5DD5H 3PE9A 1E6OH 3EGXB 3QCVH 5ICYB 1HOEA 1T1WA 2FYYA 3FU3A 3KE0A 2MOQA 2ZIDA 5CLWA 4IBTA 1F11B 1U8LA 1TU2A 4UZGA 1M05B 3O11A 4YQXL 2IAMD 5EWIH 1VB9A 3LB6C 1GHFH 1FL3A 1GMIA 3LKQA 3O3EA 3WTXA 3LNDA 3MKKA 2C26A 5C0DA 4F15C 1Y6NR 1N4XH 2GTWB 4Z0BH 1TFPA 1G94A 4M8UA 1T7ZA 2BRRH 5DYFA 3W57A 1UH4A 1JXJA 5HHME 4C4BA 5MP6L 3LEXA 4J3OF 3K91A 1XO8A 4BUQA 4JJHA 4JRYA 3SOBL 2FYYB 1SLVA 4BZ2H 3L3OA 3T04D 4JFYA 1U8LB 1TU2B 5AOLA 1TJXA 1CXIA 1X5MA 3O11B 4D0CA 4ZMQA 1FL3B 3O3EB 3AG3B 3LKQB 5DA4A 2A9ML 5C3IA 5C0DB 3JVFC 4CSZA 1DBBL 4KXAA 1P6AB 3LEXB 2XFXA 2X87A 3BKCH 3MRIA 4EQ3A 4XPHL 3WU1A 2HAZA 1UQSA 1XCTB 2EE6A 4JQIH 4O9HH 1RZGB 4P5KA 2XN9E 3L3OB 1RLWA 4HGKC 4KJYB 3LS5L 3D09A 2A3TA 2XQYA 4ZT1A 3KPSA 4D0CB 3LZOA 4MJ2A 5A6LA 2NNXA 3ARDA 1T1XA 4F58H 4NZTH 3OF6A 4PJDE 5DJ0A 4HC1H 1C5BL 1FE8H 3T6ZA 1MNUL 4AQZA 1EH9A 5TF1H 3HMXA 2XFXB 1JF1A 5ACMA 3ZL4L 4G80A 1VDGA 4KHXH 1UQSB 3EYVB 2BX5A 1AIFB 2H3XC 4WI4A 3NRPA 4P5KB 1OD9A 2COQA 3BPLB 1SN0A 2QPUA 4Z7IA 1FSKB 1V7MH 2EICA 3QUZD 4FQIL 5KSBE 4GRLD 1ZS8A 5K39A 1R0AH 3Q8BA 1VPOH 3VWJC 4L23A 3SDAA 3FQTB 4IK6A 4U7SA 5C09A 3ARDB 3LEYL 1YEIL 3IRZA 3QAZC 2GJ6A 4LHUG 5DJ0B 1Q9OB 3MGAA 3W0WE 1OF0A 2MWCA 2HLEB 1UENA 2AC0A 2G2RA 1QLEH 3FO1A 1JF1B 1GOFA 2KH2B 2VT0A 4OR1A 5FLUA 1SBSH 4JREB 4CAGA 5J11C 1OK0A 4F7EA 5I1AB 1UOKA 5L7XL 3WE6A 2A6KB 1FA4A 3D18B 3HZKA 3HE7C 1TO5A 2WYHA 3ZBMA 3SDAB 5MI0C 5F8QC 4LP8A 2UZIH 5GS2D 1YLBB 2X12A 5E6SB 2G2RB 3FQRA 3FO1B 4TNWK 4AV5A 3HAEG 2WSKA 2X1PA 4F7EB 5ISZA 3U7WL 3WE6B 1MVUA 3W11C 2AXGA 3GBEA 4DVBA 3LNHA 3IETA 4X4XA 4GQRA 3WTSA 3QDJE 5CZVL 5GGTH 1S78D 4LQ1A 3D9AH 5JA8B 5IT2L 1X5XA 5AYTA 3CDGA 4F5CE 3KMDA 1G4RA 1E5BA 4IMLB 3FQRB 2OMYB 4RSYA 4TUOB 4WEUD 4AQ8C 5I66A 4JRYD 2AK4D 5A3IC 1C1EL 1GS7A 2W60A 1KV3A 2H1PH 5ISZB 3PQYA 4FQHA 1MVUB 5DZNA 5HDRA 3VRLE 2Y06H 4MAUL 2AXGB 4FI6A 4DVBB 3WFDH 4Z3JA 3IETB 1UGNA 4X4XB 4Z8FL 1PIGA 2QMJA 3A6BL 3SPCA 4HUWA 3ELQA 3H2QA 4K23H 4J6IA 4JJOA 3H8NA 3CDGB 3HHRB 2QZ5A 3P11L 1UA7A 1E8WA 4RAUA 4YFDB 2X9WA 5TDOA 1ZLWK 2W60B 5CP3H 1KB5L 3S8WA 3ML8A 3PQYB 4FQHB 3VMPA 1FZMA 2R8SL 1J10A 5DUMH 4WJKB 3KPSD 1OZUA 3RKDD 4H13C 2I26N 3RY6A 3ECVA 4YOKA 2ZKWA 1WWWX 4HS8H 4XPTH 4Q58C 3VFUB 1CB4A 2PETA 5EOCL 1YSOA 5DZOA 1S3KL 3AGVA 1CTOA 3RU8H 1MRCL 4U1SA 3DJSA 2FBJL 2XN2A 1ZV9A 4ZXBD 1GGCH 4RAUB 5K9JH 5TDOB 4WTWA 1A7NH 4UV4L 3TA4D 1Z6JT 2OW7A 4IRZH 4S1QH 1FZMB 4ZX6A 2EE9A 1IAMA 3O9WD 2YGPA 5C09D 4RAHA 1TLKA 2GJ6D 2WN2A 1AJ7L 4GRMB 4PLJC 1NLBL 5IMOA 3TWYA 3ZX1A 3H6JA 2D0GA 4HALA 5GISH 5FYKU 4XN5A 4MA7L 5HGHA 2NY2D 4ZMXA 1KFAL 1YPZB 2XZCH 4U1SB 5LDUA 2YXMA 4MDJA 2DPKA 4XVSL 1FLTX 1H3VA 5D93C 3MLRH 5A2IH 4LLDA 3I6LD 4A04A 5HPMB 2J4WH 2NR6A 1XMEB 3F12B 1NICA 2VXUL 2WYZA 2EDOA 2J6WA 4ZD3H 1L9PA 4DH2A 4LCIL 1UKTA 4L5FH 2ESVA 2FX8L 3CH1B 3MLZH 4D9LL 2F5BL 2BNUA 2HG5A 2JJWA 4MCZB 5HGHB 4JVWA 4PWKA 4ZK8A 4MDJB 1AO7A 1MG3C 3VGEA 5E8OB 4UU9A 5DQJA 2EYSA 1Q9WA 3JWNE 2K1MA 4BWWA 2N59A 4POZD 4MQ7B 2VZOA 3U9WA 3UZEA 4FXKA 4P57A 1GAFL 5TE4L 4M3JA 3VAEA 2Y69B 3MJ9A 1KCRH 5EU6A 1ORQA 1RZJC 3S8FB 3ML9A 3VD3A 4JJ5B 4JE4B 4Y19A 2FWSA 1TSHA 5GGVL 2HG5B 2BNUB 2NT0A 1HL8A 5FK9A 4DO5A 1JZ6A 4OLZH 1GZHA 1AO7B 5IBTL 3O2DL 3S5LG 1CGXA 3MRMB 2WNGA 4M6NL 4OLWL 4UU9B 5D7KD 5DQJB 1F1AA 1Q9WB 3NQKA 1CK0L 2DLIA 4MKMA 4DO6A 5E5RB 5M94B 1PX3A 3NACL 4FXKB 4P57B 3ULUL 3IJYB 3O6ML 3ZL1A 1OGAA 5EU6B 1ORQB 4KO5A 4DKFL 2DD8L 1BFVH 5I0XA 4Y19B 1XGZA 4TNFA 1MCPL 1YJDL 5FK9B 2F1BA 2VLMD 4U1KA 3Q5OA 4P5TA 4FF9A 4Q4IA 2XWEA 4K5PA 3VWKB 3GBDA 4QF1A 2XRAH 3JYBA 4DGWC 1DQML 1OGAB 1RZIA 4B6ZA 4NZFA 4I77H 4J23A 4L4VB 3MCLH 4GOSA 4RGNE 3ZIYA 1EJ6A 1QX1A 2H26B 2ZCHH 3GI9H 4U1KB 3U6XS 3ZHNA 4P5TB 1AP2B 1RUPL 4XB8A 4FLSA 5DUPL 4HWBL 3OR7A 1OD7A 4N68A 4AENA 3KEHA 1I3GH 5CINL 1OT1A 1YEHL 3RGVA 1RZIB 4BM7A 1OB0A 2LLLA 1S9XA 3GC3A 1NFIA 2H41A 1KMGA 3AS3A 5F21B 1ILUA 5L2JA 5DDHA 1Y7VA 1MCEA 4Z95L 1R34A 1YMHA 3LZPA 2B2XL 2QEJA 4QRPA 2EH7H 3L8QA 2MFNA 1OM9A 1IT9H 2NR6D 3GKWL 5GS1C 4X6DE 1NMCC 5E4OA 1PX8A 1QFHA 2A5UA 4QR7A 4AENB 2XVBA 3TFKD 5KOVC 2CCLA 1TCRB 5A16B 3PABA 1DBJH 3IBEA 1NC2D 2JQAA 2IV8A 2LVCA 4W6WB 1S9XB 5AW9B 4Y1AE 3SPGA 3ZDWA 1CLOL 2ESVD 1KEMH 4ZSOB 4OGAD 2VZTA 5L2JB 3ZYJA 1T04A 3QHFH 5DDHB 1F56A 2NY0D 1YMHB 2C1OA 2NY3B 4W9IC 4QRPB 4F3FA 3P4MB 2R1YA 1PPIA 3L2LA 5EIIA 1EWHA 1HN1A 5F6IC 1EVTC 3VXNA 2B7DT 5MERA 2WY3B 4X9YA 4UTBL 1ZDQA 3HVDA 2W0KA 3PABB 3SCMD 4FA6A 4ZOBA 4DIXA 5C7XL 2HXAA 1LDSA 4X8GA 2JKJA 5I8CB 3OMAB 3HN3A 4B9FA 5IOPA 2YPVL 3SDDD 1T04B 4XX5A 4X0KB 4LDCA 4XCFH 2GKIA 2P52A 3CBRA 2C1OB 2YKLL 3WFCL 4KAQL 1GOGA 4HQQL 3ZDZE 4HLZG 4F3FB 2QPDB 2XTJB 1AHWA 1NEPA 4TQIA 1X6LA 5EIIB 3QXDB 3FONA 3LRLA 4ELMF 5JIDA 2OFQA 3VXNB 1HEZA 2OA9A 4FYTA 1MFCL 5MERB 4HUXB 2P80D 2ZKYA 3UABA 3N2JA 4LGPB 4N2OA 4YL4A 1E6OL 2DM2A 3QCVL 4QOKD 2ZTBA 4JVPA 2HJLA 3SKMA 2AJ3A 4L9LA 4LRNH 1R5WA 3D87B 4P5MA 3X1EA 2WNKA 1WAEA 2Y7QB 1KGJA 3HG3A 1AHWB 3DHUA 3OLGA 2X7LA 3BEVA 2DQDL 3FONB 3DNKA 1N4XL 4GRWH 3ZKXB 2BRRL 3WEOA 5J13B 1ZV5A 2Y24A 2XWBA 2BSSA 3BKJH 5LG6A 1B0RA 3ABKB 1H0DA 3HMWH 4IBQA 3LSOA 3SKMB 4BZ2L 4ANUA 1R5WB 1NIBA 4P5MB 1QD0A 1U8KA 2X44D 4KPHH 4ZMLA 1JNNH 5JYLA 4L8DB 4L3EA 3BEVB 1Q0YL 4Q52A 3EOAB 4LRIC 5D6CA 1BF8A 3Q6FA 2QQKH 3W39A 4WV1C 5ANMA 2AEOA 3RGVD 3PG2A 2DF3A 3RG1C 3BKCL 2MCG1 4NT6A 3L5JA 4N2HA 1NOAA 2BSSB 4LCWD 1B0RB 1NUDA 3KLSA 1H0DB 4GP5B 1FGNL 1NBVL 5J12B 3BWUC 4N9OB 3QGVA 1XSOA 1CD1A 5EF3A 4HPHA 2HP4A 4KX8A 4L3EB 4NZTL 4Q0XL 3WD5H 4KDVA 5D6CB 3Q6FB 4QI3A 3SE8H 4NIKB 3W39B 2ZONA 2YZ1A 3H7LA 3MLWL 3IWVA 5ANMB 5GS0L 5TF1L 1BD2A 1HOCA 3FT3A 2EDBA 5AD0B 3OX8B 4JCLA 2BZCA 3KS0J 1RZQA 1EO7A 5C0BE 3S0PA 2Q7YB 1KB9K 3K0WA 3G5WA 4OBRA 5FB8A 4U6TA 5AZEH 1CD1B 3S5ZA 1OO2A 2V2TA 3VU2A 4YSEA 5JPMC 1RPKA 1G6RH 2YZ8A 1H6UA 4UV7L 3JV4A 1GGIH 1TYEB 2X4OA 4F9LC 3UBGA 4ZFOA 3IMRA 3FH7A 3HZ3A 4PS4H 2Z34A 1BD2B 3IXTB 1NDMB 1SGKA 5GGQL 3SE4A 5GS2H 3FT3B 5I2IA 3BN9C 2TSBA 2OMTA 2LAGB 2P3YA 1HTYA 2ZUQB 1FH5L 5JXAH 2X3CA 5FB8B 2Y7NA 4JRXA 3T3PF 2C3VB 2FGWL 4JMXA 3SQOL 2V2TB 2G75A 1SJEA 4JG0H 1OQOA 7PCYA 4JZOB 1GYWA 4OD1H 4PJFE 1PNCA 3JV4B 2MSPA 1Z9SA 2H45A 2X4OB 5HHVL 4ZFOB 1SQMA 5HYEA 1P0SE 4Y8AA 5I2IB 5I74C 4LLMA 3NFNA 4M4RA 5TDNB 1ZOXA 5FECA 5IQ9A 2EINB 4JRXB 4DFHA 4KTEH 5C0AD 1BXAA 2G75B 1G7HA 4HUMB 1SJEB 4LPXA 4YGAB 1BYPA 1U2HA 3V9CA 2V9UA 4AEHH 5C0FA 1GGBL 5I0ZA 1X7QA 5GGTL 4ES8A 1Q1JL 3APCA 1Z9SB 1YNTA 5AW4B 4E9TA 1JYXA 1V7NH 5F0LB 2EH8H 1SUJA 3VXSB 5L2KE 3CMGA 3NSCA 3NFNB 1CIDA 4M4RB 4OM0L 3FUHA 3L45A 5FECB 5I1EL 2W91A 2Q3ZA 2WBKA 2CXKA 3D30A 4JZNB 5I5JA 1TETH 1JGUL 2XJLA 2ALWA 1WBXA 5C0FB 1RZFH 2HA1A 3CD4A 1KY7A 3QI9D 4FKEA 5D1XD 4HA1A 2CR0A 2VUKA 1ECZA 2NY5H 4EUPA 3EDEA 1YY9C 3NZ8A 4YDJA 5L4MA 1ET7A 3IMVA 1U8NA 3ABLB 4IYKA 3FZUD 2NYYC 3A6CL 5IM7B 1INDH 3ULUC 2CM5A 4AV4A 4YIQA 3DUSB 4UTAA 1BGXL 2BM3A 2MNUA 2XWCA 3HJEA 1OOWA 4H8PA 3FULA 3PWNB 1XGYL 5F7DA 3QSKB 3VXME 2IAAC 3QNFA 1WBXB 4YWGL 5KSBF 1V54B 1C8PA 4ENZA 1PDKA 1AZCA 3RL2A 3X3FH 2HSIA 4GAYA 3NSYA 5AYUL 4HJGB 4EUPB 1M9WA 3NZ8B 5DD0H 4YDJB 3ABMB 4APQC 2YPLA 5T33L 1BQ5A 1MF2L 3KHQA 1AS8A 5CCGE 3IRPX 1U8NB 2A1WL 4LU5H 4MNQD 4LMQI 4FC3E 2H1LM 5E2WL 3O6FC 4JHWH 5GS3A 3V4VA 1HIMH 3AXLA 2FEDC 1TQCB 3QWRD 4CL7A 4OZ4A 5F7DB 1F90H 4Y16C 3AS2A 1OP3H 4ANXA 4EIUA 1GYAA 1INEH 5SX5H 2WIIA 1PDKB 1DQLH 3D4ZA 4KJQD 1UACL 3RL2B 1FPTH 2A4CA 4I9WD 4O58H 3G3LA 5C92A 5FO7A 4G6AD 4CVXA 4PCKA 4AYFB 2D4FA 2NYZA 1JFQL 2EDLA 3V4VB 3U1QA 3AXLB 1HC1A 2ZUTA 3UTZA 1BVOA 5H4ZA 2ZCKH 1T7VA 4ZD3L 1AY1H 4J8QA 4I8DA 5DK2B 5IK3A 4YBLB 2CJ3A 2HCZX 2O5YL 3MNDA 3OB8A 4L5FL 2XETA 2ZSWA 1TQTA 3NIDB 1VGEH 1U6AH 3X14B 2L0DA 4PJ9B 1DE4A 1CDBA 2EYTB 3SO3B 1K8IA 4N2NA 2E8YA 3X3GH 3UTZB 4M61A 2E9JA 1ITCA 4AGLA 1CU4H 2VLKA 3T4AC 5IK3B 1MPAL 4R8WL 4GAGH 4AGOA 1TTRA 4G59C 4LVEA 1TPXC 2K6ZA 1R3KB 2ZSWB 2ENSA 1LO3L 3KW7A 3CDCA 1CXFA 3V6OE 1DE4B 2QVFB 5C08E 1K8IB 2MQ3A 3FFCE 1YYMH 4M61B 4UDUA 4DTGH 2ZP9A 3CDFA 4MNGE 5FHAH 1OCOB 4KY1L 1BFVL 3A67H 4NQCA 1D9KC 2GIXA 1E8XA 3MAWA 4JFEE 4MDRA 2QQNL 3JVGC 2JJUA 2ZUWA 1Q9KA 3L4VA 1EERB 1UCBL 3K7UA 3UROR 5CD5C 1U91A 3PAZA 1KLUA 4LOFA 4IRSC 3VQLA 3SZKC 4Z18A 3U4AA 2EACA 3CVHH 3TT3H 4UDUB 3EDFA 4Q4EA 5BV7B 1LDPL 3TOPA 4MJIA 1JWMA 4N2MA 1CGTA 1SY6H 4U1MB 1QSFE 4I77L 5ESQA 1OM3H 1P5VA 2OMZB 3QG7H 4N1HB 4NQCB 4JO2L 4OZFH 2YPLD 1QEWA 3FTYA 4WCYH 4Z7WE 1IB5A 4XO4A 1VKXA 3KGTA 1Q9KB 1CYXA 3VG0L 2CO7A 1A6PA 2R2BA 3QJVB 1XIWB 1U91B 4PLKD 1FNGA 5I1IH 3SDCC 1I3GL 1OW0C 4WW2A 2B14A 4HYTB 2B15A 1JWMB 2BNQA 4IIQC 4MJIB 1UATA 3BD4A 1EJ8A 5ESQB 3QHZH 4NIYE 1AS7A 1BPLB 4H2AA 4WIQA 1W8EA 1W8NA 4KKLD 2OYMA 1VKXB 5FA3A 5IQ7H 4KK6D 1E9QA 1NFDA 3CVIH 2CO7B 5KANG 3OKMA 1O9WA 4AXWB 3T2PA 1FNGB 1IT9L 1TVHA 4JB9L 5HI5D 1HYSC 4WW2B 1DBJL 2BNQB 1YC8A 4URKA 4CSSA 1TNMA 4A6YH 1SYSA 4NZUH 1AR1B 5I1JH 2LVEA 3QHFL 3IPBA 4X80H 1E9QB 1NFDB 3ARGD 3ZO9A 4U2YA 1QPPA 1A3LL 4LQFH 1QFUH 4M8RA 3OKMB 2GSMB 5GS0C 1WG3A 5JW4Q 2QVKA 3EG9A 1RK0B 2TRHA 3H56A 1TVHB 4XXWA 5MEPA 1IE5A 3UP1A 1D7CA 5EUOE 3PF2A 2VLKD 2UXTA 1PEZA 2HFGL 2WKLA 4ODTH 4JFSA 2DAVA 4YXLL 1SYSB 3V6BR 3M17A 2V8MA 5DUBA 1NUGA 3PJSA 3ZYZA 1A6UH 1BJMA 2WJ5A 4WNQA 2CUMA 2GK0A 1XXFC 2G5RA 3BZ4A 4Z5RA 1A6VH 3AY4C 1ZT7B 4M6MH 1DL7L 1JZ5A 2V3FA 5MEPB 2D03H 3SKJL 5B8CB 3MRNA 4NN5B 4YDZA 1P7QD 4HUCA 4Y5VA 5FGCB 5GZND 5A1AA 4XP1H 3WS6C 2AQNA 2QPFA 1UD6A 3D3VA 1OAKL 5DUBB 2LGNA 5LNGA 3PJSB 2OTPA 1KNOA 1YMMA 4N2DA 4WNQB 2OCCB 5EBWA 2HX9A 2GK0B 3BZ4B 4S1DC 1E6JH 2XXFA 4WY7H 3ZT5A 4BKSC 1F13A 4KGLA 2X42A 5EF2A 5A2JH 1XFPA 2EVHA 1Q72H 5F7EL 5AZ2H 2F54E 2Z93A 1NCHA 4ICXA 4L1TA 3V79C 4ETYA 4FZ8H 4WWID 5IMKA 2YBRB 3Q9PA 1DEDA 4EI6A 1XZ0A 2EEAA 4Y5XC 2VERA 5I73B 2I69A 3D3VB 3MRBA 4PGBB 1YMMB 1TSRA 3MBXH 4Z7UF 3BVDB 5EBWB 5IVXA 4PJHA 4XMTA 4XP9L 4ZO9A 4FQQA 1XH3A 1JIBA 1ZTXE 4EZJA 2BIMA 1A4BA 4LSVL 4NFDA 1F58H 2ZXGA 4UIMA 4XN4A 2NLJA 4DEPC 3DMMD 1PSKL 4WWKA 1MCIA 1Y6MR 4HKBB 3ZKND 5EIIG 1XZ0B 3QCUH 1MJJA 4GAAA 1AR1D 3QDGD 4ZS7H 43CAB 2PABA 3AG4B 4R0LA 2WNXA 4BWTA 5DEJA 1LLAA 1Q9LA 4AQOA 1RLBA 4GI9A 2RD0A 5C70A 4IMKA 1IM3A 3E6HA 4FQ2L 5IVXB 4K07A 1UYWH 2IDTA 4PJHB 3HHSA 3MRLB 4G6FB 4FQQB 1XH3B 4PV8A 3UO1H 2LTQB 4KO7A 4DPAX 4NZRH 3P69A 1CGUA 2EO9A 4U1LB 4D9RE 5I1CH 5FUZH 4UIMB 2WXIA 4ZUTA 2NLJB 3UZVB 4JDZB 2J1YA 2WAHA 3BVNB 4WWKB 3ESVF 2RQEA 4CMHC 4LAJH 5FWRA 3M7OA 5JHLH 1ED3B 2VLJE 4R0LB 4MMZB 2ETWA 2PP9A 3VGAC 3ECUA 3UG4A 1IM3B 2G2PA 2MKWA 3E6HB 2VDKH 5SWZA 4XVTL 3Q06A 3HHSB 4FFZA 4U3SB 4PV8B 4F1SA 3BISA 2ED7A 1OAUH 1T83A 1F4XH 4X7FC 5KVFE 3ZDZF 1MQKL 3WNOA 1L9NA 4PS4L 2VM9A 4WJG3 2GAZB 2BHZA 2J56A 3UTTA 5KG9A 2WW8A 2BIOA 3DDFA 1H3GA 5IBLD 1G4MA 1OCCB 3OWRA 3LPOA 2DKMA 3TVMD 3OB0K 2HYMA 1NEZB 2ZKHH 5B4MD 4IKJA 5K9QI 2H6UA 4KDWA 4JG0L 5JQIB 3F5WA 3JUZA 2R1WA 3T9WA 1PL3A 1YUKB 5I6MA 3ZY7A 1VFBA 4ZAKC 1HH6A 3O8XB 3UTTB 5KG9B 2D3NA 5SWSE 3D8MA 1XHHA 4V11A 5DO2C 2Y6TE 3GMRA 5F7NC 3TNNA 4KH2A 1BF2A 2A6IA 3H4FA 5BOJA 4ADIA 2XA3A 3F5WB 4AEHL 3MREB 4ZUSB 2B4CC 5FM4A 3W2DL 2E9WA 2W59A 3FPXA 4OFDA 2MRYA 2GJPA 2AVGA 1IC1A 1X4YA 2EH8L 3T2NH 2DQTL 2EDFA 3FU7A 2ZYRA 3SDYL 1XF4A 1IARB 3BXNA 4M1CC 4Y9GA 5CZXC 4OI9A 2R0KH 3AM8C 4HWNA 3EW3B 3GMRB 3ISWA 5KWYC 2R23A 3TNNB 2HUEA 2A6IB 1JG9A 1TETL 3LOWA 4NUJA 1WFUA 2E7BA 4TNEA 1UA3A 4O51A 1QNIA 1L5GA 1L7TL 1BZ7A 5KYNA 3SJVA 3Q2VA 5DHVH 3PGDB 4MA1C 3WJJA 5DLML 2FLRT 1G5GA 4M62L 1INDL 1BVKA 1XF4B 3BXNB 2P8PB 1TTCA 2YS4A 3F7YA 2EDHA 1C7SA 4NUJB 1MHPH 4X7DC 1QKZH 1N12A 4TQEH 1G84A 1RZ7H 3T0EC 3HE6A 4ANWA 4UB0L 2XT1B