1IAIM

Idiotype-anti-idiotype fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
b'DIQLTQSPAFMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM01
5C0CE 3QXVA 3HNSL 5C07A 2CKBB 1YEGL 3KJ6H 1A64A 3HE7A 3LEXA 1PG7X 4KROB 3ULSA 3BSZH 4OCYH 1FNAA 1U8OB 5DURB 3MQIA 4Z7WF 5L7XH 2DLFL 2R0LH 1DP0A 3CDGA 3UBXI 3QQ3A 3BAEL 2PXYB 1AQDA 3SBWA 4WI9A 3MNWB 1T20A 4FFZL 2R0ZH 4ZNCD 1YMME 1K85A 4FZEL 4H25B 1CFSA 2BVOA 1EFXB 2ED7A 3DXAD 4R4ND 3MLZH 4IRJA 2JIXB 5DWUH 3K4ZA 5C0BE 4TTGA 5IWLC 3BJ91 4MJIB 4O02L 3IDNA 3SDXE 3KNBB 4G6FD 1JWSB 4HMCA 4DFHA 4IOIA 4MD0B 1LO4H 2YA0A 3FHAA 5BMFH 3RUGA 5D7IE 3ARQA 1JFQH 5IM7A 3HAEG 2X4UB 1Y18A 3VD5A 1ZGLP 3QG7H 1NBZB 1MCHA 1EA9C 5EU4B 1U41A 3O2DL 3LIZH 3OKDB 4HBQA 4KJPD 4F37K 4NKDA 5BVJA 2FECI 4NYLA 3H3KA 2XKUA 3ARFA 4L3EA 3L5WA 2E6PA 5DS8B 1QP1A 3O2VH 1UCBH 1IGJB 4DQOH 1GPOH 3C5ZA 1RZKC 3T1FA 5FB8B 2BOBA 4OZFH 1OGAE 1WCBB 4FQIH 3ZTNL 5FGCB 3U0PA 4RAVA 3KPNA 1RFDH 5EOCH 3SO3B 4EBQL 1DANT 1TNNA 2XKNB 4HWEH 3MV8E 3QXUA 4KVNL 5HTSA 1T7ZA 5AUMA 3WN5C 3X14A 3DX9A 5SWQB 1DQDL 1S5IH 3U1SL 1A7QL 2Q7NA 1KBGH 5E0QA 3QULB 4NOBA 4LCWD 5C08E 3RVTC 5DQDH 3NA9H 2EH7H 4EUPH 1FVCA 4POUB 5A2IH 1INEL 3I02A 2NY6D 1SJEA 4GRWF 3TN0A 3KYOA 5HYQB 1XH3A 1H15B 4YDKH 4ZS6D 4WIQA 5T5FL 5JO5B 1EO8H 1N4XL 5D96C 4Z95H 3HUJE 4BZ1H 5J4MA 3L3JB 1V7ML 4L9LA 2VABA 3TVMB 4S1RH 3LV3A 3GIVB 4LCUB 3O9WA 5C09E 4L4VB 3O3EB 4QHUB 2J5LC 4NZTL 5LGJA 2X7LA 1JWMA 4XCNA 3V7MA 4BQCA 3MRBA 3QCTH 1N64L 3P4MA 4CADA 1H3WM 3QRGH 1PDKA 4D9RE 3EUUA 2DDQL 1AXIB 4R4NC 1TPXB 4X6FB 1I1CA 3LD8B 3TT3H 1F13A 4LCIH 3EFFB 4YO0A 2DKSA 2AJ3B 4AT6A 4JN1H 3UTPE 1IC7L 5I1EL 3RKDD 5ICZB 1MREH 5K9QG 2JKXA 2DL2A 2BNQD 2F19H 2F53B 4PYGA 1TCMA 3IFNL 3WKML 2NXYD 2L4OA 2BERA 4C4KO 4JR9L 4RZCB 5DJ2A 3UYRL 5FK9B 2ZCHL 2ZUQC 1U8LA 2QHRH 2VQUA 4EQ2A 2VH5H 4KJPC 3OAYH 1EX0A 3UO1H 4DOHE 2X42A 3MLXL 3DX8B 4AEFA 4HFWA 1CXEA 4JFDA 3NTCH 3FT2A 3QDHA 5F9WB 1O0VA 5E08H 2XWTB 2P7TA 1X4XA 5BRZA 3BIKB 5DHVB 3LN4A 4HUKB 5I17B 3OPZL 3PG2A 1MI5E 4XCFH 1QNZL 1T66D 3ULVD 3GK8L 2R2BA 5CP3A 1BVLB 2DQJH 4OM1L 2ICWA 3FTGB 1FAKT 2V7HB 1U3YA 1JPFB 4YC2C 4MVBD 4BFBD 2ORBL 4ZUTA 3O4OB 1V7NH 3GSUA 4NNYA 4RMUA 4M6NH 1UADC 2HLFD 4YHLL 5FKAB 2Z93A 1G7MA 3H3PL 4AEHL 3HI1B 4EDWH 1MJ8L 1BVZA 1AJ7L 4XNQA 5DMIL 1AQKH 1NEZB 4PJHE 1HEZB 2NY6C 3V52H 3ZDXF 4JCMA 2VZ1A 3EYUH 4MQXD 4ZS6C 3V6OE 2LAGB 4XMPH 2BK8A 2X1QA 1KULA 5DJAB 4ZUUB 3KG5A 3GBMH 4JFED 1UQSA 1YECH 3O0RH 4NQDE 3TJEH 1G7QA 1FZJA 1AD0A 3GMQB 1MFNA 3DHJA 5D4QA 5DFVD 5EO1A 4NQUA 1AO7D 1EMTL 4X6BA 2V17L 3TYFA 2WNGA 4YHPA 4TVPD 4U1JA 1I7ZA 2X4RB 3WXWH 3HZYA 2ARJQ 35C8H 3LH2L 3MRDA 4HK0B 5E2UL 3VWJB 2XZQH 4GW1A 4HKJA 4PJEA 3BPOC 4JG1H 1U6AL 4UU9A 1ZXQA 5F1OB 2YZ1A 3RKDC 1E4KC 1JYVA 1KIPA 4HV8B 5J9PA 1BF2A 2FJGA 1JZ5A 3RNKA 3H7BB 3K8MA 5IBUB 5I71B 4OLEA 5I16B 2NXYC 4LVEA 3CDYA 5GZOD 4OZGB 3ARWA 1E4WL 1QYGL 3MV9A 4M7LT 2LFGA 1BVKB 1MAMH 1RHFA 2UV3A 4HIHA 1IKNC 4R7NB 4RGNB 5INDB 1NCNA 1KT2A 1BAFL 5HDQH 5BW7A 1OM3L 2F54A 5I8KL 2A6JA 2ICWI 3CMGA 1WV7T 5IHUH 5JW4Q 3UTQB 1GH7A 3C9NB 3HG1E 3V4UH 1NUDA 4M7JL 4WDIA 4UIKH 3HZKA 3RGVA 1U9KA 1SQ2N 1MUJB 5CJOH 1CXHA 1T66C 4F7EB 2CUHA 3ULVC 3CU1A 1JGVH 2D0FA 2A1WH 2BZDA 4EDXA 3M1BB 5IMMA 4UQ2A 5GS1A 3ILPA 5JW3L 4MVBC 3TBSA 3L3DB 3LKSA 2AJXH 4F15B 4U05A 1A6ZB 1QFWM 5F3HA 1XGQA 4NP4L 5DEFA 2DMBA 4UV7L 3QDGB 4NO0D 1A6WH 2YWZA 3MRQA 4YBLB 1LO5A 2ICWJ 4NO3B 3TZVB 1UH3A 2VISA 4M1GH 3RIAF 4KJYA 4PJCA 2I26N 1YYLH 3IKCA 4IMKA 5CJ5A 3C60D 4MQXC 4FFYL 3G6DH 5T3ZH 2QSCH 2IQAB 5TQ0L 2R4RL 2OXGA 4RISL 3GB7A 2UVFA 1CFQA 1A3LL 4QXTB 4OLWH 3BDYL 3CSBA 4D0CA 5T1KB 4JLRA 1U8MB 3C08L 3PGCB 4X7CC 4OV5B 5GRZA 5DFVC 2Y7QA 4X5XA 1OT1A 1T04B 2JELH 4PJ5A 1YEEH 2X70A 5HGAA 5DHYB 2A9ML 5D2LA 5D7IF 3ZE2E 5D5MF 2NX5B 5ISZB 3LKOA 3MJ9A 2ZUUA 1CLOL 1DJSA 1JHKH 1MWAB 3ZYOA 4KFZC 2XQYK 2MPAH 1UVQB 5DYOA 4GXVH 3SGJC 3T8XB 5J1AB 4PJAA 1QHOA 2GSIB 2DTSA 4LHJB 3TBVB 1J88A 3U0TB 5GZOC 4R90H 4WI5A 1JGLL 2MCPL 3FQWA 4K3JH 4EI5B 2J8UE 5L8KB 5KZCD 4OGYL 3FN0H 1I7TB 1GZQA 2R4SH 2P45B 3M8OL 4XZUA 1ZT1B 5F8RC 3KPPB 3MACH 4GG6B 5DXWA 5F1NA 1KN2L 3H9HB 1S7TB 5CD5D 4HXBH 4LSTL 5L9DL 1DN2A 2BHUA 3VE0B 4ODUA 4KDTA 4XVJL 2ZUYA 2R2HA 3GDBA 3T3PF 2VN7A 4QRUB 4MCYB 4LPUA 3PQYE 4FQXB 4RFOH 3VG0H 5FYKE 4GW5B 2JE8A 3MJ9H 4P3CH 4QCIB 3MA9H 2R0KH 4G6JL 2GITA 3F58H 3ZHDA 1KOAA 1Q9OB 4U6TA 1KCLA 3OKEB 4Y1AB 4H1LB 2FYYB 5GJTL 2P8MA 2VLLB 5D7LE 4XMLL 1EVUA 5IR1A 4H20H 3FJTA 3HUJF 1JTOA 3U36A 5F72S 4ODHL 4HLJA 3ZKMC 5I6XB 3RWDB 2VWEC 4RGMB 4F7TA 4U1SB 4JAMB 4M3KB 2AXHA 2FO4B 2CKNA 1NGZA 1G0YR 5E2JA 3SDXA 1KLFA 1NGXA 3IS0X 2VLMD 5KVFL 1ZWIB 3C60C 3EYQD 3PIQA 5HHOB 2NR6D 4F57H 1YEDB 5DUPH 1JHLL 4WI2A 5D1QD 5MHSE 1P4IH 1JIBA 4ZQKB 1A6UH 1FIEA 3CVHB 4YUEH 1LMKA 3VFOB 2OTWA 1N3NA 1K4DA 1AD9A 5BZDB 1ZVSA 4G8GE 5AG8A 2A83B 4PGDA 5GGQH 5LGKA 5ADPL 1IAOB 2SEBB 5C0GB 1KG0A 5GXBB 4JG0L 3MLVH 3D9AL 4Y2DD 5CCKH 4OF6A 5HPMB 3MMEA 3SKJL 1HHHB 1Q94B 4Y4KA 4NQEE 4RWYL 4MJ5A 4HGWB 4LBEB 3OL2A 3RL2A 2VLJA 3KPOB 4HUXA 1OGAA 5KG9A 2HTLD 3IRZA 5E1AA 2EE3A 2FEEL 1G9EA 3BKCL 1QSVA 4WFHE 3PWUB 1WAAA 3QDMD 3MV8A 1KLGB 1NCDL 3KLHD 2FZ3B 4LSUH 4YZFF 2YD4A 1ZT4A 2CQVA 4NRZA 3RI5K 2MTPA 2X4SA 3UP1A 4ZFZA 1BBJA 1KPVA 3L3KA 3DSFL 3D3VB 5DD6B 1FN4B 4MZ2A 5CD5C 1EPFA 4B5EA 5D70H 1RIHH 3M17B 4KROD 5B38A 3K46A 1SYVA 3ULUE 3HI5L 4R8WL 3C6SA 3RWJB 1Z2KA 4BFEA 5FYKU 1SY6L 4O58L 2DI8A 4R96B 5C9KA 3DMMA 4H0GA 5HYJE 2DICA 2OZ4L 1WVZA 1HK6A 1T83C 4HDIB 1FPTH 1LP9F 1WBXB 1F4HA 5E9DB 4G8FB 3V6BR 3SE9L 3FB8B 3DROB 1RZIB 4JQXA 1UWGH 4L4TE 5GRVL 5C0AB 2APFA 2BXYA 1S7RA 4CDGC 4YDLC 1CE6B 4MJID 3CUPB 4Q9QL 3RVWD 3FAWA 3X3GL 4BFIA 3BD4A 4MAYB 4C4KT 3L5XH 2B2XL 4MNHB 1II4E 1ZLVK 1QUNA 1U8HB 3EYQC 1J8HE 2NR6C 2EE6A 2IFFL 3K81A 1DE4A 4PD4J 5D1QC 4ZPTA 3S34L 3WMSA 1YNTA 4QRPD 2PTTB 3X17A 4HQQL 4XCEB 5TF0A 4WHTA 1A1NB 1PX3A 1A0QH 1L0XA 1RJZB 5BOPA 4DVRL 1CXFA 4WY7L 3RNQB 1L7TH 3CMOL 1NFDA 1RV6X 3ARUA 3MRKB 4R3SA 4CN4A 4LASL 4DKEH 1T5XB 1N6QL 5E24E 4Y2DC 2J2ZA 2HT3D 3V6FA 4KMLB 1U3HA 3PGFL 4RQQA 2DLEA 2QL1A 4RNRA 3PHOA 4P5TB 5F7NC 1T0PB 3OJ2C 1QSFD 4JFQB 4P3DA 4PTTA 2NY2B 4NQTA 3MRMA 3P2TA 2FX9H 2HTLC 2YD8A 2EO1A 3T65B 1MI5A 2B1HH 1IGMH 2BHYA 3KLHC 2LQRA 1V3MA 3RIFF 3F65A 5EU5A 2HT2D 3RX8A 2CGRL 3VRJA 4MA7H 3AU1A 3FB7A 1FVEB 5I1AB 4NZDA 4IM8A 4F8TA 3B9DA 1YNLH 5FYJH 2X4PA 4FXGB 3EDDA 4ZFFB 2XNAB 4Y5XB 4UBDD 4QEGA 1S5HB 4OAWB 3ME0A 5DDHB 4PJHA 1KV3A 2ENSA 4KROC 3F5WB 4TNVK 5E1HB 1CFVH 5E2TL 1MHCA 2ADGB 3T2OA 3V6OA 3TVMD 2IPTL 1MRFH 4MD5A 5TFSH 3CX5K 5GGRB 4N68A 1RIVL 4JO2H 3S5LB 4KWUA 4WFFE 5L0QB 1KNOA 3HTLX 3NMEA 5I1KH 4PJIF 2IBBA 3HC4L 3N1GC 4L8CA 4XP1H 5K9KB 3KXFB 5IMOB 3QCUH 3QH3B 5T1LB 3TEUA 3RBSA 1W0VA 2ESVB 1TZGL 4QOKA 4ZXBB 3QAZB 3SDYH 2YN5A 5EPMA 4HX1B 1E27B 3EGSA 1UWXK 2QQQA 4IJ3C 3C2SA 3GGWA 1EGJA 4PRPB 3IAPA 3RVWC 5IESL 1AR1C 4J3SA 1J05B 1QA9A 2FGWH 4WFGD 3GRWL 1P4LA 2F53D 4N8VG 3VXMD 2DYPA 5F96L 4PRBB 1RULL 5EUKB 3GSVA 4NRYB 3HPLB 5DRWB 5I0ZA 4JQVA 1FO0B 4OCNC 3BPNC 3G04A 2MJWA 4NHCL 5HYEA 3PDOA 1D5MA 2F9BT 3GSWA 4FP8H 4I1NB 1TQBB 3KPRA 3MCKA 1I1FA 5DUML 1AI1L 1ES0A 2AEPL 3RWFA 2DMCA 3IDIA 4TUKH 4W4OC 1LWRA 3SY0A 4R0LB 3PL6B 1JHTA 4JB9H 5DJ6A 4UTAH 5AD0B 2HT3C 3BH9B 4HAGA 1P4BL 2DWDA 4X9FA 3HG1A 1FIGL 3D39E 1L7IL 3SO3C 4YBQD 4WJ5A 1UZ8B 5EU3A 3QIUD 3LSOA 3O8XD 1EUTA 4ZFOL 3U6RB 1JGUH 3CXHJ 4KTDH 4GKNB 4ODWA 4POZD 4PJ7E 5J11C 4PJ8A 4BH8B 2PKDA 2HT2C 2B0SH 1IGCH 1AHWB 2UUDK 1FDLH 2R0WL 5E94B 3VXRB 1E4JA 3WFHA 1U8PB 2BXZA 1XCTB 4ZOBA 1Q9LA 5IB4B 1RY7B 4FA8A 3BGFC 4XBGB 3WUWB 4M03A 5I66B 4MNGB 1JPTH 5FA3B 1YEJH 4QY8B 3TYGL 4UBDC 2HKFL 2X4OA 2IPKB 5K9OB 2HKHL 1BX2B 1R5WB 3HHRB 1V5JA 5KTEL 5E8EA 3TVMC 3L1OH 2G9HA 4LEOA 4V2BA 3FQTB 1NCWL 4C59B 3HR5B 1AGDA 1G6VK 1V05A 5DJCB 4HH9A 4D3CL 4XP9L 2DJSA 4BZ2L 1MCWW 4JY4A 4XC1L 4BQ9A 1EV2E 2APTA 4N0UB 1H3UA 4NSKA 1R3KB 1DQJB 3P0YL 2Q20A 4D2NA 1XGUB 1BQLL 1X5KA 4BKLB 1NPUA 3LD8C 3T0AA 2P24A 3VWJD 3N85L 3TV3L 3IJYA 3ULVL 4RAUA 3F8UB 4L8DB 3AY4A 2AGJL 1G9MH 4OF7A 3OKMA 5I1IH 2BNRB 4WWKB 4PB9H 2JJTC 3I9GH 5AZ2H 5D71H 2V2TA 4A6YL 3IFOB 1MFAH 5ILTL 4QT5B 4HK3N 5E8OB 1QZ1A 1Y0LA 1XMWA 4LF3B 2IEPA 4F7MA 1E6OL 2PYEE 4NQVA 2OMNA 1RIUL 1JI1A 4YAQB 1UYWH 2NTFB 3IF1A 5E4EC 1C1EL 1R5IA 3NIFF 3QHFH 4HKZB 1BLNB 3IRPX 3D25A 3GJFA 2D7TH 4R4BB 2W0PA 5FGCE 2PTVA 1AP2A 1IKFH 5DJ0B 4WW1A 1PX4A 4UINL 4K7PX 2XI9A 3IAQA 3IFPA 1OAQH 4YBQC 1TXKA 4HMDA 3QIUC 4LSRL 3VRLE 4Z5RA 3O8XC 3PQYA 5FUZH 2YBRB 3VFGL 4POZC 3DV4B 4OIIH 1UC6A 1ODAA 4ONFL 5E8PB 5EOTB 5GJSL 4JHWL 2UWEF 4U1GB 1RZJH 1YQ2A 3FFDA 5D7LA 3QDGD 1A6VL 1T7YA 3QXAA 4JHAL 3TBYA 2K1MA 4JM4L 1C5CL 3TZVD 4OSUL 4D0BB 4ODBD 1QLRB 1HH9A 2WBKA 5D7JD 4G8EA 4MLSA 1QBLL 1V3KA 3CD4A 5ALCH 5B8CB 3S88H 3DX7A 4KHTL 3BUYB 4PP1D 5H35A 4L4VE 1TCRB 3W0WB 2R69H 1BMGA 3BEVA 5J13B 2VXQL 4GS7B 5EWIH 5T1KD 2EIZB 4P0DA 4JZOA 2EDQA 1H5BA 3RDTA 4XP6H 1TTGA 3LKNA 2VXVL 2Q76B 4ZTPH 3VXPA 3LS5L 1RUKH 1UKQA 2LV4A 5IQ9B 5J12B 3PHQB 3U2SA 2D03H 2BSSB 2NX5D 5ISZD 3UZVB 5KW9L 2ITDB 4G6KH 3VWJC 2VDKH 5D93B 4GKZA 3FO0L 1KYOJ 4NQEA 2YPLD 3BRDA 1P1ZB 2HFEB 1N5YL 2YPKB 3PV6A 1OARL 3X13B 3DWTA 1BIHA 4MMZC 4DVBA 2DQDH 2XA8H 5I1DB 1RZFH 2QLVB 2RB8A 2DQHH 1FSKC 4JZJC 4J7RA 4UNTA 4P9ML 3BP7B 4MJ6B 1MOEA 1QO3B 3ZT6A 5FOJA 3A0OA 3WLWD 5FOBB 5DJ8B 5DEZA 1CF8L 5DJYA 4PB0L 4ESKA 5IB5B 4RFNB 3ROLB 3WD5H 3OXSA 1XFPA 3BKML 4Q2ZA 3KVQA 2ZSVA 1F90L 2H9GA 1MCOH 1BD2E 1WCQA 3INUH 1UB5A 2LE9A 3CFBA 1OAXH 2CMRH 3CFEA 1KB5L 3Q5TA 1SEBB 1RURH 4UDTB 3IXAA 5HYJA 5ERWA 3H9YA 4F15C 3OB0K 4XP5L 3FQRA 3HAEA 1MQKH 3OAZK 3Q6GL 2Y23A 1CDUA 5GRJH 4P5KB 1FNHA 3TZVC 2AK4E 5IROA 4LRNL 2KUTA 3TIDA 1H3PL 3IJSB 3BX7C 2VNCA 3H9SA 3MBXH 4JPKH 3FFCA 4S0SD 5D7JC 1DLFL 2QQLH 1OAZH 4RFEA 5HHOD 3EO9H 4PP1C 4TN9A 5I18H 3ZKXB 1J8HA 1UG9A 1DDHA 1SMAA 2HLAB 3B3IB 3QIBD 1MNUL 5CEZH 3DRTA 3D18A 3LN5B 4J1UA 3MFFB 3U4AA 5AWNH 1NAML 2ZCKL 5D6CA 1F8TL 1R3LA 3FO1B 1HKFA 1X7QA 4M62L 1RK0B 2X9WA 2IMNA 4R4FL 4JZNB 2YSSB 4DW2H 1KXVC 3HKFA 4U6HB 3TO2B 4G8IB 1B6DA 2AI0H 4GAGH 1X5GA 4LSVH 5FF6B 2IBGA 3GMLA 3V6ZA 1K5NA 1LK3L 4HZAA 1KCSL 5BQ7B 1MSPA 3HAEH 2M26A 3C8KB 1FNFA 2RR3A 5CINL 1ZHNB 4JKLA 3MLUL 3QDJE 2BOCB 4EJ1C 1OSZA 4LOUC 2FX7L 4O9HL 1H3GA 5JLZB 2XN9B 4RGNE 2BC4A 3FONB 3WLWC 2AV7A 2IH1B 4NZRH 2LU4A 2V2XA 3M07A 4TVSa 1ZT7A 1MFCL 5DVKA 4K8RH 2ADFH 2H3NB 2CDFB 3BXNA 3QHZH 1X5YA 2QV2A 3VGGA 2CR6A 4PJ9B 1DVFA 5F9AC 4FS0A 4P2RB 3WYRA 1AGFA 3TNMB 3WS6C 3DTXB 3T2QA 1DL7H 1FH5H 1KJMB 3AXLB 5IT2L 4G43A 3LQAH 4MNQD 5DK3A 3P4OB 3RIAK 4Z77B 3PWJA 3WE6B 1S7VB 5A2KH 5KVEH 5C0AD 4P4KB 4QRRA 1ND0B 1RHHA 4XC3H 2ZKHL 1BFOA 4RGMC 3T09A 1BIIB 2X4NB 2X89D 3I84A 3THMH 4AEIL 4G3YH 4MAYD 3LQZB 5JUEL 2D7MA 3ESVF 1HI6B 1BQHG 3TCLB 4XNUL 3OKNA 1K6QH 4J3XA 4M9OA 5C3LD 5I1LA 4WNQB 3IVKA 1FFNA 3LKPA 3QIBC 4U6YB 3OX8A 3GFUA 4K3EH 3RZCD 2AJUL 1YZZA 4GAFB 4UIMB 1IGFH 3RA7L 4P46A 5EN2A 2B4CH 3UTTB 1UA6H 1I3VA 5HDLA 3GSNL 4J8RA 5EZIH 3O2WL 2BFVH 2OR9L 3E2HB 4RIRA 2DWEA 5JR1L 4UNUA 1W2KT 2QHLA 3PP3K 3GMMB 3MRIB 4HKXB 5EU6B 4YHYB 4JO1H 4N1EA 1DBKH 4UB0H 5IVZA 2NY2D 2EECA 3ARBD 1CLZH 3VXSE 4XRCB 4LRIC 4ZOAA 3BIBX 2CIIA 1HHKB 3BOVA 2A73A 4JDVA 1OQOA 3L3OB 2K7PA 2A6KA 3HNSH 3E3QC 2GIYA 4PBWD 4DN4L 2ADJA 5F7EH 4G6AD 4TPRL 4ELME 1X6NA 4N0FA 4JFHE 4PJ7A 5BZWA 5BXFB 3O2DA 3ARVA 2ATKA 3QCVH 4LNRA 3MRGB 4Z7NE 2ERJB 4QTIL 2FJFB 3HNTL 5CSGA 3KPSA 3VRLF 2DLFH 4Y5YA 5DZOA 1HOCB 3BAEH 1JRHL 2JB6B 3X11B 1MCPL 3TM6A 3QUZD 3SJVB 3LPGA 3IFLH 5L88H 4Y1AE 4YNYB 4ZAKA 5TE6L 4B7IA 4ZNEE 1ZGLB 1A3RH 3TCXA 4FTVB 1QR1B 2PO6B 4O02H 5TH2A 5HXMA 4ODXB 3DOSA 2O5ZH 5FXCH 5T1LD 1TIUA 1REIA 5I2IB 1RMFL 4ZXBD 1XGTA 5CWSB 4NO5B 2QEJA 5J6GA 1ZLUH 4GLRH 2UUDH 4I18A 4PRPD 5IGXL 2OL3B 2PW2A 3P77A 3D87B 4MAYC 4ODSH 5C8JB 3O2DH 3PNWB 2AJVL 4FQLL 3GM0A 4HLZH 4WWID 4TSBL 5TE7H 4A2MA 1E4XH 4OZIA 4C56E 2Z9TA 3F7RA 4QRQA 2MFNA 2VUOA 1M7DB 3P30L 3HLAB 4HIEB 3RZCC 2F8XC 4OTXL 5L8LB 4X8JA 5IV2A 1CIDA 4P23B 3SE4C 2WIMA 4EVNA 1FAIH 1RVFL 1N7ML 2WIIA 3WIHL 4EBQH 2P4AB 1K8IB 2KH2B 5IK3A 4GLRI 4KVNH 4DTGL 1CR9H 4JRWA 1G7LA 4LLYB 4WFED 3OJVC 4DKFL 3U46A 4RMQA 2VDRL 3S3SA 1A7QH 1IAIL 2A6IB 3KAAA 4JQIH 4JVUA 5H2BB 2NY2C 3BW9A 1P9MA 3CCHA 3B6SA 4GW4A 3ARBC 3V79C 1WWWX 2C3VA 1J5OL 4DKDC 5KJRH 4TOYL 1S9VA 4KQ3L 3BP5B 4MZ3A 1VHPA 1J11A 3QWOA 5FGSA 3SKOB 4UQ3B 5FV2A 1ZOXA 3V0WH 5IB3B 4JJ5A 4G6AC 2IBZX 3KGRA 3VXRD 2XZAH 3ALPA 3D3VE 1G7JA 2HJKA 1PY9A 2BJMH 1T7VA 3NFNA 5EUOB 5FA4B 1BEYL 4EI6B 3K2MC 3QO0A 5T3XL 8FABB 1LNUB 1G7IB 4Y5XC 3MNZB 2VRAA 3BE1L 3QUZC 2APWA 4MB3A 3KYKL 4BA8A 4NZTH 4PRIE 5CSZA 4OLYH 2EDJA 4YXHL 5C70A 2YRPA 3VWKB 1N64H 4IBLT 4PRHB 3G5VA 4DFIA 1IT9L 3DYMA 3NZ8B 1DBJH 2YN3A 1GIGH 4JFZL 3P73B 2H32A 1OAKL 5L0QC 1TFHA 1NANI 4XB7A 4G9FE 3BZFB 2ICEB 5DFWH 4K3HA 1I8KB 1IC7H 5ESVB 3HZMB 3HMXL 5F7DB 2Z8RA 3MRLA 4ZXBC 4LSDA 3T04D 3QAZC 4NNPL 1PSKL 1XGYH 1NC2B 1MIML 3IFNH 5E5UB 3MO1A 3BO8A 1BJ8A 4GRWH 2CIKA 3MR9B 4FQCL 3T77A 4PY8I 2GI7A 3C87A 4OT1L 2BSTA 4JPWH 4HGKC 2BNRD 4WWKD 5SWZA 3VG9B 3T2NL 4MGXA 2QJDA 3T4AA 4GMTL 1QSZA 1LVEA 1VADA 1W72B 4W6YB 2XY1A 1G9NL 3VFWA 1CDJA 1OB1B 3L9RB 1TQBC 5TDNA 2FB4H 1EXUB 5D1XB 3OHXA 4OZGF 2H32H 3VXUD 4R0LC 4KKAD 3FO2B 1QNZH 4PREB 1JE6A 5DMYA 5I1HL 3GK8H 4OF3A 5CJ8A 4U3CA 2H1PH 4KMTL 1GC1C 4OM1H 4OCRL 3D0VB 4PY8J 3VD7A 2P44B 5IEKA 4RMRA 5KVGL 2EC8A 2GYSA 4Y4FB 2ORBH 3FRPG 25C8H 2R2EA 1C16B 4GAYA 1PZ5A 5FDYA 1BD2A 5JIKA 3NCMA 4YHLH 5DJDB 3S96A 5GS2H 2HFFA 1TZHB 4PP2B 2DBLH 4AEHH 2I9LB 4NM4L 3H8NA 3W9DB 2OTUA 5CILL 1B3JA 3X3FH 1AJ7H 4GRMB 5FUCC 5DMIH 1HSBB 1J87A 3WNMA 3T08A 1MJJB 4PRNA 4PTUA 3V5KA 3CFKA 3RWIB 2BVTA 3MRFA 4K7FA 1TVHB 2X1WL 4OCMC 4J23A 4NN7B 1PKQA 3HCVB 4MD4A 1CTNA 4YWGH 4CJ0A 2D9QB 4NCC1 4NHUB 1CFNA 5D1ZA 4PR5A 2W0KA 4U1MB 3QFJD 1ETZA 4L1DA 1QPPA 3F62A 3QUYD 2V7NA 4WV1A 3BIAX 2XT1B 4GUPA 4PLOB 4ZYKB 2V17H 2F5AL 2H2SD 1D5BB 4ZSOB 4X0KB 3LKRB 3CLEL 1AGCA 3KXFE 4NPYB 3LH2H 5BJTA 5B21A 3UBXB 2C1PA 5E2UH 3RWCA 1ONQB 2ENYA 3T4YA 1CZ8L 4D8PA 4E41A 2VL5A 1MHPL 2IH3B 3EYFB 1AC6A 3ZYIA 1W0WB 2EEBA 4Z0BL 3CDFA 2Y5EA 4WW2A 1OP9A 3WFEH 2VAAA 5KN5A 3FN9A 4E0RA 4NOFA 3AAZB 1JZ4A 4Z7UE 3TA3D 2VLKE 1E4WH 1FFPB 3DVNB 3OAZH 5CKAA 4DEPB 4Y19E 1OP3K 3C6LA 1NGPL 5D2NC 4CDHA 1AGBB 1J1OL 1INDL 1T1WB 3MA7A 5T1MA 3ZDZF 5CEYB 2VDPH 3A67L 5I8KH 4MHHI 3S36H 4AIOA 3FN3A 5JHDE 3WJLC 5EBMB 2Q86B 3NFSL 5C86A 1GGBL 4KXZH 4YQXH 4GT7A 5E00A 2DM4A 2D2OA 5B39B 1KEML 2VLRA 1CI5A 4KKAC 3GJFK 3UJTH 1JNLL 1CK0L 4S1QL 3WV0A 2VC2H 2WSKA 5JW3H 1J7VR 1NSNL 4NUJB 4WI4A 4GG6F 1VEPA 4Z7NF 2E9BA 2Z31A 3N1FC 3MV7A 4M48L 3GNMH 2YC1A 4OZHE 1F4YL 5I8CA 3D1MC 2JCCE 4UV7H 4F58H 2DLGA 1NLDH 3U7AA 1P7KB 5DRXB 1IAIM 5IVOA 3WJJA 5F7HA 4HZLB 1IILE 2XA3A 4KC3B 5DVMA 4U1GC 3QEQE 3IJHB 4NKIL 4TUJA 4MNGE 4FFYH 2IAMB 3HE7B 1H8NA 4KXZI 2ZJSL 1WWBX 3ULSB 1X5HA 2R4RH 1HSAA 3KDMB 3ZO0A 1T2JA 1A3LH 3BKJL 3QQ3B 4M43H 1AQDB 4CN1A 1IEBA 3IDJA 4YDVA 1JNNL 3KJ6L 5DA0B 3QUYC 3D0LA 1T20B 2CDEB 4PYHA 5HGDA 3OF6A 2YK1H 3BSZL 1FL5A 4OCYL 2VYRE 5F7YC 3JWDC 2H2SC 5L7XL 2R0LL 4YE4L 4GS7C 1CFSB 2BVOB 4XPFL 4N0UE 4FZ8L 2P5WD 5MERA 4IRJB 1CLOH 2F74A 2YXFA 2R0ZL 1NJ9A 2EDOA 4UTBH 4WGWB 2FECL 4BH7A 3ARDA 1EHLL 3IDNB 4JEGB 4JRXA 3TBTB 3VA2C 4IOIB 2NY5H 1HWHB 4P59H 3SKNA 4O00A 4K55A 3RUGB 3PABA 3TA3C 3V8OA 2BVPA 1JUFA 4PG9A 3QNZA 3LPFA 5IM7B 1NKOA 1T22B 2C26A 1Y18B 4D9QD 5GS0D 3CZFA 4PBVC 3LMJH 3X12A 3M8OH 1LO4L 1MHEA 4LQ1A 5LVEA 4V1DB 3VXSA 3L3GA 5BVJB 5L2KA 4OI7A 3MJ8A 4NYLB 1KN2H 3ARFB 3QG7L 4KJQD 4L3EB 3L5WB 1E28B 4LKCA 3QPXH 2W60A 4LSTH 3LIZL 3RY4A 5BV7H 2BX5A 4ELMA 3C5ZB 4XVJH 1UACH 3T1FB 1AXSA 3IDMA 3CSGA 5DD1H 2BOBB 1CLYH 2NY1D 3IKKA 5JXAL 4RFNC 5DZLA 1A7NH 4RAVB 5CEXA 2EH8L 3KPNB 2CO6B 1UCBL 3O2VL 4WEUD 4NC1E 4DQOL 3W5MA 1GPOL 4PJ9D 3FT4A 4P2RD 5AUMB 5GGSB 1I3GL 3DX9B 5E56A 4FQIL 4XMLH 2V6HA 1UM6L 3JTSA 4O2FB 4ZFGH 5EOCL 1X5FA 5I8EA 1CICA 4ODHH 5SWSD 1C7TA 5J3HD 1YQVH 4ZNEA 2YKLL 4N8VA 3DVFA 3PDGA 2VWEE 1S5IL 4LHUG 1HINH 3I02B 4PV9B 1KBGL 1SJEB 5IWLA 1S7UA 3KYOB 3NA9L 4P4KD 1J8KA 3JTTA 1BECA 2AKRA 4JY6A 3I3EA 4L9LB 3TT1H 2VABB 4DKAA 2I07B 1GXEA 3O9WB 3GBLA 3W0WE 2CLRA 4YDKL 5HHNA 1Z9OA 1EO8L 2X7LB 1JWMB 3MRBB 3AB0B 5DJXA 5ADPH 4BZ1L 1MCDA 3P4MB 4JE4B 4X6DE 4GRLD 3D9AH 4S1RL 3K8LA 3QZWB 1SY6A 3SKJH 2CJUL 4ZPVA 2FHFA 3LZFH 2OZ4A 1NBQA 3EYVA 4YO0B 4WI7A 4X6CE 2EDDA 3LKQA 2YD9A 1MHHB 5ITFA 5A3ID 2VZOA 1YN6B 3PP4L 3BKCH 3TT3L 3QUXD 1F11A 4LCIL 3RKPA 4ISVA 3UBXG 5DJ2B 1UJTA 1S9XA 5GS0C 1U8LB 5DD5H 4Z7VA 1MREL 3GSXB 1X4YA 2YXMA 1QRNB 1QTYT 5CZVL 2Z8SA 1Z9MA 3LDBC 3DSFH 3ORJA 3BGAA 4KJQC 2QHRL 3ARYA 3CSYA 4HFWB 3ZDYE 2VH5L 1FQ9C 4JFDB 5J6HA 3FT2B 4WRLA 2HAZA 5GISH 3UO1L 5GRYA 5BRZB 4U6VH 3LN4B 4O58H 2NY1C 4XAKD 4GMSH 3QI9D 4KGJA 1TJIH 2FEEI 1U93A 2OZ4H 2R2BB 2AQ1A 4PJ9C 1BJMA 5E08L 4L3CA 2ICWB 1FYTD 1U8QA 1A1OA 1RZKH 2EIBA 5A2LH 2YR3A 4PRIA 1J0IA 1S9WA 4ZUTB 2V9TA 1CGSH 4DUWA 2VL4A 4XCFL 4NNYB 4RDQF 2QSVA 2X4QA 3GUTA 1CVRA 4HIIA 2Z93B 2DQJL 5J3HC 4I0CC 3DGCR 1DSFL 4MA3A 3DXAA 4G9FA 4IS6B 3AUVA 2C5DC 4XNQB 4U33A 4ZDHA 3AVEA 3TH2T 3SGKC 4P4KC 1KN4L 5JTWA 3UEZA 1H3TA 4NQXB 2G60H 3PWLA 3S34H 3H9ZA 3MGOA 2NLJA 1DQMH 3UDWC 1Y6MR 1AQKL 5FM5O 1AE6H 2KBGA 3V52L 1T6WA 3I6GA 1G7QB 1FZJB 1AD0B 2XY2A 2P42B 3EYUL 1I9EA 4XMPL 3SGDH 3FQUB 5I1CL 3SDAD 5DZNA 4X6BB 4LASH 3TYFB 4GRLC 1YECL 3O0RL 4YHPB 4U1JB 1I7ZB 3MXWH 3TJEL 1BF8A 3HZYB 32C2A 5IMKA 3MRDB 3PGFH 2VXTH 4P23D 4HWNA 4HKJB 4PJEB 2W9EH 3ARED 4LLQA 4UU9B 2DLTA 5EH1A 2P48B 4FABL 4LARL 1N5AA 5A3IC 5J9PB 2FJGB 3RNKB 5D7SH 3EO1B 3RAJH 4ALAH 4MWFA 1A4JA 4OZFG 4YHYC 2VDNH 3QUXC 4KU1A 2CPCA 1ZHKA 1MY5A 4GQ9L 1JNJA 3MV9B 4MJ4A 4PJXE 1GZPA 3ZZ1A 2ZUTA 5HY9A 3GRWA 3QUML 3BD3A 3B83A 4JHZA 3SGDI 1CTOA 1O7SA 4HIHB 4P4RB 4F2MA 1CLCA 1KT2B 4OIBA 4BSWA 2F54B 4EUPG 5HYSG 3I2CH 2A6JB 2G75B 1U8JA 1HQ4B 3TPUA 1MAML 5DMKB 1BOYA 3WXVL 2CSPA 4OZHF 1A5FH 5JOPD 4WDIB 4YIQB 1IBGL 3HZKB 3RGVB 1OWWA 4QYOA 1BFSA 1RIVH 2IWGA 3QI9C 4KI5F 1A9BA 4MDJA 4RAHA 3VFUA 2NXZD 3HC4H 3V4UL 2Q3AA 3J8F7 4EDXB 3VWKD 5IMMB 4UQ2B 4YPJA 5GS1B 1ZHLA 3TBSB 1TZGH 3LKSB 1B0GA 4CU8A 5F3HB 1XGQB 2EDBA 4FQJH 1JGVL 5GSVA 2A1WL 3BYTA 3EYSH 3SDCB 4JFFE 4ZFOA 3MRQB 1GC1L 3AMKA 1CGYA 3EOBA 1TVDA 2AJXL 2VISB 3GRWH 3Q5YA 2C4XA 1NC2D 1X4ZA 4KJYB 4PJCB 5FHBH 3IKCB 5C0EA 1E4KA 2OM5A 4N1CA 3EO0A 3QJFA 5FYLD 2BNQA 5F89A 4Z7UA 3GB7B 4XPBH 1CFQB 1DEEA 5J0BA 1AKJB 1K8DB 3SPVA 4D0CB 4JLRB 1JL8A 1YYLL 5I73B 2VQ1A 5E6IA 1AI1H 3R8QA 3G6DL 5T3ZL 4D9LH 2QSCL 5CBEA 4X5XB 3SDAC 2HJFA 5GGTA 4PJ5B 2X70B 4H0HB 4FRWA 4OLWL 5CGYD 5D2LB 1IKNA 1KJ2A 2D7PA 5D1XD 1AIFB 1NMAH 5C7XH 5JHDA 4P23C 4FFWD 1UCTA 5A16A 1EO5A 4P2OD 43C9B 3AREC 3FB6A 5DYOB 1YEEL 3QEHA 1NH6A 4PJAB 5EU6E 2A74A 4ZUWB 1S7QA 1IQDA 3RHWF 1HYSC 1CT8A 1JHKL 4XBPA 5BOZG 4MCZA 4Y4FD 3KS0J 3VXOA 4LFHD 2CUIA 4MAUH 4GXVL 3FQWB 4WCYL 1A7OH 2EE2A 3KR3L 2WBJA 4Y88A 2GJ6E 4XWOD 5E2VH 4OFYD 1GZQB 4TSAH 1TTFA 5F9OL 4R90L 3DVGA 4A6YA 2JCCA 4UOW1 2Y06H 4K3JL 5HVGB 5C2BH 3TYGH 2HKFH 4WI6A 2HRPL 2R4SL 1N8ZA 2HKHH 1TVBA 2A2QT 5FO7A 2EIEA 1T89C 4ODUB 4O2CA 3QEQA 5GGTH 3MACL 2R2HB 5KTEH 4HS3A 1NMCB 1KJ2H 1YEIH 5GGUA 2WM0A 3W2DL 4KY1H 4UOW0 1GVIA 1U95A 4D3CH 1G1YA 4JFEA 1HILA 2NXZC 4WU7A 1F6FB 3SJVE 3VWKC 4FTVE 3P0YH 1P7QB 4Y2OA 1I85C 2P8MB 4OD3L 2MOVA 3UYOD 5IR1B 1N26A 1YMMB 1YMHA 2OI9B 3R4DA 3DIFA 3MA9L 1AO7A 1I9JL 5B3JF 2R0KL 1QACA 3U36B 3TV3H 2DBJA 5D72L 2EYRA 3ULVH 2R9HD 5M95B 4F7TB 3ILQD 4H20L 5C0IB 3B9KD 1AXTH 3SDXB 4DGVL 1LE5A 4OFKA 1NGXB 5JHLL 1FJ1A 5T3XE 2VDLH 3PIQB 5DUBA 5ILTH 4M3JA 3H0TA 2WUBL 4Z7QF 2CRZA 4IMLA 3BEWA 1XF3A 1N3NB 1WIUA 1E6OH 4OM0L 5IBTH 4F57L 2E9WA 4X5WA 4QKXB 1P4IL 4PGDB 2YA1A 1A6UL 4Q9BA 4YUEL 4RMVA 2FRGP 5CHNA 1D9KB 1Q9WA 5CGYC 1LEIA 2RGSA 1UEYA 3TPKA 5D1XC 2W92A 2YUXA 3QUKA 5IFAL 5J8OA 1OLZA 4FFWC 4NCC2 4P2OC 5GGQL 4MJ5B 3O3AA 3KYAA 1FGVH 3RL2B 2VLJB 4LSRH 1UGNA 4HUXB 1OGAB 5CCKL 4TVPH 5KG9B 5E1AB 3ZDYF 4WUUD 4Y4FC 5CJBA 3MV8B 4XVSH 4ONFH 4N0YH 4EN3D 1ZT4B 1CU4L 4NRZB 3RY6A 1B9ZA 4XWOC 2OTPA 2J6EL 2XZCH 2X4SB 1JPSL 1A6VH 5C08B 1BBJB 5F7WC 1BQHA 3VXNA 4Q6YA 2CDGA 1KPVB 1X5AA 3L3KB 4A2LA 4OSUH 4LSUL 1DUZB 4NO0A 1DUYA 4FN0A 2IAMD 3HE7D 4AENA 1F45A 3CVIL 4KHTH 1MCNA 5B38B 4NN7C 3C6SB 2BDNH 3BYYA 4OCSH 2VXQH 4OJFH 3C60A 4JPVH 4AMKH 4KRNA 5T5NG 1UXWA 3LAFA 4PRHE 1HE7A 5D70L 3DMMB 1RIHL 1MCBA 2VXVH 5BCAA 3LOWA 4OD2A 3L6FA 1B2WL 5TGBA 2EDYA 3BN3B 3A6BL 3FB5A 2GAZB 5KW9H 1MCWM 4X6DA 1QD0A 4U49A 1KB5A 3VI3E 1S7RB 4X9BA 1FPTL 2R9HC 2ADIA 4BFIB 1OP5H 3U30C 2NY0B 3ILQC 5LAXA 3HN3A 4X6CA 3B9KC 1OARH 3U82B 3U4BL 1MCJA 3LCYA 1WICA 1RAMA 1DE4B 1RUAH 1FL3A 4ZPTB 2VDOH 1YNTB 1KTRL 4P9MH 4PJGE 2VJXA 3L5XL 4WHTB 5C6WH 3WDJA 6FABH 3GIZH 3L5JA 4V1DD 3C09B 1CF8H 3K1DA 1NFDB 1T1YA 4JFYA 4DOHB 3BKMH 1A0QL 2CLVB 5JPMA 2DOCA 1L7TL 1OY3B 1U3HB 1NAMA 4RNRB 5I76B 1XF4A 1FBIH 3I6LE 1DZBA 4P3DB 4PTTB 4S2SA 3MRMB 3IYLW 1SJHA 1KB5H 3DBXA 3OKLB 3LQAC 2V9QA 4OGZA 1MI5B 3BPLB 3LRGA 4P5MA 4DZBA 3EYOA 4EN3C 5EU5B 4XP5H 3WNKA 4NQCD 3VRJB 1T83A 5JW5B 3P40A 3AU1B 1PG7H 3FB7B 2CXKA 1WT5C 4KUCF 1IGML 4OF8A 1IC1A 1VFAA 2VQTA 4ODTL 4BYHA 2X4PB 2NY4B 2EIDA 4XNMA 4MA7L 3MOQA 3S35X 1DLFH 3LB6D 1T7XA 5GS0L 1R0AH 1F6LL 2IAMC 3HE7C 2GTWA 4PJHB 3V5HA 1UEMA 1NCAL 2XRAH 3BDXA 1T3FA 2AJYH 5SV4A 5B4MD 1YNLL 5F88A 1MHCB 3EDJA 3VFRB 2O5YH 4JVPA 4MD5B 5D1QA 2Q6WA 1EFQA 3IGAA 4KRLB 2ZCKH 1FFQA 1LD9B 4NQDB 4Y8AA 3QPQD 2DB8A 4CVXB 4J4PD 1CFVL 3EOAA 4R4FH 2IGFH 1W0VB 1H9VA 1QLFB 4YK4C 4JO2L 1FC2D 5EPMB 1YPZE 3EGSB 5DHXB 5I1KL 43CAA 2E7CA 4P9HC 2ZCLL 4XP1L 1GOHA 4Y2DA 3GGWB 3NIGF 3SDYL 4FNLL 2APBA 1P4LB 5CINH 3UPAA 1LK2A 4J3TA 1XR8A 3GSVB 3MLUH 1ZLSL 1TMCB 3UC0L 1JZ2A 5GHWL 3MBED 1CL7L 3G04B 2FX7H 1ROWA 3GSWB 3EJYD 1QRND 4Z7OE 1OHQA 3MCKB 2Z8WC 1MRDL 4PJXA 1ES0B 3RWFB 3KPQA 1FG2A 3WS3A 3IDIB 3T0EE 2V5YA 3SY0B 3RTQB 5DJ6B 5HGBA 5FKPA 3TGXA 5BRZD 3WO4C 1LDPH 1D6EA 1TENA 4TUKL 2DWDB 5JW4M 3HG1B 4LDLB 5GGVY 1V8HA 3GSNA 4JB9L 4OGAD 3MREB 2ZPKH 5EU3B 5JQ6H 3M45A 3LSOB 1F3JA 3HS0B 4UTAL 3U83A 3MLYL 4LU5H 3MRCA 4ODWB 5IB2A 4HPOH 1XF1A 4HC1L 2ATPA 3F7VA 1OAYH 1AY1H 1O5DT 3WFHB 5LXGH 1JGUL 4W70A 5C07E 1J0HA 1Q9LB 2R1YA 3ARSA 5C6TH 4JFFA 2B0SL 3VGBA 3CFDA 3MLRH 1FDLL 4MJIA 4YHKH 5DA4A 4XPHH 3LB6C 2X4OB 3KNBA 4X4XA 3DURA 1MCFA 4ZTOH 1VCAA 5B4MC 3C5SA 4KK5D 4L9LC 3S7GA 1JPTL 3AS3A 2DTMH 5I0DA 1YEJL 4LEOB 2G9HB 3JSSA 4Q74A 1MFBH 2YD1A 1ORQA 2X4UA 3RA7H 4QRPA 4ELKA 4HG4K 4HH9B 3QPQC 4J4PC 1BQSA 3GSNH 5ICXB 4NSKB 3Q6FB 3L1OL 4J3WA 5JR1H 4I4WA 1SYSB 4W4OA 5C0JA 5I1JH 5J56B 4HPYH 3DECA 1U3ZA 5IHLB 2P24B 2D4FA 3IJYB 2GY7B 4PJDE 4X7TB 3PWVA 1B6UA 3OKMB 1U3JA 3GBNL 4RCAA 5KS9A 1QSFA 1MLCA 4KDVA 1DQLH 3QIWD 2RFXA 4IRSA 3MBEC 1G9ML 2HN7A 2ZOLB 3TNNA 1Y0LB 4Y4HC 5HGGS 1AC0A 4PB9L 3DHMA 3OGOE 1L6ZA 1WFOA 2J8UB 3EJYC 1SHMA 4L3EE 1N2RB 5E99L 4F7MB 3I9GL 5AZ2L 2GJ6A 5D71L 2W59A 3HNTH 1MFAL 3CFCH 4NQVB 3UTSE 2E3VA 1Y6KR 4QF1B 2F54D 3IF1B 1R5IB 3V7AG 3GJFB 3O4LD 1F4WL 1AP2B 2DQGH 3DPBA 5C2UB 3VGHA 3RGVD 4WW1B 1UYWL 5JO5A 3QHFL 2X2YA 1P84J 3IFPB 4OGAC 5TE6H 3CX2A 2NZIA 4Z5RB 3PQYB 5EUOF 3N0PB 5HI5D 1IKFL 3REVA 3GSRA 1P5UA 1OAQL 1WWCA 4IDJH 2L7UA 5D7LB 5IB1A 3SDCD 3RVXD 3QXAB 4KTEL 5IGXH 3TBYB 1FLRL 1MFEL 1RJYA 3GSOA 4PY7A 4KDWA 1HH9B 3L7EA 2JJVA 1RZJL 4G8EB 4DN3H 1UB6A 2IF7A 3DX7B 5H35B 3WEXA 2Z92A 3P9LB 4YDJA 2F53A 3VXMA 3ZKND 4ETYA 3PXJA 4KK5C 2JJTA 4ZS7H 3NH7H 2MQ0A 3BEVB 1EEQA 3ZT5A 3BISA 1AKJD 1ZE3C 1I7UB 4XXCA 1M7IA 4JZOB 5ALCL 3S88L 1H5BB 1R5VA 3LKNB 3VXPB 4QHLA 1RVFH 1N7MH 3O6FD 3OKOB 3U2SB 5EWIL 3ZLQC 1JZ6A 1H3VA 1X5IA 5GQBA 4ZTPL 4NWTH 4EIGB 4DKFH 4F7CA 2VDRH 1RUKL 3I3BA 4GKZB 4RGOH 2Z91A 3O41B 3MLTA 3HMXA 1QSED 4NQEB 1MVUA 1EBPA 5ALBL 5IW1A 3PV6B 4OLUH 4YR6A 4Q97A 4G6KL 2VDKL 4QXUL 4DVBB 3QIWC 4HT1L 3QIUA 1WF5A 4NFBA 3O8XA 3CFIC 3MNVA 2DIJA 4NIKB 1PD6A 2EXWD 5LGHL 2BSRA 2PR4L 2YEZA 4H8WC 2D7NA 4J6RL 2PCPA 1KB9J 2NY7H 1BEYH 4R7DA 2DQDL 2XA8L 2DQHL 4FHBD 5DJYB 5FYLL 4Z18A 5CIPA 2F8VA 3OXSB 5C0CD 4Q2ZB 4IOFD 1NEZA 3BPCA 1NGQH 4M7ZB 4YXHH 2H9GB 1IAII 3RGVC 2JTDA 1UB5B 2A9NH 2VZTA 3CFBB 3WD5L 1FCGA 3MLWL 3CFEB 3S4SG 3GJEA 1RPQA 5HI5C 1VKXB 2KL6A 5EIQA 1MCOL 5HJ3B 2GHWB 3IXAB 2LU3A 5HYJB 3INUL 1P7QD 5ERWB 2XIDA 3NCYP 2W9DL 5HHQA 1YMMD 1OAXL 3MYZA 3FQRB 3HAEB 4M1CD 1NC4A 4LEXL 3SCMA 2H45A 3LEVL 2MHAA 2X4RA 3SDCC 3RVXC 3WHXB 1RURL 4CRPA 5C0BD 4R2GD 4NM8L 4F9PC 3VWJA 3JV5A 3TIDB 1KTLB 3T2NH 4YPGA 3H9SB 1MQKL 2Y5TA 2CLZA 4RFEB 4N90E 3NCBB 5HSFA 1F4AA 3OWEA 5GRJL 1YJDC 3ZKNC 4LLUA 2GTZA 5ANME 5CIPH 5I16A 1EEYB 4I9WE 4OLZH 1J8HB 1VFBA 4X4MA 5GGVH 2MSPA 3LHPL 1U8KB 4OZGA 3DRTB 4JPKL 4UT7H 3D18B 4J1UB 5I73C 2QQLL 4JZJA 2FLRT 3EO9L 5D6CB 1ZTXH 4I3SH 3WKNA 1R3LB 5I18L 3AM8C 1LEKA 5KSBE 3FOMA 3O6FC 4LLWA 1D9KD 5CEZL 4PJEE 2DQFA 5I1HH 2ZUSA 3QSKB 4KMTH 1RZGA 4CMHC 5DJZA 3GMLB 1N0XH 4MB5A 2XACC 3UTQA 3V6ZB 4Z7OF 1K5NB 3N50A 1SEQL 3UJJH 1OGAD 4NN6C 1FVDA 4LHUA 4NM4H 3D2UD 5CILH 3MV9E 2AI0L 3EOTH 4LDOB 4UV4L 4LSVL 3L5IA 5AAMA 2W0FA 3MV8D 2WZPD 2XYCA 4LVNB 1JNHA 1OSZB 3M1BA 2EXWC 5K59F 3LVEA 1OGTB 4TYUA 2BC4B 3OG4B 5T3ZE 2P46B 5C08D 2VR9A 3MUGA 2AV7B 1DBAH 3MGTA 2V2XB 4XCCH 1ZT7B 5D9SA 5DQJA 4ODVL 3QDGA 2FWOB 1HNGA 3OKKB 1ED3A 4L8SC 5JXED 2AXGA 1WFTA 4IOFC 2BCKA 1DVFB 1EEZA 5D7JA 1M71A 1NMCC 1AGFB 2R1XA 2ADFL 2IQAA 3ARZA 3QHZL 5DC4B 3DMMD 1KCRH 1IM3A 2FJHA 3ZTJH 3SDDD 1CZ8H 4KKBD 5C09D 1I3RA 3HR6A 1MHPH 4G43B 3SO5A 4CGTA 4Z0BH 1U8MA 1VSCA 4X9IA 3WNNA 4XPAL 2DN7A 3PWJB 3RWGB 2OI9C 1FH5L 2HT4D 3DYPA 4LVOB 4HAFA 4M1CC 4QRRB 3IDUA 1RHHB 3CPLB 5ISZA 1RZ8B 1BFOB 4WUKL 3LQAL 4PJCE 1ORSA 1YPZA 3UROR 4R2GC 1JP5A 1MWAA 4KV5E 2NY0D 1MLBA 3UTPD 1A8JH 4KQ4H 3OKNB 1CDGA 2YPLA 1INDH 3MLPA 5I1LB 4I0PD 5D2NE 4JHBA 3THML 3IVKB 1FFNB 3LKPB 3NA4A 3MV01 4L4JA 3CXDH 3OX8B 1KSRA 1K6QL 4P46B 3RUGF 4KRPB 4PGEB 5EN2B 1BZ7A 3KPMA 5D2LE 1G6RL 4I3RH 5EG6C 1NGYB 4ETQB 4KZEH 5FIEA 1UT9A 3KPPA 1D9KC 5I1GH 3RHWK 3T0EA 3OSKA 1JNLH 4RIRB 4Y16D 2DWEB 5CJXC 1GGTA 2AV1A 5A43C 1U3HD 2B4CL 1OL0A 1YC7A 5C0RL 3ELAT 1TLKA 5D6DC 5EZIL 3VE0A 5IVZB 4DGYL 1KENH 2Q8AL 1HIMH 2B5IC 4HUNB 1KEGH 3D39B 3WS6A 3MRRA 1MWAH 2CIIB 4JO1L 5EOQL 2R1WA 2A73B 2R29H 4JDVB 4P9HL 2A6KB 2Z8VC 4UZGA 2ADJB 2X9XA 1X3DA 2QBWA 4PJ7B 1CLZL 4O5LL 5GGRY 2FLBT 2FYYA 4NKIH 5BZWB 4X80L 2JLLA 4LNRB 2ATKB 1KPRA 2VDQL 1KTKE 5CFHA 1ZLWK 2DKUA 2NTSP 2NY4D 3FMGL 3BKJH 4IHOB 4Y5YB 5F7EL 4RBPK 3U7WL 1JNNH 2P8PA 1WFNA 4U1SA 5JXEC 5MEOB 3QCVL 4X9GA 2FO4A 3GO1H 3EHBD 5C1MB 2HJLB 4B41A 4HW6A 4YE4H 1T2QH 5HHOA 2VZSA 3ROOA 5JPNA 3QRFM 4XPFH 4OZ4A 4FZ8H 3DMMC 4ZQKA 3SDDC 3QIBA 3CVHA 1F02I 4KKBC 4NQDD 2GK0A 4OQTL 3PV7A 5TH2B 4ZO6A 1ZMYA 1EHLH 5JQHC 4OZFA 5EB9A 4PLKD 2DM3A 2E7MA 3IFLL 4LCCA 2H26A 5L88L 2HT4C 4R97C 1A3RL 4M6AA 3ZE0F 5FO9A 1CVSC 4I18B 1TZIA 2O5ZL 4MXWL 2PW2B 3HRZA 2NY0C 4H1LH 1GHFH 2AQ2A 4PJDA 5EDXA 2FL5B 1U42A 4EUPA 5HYSA 4Y8DC 4I0PC 4WEMB 3BZDA 4QRQB 2G5BB 4ODSL 1OF2A 3HPJA 1AFVL 1PQZA 3ALXA 1BQUA 4K9EC 3VJ6B 2FZ3A 2WWMD 5TE7L 1E4XL 1WZLA 2J8OA 3VMPA 1I8IA 5IV2B 4OF5A 4MDIA 1ZV5A 4OI8A 2L0DA 5JXAH 1C5DB 3QWRD 4EVNB 2PYEB 3F7YA 3UTSA 2EH8H 3ARGB 2WIIB 4LVHB 3RTQD 3CVHH 4Y16C 5IK3B 1FN4A 1ULVA 3ARPA 2XWBA 2QKIB 5KAQG 1U3HC 1G7LB 2VLJE 1I3GH 2VDML 4UDUA 3G5XB 3HG1D 3U46B 1UM6H 2IADB 4ZG1A 1FAIL 5MEND 3U4EA 3BW9B 1WAAE 3RWJA 3TESA 3B6SB 3E1F1 1S78C 1VFOA 3TJHD 1CR9L 3MLSH 4YDIH 2B39A 2YPVH 2YKLH 1X5LA 4U1IA 3WCYA 1S9VB 2NW2B 5BVPH 4JQIL 4HXAL 3QWOB 2OX5A 4JJ5B 3H2WA 2VIRA 4CNIA 2WWKO 4MNQA 3MROA 1G7JB 2HJKB 4M61A 5KJRL 3QO0B 1H8OA 1WEJH 2CK0H 2NY4C 5GSRA 4OIAA 3V0WL 3MZGB 4EZMA 5FHAH 1B88A 3CUPA 2AJZA 2XZAL 2UY7A 2X89A 3R0MA 5FV1L 5TDOA 5CLWA 4MAYA 3SN6N 2AVGA 2BJML 5CSZB 3EHBC 4MNHA 5C0ND 4EEEA 1S7WB 3V6OC 4B7LA 4Q9RH 1EO7A 3WUZA 1IEAA 3SKMA 2EO9A 4Y5VB 2H41A 2CJUH 1HHGA 4XPTL 3RPIB 3MUHL 4OKDA 4U0RB 3STZB 4OLYL 1A1NA 3VFSB 3RZCA 2WBWB 1DBJL 5MI0B 5ACMA 1GIGL 3RNQA 4PLKC 1Q72L 1T0NA 1CIUA 3PP4H 3SE4A 5FM5M 2PYFA 4IRZL 2F58L 1XIWB 4QHNA 3RZWA 3T77B 2D3VA 5F97E 2BSTB 5TPWH 3FQXB 4D9QE 5SWZB 1XGYL 2APXA 3V7AE 1Z9SA 1U36A 1QEWA 2CRMA 2EKSA 3D5OF 3Q1SL 5CZVH 4AJ0A 5FYJE 3T4AB 4PJEF 4WO4A 5EOCJ 3ARBA 4N8PA 4NNXA 3V5DA 4YHZL 1J1PH 1VADB 2IQ9L 4JPWL 3MODL 3RVUD 4G42A 3VFWB 5HVFB 2Y72A 3EJZD 3C5JA 1NFDE 2WWMC 1MPAL 4I0KA 3OHXB 3G6AA 5C9JB 3JV0A 4TUOA 5I1AA 4XMKH 1BOGB 3RTQC 1G0DA 4JANA 2FB4L 1W8NA 4C83A 1KC5L 5IEKB 5JDSA 5DDHA 3MRJB 3QUZA 2R2EB 3QNYA 1EUUA 3IDXL 1BD2B 4WTXA 3S96B 2H1PL 3PQYD 5TE4H 3TJHC 5FYKD 3ZHLA 1VB9A 3BN9D 5GGRA 1DSFH 3UJIH 2OTUB 4YFEA 1HH6A 1JV5A 5HGHA 25C8L 5DMGD 2VSDA 1NFIA 1XT5A 4PTUB 3V5KB 1P6FA 1KN4H 2IANE 3MRFB 2O61A 5D7LD 4K7FB 4M1DL 2DBLL 3QUMA 5BS0D 4KK9D 4BELD 3X3FL 4MD4B 1SBBA 2EC9U 1CFNB 5D1ZB 1M4KA 4PR5B 5IG7B 8CGTA 1ETZB 2RQ8A 4QNPF 2AK4B 1F42A 1I8LC 4TTDD 3SHSA 2V7NB 3MYJB 4WV1B 5I1CH 5C0NC 4YWGL 4HLZG 4UI2A 1HHJB 3VH8G 3BHBA 5MHSD 4BSJA 5ANMA 5C92A 1A6AA 4PJCF 1AGCB 1FO0A 2FHBA 2DRUA 1IMHC 2M2DA 1I1YA 3LS4H 5BJTB 3KYNA 4M7LH 2C1PB 2F15A 3T4YB 4QOKE 4D8PB 4E41B 2VL5B 4MQTB 2DQEL 4FABH 3VGAB 5JNYA 4G8GD 4LARH 4PBXA 2AABL 4WW2B 1WK0A 2VAAB 4L29B 5KSBA 5I74C 5KOMC 4ENED 3TIEA 3RJQB 4APQA 4GQ9H 1A1MA 1QHPA 1GYAA 5D2LF 1YDPA 3WFEL 5LG1A 3QUMH 3QG6B 5FYJU 2DQUH 3C6LB 3SE3C 2IPUG 5IFJA 2FGZA 3MA7B 4B50A 5T1MB 4WFHD 1QBML 3KPRE 3RBGA 4PJAF 3RVUC 1AGEA 2E9JA 3CK0H 3QDJB 3EJZC 4MXVF 3WXVH 1KIUA 2DF3A 4HIJA 1DBBL 3NIDE 4K7PH 3VXRA 1IBGH 1I4FA 1U8PA 2VDPL 3WFBL 1FO0H 1XCTA 3S36L 2QR0A 2YD3A 3K3QA 4PRAA 5IB4A 1MEXL 3NZHH 5LCVL 5JIHA 4G7YL 4D0DB 2PETA 4QY8A 4YQXL 2IPKA 2Y07L 3ULUD 5J06A 1FZOA 1WC7A 2Z31B 3UJTL 3MV7B 5FFLA 1NGWA 2YC1B 5I8CB 2VC2L 2Q7YB 4MQ7A 1LEGA 3BN9C 1GC1H 4BFGA 5HYJD 5TDPB 5IVXE 5DJCA 2XTJD 5DMGC 3HE6B 4P2CG 2EDNA 1NBVL 3GNML 2HLFC 3RX5A 4QGTA 1R3KA 4TUJB 1DQJA 3FQNA 4LNVA 4F58L 1NLDL 4KK9C 4M8QB 4L4TD 1IEHA 3BQUD 1MCEA 4U4BA 4L8DA 1IEBB 1YEFL 3IDJB 4YDVB 1FCCA 3E6HB 2FIRT 3D0LB 1ZEAL 2BNRA 5HGDB 1JF5A 1H8SA 3DRQB 1FL5B 1J8HD 4J12A 3IFOA 4LQFH 1L9NA 5D2NA 4M43L 4O4YL 4QT5A 3SDXF 3N9GH 2P5ED 5MERB 1H5BC 2F74B 4LF3A 2YK1L 1NJ9B 3IETB 2VZUA 1V3LA 4OFIA 3QQ4A 2ARJA 4BH7B 2B1AH 5DC9B 4GBXD 5CKGA 15C8L 4YAQA 2NTFA 4ENEC 2OK0L 3SKNB 3VXUA 3OJDA 2ITCA 4HKZA 5AYUH 4UTBL 3QBTB 1FLTX 4GAJH 4PG9B 1T4KB 3QNZB 4WCYH 3KR3H 5CBAA 5MEPA 3CZFB 2NY5L 1GGUA 4P59L 5F9OH 1Q0XH 4G7VH 3DLQR 3VXSB 4X4YA 2OJZL 1OAUH 2HRPH 4LKCB 1T21A 3LMJL 1GGCL 4LK4A 4JKWA 5EOTA 2J12B 4ELMB 4I48A 1WAAF 1AXSB 3IDMB 1W0YT 4DGIH 5HHXH 1A7BA 1D5IH 3QPXL 2AK1H 3V0AC 3W2DH 5CEXB 4X6EA 5BV7L 1VACB 1QLRA 1UACL 4FFVD 2XG5A 3FT4B 5GS3A 2NW3A 3QFJA 5DD1L 4X7SL 1CLYL 3QUYA 4OD3H 3ULUC 2UZIH 1A7NL 2J3SA 3JTSB 1I9JH 4J3UA 4I5BA 5FAAA 1GCFA 1CICB 5D72H 4E42A 3SOBL 1EDQA 4WFFD 2NNAA 1YY8A 3HMWH 4N8VB 5IEHA 4MHHG 2GSGB 2XTJC 3KPTA 3U9PH 4ZFGL 3S35L 4DGVH 3OR6A 5JHLH 1B0RA 4I2XA 1XZ0A 3PHQA 3DGGA 2J6EA 4JO4H 2BSSA 3G5YA 1YQVL 2ED9A 2M8XA 3FRUA 2R15A 3BQUC 3D69A 2WUBH 3HC0A 1HINL 2VMFA 4IDLA 3TA3A 4ZUVA 4GSDH 4U7KA 2IALB 4OM0H 1BPVA 1FYHB 2CLRB 5HHNB 1XF2A 4RBPH 4UT9L 1SBSH 1KCKA 1KCVH 2YD6A 4NFDA 5DJXB 1CDBA 3R06A 3TT1L 4C56B 2O5XH 3U9UA 1MIEL 1NCCL 4XNYL 2YUVA 3H3BC 4KRPD 4ZPVB 5IFAH 4XT1C 4MJ6A 3W39A 5T33L 3EYVB 2QQNH 3L3HA 3EBAA 3JWDH 5ITFB 4GBXC 2J4WL 3V0VA 3CH1B 5HI3D 1C12A 3LZFL 3FT3B 3VD4A 5F7MC 4KKLD 1CDIA 4ISVB 2XG4A 1IGIL 1NFDF 3JXAA 4N0RA 5A2FA 3LPWA 1CU4H 4NJAH 1LE9B 3QDAA 4Z7VB 12E8L 2J6EH 4GH7B 1JPSH 1JN6A 3D39D 4JPIA 2VN4A 1P6AB 2WWKT 4PJFE 4KUZH 5LKNA 2VAJA 5A40E 5IP4A 4LVNC 5DD5L 1IZKA 3ZSTA 3CVIH 3ECBA 4NFCA 3P0VH 3CDCA 1KTDB 5CEZE 4Q7DA 4BUGA 2QADB 5D96B 3TLRA 4H0IA 1U93B 3O6KH 4K71B 5GISL 3T1WA 4FFVC 5DURD 2C3WA 3DUSB 1B2WH 4EOWH 2J7LA 1A1OB 4MQSB 4U6VL 5GPRA 1RK1A 4FQQB 1CDYA 5FM8A 4PRIB 2PXYD 2YRLA 2J5LB 3A6BH 4GMSL 3PJSA 1XF5A 1TJIL 4NO2A 3VD3A 4PJHF 3GUTB 4HIIB 2HLAA 1LDSA 3MRPB 1NBYA 1RZKL 2K3TA 3DXAB 4MA3B 2P5WA 3QFDA 4G9FB 1CGSL 1EFXD 4X8XA 1KJ3L 4ZDHB 4BQ6A 3FO1A 2JIXD 4V2CB 2KQNA 3D48R 4LVOC 1F3DH 2LTQC 3U4BH 4G6FB 1T1XA 3W11D 2GQHA 3PWLB 3H9SE 1MY7A 3FFCE 2NLJB 1CXLA 3B5HA 4ZO9A 5FF6A 2B7DT 1UJ3A 3QNXA 3I6GB 3RPKA 3C8KA 2ZUQB 4ZD3L 2G60L 1NMBH 3P11L 1DQML 3RGHA 1AE6L 2AXFA 3FAXA 32C2B 5IMKB 5EZJA 4KRPC 3MRHA 1RQ5A 5DTFA 3VXQA 4LLQB 4G6MH 2PYED 3MJ6A 3ARGD 1WISA 2IH1A 2BHZA 3RVVD 3MXWL 1N5AB 3OGCB 3BZEA 3MGAA 5HI3C 3H6JA 4NKOB 3QXDA 1J1XH 4MWFB 1A4JB 2VXTL 2CDFA 2DI7A 4KKLC 4JGMA 2W9EL 5HDBE 4KK8D 3QYCA 1ZHKB 1JWUA 4PJ9A 2H6PB 1Z3GH 1GZPB 4P2RA 5D7SL 5HY9B 3RAJL 4ALAL 2VDNL 3DTXA 2JJSC 4ODTH 1XEDA 4F2MB 1D6VL 5SWSA 4BSWB 3MZTA 4CVWA 1I9RH 5HHME 5GS0H 1U8JB 1NCAH 4Q6IA 1IC4H 2C4FT 4AYFA 2IANA 1RI8A 4JY5L 4XTRD 3B2VH 4QYOB 3I2CL 5DRNB 1JBJA 2GFBA 4HGMA 4F8QA 4MDJB 1FV1A 2VTFA 3QJHA 3VFUB 2Q87A 1A5FL 1SJXA 1ZHLB 2HP4A 4LSQH 1JF1A 2PXYC 4L4VD 1B0GB 3WSQH 4KH2A 3AMLA 4GRLA 2ZCLH 2YOCA 5C3TA 2RAMA 4ZFOB 5AAWA 5IW6A 4QRRE 3KYMB 4FNLH 1S7SA 2R56H 4FQJL 4HC1A 4PG2C 4PFEA 1ZLSH 5C0EB 4RX4A 1BJ1H 4KHXH 3EYSL 3W11C 4HJJH 3UC0H 1XIWD 2DLHA 3EO0B 3QJFB 5GHWH 5IHZA 2BNQB 1CL7H 5F89B 4Z7UB 2VLKB 2NXYB 3QUXA 2DQIL 4AQOA 3WDHA 1MRDH 5FHBL 1MJUH 1TJHH 4Y19B 3ZE2F 5E6IB 5KSAA 1I7RA 2DD8H 2HA1A 1URLA 4XHJD 3QT2A 4LSSH 2HJFB 4LAQL 1AR2A 2Z4QA 4XPBL 3TFKD 2C7UA 1HHKA 2C1OB 5IJVB 2FDBP 5I30H 1A21A 4D9LL 5JHDB 5A16B 3KLAA 3S4SA 3FB6B 3MRGA 7FABH 3ARGC 4LVHC 2FJFA 5IHBA 4OLVL 2HFGL 3RVVC 2PUQT 2A74B 2J8UF 1S7QB 1IQDB 1VA9A 3MLYH 1NMAL 5C7XL 4XBPB 3QI9A 3P4NA 4AIZA 2D31A 4JKMA 4L5FL 4MCZB 1CL7I 3VXOB 2R8SL 4KK8C 3VCLA 1QFOA 3D6GA 4NBXB 1P9MC 4HUVA 4HC1H 2WBJB 1FYTA 3PWPE 4U1NA 4MLIA 3BGMA 4OZHB 2X1OA 3DVGB 4A6YB 4MAUL 2JCCB 1QR1A 1A7OL 5F21B 1A47A 5IVXA 5E2VL 3KPSE 4TSAL 1BREA 1N8ZB 1TVBB 5FO7B 1A9EB 4JJHA 3JUYA 4NO5A 3QEQB 3WLBA 2Y06L 4XTRC 5C2BL 1Q38A 4HS3B 3P9MA 4U1LA 2FEDD 2WLYA 1BJ1J 4H26A 1FFOB 2AK4D 3A6OA 1U95B 3JV4A 2DQCL 3OAYK 3DARA 4JFEB 5GGTL 3IU4H 1XGRA 3JVGA 5ESQA 1NL0H 1KJ2L 2BY3A 1KUMA 4Y5VC 1YEIL 4AM0A 4KY1L 3SDAA 1NDGA 3DIFB 1AO7B 4U0RC 5E2WL 3QWQB 2A77L 2EYRB 1BP3B 3REWA 4LLMA 4N0CD 2DL9A 3WFZA 1TPXC 3GBNH 3BP6A 3S98A 3AREA 1LE5B 1ADQL 1FJ1B 4PGBA 1HDMA 1CGVA 5EULV 1ZK9A 5DUBB 1BBDH 3WIIH 1K8IA 1XIWC 1OW0C 3H0TB 1U8NA 2I5YH 5EU7E 2OP4H 4YGVB 4OZIE 5JA8B 3QQNA 4H88L 1AXTL 4IMLB 5E99H 5H2BA 1K9TA 1XF3B 3BEWB 2I24N 2VDLL 3W81A 2RHEA 1QKZL 3BFOA 2EYTB 1WZMA 1MCQA 3GSQA 3TFKC 3QDJD 5CHNB 1Q9WB 3BP5A 4HUUA 1UWEH 1F4WH 5IBTL 1KJVA 3QUKB 1YC8A 4RGND 3EKCA 1MH5A 3KLDA 5T1DH 5C6PB 3O3AB 4HWZA 5IF0A 1LNUA 1MELA 5F9WC 1G7IA 1ZHBA 2A6DA 4QRSB 2EDKA 4WI8A 2LVCA 3LQMA 4PGZA 1HXMA 2W65A 4HWBH 2XPGA 4M02A 4CU6A 2Z31D 1FGVL 4OCWH 3I6KA 5ACZA 5FECA 4GRWE 5DF0A 4TVPL 3B9AA 1I85A 4KTEH 4Z0XA 2ZUWA 3S6CA 1FLRH 1BQHB 1MFEH 3VXNB 3L3IA 2CDGB 3HE6D 3O4OC 4XVSL 3VI4E 1WIPA 4N0YL 3ULUF 4LLVA 1X9QA 2ZSWA 4LGPB 2ICEA 3BZ4A 1I8KA 1DUYB 3L95A 2XZCL 1IGYB 4AENB 4JKPH 2V5TA 1NC2A 1R6VA 1F6AA 2HYMA 3VFVA 1KFAL 1IC5L 3C60B 2FEDC 1UXWB 1J0YA 4HCRL 5CUSH 1TJGH 1I3UA 3OF6D 4S1SL 4RMSA 2JK5A 5LQBH 4OD2B 3L6FB 4NCDA 3G5ZB 5TGBB 3O3BA 2BDNL 4OCSL 4OJFL 4JPVL 1U8IA 2OQJA 4AMKL 1UZ6E 2DMKA 3SEPA 1HNFA 3FB5B 3O6LH 3W9EA 4X6DB 2VZ3A 3L9RA 1KB5B 4AG4L 2EKJA 5SX5K 2D4DA 3G6JA 4N0CC 1K3ZA 1EXUA 2ADIB 3QXWA 5ALBH 4XH2A 3MV11 3FOLA 3V4PL 5LAXB 1ZA3A 4X6CB 2HVJA 4P2OA 3ABZA 4QXUH 4BSVA 4HT1H 5SWZE 5CMAA 4HSQA 3ZT7A 2A0LD 4P48A 1PYWA 5IKCA 2E6JA 3WO3B 5LGHH 2PR4H 5I71C 4Y4FA 1NUNB 4J6RH 1NCUA 3R8BB 5INCA 1OSPL 2EXYD 3VXSD 5DJDA 5DRZA 4EI5D 1RUAL 4OFYA 2VDOL 4PP2A 5GGSY 1T1YB 5FYLH 1ZS8A 5DEGA 4JFYB 4PJFA 4GRMA 5HDBF 3TF7C 6FABL 5JPMB 3GIZL 3O4LE 1A2YA 4RGNC 3RWIA 2JJWA 1NAMB 1YYMH 4HJGA 5EFIA 1TVHA 1FL6A 4K3GA 2VXSL 5DR5H 4CU7A 3GHBL 3MLWH 1SJHB 3DBXB 2YUZA 5I75B 1MAKA 5HVWA 1FBIL 4JM2A 5LBSL 4FQXD 4P5MB 4DZBB 2W9DH 3ZSSA 4ZOCA 4ZYKA 4LEXH 4ZSOA 5H37H 1C5BH 1CICD 3LEVH 3LKRA 4OFDA 1L4IA 3QB7C 4Y1AD 1VFAB 3GMNA 4KAQH 1ZKAA 1PGRB 1A3QA 3HE6C 4NM8H 1ONQA 4XNMB 2IH3A 4JRYE 1KACB 1PKQE 1PG7L 4FXKA 3STLA 4YBLC 4HJ0D 1IQWL 4W68A 1T3FB 3B9KA 4D94A 2BRQA 1I9IH 3LHPH 5F88B 1P7HL 1FFPA 4ONHA 3VW3H 1OTSD 2Q6WB 4OQ1A 1R0AL 4ORGA 3IGAB 3AS1A 1Z9LA 2XRAL 2AJYL 2P43B 1KIRA 3EOAB 4C56D 3N1QC 3RL1A 2O5YL 4E41E 3AS0A 2MQ3A 3FCTB 1Z0NA 43CAB 3G08A 2EDRA 2DM7A 1Z0MA 4Y2DB 1SEQH 3R0NA 2IGFL 1WFUA 2V9RA 3UAJD 5B39A 2J88L 1Z5LA 1LK2B 1XR8B 1K2DA 2F8OA 4UV4H 2YD7A 3B43A 3P3YA 2A0LC 1IAKA 2Z35A 4PGJA 3NCFB 2DJUA 4WUUA 3T0XA 1W8OA 4XGZA 3NCJH 4PJXB 4EN3A 2EXYC 1DQQA 1ZLVH 4EI5C 5CZKA 1FG2B 1R24B 4ODVH 1WT5A 4URTB 2X9YA 5IIEB 1P7KA 5ID1A 1OCWH 2EDXA 5IVNA 3RWHB 3BMVA 5HGBB 2VLRE 5FKPB 4HZLA 1YN7A 4YH6A 1A6PA 3D3VD 1D6EB 1G6RA 3IJHA 3NAAH 2IAMA 3I75B 2QADD 5HVHB 3GSNB 3L7FA 4PJ7F 3BMWA 3KDMA 1KXQE 2GCYA 5I15H 4Q0XL 3BWUC 1F3JB 4E9LA 3MV7E 3MRCB 1LDPL 4BZYA 4PRID 4FQXC 4XPAH 4DZ8A 2CDEA 1FRGL 4HK3J 4F7PA 5IB2B 4PJBA 3BP4A 2W0LA 2ZPKL 2ATPB 3F7VB 3DUHA 5JQ6L 5IOPA 1CICC 2DIBA 5ICYA 4LU5L 1DCLA 4WUKH 2R1YB 5E9DD 5ACLA 4G9FD 4HPOL 4HD9A 4IJ3B 1OTTD 4JFFB 4PD4K 1QVOA 4PV8A 3CFDB 1OAYL 1AY1L 4U6XA 5L2JB 1EJ6A 1CDCA 3BUTA 4X4XB 5LXGL 1XR9A 3TBTA 3DURB 5I6XC 4HJ0C 2UY6A 4W6WB 1OVZA 3C5SB 1PLGL 5C6TL 2OR8A 5ENWB 4YHKL 3MLRL 1OTSC 4XPHL 5D5ME 1ORQB 4LP5A 1INQA 1T22A 3BPNB 4QRPB 1G6RH 3S3PA 4CN6A 4ELKB 4ZTOL 5EO0B 1A7RH 1PAMA 2KQMA 2FNBA 2VZVA 2DTML 4V1DA 4U3HA 4AH2B 1MFBL 2CKBL 3OTTA 3PXHA 4I4WB 2BMKB 1CDHA 2WW8A 5C0JB 3OZ9H 4OZIF 3GMRA 1E28A 4JRXE 4F33B 4U7SA 3DV6A 5C0RH 4OQTA 5MEQA 3GMPA 5DD0H 2BVUA 3O11A 3PWVB 4DGYH 5D7KE 5ETUA 2Q8AH 5GRXG 3UAJC 4C55A 5I1JL 5KS9B 4HPYL 1QSFB 2AEQH 1QFWL 2OBGA 4P5TD 5EOQH 1MLCB 2RFXB 2WMPA 1UWXH 1JGEA 4IRSB 4P9HH 3OR7A 2WLZA 2HN7B 5CJQH 3TNNB 4O5LH 4PIRF 2FR4A 5GGSA 5L2KE 4X80H 4TSCH 4YHNA 5ELIA 4G80B 5J11B 2VDQH 1F97A 4OCXH 4FMKA 4O2FA 1CD1A 2GJ6B 3PWPA 2XZZA 1DQLL 4NQCA 2YD2A 4P49A 3VGFA 3FMGH 2XTLA 3T3PE 5KOVC 5JZ7D 4DJMA 3PDDA 3JV6A 3U7WH 3VFPA 4Z7WA 3HI6H 3BGFB 4CBPA 4PV9A 3VH8A 3B8YA 2FATL 3CFCL 4YGAB 3OB8A 2VO5A 1RUPL 3T0VA 3SQOH 2QADC 5F70A 3Q0HA 3VI4F 5JMRA 4CVZB 4K71C 4OQTH 2I07A 4F3FA 1ZAGA 2DQGL 3REVB 2VE6A 5FCUH 5J1SC 3GSRB 4NQSA 2E8YA 4J4PA 1IGTA 3I50L 1A02N 1I1AA 1IZJA 5CD3B 3QZWA 4AL8H 5IB1B 3KXFD 4CVUA 4MXWH 1RJYB 2ESVD 1OQXA 3GSOB 4PY7B 3HFMH 1KIQA 4XNZB 1OTTC 1WWAX 3CX5J 4IDJL 3HNVL 3L7EB 4PGCA 2GW5A 1HQRA 3MCG1 1MHHA 5JMOC 3IXTA 4IIQB 1UB6B 1UZ6F 3WEXB 1YN6A 2Z92B 3NVQA 4YDJB 3VXMB 1T80A 3CSPA 1C7SA 4ORZC 1AFVH 2VLKD 4KZDH 4M5ZH 1FORL 1EHXA 3MBEA 5C0DA 4MXQD 4Y19D 4DN3L 1M7IB 5E6ID 4Y4HA 1R5VB 3GSXA 3NBNA 4QHLB 1QRNA 4WHYH 1ACYH 3NH7L 4ZS7L 3HZVA 4G9DA 2F5BH 2EDTA 1MCKA 2N7AA 3V8CA 3QEGH 5E4EB 4NDMB 5JHDD 2VDMH 1KGCE 5EC2A 4F7CB 4P2QE 3ZMRA 3CXHK 2Z91B 2IG2H 1DBML 3PL6D 2E6QA 4YZFE 3MLTB 1MVUB 1EZVX 1OWRM 4G5ZL 5IW1B 4YR6B 2PW1A 3ZKQD 4M00A 4P5TC 4NWTL 4Z7VE 5EBLA 4RGOL 1X5ZA 1T1ZB 3QIUB 3RJDA 1SJVA 4HXAH 3SKUD 4K3DH 3O8XB 3MNVB 3TH4T 2WBJD 3ISWA 5DT1H 4OLUL 1E4XI 2BSRB 2YEZB 2DQTH 1T5WA 2PCPB 4R7DB 5K33A 3Q3GA 5JZ7C 1GSMA 1UFUA 1UH2A 4KI5D 5HD8D 5CIPB 4P57A 1D5XA 2R23A 1U91A 4IS6A 3QP3A 2NY7L 3BPCB 1GAFH 4DK6A 3QEQD 5GRUH 3OBAA 5M94B 1LP9E 1ZSDB 5EZLA 5K9JH 4L8BA 4QHMA 2G5RA 3HC3L 3WIFA 2YRZA 4NQXA 4XPTH 1P69B 1WBYA 1IM9A 3GJEB 1NGQL 1TNMA 2OSLA 2BVQB 5EA0L 3LRSA 2DIAA 4U31A 1Q72H 4OI9A 2A9NL 1Q1JH 3FQUA 3C8HA 5HHQB 3DXAE 1NC4B 4IRZH 3SCMB 2F58H 1BM3H 2MHAB 5CP3H 3K4AA 3WNOA 4PLNC 4JFOB 2Y4SA 4FQHA 3GKWH 4MSWA 1XCQB 2V2WA 4YPGB 2FHCA 2Y5TB 3Q1SH 4X98A 4M93B 2CLZB 3VGEA 1UENA 5ADOH 3EO1A 4YHZH 4LLUB 3MOAH 2GKIA 2GTZB 2IQ9H 3MODH 1VFBB 2BNUA 4WW2F 3QIWA 3TO4A 1MPAH 5DQ9A 3VFMA 4MXQC 4PJGB 5E6IC 1FZKA 1FSKB 4JZJB 5JW4N 4N9GA 2EDEA 1NFKA 3ZL4H 1LEKB 4OLZL 5GGVL 3FOMB 1XAUA 4AK1A 4LLWB 4P4RA 2VXUL 3ZE1E 4UT7L 2DQFB 3RWEA 4CJ1A 3EFDH 1RZGB 2VITB 3C2AL 4O51A 1KC5H 5DJZB 2ZOKA 2AQ3A 1ZTXL 4I3SL 2G75A 1HQ4A 4Z6AT 3O4LA 4LGSB 5DMKA 4EIZC 4W4NA 1M6OA 3PL6C 3UPRA 3IDXH 4P3WA 4YFDB 1FNGB 2GJZA 4XAWL 5MENE 3BDBA 4YIQA 5SX5H 4L9DA 1S7XB 4OFVA 1FVDB 5HYFA 2ARWA 4LHUB 3S8WA 5EIIA 3FO9A 2EZ0D 1IAMA 1KXTB 1N0XL 2W0FB 3CU7A 2BY1A 1DN0A 2WBJC 3UJJL 1JNHB 1IJ9A 4LCWE 5F9JA 4M1DH 2MKLC 3EOTL 4QRTA 1T0MA 3MUGB 1MRCL 4DUXA 4GG8A 4N8CL 3V2AR 3MGTB 3E6FA 1S8DA 5D9SB 1AHWC 5DQJB 4KI5C 5EC1A 5HD8C 2OS7A 3SDCA 1QG3A 3ZKMD 3MX0A 4LIQH 1NAKH 3DX6A 2E27H 1ED3B 1BWMA 2AXGB 4F9PA 4H8WH 4JRYA 2BCKB 1JCKA 2WINA 3EIFA 4PJIE 1EEZB 5DK2B 1DBAL 5GIRA 4YFLF 5D7JB 4XCCL 1M71B 2R1XB 1HCFX 3MRNB 1NLBL 1VGKA 3OXRA 2XOTA 1IM3B 2FJHB 1I3RB 3TWCH 1AKJA 1K8DA 4R6UA 2DQEH 3W0WD 2YA2A 5I19H 1OPGH 3VA6A 2X5PA 4DCQA 2AABH 4JGJA 4HEME 5MP6H 1KYOK 1VGEH 3AM8A 5L6YL 1KCRL 2C3GA 3O6FA 5E5MA 5HPOA 5DK0A 5EBWA 1ORSB 1YPZB 1AIFA 5TF1L 1ZA6B 2HWZL 3ET9F 1MLBB 1UM4L 1MCCA 1R3IH 1G7HB 43C9A 4TRPL 2BNQE 5IJKA 3K0WA 1QSEA 2YPLB 3OB0H 2LU7A 1JK8B 4ZUWA 2KDGA 1QBMH 5HHVH 2HMID 4WWKC 1PZUB 1M05A 3O45A