1IAIM

Idiotype-anti-idiotype fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DIQLTQSPAFMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM01
2NY6C 5FYLH 4PJCE 5JXAL 3DBXB 3H7LA 2BNQA 4Z18A 1INEH 1GPOL 4D8PA 3QO1B 1DANT 1RUAL 1ZLWK 4KV5F 4OZGB 2ERJB 2AJYL 2NXZD 3T0EB 4N1CA 1F58L 1VCAA 2ESVE 2P7TB 3L3JB 3P4OB 5DJDB 5CEZD 1KIQA 1EX0A 1MCWM 1I1RA 2E9WA 3B6SA 3BUTA 5H35A 1ZGLM 4R97B 4OLUH 3BE1L 3IGAA 3L9RB 3MMEA 4PLNC 4AEEA 3C60A 5JDSA 4R26L 2OMNA 5D7JA 5EOCL 3TBVA 4GAFB 5FO9A 3RX7A 4JPVH 5A2FA 3KJ6L 4QOKB 5C0AD 2OL3B 3STZA 3IDIA 1V8HA 5SV3A 1NGZB 4HBCH 5C0CA 4FRWA 1TZGL 1I1AA 2ZOLB 1Q1JL 1Q9LA 1WTGT 1FO0B 2VLJA 3RI5K 1U2HA 4U31A 4P3CH 1WIOA 4IOIA 4XXDB 1QRNA 2XQYG 1MCKA 5IB3A 2D7OA 4EIZC 2WV3A 3FQRA 4PV8A 1I8IB 3MRCA 1JWSA 5T5FH 2YC1B 1ZSDA 1MJ7H 2A1WH 2W0KA 2J8UA 5I66A 3U79A 2X4SA 5D2NC 1BM3H 3WIFB 4LMQE 4LSVH 1BD2B 4N0YL 3G5YA 4PLOB 2C3GA 2GJZA 3PL6D 2FGWH 1HQRB 3QIWB 4K3JH 4TVPE 4ELME 2AEWA 3GRWH 2VTFA 2JCCF 1GC1C 3MREB 3VFMB 2Y07L 32C2B 2VL5B 4TYUA 4EI5C 4HQQH 4OGYH 4APQA 1LEGB 1J12A 4U4BA 4Y5XB 3IAQA 3PXHA 4BM7A 5CEZL 3CSPA 2PYEA 2XWTB 4LP5A 1VPOL 2CPCA 4YHKH 5J6HA 4G6ML 5GRWA 4Y7MA 1ZANL 5JO5B 1C8PA 1BFVL 4JFOB 3PWVB 5DUPL 1E6JH 2FATH 3T2OA 4G8GE 3P77A 1NLBH 3PQYB 1NCCL 4PBWD 4X80H 3BESR 3GO1H 3VGEA 2J8HA 5AYUH 5C3LD 4XNQB 1LEIA 4L3EB 3DSNA 5J8OA 5I0ZA 1ZGLA 2A74B 4YE4L 3MNWA 4O51A 5DJ6A 2AJ3B 1HE7A 3REVA 3WD5L 4Q9RH 1NCNA 1T7YA 4P5MB 3PWLA 1PKQB 5IWLC 2AEQH 1FZJA 1EO7A 1NFIB 1UJTA 4P5TC 2X41A 5KVGL 3NN8B 4I0CC 4LFHD 2P5EE 4U1GB 5CGMA 3QUXC 3BZEA 4Q6IA 2YOCA 3EO9L 1IM3A 1OWWA 2H2SC 3MUHL 3X12A 2BCKB 4X6CA 3C8KA 1UM6H 1JHLH 1CD0A 2G75B 1E4KC 4OF7A 4RFEB 4WRLA 4PBXA 1CICA 1FN4B 1TVDA 2ESVD 4LSUH 2AI0L 1A0QH 3OKNB 1V3KA 1P7HL 4CL7A 1TJHL 4UUJB 3IJYB 1KCSH 4YHOL 4DCQA 3NFSH 5DSCB 3QIBD 3I9GL 5HDBF 5E4IA 1DP0A 1QSVA 1F4YH 2J8UF 4XC1H 3QXAA 2FH8A 1KIPA 2ZUQC 5CCKL 4H26B 1JTOA 3EGSB 4YGVB 4U0RB 3QNZA 4KMTL 1CDIA 5B21A 4MA3A 4ZD3L 1RJYA 1JNHA 2H9GB 4NQSA 1ONQA 1O5DT 1A02N 4GRMA 4ZFOA 4S0SD 4TVSa 3WNPA 2DLFH 4KTYA 2AABH 3QNXB 2ED7A 4PUBH 3PWNB 3UPAA 5DVOA 3QXUA 3AXLA 4EEEA 1MF2L 1YPZE 1J86A 1RZFH 4OFKA 3F5WA 4WUUB 2XRAL 2XG4A 1I9JH 4HUXB 1CT8B 3FO9B 5EIIB 3QRFM 4WUKL 3HPLB 4P3WA 4OGXH 1EZVX 5F88A 1P5UA 2F54B 4TVPD 3R06A 2B39A 2Z8VC 5DJ8A 5I8KH 1ED3B 3AREB 5IJKA 2H45A 2AJUL 5GJTL 2PW2A 1EHXA 2W60A 2C5DC 2HP4A 3FO2A 2GFBA 3LB6D 3VFVA 1NAMH 3AMLA 2WW8A 4FA8A 3SE8H 4BZ2L 1I3GL 1BQSA 2CJUL 3L6FA 3MUJA 4FQIH 3BWAA 3U4AA 1C5BH 3LKPA 2OTWB 5B22A 1HWHB 5F9OH 4YXLH 3VD3A 4G8GD 5ID0B 4MNHA 1BHGA 3IVKB 1QQDA 1WEJL 1AQDA 1YDPA 3RUGE 5CJQL 4IMKA 4XB7A 3LEYH 1BWWA 4NNPL 1LK3L 3RVTD 1ORSA 4U7SA 3UCRA 2EE2A 1YJDH 3TA3B 1A6TA 5KSBA 5D7IB 3FQXB 4I8DA 1LO0L 2VABB 2B2XL 3EW3B 3UTTA 1BQUA 4NKDB 5C7XL 1IM9B 5J11B 1R5IA 2P5ED 1EGJA 3VFTA 4UV4H 2X40A 5E6ZA 3OKEB 2V7HB 2WINB 4PJXE 4PS4L 2D7MA 2HN7A 4JLRB 1A2YB 3RAJH 5I1EL 2VIRA 4CU8A 4NN7B 4JCLA 4NSKA 3H9HA 4OLXL 4MMZC 5D1QD 1GIGL 3QEHA 3HB3C 2BRRH 3GGWA 1F2XK 1SMOA 1G7JB 3MGOA 4NNYB 4F7PB 4ORZC 1T0PB 1FHGA 4JM2A 4XVJL 3QJHB 5CKGA 1B4JL 5IMMB 4GG6E 2VLME 2P46B 2J88L 4M61A 3VD5A 4XZUB 4K7PX 4TQEL 4XH2B 1OGTB 4N0FB 2DLTA 1PSKL 1G7QB 5JPMB 4UU9B 1BMGA 1CFQB 3QJFA 4NKIL 3HMWH 4JN2A 3LQMA 2AS5M 3NVQA 2ZJSL 3RDTB 1CU4L 1MY5A 1BGXL 4M7KL 2CO7B 3RKPA 3SDYH 3B9EA 2NX5A 3QEUA 1KJ2B 4CAGA 4X4YB 4K3DH 1RIHH 4P9MH 3BIKB 1WIUA 4MVBD 3HAEA 5KS9E 4IRJA 2WLZA 2LQRA 2F5BH 1EAPA 2IBZY 1JGEA 2XICA 1UM5H 3RPIA 1KLGA 1IJ9A 1QA9B 2W0FA 4RISH 4NNXB 4NRZB 2VDPL 3TFKC 3QXDB 1HQ4A 3BDXA 2JK5B 4G8FA 5FUZL 1HOCA 2BSED 1G6RL 2C26A 4PB0L 1ZGLP 4UBDD 3PNWB 2WZPD 1YMME 3NIGF 4UIKH 5FGCE 2PTTA 3BP5A 2BMKB 4NUJA 1H8OA 2XOTA 1MWAH 4UOW1 1J0YA 4PJGE 4H25A 1YECH 1X5FA 4S10A 8FABA 4OLZL 3O8XB 2Q3AA 3Q5TA 1P7QD 1JF6A 4JRXB 3S37L 1YQVH 4JCMA 5L9DL 4Z9KB 4Y19E 1VEMA 5B3NA 4MB4A 4KDWA 4OQTA 12E8L 4POUB 5JXEC 1S7XB 1MLCA 3RVXC 1OAYL 3LKNB 5EZJB 3O4OB 3GSRA 4ZFGL 1D5MB 1ZV5A 4QHMA 1WICA 3DJ9A 1VACA 4O02L 4WW1A 3KDMA 2JLLA 5E2UH 1JGUL 3O45A 1LE5B 1FYTE 5DD3L 2XI9A 2GIYA 3V5HB 1S9WB 3C8DA 1ZHNA 3G5XB 4Z7NF 3T0BA 4PGEA 3KLDA 2Y4SA 5F8RC 1OSZA 2YRZA 2OX5A 2W91A 2OP4H 3B2VL 5GGUB 4G8EB 4CDHA 2EIZA 3QUYD 1A4JB 1B3JA 4OGZA 2BK8A 1QLEH 4NUGH 4ODTH 3EZJB 3DX8A 5B38A 3G04B 4LSQH 4X6DF 5DZOA 3VXRB 2OK0L 4WI4A 2VXQH 3BT2H 1IGML 5EN2B 5DD6B 2HT3C 3MOBH 3HZMB 1X5HA 1PDKA 1D6VH 5D2LF 2DQGH 4KRPD 5I1JL 4R4ND 1XF4A 4YLQT 2VLMD 3K81A 1WTLA 4GRWE 3JWDC 4QTIL 4NT6A 3WLWD 4G7VL 2X4NB 4QXUL 3TA3C 3RA7H 4L3CB 2EC8A 3LV3B 1GZPB 1EIBA 5DUBA 3LEVL 5D5MF 3ARDA 2BERA 4MJ5B 4D0BB 1A64A 1FG9C 4GQPH 2NW2B 4JEGB 4XCFH 5KJRL 3HRZB 3PWPB 4Q0XH 1T89C 3RRQA 4XXCC 1E4WH 3RWDB 3T1FA 4HUWB 5I8EA 3MBEA 3WJLA 5ILTL 4PJBB 3QWOA 5DZNA 1PZUB 4HPOL 4Y4KA 4CMMA 3OSKA 4NRXB 4KU1A 4L9LC 1JYNA 2F74A 1P53A 4K23L 4PJ5B 1LQSR 1E0OB 2FB4H 5DJAB 3QDGE 2EDXA 1ZA6B 3BW9B 3VXUE 1D5IH 1F3JB 4JPIB 4OIIL 2B1HH 4JG1L 3ES6A 4OF0A 1J8HA 3VRJB 4LGPB 4JFQB 4NZTL 4K94C 4G9FB 5CP7A 1YMMD 2XY2A 1WWAX 3RTQB 5CIPH 3ALXA 4HWEH 3KPRE 3KPPA 3DMMD 1T1XB 1AGCB 4PJ7B 1A7QL 5CP3A 1P4IL 1A6ZB 4JGMA 5EU6B 1QNZL 4P2RB 3MRGA 4WEBL 1TFHA 1ZHLA 2Z0BA 4P23A 1MIEH 2MCG1 5HHPB 4Y19D 5MEQA 4BK4A 5HGBA 4TRPH 4DGIL 4NQCE 3M17B 4LHUG 5DR5H 3FB8A 1ZMYA 5AD0A 2X7LA 4Z95H 1MI5B 1XF5A 3OJDA 5GGRB 3JWOC 5L0QC 4FQXD 1I3RA 1F97A 2UWEA 3BO8B 4KUCD 4NKMA 5BXFA 2WLYA 3V4PH 5MENA 1RUKL 1MLBA 2PF6A 3DV4A 5E2TH 2DAVA 1OW0A 4OTXL 5HGAB 1FYTD 1KFAL 4LASL 3MA7A 4U6HB 2QQKL 1VA9A 4ONFL 1E4XL 1N8ZB 1YEDA 3O8XC 3BGFC 5T1LB 4LU5H 1FCCA 43C9A 4CN1A 1CLYH 1JV5B 4MA1C 3S88H 2BY0A 3PWJA 1FZOB 4NJAH 5K9QG 5I1LB 5C0IA 4R0LB 5DTFB 3VXNB 2YD7A 1OCWL 4WTZG 1C5CH 3GMMA 3MRBA 4C55A 2HKHH 3BP4A 3UBXG 1NEZA 1T21B 5IW1B 1CR9H 5JZ7D 3MV9A 1J0ZA 4JO4L 1QFWH 3ZYJA 4DKEL 3BZ4A 4WWKA 1OLZA 4PRBB 3MROA 5I30L 2NQCA 1XGTB 1OGAE 2VRAA 3C6LB 4M93C 4AK1A 1NKRA 1O7SA 3A6BL 2ICWA 2L7UA 2I07B 1ADQA 4X99A 4X83A 4ONHB 4NKQB 1J7VR 1S7WB 2CH8A 4PGZA 4NN5C 1XR8B 2ADIA 2YPLA 4YQXL 1FC2D 2R23A 1JK8A 4MJ6B 4IJ3C 4FG6D 5DJCA 5E6ID 2EH8H 5EUKB 1U95A 5KVDL 3BEVA 5ACZB 3QDGD 3HG1B 4UOJA 3VDCA 1MAMH 3VXUD 1EA9C 3IU3B 4E0RA 4OCYH 2CLZB 3GSWB 3Q5YA 4P2QA 1AD9B 3N50A 4JFYB 1KJ3H 1LE9B 3ZE2F 5TFSL 3STLB 4U6VH 1CD1B 5IVZA 1F6LL 3RU8L 3KPRD 5TGBB 1FZKB 3DVGA 5F1IA 2DLIA 3CH1A 2HA1A 1JL8A 2F5AL 1PX4A 2XZCL 3F7YB 2PTVA 4M9OA 5I6XB 1NANI 2FD6H 4P46A 5CILH 3HR5A 2BRQA 2IH1A 1UYWL 3AS2A 3ALPA 4Z7UB 5IW3A 1BQHB 3UJJL 4ZFFA 3QT2A 1UH2A 3IJHB 1LO4H 3QUMA 3AS1A 4FFZL 4YDVA 3WXVH 3I85A 2XZQL 4X6FB 5GGVH 1EHNA 5F1SA 3T3PF 5DHYA 4NQCD 4OZHE 2Q7YA 4KHTH 4RDQF 3OV6A 4KPHH 1IT9H 1U93B 1GRWA 1IAKB 1ZAGA 1NGQL 4UT7H 3UAJC 4L4TB 1CIUA 3I6KB 2PN5A 4PJFB 4HIIB 3RTQC 3LRSB 1RHFA 5A40E 2YMXH 4LPUA 1W0WA 4ZO8A 1AO7E 1KPRA 4HXAL 4U3HA 2NCMA 1IL1A 4YC2C 5D2NE 2FZ3A 2R29L 3F65A 1FPTH 4QXTA 3QCUL 2P42B 3SE4C 1KJMA 4POZD 1CXFA 4NQDA 4H8WC 5ALBH 5LAXA 4NO0A 4HUVA 4FQHB 4N8VG 2XA8L 4R90H 1NCAH 1U91A 3EAKA 2EXYD 1IEHA 1F11A 5MEOB 5D6DA 4XNUH 3ULVL 4GO6B 1NAMB 4R7DB 4P57B 2WIMA 2C3XA 3J7HA 4KHXH 1EFQA 4GKZB 3ZLQC 1FGVL 1A14H 2Z8WC 1IFHL 1OGAD 1G7HB 4UB0L 4MNGA 1HEZA 5HVHC 3BRFA 4QY8B 5I1HL 4DZ8A 3DUUB 5I1AB 1AKJD 1OT1A 4CW1A 3VD9A 5SX5H 3E6HB 4HS6A 1BZ9B 4KZEH 3RWJB 4S1SL 3IDGA 5BRZB 2YA0A 2NY0B 5IB4A 3MRHB 3T2QA 3FQTB 3MC0A 1WSST 4OCWL 4JO2H 1RZKL 3F8UB 5LQBH 1MVUB 2LTQC 1X6LA 4JDTL 4M6NL 4AT6A 4TTDD 4RFNC 5C0BA 3CDYA 3CFIC 1OOAA 3MRQA 5CZXC 4NZRL 1OQOA 3O11A 5J9PA 4I3RL 4NN6C 3IAPA 2ATKB 1CVSC 1I7UB 5KN5A 5C0AA 1YEIL 1NGPH 1FNGB 4PJ8B 5FM8A 4MDIA 1JPGB 5ITBL 4L8BA 2X09A 1FQ9C 2QADC 3QDJB 3SDCD 3P9MB 3QH3A 3E8UH 1P84K 3B9KA 3CMOH 4RDQG 3O4LB 1LP9E 1ZKAA 2QQLH 2VXTH 2P43B 4D0CA 5I18L 3HNVL 3EOTL 2D2OA 3SCMB 4N0UB 2WBJA 4N0CD 4JY6A 2XKUA 4S2SB 1H3WM 3Q2CA 5HGDB 1ZHBA 3WUZA 3ARWA 1S9VA 5I1GL 5IVXB 1FFPA 1AI1H 1CDYA 4JHAH 1MAKA 5EO9B 1KIUA 4Z6AT 2HVKB 3T0VA 1FLRL 2A73A 4I48B 5BO1H 1IBGH 5GRVK 4DKDC 3GUTA 1KCLA 1EUUA 3GSVA 5E2JA 2G9HA 1FBIH 2CRMA 2FX9L 1WFNA 2GQHA 3FHAA 2F53A 4ESKA 3FJTA 3BJ91 4GKSB 5ELIA 2DM2A 2GJ6B 2ZNXA 4QHUB 2ICWI 3RNKB 5JW3L 1N6QH 2B4CL 3H9SB 1RULH 1WBXB 4LSPL 1AO7D 1Z3GL 2HVJA 1WAAE 3FKUS 4HMCA 3G6JE 3WDJA 4BZ1H 3IFPB 2ADJB 3AB0B 4HUUB 4NQVA 2NY5H 3RGVD 4L4JA 5AUMB 5BQ7B 4MAYD 1DUYB 5T1KD 4ZAKD 4X98A 4YBLB 3QHZH 3DIFB 3MUGA 2XZZA 3IETA 4RBPK 4I18A 2CIIB 5GS2H 3U7YL 1JF5A 2RCSH 5BV7B 1K8IA 3GSOA 2B0SL 4I5BA 1ZWIA 4EDWH 2CKNA 3BGAA 3ZDZE 4F3FB 1I8KB 3CH8A 1QSZA 5D6CA 2A6JB 1U6AL 1T1WB 2HFEB 4PJCA 4CDGC 1YEGH 4P2OD 2BOBB 4B7IA 4TSCH 3AS3A 4WY7H 4JGJA 2F58H 2DI8A 2ZSWA 5I76B 1M05B 2ZUVA 4K7PL 4OQTH 1JMXA 4QRRB 2ESVA 2X4RB 3ARXA 2ADFH 3IDJB 4ORGA 5IOPB 3K2UH 3P4LA 5EBMB 2E6QA 4XP5H 3IAGC 1A1NB 3QSKB 1L4IA 3U4BH 3LQZB 4LHJB 4RA3A 3VWJA 2AV1B 2ITCB 3QIBA 3QULB 4KI5C 2Q6WA 4NPYA 3RX8A 1XF3A 5JPNA 3BI9X 5KOVC 5CEYA 4EBQH 4NDMA 5FYJE 1GCFA 4JY5L 4WW2A 5DJ2A 1U8HA 1AGEA 4HPYL 1KCVH 5DMGD 3BP7A 3CK0H 3L3IB 1BX2B 3ALWA 4LSSL 2Z31C 1ZOXA 1MCSA 2H2SD 3MYJB 3SPVB 2VXVL 3W11C 5FM5O 2AJXL 1V7NL 1P6FA 2APTA 1NANH 4H0GA 2Z91B 2VDOL 5I71C 2Y6SD 2WUBH 1IAMA 2Q8BL 5DJXB 2NY0C 1MCCA 4PJEE 2HJKA 1NMBH 1YJDC 2GCYB 2NMSA 3THML 1FRGH 2A9NL 5D1XC 3Q3GB 1B4RA 1Z6JT 4XWGH 4HDIB 4MX7B 3B3IA 4Y8DC 2WP3T 3O2WH 3UZEA 1HSAB 1C12B 4ELMA 2H26B 4M43H 1VFUA 4LLVB 4MQTB 2G2RA 3O2VH 4PJ8C 4PG9A 5CINH 3TYGH 2WBKA 3KPMB 3DROB 2FX7H 4LQFH 2P8MB 3ILPA 2YS4A 2JCCB 2MSPA 4E41E 3WUWA 5JLZA 3RKDD 2Y36L 2NY3B 4LEXL 3G08B 2X1PA 3MJ9H 5ADPL 4G8GA 4KTDL 3EYQD 2I9LB 3VWKD 1C1EL 1MUJA 4PJCF 5T5NF 1JBJA 2QJDA 5DJZA 1BF8A 4MYWB 4HWBA 5CIPB 1QBML 3GMQB 5GSRB 3PGDA 1NC2B 1Q72L 2ICWJ 5ANMA 3BMWA 3I3DA 1MJJB 1NGWA 1CD8A 4JQXC 3VA6A 3MRLB 2OMBA 1J05A 4UT6L 5A43C 3D25B 2BVQA 4PJIE 1JPST 4XWOC 5DWUH 4BJLA 2VSDA 4YHPA 3DVNA 5HY9B 4MQSB 4F2MA 5DURD 5DT1L 1A5FH 3ARGC 3NABL 1XGRB 1JPTL 5H35B 3BKJL 3IGAB 5D1QA 1LD9A 5JOFB 5C92A 1KC5H 4IRSC 2BHYA 3MLXL 1QVOB 4JO1H 4ZSOE 4HK3N 4ISVB 2Z92B 1X5ZA 3IDIB 3AB0C 4LRNL 4R2GC 2R1WA 1TQBC 2X10A 3SKOA 4DFIA 2XTLA 1YEJL 1S7SA 4JY4A 5K93A 2E7MA 3HC4L 4PJAE 3BZFB 3C2SA 3GBNH 3DGCR 2Y5TB 5IB3B 1D5XA 5FYJD 5EH1A 3FQRB 3OPZL 3NPZB 3MRCB 1TJIL 4U3XA 4QT5B 3ZZ1A 3WFDL 3BDYH 2V5TA 2J8UB 3IF1A 4JFZH 3SDAB 5I66B 4OI8A 4XPHH 2X4SB 2I5YH 1MFEH 4QHLB 4V1DE 4ELMF 1I7ZB 5FUCE 5FGBA 3QWRD 4DUVA 3QCTH 3SY0B 4Z8FH 4NFBA 2ED8A 3WSQH 1EDQA 3EFDL 4U49A 1XGQA 1JRHI 1YPZA 1UWXK 2OL3L 3RZCD 3V6OE 5CD5C 3DHMA 3K1KC 4APQB 3GSXA 5EOCJ 1KGCE 2ITDA 4LNRA 3MCKB 2C1OA 1QSFE 3FFDB 5T5NG 5F96H 1DQLL 4U1MA 1GAFL 2P8PB 4WJ5A 3VRLE 3LN9A 4ZXBD 3MACL 1DL7H 4RWYH 5AG8A 1C5DB 1DLFH 1TNNA 1FYHB 5E08L 1P7QA 4LL9A 1BOGA 4OFDA 4TOYH 1ADQH 2PW1B 4M1GH 4J3XA 4U2ZA 1LEIB 4DGVH 1KTDA 1YEHH 4E41D 4PTUB 3VXPA 2WNGA 2LVEA 2W65A 2AJVH 3C5SA 2AJSH 2YD3A 2BNRE 5MERA 4A2LA 4JQVC 1Q8MA 2DS4A 3FFCE 1FZJB 3D0VB 5C09A 4XX1E 5GIRA 2APXA 3G6DL 1R6VA 4KDTA 4LPWA 4QYOB 5MI0B 3OF6D 4WHYG 5F1NB 5F7EH 4CRPA 5ACMA 2DMBA 3BZEB 4Q9QH 4Q6IB 1AGBA 1IM3B 4LLDB 5D96B 4O58L 4X6CB 5L2KE 1JHTB 4HLJA 5ALCH 4RIRB 4ODHH 2XTJE 3T4AA 5HHME 4O2EA 4PRPA 4L4VE 4F15B 5JA8B 4NQXB 4OV5B 1OARH 2VZOA 2V7NA 5GRYA 4PJXA 5HJ3A 1YC8A 4NKOA 3QUYA 4FABL 3GJEB 4YR6A 5JXAH 2KBGA 1YN6A 2NY3C 3D9AL 4JREC 2G60L 5C2BL 1RUAH 3RVXD 1QTYT 1JN6B 1QBBA 3QXAB 4F7MB 2KQMA 1F58H 4M1CC 5GGQL 3P4NB 5L7XH 4GG6A 1IGJA 2DKMA 3K0WA 1JNHB 1JI2A 3QIUD 4NHCL 4Y4FB 4ZFOB 1Q94A 1L6XA 2FO4A 1SM3L 2R0ZL 4WFHE 3BE1H 1YPZF 1CFTB 3T0AA 4LEOA 5FEBA 4R26H 1EPFA 2XPGA 1IILE 4RGNE 5EOCH 2HH0L 3KJ6H 3S97C 5TDNB 4OBSA 3L1OL 1SY6L 2HKFH 2FX8H 4RBPH 4HWUA 3D69A 4F7CA 1TZGH 1M7DB 1T03L 4V1DD 1JGDA 1Q1JH 1ZS8A 2P5WA 5DD1L 4CU6A 5KS9A 1I1YA 4RMRA 2EC9U 4EIGB 2YEZB 5EUOF 3C60C 3MLUL 5BS0E 4WENB 2HT3D 3D87B 3HE6D 5D7JC 3M1BB 1YY9D 5IQ9A 3RL1B 5DI8B 1KULA 4OLWL 1CF8L 3VFVB 3QP3A 1U58A 1I1AC 5E00A 3QRGL 1KGCD 3L6FB 1QSFD 3MLWL 3BWAB 3RUGF 3D18A 3DMMA 1HILA 4LARL 3KLAA 3NCBB 1WWBX 4PJGA 5HHVL 3V6BR 2Y07H 3HE7D 1CXLA 3AC0A 3TCLA 1HHIA 3C87A 3WHE0 3KPNA 1C16A 5CEZH 2NY4B 3KLHC 4Y19A 1CK0L 4G6MH 1ZANH 2BNRD 4ZUWB 2BVTA 3UTTB 3CFKB 4PJXF 3H8NA 4ZDHB 3N85L 5J7CC 3FFCD 4AQ1B 4HX1B 1NCCH 1R5IB 4CN4A 3VFTB 4FFVC 4FQXA 4APQC 4Z77A 4F33A 5C9JB 5HD8D 4XCNB 5IFJB 4JQIL 3AMKA 3NTCL 1YUHA 5L2KD 3WD5H 2H2PC 1IEBB 2IH3B 2DM7A 3CFBA 5FO8A 2XTJD 5BCAA 5JIKA 4XNMB 2CDEB 5HHMD 1D7FA 5KVGH 4L4VD 4WV1A 3WKNA 4M8QB 2XZAH 3TYFB 5KZCD 1T3FB 3I50L 3BHBA 5I2IA 2FRGP 4M61B 5IHZB 3EO9H 3JWDL 1DVFA 4W6XB 3A6OA 5HHOA 1FNLA 4JN2B 4HGMA 4LHUB 4AZ8A 2ED9A 2C4FU 3DYMA 2VL4A 1WC7A 5MI0C 4GW1B 1E4JA 4X6DB 2NX5B 5IKCA 2V2XA 3OKOA 5CAYB 5D71L 4LLYA 4Q6IC 2CGRL 1TJHH 3MLZL 5H94A 5D96C 3RJDA 1G1YA 4YHOH 1UB5A 4LLQA 1V05A 5JHLL 5IQ7L 4U1JA 4WFHD 2CMRL 3I9GH 5KSVA 2ATPA 3E2HB 2FIKB 1Y6KR 3M8OL 4RGND 5CCKH 1LO5B 1KLGB 5J1AB 1CICC 5GSVA 4GSDL 5D5MB 5EC1B 2PUQT 4KMTH 4BH8A 4ZD3H 1PY4A 3IS0X 4XRCB 25C8L 4OV6F 1RIVL 5M95B 4DVBA 1HOCB 3CSYB 3WNLA 4LF3B 2FJFB 4XPFH 5LJYH 4PJGF 5C0RL 5E6IA 4G6JL 1I4FA 2NNAA 5BS0D 4NUJB 3QEQA 4PJ9D 1ZVYA 2V2TB 3UPCA 2CXKA 3VXUA 4LLMB 1DE4A 1MF2H 1JWMB 1MFCL 2OJZL 4M6ML 8FABB 4ZPTB 3TN0A 3U48A 4PG2A 1KJ2L 5MP6L 2XRAH 4XPTL 3DXAB 5C0GA 3X13A 2HJLA 3L7FA 3VE0A 3LSOB 4OAWB 1WBZA 3KPRA 1HCVA 1P7KB 5D1ZD 4HGWB 4GMSL 1H5BB 3I75A 4A6YL 1MHEB 2P4AB 1MLCB 5IVOA 5B4MC 3MRRA 1IAII 2AJUH 4F9PA 5GJTH 2C4FT 3ESUF 2YRLA 5I9QB 4CMHC 3MNVB 3JWOL 4PY7A 3K8MA 2OSLB 4JFHE 1PY9A 4BZ2H 1I3GH 2CJUH 3MJ7B 1CDUA 3MPCA 3O6FA 1U8JB 2G5BA 2GAZA 4LCWB 5K9OA 3S4SG 3H3PL 4HW6A 4NQCA 4LPYA 2FSEA 3NFPB 3MRKA 4MWFB 5IJKC 4FHBD 5CJQH 2QHLA 1DUZA 3H0TA 4WHYH 4M03A 1X9QA 2IF7A 1UWXH 3UZQA 5B38B 4OLVL 2B2XH 3STBA 5C7XH 1NFKA 3GHEL 4YHIB 2DIJA 4GRWF 3LY6A 4PTTA 3KWWB 4IMKC 3CZFA 2XA3A 2DMKA 3UROR 1XF4B 3FB6A 5I1EH 1G0DA 2NY4C 1MVFA 4AEIL 3QUZD 2QL1A 1WWWX 1E4XI 1D9KB 1P6AB 5FA3B 5GJSL 1B0RA 3FONA 4OLXH 2AK4B 3V6ZB 2CLVB 3BRGC 4TVPH 1DBML 1CLZL 1KENH 3QZWG 2XV6B 1B4JH 3ELAT 1UWEH 4JM4L 4Y16A 5JDJA 5F3BB 3FB7B 2J88H 1Q0XL 5HI5D 4TULL 1SJHB 4TQEH 4FP8L 1AC6A 3UC0H 4J2XA 5ICXB 5LGHL 1I8MA 4GBXD 5H2BA 1BBJA 2VDRL 3NH7H 4Y4KB 4H88L 2F74B 1CU4H 4MJIE 3MNZA 1RIUL 4LOUC 3BQUA 5DQDL 4XBGB 4M7KH 1M6OA 5C0JA 1N0LA 3ULVF 2YZ8A 5I1IL 2MHAA 1NAKL 1J8HB 4CVZA 3QPXL 5IEHA 4N8VB 2AKRA 4Y4HA 3TO4D 1I7TA 3MOAL 3LH2L 2A6KA 1S3KH 2EH7L 3QR2A 3VJ6B 4JFDE 3KPPB 1RJLA 3ROOA 1DQQA 1T0MA 4ODWB 4ZPVA 3MCLL 2R2HA 3WIHA 4KY1H 5K9JL 2VDPH 2E8ZA 3G6AA 5AG9A 3TIDA 5FUZH 1SJXA 3VFUA 3SDCA 1TCMA 1G6RH 4PGCA 5EIQA 5GRJL 4PB0H 3FN0L 4IRJC 4LLUB 1B6DA 2BDNL 5E70A 1T1YA 3CSBA 5TQ0L 4ZTPH 5EU5A 4WI8A 4GAYA 4N90E 5E94B 3TBWB 3FB8B 5E4EC 1GYAA 4XMKL 2VSCA 4OLZH 1XF5B 4GAJL 4YHZH 2R0WL 2NZIA 4B0MM 5A3IC 4MXQC 2DBJA 1I3RB 1INEL 3S37H 1YNTA 5L9DH 4JFHD 1VFAA 3W39A 4NKMB 1G7MA 4PGJA 4YIQA 12E8H 3X3FH 3KNBA 4X7TA 5FCSH 4W6YB 2HRLA 3TBYB 2EDHA 4LPXA 1OAYH 5IUSA 3DX6B 4KRNA 1YEDB 1UXWB 4FXKA 1P2CA 2CD0A 4ZFGH 2QADD 1XCTA 5SWSA 3PWJB 2O5ZL 3MBXL 4O02H 4DK6A 5C0IB 1G9MC 4H8WL 1JGUH 3CFEB 3MRBB 2MFNA 1AO7A 3B43A 5DD3H 3WMSA 1Y0LB 4GW5B 4HHAA 1HINL 5D9SA 4HBCL 1KELL 2CDFB 3NFNB 5I9QC 1BFTA 5INCB 3PGFL 1LO3L 3RGVA 2ZG1A 3B2VH 3WNKA 1BFSA 1K4CA 1XR9B 4YXKL 4WWKB 2BVOB 1OTSC 4MAYA 4ZAKA 3MRIA 2Q87A 2N1KA 3KJ4C 1HH9A 1RQ5A 5ENWB 3VGDA 3RVWC 3QQ3B 1BVLB 5LBSH 4FTVE 3MJ8A 2V2WA 2A1WL 3QQNA 2ICWB 3PWUB 2OK0H 4XPAL 3T1WA 4O4YL 5DS8A 5L8LB 3RY5A 35C8H 3OG6B 5EZOL 5I1JH 3Q0HA 4UNTA 2V9RA 4BFIB 4L9DA 4QTIH 2UZIL 4G7VH 5SX4H 2R23B 4QXUH 1JK8B 3HZVB 4P2OA 4KJPC 1DN2A 3GRWL 2OR9L 2GTWA 3LEVH 1TLKA 3IKCB 1BEYL 4DKFL 3KPLB 4MJID 3RVUD 4NQEA 4NO2A 3CFDA 3L3OA 2XNAB 1ZLVK 1FV1B 4PLKC 1MCRA 2X4UB 4O2FB 5TH2A 4YHKL 5F7UA 1BFOB 3BPOB 3MRFA 1Z0NA 2IGFL 3BOVA 2DYPA 4P3DA 4HUNB 4HPOH 4MCYA 3ARDC 5IG7B 1NLBL 2XWJB 3V6FA 4JFDD 3DVGB 3GB7B 1MH5A 1QYGL 4K23H 4WFGE 4XT1C 1DJSA 2VLKE 3O3AA 4R8WL 5F6IB 2VDLH 3GIVB 4OIIH 1OT2A 4KTEH 5A2IH 4OSUH 2GKIA 3CXHK 3MBEC 3WJLC 4NZUH 2IH1B 1DQJA 1F4AA 5ITFA 3QPQD 4P9HC 4AEFA 4HS8L 2XN9A 3D39B 1IAIH 1WISA 4OZHF 2IFFL 4NO3B 4Y4KC 1NDGA 4QRUA 4QNPF 1GGTA 5DD5H 3N1MC 1RZ8B 4N90D 3X11A 1K6QH 3ARRA 1A7QH 2CK0L 5L8JB 1T22B 1QNZH 5ICZB 2WANA 3QO0B 1M7IB 4WEBH 3WNNA 1KIRA 1NMCB 3AM8A 1UM6L 2X4TA 4ZUUB 3BUYB 2H1PH 3ILQD 1CDJA 1DQTA 2DF3A 4JKMA 4DGIH 1PYWA 1W0YT 3IU4H 2IBGA 3MLPA 1KPRB 4ZFZB 1EEYB 3ZMRA 2YPVL 1IL1B 2Z31D 1ZT1A 3EDEA 1RZIA 4YFDB 3W11D 1OM3L 3PDOA 4UTAH 3VD4A 5KSAD 3NFSL 2CUMA 1KJMB 4P23C 4S1DC 2IBZX 4UV7L 1C08A 5LAXB 5TJWK 3L3KA 4NO0B 2X2YA 4OTXH 3BZDA 2VYRE 2FECL 2QQKH 1LWRA 4XVUC 4ONFH 2M26A 3VWKA 3G6JA 5HSFA 1E4XH 2Q20A 2VZVA 1YY8B 1MSPA 3RBGA 3SHSA 1MCOH 2EIBA 5D1XD 2AABL 3GNMH 1JHKL 1GZQA 2OXHA 3O3DB 1JIBA 1S5HA 2ZUWA 4MNGB 1A6PA 2E8YA 3OAYH 1OW0C 1MJUH 4JG0L 4HMEA 4FTVD 2NPLX 4JO3L 3FMGH 1NJ9A 2NXZB 4Q2ZB 3MRNA 3MO1A 1FVDB 3HI1A 1CN4A 3QDME 5IB4B 3QDAA 4JO4H 4BQ8A 3VXSE 1RU9L 1TTFA 4DKEH 2D7NA 3PP3H 4P4RB 3HS0B 4OGXL 5I30H 4LQ1A 4PRNA 3ZT7A 3ZYOA 3N1PC 5GGSA 3ZYIA 1AR2A 3IT8D 3CX5K 3T4YB 2KKQA 4KJYA 3V52L 1LP9F 4WWKC 3FCTB 4L8BB 5JMRA 4UZGA 1BREA 1Z9OA 4QWWC 1UCBL 3MV7A 4XPBL 3QH3B 4TUOB 1QEWA 4QF1B 2O5YL 4D0CB 1FH5H 1E28A 3VDBA 3ZTJG 4NJ9L 3IDMB 1A7NL 5KVDH 4WFGD 1R3JB 2UYLA 3BISA 3LEYL 2VLKD 2CLRB 4V2CB 4JY6B 1I7RB 3KPOA 4IHOA 1G7LB 1T6WA 1IGYA 2QTEA 4DKAA 4XAWL 1U92B 1YJDL 4WCYL 3ARGD 1NCWH 2JB6A 2VLRE 4LCIL 1YA5A 3GI9L 4MGXA 4MD4B 3OGOE 5FKPA 1OD9A 4L8DA 2DWEA 3RU8H 4P4KB 3PL6B 2OI9B 3HUJE 4C4KT 5C07B 2F5AH 2XZCH 2JF1A 4PJEA 2G9HB 1KB9J 4HS3A 3SDXA 4R2GD 1M71A 1MAJA 3RZCA 3ARTA 4Z7QE 3BPOC 5ICYA 1V7ML 1UYWH 3SGKA 3P73B 3DX7B 1DDHA 1CXEA 2L4OA 4ODXB 4KC3B 4LSRL 3U36B 1WAAF 2V17L 2DLEA 3GSNA 4FFZH 2QR0A 4H1LG 2XZQH 4GRWH 4F80A 3BN9D 4ZXBA 4RMSA 3RJQB 3JV4B 4MA8H 5F6IC 4U3CA 4KI1A 3DSFL 3KG5A 4KROC 4EOWL 3UJIL 4YNYB 3KR3L 3GMLB 4P46C 1NGQH 5GGSY 1ZT7B 1CDCA 2E3VA 3HMWL 4JDVB 3B83A 3O81A 3RHWF 2NTFB 2WIIA 2R4SL 3IETB 4I18B 3ZDZF 2FEDC 1J11A 3VFPA 1D3CA 3SDYL 4U1HB 5KVEL 3MFFB 4N8PA 4P9ML 5CD5D 3JBG7 5C0CE 4QGTA 2R29H 1NMCC 3BXNA 3QCUH 4WU5B 2H6PA 1KJVA 2VLJE 2GYSA 5JW5A 1H0DB 1QRNE 2V5MA 4PJCB 1I75A 4HC1A 2XA8H 1UM5L 3T2NL 4OD3H 1JF1B 4RISL 4F7EB 5HYSA 3ULVH 2E7LA 1T5WA 1B0GA 3LN5B 3AGVA 3MRDA 3ZKXB 4M62H 4PJIA 1NBZA 3DHJA 2ESVB 3E6FA 1A22B 1RJZA 3QDMD 3VXSD 4RAHA 3OKKB 3NCJL 2BOCB 4AH2A 4XCYB 1FGVH 1RHHB 1MJ8L 1NFDF 2QSVA 2HT2D 4UIKL 3T0EE 1IFHH 3PHQA 2ILLA 4WI6A 3BYTA 2K3TA 3QIBB 5FM5M 1MWAL 2HFFB 1HSBA 1U3HA 3RPKA 5JPNB 1UZ8B 3FO1A 5D6DC 4H0IA 4HCRL 2FR4A 4S1SH 5TDOA 4E42B 2HFTA 4PRHB 4G6KH 4MB5A 3OL2A 2PYEE 2B1AL 3OHXA 4HKXB 4LLAA 4OCWH 4U1SB 3D85D 2IPUG 3QIUA 1CGWA 2J7LA 2VKXA 4JDTH 4M6NH 1LILA 4KVCL 4YDKL 3GSQA 1RK1B 3MV8B 2NXZC 4GFTB 4NZRH 3PIQA 4BH7A 4I3RH 2C1PA 4UILL 4QRSB 1YEIH 1F6FB 5HYQA 2AW2A 1FIGL 7CGTA 5ITBH 5AAWA 3CPLA 3HKFA 3QNYA 4V1DA 3LN4A 2OTUA 5JORA 1SYSB 1F5WA 2VLRD 4WI9A 1EFXD 4EN3B 3V4UL 3HE6A 4JDZA 4UOW0 5FHAH 3HNVH 3REWA 3EOTH 4ELMB 5I18H 5GS3A 1PG7L 1K8DA 2OP4L 4OD1L 5IHUL 5EZLB 2DQUL 3W0WA 3V6OA 5C2UB 3BMVA 3JTSA 2NXYC 2HLFC 3FT2A 3ILPB 4PRIA 4K9EC 1FLRH 5KVMC 2Y1VA 3RWCB 5BZDA 3TESA 1U8OA 1ZLVH 1DN0A 4HK0B 2C7UA 3MOBL 1IQDA 4NWTL 4G8GB 1X5XA 2DQGL 4DEPB 1NUGA 2WBJC 5I1KL 1YEKL 3HE7A 1KF9B 2FX9H 5E8OA 5KAQF 1FG2A 4XNZB 2J8OA 3P4MA 5DJZB 3FQUA 4NGHL 4PGBA 3RA7L 1PG7W 3TVMA 3PQYE 1GGYA 4ZUSB 3PGDB 2H8PA 2BNRA 2YKLL 4EJ1C 2OI9C 4P5KA 5JW3H 2GEEA 1WWCA 2B4CH 1NGWB 3FT3A 4OZIE 4LSPH 1Z3GH 4L3EE 5JUEL 3FFCA 1J05B 2HG5A 2IANB 2P5EB 1FP5A 1MREL 5C0CD 2L7JA 1G6RB 4YZFF 3LPFA 4YDJA 1I1AD 3IDNB 4I0PD 3VRIA 2VLJD 2EXWD 3WIHH 1QRND 2GTZA 4F2MB 1FC1A 5J3HD 3AROA 2P24B 4MJ4A 4JFXA 2D4DA 4JE4B 3BPNB 4UDUA 3RGHA 1D5IL 1ITBB 2IBBA 2B1HL 5FM4A 4L4VA 1WZKA 4RX4D 3MUY1 1FLTX 3IXTA 1R24B 4PJAF 1IC4L 4E9LA 4YUEL 3KLHD 4JRWA 3T0ED 1U8KA 2NY2B 3QQ4B 1ZHKA 4JY4B 4I18C 4U6YA 4DZBB 4KJWD 4TNWK 3UDWA 3JVGA 3I2CL 4RAUA 5F3HA 1F90H 1ODAA 4X8XA 1DBJH 4PJHA 4LCCB 4TUKL 2XWBB 4TTGA 2V9QA 3OX8B 3L5WA 4UT9L 1HHKA 1X6NA 2AERT 2PYED 2ZKHH 3U46B 3QI9D 4X6BB 4XP4L 1SJEB 1IC5L 1BZ7A 4HGKC 5HGHA 5CLTA 1A3LL 5HYJB 4MJ2A 4JY5H 4Z95L 5IW6A 2XFXA 5E5UB 2GK0A 4HPYH 3ZTJH 4X9GA 1XGQB 1EMTL 4M7LL 3W5NA 1YPZB 3O0RH 7FABL 5FIEA 3V4PL 1S78D 4MA7H 5DEFA 1T80A 2VXVH 3VRLF 3GSXB 1KG0A 4YHNA 1EBPA 2AJXH 5IM7B 1V7NH 2EDKA 3QIBC 2NW3A 2IQAA 5KAQG 1Y6MR 2BHUA 3U6RA 1AGDA 2VDOH 4U1NA 4WJ5B 4WW2C 4PJ9A 4X0KB 4KH2A 4R3SA 5D7LA 4LU5L 4CVWA 4FXGB 5EUOB 4HKJA 2DKSA 2R1XB 3OR6B 1BOGB 4ZO6A 3FHQA 3THMH 2A9NH 4OKVA 5EWIL 5C86A 1QFHA 5F9JA 3ZDYE 5L2JB 3C5ZA 4KXZH 2HKHL 3BPLB 3MLSL 3VXPB 4ZUVB 3C5SB 2BY3A 1UACL 3EZ8A 5D1ZA 4H1LH 1G7PB 1UENA 4YBQC 1EERB 4G5ZL 4AEHL 1TDQA 5B39A 4LAQL 1XGPA 3ARBD 5DHVA 4YDIL 4G6FD 3RUGB 1UB6A 4YFLF 4Z76B 2ARWA 4BUHA 1YEFL 4JGUA 1KPVB 1DBKL 2PETA 4FFYH 2UV3A 3PQYD 3UTZA 3OXRB 3ZT6A 2A6IA 2Y36H 3DGGA 4IIQB 5ADPH 4DJMA 3OTTA 3SJVB 2BXYA 4KTDH 4HJGB 4L3ED 4YAQA 3T4AB 1C1EH 5EPMA 4Y5YA 2BFVL 2V7NB 1OQXA 4PJXB 3V5DA 1VGKA 3ZDXE 4HAGA 5CD3B 1AGFA 2VR9A 1QBMH 3OR7B 2RFXB 4MQXC 1Q72H 5LGJA 2GY7B 1X5AA 5DFWH 4DEPC 3W2DL 4EXKA 4OCYL 4YHYC 2EDTA 5DEGA 3ARFD 2YN3A 3WHXB 4XNZC 2EEBA 4KRPB 1IGJB 5CZVH 4UINL 3KYKL 3K4DA 3QUZA 5DT1H 4QCIB 3EUUA 1B2WL 5A2KH 1NL0L 1JPTH 2FO4B 3S4SB 3BKJH 2BC4A 3K4ZA 1OAZH 4P49A 1MCWW 5DZLA 1KEML 4LEOB 3DNKA 3MLXH 2CDGB 5IIEB 1U8QB 5EIVA 4ZOEA 4KGLA 3GMPA 5B3JE 1H3TA 1MFDL 1DEEB 1T1ZA 4YPGA 1NBQA 5ESQA 1ZVSA 4GBXA 5KS9B 3HC4H 3TBSA 1I1YB 1MCNA 2JJTA 5D1QC 1BJ8A 5EC2A 1QG3A 4KHTL 1S9XA 4KPHL 3OPZH 5F9DC 2CKBL 4I3SH 1TJIH 1UZ6E 4JJHA 2H32A 4UT7L 3V8CA 3WFDH 2EIDA 3QA3B 1HHHB 4X5XA 4IS6A 5DK0A 5E95B 1IARB 1A7BA 1F4WH 5E00B 3TO4A 1MQKL 2YMXL 4ZFOL 4CNIB 1YMMB 2DQFA 5FGCB 3VGGA 3DMMB 1R5WB 5KTEL 2SEBA 4EUPG 3EFDH 1FPTL 3ZKND 1S9YB 5ESVB 2CRYA 1W8NA 1BLNA 4ZOAA 5F71A 4PJGB 3DI3B 5GS1A 4M6OL 3H9YA 3O2DA 3HC0B 2HLAB 5EU3B 5ALBL 1HHIB 5DRZB 5GRZA 4R90L 3MQIA 1NCAL 5FGBC 4JZJA 1DQLH 5C8JA 5I1CL 4LOUD 1UJ3B 3RY4A 3MACH 4JM2D 1F2QA 3GJFH 2FJHB 1EEZB 5E08H 3OAZK 1BVZA 4LVHB 2IJ0C 3FTGB 3EYOB 2AVGA 2YBRB 3AU1B 3KPQB 2C9AA 3BPCA 3HC3H 3BKCL 4X9BA 5KG9B 1DSFH 1FYTB 1BIIA 2HAZA 2ZP0T 4HJJL 3SGEI 2NZ9C 1FL6A 2RB8A 3Q5OA 1UA6L 3VG9C 4NYLA 4TNVF 1J1OL 2HJFA 1MIML 5FYJH 5HPMA 2LAGB 1VFMA 2GSGB 5LQBL 2W92A 4N8CH 5FOBA 2RIKA 2DTSA 3KPTA 4O58H 4X4XA 5T1MA 1JYXA 1IGFL 1GVIA 1R3HA 2M2DA 3Q6FB 3MSPA 1QO3B 1WCBA 5HVGB 2R0KL 4AY0A 1CQKA 1GHFL 4JZNB 2J4WL 4HJ0C 1H3GA 3TO2A 5DVMA 3QG6B 4KDTC 5A3ID 4MXQD 1EGJL 2OYPA 3VCLA 5IBTL 3CDGB 4PJ7F 3E8UL 3LKQB 5F7DA 3OKOB 1ORQA 3VXRE 1BOYA 2EYSA 4GRWB 1VFBA 4FABH 3PHOB 3O9WA 2VXTL 3D5OF 2VAAB 3CJJA 3HRPA 4Y1AA 2A77L 3D9AH 4Z0XB 2G60H 3DLQR 4HWZB 2BVPA 2OZ4A 3CU1A 4YO0A 1VADA 4MXVF 5CHNA 3T65A 1JJUA 1YEEL 2YD4A 2Z4QA 5GGQH 2BJMH 3QG7L 4GQ9L 4GLRI 1IGTA 4JHAL 3BP6B 2CUIA 5EBLA 5CLWA 3QUYC 1P5VA 3RDTD 4N9GA 5BO1L 4NHCH 1A7OL 1IBGL 2R0ZH 4Z0BH 1A6WL 2W07A 1H15B 2VZSA 5CBEA 2H3NB 4MJIA 5KSUB 2Z8SA 43CAA 1BJMA 4F58L 3QDGB 2HH0H 3WNMA 3VXUB 3L1OH 1DE4B 1SVZA 4QTHB 2NLJA 2UWEE 5DK2B 3TF7C 1OTSD 4HKBB 5E8EB 3VFRA 1MPAL 5MENE 3WLWC 4I2XA 4JPKH 4BQ9A 5EBGA 1T03H 4HFWA 1BPVA 1QR1A 4JFPB 5D70L 3HI6H 3CU7A 3TBTA 5C0GB 4O5LH 1WBZB 5AEAA 4OFYD 4JFDA 3KPRB 3MLUH 2ARJA 4RNRA 4DTGL 3VXQA 1HIML 3V7MA 3GIZL 3B9DA 4OLWH 5GZOD 1N59A 1CF8H 3CNKA 4KJPD 4CADA 4WO4B 4ZS7L 3BEWB 3QRGH 4BK5A 3MZTA 1HXYA 2X4OA 2XKNA 2D3VA 3MLWH 2DN7A 5GISH 1TZIB 1AIFA 3MV11 3QBTB 4Z5RA 4LARH 4XHJC 5IESL 4NQCB 4HG4K 2FSEB 1X5KA 2P48B 3MV9E 4XMLL 3VGBA 5I73B 1WZMA 1LNUB 2BSSA 2W38A 4G7YL 4BUGA 1ERNA 2EYTB 3H0TB 4OF5A 4WDIB 2X9WA 4U6TA 3ARDD 3OGCA 3SGJA 3KGRA 1JCKA 4G42A 1CK0H 1HH6B 1MI5E 3TH2T 4ENED 1G9ML 3DMMC 3MRPB 1YYMH 4OQTL 5MEPA 1T6VN 3BIBX 3WN5A 2ADFL 3N85H 5CFHA 4MQ7A 1GH7A 4PIRF 3NCCB 1HDMB 1LO2L 4IDLA 1FJ1A 3VXMA 3MBED 3G5VA 4PTTB 1WT5A 3LAFA 3CZFB 3OKDA 2R69L 5KSAA 5F97E 4J1UA 3WXWL 1BVKA 2RHEA 3CLEL 5F9WC 1CFSB 4JQIH 4U1KB 3DYPA 3NTCH 3FONB 3KPSE 1PD6A 2FBJH 3KXFA 1G84A 2VE6A 1TCRB 3NIFE 4XGZB 1X7QA 2O61B 2M8XA 4M02A 4U33A 3TNMB 4RGMB 4P2QE 4FQXC 3LDBB 1DQMH 3P9LA 5DJYA 3VXRD 4ONOA 2W0PA 1ITCA 1KNOA 1OGAB 2Q76A 3LKSA 4BFGA 2WUBL 1I8MB 3AFLA 4WGWB 1XIWD 1BBJB 2K7QA 4O00A 2ZUYA 4FTVA 3QQ9D 1AKJB 2GITA 4LLWA 4PRAA 1WJ3A 4UNUA 2FL5A 4WV1C 4JHWL 2C3VB 2DOCA 3GBML 4BZYA 1RFDL 4LAJH 4PY8I 4S1DD 4XWGL 5D71H 2VN4A 3NZ8A 1FFOB 3MLZH 5TF0A 4CVZB 3QFJB 1T0NA 2AKRB 3HPJA 1DVFC 5JHLH 5IQ7H 1DFBL 1OP5K 1OTUD 2CMRH 4UQ2B 3VH8G 2GT9B 3O2VL 4M1DL 4XVUD 3ULSB 5K9KA 1MCLA 3M8OH 2N7AA 3TYGL 4RRPG 5K33A 4X7EC 3FOMA 4ZPVB 4YJZL 1D5ZA 4GSDH 2R2HB 2VLLA 1A9BB 5JZ7C 1HHJB 1GGCL 3VD7A 1L9MA 4RMQA 1N3NA 25C8H 5MEND 1RIVH 1FNEB 4PP2A 4P9HL 3UP1A 2J12B 5E03A 1T04A 5C0RH 2WSKA 4G6JH 4JN1L 3EJZD 3CZJA 2VLKA 3EBAA 4EUPH 2OJZH 1MFCH 4M6MH 4NQDE 3L7EA 5IB1A 4U1IA 5MP6H 3ZHDA 2VQTA 4J3OC 4XPTH 4UDTA 1YNTB 2N56A 4FG6C 1U3YA 3W39B 5E6IC 3MCG1 3PE9A 1MHCA 4YIQB 1FGNL 2AEIT 4GMSH 4DUXA 4A6YH 3MV9D 4OZHB 1DLHB 4ODSL 3TN0C 1AJ7H 4EZMA 2AAVA 4QHNA 4PG2C 4QWWD 1A3RH 3N1FC 3O3BB 3SGEH 3HI5L 3JWOH 3W9EA 1HI6A 5GHWL 3PXJA 1WGOA 1MI5D 1ZLSL 4HMDA 4Z7WE 2Z35B 3VFGL 1CFNA 1MHHB 2YPKA 1FDLH 4R7NB 1K85A 4NC2B 4BSVA 4PYGA 1A6AB 4HHAB 5CSGA 5D9SB 4B53A 2J5LB 4F9PC 5D2NB 1OP3K 4HUMB 3RGVB 4G43B 3VI3F 5T1KB 4ZAKB 5C0BE 3D2UB 3O6FC 1OWRM 4X6EB 4MSWB 4P48A 1CD9B 5T1LD 4OLVH 3KPSD 3MR9B 4EI6A 3GHEH 3VXOA 1NUDA 1K2DA 4JRYA 3EFFA 1FZMA 1H3PH 4P2QD 5DQJA 5EO1A 4KMQA 2ZG2A 3BH8B 5CJ8A 5DDHB 3QCTL 4AEIH 4X5WA 1EBAA 3RIFF 4H1LB 1PKOA 3C5JB 5DRXA 5E1AA 1HNFA 4GS7B 3WSQL 5GJSH 5K59E 1SEBA 4LKXB 1U8LA 2K1MA 3IYLW 5IV2A 4NO2B 1OP9A 3C6LD 1DBMH 4P46D 1CLZH 3QDMA 5CWSA 2OM5A 3TGXA 3VXSA 2E7HA 1XF2A 2YSSA 4JM4H 4GJTB 1XZ0A 4POZC 1CXHA 5DHVH 4HT1L 1Q0XH 4TULH 4FP8H 4R4BA 3GDBA 5DJ0A 4JANA 5LGHH 2FEDD 1DL7L 2VDRH 3DV6B 4H88H 3KYNB 4PV9A 5IB2A 1RIUH 2X4PA 5DQDH 4LSDA 1ADQL 4M1GL 2APFA 1RZJC 2KL6A 4Y16C 2EE9A 3DETC 1NAKH 2O5XL 3D85A 5B8CA 3QPXH 5KVFL 4F37K 2AV7A 3MOAH 3LH2H 1LP9B 4DVRH 1NDGB 1JZ7A 1QKZL 1BWMA 3BQUC 4D0DB 1OTTC 2PCPA 3MCLH 5ECJE 5JNYA 2IG2H 4Z7VF 3O4LE 5FK9B 4HLZG 4AL8L 2UVFA 4NQDD 3MA9L 4UIMA 1FVCA 2HTLC 3D0LA 5DRWB 1P1ZA 2OR7A 3EOAA 2X4TB 4JR9L 4Y4HC 5DO2D 5GRJH 2VLRA 4L3AA 5HI3D 5BVJB 1EFXA 2A83B 4TTDC 4N0UE 3FN0H 4ODHL 1KXTB 5SWQA 2BDNH 5DK3A 4K3GA 3UX9B 3OMZA 4MDJA 5TQ0H 2ZUQB 2DWDA 3HUJA 3SE3A 5GXBB 5IVXE 3L3GB 1NDMA 1OARL 1TVBB 1S7RB 2J2ZA 3W9DB 4JAMB 4HKZA 1ZT1B 5GRVL 4BKLB 1ZT4B 4GAJH 2R0WH 3RI5F 5BZWA 5TE6L 3EOBB 5DRNB 2E27H 3SDCC 3EIFA 2UY6A 3U2SA 2ADGA 3HZKB 3QUML 1CS6A 4ZO9A 2FYYA 4NM8H 4J7RA 5ETUA 5E9DB 5L7XL 1CQYA 3CFJA 4N0CC 3VWKB 2NR6D 3G6JB 3OKMA 4OM1H 5LVEA 3WFZA 5T3ZL 4N0RA 2QSTA 2IPTL 1V3LA 1S7TA 1LK2A 3SDDD 3GFUA 1GGIH 2O5ZH 3MBXH 3D3VA 3JXAA 5C0BD 4EDXA 5ID1A 4GOSA 4H8WH 1T7WA 5C0EB 4JVPA 3TZVA 1NJ9B 4HZAA 4CJ0A 1JWUA 2HKFL 2FX8L 3MRNB 2Y7QB 1HINH 1KELH 3MO1B 2E6PA 2NXYD 3FQNA 3PGFH 3KLSA 1LO3H 2HLFD 4PJDF 1S8DA 4I0PA 3B9KD 4YXKH 1SYVA 4QRTA 5DURB 5EDXA 2W9EL 5IMLA 2VO5A 2AXHA 1F3DJ 3BKMH 1QPPA 3GJFB 4L8SA 2ZNWA 2WBJD 5LXGL 3ARZA 5CMAA 4XPAH 3CC5A 4O4YH 1MCDA 2J5LC 1KN2L 4RX4A 1S5IL 3RGVC 5EZOH 1INQB 3QO1A 4LVEA 4PR5B 4OZGA 4MAYC 4ZAKC 2OS7A 4GG8B 3T0EA 2UZIH 1FL5B 3NACL 1IAOA 1QEWB 2P7TA 2OR9H 3JTTB 3P4OA 5DJDA 2I25N 3RNQB 4KV5E 5CEXB 3GKWH 4XCEB 1BEYH 1E28B 1NFDB 5IMOB 4KRLB 1UADC 4DKFH 4XB8A 2F53D 1MCPH 3EDJA 3UTQB 2FWOA 3L9RA 4DN3L 3QI9A 4Q9BA 4FQJH 2JIXD 5L6YH 2ICEB 2IGFH 4P2OC 1Q9WA 1OPGH 2JB6B 4GS7C 4QOKA 4XP9H 3ROLB 4D9LH 2DWEB 1NGZA 5F7KC 5AZ2H 4P0DA 4K3EL 1QYGH 3R0MA 4M5YH 1FO0A 3IFOB 4R8WH 5FDWA 3U30B 1U8NB 4PJEB 5ICYB 4JKLA 4MHHI 5ANME 1I8IA 4HS8H 5FA4A 4XP6L 2YC1A 3SCMD 2IFFH 4K9EL 1J0IA 4BELD 3UTPE 3KHOA 1DQDH 2XZAL 5DMGC 3WIFA 5J13B 2CK0H 5J0BA 4NBZB 3DX9A 5IHBA 3HCVB 3QIWA 3WV0A 4OZ4A 4Y5VA 3WS6A 4HIHA 5JIHA 3C6SB 3VFNA 1U3ZA 3V4VL 4E41B 1OB1B 3MREA 3VFMA 5C08B 32C2A 4GAGH 2WM0A 2Y6SC 4J3SA 1LEGA 4WU7B 3VFPB 4Y5XA 5IBUG 2JCCE 1R3LB 2XWTA 1LHZA 3ARBA 3WO4C 2YPVH 1JE6A 2W1NA 2ZSVA 1F3DH 2EICA 3RWEA 5JO5A 4JFOA 5EOQL 3BXNB 1OM3H 3VWJD 3AM8C 4WTWA 1WLHA 2DQDL 3IRPX 5FGSA 4EQ3A 4Y0GA 5JW5B 4O2CB 1DR9A 3PQYA 4M6AA 4UV7H 3TT1H 2CKBA 4ZUTA 2DJ4A 4OZIA 4L3EA 4ODVL 5HYSB 4KK8C 2DTMH 2A74A 3MRDB 1NBZB 2LU7A 1JRHL 1RJZB 4P5MA 3T08A 4XPFL 1PKQA 4M9PA 1JHKH 1CL7I 1NFIA 3NN8A 3PHQB 1LDPL 3RKDC 3FAXA 4YBQD 2DQEL 4JG0H 1HSBB 4JO3H 5C0FB 3EYVB 1UWGL 3EYQC 3FO1B 5IB5B 3VWKC 4LSTH 3ARFA 4ZSOB 2FR4B 2BCKA 2NTSP 3RFZC 1J5OL 1RU9H 2G75A 4Z78A 2D0GA 4KVNL 4RFEA 1UEMA 1N6VA 4Y88A 3QIUB 3FQWB 5D8JL 2AK1H 1FL3B 1K4DA 4PJAB 3OKNA 1OP3H 2XIDA 2FH6A 4DGYL 3PIQB 2JKXA 3ZSTA 4UUJA 2B20A 4HV8B 1AXIB 2VR4A 3V52H 1CBVL 3CCHB 3LMJL 4DFHA 3LEXB 4MQXD 1FCGA 3SN6N 4V1DB 3LN4B 1UCBH 3I84A 2P47B 2Q86B 4XPBH 4DUWA 4YGVA 4PP1C 2DI9A 5HDBE 2O5YH 2IAMD 4NRYB 5C09E 5E56A 2H9GA 4NJ9H 1A7NH 1CIDA 4X6CF 2VDQL 3QNXA 1A21A 1ETZB 1MRFL 5I75C 1QUNA 3MXWL 3WDHA 4MNQB 1A6VH 4XAWH 3TIEB 4HLZH 3PWNA 4WCYH 1AY1L 2R2CA 3FT2B 1U8MA 1PEZA 5CBAA 2VR5A 4LCIH 3GI9H 2APWA 1QSFB 2OQJB 3FT4A 4H5SB 4PRPE 4JFFB 1XGUA 3UTPD 4WUUA 4HUXA 1CT8A 3FO9A 5EIIA 4KZDL 1ES0B 2AXFB 1MOEA 3HPLA 3OJVC 4PBVC 3HE7B 1SHMA 5FYKE 5E8OB 1FG2B 2F54A 2DQCL 1V7MH 3SKNB 3AY4C 3AREA 3UTSB 4LSRH 2V17H 4L9LB 1PZ5A 2BNRB 1GOFA 4P5KB 2VISA 4TVPL 5C6PB 1KENL 3DARA 4MS8D 4I4WA 4RMTA 2DD8L 3FFCB 3U30C 1UWEL 3DSFH 3RZCC 4EOWH 2OLDA 3P40A 3UJIH 1I3UA 3EHBD 5EBWB 2R2BB 3KR3H 3V2AR 2OTWA 3UC0L 3WNOA 4HXBL 1NQBA 1BAFL 3SGKC 3TPUB 4QRQB 4DK3A 4MCZB 3NH7L 1UXSB 1OSPH 1RZ7L 2GTZB 2YK1H 1CXIA 1V3JA 1OY3B 5L2KB 2R4SH 4ZXBC 4EUPB 1HHGB 1PAMA 5J13C 5HYEA 5HHMB 5KVEH 1HK6A 3NZHL 3SEPA 5KZCB 5D7IA 2IMNA 3FQXA 1U8PB 2VABA 1LVEA 2P5WE 1Q0YL 3QYCA 4JB9L 4NKDA 1RUMH 1IC7L 1R3IL 4PD4K 4HWBL 1S3KL 1MHPL 1T89A 1KXVC 4A6YB 1UGNA 5JHDB 3T2NH 2V7HA 4KY1L 1SBSH 4JLRA 4LDOB 3WFCH 4HEME 3S34L 1KCUL 1ZLWH 4YX2L 3NCMA 5L0QB 2FBOJ 1JGVL 2W0LA 1F3RB 2QKIB 4HIJA 3NCJH 1FNFA 1G7JA 4FOMA 4NNYA 4F7PA 1MJ8H 4HSQA 4ZTPL 5FECA 3GMRB 2X5PA 4XAKE 3VFWB 5I74C 1BZ7B 3QJHA 2NZ9D 2X70A 3DO3A 2E7LC 4HCRH 3QXTA 4XZUA 4MLSA 3BGFB 4ONGL 4XH2A 1OGTA 4YHZL 4N0FA 4R6UA 5KSBF 4NQTA 1G7QA 3UMTA 4MA1B 1CFQA 4GKNB 2B1AH 2BSRB 5DEFB 3RDTA 1UQSB 3ZTNL 4HEPG 4NC0B 3X3FL 3PABB 4KVCH 4YDKH 2NW3B 1RV6X 2YWYA 3WKML 1U3HC 4X4YA 3U6RB 5C09D 4HJ0D 5BS0B 3BIKA 2DQIL 4U1NB 4PJ9B 4R3SB 1FORL 4UILH 1VDGA 3ZE0F 4WHCA 3NCEB 4OUUB 1FIGH 3Q6GL 4M93B 2R1YB 3HFML 3QIUC 5I0DA 5D7SL 4JM2F 1F4XH 1T20B 1CLCA 3SO3C 4NNXA 4NRZA 4OFYA 3EJJX 3CFCL 3QXDA 4PRPD 3V4UH 4NFDA 4X5LA 5D1ZB 2JK5A 2PO6D 5ERWB 2VH5H 3PGCB 1PG7H 4L5FH 4LCYB 4GXVH 3ULUC 3BVNB 4OD1H 5JQHC 5IHUH 4NN5B 2DQUH 3C09C 5FYKD 1NBVH 3DRQB 4K7FB 2BMKA 1HNGA 4IJ3B 5FUCC 5LBSL 1E27A 5HHOE 5C9KA 4F8TA 4W81A 2EKSA 5FFLA 3HE6C 4W6WB 2IPKB 4NWTH 35C8L 3ZDXF 4YAQB 4HH8A 4QRPE 1YY9C 1A1OB 5I1KH 1YEKH 2DDQH 3N9GH 3V6OC 3QDHA 4NGHH 3LD8C 3SGDI 3EKCA 1VGKB 4J4PD 1S7XA 3CUPA 4ZQKB 3LKNA 5EZJA 1KT2B 2YKLH 1D5MA 1CL7H 2Q3ZA 5JUEH 3UPRB 3S35H 3EO0B 3P9WB 5TDPB 3HE7C 4KKLC 1MREH 5DEGB 1ROWA 1WBYA 2UZXB 1S7QA 2DLHA 2P5WD 4C58B 4RQQA 2B5IC 3V5HA 2GUOA 3TVMC 3G5XA 5I16A 2CRZA 3SBWA 4G8IA 3QEQE 3MJGX 4XHJD 1A7RL 1JNLL 5GGUA 2VDLL 5FF6B 4G8EA 1JPFB 4KTEL 3IDYC 4Z7NE 4LCUB 1A4JA 4OSUL 4NZUL 1JTTA 3WBDA 4M3KB 4J3VA 1IAIL 1IC4H 4YUEH 1L9NA 3VXRA 5HD8C 1EJOL 5ESQB 5DD6A 5DD5L 1XIWA 4XAKD 1K6QL 1UZ6F 2YWZA 1A1MB 1UKQA 3I2CH 4X6DE 2BSTB 5EC2B 4HZLB 2EYRB 2XTJC 2DMCA 3B4NA 4YC2B 5GRXG 2X44D 6FABL 4TUKH 4L3CA 4Y4FD 4U2YA 1GZPA 4UT9H 4YBHA 5D2LE 5DYOA 3GKZA 4D0BA 4NC1E 1C7SA 1JTPA 2H1PL 2NW2A 4XP4H 4JKWA 3PWPA 5DK0B 1CE6B 1IC5H 3TO4B 3QUKA 3KYMB 4FQQB 2PYFB 3IU4L 3UDWC 3JVGC 3RWDA 5C71A 1KCKA 3IDXL 3R8QA 4HUWA 4F7TA 1A3LH 4Z7OF 1T66D 4PJBA 2SEBB 4PREB 4UTAL 1ZE3C 4M7LH 1EMTH 3ZL4L 4QHKI 3WFHB 7FABH 4PPTA 3O41B 5HVHB 3HAEG 1ZA6A 5E5MB 4FMFA 4JPIA 2CUHA 3TPKA 4RAVB 1NKOA 4RGNC 3VRJA 3P0GB 1MCOL 4HBQA 3DXAE 2X9XA 3GNML 2MQ0A 1K5NB 3MYZA 1QHPA 1AGCA 2LTQB 1DVFD 5EWIH 1MJUL 4RA0C 5HHOD 4RFNB 1A6ZA 1D5BB 3FMGL 4OI7A 3VH8B 1FNSH 5EU6A 3MLSH 4NN6B 1UACH 3BPCB 1D6EB 3B2UD 4PJ9C 3JV0A 4G5ZH 4AEHH 1BIIB 4LAQH 5ACLA 4QRPD 4NYLB 4KKAD 4YDIH 3JV6B 4LCWE 5HPMB 2QADB 2UUDK 1AP2B 5IR1A 1YEFH 3DO7B 3VMNA 1DBKH 2VZ3A 3VI4E 4A2MA 1O0VA 3C5ZC 3DPBA 4OLYL 3W5MA 1MI5A 1A6UL 3WEXA 1R3HB 5GGRA 1PLGL 2Q8AL 5D1ZC 1WCBB 5F7YC 3NGBB 3MV01 3EJYD 2BFVH 3ET9F 5HGAA 1G0YR 2DQHL 2XXCB 5F7DB 4U6HA 1ORQB 2EYSB 1VFBB 3DURB 1FH5L 1N8ZA 2L0DA 3HZYA 3QEQD 5T1LA 5DMKB 1NGYA 1GSMA 3KPSA 5HI4D 1Z5LA 4X9IA 2BVPB 2EKJA 2ENSA 1JV5A 4YO0B 3W2DH 5J06A 1FZOA 3TN0D 3T65B 3QFDB 5I1LA 5EU4B 3PJSB 4R0LA 5DTFA 3UYRL 4Y5YC 3VXNA 3V0AC 4AG4L 1QZ1A 1NCWL 4ODBD 2YXMA 3CDFA 1HYSC 4UINH 4LHUD 3WIIL 1S9KC 3KYKH 2XG5A 1EXUB 1B2WH 3DECA 1NL0H 1JPSH 5B38G 5EU7E 3SKJL 3IJSA 5HDQH 3KYOA 2LU4A 2X1QA 1KLUA 1DCLA 2UWEF 4YWGH 1KEMH 1XGTA 3C6LA 43CAB 4MD0B 5IROA 1MFDH 1F00I 2NLJB 2I9TA 3VFRB 5EO0A 3O6FD 3QUZC 3MXVH 1P4LB 4HFWB 1IKNA 2I07A 5E0QA 1NCBL 4ONHA 3TBTB 4MA8L 1S7WA 3F58H 1A47A 4J8RB 4L8CA 4JFDB 1XR8A 2ARJB 2CKBH 4MJ6A 3VXQB 4M4RA 2P8LB 5GS2D 3LKRA 3P0YH 5EA0L 4TN9A 5SWSE 5KBNC 1NBYA 5IMKA 3L3DA 3OKLA 5HI5C 4WHTB 3FB5B 5GGRY 1JMZA 3B9AA 1MQKH 4GBXC 1HXYB 5GQBA 2JJTC 2XKNB 4D9QE 3IU3A 2CLZA 2D31B 2DI7A 3DUHA 2I60L 5CJXA 2A6DA 3GSWA 5C1MB 3MGTA 3S6CA 3EOYG 4Z5RB 5KTEH 4WIQA 1REIA 3DXAD 1LE9A 4M6OH 1WK0A 3AAZB 3FRPA 1J87A 3STLA 1CD1A 2BSSB 2FEEI 3HMXL 5I8CB 3BX7C 4HIXH 1FZKA 4OCSL 4X9HA 3TO4C 4OD3L 3HNTH 5I1CH 3F7YA 2JB5L 4M62L 4KK9D 1KTRL 4Z7UA 4MD5B 2ZCLL 1BQHA 2ZOKB 5GS1C 4MQ7B 4Y16D 5D72L 2Z31B 3TNNB 3DETD 5F44A 4S1QH 4LCWD 4X6FA 2ZCHL 3OKDB 3I6LE 5L8KB 1Q9KA 3FOLB 4LGSB 3O6ML 3DRTB 3NIFF 4JZJC 1U93A 5I71B 1LGVA 4Z7WA 3T3PE 4NQEE 1J0KA 3BKCH 3BQUD 1OTTD 4HJJH 2VDKL 4G6KL 1UA6H 1J1OH 3I6KA 4I77L 2HTLD 1MIMH 4PJFA 4HIIA 3LRSA 2HFGL 5F93C 5D1XB 4Y4HD 2AQ3A 3U0PA 3SDDA 3P9LB 3WLBB 5EOTB 1YN7B 1J1PL 4K8RC 3U82B 3MZGB 1X5YA 1IGFH 5E6YA 4EQ2A 1J0HA 2QV2A 4FTVB 4U7KA 4IRZH 5FKAA 5T33L 2R0KH 1GHFH 2J4WH 4LLWB 4PRAB 4LKCB 4R96B 2JJUA 3WCYA 4NZJA 4W4OA 1EGJH 3RY6A 2X4QB 5IBTH 5T1DH 2XN9E 3X14A 2AXGB 2X1XR 2GSIB 5MEOA 4JKKA 3BH9B 5FO7A 1JGLL 3U9PL 1NAMA 2A77H 1KOAA 4R7DA 2WWKT 3OG4B 5FHAL 3V9FA 2WK2A 4P57A 5GS0C 4JZOB 1NEZG 4GKZA 3NGBC 4HH9B 1WQVT 4TUJB 4ODUB 1G7HA 1YEEH 3T04D 1FFNB 3QG7H 5TE4H 4GQ9H 4OD2B 4QY8A 5I1AA 1EVUA 1FSKC 1IEAB 1RZJL 1CDGA 1OD7A 3O9WC 5IGXL 1BZ9A 1A7OH 3RWJA 5BRZA 1A6WH 3MRHA 5CGYC 4LGRB 1T83A 3FQTA 3T8XB 2R39A 1EHLL 4F58H 1MVUA 1A7PL 2VLKB 4E5XB 3KVQA 2YUXA 5SWSD 4U1IB 1MPAH 2HMIC 3ARGB 2JIXA 4NM4L 3UTOA 1YZZA 4C83B 2ATKA 1I7UA 4UDTB 5D70H 3NCYS 1FNGA 3HAEH 1RK0A 4IRSB 4D9QD 3CXDL 1JPGA 1MHCB 3RVUC 2O93L 4DTGH 3QDJA 1HIMH 3LKOB 3VGAC 3O4LA 3WIHL 5HHNB 3LRHA 4R2GB 3EO1B 1TQBB 3GIZH 2VUYA 4HIEB 4XC3L 3WS3A 3U7WL 4Z7WF 2OBGA 1OAKH 1MWAB 5HXMA 4ZS7H 4Z7VB 1HI6B 3SCMA 4N0UA 1DZBA 1UCTA 4S2SA 5A16B 5HGDA 4GRLD 1FE8L 1NC4B 3OJMB 1H3XA 2K7PA 2XACC 4FMKA 5IVXA 1KB5L 5IESH 3UJTL 3TWCL 5IP4A 4RMUA 4XMLH 5IJVB 2HVKA 4G7YH 4I48A 2EDWA 3RP1A 4AMKL 3QPQC 3I6LD 4YEFA 5KW9H 5ISZB 4OI9A 1JVKA 4XMPH 1FVEB 1F90L 1ND0B 1DBJL 1G9MH 4NQED 5I8OL 4GKSA 2BZDA 2ZKHL 1K2DB 1LO2H 4OGAD 2EDRA 3U9UB 1YQ2A 3U7AA 4FZEL 3EFFB 4QHUA 3RNKA 3MV7E 5DQ9B 1TIUA 2R69H 2YA1A 4KKBD 5EFIB 1WBXA 2DYPD 3WXWH 1QLRB 3K2MC 4X8JB 5F89A 3CLEH 3SGJC 4X5WB 3ILQC 5E1AB 5DRXB 2ADJA 4QEGA 1OF2B 3T0DA 3F12B 3TJHC 3WN5C 3O0RL 2N4IA 3VG0H 1DUYA 3LOWA 4ZYKB 3I02B 5IV2B 4MA7L 3DIFA 1WT5C 1JZ6A 2EDEA 3QDMB 5CWSB 2CIIA 2XN9D 4I0KA 5KSAC 2YSSB 1JNJA 1WZLA 4GMTH 2D7PA 3HLAB 1NSNH 4B50A 5DJ0B 5DMIL 3H3KA 4PJDB 4F3FA 5CEZE 2A6JA 3NMEA 5IBUB 2UUDH 1IKFL 1VEOA 4WTXA 3SDXE 4PRDB 1T1WA 1OAXL 5IB2B 2IEPA 2X4PB 1MRCL 5FYJU 1CE1H 4JHWH 3GBMH 1RFDH 4LPTA 5GZND 3D85B 1I1FB 5I76A 2EZ0C 2MJWA 5B8CB 1NGXA 2X4RA 4KQ4H 1DFBH 1T2QL 3IDJA 4M1DH 2R15A 1A1NA 4KK8D 3LQZA 3BJLA 4CVXB 4NO5B 2Y72A 2AV1A 2ITCA 3QULA 5GRUL 1GGCH 4FFYL 1N5AB 2OR8A 1NH6A 1II4E 2UVEA 3MRMB 1INDL 4JREB 4P9HH 1Y18B 3D48R 3NAAL 2OJEA 3L3IA 4EVNB 2IAMA 2VXUL 4JN1H 5M94B 3SPVA 1V5JA 3HUJB 1DEDA 5F7WC 2CR6A 3CX2A 4GXUM 4FQPA 2KQNA 5TF1L 1BIHA 4XHQA 5TE7L 2EIEA 3MTRA 2BNQB 1CZ8L 4GUPA 5C07E 4D8PB 3U2SB 2ADGB 5FDYA 2GCYA 2CXGA 1FGNH 2FYYB 4DW2L 1AD0A 3Q3GA 1KIQB 5CP3H 4HDIA 3OKMB 5CZVL 3CAFA 2VWEE 4NFCA 4ODSH 1NCUA 4WW2F 5DFTA 1C12A 3B6SB 1P84J 2H26A 3HI5H 5DD0L 1LK2B 4LLVA 4PP1D 4XP1L 5GHWH 3MMEB 1OAZL 3C60B 5ID1B 5JDSB 1ZLSH 3V0WH 5D7JB 3KPMA 1I9IL 3DROA 3RIAK 3TBVB 3VFGH 5I17A 5FO9B 5F72S 2P8MA 3STZB 2JCCA 5C6TH 3H3BC 4OJFL 5C0CB 4EXPX 3G08A 1I1AB 3ZT5A 3MV7D 1Q9LB 5F7FA 1S8DB 3L5HA 2VLJB 4J3UA 3N06B 1QHOA 2Z8RA 4IOIB 1QRNB 1QFWM 5IMLB 3BN9C 4PV8B 4I3SL 2EDBA 1JWSB 2XQYK 4L8SB 3LZFL 1ZSDB 3ULUE 2A2QT 5CMAB 5CIPA 3CC5B 3CLFL 1AR1D 1JNNL 3GMQA 4UTBL 5GSRA 5E24E 1NC2A 5HVFB 2NYYC 1F4WL 1MJJA 1H8NA 4CKVX 3DWTA 1YMHA 3MRLA 3F6IA 3SKMA 4LVNB 3G5YB 3ZKQD 2GJZB 3D25A 1GGBL 1IAOB 2GHWB 1MCBA 1HZHL 5HY9A 5CZKA 4LFHG 2APVA 3W0WE 2JELL 1XGRA 4HULB 4BFBD 4PRIE 4AM0A 1QBAA 2FWOB 2PYEB 5JOFA 4D3CL 5J6HB 3QI9B 4HT1H 1RURL 1QVOA 3EYUL 5CJOL 1Q9WB 3D1MC 4ISVA 2Z92A 3P77B 4PRHE 1PFCA 1K9TA 1QFUL 2WWMD 2X1WL 1QSEE 1TETL 1N4XH 1NCTA 1TZHA 5FDWB 4KUZH 5LGKA 3BZFA 4N5EC 4URTB 3TM6A 2Y5TA 1ZGLB 2O5XH 3MNWB 3MV8E 4O51B 5DJ6B 2HT2C 3REVB 1WFTA 3HC3L 5FA4B 3GMOA 1DSFL 3BN3B 5KVFH 4QT5A 3PWLB 4G6AD 1JYVA 4I13B 3G5ZA 3SDAA 3LQAH 3JWNC 1QKZH 5FYJL 1JI1A 1SEQH 4QHLA 1I7ZA 1RSFA 3L95A 3DX9B 4AL8H 3MA9H 3SY0A 1UKSA 4N8CL 4P4KD 3X12B 4BQCA 3C9NA 4X9FA 4OZ4B 4Y5VB 3C8KB 3L5IA 5B8CC 1XH3A 2DM3A 4HIHB 4JR9H 5C07D 3VFNB 2FHCA 4RGOL 4OCLC 4C54A 4ZS6C 2PO6A 1CICB 5HYFA 3ARBB 3MCKA 5IFAH 3FFDA 4G6FB 2ZSVB 5H37G 2P8PA 5TE6H 3RWEB 4M48L 4DCQB 1IZKA 1C5DA 1J9CT 3EDFA 1U3HD 3NCYP 4PJHE 5C0NC 3GSNL 1MFAL 3QUMH 2CKBB 1KIPB 1W72A 4ZUTB 4LVOC 3SE3C 2NY1C 2BJML 2PW1A 3Q48A 4OZIB 3QNZB 4CJ1A 5JOPE 4YHLL 4MA3B 3RQ3A 4PTUA 1RJYB 4NQSB 5T3ZH 5SWZE 1ONQB 2IPTH 4NWUH 4GRMB 2ZCKL 1I9RL 1QBLL 1I85A 4GKOA 3WYRA 1T2XA 5AZEL 4Z0BL 5J12C 4J4PA 4MMXC 3WUWG 2A0LD 2IWGA 3D0VA 4P2YA 2XT1B 2IANE 2EDLA 3MRJA 1IGIL 1CFBA 1X5JA 4QYOA 2EE3A 5F1NA 3K46A 3AXLB 3ULUD 3F5WB 4KMLB 4LLDA 3ARFB 4CMHB 2D9QB 4JPKL 5F7NC 1JHTA 4RIRA 3HI6L 2AP2A 4Z78B 4FQ2H 4O5LL 4X7DC 5D4QA 1Z9LA 5E7FA 4WEMB 5F88B 1DBAL 1RZGA 4K2UL 2HRPL 2W9EH 3R06B 5DJ8B 4G3YL 4XNYL 4NQXA 4OV5A 4HC1L 1K4DB 5D7LE 3TZVC 5LXGH 2PW2B 3NA4A 3GJEA 2W60B 3W0WD 2RAMA 1QACA 3FO2B 2GFBB 1KN2H 3WE6A 1S5IH 1Q9OA 3BSZL 4PRID 4I0PC 4RCAA 4RZCA 4AENA 2EXWC 4FXLA 1JN6A 5GISL 1V3MA 4F7MA 5J3HC 5GGTL 2J1KA 3LKPB 3NACH 3P4NA 2VDNL 4PRHD 1VGEH 4MNHB 1SVCP 1NUNB 1QSED 1QQDB 4L8SC 2YD2A 4IOFD 1AQDB 1YDPB 4KKLD 4Y4FA 4NHUA 2VN7A 3ZSSA 1ORSB 4DN3H 3TVMD 1CFTA 2ERJC 2RBLA 5HYJE 3MV8D 3T0EC 1A6TB 5KSBB 4LVNC 1A9EA 4M7JL 4FQCL 1U8MB 1YYML 2LABA 5CBAB 5TDNA 4KJWC 2WBWB 3D6GA 3FT4B 2ZUUA 1HKLH 1M7DA 1XGUB 4K3EH 1W0VA 1F6AA 3OBAA 4Q74A 1PW3A 4R97C 2E7BA 2YN5A 4OZFA 2HN7B 3ULUL 2YEZA 3C08L 2VIRB 1W8OA 4KDVA 3QI9C 4EN3D 1NMAH 4NSKB 5FUOL 1EO5A 3H9HB 4XP6H 2EC9T 3QEHB 2FBJL 2X42A 3M1BA 3GGWB 4K9EH 5EUOE 2VJXA 5DI8A 3RL1A 4GG6F 3MGOB 3X17A 1PZ5B 5BVPL 2VISB 4JM2B 3LPGA 4I4WB 2V5YA 1DQML 5IFHL 3GK8L 1S78C 2E6JA 3QJFB 3V4VH 2DQJL 3V8OA 5GGVY 5F7LB 1L0XA 1FNHA 1K3IA 1RUPH 4OB5H 5DEZA 3T3ME 5KS9F 5I19H 3QEUB 4QRPA 5FGRA 5JOPD 4OFVA 5T3XE 1R5VA 3BFOA 1AHWA 5LCVL 3TH4T 5SWZD 3QIWC 5EOQH 4ZUWA 4MXWL 4Y5VC 2DQDH 3HAEB 3CFKA 4IRJB 3SJVE 3WS6C 4ZDHA 2D9CA 2FNBA 5E5RB 4HX1A 1EAPB 2IAND 3LS5H 1JGEB 5DGQA 3RPIB 2IADA 2W0FB 1N0XL 4Y5XC 5E4EB 1CLOL 5IF0A 5C9JA 2VZTA 4ODVH 3ARBC 1FFRA 4XCNA 1TTUA 5IFJA 1HQ4B 3SQBA 4DQOL 4G8FB 2BVEA 1JRHH 1IEBA 2IH3A 5GPRA 4HIJB 4XNMA 2CDEA 4F57L 2PTTB 2BNUA 3B5HA 3BP5B 1LDPH 5FECB 4M8QA 3TYFA 1T3FA 4TPRL 1CGSL 2DQEH 5D7LD 1UWGH 4H25B 4NZDA 2X70B 3HMXA 2BP3A 4ETYA 4CN6A 5IHZA 3F62A 4KAQL 2NY2D 1PG7X 1J5OH 5DVLA 2JJSA 4KVNH 1QFWI 3C5ZD 4LHUA 4J3TA 5D8JH 3IFNH 1NCDH 4WNQA 4GW1A 3CD4A 2YD6A 1I3VA 2DRUA 4U1GC 4X6DA 4KUCF 3RWGA 4DGYH 1AJ7L 3GMNA 1X4ZA 3GSRB 3ARFC 1A3RL 5DGRA 5D2LA 2P49B 4QHMB 1CBVH 1VACB 1XGYL 3B5GA 3LMJH 5HYJD 2FIKA 4XPGL 3KJ4B 3W81A 4WW1B 3KDMB 4NBXB 1LO5A 5J1AA 3O45B 9CGTA 1FDLL 3CVHA 5D5MA 5EC1A 1NUFA 4JJ5A 1ZHNB 5F6HI 4PGEB 4XRCA 2QSQA 3SQOL 1OSZB 3U1SL 3ZKMD 3CSYA 4LF3A 5J1TC 2VDQH 2FJFA 3TV3L 4C57C 1MRFH 4WTZA 1HYSD 5JA9A 3S35X 3WFEL 3MXWH 2EIZB 5F8QC 5FCUH 3UBXA 1AY1H 3DX8B 3S9DB 2V2TA 2Z9TA 1E27B 4U0RC 4LLMA 1JWMA 4ZPTA 5BV7H 2AGJH 2EKSB 3FZUC 3ZE1E 1X5LA 3OZ9H 1H3PL 3DXAA 4KZDH 1WITA 5BOZG 3LSOA 2W59A 4OAWA 5F7HA 3AS0A 4NT6B 4V2BA 1P7KA 2DQCH 4Y1AE 1AQKL 4HGWA 5F7MC 5H37H 1H5BA 2J6EA 5DUBB 3OB0K 3ARDB 1MHEA 3CUPB 5C3TA 4FFWD 3MNVA 1G7IA 5SX5K 3ZKNC 2OSLA 2DD8H 3T1FB 3MJ7A 5T3XD 1U8JA 5I8EB 3MBEB 1GXEA 4LCWA 3S3SA 3CIQA 1WBYB 3QWOB 1S7QB 3AUVA 4HXBH 1BAFH 2XQBL 2WAHA 3RBSA 1AH1A