1IAIM

Idiotype-anti-idiotype fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DIQLTQSPAFMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM01
5IEKB 2CR3A 4LIQL 4NN5B 3I3DA 4L29A 5KS9F 1T89A 5KSVB 5F71A 2GCYB 2MKLC 5EORH 5I17A 1VKXA 4PREA 5TDNA 4PG9A 1G6VK 4OLEA 1A6AA 3BZEB 4NKMB 5CZXD 3ZT5A 5CBEB 2NY0C 1AQDB 5DQ9A 2Z92A 1IC5H 1IC7L 3L7EA 5EDXA 2GUOA 1IGFH 1WAAE 2EH8L 5T5FH 2FL5A 3KLHC 4MQTB 3SO3C 1S78C 2CLVB 4XP5H 1A7PL 4XP4L 3G5VA 5GS2H 1R5VB 2ZG1A 3MUY1 2YPVH 2E27L 3DURB 3OR7A 4EI6A 4WUUD 1FFOB 1FGNL 1T0PB 4J1UB 3CSGA 4ZSOA 1QFWM 3WLWD 4C58B 1UCBL 1KYOJ 3WBDA 5IFJA 3LIZH 4Y1AB 4FQQA 2XOTA 3SGDH 2FBOJ 1P4IL 4IRJC 4NQVB 5JIIA 1KB5L 4LBEA 5J06A 3C6LD 4RMUA 2CLRB 3U7YH 4M6AA 1ADQA 3PGCA 1SJEB 3PJSB 2DWEB 1X5LA 4RFNB 4IOSD 2OL3H 1NEZG 5A43C 1NGXA 5HHPB 4KJWC 5EG6C 2V2XA 2Y5EA 1UKTA 4Q58C 1UB5A 2MOVA 4XNUL 1SJVA 1YEEH 3CFJB 4ODHH 2Q7YB 3H6JA 3ARBD 4DK3A 4YFDB 5ISZE 2ZUXA 4NN7C 2NY5L 5DFVD 1G7LB 2VH5H 3RNQB 4OF8A 4L1HA 1ZHBB 2QEJA 5KW9H 4BH8B 4ZD3H 3IDXL 1R3JA 2GJ6B 3RL1B 3P0VH 3M17A 5C6TH 2X1XR 4JVWA 4X8JB 3TBWB 4TOYH 3ZHKA 1I8KB 3HNTL 3QHTC 1YEGL 5T1DL 3RHWF 2V7NA 3ARTA 1HINL 3MRKB 3UTSA 1KCSL 3RP1A 4MNQA 1U8QA 1Q9WB 1HHIA 1I8IB 3QPQD 3MRRA 1QFWL 3EYUL 3EO0B 5KVEH 2B5IC 3G6JF 3O3DA 5DLML 2LTQB 4G5ZH 1HOCB 3MLWL 3RWIA 3QRFM 2VMFA 3ILQC 4MCZB 1GL4B 1KJ2B 2IH1A 4LPCA 4EQ2A 1HEZA 1KLGB 4LAQL 5JW3H 4KWUA 4PJ5A 2P49B 3MACL 4JGJA 5GS2D 5ESVB 1V3LA 1BIIA 1UM6H 5MHSD 2DMKA 2VQ1B 5JIHA 2KZWA 1IGTA 1WITA 5GS0H 3QIUA 5HYJA 4ZNEE 2I5YL 2YD2A 3MA9L 1VKXB 3BH8B 2XA3A 3O2DA 4WHCA 3PL6A 4X5WB 5K9OA 2OTWA 3BEVB 3DI3B 4PJ9B 1H15B 1WT5C 1A9EB 2WWKO 3HA0A 3P77B 5D2NA 3QJHB 3GHBH 4LLWA 3V52L 5TGBA 5DJ8A 2IAMB 4KUCF 1ITCA 2A9ML 2B20A 3E8UL 1YJDL 1KELH 4NNXA 3NCMA 4V2BA 1KB5H 3WIHL 2RCSH 5E2TL 2FEDC 2A74A 3O8XD 2HWZH 4Q6IC 3TVMD 3PABB 3LN4A 4PJ8D 5IP4A 3OR7B 2D31B 5H94A 4P4RA 3DYMA 3QDGD 2EYRA 3DRQB 3SO3B 3ZE2F 4P5MA 5FV2A 1QSZA 1RZ8B 4XBGA 5B39A 5C09E 5E2WH 2IH3A 1Z0NA 3DMMD 2VN4A 4OQTA 4U2YA 5C08A 4YBLC 2Q8BH 3VFSB 2OK0H 1CLZL 2VKWA 4L1DA 3ARUA 3KLAA 5CEZD 1E27B 2HTLD 3HTLX 1MWAA 3GHEL 3QP3A 4XPTH 4ETQB 4BQ9A 5I6XB 3WNMA 5HYQB 2Z91A 5D2NE 5HTSA 3KHQA 3S5LA 1CFTA 4K9EC 3ULUL 1M7DA 4M5YL 2JJVA 3GSQB 5FOJA 4UNTA 4OZFB 4F9PC 3SKUD 1IGMH 3WE6A 1IM9B 1RZIA 4NKDA 3BHBA 4WW2F 3H9SA 4X99A 4JFQA 4U1LA 3HRZB 3P11H 3MCKB 3TYGH 1F2XK 1QFWH 4XCNA 1T7VA 4RGMC 3FQRB 3ULVD 2PKDA 3ROOA 1CGUA 5IJKA 4N0FB 1XH3B 5DSCA 3VXRA 5IIEA 4S1RH 1P4LA 3OKMA 3GJEB 3JTSB 4UOW0 3O8XB 4QGYA 3MACH 2YXMA 4PFEA 3FFCE 3LSOA 1T04A 4I0PC 3ZO0A 2AI0H 5AAWA 3KPSB 5AAMA 1YDPA 4POUB 5I1CH 4YR6A 4AEIH 1HZHL 1V7MH 2EH7L 3QO1A 3O6FC 1HWGB 5SWSD 1JPTH 4HS8L 1J1OH 1BVKA 2EDBA 3X14A 5HDQL 4HDIB 2VUYA 2N4IA 3EYOA 4HT1L 2SEBB 1FBIH 4YXKH 4Z7VB 2FX9L 2VLKD 3V52H 1E6OL 1WCQA 2FB4H 1MHCA 1N3NA 4J6RL 3F7QA 1H8NA 1KPUB 3TBVA 1M1SA 4NRXB 4PRDB 1IFHH 1I9JL 3IAPA 2CDEA 2FZ3A 4HWZA 5C8JA 4LHJB 4I2XE 4PLKD 1RUMH 2FCBA 1RZFL 2NXZB 5D7SL 2M1KA 4K55A 4ZS6C 5JUEL 1Z2KA 4L5FH 1MHEB 1EGJL 4M7LL 4JFHE 1GIGH 3X3GL 1GYAA 2BSSB 5JXAH 5I8CA 3MYJB 5IVXA 5DRXB 4PD4J 1LO2H 1CLZH 3SDXB 2XG4A 5CEZH 3MR9A 4IHOB 2GK0B 1FC2D 2FATL 3KHOA 1RVFL 3HE7C 4XPTL 4DK6A 5C0JB 4JO1H 3VI4E 3HZYB 1PYWB 2F74B 3OKYA 5FHAH 2FGWH 1NCUA 3BDXA 3N85L 1OB1A 3JWDH 2XA8H 2NPLX 1JNLH 4X6CA 4PV8A 1G9MC 4X4ME 3QJFA 5C08D 3I84A 3K8MA 1SJHB 3V95A 3FT2B 4Z7QF 4CADA 3EO1A 4CMHC 3FCTA 5DMJB 1MY5A 1Q9LB 3L5JA 2CR6A 3WLBA 5BVJA 2H32H 5C9JB 1IGIH 3BZ4B 4OTXL 3STBA 3GKWL 4NN7B 1YMHA 4PY8I 2X89A 3EKCA 4UUJA 3VA2C 3DV6A 1R3KB 3VU2A 5EZLB 2Q6WB 3WIFB 3RKDD 1CFBA 4IDJH 3QI9C 3NCJL 3ZYIA 4F57L 3KNBB 4U6HB 1FH5L 2WUCL 1WJ3A 4KDTC 3ZDZF 5F7LB 4AEIL 3NIFF 4BK4A 1BBDL 3ARDA 4RRPG 4HXAL 4V1DD 1FRGH 5IT2L 3JWOH 1UXWB 1TCRA 4NQSA 3W2DL 4LP5A 4U7KA 1J0KA 3JSSA 3RVUC 4JDTL 1H5BB 2DJ4A 2LFGA 3H0TB 3AFLA 4I18B 4IJ3C 4PRNA 5E5RB 2QHLA 1I9RH 5D6CB 3WSQL 5IR1B 2CKBL 1ZV5A 2NXZD 1K4CB 1HQRB 4PJDE 2WWMC 2R1WA 1JPFB 4P3DA 5ID0A 3TEUA 3DURA 1QD0A 1OQXA 2ENSA 1FNSL 1QFOA 4I0CC 2AEPL 4JG1L 4X7TA 3V2AR 3V5DA 1CXFA 4XPGH 4A6YB 1ZA6A 3LS4L 2Y23A 5C07A 5JUEH 4EQ3A 3P4NA 4FFWD 3SY0B 4U3HA 5AUMB 1I1AB 4N1CA 4WEBH 4YIQB 4FABL 1KENH 3MRQA 5EBWB 3VRLE 5IHZA 3MV8E 4XVTH 3BGFC 3AS3A 1RZKL 1LO2L 5E1HB 5F93C 1JJUA 1MIEL 4QEGA 3UTSB 3MBEC 1JUFB 4NNPH 4JFFA 3FT3A 4PP1D 1YNTB 2A9NL 4LCWB 4O2CA 5D7IB 3BP4A 4JO1L 2V9TA 4E5XB 4MA3A 4Z8FL 3LH2H 3L3IB 4XMKL 2BHUA 2XA8L 5I18H 1IL1B 4EN3B 3BW9B 3U7AA 2RHEA 5F9WB 1KTKE 4PGJA 5MEPB 4JRYB 5F9DC 4GRWE 4FFVC 4NQCB 1SEQL 3O6KH 5GSVA 3O41A 4CVZA 2A6DA 3VFGH 4N9OB 4JQIL 2NNAB 5D7JB 1VACB 3RVUD 1G6RA 1SEBA 4HUNB 4OV5A 5D71L 4OBSA 3WHE1 2EKJA 2ZKHL 2EYSA 5E94B 1U3HB 5DO2D 2MHAA 4GBXD 3ELAT 1JIBA 4I5BA 5MEOB 4H8WC 3HS0A 1LDSA 5GQBA 4NYLA 1SM3H 1CBVH 4IDJL 1HNGA 1QACA 1RJLB 1CGYA 4GG6A 1ORSB 4HH8A 4LF3B 1MIMH 1OGAD 2VERN 5T1MB 5IKCA 3S4SB 3QYCA 4OQ1A 4G8GB 2JJSA 2EYRB 3TWCH 1T7ZA 4OFPA 2X5PA 1IKFH 4OKVB 4JDTH 1A1MB 3NZ8A 1NBVH 2X4UA 2ED7A 1GZPB 3WD5H 2DQUL 3DXAA 1NAMH 1RQ5A 2WLYA 1UENA 1IGCL 1CR9H 5DD6A 1EIBA 4HUXA 3QDMB 4X4XA 2C5DC 2EIDA 3FJTA 1MI5D 5KN5A 4R2GB 2CUIA 2OTWB 3BEVA 3FB7B 3QUYB 3E6HA 5DUBB 5D7LE 4N90E 2JB6A 2NY4C 4QHUA 4NNXB 3WL9A 2X4RB 1S5HB 3BT2H 3VWKC 1C08B 3MXVL 3F5WA 4JZOB 1WSST 4J4PC 2AW2A 4FQXD 3KDMA 4I3RL 5DJYA 3DTXA 1G7HB 5JHDB 4HK3J 4ZUSA 1R3JB 2OCFD 5TPWH 1FZMA 3OJ2C 1NMBL 4QY8B 1X5YA 1XF4B 3HAEA 4PG2C 4YZFE 5L2KB 4Y4HC 3ZE0F 1J1PL 2H2PC 1FGVH 4ZS6D 43CAB 1NUFA 2AXGB 1SMOA 2W91A 4JY5H 3SE8H 3QG7L 5KJRH 2ZJSH 1YEDB 4XVJL 4XI5D 1UA6H 3S5LB 3SE9L 3P9MA 1IC5L 1IC7H 1CN4A 3DO7B 5HPOA 4LQ1A 2EH8H 2YZ1A 3EYVA 4LK4A 1X5HA 2DMBA 2WW8A 5DQJB 3VXSA 4XP4H 5EU4A 2P46B 1IE5A 3BPNB 1CYGA 1T7YA 3CJJA 2DMCA 1CGVA 4Q6IB 3BO8A 5GS0D 1G84A 1MIML 3SKJH 1WFOA 3MRCB 3S3JA 3AGVA 2V17H 3LOWA 4FQXB 1J5OL 3GSRB 4NC1E 4F58H 3GMOA 4OFVA 3BKML 3TLRA 1T5XA 3D48R 4XXCC 1TTFA 3E6FB 4HKZB 1RIVH 2BHYA 4R2GD 4HWBA 4HK0A 5DVMA 4XC1H 3GK8H 1CIDA 4LGPB 5CLTA 1QBBA 3V4VH 3MO1B 5JHLL 3W9DA 3MJ9L 3QXAA 4RZCB 4U6XA 3RIAF 1K85A 1A6ZB 4OM1L 4YGVA 1AGFA 4R4BB 3NCBB 1QO3B 4X4XB 3WKML 2DQHH 3NH7L 5E2VL 1CDYA 1HHKA 2E8YA 4UT6L 4NQCE 3L5WA 2PYFB 2LU7A 4YHOL 1MAJA 2I27N 4PJXB 4FZEL 4TRPH 1QFUH 2OBGA 1X6LA 2VAAA 4WHTB 1E4JA 3KLDA 4WFFE 3QEGL 5CILL 5CJ5A 4HEPG 5B4MC 2DWDA 3N1GC 2D9QB 2AJUH 4NO2A 4WI5A 5KVMC 2AP2A 3A6BH 3GEWB 4JY5L 2ZJSL 1YNKL 1FG2A 2XZCL 2IALB 3O11B 1NL0H 5KSBA 1S9XB 4A6YL 2JJTA 4JCMA 4KAQL 2BVUA 4J3TA 3WXWH 4TPRH 2OSLA 4LHUG 3RX5A 4EN3D 3WNPA 4JKKA 4G7VH 5GGRB 2VDKH 3EO1B 3TCLA 3FCTB 2BVTA 3VXNA 4KJQC 1IAIL 1TETL 4GG6E 2OYPA 4EOWH 3PWPB 3G6JE 3P9MB 3EYFB 3QXDA 5DEFA 2B4CL 3SDDC 3VW3L 2LQRA 3HB3C 3VCLB 5IWLC 3T0XA 3NABL 4MJIA 5IB3A 5K9KA 4ODXB 3HI5L 3IJYB 3EJZD 3ARED 3GI8L 3SDAD 3L3KA 1YNTA 3F7YA 4LPXA 3RZCA 2WBWB 4HS3B 5E03A 3FOMA 1WEJH 1WTLA 2DQFB 5J6GB 1AKJA 4HFWB 4YDVA 3GB7B 5HGBB 3LMJH 5TH2A 1NCAH 5JHLH 5DJ2A 1T0MA 1AI1L 4ZFFA 5FKPA 3CH1B 1UYWH 2IAND 2R1WB 4U1NA 1LK3L 2PCPA 4Y5VA 1S7QB 4PTTA 4K3EH 5DTFB 4X7TB 4GKSA 3WN5B 4MXQC 1TVHB 1OAQH 2NQCA 3ARFA 5C7XH 2R2HA 4ZUUA 2VLKA 5HHXL 2R2BA 2YRLA 1DDHA 4X8JA 1KXVC 3QIUD 2PW2A 2QSCL 1J12A 2COQA 4Z7VA 5HYJD 5JW5A 4QRSA 3KPQB 3D25A 3HS0B 3O3AB 5T3XE 4OZIB 4NUGH 5C0AA 1MCDA 4U1MB 1D5ZA 2H6PB 3QEUB 3NACH 3N1PC 2AQ3A 5E99L 3CC5B 3VXPB 3PIQA 4JO3H 4HKXB 4P2OC 1DANU 3U6RA 2F54E 3HI6L 1G7IA 3FQTA 1QLRA 1JK8B 1GZQA 2KBGA 4LCCC 4OF3A 5EU6D 5HI5D 5C0AD 3T1WA 4H1LA 4KI5E 3P9LB 5F6HJ 3T77A 3TIDA 4WUKH 3DARA 1NCBL 3WIFA 4RWYL 3I6KB 4Y2DA 3BIAX 3VGDA 1A3RL 4D9RD 1HZHH 1V7ML 2Y1VA 1EJOH 4QXWA 3QUML 1JWMA 3BRGC 5E94A 2IPKA 2P5WA 4X6CB 1T6VN 3UTPD 5D1QC 2MFNA 4WTZG 4UT9H 3V0VA 2WWMD 1I7TB 1S9XA 4LSSH 1A1OA 2WNGA 5IQ9B 2E8ZA 5EO9B 3HI5H 3FT2A 5DI8A 2W9LA 1YUHA 3OKLB 1BAFH 2NY0D 4I0PD 1AKJD 3EFDH 3CX5J 4GRLA 4B7IA 2PR4L 1W0VA 5EU6B 4OB5H 1EGJH 1OB1B 1I7ZB 3R1GH 1GGIH 1CE1L 2HJFA 4YHZL 3L7FA 4XP6L 3CSBA 1NMCB 3TYFA 4GMTL 4GBXA 4E41D 2QADD 3QZWB 3RUGF 4GSDL 4UV4L 1UYWL 3LSOB 4M48H 1KUMA 3RY4A 1JZ3A 1II4E 4LCIH 2VZ1A 1U8OB 4HPYL 2R69L 3P0GB 2FR4B 2X1PA 5F7UA 4LRNH 4PBVC 5KN5B 5TF0A 5FHAL 4P59H 4MLIA 3G9VA 3IDXH 4ZD3L 5IWLA 5KVDL 1NUDA 1F6LL 4HFWA 1D5MA 1NGQL 2Y06H 2AV7A 4Y4KB 1OTSD 5EZLA 5I71C 3D0LA 5IR1A 3T65A 4NCC1 3PWJB 3W5MA 5KSAD 4BSVA 5F3HB 1A21A 5CIPB 4DVRH 4PJCE 4HMCA 4G9DA 3VD7A 4YPGB 4WI7A 2G75B 3MLWH 3OBAA 5C0IB 1K2DA 2QR0A 1PX4A 4RGOL 2VZSA 3K4DA 5DHVB 1AGDA 3D6GA 4D2NA 4F2MA 2C9AA 4MCYB 4DZBA 1U91B 2BNUA 5GRVL 2J12B 3BP6B 1UJ3A 4JDZA 5GJTH 4ESKA 2OJZH 3Q5TA 1LD9A 1W0WB 1FFPA 3KYOB 5J6HA 1R0AL 1JPST 5IBTH 2FSEA 3EJYD 1KIPA 3UPAA 4UT7L 4EIGB 5C0FB 1FRGL 4HLZH 4N5UA 1QRKA 3EYSL 4NKOB 5T3ZH 5E00B 1AD9B 1G7IB 3FQTB 2B39A 2EO9A 3ILPA 1MFAL 1G0DA 1G7JA 4M00A 5A16B 5I75C 3N9GH 5B38B 2XICA 3H42H 3K1DA 4V1DA 1U58B 1I1RA 2HFEB 2ITCA 1XF3B 2GYSA 3QFJE 4OI7A 2RFXB 1BJMA 1XGUB 1Y6KR 3GZKA 2P45B 3Q6FA 3INUH 1MLBB 5E2UH 4RAHA 3QULA 4YHZH 4IM8A 3BDYL 3VI4F 1EV2E 4X6DF 4GO6B 4GSDH 1ZLUH 3WFCH 3GBML 5L2KE 1GAFH 2GK0A 2QQQA 2D03L 4N8CH 1ONQB 1GOHA 3TNMB 4H0HB 3EAKA 1C5BH 3SJVD 4FQ1L 4P59L 4A2LA 3D85D 3RA7H 1FVDB 4Z8FH 1F5WA 5D9SB 4AL8H 2G5BB 3IDIB 3BZDA 1VGEH 3MV11 4YZFF 5C08E 1BF2A 2R0LH 3NIGE 5EH1A 2OX5A 3QZWA 5AD0A 4WO4B 5J4MA 3F6LA 3B8SA 4HZLB 4TUJA 3H9HB 3I6LE 5C09A 5BV7B 1FLRH 5DVLA 3KS0J 1PJ9A 1CFNA 2R9HC 1U8NB 4NFCA 3KPSE 2AGJH 1R5IA 2AJSH 4O58H 5E5MA 3DWTA 4JKPL 2J6EL 3T3ME 3PP3H 1MCPL 3MV01 4PRPE 4QHUB 1PKQB 3JVGC 4KJWD 5EUOA 3EW3B 2Q6WA 4LNVA 3GJFK 5I6XC 5JMOC 4LPTA 1B2WL 3CMOL 1FYTD 1DFBL 1TQBB 2VLRD 5ACZB 3W39B 2EICA 4UDUB 5MP6H 3OJDB 4JR9H 1R0AH 1N6VA 4XHJC 3SQOH 1J1OL 4EDWH 3MNWB 5IB1B 3SDCC 2XNAA 5DZOA 4XRCB 5TE6H 4ZYKB 1BVZA 2X4PB 3QDJD 2Z8SA 3GSWB 4XNYH 5GGRA 2AJVL 3GMPA 1T03L 4FQJH 4LSDA 3OKNA 3U48A 1BOGA 4R90L 5F6IB 3F65A 4U2ZA 5SWSE 1T66D 2YPLA 3QHFL 1MRDH 4MB4A 1LO0L 2BXZA 3INUL 1E4XI 4X8XA 1HKFA 1IQWL 1XAUA 1P7HL 2WP3T 5EFIB 4G6AC 4ZFZA 5JXAL 4K3JH 3RFZC 4NC0B 4U1HB 4N0YL 3FQNB 1F8TL 1KGCE 4LFHG 1UG9A 1T7WA 4K9EL 2D03H 4KJPD 3DJ9A 3QEUA 2EIZB 5L0QB 1HI6A 3VXOB 5D7IA 2NR6D 3OF6A 1HHKB 3N85H 4WUUB 3MRPA 3QIBD 3C5ZA 4WV1C 1C7TA 3I9GH 3O45B 3CFIC 4TVPH 3B9KD 3CX2A 1QLFB 1UB6A 2ICES 5IW6A 3OV6A 4NJ9H 4JFEB 3DETC 1XIWD 4R3SA 2EC9U 4S2SA 4M1CD 4P5TD 4JPVL 1XCTB 1TQCB 5IB2A 1KNOB 4L9DA 3IETB 1UA6L 3GBNH 1HXYB 1IRAY 3OQ3B 2EDXA 3WEXB 2XWTA 2JB6B 4TSBH 2E9JA 3QNYA 1W8OA 3KPMB 1JZ6A 3IJSB 1KEMH 5D1QD 4HKZA 1DFBH 1KTRL 1DN0B 2AK4D 4XAKD 3T1FA 4MWFB 1FE8H 1Q72L 2DQCL 1KPRA 3UJIL 1FAIL 4G6AD 3LEVH 3AVEA 5EU6A 4XMPL 2F5BL 5F1OB 2NY7L 3BVNA 4LOUD 3VFTB 5IFJB 4L8CB 2IADB 3DXAB 4CVXB 1LO5B 3NGBB 5MHSE 3ECBB 1JPGA 3MLXH 2B7DT 5FB8B 3FQXA 1WAAA 2VLLB 2GCYA 3HZVA 1FSKB 1JHLH 1AO7D 4LDEB 2DJSA 4J3OC 3CLEL 5D7LA 1EERB 1LO0H 1YEDA 3S36H 5EOQH 2OP4H 1I9EA 4YE4L 1B88A 3QXVA 3UTZA 2DD8L 3RPKA 3CFCL 5GRUH 3PG2A 3SDYL 2VDPH 3BE1H 3ZHDA 3RU8L 1UZ8A 5FYKD 4GFTB 4CN4A 3WXVL 3CVIL 1GGBH 4JZNB 2ED8A 4UTAH 1SVCP 4J1UA 4R0LB 1RURL 3WFEL 4IOIA 2P8PA 5A40E 1MRCL 3EOBB 3Q6GL 3A67L 4GW5A 5EU5B 6FABL 1F6AB 2QSVA 2X4NB 2B0SH 1AGCB 2X4TA 5F1NA 1GH7A 3O3AA 1QKZL 2DN7A 2P5EA 4B50A 1W72L 2WP3O 3BWAA 4F3FA 3HC3H 3BD3A 2BNQE 1ZKAA 3LQMA 3O4LE 3PDGA 4JPVH 4EI5A 3W5NA 5SWZB 5J6HB 4M7ZB 2XQYK 5A2LH 3B9DA 5E6IC 3MOBH 4TQEL 3FOLA 4NO5A 3U6RB 1BBJA 3SDAC 5EU3B 3O45A 5T5FL 1NL0L 3H9ZA 1P7QA 5SX5H 5FKPB 1NEUA 1T0NB 4OLUH 1KEGH 5F8QC 5IHLB 1INDH 3GSXB 3FN3A 5BRZB 1G0YR 4TN9A 4AQOA 1TETH 1WC7A 1OW0C 1DLHB 4QRQA 3PL6B 5K9OB 2DQFA 3L5IA 5C6WH 4AH2A 1N4XH 4OLYL 4QCIB 1MNUH 4JFPA 2VE6A 1CU4L 3NABH 3VXUD 4JFFE 4ZO6A 4ZUVA 3AB0B 1MFCL 4JDZB 4QHMA 1TENA 1LP9B 5LKNA 1IEBA 2KUTA 5C0BE 4ZOAA 1FFPB 2BNQB 3RWCB 3VD5A 4F7MB 1HOCA 3QCVL 4WU7B 1WEJL 5HGHA 2OP4L 1BMGA 2H3NB 4U1SB 1SVZA 5HVGB 4RBPK 3ARGB 2DD8H 1CDBA 2ORBH 4S11A 4GLRH 4OQTH 1X5IA 5A16A 3RGVC 3VFSA 3BT2L 2OSLB 5TE7L 4NC2B 1NC4D 3DVIA 5DUMH 1PVHA 1OD7A 4OSUL 4XHJD 5JTWA 1PG7X 1PG7L 1S9WA 4FTVA 2NY3D 4YHML 3OSKA 2YC1B 1RURH 3OZ9L 3S37X 3TF7C 5JDSA 3NA4A 4RGND 4LVOC 4R26L 5C6TL 3HN3A 1KBGL 5TGBB 1PX3A 1YEGH 4H1LB 2X42A 2G5RA 5KAQF 3D2UB 5IG7B 4E41E 5F3BA 2DJUA 3K80A 5M94B 4KRPD 3RWFA 2VLJE 1W72H 3W39A 4X9FA 2QQKH 3IT8D 4H1LG 4BFIB 1Y18A 4HIIA 4M1DL 3KLSA 2HJFB 4OFYD 2AJXH 1F3RB 1IBGH 3V6ZB 3TYFB 3HZMA 3RY5A 5J7CC 4TULH 1NQBA 5HHOA 4QF1A 4WUKL 4ZFFB 2PXYB 3G6DH 1XF2A 4KKNA 1QFWI 3U4EA 1YDPB 4X7DC 4APQA 1BGXH 4X6CE 1NGZB 4B53A 1QEWB 3IFOB 4P2QE 2JK5A 3IU3B 2HP4A 3U9UB 2DAVA 3SCMD 2QHRH 4HDIA 4Y4KA 2BVPA 2HT2C 2RB8A 4JHBA 3QIBB 3BSZH 3LZFH 1KOAA 3WIHH 5F88B 2NY1C 4NNYB 2O93L 5FO9B 2QJDA 4JQXC 4Z0XB 3ZYOA 4FP8L 4ODTL 5IVXE 4EVNB 4MMZC 1FNHA 1FZJA 4XC1L 1UKQA 2BRRH 5C0NC 4FA8A 5DHVA 1NLBH 3P4OA 3QULB 2VDML 1JZ5A 4GAJH 4PRHA 3BPLB 3TA3B 1WV7T 5SX4I 2BSTA 3GMPB 3V5KB 3ARBC 3KWWA 5CIPA 3W82A 1IEBB 1NBZA 3NMEA 2E5EA 4L8SC 5DDHA 1KC5L 4NKIL 2B2XH 4HS6A 4JGUA 2PW2B 5JW5B 4ODSH 1U92A 1QFUL 4TRPL 2P5WB 4QRUA 2XI9A 3D25B 4C59B 5I30H 4PLJC 1OSZA 4ORZC 1LO4H 3OAUL 1JNHA 2BZDA 4JM2A 5D2LF 1DN2A 5DJDA 4WCYH 1RU9L 4WO4A 3IJSA 3JUZA 4X9GA 1CXHA 1L9NA 3A6BL 3OAYK 2IG2L 4HJGA 4TUOA 5E9DE 4RISH 5LQBL 5GS3A 2Z4QA 1OARL 3CDCA 5CEYA 2AJXL 3SKOB 4KHTL 1HEZB 1KLGA 4UU9A 4WDIB 2OR9L 1WQVT 1SMAA 1KCVL 5JLZB 4LASH 3KGRA 4FQ2H 2FO4B 1IAIH 2EH7H 1KNOA 2IMMA 1OCWH 1EHLL 3KYAA 3MGTB 1IKNA 3THML 3QJHA 4YXKL 1C8PA 3GJFB 2AV7B 3VFUA 3ZLQC 2IAMA 2ADJB 2DKMA 3NCCB 2BC4B 5ACMA 4AEFA 1MJ8L 4J3WA 1H3VA 3MRHA 4NQEE 1D6EA 3H9HA 1RZ7H 2FH6A 3TN0B 3EZJB 2RJMA 1L9MA 4XT1C 1CICA 1EHXA 1RHHA 4L4VB 4PJHE 1YMHB 4J3XA 4XPHL 1GIGL 4XI5C 2A0LC 1TXKA 2Q76A 1OSPL 3QQ4A 1CQYA 4HUKB 4DFHA 2X4TB 5CP3H 2GAZB 1S7RA 1CD9B 2FATH 3P73A 4K3DH 3FQWB 1WCBA 1OAQL 1QTYT 2HN7B 5FUCC 1IQDB 5IK3B 2HFFB 3PXHA 5E4IA 1BQLL 4XTRD 1SYVB 3TO2B 2V2XB 4PJGE 4P49A 5GRZA 5FAAA 4N8PA 4TNWK 5F7EL 3VH8A 5LGJA 1JMXA 1UJTA 3GJFH 5HYJE 2P48B 1UZ8B 4FQHB 1MHCB 4FQXC 3X13B 3F58L 4XCNB 5DMIH 5F7HA 5B8CC 1J1XL 3VXRD 5DURB 5EU7C 5BRZA 1HSBB 3LRHA 1ZXQA 1WC7B 1IGIL 2WANA 3SPVA 4QKXB 3IB4A 4JM4H 2BVQA 1OARH 4LKCB 1R3IL 1KG0A 4FXKA 4AJ0A 3VFNA 1KCVH 3RWEA 4LQFL 3SQBA 1U95B 4RGMB 4MNQE 2A74B 4LHQB 2GITB 2I5YH 4JKWA 3QCUL 4YDKH 5KSAB 1EJOL 2ARJA 1OAKH 4IEFB 4P2RB 4J7RA 4LVNC 5IOPA 5IT2H 1RUAH 4ZPTA 3LV3A 4D9RE 2GTZA 4PJ7B 3IXAB 4PP2A 1NFDB 2IH3B 4KJYB 4DTGH 3LQAH 1TJHL 4OLXH 2CLZA 4WI4A 1QRNB 1BX2A 3O4OC 3VMPA 3GIZH 4JG0H 3O4OB 4C57C 1LGVA 2VAJA 1BFVL 2HWZL 5ISZA 3VXTB 5C0EB 5ICXB 4KVCL 4FTVD 3LDBB 4QHKI 5ESAA 4FMFA 4XPGL 5BS0B 4XAKE 4KPHH 3C6LC 1OWWA 4HH9A 1NGWA 4ZQKB 2R0KH 1NC2A 5HGAA 3UTPE 3U36B 3IDJA 3ESUF 3U0PA 3W0WB 2VJXA 2X9YA 2ZCLH 4K3JL 4ENEC 4UUJB 3AMLA 1F3DJ 3O6FB 4UV4H 3BX7C 1MCOL 3P40A 4NNPL 5F9OH 1DUZB 4IDLA 3HRZA 3MCKA 4PYHA 2ADGB 2A9NH 4YGAB 5HDBE 5HYSB 4NQXB 3ULVE 3LEXA 4DGYL 2IAMC 2XXMB 4M9OA 1ZVSA 1P7KB 2WZPD 3ULUH 3T2QA 2G60L 4X6FB 2IADA 7FABL 5DRWB 1JZ7A 4NFDA 1QRNE 3HE6A 4ISVA 4XBEH 1R5VA 3TYGL 4Z78A 3BAEH 1E4WH 3T1FB 4L8SB 1RIHL 3S37L 4KKAC 3ROLA 1HK6A 3ALPA 1NGYA 3SCMC 2BVOA 1TMCB 3VMOA 5I1DB 3GUTB 1U8KB 3FOLB 2NY3B 4NO5B 1MOEA 4KXZI 4RDQG 4Y5YC 3QT2A 3RL2B 4MHHG 1NEZA 1KB5A 4KRLB 2E7BA 2AI0L 1TLKA 4HIXH 4AK1A 4CW1B 2P8LB 4I3SH 4GKZA 3DTXB 4IS6A 4PB9L 1FAIH 5T5NF 3P2TA 1RUAL 1JP5A 4M62L 3TWCL 2NY7H 2UY6A 5EN2A 3FO2A 2VC2L 5HVFB 4JFPB 3QIUC 2FB4L 1ZHKA 5CSBA 5GZOC 1CFQA 2ESVE 5DRZA 3ZDXE 4GQ9L 3PWLB 4WNQA 5L6YL 4RWHA 3S7GA 1JZ2A 4KVCH 3QO1B 1ZA6B 2NY6D 5D7SH 5FUCE 3TH2T 3RDTC 3HMXH 3CU1A 3VDCA 4KV5F 5EU5A 5FA4B 5CJBA 4ZFZB 3R06A 3BDYH 1LMKA 4DN3L 1N0XL 4OCRH 2Q20A 2E7LA 4NRXA 4PRDA 1WZKA 1ZT7B 4W4NA 2AJ3B 2MNUA 5F21B 1ORSA 4LF3A 1WBXB 1FZJB 4X80H 4LPVA 3BZ4A 4MAYD 2ADIA 4BSWB 3TIEB 3SDDA 1CXKA 4OKVA 4I8DA 1WIOA 3MYJA 3BW9A 3RX7A 2HRPH 2OS7A 5I76B 2B0SL 5AZEH 3EDKA 2DWDB 3GSXA 4EI5D 4HWBL 3KWWB 1GSMA 3O41B 3MRMA 5I75B 3TZVC 1VACA 2OLDA 1B6UA 2F8XC 2E6QA 3MOBL 4TQEH 2M26A 3G5XB 3GKWH 1K5NB 5DJXA 5E56A 2D7TH 1XIWB 4P2RE 5GRJL 3NFNA 1DBBL 5D7LD 4WTWA 8FABA 3PQYB 4RZCA 4U6XB 5FGBA 4QHMB 4P3DB 5ID0B 2PYEA 3V6OC 4PJ8A 4P4RB 4YFLI 4P5MB 3FN0L 1CICB 2X05A 3ARGA 3WNLA 3STZB 3DROA 3ECBA 2BK8A 1B4JH 1I9RL 3PHQB 3CFEA 1HYSD 3KLAB 4YDLB 4MDJA 1KJ2L 1NCDH 5E8DL 1KB5B 4M8QB 4OT1L 4EUPB 4N0CC 2F58H 1C5CL 5ANME 3RZCB 5TF1H 2LAGB 1JNJA 1MFEL 2NY5C 1IT9H 3B5HA 3MGTA 4WGWB 1WZ1L 2XRAL 3KVQA 2J4WL 4PJXF 4KRMB 5D6CA 3V4VL 3MRJA 1QG3A 1F8TH 4J3SA 4PGCA 2DQTH 1IAKA 1FN4B 5TE7H 5F3BB 5DURD 5IV2A 1A02N 4Q9QH 3VXSB 1TZHA 1DP0A 1JWSB 1FIEA 1YYML 4AYFA 4XGZA 5E1AB 5GGSB 5IB5A 1QBLL 1H5BC 4O4YL 3MLZL 3F62A 4F9LC 3CFDA 5ETUA 1W8NA 2W92A 4PLJD 4XMKH 2MHAB 4FFYH 3BD4A 1KBGH 2C1OB 1DBKH 1CXEA 1PDKA 2XN9E 4MQ7B 3IGAA 3RWGB 3QEGH 4M93C 3D69A 2IQAB 2YD7A 3VFNB 5MEND 4OZHE 2JIXA 3L3GB 4JM2B 5DJDB 4WW1A 3UAJC 3TH4T 4S1DC 1LE5A 4JVUA 3WO4C 3HR5A 2QQKL 4NRYB 4NRZA 3GGWA 1MRFH 3BH9A 3MV7A 1KTLB 4URTB 1F4YH 1JTTA 4PRBA 5D2LA 5EC1A 4D0BB 1IBGL 4H1LH 4X98A 1W72B 1IEHA 2VWEC 4WI2A 2EIEA 1JCKA 2EDNA 3JTTA 3OKOA 3WJJC 2YS4A 1GGYA 4LLDA 1NCCH 2GI7A 1F90L 4N0UA 2FZ3B 2DRUA 3QDJA 4MA7L 4XMPH 3WUZA 1EAPA 2YBRB 4BFEA 1IKFL 3FRUA 4KI1A 2LU4A 3U0PB 3MLVH 3VFUB 2CUMA 3WD5L 1U8PB 1K6QL 1P4IH 4J12A 3OG4B 4PY7A 1CF8H 2ZUVA 1UH3A 3C09C 4G43A 1VFOA 4JY6B 4OM0L 3UZQA 2Y5TB 2GITA 2I24N 4FP8H 3IKCA 3VGBA 4HJGB 4U33A 5F9JB 2OL3L 4Q6YA 5TF1L 4MX7B 4OF6A 4YE4H 4U0QB 4PRPD 1FZKB 5DYOB 3SOBH 2P24B 1MFBH 2ZUYA 2H2SC 2R4SH 5DD5H 2RR3A 1Q0XL 3HZMB 4Q9RH 2VXSH 4RX4A 1RFDH 3K46A 3VFVB 5DGQA 5DD6B 5E8PB 1DSFH 1GGBL 4JFZL 2DQJL 4OZ4B 3O3EA 2XWBB 1ED3B 2B2XL 4FXLA 3BKJH 5C0ND 1UB5B 3AC0A 4OF7A 3J7HA 3OB0K 4G8GD 5DFVC 1G7PA 3HMXA 4D8PA 3T0EC 1EHAA 1W0YT 2VZTA 2GY7B 5E4EB 3SE8L 2ICEA 1QA9B 5CGTA 3RTQD 3T0WA 4BFGA 4YAQB 3QDME 3OJVC 4PJ7E 4G42B 2H9GA 2CKBA 1F4YL 2KQNA 2E9WA 4DGIH 3QXWA 4BZ1H 2YK1L 2YSSB 4PJHF 4X6CF 3GMLB 3D69B 1U8HB 2DYPA 1F90H 5C3TA 4MD5B 1OP5K 5TFSL 1CFSB 2Q8AL 1WCBB 5DTFA 5D93C 2FIKB 2AABL 3MA9H 1A3RH 3CC5A 4XBPA 5DR5L 3G5ZB 2ZG3A 4PLOB 3VXPA 5FKAA 1UWXH 3MLSL 3P4NB 5I1AA 3THMH 3WFZA 2W0PA 5E8NB 2ITDA 3D1MC 2VSDA 1NCNA 3MLVL 5GSRA 1KFAH 2XTJC 4XVSH 2ATKA 4IRSB 2RCSL 3C8KA 3E2HB 5E2TH 5KOVC 2YN3A 1IGTB 4LSUL 2M2DA 5MERA 3OKEA 1QO3A 4M93B 5KS9E 5I16B 4KH2A 2EXYD 4GXUN 1NFKA 3D85A 2VDQH 5JORA 5JPNB 2JJWA 3WJJA 1JE6A 3SOBL 3BP5B 5CEYB 5DHYB 4MCYA 5FYJU 1JK8A 1WWBX 2R4SL 4M7ZC 5DD5L 5DJ8B 2Q8BL 5DJ2B 3A6CL 4KQ4L 5FYJH 3MJ9H 3VH8G 3BZFA 2HLAA 4UQ3B 3SN6N 1XGYL 4HIHA 3BMWA 4ONHA 4HGMA 3IJHB 4O5LL 3NFPB 4LRNL 1XCQA 5EOTB 1A4KB 3BKYH 1P5VA 1AQDA 5I8KL 4K8RH 4G6FD 2DM3A 4LKCA 1I7ZA 1ZT1A 1NAMB 3KPQA 4X0KA 1KTDA 2IANA 4WWKC 1MCJA 3V6FB 1V7NH 2DLHA 4R97B 1LNUA 3MBEA 5DRNB 3CUPA 5J13B 4LKXB 3O3BA 3QUYC 1E27A 4M6NL 2FR4A 4Y2DD 3AY4C 1NCTA 1FFOA 4K07A 2EDHA 3C5SB 5DK2A 1PSKL 4HCRA 2YUVA 3LKRB 4LCUA 4RGOH 3SKOA 3TO4D 4BKLA 4BZ1L 15C8L 4IRJD 4V2CB 1LHZA 1ZHNA 5IEKA 3QDGA 4G9FA 4TULL 3GI9H 5ENWB 2VRAA 3CVHH 4E41B 4Y2DB 2VXTL 2VDKL 4HAFA 3P73B 2ZNWA 1FNGB 3F7YB 2OJEA 4NKMA 4Y19E 3HCVA 2K7PA 5E08L 2FD6H 4WGVB 3KXFA 2X41A 3FHQA 3MJ6A 1SYVA 3TO2A 1IC1A 4HT1H 4ZAKC 4DTGL 3VW3H 2YD8A 1E6OH 2X1OA 4WHYH 1OTTD 1DVFB 4FNLH 5DD3L 5EU7E 2HFGL 4Z95H 3V5HB 2LTQC 2X44D 1YECH 1CXIA 2F54B 1T1XB 1MFDH 3JV4A 2DBJA 1UGNA 5C0GB 2FNBA 4LSUH 1FL3B 1G7LA 1GPOL 1SYSA 2E9BA 2FIKA 3FB6A 4PJ5D 4KY1L 2F53A 4KPHL 1R5IB 3HG1A 3IFPB 4HQQL 4ZS7L 2VB5A 4M7LH 4P2QB 5C0IA 1DDHB 3D0VA 1AD9A 3X3GH 2OQJA 4MXVF 2VDMH 1A1NB 3RL2A 3A6CH 1QUNA 1P4BL 1N2RB 3WFCL 5L7XL 2F9BT 5DS8B 1A64A 4HGWA 1MJJA 4U6YA 4K3EL 1P1ZA 2RIKA 3ROLB 4K7PL 1MJUH 1A7NH 1B3JA 2AAVA 1VERA 1JI2A 4KMQA 1E4XH 4KVNH 1HHGA 1D5MB 1TZGL 2Q86A 4P5KA 2OTUA 2J88H 1KCKA 3UBXG 1IKNC 5HHVL 2VTFA 3OMZA 4LLMB 2HKFL 2FJHB 5SWQB 4LLUB 1JHTB 1IEAA 2FBJH 3B2UD 3PWUB 2VDLH 5HI4C 4ELME 3QIUB 5HYJB 5M7QA 1X5GA 5HGDB 3S37H 1GJIA 2ADFH 4O02H 3TPUB 3RGVB 1PSKH 5IHUL 1B0RB 5IBLD 3SGEI 4YFLF 4PTUA 4U1GB 2C1OA 1AGEA 2AKRB 1MCPH 3ZKXC 4P2OA 2OR9H 4YX2L 1WIPA 3RKDC 1LDPL 4XH2B 1A2YA 1UH2A 1HHIB 3O4LD 4RWYH 5I73C 1LNUB 5DRNA 5DI8B 3EO0A 2R1YB 4PJBE 1I9IH 5DWUL 5BOZG 3HR5B 1NC4A 1BBDH 1MCLA 4MWFA 5E08H 2HT4D 3MPCA 3BOVA 3MGOB 5IVNA 1FVCB 4CGTA 3UBXA 2EE2A 1MQKH 3BQUD 4HIEB 1N5YL 4X98B 1AXTH 2E7HA 4WFGE 1MAMH 5BV7C 5TDPB 2BSRB 5GGUA 4P23C 1N8ZB 1A6ZA 4XNYL 4PJAA 3PUCA 3BWUC 5CKGA 5BW7A 1ZLUK 2DBLL 5BS0A 1WBXA 4YK4C 2D9CA 2PR4H 2BCKB 2BOCA 4XNZC 1CLOH 1CI5A 4PJXE 4N0UE 4CNIB 2UWEA 4KK6C 3ULVL 5L2JA 1AQKH 1YZZA 2BHZA 4LGSB 1Q0YL 3W11D 5FCUL 2HMID 4M4PA 4QRPA 4DN3H 3UJJH 3NIDF 5T1KD 1OP3H 4JRXA 3QFDA 1G7PB 3T3MF 5ADPH 4K3DL 4PJ8B 3IKCB 3VFPA 2CIKB 2YWYA 5IFHH 4ZODA 4A6YA 5GRWA 2F53B 2DI9A 1WIUA 2W38A 4QRPD 5DYOA 2CDFB 4Y1AA 3EOBA 3K4ZA 4KZDL 4Z7OF 4GW5B 4MS8C 5IW1B 5FDYA 2R2EA 3V7AG 1AR1C 1F6AA 1DL7L 1JPSH 5DEZA 3W9EB 3CFEB 5AD0B 4KTEL 43C9B 5AZEL 4XP1L 3OHXB 1U8QB 4UB0H 3F7PC 3RIFF 3LKPB 1R24A 5HI5C 1U6AH 4GG8A 2BERA 4KU1A 4MLSA 2NYYC 2Q3AA 4YHIA 4Z18A 5FGCB 5ICYA 1NFDF 1RD6A 4Y5YA 2GJ6E 5CEXB 2A73A 2HYMA 3DROB 1D9KC 3N0PB 4TSBL 2Y7QA 4O2EA 4ODXA 9CGTA 5DJZB 2R29H 3RY6C 4OCWL 2A6JA 4DN4L 4N0UB 4WI6A 3EFFB 4YBHA 2VR4A 3TBSB 4EEEA 3QDJB 1FE8L 1VDGA 3NVQA 3TNNA 4XCEB 1JGUH 2PO6A 3JV5A 1J05B 1DEEA 2PTUA 1CDHA 3M17B 2YPLD 1JN6B 1S5IH 2OTPA 1NAML 3MLXL 3KYMA 5DRXA 1U8HA 2DYPB 1RJZB 3S4SG 4RDQF 1V3MA 1CFSA 4XX1G 3TBYB 2UZIH 5FYKE 2WBJD 5SWZE 4LP4A 4ELMF 2F58L 1FV1B 5H94B 4QHNA 1MFEH 5IROA 3G08A 2CIIA 4X9HA 3MGOA 2PTVA 2GHWB 3V79C 3KJ6L 5HGHB 1Y6MR 4X6DA 3SKNA 2B1HH 3BI9X 4L8CA 5DC0A 1X4YA 4XCYA 3QIWA 1N3NB 4L8DB 3MTRA 2V2WB 3NFSH 1FNEA 4OIIH 3GMRB 5DEGA 1OTSC 5F9OL 1BFTA 3DUSB 1DN0A 3K3QA 4Y4FB 1QBLH 1F4XH 3RWHB 3DHJA 2MPAH 1H15A 2UWEE 4YEFA 2D7MA 5E7FA 3I75B 5DUBA 6FABH 1G7QA 3G5YA 5L2KD 3SDXA 2AEWA 4XBEL 3M8OL 4X5XB 4G43B 3QQNA 4LBEB 4PGBA 4JB9H 1AXSA 1WFTA 3JWDC 4QXGL 4M8QA 4Y16D 2PW1A 2O61B 5E70A 1UADC 3Q3GB 3OB0H 5ITBL 4O58L 2ZSVB 1I8LA 3UTZB 2L0DA 1BP3B 1KN4H 3MOAH 3QNZA 2R2EB 3WLWC 3N1FC 3DSFH 3ZTNL 3RVXC 4AT6B 1OL0A 2O5XH 4L4TD 5EB9A 2Y5TA 3MUHL 1Y6NR 3B5TA 2KL6A 4G8GE 5GJSH 1ACZA 4B0MM 1JYVA 5ADOH 1L4IA 3FB6B 5HYEA 7CGTA 4QHKJ 3HG1B 3IFPA 4LMQI 3QI9D 3LS5H 1N4XL 1H0DB 4G8FA 1MUJA 4UOJA 5TE6L 5CIPH 3DOSA 3HPJA 2RQ8A 5C0CE 2ERJB 1ND0B 1CF8L 2BVEA 4GQ9H 2FJGA 1JUFA 1MFCH 3O9WD 4FQIL 1VSCA 2UY7A 5I74B 3QI9A 1U41A 5HYQA 1BLNA 4KK5D 3RY6A 3HMXL 3BH9B 1LQSR 3H3PH 3RNKA 1N64H 4K7PY 2ORBL 3IDYB 1KJVA 1HSAA 1Q0XH 3DGCR 3H9SB 3NFSL 1M4KA 4LVNB 4TVPE 2BP3A 4ODUA 4LSTL 1VPOH 25C8L 1J10A 5K59F 4P4KB 2A77L 3WKMH 4CRPA 1C5DA 2A6DB 4RGNE 2A6IA 1JFQH 4GAYA 5EZJB 1RZJL 2IMNA 4LMQE 1MVFA 1QBMH 1MCQA 2MPAL 3QFJD 2Y07L 3I9GL 3T2OA 4N8VG 1RZGA 3MNZA 3V8CA 1U91A 2K3TA 4JPKL 3B4NA 4ZOEA 1KTDB 5CILH 5GGQL 3NCYP 4APQC 1M7IA 2FECI 2DL2A 3KG5A 4ZTPH 2FHFA 4GS7B 3RJDA 4XP9H 4YR6B 2CK2A 5I16A 3BP4B 2QADB 5LJYH 3DI2B 1YNKH 3QWQB 1JGVL 1S8DB 1VCAA 2XZZA 3KXFE 2NLJA 1MHPH 4LCWD 1DBML 12E8H 5FV1L 5I8CB 5J9PB 1CVSC 4XWGH 3DMMC 5I1EL 4JFEA 2CRYA 3G6DL 1A6UL 2OR8A 4Y4HA 2Y6SD 2VZUA 3MXWL 3RQ3A 2VL4A 2Y36L 4P2QD 1BGXL 2YC1A 2R4RL 3MLSH 3EO9L 2F5BH 5EBMA 5E6YA 4FRWA 4PPTA 4QRUB 5IMLA 1JNHB 2P43B 4NKDB 1Y0LA 3LRSA 3VFMA 1AHWB 3KLHD 4CADB 5E8DH 2VXQL 2FJFB 2W60B 3C6SA 5E9DB 1AGBB 5LG1A 4X4ZA 2IWGA 4XXDA 4QTIH 4ERSL 2DLEA 2J5LB 4J4PA 4XZUB 2W59A 3VXQA 1DEDA 3I02A 3WMSA 1L6ZA 3CFCH 4NHCL 1ZHNB 3LMJL 2WIIB 5BXFA 2FDBP 5L9DL 5DK0A 1BQSA 5E7BA 1JTOA 5HYFA 4UTAL 2OXGA 3HCVB 3H7BB 5SWSB 3MLZH 1QBML 4GRWB 5I8KH 1ERNA 1SHMA 5JPMB 3L3IA 2QSCH 2ADJA 3PV6A 2X09A 3MYZA 4FXGB 2C1PB 4OV6F 1YY9D 4PJCB 4OD2A 3ZKXB 4WCYL 3TGXA 4ZAKB 5D70L 1RIUH 3CZJA 1CFVL 1F58L 3EYQC 3NGBC 1ZGLB 5CJXC 3FO9B 1KN2H 1KT2B 5BV7H 5E8EA 4ZUSB 4J8RA 2EDTA 5TE4L 3OKMB 2X2YA 4LLAA 2AK1L 3D0VB 1EO5A 1WFUA 2XN9B 4TNVF 4LAQH 5JW3L 2VITA 1AGCA 3HC4L 3CVHL 4IRZH 1KJ3L 4OLUL 1JPFA 3QAZB 2EC9T 4PJHA 2E3VA 3MX0A 3TBTB 5H2BB 1I85C 3NFPA 4ZXBB 3N1QC 5KVGL 2J8UB 4MA7H 3EO9H 4JPIB 4IRJA 3EOTL 1CLCA 1HH6B 1BF8A 4I48A 1OW0A 2H8PA 5GSRB 1NDGB 4KUCD 4ZFGL 3MNVA 1UM4H 2B5IB 3ORJA 1FNEB 4OM0H 5J1TC 3CXDH 1KPVA 3CUPB 5LXGH 1FAKT 3FHAA 3I6KA 1J8HE 1VFAA 5E5UB 1JYWA 1PD6A 3V9FA 1PLGH 3PF2A 4QTIL 3C5ZB 3TV3L 2C3WA 3R1GL 4KGLA 3V4PH 2DQEH 1IILE 5BJTB 3IVKB 1T22A 3MLTA 4XP6H 3TCXA 3ZKND 1AJ7H 3WFHB 2VABA 1BQUA 1PW3A 3MRGA 4HUVA 1A8JH 1DSFL 4WENB 2R1YA 1C12A 3CFBB 4HPYH 4XXCA 1PG7H 2DQJH 2HT3D 5E9DA 3TP4A 1XCTA 2AXJA 2V9RA 3QA3B 4F7MA 4K7PH 4XXDB 3WV0A 3QZWG 3UTTA 4HEME 4ZUTA 1ZT1B 4KMLB 4M5YH 4NZTL 3GJFA 1HCFX 2DDQH 2ZUUA 1XF4A 3QUXA 3F58H 3UTTE 3WS3B 1IM3B 1CFVH 1F58H 1A5FH 4L4JA 2ESVD 2YKLL 2QLVB 4IMLA 3KPPB 1S7UB 4ZPVB 2V7HA 4LLYB 4ZXBD 1WUNT 5C07B 5F89B 3VFWA 4UBDD 4BKLB 4NJAH 4YX2H 1MCKA 3TJHD 1C08A 1OF2B 5INDA 4TTDD 3UP1A 4NBXB 2Q8AH 2PYED 1I7UA 4BA8A 3QB7C 4LSQL 4PGEB 1ETZB 3KYKL 4UIKL 5IBTL 1J8HA 3OKKA 1UXWA 3B9EA 3FB7A 4NQSB 4MNHA 4NQUA 1QLEH 2ZSWA 4YHNA 5CBAA 3WS6C 1OVZA 3RWJB 2EE3A 1A6VH 1YMMA 3ARGC 4AM0A 1MAML 3OX8A 4XVSL 5FO7A 4P0DA 1K4CA 1KIUA 4Y2DC 1O7VA 1CFQB 5DRZB 3LKPA 5LAXA 2J2ZA 1KLUB 1IFHL 1I9JH 1U95A 2H1PL 4P3CL 2WBJB 4WFED 1RUML 5FUOH 4R0LA 4DUVA 2ZUTA 4DFIA 1YJDC 3ZE2E 5GS1B 2DYPD 2CIIB 4PJFA 4YO0B 2BVQB 2J5LC 5CSZA 5FCUH 3MFGB 2H41A 4OI9A 5F1NB 4KQ4H 1AIFA 1MSPA 3GBMH 1CDJA 4NYLB 5ALCL 5FO9A 4FG6C 1S7WA 4N8CL 5KVFH 1UZ6E 1VFAB 5IJVB 5CD5D 3EZ8A 4F9PA 4Y7MA 1OGTB 4DGYH 4IMKC 1J88A 1UWEL 4NZTH 5EIIB 1QSFE 5I30L 1T21B 3KYMB 1OTUC 1ZMYA 4UIMB 5MEPA 4JRYA 3BPCB 1KB9K 1H3PH 2Z8RA 1EVUA 4N1HB 4D94A 3BKCL 3BD5A 1A6TA 3DVGB 4Y5VC 2PW1B 5BVPH 2GEEA 3ESVF 3O81A 4RA0C 5BMFL 2AJZB 2I07A 4KKCD 2F5AL 3Q2CA 4PBWD 3MNZB 4JFXA 3O11A 4U1GC 4MS8D 3M1BB 4NM8L 4QRPB 1MF2L 2PUQT 4XC3H 5EO9A 1Z6JT 4U1MA 3CMOH 1UFUA 4NBZB 5B3JE 3FKUS 1RSFA 5DA4A 3GMNA 4HIXL 5FYKL 3MCG1 4KRPB 4PB9H 4PR5B 1VGKA 3C60C 3D2UD 3JWOL 4L3ED 1EEZA 3CSYA 2Y6SC 4PJEB 1S5IL 2VAAB 4CJ0A 2VO5A 1KCRL 4PJDF 3ETBF 3HR6A 4MJ6A 4HC1H 4XNMB 5SX5K 3WHXA 4LPWA 5FYLL 4FQLL 4FQCL 5L6YH 1RUPL 1T5WB 1TDQA 2H1PH 3VWJD 1FNSH 1Q94A 4R90H 3MV9E 3CFKB 3VXME 2AK4E 2D7NA 3RWHA 3JV6A 5MENA 3DV4B 1L0YA 1XIWA 4WEBL 3HC0B 2C3XA 1KJVB 4M3JA 3CZFB 2EDQA 5I1HH 5KSAC 1C16A 3EYQD 5ALCH 3RWFB 2I9LA 4HMDA 2BNQD 3TCLB 3T0DA 1AGBA 4DZ8A 4JRYD 4P4KA 4NQXA 2XXCB 5EO1B 4P9ML 4AQ1B 3Q5OA 1F4XL 2P5EE 3NAAH 4HCRL 1FZMB 2JB5L 4W4OC 4TVPL 1OAYL 5C2BH 5I1JL 4TTGA 4MD0A 2HKFH 2VLRE 3EBAA 5D2NC 1F3DH 3UPRB 4OZIA 4PD4K 3PWNA 4NQDA 4CDGC 4PV9B 1ZT4A 4QXGH 5J89A 3MRRB 3BKCH 3VXNB 1X4XA 3U7WH 3V6OE 5JHDE 1IGYA 2AXFB 3C5ZD 3B2UC 5HD8D 3JUYA 1OGTA 4KKAD 1MWAL 1NJ9A 2EEBA 4LHUB 3QPQC 3BXNB 2Y7QB 1DBBH 3T65B 4O2EB 5HHME 1MF2H 3D18B 1CCZA 4JN2A 1YA5A 5HPMA 5GIRB 3MQIA 1NKRA 4KFZC 5ADOL 1I1YA 4YDKL 5ESAB 3LEVL 1T66C 3RPIA 3U0WL 4OGZA 3RWDB 2NY6B 1I3RA 1MQKL 2HKHL 3UTQB 4WWKA 3D39E 1AXTL 1NSNL 1I7TA 3V6OA 2XWJB 3RWEB 5FYLH 5GGTH 5D7JC 3AB0C 4LIQE 3GBLA 3FFCB 5GRYA 1BFVH 4I9WE 1RUPH 3U4AA 3IRZA 2XQBL 4YC2C 3VRIA 1ONQA 5I71B 5KSAA 5CD3B 3MLRH 3QUMA 1BQHG 1HNFA 2E6PA 4Y5XC 3MV7B 3LV3B 5CBEA 4Y4FD 1F11B 2Z35B 2HH0L 3SKNB 4C56E 3GRWA 1WAAF 4XCYB 5IUSA 2HLFC 2HVJB 4MAYA 3S96A 2VDPL 3BE1L 3JWOC 5DJ6A 4JHWH 3S3PA 3DPBA 2ID5A 1B0GB 4Q9CA 5CEZE 1EEYB 4P57A 3MRDB 1XF5A 4DCQA 4M7JH 1CICC 2ITCB 3QUZC 3RDTB 5F7FA 4UDTA 2FHCA 1AO7B 3ARPA 4FZ8H 3Q6FB 3L5WB 5HYSG 1L0QA 4PG2A 2XWBA 1EMTL 4KXZH 3Q6GH 3MA7A 5MENE 1OAYH 4GJTB 4HJJL 4G8FB 1K8IB 2DTML 5D5MB 4OZGF 1DL7H 3MV9A 3SGJA 2O26U 3D39B 3SDDD 1MREH 4N8VA 1FNFA 1T1ZA 2AS5M 2MCPH 1M05B 1G7MA 1FGVL 3HC3L 1UKSA 4M61B 1F2QA 1FDLL 1RIHH 1TNNA 3IF1B 3TZVB 3SE3A 1J8HD 4WIQA 5T3ZE 1VFBA 5CGYC 2Q87A 4K7FA 3VXQB 1AE6H 1PQZB 4HLZG 1QQDB 2O5YL 1PAMA 5IJKC 3B8YA 3MV8B 4DZBB 4CDHA 1CL7I 2BNUB 1Y0LB 3O6FD 5FO7B 4KK9D 1INDL 4MDIA 4EDXA 5IW3A 4NO3B 1I75A 5SWSA 3T0BA 1KIPB 2VLKB 4CBPA 5B4MD 1G9NC 2NYYD 3MROA 2C3VB 3B9KB 3DBXA 3QUXD 2G9HB 3D0LB 4JFDE 3VFRB 2MTPA 4H0IA 1MCWW 2ZOKB 4YQXL 4ZFOA 2FRGP 5HDLA 3IS1X 4D8PB 3ULVC 2O5ZL 1M7IB 1QPPA 4JRYE 2XG5A 4CW1A 2VR5A 2UZIL 1NBYB 3MLRL 2F53D 3V4UL 1YN6A 5J6GA 3GM0A 5BQ7A 2ICWA 3QQ3B 4GRWF 1MFBL 1DE4A 3O2VL 1UCTA 5F7KC 5BJTA 3VH8B 3MZTA 4X4YA 1M71A 1U2CA 5KZCB 4Q9RL 4OCRL 4K2UL 5AWNL 4WI8A 4F15B 4WFFD 4YEEA 3HE7B 5I74C 2YA2A 2HRLA 4OSUH 4POYA 4UNUA 2V5TA 4LU5H 3RI5K 3SEPA 4HMEA 4MVBD 1EBAA 1L6XA 1J0ZA 4FZ8L 2CK0H 3OZ9H 3CFDB 4PJFE 1I8MB 4YHOH 2PN5A 4YLQT 4AIZB 2GJZB 3AREC 4X6BA 4G8EA 3FONA 1P69B 4MNQB 5DJ6B 3H9SD 1IAMA 1GVIA 5DC4B 4HWBH 4JB9L 4HUMB 1OAXH 4MXQD 3D3VB 4HIJB 4BZ2H 1XF3A 3I6LD 2QQNH 2YN5A 5C0FA 4KROB 3KXFD 4JFOA 1OGAE 4AMKL 2DI8A 3MJGX 4LDLB 4PP2B 4WEMB 1YEHH 5JO5B 1GZQB 5DUPL 2YK1H 5IVXB 4QRPE 3NN8A 5CGMA 1CDCA 3QDGB 4U6VH 4P9HH 3IDGB 4NQVA 3FQXB 4QNPE 5HI4D 5I8OL 4FFZL 3HZVB 5ICXA 2YPVL 3FT4B 5GZOD 5BS0E 5GRXG 3CFKA 4LVHC 3H9YA 1LEKB 1OPGH 1QR4A 5BZWB 1T2QH 4PJAE 4CMMB 4G80A 4EOWL 3MJ7A 5DD0H 1DQLL 5CP3A 4GUPB 4X6EB 3LIZL 2EDEA 1CTOA 5D1ZB 3ARDC 3T4YA 4DQOH 5T1LB 3RWJA 1U8PA 3V6ZA 1B4JL 1MHHA 4PRPB 2E9IA 3MRJB 1WT5A 2NTFA 1BJ1J 3GSUB 3PNWA 1RUKL 2NY2B 1HQRA 4E42B 4YNYB 1J8KA 3GMNB 2ADGA 1T04B 4W6WB 4EBQH 2RGSA 2G2RA 3OXRA 4XVUC 1QEWA 3TV3H 5EPMA 1EH9A 4BQ8A 3PV7A 4HGKC 2GSIB 4KI5D 3GJEA 2J4WH 3EHBD 3DX8B 3MLYL 2G9HA 3E3QE 4LEXL 4G6ML 4L8BB 4MDJB 4UV7L 3OWEA 2UZYB 2ATPB 3F7VA 1XGYH 3KNBA 4U6HA 1Q94B 4C83A 2YZ8A 2CDEB 4PRHE 3AS2A 4QYOA 1H8SA 4NRYA 4XBPB 1KC5H 3S8WA 3S35L 3HLAA 5I1DA 2XNAB 3W11C 1LEIA 1A14L 5CGYD 5EC2A 1T83C 1H5BA 3R8QA 3EYOB 4LVOB 3V8OA 4KC3B 1DBKL 3WE6B 2H8PB 3AAZA 3C60B 5J3HD 1DQDH 3JTTB 3OKOB 3OR6A 1KCSH 4ZAKA 5GGRY 2IBZY 5FECB 4LLDB 2ZG2A 3NACL 2IBGA 1A5FL 3X12A 2WV3A 4BZ2L 4LPYA 2HFEA 4YAQA 1FL6B 2QQNL 3FB8A 1OT1A 4JO3L 2P8PB 5GGVY 3BN9D 5ETUB 3T3PF 1JGVH 5CLWA 3UROR 1B0RA 1FO0H 1U93A 1AGEB 5HI3D 1QNZH 1T22B 3MLTB 4OLZL 3GMLA 1PKQE 2HJLB 1DQMH 1H3UA 3FONB 4CN1A 4U6VL 2GTWA 3QNYB 4P9HL 1BZQK 5EO0A 3I6GA 3TFKC 5A2FA 3DLQR 1RK0A 3PABA 5HHOE 3MXWH 4QNPF 3WUWG 5ITFA 4NT6A 4E5XA 4RGNC 1BEYH 1HHGB 1U3JA 5DD0L 2VNCA 4P5KB 4ZOBA 4LSVL 4X5LA 4GLRI 5EBLA 1W2KT 1E28A 4QRRD 1MJ8H 1KIQB 2CGRH 4DKEH 1FORH 3MFFA 5JXEA 1YEKH 3IU4H 4HWZB 3WS3A 5C8JB 4XTRC 1P6AB 1FG9C 1S9WB 2P5ED 3EFDL 3QR2A 4P4KC 2YUXA 3O3EB 4GBXC 1WF5A 5J3HC 1MLBA 5E2WL 2XFXB 5EIQA 4D0CB 1U8MB 4PJFF 3TM6A 3OKDA 4D3CL 2XWJA 5L8JB 3BPCA 2XY2A 4M48L 2F54A 3AMKA 1GGCH 4JJHA 1J7VR 1FL3A 1HCVA 3GRWL 3S4SA 2CKNA 2BXYA 3ARDB 3OXRB 1T89C 2EC8A 1BQLH 1FFQA 2ZUWA 1VFBB 4Q7DA 5DSCB 5D9SA 2ZPKL 3KPOA 2NY1B 1BHGA 2J88L 4HUWB 1DLFH 5ECJE 2QKIA 1TZIB 1GC1C 5KTEL 4XCFL 5GGUB 3ARBA 4RRPA 1SJHA 2XPGA 3PXJA 3IS0X 3JV4B 4DVRL 1J87A 4Z7UF 1AO7A 1AR2A 2CO7B 4I13B 2WIMA 1CFTB 1UJ3C 3LKNA 3GSQA 5GISH 1JTPA 1D9KB 4Z7UE 5HHNA 2IPTL 3QFJB 5K9JH 5FYLE 4OZIF 4NM8H 3HC4H 1DQML 3PHSA 4JQXA 4LQFH 1A4JA 4XPAH 4IRZL 4U1LB 4P4KD 4ONFL 4UILL 5FECA 4Z0XA 3L5XL 5ANMB 5DR5H 3TZVA 1PG7W 3MNWA 5DZNA 4LDOB 5T3ZL 5C6PB 1X5FA 3EOTH 1SBSH 3SDCB 2FEEI 2YSSA 2ICWB 4MJIE 4R4NC 5DA0B 4KK8C 4CMHB 4JFDB 3OG6B 43C9A 1UM4L 3ABZA 5LGHH 2FJHA 4XH2A 2EDLA 2AXHA 1T80A 3PP4H 1UQSB 1IEAB 4UQ3A 4DEPB 3ALWA 4ONHB 4APQB 1P84J 1AO7E 1PLGL 1YQVL 3TPUA 2VDQL 1WZMA 1R6VA 4PJIA 4PRAA 3ULVH 1PFCA 3PWPE 3F6IA 1WBZB 2WLZA 3B9KA 4M8VA 5JMRA 3VFRA 2XWTB 2OI9C 5KSBE 3MO1A 5FYJL 1ZVYA 5FYKU 4RMRA 1S7VA 3KPLB 5HDBF 5CEZL 4MMXC 3MFFB 5DZLA 5JR1H 3MBEB 2PETA 5FK9A 4Q6IA 5MERB 1NBYA 4HV8B 4P9MH 4Y4FA 3WLBB 3CPLA 2F8OA 2FGWL 1TFHA 1BWMA 1NGWB 1CG9A 4MCZA 4Z7WB 4LEOA 1DLFL 2Z4QB 1FCGA 1XR8B 3H3KA 4WV1B 1VGEL 7FABH 5JO5A 3NZ8B 1FLTX 4TVPD 4RFOL 2BSTB 1V7NL 1BREA 1P2CB 1EK3A 4UB0L 1CLYL 3BAEL 1U6AL 3U7WL 2YKLH 3KAAA 3IF1A 2NY2C 4QHNB 4X7EC 1KIRB 3KPNB 4OLVL 2VZVA 4YHLL 5EU6E 1FG2B 1JF5A 1MVUA 2BY1A 3KPRD 4Z5RA 2BJMH 4RMVA 3IFNH 4I5BB 5MEOA 1AC6A 3ZYJA 1MJ7H 2NX5D 4OKDA 3GMRA 4JREB 4WFHE 1YMMD 5B8CA 3ARDD 1I4FB 5DF0A 5HVHB 2VXTH 1LP9A 4HIJA 5MP6L 1TQCC 1G6RH 1GC1L 1YPZA 2FD6L 1BD2E 4KDWA 1BWWA 4WRLA 4HAGA 4BH7B 3MROB 2DLGA 2A1WH 4CVXA 5FO8B 3QSKB 2VC2H 2UWEF 3I2CH 3HFML 3WSQH 1YECL 5BS0D 2AJVH 3DXAD 2P5EB 5EZOL 4JG1H 4ZXBC 5FUOL 3U79A 3QHFH 4RFNC 4H88H 4TUKH 3AS1A 1M7DB 5E6ZA 3VXSE 2AK4B 3AY4A 4NKQB 3BUTA 3EYVB 4XVTL 1VHPA 2IGFH 3V5HA 4LCWE 3VGAC 5D2LE 3D2UA 5IG7A 3HUJB 5HYIA 2PXYA 2GFBB 3GNMH 5EULV 4WW2A 5KVFL 1TNMA 2EXWC 2CIKA 4O2FB 3BN9C 3Q48A 5IMMB 1EVTC 4IRSC 2C26A 4JANA 4IBLT 4P23B 1TZGH 2R2BB 4P5TB 2Z31C 2WUBL 2C3VA 1V3KA 1KXQE 4GAGL 5HHVH 4W4OA 5BO1L 1TJIL 4ZO9A 4PBXA 3HAEH 4AEHL 1A0QL 2CUHA 1JGEB 2VDLL 4RQQB 1IGYB 2AXFA 4MJ5A 2VQUA 5H37H 4TUOB 2YHGA 5D71H 2OXHA 2VDOH 5BMFH 4WU5B 1S7XA 4J23A 3C60D 4PJDB 2W9DL 2FEEL 4GRLC 5GXBB 2D0FA 2H26B 4HWNA 1LO3H 1EO7A 2WBKA 1GCFA 5F1IA 4XC3L 3P9LA 2UVEA 3QUKB 3SE4A 3X13A 1KEML 3ARZA 3QH3A 5FA3A 1ROWA 5CZVL 3T0EA 4DKFH 1O7SA 1PY9A 1I9IL 4P48A 1G6RL 5DWUH 1Q72H 2DQCH 5BZDB 2J3SA 1NCWL 5I66A 2BMKA 3DX7A 4KTYA 4HS6B 4QHLB 4QWWC 4WO4C 3LS5L 2MQ0A 4PJ9C 4XPFH 1RZGB 1I7RB 2Z9TA 3MA7B 1NBVL 2C3GA 3MOQA 3T3PE 3ILQD 2APXA 3UDWA 3LRSB 3VFMB 2O5ZH 3HE7A 1UC6A 3HI1A 4PGBB 2R0WH 4FQIH 1YPZB 3CLEH 1C5CH 1PYWA 2ZCKH 4Y1AE 3SJVE 1IT9L 1EPFA 1Y18B 1F11A 1Q0YH 4QOKA 3CLFL 3UJJL 1BOYA 1BQHB 4C56B 4LSTH 3BQUA 5ADPL 4JZJA 3RDTA 4W81A 3QDMD 2X4QA 4GG8B 3VG0H 1LEKA 4E0RA 4PJXA 1P84K 4Y4KC 2VXUL 1JVKA 3A67H 3WJLC 1XZ0B 4JN1H 2EZ0D 3UO1L 3RGVD 4M6OL 2W65A 5J1AA 1JPSL 5I1JH 3DECA 4P99A 4MJIB 3CCHB 5IVXF 4K94H 4JFDD 4XP1H 3PWJA 4XCCL 1OGAB 5CMAB 4ZTPL 1TZHB 2AJYL 1I3VA 1QPXA 3U1SL 4GKZB 1N0LA 1BD2D 1HYSC 5KG9B 2VDOL 2N56A 4K7FB 3SJVB 2GSIA 1DBMH 1QQDA 3H0TA 4I18A 5EN2B 4GBXB 3W9EA 5L0QC 2V7NB 4Y89A 3QAZC 4Z9KB 1DTUA 1K4DB 2MQCA 3E6FA 1ZEAL 5C07E 3ZTJH 1V05A 4DKFL 3VA6A 5D93B 4RMWA 1RZKC 2VLMD 2KZ1B 1T2QL 3U0WH 4LFHD 2ILLA 5FM5M 2D3VA 1KTLA 2A73B 3IFLL 3HNSH 3RIFK 4XPFL 4PJDA 5E00A 2CDGB 4OLYH 1FNAA 3CD4A 3BKMH 3GM8A 1OSZB 3D9AH 1F13A 5F88A 4CL7A 2W07A 1RUKH 4ZOCA 1QYGL 3TBSA 4LCWA 2NXZC 4EZMA 5C0DA 4G9DB 5F7DA 1IQDA 3P30H 4HX1B 5H8DA 3UTSD 1HXMA 1OLZA 2F8VA 3L6FB 1JWMB 5E8OB 3GK8L 5EA0L 2HH0H 2EIBA 1ZVHA 3U36A 4NHCH 2X9WA 2VITB 2VXSL 3OR6B 2FX7L 2YPKA 3N50A 4JHZA 5LCVH 1SBBA 5EIVA 2HMIC 3VG9B 3LN4B 3DHMA 4HK0B 3G6JB 3L95B 3V0WH 1BD2A 5EBLB 1QRNA 2DTMH 1YPZE 3BGMA 2CLVA 3ZE1F 1I85A 4K94L 5DVKA 4F7TA 2D0HA 4Y5XB 1BPVA 4V1DB 3FO0H 2MCPL 3PWVA 5I9QC 1OHQA 2XACC 1F4HA 1FDLH 1NUNB 1YC8A 4M9PA 2P5WE 4OGYH 1S8DA 5ITBH 3ARQA 2XZCH 1FO0L 1Z9OA 3MC0A 3ZDYE 1QNZL 4KHXH 4ALAH 4XP5L 2C1PA 5IB3B 2KPNA 3WCYA 2HAZA 1QOKA 4WWKD 2E27H 1CT8A 3QDGE 1FO0B 4HXBH 1WICA 5GGVL 1RJYB 4Q0XL 4CMMA 3L3JA 3N1MC 4G7YH 1QR1B 4LLQB 3QEHB 5A3ID 1ZANH 1D5IH 3F7RA 5E95B 3IFLH 4I0KA 4ZFGH 5B38G 4G6KH 3BSZL 1NUGA 3IDNA 4ACPA 1ORQB 1RV6X 3BEWA 1ES0A 4L3CA 4Z78B 4F8QA 4ODTH 4QWWD 3LQAC 3RNQA 3KPRB 4A2MA 2IFGA 4GRLB 4WI3A 5JHDA 4Z7VE 3PWPA 3MRBB 2APWA 3VXUB 4YHPA 2UVFA 3M45A 4PJIE 3QWOA 2VLKE 2Y9RT 4I1NB 2Y25A 4BH7A 2QR0B 3OXSB 1VEPA 1TZIA 3O2VH 5JDJA 2NW3B 4I4WB 4XNUH 4CKVX 4F2MB 2VZOA 2X70B 1KSRA 5AWNH 1ZT7A 1LK3H 2ZZUT 5IROC 4PGEA 2EXYC 4QYOB 4NP4H 4PJIF 4J4PD 5BRZE 5C71A 5KW9L 3HLAB 3GMQB 4ENED 4KUZH 3UYRH 5CBAB 3P0VL 1F02I 1S7SB 3RVTC 3WIHA 3TIEA 3WUWA 1A3LH 3LKOA 5T1DH 1V5JA 3MNVB 1A7QL 1N5AA 2GFBA 2HVKA 1DBAH 1ZHLB 4HIHB 4XP9L 3ULUF 4QXTB 1WWWX 3SKMB 4M6NH 1KT2A 3ZL4L 3IJHA 2D4DA 4Z7UA 4ODVL 4R4FL 2EZ0C 4RISL 1I3GH 3G6JA 5TQ2H 3HI6H 2AJZA 2I07B 4ZQKA 4APQD 4UAOC 2IPKB 1MHPL 1AGDB 1U42A 2XFXA 4FXKB 4KHTH 1EFQA 3ZT6A 1Z9SA 2IPTH 2IANB 4YDJA 2R1XB 3PHOB 1BJ1H 4LASL 4LGRB 1A6UH 5E24E 3OAZK 5FK9B 3OB8A 2WMPA 3B3IA 4KROD 1OPGL 3DYPA 4K94C 1Z0MA 1OCWL 4ZSOB 1EHLH 2GTZB 2J8OA 4PJ7A 4OFDA 4K3GA 5T3ZD 2XKNA 2XT1B 1MCRA 3IDIA 2FYYB 4L8DA 1LO5A 3L1OH 5A2JH 2A9MH 3CMGA 4LSSL 4ZMAT 4FNLL 5DD3H 5LGHL 4CU6A 1AY1H 1QSED 1INEL 3RTQC 1U58A 4OLWL 1U8OA 3IDUA 1BECA 3O9WA 2D0GA 1FNGA 1Q8MA 1YQVH 4HG4K 2IPUK 3DX7B 4HQQH 4ZS7H 3WNKA 3WKNA 4MNHB 1PGRB 2OMNA 4XB8A 1WISA 4U49A 1DBJH 3ARVA 1QSFA 1DUYB 4KI5C 2OK0L 1MCIA 2Q7YA 1P2CA 1P4BH 2A0LD 5FM8A 5L88L 1Z5LA 2ARJQ 1B90A 1LEGB 5L7XH 5IBLC 1DQQA 4KQ3L 4R0LC 4NP4L 3MBXH 4PR5A 3S35H 5KVDH 1E4XL 4W70A 5IB1A 5IHBA 2VQTA 1IAOA 4L9LB 2FEDD 4HHAB 4JE4B 2FL5B 3UYOD 4KZEL 4NN6B 3MRNA 2KH2B 4JRXD 1LK2A 5F7EH 4RFOH 3HRPA 4PUBH 3DYOA 1S7TB 1ZHKB 3FAWA 3QUXB 2UUDK 3GSWA 3REWB 1IC4L 5DK0B 5DS8A 1J1XH 4JZJC 5DHVH 4H8WH 3ZL4H 2EDFA 4JGMA 1YEJL 3T4AB 5I2IB 3X14B 3EYFA 2AK1H 3QXDB 5DEFB 2OTUB 4P23D 4MZ2A 1BFOA 3IFNL 1NDMA 5EOCJ 4NCC2 4DW2H 3WN5C 5IB4B 1DANT 3QDJE 2DM7A 1LVEA 1P7QB 5IW6B 1KJ3H 1TJGL 1Q9OB 5B39G 3DRTB 5FYKH 1VA9A 5KG9A 4KKBD 3IXTA 1OAKL 2AV1B 4GKNA 4F8TA 3U46A 4OGXL 3EYSH 1A9EA 3LAFA 4JLRA 1EGJA 1FBIL 1N5YH 2DQGL 1CE6A 4NHUA 4HC1L 1FIGH 5SX4H 4M43L 1H3GA 1RI8A 2JJSC 1A2YB 2ZWLT 5HI3C 4EUPG 3UCRA 1INEH 2VLME 1U8JA 3CFBA 3H2WA 5E1AA 4PREB 4MJ5B 5TDNB 3FB5A 4GG6B 4R97C 2F74A 4H88L 4JPIA 4HLJA 3BQUC 1YQ2A 2R0KL 2NW2B 5I1KH 3V4PL 2DQEL 2V6HA 3R06B 5CSGA 1W72A 4D3CH 1DBJL 5I1HL 3D18A 4WJ5A 3PQYA 1N8ZA 3GNML 1I8IA 1UH4A 4JAMB 2NXYC 4M7LT 5D1XC 3MLUL 3PQYD 1R5WA 5IMOA 3Q1SL 4NM4L 5D7LB 4ELMB 4Q9BA 4WU5A 2Z91B 3ZKNC 2IFFH 3JWDL 1M6OB 3ET9F 4QCIA 4NC1C 2DDQL 4P46A 1BZ7B 2HT3C 5C07D 5BO1H 5FB8A 3DVNA 1TTUA 3FL7A 2GSGA 1LEGA 5FGRA 2CLRA 2YUWA 1E4WL 4MSWA 1SJEA 5CD3A 4OCXH 3HPLA 4FTVE 2BY2A 3TN0C 3DRQA 3FZUC 3L7EB 2FX8H 3RIAK 2ZSWB 4F7EB 3BP7A 2P24A 2W9DH 3O2DL 4NJAL 5C0CD 4MAYB 4TSAH 1DQJA 4K71B 2DICA 4XPAL 4MQXC 3EJZC 4Y5XA 2ZCHL 5D7KE 4GRWH 3P4MB 4OCWH 3QEQD 1FH5H 1S9YB 2WUCH 3CXHK 5T3XL 5E2JA 1JL8A 5IB5B 1VGKB 1R3HA 5SWZD 5T1KA 2JCCE 4EDWL 1A7RL 2X10A 1F00I 1UEMA 3T4AA 5I2IA 3IU3A 4DGVH 3WFDL 3DO7A 3QNXB 1JF6A 1JYXA 4NQED 2DQGH 1NC2D 4HWUA 3I50H 1CL7H 4MD0B 5GGTL 3WIIH 1AD0B 1AP2B 3DMMA 4C4KT 3UTOA 1IARB 2W0KA 3WFBL 4MXVE 3FTGB 3BO8B 3KXFB 5MI0C 1TCRB 5J13C 2BX5A 1BVLB 4XNZB 1PQZA 4PRBB 3D3VD 4LHUA 4ZYKA 5C86A 1RZJC 2NY4B 1ZS8A 3MCLH 4UIMA 4JFQB 1YY8B 3TA3A 1T1XA 5D5MF 1ITBB 2P5WD 4DUXA 4R2GC 3ME0A 4YPGA 3ZE0E 5DHXB 3NIDE 3Q1SH 1ZLWK 1XH3A 2H2SD 4PB0H 4WTZA 5D7JD 1UWEH 5FGCE 3T0ED 1TVBA 4HJJH 4WWKB 3O6MH 3LKSA 4U3CA 5ALBH 3V6FA 3M8OH 3R0NA 3P3YA 4NBYB 4ZUVB 2ESVA 4AEEA 4DCQB 2AJYH 3VD4A 2LU3A 4UDTB 2FSEB 5BVPL 2CJUL 5J12B 5JORB 4YHLH 3WDIA 5DK2B 1S3KH 2H3NA 3QQ3A 2Z35A 3O2DH 1QLFA 5JA9A 5GRJH 5BOPA 4U6TA 3B2VH 5F1IB 1V3JA 4XPBL 4KKBC 1ZTXH 3MR9B 2P1YA 1SM3L 4M1GH 4GOSA 4X5XA 3WO4B 2Z0BA 5L8LB 5C0BD 1EEUA 2A38A 2K9UA 4LLVA 4R3SB 4YBQD 5HSFA 4HUXB 1A6TB 4FFWC 5T3XH 4MSWB 4UMGA 3MV9D 3JXAA 3FAXA 3UJTH 4PJ9A 4G80B 4MYWB 4GG6F 1A7RH 4GUPA 1DJSA 2NX5E 1XZ0A 4JFED 1UWXK 3HUJF 4RMSA 3WEXA 5E6ID 3ES6B 4DVBA 2PF6A 1DUYA 3BPNC 2HG5A 2V5MA 3WIIL 2HLAB 4NIKB 1QYGH 3B5GA 1XF2B 1F42A 1EFXA 3L3DA 4Y2OA 3TNMA 5E9DD 4ETYA 1Q38A 3MUGA 3A0OA 3V5DB 2Q7NA 4K23L 1NFIA 1PEZA 3B9VA 1MY7A 3KR3H 4AIXA 4YHPB 3C5JA 1XFPA 1RJCA 1WZ1H 1JZ8A 5DJ0A 5DJCA 2JE8A 3QRGL 2Z31D 3C6LA 4PGDA 4G9FB 2P44B 4P2RD 2IGFL 4PJGF 3RU8H 2XV6B 3LPGA 4KK6D 4QY8A 5CINH 5F1KC 2FJGB 4PV9A 4IOFD 4R9HA 4YFEA 5BVJB 3GO1H 5C9KA 2M8XA 2HFFA 3NCEB 3KPTA 5DMKB 3K2MC 5F7NC 3X17A 3QG6B 5JZ7D 4Z76A 3UZVB 4O9HL 4QOKD 2CDGA 4GAGH 2VUOA 4UAOB 4HULB 1R3KA 4JPKH 5K9QI 1DVFA 1L7TH 3L3OB 4DJMA 4L3CB 4ODUB 3MLPA 1G7MB 4KTDL 4UDUA 3EFFA 3CK0H 4FN0A 3DRTA 4IIQC 4C4KO 1OM3H 1C7SA 1TVHA 5D7IE 2NY4D 1FL6A 5HGDA 4YDLC 4XWOC 2OI9B 4G42A 3SE9H 2HTKD 5FYJE 2R15A 3OGCB 1MWAH 1I3RB 1UWGH 3QPXL 1JV5B 2BSSA 3DX8A 3FFCD 4XPBH 2GAZA 4XWGL 4NQDE 5I1EH 3LB6D 1YPZF 3FFCA 2VLRA 1XR9A 5ITFB 3SGKA 1EO8L 5C0JA 1X3DA 4G7YL 2NXYB 4G8GA 4FFVD 1BBJB 2V17L 4PLKC 4HD9A 1NJ9B 4DOHE 1TPXC 5GZND 2ZOLA 2CLZB 3CU7A 3PE9A 4U7MA 4WO4D 1K6QH 2V9QA 5SWQA 3IAQA 5EU4B 5DEGB 3JZ7A 4F7TB 4HJ0C 4PGZA 3H9SE 3T08A 2VXQH 4PJAB 3CDGA 3D85B 3GKZA 3QCVH 2GQHA 2VL5A 1A6WL 4YHKL 5FOBA 4U7SA 5CJOH 1Z3GL 3QCTL 3TESA 2HJLA 3CLFH 4MXWL 1MHHB 4PRPA 4OUOA 4JHWL 4S10A 4LVHB 2XZAH 4M4RA 4Z7NE 3GSUA 5C1MB 1T1ZB 4DAGL 2A83B 5CFHA 5L9DH 2IBBA 2YWZA 1QVOA 3FB5B 3VFPB 1KJMA 4EUPH 2OJEB 4OUUA 4WU7A 3O0RL 4ONOA 4KUZL 3UYRL 3UBXB 4YJZL 4RMQA 2HJKA 2JCCA 3BKJL 4R26H 3G9AB 4M7KH 3KPOB 2X4UB 4JN1L 2QTEA 1Q9KB 1L7TL 2FWOB 2E7MA 1A7QH 4QOKE 1EEYA 1MREL 4P57B 3MGAA 2AJUL 5D70H 5T5NG 4C54A 1DBAL 4KTDH 5I9QB 1A9BB 1R5WB 3EUUA 1KN2L 2AEQL 5FEBA 2PYFA 4XB7A 5TQ2L 1ADQH 4Y5YB 1CD1A 4DGIL 3W0WA 3QPXH 4WDIA 4WHDA 2Q76B 2BVPB 1YYLH 3BJLA 4JQVA 4ZNEA 5IF0B 3WXWL 3EJJX 1KCUH 3STLB 4WFEE 1AD0A 3DMMB 5GGTA 1Q9OA 5LWYL 1ZEAH 1EZVY 1NMCC 4PJ5E 1DQTA 5I0DA 3VWKB 3HAEG 5KZCD 3Q3GA 1QR1A 4GH7B 3MRIA 1K8DB 2NY6C 1YN6B 4CNIA 3K8LA 2ZSVA 4F7EA 3MUZ1 3HC0A 2QHRL 4LSVH 3QQ9D 4GMSH 4UBDC 3WUWB 1EDQA 1KFAL 4NHUB 1OWRM 3U30C 3GMOB 4YQXH 1M71B 4QF1B 3RVVC 3P9WB 4GT7A 3PNWB 3U2SB 2Z8VC 1CWVA 3NTCH 3PQYE 4PJGB 2P7TA 5INCB 3CXDL 5LXGL 4TSCH 1FYHB 4GKSB 3WN5A 3SKMA 1P7QD 1G9ML 5D1XA 1FV1A 2BRRL 5CEXA 4HHAA 4JO2H 5CJQL 1D9KA 1J11A 3IXAA 1E28B 1RPQA 2V2WA 1AI1H