1IAIM

Idiotype-anti-idiotype fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DIQLTQSPAFMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM01
4L4TA 3T8XB 3QIBD 3MO1B 2F58L 4YHML 3QULB 4JFHD 1DVFD 2X4NA 3D85A 3OTTA 1MJJA 4NQDD 5HDQL 1I3UA 4G42A 2Z31B 2HLFC 1FJ1B 3HI1A 1PVHA 3O2WL 2KL6A 2OL3A 2G60L 3ESUF 2JB6B 4HLZG 3RAJH 1T7WA 3DTXA 4PGDA 1T03L 4FFZH 2BSED 2B1HL 3Q5TA 4G8EA 5ITBL 4L8BA 4LLWA 2UVEA 2DWEA 4LARH 5ANMA 2X4RB 4GKSB 3TM6A 2ID5A 1JZ4A 2DF3A 2E9BA 5MEOB 2MJWA 3S7GA 4KZEH 4GRMA 5E8NA 2AV7A 3P0YL 3FN3A 2P8MA 5I17B 3OAZH 4XNMB 4WHTA 2H41A 4AM0A 4DK3A 1NSNL 2B2XH 3GMQA 1ED3A 1S7QB 4OAWA 4QHLA 5I8OL 5JXAL 4G3YL 3HAEG 3Q1SH 1JHTB 2G60H 5EBMA 3ZE2F 4OLEA 4LVOB 3NPZB 5BXFB 1BZ9B 4WHTB 4KI1A 3DYOA 4N0CD 2JJTA 4PLNC 1F4XL 1U95B 3CPLB 1N6UA 1MREL 2DKSA 2V17L 3D3VB 3X14B 1XIWA 3SDAC 4OD2A 3SKJL 2QSQA 1Q0XH 4O2FB 4OCRL 2X5PA 4WHYH 1AQKH 2VDQL 2BVPA 4ZUVA 4JHZA 1S7WB 2E6PA 5CAYB 1N6QL 4BH7B 2EZ0D 3MLRH 4LEOB 3GSWB 1A1NB 2HP4A 1Q9WA 2QKIA 3SJVE 5DEFB 5F89A 2HMID 2XZAL 5IB5B 1LP9A 3SKMA 2JE8A 3TBWB 1SVCP 2MQ0A 4KMTL 2HH0H 4Q0XH 1G9NH 4LCCA 4Y5VB 2OR9L 2VLJD 2OS7A 5SX4H 1X4YA 2E6JA 5EZOH 3SDAB 3WD5H 5KSBA 3B2UD 3O4LB 1NMBH 5JLZA 5DI8A 2UZXB 3O41A 4JLRA 5FKPA 5TQ2L 3QCTH 5LJYH 4YC2C 3ZTJG 4RGOH 1P4IH 4PJ5A 3O2DH 43C9B 1T21A 2PR4L 3WO4C 2VL5B 4U1JB 5ACLA 2AK1L 4I3GA 2BHUA 4H8WH 3U0PB 3NCYS 4I3RL 2DDQH 4X6CE 2Q3ZA 1X5GA 1Z9MA 1MQ8A 3DGGA 3KPSD 1J1XH 5MERB 4KUZL 1NEZB 4PRBA 1HSAB 1GZPA 5IVZB 4AH2B 4WO4B 1HHHA 5T5NF 1KFAL 4U2YA 3EYSL 5DQJB 1TTUA 3LQAH 1ULVA 2EKSB 4FQ1L 3QA3A 5KW9L 1R3HA 3C09C 3U0TA 1W8NA 3TP4A 3MUGB 3SCMA 4HIEB 4X6DF 5CGYC 3W39A 2D03L 5DJ8A 1A7PH 3O3EA 5EO1A 1N0XH 2H2PD 2IC2A 4WU5A 3LQMA 4D0BA 1CTOA 4BYHA 2XN9D 3THMH 1LD9A 4ZFGL 1CFVH 4OM0L 3BSZH 4TSAH 1DFBL 3F7YB 1JGDA 2FX8L 2KDGA 1KLGB 1NFIB 1P5UA 3VG0L 5K59F 1KXVC 2XQBL 3IDIB 1G7HB 3BOVA 3IDMA 3VDBA 5EWIL 1HZHH 1N5YH 1CLCA 2ZNXA 2A0LD 5DRZA 3VG9B 3SJVB 3WXVH 4NHUA 5FECB 2BZDA 4JN2A 1MH5B 4MAYA 2WWKO 2D7PA 2CDGB 3P4NA 2X4NB 4OLVH 5I18L 2XA8H 5CLTA 5C0AA 2G5BB 4MJ5A 4J7RA 4XH2B 3DX8A 4MHHI 3ZDYE 1Q9LA 2A38A 1KJVA 5GGVL 1AFVL 4X4ME 3IETA 4KTDL 3L3OA 1HINL 4EI5A 1X5HA 4YPGB 1J0KA 4ELMF 1WTGT 2D7OA 4LK4A 1AD0A 1FZKA 1IQDB 2PO6C 4R4BA 1PGRB 1B88A 5FGCB 5HGAB 4R97C 3DMMD 1GZQB 4CKVX 4S1DC 1NCWH 4MQ7B 4JJ5A 1VHPA 4NQEB 2VDKL 1ZVSA 1HOCB 2GCYA 3NABL 5CGMA 3OQ3B 1A1MB 1D9KB 2V2WA 4OZGE 1SM3L 4BFEA 3JWOH 3V5DB 3QUYA 1JGEA 4XP1L 1G6VK 2X70A 1HHIB 5SWSE 3ZSSA 4O9HL 1CDYA 3H9SA 2YHGA 1MI5A 3L5WA 4ELME 5TDPA 1ACYL 4RFNC 1MFDL 3NCJH 4OCYL 1F2XK 1O7VA 4UQ2B 3C8DA 2MCPL 4NRZA 2GFBB 1NGYA 2K9UA 3O41B 4WI3A 4ZYKB 4U7SA 4AQOA 5I1HH 3QUKB 4R6UA 5IESH 3P2TA 4MAUH 3B9KD 5F7EL 4TOYH 3HZMB 1P4LB 2AI0H 3RY6A 2JJTC 4PGEA 4YJZL 2F53E 1KCRL 1NBQA 4PRBB 2R1WB 1ITBB 1AGEA 3C6LC 1QTYT 1FYHB 2F58H 5BCAA 5CHNA 4XXCA 1Q94B 3HNVH 1YMME 3WS6A 4RFOH 3H7LA 2ZSVA 2QSCH 4LSQH 3KPSA 5IESL 4JFDB 5ITBH 2VZUA 3MXWH 2DJUA 2A6DA 5HJ3B 1LWRA 5CMAB 4MHHG 5CKGA 3FT2B 2W0FB 1DZBA 4YGAB 2IADA 4PD4J 2F54A 4PPTA 3UZEA 1AQDB 1ZLWK 3MRIB 4LVNB 3F7QA 1G9MH 2EYSA 4OLYL 4NOBA 4CGTA 3KYMA 1JGDB 4PJHE 2FECI 4PY7B 3QI9A 3T0WA 3MNVA 4F3FA 3V7AE 4UTBH 2MTPA 2DQJL 4QF1A 4R8WL 1JPSL 5E8PA 4APQA 1FGNL 1AR1D 3KYMB 3DTXB 4PGDB 3SDCC 2BCKA 3O3EB 4L9DA 1E0OB 1MH5A 3ZKMD 5BVPL 1CE1H 4XNQB 2FGWH 4DN3L 4CVWA 3QUXD 1T3FA 5EU6B 3WNNA 3A67L 1NL0L 3QFJE 2C9AA 3MA9H 4F7PA 3PWPE 3VXRA 1NFIA 5H2BB 4ONHA 5GHWH 2YUWA 4PB0L 4ZFOA 1LILA 4FXKB 2AERT 1MWAL 1ED3B 4QHLB 5SX5K 1GGIH 4UIKL 1CBVH 3FO0L 4XPAH 3SDCB 4L4VA 1OTSC 4XPHL 1TIUA 1T6WA 1TVHB 1UJ3B 5IW6B 5T1MB 3GMNB 5DD3L 2BNRB 3G5VB 4J4PA 3S36L 2GCYB 1ZHLA 3BPOB 3U46A 1JZ7A 2V5YA 1DP0A 4OD1L 1OM3H 3PQYE 2EO9A 3BZ4A 1JGEB 5D1QB 3GM8A 3LZFH 4PLJC 3DLQR 1FZKB 5K9QG 4KV5E 3SEPA 3HMXA 5I19H 7FABL 2IBZX 4OCWH 5AG8A 1LK2B 2BXZA 5EZLA 5IB5A 5CSZA 1T04A 2ZOKA 4HKZB 2RIKA 4JPVL 3TVMC 1PG7L 4KRNA 1NC2A 5KW9H 2QQQA 5EN2B 4FQJH 1LO3L 3G04A 5TE4L 4O02H 3VGEA 1MCPH 5C07B 6FABL 1GOFA 8FABA 2K1MA 1NBVH 5D1QC 7CGTA 4JRYD 5CIPB 1IM9D 2FB4L 1OLLA 4P5TA 3VD7A 1MAML 3VRIB 4KHTL 2VR5A 3TH2T 5TDPB 4Q7DA 3ABZA 4RWYH 1NFKA 1DBMH 3FQTA 5AYUH 1MCCA 2FLRT 3FO1A 4MD5A 1CDGA 1S9YA 3Q0HA 3EZJB 2GJJA 1QRKA 5EA0H 4X9IA 5GRWA 1UEYA 1SY6H 4RMQA 5F6IC 2B8OT 2IQAA 2DQIH 1YPZB 1ZMYA 3FOLA 2Y6SC 1J86A 3RPIB 1S9YB 4F7TB 3KXFB 1AQDA 1Z5LB 1IAIM 3H3PL 5IM7A 1M7DA 3QZWB 1YDPB 3PNWB 3BT2H 3JV4A 4XGZA 4XAKD 3OR6A 4WTWA 3IKCA 4HBQA 1DE4A 3MJ8A 4RGND 5D2LA 1FNLA 5ICYA 2A6JB 4JVWA 4W6YB 4P46A 1QFOA 4WTZA 5DYOA 4ZXBB 1ZGLP 4JFDD 4GRWF 4L3AA 4N68A 1SY6A 4PFEA 3INUH 4J3UA 5HVGB 3JZ7A 1T2JA 2VN4A 4MYWB 5IEKB 1U3YA 1SJXA 1CFNB 4HGWA 2HFEB 1M71B 3SE3A 4LQFH 1OPGH 5I2IA 5E2JA 1A9EB 1T2XA 4K9EC 2CDFB 5IVOA 5IP4A 1SYSA 4H1LH 1K3IA 2F5BH 5ENWB 4ZPVA 1CYGA 4XZUB 2PUQT 3G6DH 3L5XH 2DL2A 3OAUH 4OCNC 3RWGB 4AZ8A 4XNYH 2BOBB 2NW3A 4Q9CA 2BNRA 4YNYB 5IV2A 1T1XB 5D2NE 2G75B 4LDLB 1NPUA 2ENSA 4EEEA 1RK0B 3RWFB 4PP1D 1BLNA 5GGVY 4OLVL 3U1SH 2BRQA 1A2YA 5D7LE 4IRZL 3PP3K 1DANT 5EC1A 4FFZL 1ZE3C 5GIRB 1BQHB 1RUAL 5TDNB 1FYTD 1DBJL 4R7DB 3DSNA 4L4VB 3PHOB 4DW2L 2ZJSL 4QOKA 1T89C 4PJCF 2R29L 4JQIH 4LCWA 3FFCD 3P0YH 4P4RA 3SBWC 2HKFH 3VXMA 4YX2H 5D71L 2FL5B 4GXVL 5JQ6L 3RVTC 3DHMA 1CGYA 5IQ7H 3L6FB 1NFDB 1I8KB 4HJ0D 3NZ8A 4M5ZH 8CGTA 3F6IA 4DKFL 3P77A 5ISZB 5J1SC 4NDMB 3EDJA 2DQTH 4MA8L 3V52H 5IROA 5ECJE 3NVQA 5GRYA 3QDJB 1FQ9C 1XGRB 1LNUA 3CXHK 1G7QB 4TOYL 5F3HA 1UM4H 3QXVA 4XP9L 1MVUA 3QUMA 4HFUL 1CDIA 3BGFB 3VFRA 4OKVB 3EYVA 1A1OA 1M7IB 3EAKA 5L2KB 4YHLL 3KLSA 2IQAB 3MRGA 5AAWA 5F9OL 3UTTA 1DBAH 1TDQA 5CIPA 4E41D 2AJUH 4JZOB 1GSMA 5I17A 1O7SA 3CNKA 5GRJL 4F7TA 5E8DH 2GHWB 5LAXB 43CAA 3GMQB 1EDQA 1YEIH 3PGFH 1E6OH 4RMWA 3BQUB 2R0ZL 3PGCA 4KDTC 5C6TH 4HKXB 5CS7A 5DUML 4ZAKC 5KVFL 4HDIB 2Z91B 4Z77B 5INCB 5JOEA 4K3EH 1VB9A 4X98A 3QUZC 5CP3H 4OUOA 3MV8B 5L6YH 5MHSD 4QHUA 2VO5A 1Z0MA 1OB1B 4OGAC 1XR9A 4PRAA 5BQ7A 5EH1A 5J6GA 1AXSB 3ZT7A 4M4RA 1DEEB 3HUJB 1J12A 2JELH 3ARGB 4IIQB 3U9PH 3OJDA 1CFSA 4LKXA 2MFNA 1NC4B 3FQNA 3FTGB 1JIBA 4P2QA 4XCYB 3UTPD 1M71A 5IBLC 5E5RB 3G6AA 2EXWC 1OAUL 1P1ZA 4K3EL 1D5IL 4HUVA 3WUZA 4XCEA 1MFCH 4Y19B 5DQ9B 4KMLB 4U1GB 2P43B 5KOVC 4HJJH 4KKBD 1PEWA 1BECA 1WZ1L 2OP4H 5F9WC 4G6AC 2YPLA 1PZ5B 3RHWK 4PJIE 5C0FA 3NA9L 2Y23A 4XCEB 4Z7WA 1HI6A 1DLHB 3CC5B 4WWKC 3GJFB 2NY7H 2CDEB 3SY0A 4ZFGH 5IOPB 1WEJL 4UUJA 4LBEB 2EDHA 3MRFB 4XPFH 1N26A 1L6XA 2DQDL 3I9GH 4GAJL 1TTFA 2D03H 3CFBA 1FE8L 4C56E 4MWFB 4L5FH 1OAYL 4RFNB 1RZ8A 1ZOXA 5IK3B 1CIUA 3B3IB 4MD4A 5KJRH 5DVLA 3T3PF 5C6PB 3GMPA 3TO2A 3T0XA 4PJ7F 2PCPA 1DBJH 1VCAA 4ISVB 3S96A 3HC0A 5KS9B 5CJOH 3QIBA 2P8LB 1OGAB 2YUVA 2MMXA 4TUOA 4R7NB 5D71H 4I3RH 3VU2A 1FFPB 1G7MB 4JPIB 2YRZA 1J8KA 1W0YT 4X9HA 2EICA 1MJ8L 3EO1B 2YPKB 5DJ2A 5F3HB 4GRLA 1U8NA 3NIDF 5D6DC 4R0LA 2R2HA 1BVZA 4AM0B 1H3GA 2E27L 4BFGA 2D0FA 4OKVA 1VEOA 1BOGB 4X0KA 2A6KB 1AD9B 1WVZA 1RIVH 4JRYB 1NGPH 3DETC 3RIAF 3TH4T 3PABB 5DK2B 1DN0A 1I9IH 4LLWB 4MD0B 3TZVB 3MR9A 3O81A 1NCWL 3H7BB 2AP2A 2BK8A 2Z31D 1NBZB 1KJMA 1UCBH 2I07B 1CE6A 1CQKA 4QNPF 1OARH 1CT8B 1YEEL 1MFAL 1DANU 1ZT1A 5EB9A 4M1DH 1JHKH 5IBLD 1J7VR 3LB6D 4LF3B 3RGHA 1A4JB 4U6VL 5JHDE 1Z3GL 2M8XA 3HKFA 3VMNA 1A1NA 1PKQB 1X9QA 4M6AA 2GKIA 5HXMA 2B20A 1KSRA 1UWXK 2AEQH 1QBLH 5KN5A 4JDTL 1L7TL 4GKNB 1K2DB 2OSLB 3V4UL 4PTUA 4MNGE 3LEVH 5CP7A 4ELMA 1CU4H 2ILLA 5DD6B 1JF1A 1SBSL 4Z7QE 1R5WB 2VZSA 3F12A 1QLEH 4XNZB 1GGBH 1GC1L 3QUYD 1K2DA 5TDOB 5I30L 3L3KB 1XCQB 3WDIA 3PL6A 3SQOH 1EUUA 3ZMRA 4XTRC 4KZEL 1MCHA 3QIUD 4KROD 2UZIL 5T3XH 4AMKH 5FHBH 4X6FA 4WW1B 3G5YB 4NZRL 4PJHA 4XNXL 1KCSH 2VNCA 1XCQA 5IB1B 4MZ2A 3DBXA 3KS0J 1J8HE 1RU9H 3EOYG 4WEBL 4QTIL 3UCRA 1RVFL 4U1IB 4LSUH 5I1AB 4M03A 5E6YA 5CILL 3O6LL 4KGLA 4MX7A 4HPYL 2DKMA 1ZHKA 5EO9A 2HFGH 2V7NA 2APWA 2XN9E 2CK0H 3LKPA 1NLBL 2QADC 4N5UA 4KUCF 3LPGA 2CRZA 4MD4B 1RZGB 4XNXH 3CH8A 1NKRA 1YNKL 2DYPB 4KJPC 3HG1A 4B7IA 1I1FB 3MREB 2YOCA 4URTB 3T0ED 3ZYOA 2JTDA 1Y6NR 5GSVA 5JR1H 5DK3A 4LBEA 2ESVB 1ZGLA 3ARFA 2YC1B 4G6JL 1SBSH 5DJCA 3M45A 4W4NA 4L4VD 4EI6A 4NN6C 1DQJB 4GW4B 3QCVL 2X4QB 1R0AL 5DR5L 2QADB 5J4MA 2WQ8A 5DRZB 3S8WA 1IBGL 4PRIA 4PRDA 1LMKA 1I1AA 4HMDA 2EDFA 3TO2B 4JKLA 4PJ9B 3QPQD 2VZ3A 4JY4B 3IDJB 1NUDA 5KVFH 4MXWH 3S96B 4NSKB 2D0HA 4Q74A 5C0EB 1RAMA 5ACZB 1INQB 4QXGH 4Y1AD 5J6HA 3DX8B 5D1ZA 4LRNH 5SX5H 5KSBF 5GPRA 5LVEA 4MCZB 1CFQB 2ED8A 5E00A 2YZ8A 3D85B 4M8QA 3IB4A 2APTA 4RX4D 4YHLH 2OBGA 1XF2B 4L4TD 2BY3A 2EC9U 3D2UD 1TCMA 1BJ8A 1N7ML 2HJLA 1A6WL 1S9XB 5E8OA 2EDLA 4RIRB 4PJAE 4I18A 3IFLL 3I3BA 1A5FL 1MWAH 2OTWA 3B8SA 4GKOA 4QWWC 2Z35A 1UGNA 3QISA 1ROWA 1IM9A 2VXTL 4M3JA 5IW6A 5DDHA 4JRXB 4UILL 4XBPA 5BS0B 5DO2C 2WP3T 3FQWA 1DL7H 4QCIB 2R0WL 5FM8A 3SKJH 2R69L 3NN8B 4GG8B 5TE6H 3VJ6A 2OTUB 4U0QB 1EZVX 4WTZG 2Y06H 5CINH 4QOKE 4RRPG 5DT1H 3KPRB 5EOTB 1JZ2A 4QHNA 3HUJA 3VMOA 1A4JA 4K94C 1BQUA 3T4YA 5IB4B 3C9NA 5DC4B 4KI5C 4M7ZB 4UOW1 2ATKB 3TO4D 2ADJB 3KPRA 3U30C 4J3TA 3WFCH 4NHCL 5EFIA 2NNAB 2A74B 2NW2B 5ICZA 1ZA6B 3MRQB 2R69H 1F90H 2IJ0C 2O5XH 2JCCE 5HYSB 3BN9C 3L5WB 2EYTA 1JCKA 2BSRB 5F1IA 4GMSL 3WNOA 4XAKE 3QEQD 1PG7X 1IZJA 1IEAB 1S7TA 3ECBB 3O11A 5SWQA 1MCRA 3QJFB 4OGXH 4FQCL 2VAAA 3OR7A 1JL8A 4WI8A 4KZDL 4Q6IA 1DQDL 3D9AH 3IFLH 3PWVB 25C8H 4NM4L 5JHLL 3PWLA 2FIRT 4OBRA 3X3FH 2VRAA 4NWTH 3ZDZF 1KPUB 2GK0B 3U7YL 1FGVH 3PDOA 1IT9H 3BPOC 3HR5A 3ZKMC 4LHUD 4YHYB 4ZDHA 3VGBA 4OCSL 3GIZL 5EU5A 2YBRB 2XICA 3JTTA 3W2DH 5C9JA 5IQ9B 4UT6L 1MCJA 3FOLB 5F6HI 1Y18A 4M4PA 3OKOA 2QJDA 2I5YH 5IG7B 5E8EB 4BFIB 4ZFFA 3RL2B 5HYJB 3QUXB 4Y4KA 1Y6KR 5HD8D 2H6PB 1MCEA 1IZKA 1HIML 1C1EL 2UYLB 1Q0YL 4LHUA 4X6CB 2JK5B 1RZKH 3VXOB 2BC4B 2HG5A 4JZNA 4KRLB 4XVSL 1AGDA 4LSPL 3KJ6L 4G8IA 2B1AL 3BGMB 3WLBA 4LVEA 1NBYA 4LSVL 4MLIA 3FRPG 1EO8H 3TLRA 1BVLB 3GB7A 5DJZB 5I71B 2GSGA 5BRZB 3LKRA 4KK9C 5B8CB 4WI7A 5E99L 4Y4KD 2X4UB 4TUKH 1E6OL 4E0RA 5FHAH 3AS1A 1S7SA 2OZ4L 1R3IH 4Y5XA 5B38B 4RMVA 1A9EA 2ZUQB 3HAEB 1NGXA 1OP3H 3ZKQD 1E27B 2ZUWA 2AAVA 5IIEB 2C3GA 1S7SB 1KN2H 1CE6B 3RWGA 5FUOL 3TCLA 1KTDB 2XQYG 1I9RL 4WEMB 2YMXL 1I7UB 1PYWB 1N64H 4MCYB 3K0WA 4FHBD 4LEXL 1VFOA 3NIGE 3T1WA 1Q9KA 3ETBF 2W9DH 5ADOH 3TCLB 2WMPA 2XYCA 3WLWC 1N64L 4LCWE 4PG9B 3FQUA 1C08B 3QIWA 4K07A 1QNZL 2Q7YA 1REIA 4UBDC 2VR4A 1PD6A 1S7WA 4OLUL 1LK3L 4JN1L 2X4TB 3NGBC 1XF5A 2R39A 5JW4N 1IGIL 3L9RB 2WINA 2A83B 1J0HA 1FAIL 4Q97A 2HKFL 5IMKA 5GRVL 1IQWL 2FHBA 4S2SB 3D6GA 3E2HC 2V2TB 1YN6B 4AEHL 1FDLL 3EDKA 4OZFG 4DW2H 2DDQL 1I7RB 1I85C 3DO7A 3K2MC 2ZCLH 1Q9OA 5L88L 1JNNL 4FZEH 5IHUH 4M6NH 5I15L 1QLEL 3DX9A 3BKJH 4HXBH 4P9MH 5FCSH 2VDRL 1H3PH 3KPLA 4U3CA 1CK0L 1FN4A 1J11A 3E2HB 5EO9B 3V0WH 2AEWA 1QR1A 4G43A 2ZUUA 1QEWA 5HHXH 3OAUL 3GRWA 5CBAA 1EERB 2BSRA 5IBUB 2AGJL 2FD6L 1YDPA 5T3XE 1G1YA 1ND0B 5FGBA 2BERA 5JMOC 1YNTB 5E08H 1BOYA 2IPUG 4KRMB 3WSQH 3VD5A 3VFTA 3MLVH 3BDBA 3BHBB 4HXBL 4ODVL 4QT5A 1X6NA 1P53A 1RZFL 3HLAB 3TBYA 3R8BB 3G08A 2VISA 4YLQT 4HQQH 2G2RB 4KH2A 1JN6A 1HHJB 3FFDA 2NZIA 2X1QA 1RFDL 2QQNL 1N2RA 5EPMA 1JWMA 4WI2A 4MJIA 2OYPA 4OF5A 2XV6B 1U8PB 3D69B 4JDZB 1X3DA 1LEKA 1LGVA 3LN4A 3HC4L 4XC3H 3MXWL 2AXFB 5CEXA 2CLVA 2W65B 1N0LA 3CVIL 1T20A 1I9JL 2RHEA 3UYRL 1OSPH 1X4XA 1E4XH 5H2BA 4NKIH 5E00B 3CGTA 4G9FA 4LU5H 4JZNB 4MA7H 4YXHL 4QF1B 4H25B 4POZC 4N0YH 4U1KB 1FHGA 3DUSB 4TNWF 1NJ9A 3RTQB 2GSGB 3DI2B 4EI5B 3K1DA 3P4MA 1B0GA 4U1LB 3SJVA 4F7PB 1BPVA 4KHTH 3EYFB 3T3MF 1A3LH 4NQSA 4ZD3L 4XPGH 2YS4A 4OZHA 2VIRB 4JJ5B 2DB8A 4JHWH 4XNZC 4NQDE 1UQSB 1S7VA 5ETUA 3BRFA 5AWNL 3K4AA 2IPTH 2CKBA 4O02L 1NEZG 5KTEL 2NY7L 4DQOL 5DHXB 1GPOH 3KYNB 3PWNB 3MOBH 4NZUL 4ODWA 1A7NH 3UZQA 5E2UL 3UTSD 3W5NA 3V4PH 1B90A 3REVA 4HK0A 2OP4L 2VAJA 4WFGE 1KTLB 3BAEH 1KB5A 2BP3A 5L2KD 1BHGA 5EZIL 2LU4A 2B0SH 3DSFL 4Z0BL 1MHPL 2NX5B 4J4PD 4HUUA 2DLHA 2OXGA 4ZODA 3AFLA 3DURB 2WLZA 3VWKB 4P2YA 3UTZB 3DX9B 1BVKA 4U1GC 1JYVA 3WN5C 1FNEA 1YEFH 3HB3C 3V4PL 4BH8A 3QUMH 4JAMB 4YHIA 4MA1B 43CAB 5C07D 3PWVA 2GJ6E 2UWEB 2ADIA 2IALB 5JXEC 3NTCH 4GQ9H 1KG0B 4WDIB 4NRZB 4EN3C 1G7PA 3ULSA 3PL6D 2GEEA 1KBGH 1MLCB 3GKZA 1FH5L 1QFWM 3VWKC 3EJYC 5FYKE 4GS7B 1WV7T 4NN6B 5H94A 2A6DB 4FQCH 4X5XA 4RZCA 1N5YL 5HYQB 3KYOA 5C07E 1UACL 2VDLH 3G08B 3ILQC 1NCBH 4FQ2L 3U0TB 5C08B 1MNUH 4PJ9C 4F15B 5D6CB 3WFHB 4PRPA 5IMLB 1O5DT 1CL7L 4P2QB 4XCYA 4ZS6C 1RK1B 4ZG1A 1NMCB 4K3HA 3V6ZA 1M05A 4HPYH 1U8PA 2SEBB 3TC9A 5HPMA 3NCMA 3VA6A 2NTFB 3ARDB 4M7LH 2BJML 3V6OA 1YC7A 5C0JB 4YDKH 2ZUTA 1YYLH 4YX2L 2XN9B 2HFFA 3IDUA 2P1YA 4HGWB 3I50H 1U92A 1JV5B 5DUPH 3QB7C 5J1AA 4LASH 1CXLA 4XMPH 1Q38A 4OLWL 3AGVA 2WIIB 3OJDB 1RJLB 3VXSD 4MSWA 4JCLA 2B5IC 5I75B 3SOBL 4ZO9A 3SQBA 5HHVL 3VE0B 2EH7L 2R23B 3CVHL 5IW1A 3HCVA 2DQCL 1E4XI 3GZKA 4NP4L 4NNXA 1K6QH 4ZO6A 3NFNB 4KU1A 5T1LA 5E2TL 2E9IA 1RPQA 2G75A 1IAII 2C1PB 1N8ZA 4RGNC 3VXSE 3RWJA 4AENA 3TH3T 3TNNA 4KQ3L 1VDGA 4DKDC 1AI1L 3WSQL 1F02I 2B5IB 3MXVL 3QUZD 4E5XA 1QLRA 3T65B 4BUHA 3LS5L 2VB5A 4ZFZB 2IMNA 3ZYJA 4LQFL 1U8OB 3N0PB 2P8LA 5IHLB 4YNYA 1FNSL 5I1EL 1I8LC 3NACL 3UYPA 5FXCH 4WWID 2BNQA 4XVUD 5EUKA 4ETQB 2VLLB 1FLRH 2NY5C 4LSRL 5IMKB 1QPPA 3RBGA 3GGWA 3MLZH 4OQTH 5I1GL 1EHLH 4XXDA 5CJQL 3TFKC 3TWCL 1YC8A 1A6ZA 3QQ4A 3VWJC 3K3QA 4KKLC 5C09A 4UDUA 3MLVL 2YSSB 5IHZB 1FO0H 4WIQA 4P99A 2X44D 4GSDL 1GAFL 2FL5A 2P45B 3NACH 4RFEA 4JAMA 2DWDB 4WGVB 1LK2A 4NN5B 3MGTB 4J3XA 4OFIA 5JXAH 3HZMA 3HPJA 5FYKD 1JYWA 1FVEB 3QEGL 3V0WL 3TIEA 5GS1B 4GAFB 3GSOA 2COQA 1MVFA 2QR0B 5IF0B 3ZHKA 3S5LA 1E28A 2QHLA 5IWLC 3MBED 5FCUH 5IHUL 1KIPA 3TO4A 4E42A 4OV5A 3HZVB 3ZHLA 1WQVT 3QUXC 3ULUC 4FA8A 4IRJB 4M00A 3KLHD 3KYOB 3NBNA 5AYUL 3V0VB 3O4OC 2H3NA 2VLJA 1LHZA 32C2A 4JY6B 4ELKA 2OTWB 3PXJA 2C1OB 1I8LA 2VABA 3CX2A 1G7PB 3ALXA 5FK9B 4K7PL 1OAKL 4JFED 5D96C 3RZCD 5HHPB 3WKMH 2KPNA 4FQ2H 1EAJA 3DV6B 5H94B 4ESKA 5C0GA 3U2SB 1YY9D 3KPRE 3QYCA 5EOQH 1JUFB 2FHCA 1FC1A 5DD5L 2H32A 5DJ6B 5KN5B 3WJLC 5BW7C 3RKDC 4RMUA 5DJYB 3JV4B 1EO8L 1HHKA 3EGSB 1YMMB 4L8DA 3O3UN 2W0KA 1NDGA 5FYJH 4G9FD 1X7QB 5T3XL 5ICZB 3PHQB 3T3PE 3WKML 3I6LE 2MPAL 3BP4A 4MS8D 2EYTB 1UADC 3PXHA 5J89A 3NIDE 5ALBH 5IOPA 3PHQA 5F7YC 2WIIA 1JF6A 3CLFL 2IG2L 1I9EA 4JPWH 4JFDE 2F74A 3I6LD 3FONA 1T0NB 1KPRB 1MHEA 2FNBA 1ZV5A 2DLFL 4WEUD 3G5VA 1BFVH 4PJIF 2VXVL 2BNRD 2Y6SD 5A2LH 3RWEA 3GJFA 4ISVA 1MCIA 4F57L 2I9TA 1GPOL 3C8KB 1IC5H 2RB8A 4JDVB 3P0VL 2PXYD 5F6HJ 3HS0B 4GBXB 1JZ8A 3BKYL 3MO1A 3EFDL 4BQ8A 4JG1L 4TVSa 3RVUD 4XBGA 3GSNL 3IDYC 4X80H 1I1AD 5IT2L 4JY5L 2B0SL 3DSFH 5GIRA 1H3XA 1OCWL 3GMOA 5CFHA 1G9ML 1A6VL 4Y2OA 5I1GH 3F7RA 4Z76A 1QUNA 5A3IC 5D72H 3T0EB 1F8TL 2AEPL 3UJIL 4ODTL 1MCLA 5DJXA 5JPNA 3GMOB 4UTBL 5GGSY 2ICEA 1YQ2A 3TIEB 5GS1A 5CZVL 3LKRB 4M43L 5JHDB 3PIQB 1E28B 2FWOB 3V2AR 1T5XA 1INQA 1S3KL 1XR8B 2YSSA 4NHUB 5EULV 4PGJA 2CGRL 4P57A 4B50A 4Z78B 4ODBD 5GRXG 4NM8L 4XWGH 5ERWA 3FQWB 1BOGA 1F58H 4V1DD 1NCUA 4IOSD 4X0KB 1WAAE 5C7XH 1R5VA 3T0EC 5L9DH 3BIBX 3O3BA 5BVJB 4LARL 5HDQH 3TN0D 4HKXA 4CVZA 5GS3A 3U6RB 4HLZH 4QO1A 3LDBB 2NQCA 2XY2A 4ZUVB 3KXFD 4ONFL 1KIRB 3MBEB 3MLXH 3Q48A 4RA0C 4TVPE 3QPXH 4XGZB 4D9QE 1ZT1B 3T0AA 5I1KL 3QEQE 4ZS7H 4LNRA 2DN7A 4K94H 4QRPA 4XNYL 5ICYB 1D5BA 5E4IA 4CVXB 5ESAB 4V2CB 4LQ1A 3S4SA 3WN5A 2VXSH 4Z7OE 1WTLA 2NX5D 3S37X 3AM8C 2E9WA 5FK9A 3DYMA 4HD9A 4M7JH 3G5YA 1CDUA 1CFTB 2OCFD 3KLAA 4PJ8C 1YN6A 2FSEB 4U3XA 5M7QA 2MQCA 5CZVH 4LMQE 2Q76A 1IGFL 2NXZD 3DX7A 3DHJA 3QNZA 5BZDA 4F37K 1FORH 4JVPA 5IFAL 2L7UA 1IGMH 2CKBH 2R4RH 2GK0A 5DC9B 4N9GA 2QQLH 3ARXA 2AEIT 4NKOA 5MEQA 2WK2A 4IMLB 4G6KL 4KQ4H 2BVUA 1RHHB 4HX1A 2CRYA 1QP1A 3KYKL 3GBMH 3DVNA 1XGYH 4PJFF 4JO3L 3VRLE 2XA8L 1IQWH 4JHBA 4I5BA 3VXQA 4LPYA 1CK0H 1KNOA 3HHRB 3PGDB 3B3IA 1F3JA 2BOCB 4ZPTB 1UM4L 3P9WB 2V7NB 2DQIL 4FNLL 3QUZB 1S9WA 4LP4A 2R1YA 3QRGH 4DKEL 3GSRB 3VXRD 1YYML 3O6LH 2EIZB 3KLHC 4RISL 2IGFL 4OQ1A 1FSKB 2QHRH 3IS0X 1PW3A 5F9OH 5JW4Q 5C6WH 2CR3A 4YE4H 1HHJA 3AB0B 4XMKL 5INDA 4AJ0A 4ORGB 2DD8L 1WIUA 4C57C 4L4TE 3HC3L 4P5MB 1MCWW 2NZ9C 3SQOL 5GZND 4JR9L 5D5ME 5GGSA 1JHLL 1CFQA 2ZG1A 3MJ7B 4OB5H 4YH6A 4ZFOL 4G6MH 1CGVA 1HWGB 3CZFB 3MGTA 5AUMB 5MEOA 4HIXH 3C5ZA 3BUYA 4EBQL 2OZ4H 3SGJA 1XIWC 4MA3A 2F5AL 4Y4FC 2QL1A 3O2VH 5CILH 1VADB 5LGHH 1T3FB 4EBQH 2Z8WC 3RY4A 2G9HA 3QWRD 1EEUA 4TQEL 1CLYL 3VI3F 5GZOC 4Y4HC 4MA3B 3D85D 4NQDA 4E41B 4IDJH 4KK8C 1DBKL 4S0SD 1VFBA 2GI7A 5D1ZD 2FJGB 5GSRA 1KTDA 1J0IA 4Z77A 1XIWB 3QPQC 1CIDA 1DUYA 3QDHA 3U1SL 4OM1L 5TE7L 4DGYL 1E4WL 4DWHA 5I75C 1JUFA 4PP2A 5K9KB 3CJJA 3UC0L 2ZUYA 2AEQL 2A74A 5M94B 4XRCA 4P2QD 3T77A 1LO4H 4HKBB 1LO5A 3ZTNL 3UMTA 4MNGA 1TFHA 3EGSA 3BW9B 3LQZA 5I1LB 2ICCA 2X9WA 4CADB 1OTTC 2A83A 4ZUSA 1EJ6A 2E7BA 3OX8B 3UEZA 1LP9F 5EOTA 1RMFL 1RJYA 1W0VB 2VZVA 5GGUB 1UM6L 5J3HC 5L8LB 1JRHL 3OJMB 1MLBA 3GJEB 3WHE1 1ZEAH 4Y19E 4P2RB 3G9AB 3U7AA 1PSKH 2DTMH 3SPVB 5HY9A 2NX5E 3X12A 1I1YB 4OIBA 3I85A 3T2QA 1NKOA 2J5LB 3F58L 2DI8A 5DFVC 2EEBA 4WV1B 4OLYH 4TSBL 4RDQF 3RNKA 3H2WA 1PX3A 3PJSA 1NCNA 3U7YH 4LSSL 4OI9A 1PQZA 2XXCB 5A2FA 5IFHH 2EKSA 4DTGL 3QQ3A 3DBXB 1IGYB 2AJVH 2G2RA 4J3VA 2EDBA 5C2BH 1QSEB 3MV8E 1O0VA 4XX1G 5DJ0A 1IGIH 1FC2D 4UB0L 5EPMB 4OD3L 1TJIH 2E7HA 4WGWB 3SGJC 4PJ5D 5C70A 4LHUB 1P6AB 3I50L 2BC4A 3VXQB 2VWEE 1MSPA 4ZOAA 2O61B 1OP5K 4OLWH 4XBGB 5HVFB 4KI5E 2ZCLL 3Q6GH 5KVGH 4JPKL 3ARFD 3QUZA 3CXDH 1D5MA 4PJXB 3LOWA 4ZFFB 2YPLD 4XNQA 4MAUL 5ID0B 4R96B 3QFJB 1FAIH 1CL7H 2OL3B 4Z7OF 1N5AA 1JWMB 2ICWB 3UO1L 2V5SA 2KBGA 4Z7NE 2D7TL 5D5MB 1KXTB 3F65A 4ONHB 1SEBB 4R0LB 4YHMH 1F3DH 1UACH 4Q9BA 1LD9B 2BNQD 1AGBA 4FQJL 5HHOE 1EEZB 1RZIA 2H8PA 5L7XH 4WFED 3QG6A 4X6DB 5HYJE 3V5KA 3X17A 1P84K 1DN0B 4MD0A 5MEPA 3K8MA 5BV7H 5T1LB 3M8OH 1GGIL 4H25A 4HS8L 2IANA 1W0WB 3E1F1 3VFSA 2AS5M 2E7LC 1MY7A 3WDJA 3ZHDA 4M9OA 3UTQA 2CH8A 3HRZB 1A6VH 3QCVH 4HG4K 3MA9L 2X4RA 4IRSD 1KCLA 1FO0B 3WIHH 4U6HB 5F93C 3T65A 4H1LG 3LKNB 2P46B 1R5IB 5EORH 4RGMC 1QFWH 4EVNB 1GGYA 1QVOB 3S37L 4NO3B 1JMXA 3ARDC 3DVFA 4EXKA 1A6UH 3L3HA 1OSZB 1XGPA 3QDGD 2P7TA 4JRYE 4XVJL 2C3WA 5E7FA 4DGIL 3X3GL 1T5WA 3VXMB 1JNHA 4QRRE 5IMMB 1CICC 5E8DL 4ENED 4DZ8A 3NIGF 1EMTH 5JO5A 1R3LA 4RGMB 1EO5A 4OZGF 3WBDA 3VW3H 1ZLSH 5EZLB 3ROOB 3O11B 5F3BA 1PJ9A 2XTJC 2EDJA 4A2LA 3EKCA 4MAYC 4P2OD 3GIVA 5IBTH 3VWKA 4I0PD 4DJMA 3DXAE 3O9WC 4NQXB 3F7PC 4PJ5B 1FG2B 3UROR 3X11A 4H26B 3RGVC 5CD5D 1ZTXH 3DVGA 4ZD3H 2NZ9D 3GIZH 4NWUH 2FH8A 1NH6A 3WFBH 2E8YA 4R90L 1A6TB 3EFFB 4P3DA 5DQJA 5I66B 5MI0B 4ACPA 4LLDA 3MOBL 1E4JA 1C5DB 1IC1A 5D2LB 4DKFH 4MVBD 1NQBA 3DUHA 1KACB 5HYJA 2VL5A 4U1JA 4QXUL 4NFDA 4UT9L 3B83A 3K80A 2Z91A 2OK0H 2VZOA 4OZFA 1H15A 3RWIA 1B2WL 5K9OA 1AKJA 4LSTH 4O58L 4BFBD 2HT2D 1S3KH 5F7UA 4KROB 4L3CA 3ZL4H 2BCKB 3H42H 1QKZH 2BDNL 4OZFB 4Z7VF 1UFUA 2ZP0T 4G42B 3TBTA 2VUOA 4U4BA 1CXFA 2HFFB 5HDLA 1DDHB 4J3SA 3CIQA 4AIXA 2NY2C 4JM2F 4ZAKA 4PREA 5TE6L 2ZKHH 5FO9A 4ZOEA 3RDTC 3RKPA 1RJZB 1W72L 1KGCE 1MWAB 1MY5A 3GKWL 4QXTB 3TJHC 1YNLH 5D7JA 1UC6A 3MRRB 4OCRH 2AK4A 3O9WD 1UCBL 2A9ML 2HJFA 2JB5H 3ILQD 1PYWA 2APVA 4MCYA 1PLGL 5I16A 3O8XD 5EIIB 1WICA 2Z35B 3CC5A 3FFCE 2CKBB 4PG2C 5GS0L 2VDKH 5HDBF 5I8KH 1MCWM 3O0RL 3QH3B 1JNJA 4YDIH 5IEHB 3STZA 4N0FB 2VE6A 1B3JA 1HXMA 4FABL 1F13A 3BQUC 3L6FA 4GG6A 1DQQB 4N8PA 2ZZUT 4I0KA 3U4AA 2X70B 1INDL 3ULUD 1JPGB 5DJDA 1RSFA 1YA5A 5KSUA 1MHCB 5DMGD 4TRPL 5LGJA 3MV7D 3ARQA 3ULVH 3I2CH 1R3LB 4PG9A 2NY3B 4Z7WE 4YHOL 4CADA 4DOHE 3BZ4B 3CLEH 2X1OA 4YWGL 1P4BL 5FV1L 2NLJB 1EXUB 4PJDF 1HOCA 1U8QB 4PYGA 4G9DB 1BBJB 1QQDB 3D39B 3KG5A 1VFAB 2VSCA 1HHIA 5F7DB 1JNNH 4WDIA 4L5FL 4LSUL 5FKPB 1VSCA 5DA4A 1MRCL 1XF4B 3IAPA 4BZ1L 1XGRA 5D2NB 5AD0A 1Q1JH 2HRLA 1KN4H 4P5KB 3KDMA 5E2WL 3C60C 4DCQA 4JFPB 1TITA 3HE7B 3SGKC 2VSDA 1FSKC 4BH8B 2GJZB 1S78C 2EYRA 4NPYB 1KCKA 1SYVA 4NZTH 4ZDHB 4QT5B 4Y16C 4QLRA 3KHQA 3AS3A 1TJHH 4K8RD 3PNWA 4M61B 3OKLB 4EN3A 3D0VB 4JFZH 4KJQC 1JNLL 3VFGL 2D0GA 4GBXC 3RVWC 2KQMA 1QSFB 3VMPA 4NFBA 1MFCL 3ZDXE 4PJEB 4KV5F 5K9OB 3DGCR 4F9LA 3PP3H 1CLOH 2WWMD 3KLDA 1J1XL 5IKCA 4IEFB 1CF8H 4DUVA 2ZSVB 4PJCA 2YD9A 3ZE2E 2NYYD 1D5MB 3LHPH 4PJXA 4XP4L 2OJZH 3DV6A 1P4IL 4GMTL 3UTOA 2ERJB 3S4SB 2JIXA 3V7AG 2R4RL 3NMEA 3LKSB 4LDOB 5SWZB 4GT7A 5T1DL 1NMBL 1KB5H 3ZO0A 4Y4FA 4IIQA 4XI5D 3K2UH 2P8PA 3ZYZA 1BX2B 1KXQE 2X7LB 3GBML 1T1WB 3W11D 4KMTH 1JV5A 1HQRA 3SO3C 3L3JB 1MELA 5DMKB 3FB5B 3QXTA 4U05A 2FGWL 4DN3H 5LQBH 2FIKA 2CPCA 3BWUC 2ERJC 5DMGC 4Z95H 3CMGA 3U4EA 2B2XL 1NSNH 4FZ8L 1J8HD 1AO7D 3LMJH 4OTXL 5MP6L 2IPTL 4AK1A 3SCMD 1WZLA 4WW2A 5HGBB 2FIKB 3ULVC 4NN7C 4Y5VC 4N0FA 4HT1H 1HI6B 3IGAA 4QY8B 2PCPB 2I24N 3QIUC 5HGAA 3ULUE 4HWZA 4YUEH 5D1QA 5ANME 3AREA 4JFQA 1OAXL 1FYTB 1QLRB 4KC3B 1BLNB 3WO4B 3D2UA 1DVFB 5GS0D 3LSOA 1YPZE 5KTEH 4XVTH 4JFXB 3QUYB 1ZT4B 5E0QA 3ES6A 3EW3B 5ILTL 3GHBH 3ARFB 4B7LA 3M1BB 3DJ9A 5JIIA 4PJDE 1JPFB 4HT1L 1C5BH 3ROLA 1ES0A 1M1SA 2VLKE 4OF3A 4KZDH 4RFOL 1EJOH 1T5XB 4LFHD 3MUZ1 4I2XE 1DCLA 2QSCL 3MRHA 2Q6WB 4W4OC 5DMYA 4P2OA 3EIFA 2D31A 3EYQC 2JLLA 3SE3C 4WUKH 2X1WL 4CUCA 3OJ2C 1ADQA 3QUMB 5JZ7C 1G84A 2Z92B 3AXLB 3F5WB 3ZKSD 1G7JB 4FQXC 1BIIA 1NC2D 4LLUA 5TPWL 4KKNA 1A64A 3V5HB 4X4MA 1MJ7H 3JUZA 4WTXA 3MZGB 1KPVB 2H9GA 1KEML 2W59A 2EDOA 4KGJA 3CSYB 4ZUUA 3P73B 4MXQC 3MGOA 2OTPA 5IBTL 5CJBA 2KZWA 2XZCH 1RUPH 2PTTA 1KPVA 3V4VL 3EHBC 4OF7A 4Z78A 1KELH 1BGXH 3WO3B 3GRWL 1A1OB 2EKJA 4TVPL 4PRPB 4NQCE 2F19H 5D8JH 4YO0A 3RI5K 1EIBA 3KNBA 3B6SA 2R4SL 4Y8AA 4YHZH 5EC2B 4KRPC 4RWHA 1S7RA 2XWJA 5A16B 3AB0C 4LNVA 1TXKA 3AAZB 3G6JB 3BXNB 3INUL 3SKNB 3OXSA 4X6EA 1BBDH 1IM3A 1LEKB 5CD3A 1VESA 1AP2A 4L8SC 1R24A 3JSSA 3MNZA 1A9BB 2FX8H 4PBWD 3T4YB 3V6OE 2IFFL 5KAQG 5TGBB 4U1IA 4EDWL 1QSEE 3L3IB 1CXEA 2NW2A 2E6QA 2ZUXA 4P46B 2EH8L 4N1EA 1J05B 1P7KB 3U36B 2VZ1A 3IFOA 4U6TA 4WO4D 4R2GC 1NJ9B 4GW1A 2DYPD 4FQPA 5CJ8A 4UZGA 3L3IA 3HMWH 4OZIF 4KHXH 2PN5A 2DQFB 4WW2B 3SN6N 35C8L 3CDYA 5IB1A 2BHYA 5DR5H 1HQ4B 1B6UA 4OCXH 4PTTB 3HB3D 2IFGA 1YECL 3IJYB 1CZ8L 1RU9L 2YK1L 2W9DL 2E7CA 4YGVA 4J6RH 3PDOB 5ESQB 1NEZA 2IH3A 4YFLF 4NGHH 1KGCD 4F9PC 1ORQB 5FUOH 2JJWA 2DQEL 1MHEB 3K4ZA 4HGMA 4PRIE 4WUUB 1CG9B 1ZANH 1J1PH 1VKXA 3JVGC 3E6FA 2VUYA 4PR5B 4BZYA 5ID1B 2YUXA 3GSVA 5I0ZA 5C0EA 2HFGL 4KPHH 1P4BH 3MRPB 3GJFH 3W39B 1TJIL 4HS3A 2D4DA 4GXVH 4O4YH 2GYSA 3D2UB 1FL6A 3B4NA 2X4QA 3QFJA 5HGDA 3DUUB 2EH8H 5MI0C 4HS3B 2CIKB 1BZ7B 1IGCH 3GSXA 3ZE1E 1NGQH 2DBJA 3SE9H 1HXYA 2CSPA 3DUUA 3TNMA 2Y1VA 2W9EH 3L7EA 4PUBL 2VDPL 3RPKA 2H26B 2D31B 3B43A 5BS0E 2D7NA 5CEZH 2AABH 2R2HB 2F8OA 5C3TA 3QDJE 5LAXA 1CU4L 3A6CH 3MUY1 3O6FC 2GUOB 1I3RB 4S10A 2KUTA 2OTUA 3F6LA 3QFDB 1A47A 4KROC 4P57B 5I76B 4OFYD 3S5LB 4E41A 3VFRB 1S7XA 1VEMA 4M62H 2M2DA 2VXQL 5EU4B 4GXUN 5JPMB 3KPQA 4WUKL 3FMGL 3TBVB 1Q0XL 2XXMB 3UC0H 1FNGA 1S7XB 2UY6A 2I5YL 2WP3O 1GOGA 3MNZB 2R0LL 3BEVA 3NN8A 1VERA 2D9QB 4FQQA 3VXUB 1QR4A 1LEGB 5IB2A 1UJ3C 3V5DA 3BKJL 1KC5H 4IOIB 3HZKA 1KJ3H 5JO5B 3GSWA 3U79A 1NAMA 3WLWD 1P6FA 3B2VL 3EDDA 4D9QD 4FMKA 1NCDL 2YPVH 4ONGH 5J6GB 4UT9H 3VWJD 1T83C 1U8JB 4L3EB 1IJ9A 4OGXL 2HT4C 2VKXA 1OAYH 4WUUD 1AKJD 3KPTA 4O2EA 1X5FA 2PYFB 2JCCA 5TGBA 5FF6A 3GJEA 1UH4A 2LV4A 3SDAD 4MNQA 2HT3C 3SPVA 1KT2A 4JN1H 4S1DD 3TVMB 1I1YA 4HLJA 2EDRA 5BJTB 1KJ3L 3L3DB 1UH3A 4NHCH 4WJ5B 3N06B 5HHQB 1QOKA 4EQ3A 3NIFF 5I1DB 1T7VA 1BQHG 1RZ8B 5LWYH 3SCMB 2FX9H 4JR9H 1MHHA 4XCCH 1G0XA 5DMIL 5IFJA 4M93B 2R1XB 4Q58C 4JFQB 3LV3A 1R3KB 5ICXA 4C58B 3FFCA 1M7XA 2MCPH 2Z31C 3C6LD 4CN6A 3BH8B 2EIBA 4PJFB 4WFEE 3UXFA 3QA3B 2W0LA 2X9YA 1RV6X 3MLTB 1P7QB 3P0VH 3H3BC 4ODSH 3RWEB 4NBZB 1DN2A 3C5SA 3MREA 1ZGLM 2A1WL 3IDMB 4P9HL 4YBHA 4G6FB 4JPVH 4MWFA 4NKDA 3VXSB 2DOCA 3LHPL 5GSVB 2H8PB 1RZJL 1H5BB 3J7HA 3RY6C 5D7IE 4MAYB 1K4CB 3O3AB 5HHNB 5ID1A 2HTLD 3QNXB 5TF1L 3MBXL 2MWCA 4Y16B 5CBEA 3KWWA 1WFOA 3ULUL 2ED7A 2Z8SA 1BVLA 1OGTB 3S5LG 4R7NA 3GSOB 3HPLA 4QYOB 5E8OB 5C0AD 4PV8B 1I7UA 1FL6B 1MF2H 5JUEL 4HUWA 3HI1B 2FO4B 4FQLL 3CZFA 3U9UA 2Y36H 2J6EA 3GI9H 2HT4D 5E1HB 4PBXA 3BUYB 1AFVH 4Y1AB 2C7UA 1RUPL 4IRSA 1CF8L 1CDJA 1FPTH 2H3NB 2X40A 5GGQH 4L8BB 3FB8A 1QVOA 4LF3A 4C54A 3O3DB 5D93C 3P3YA 4TNVK 3MFFA 2NXYD 1BP3B 4U6YB 5TF1H 3DIFB 4OCSH 3BDYL 4P9HH 3O6KH 3MRJA 3Q6FA 4M1GL 4JM4L 3BAEL 4Y4HA 2DQTL 4MA8H 5TJWK 4BK5A 1U8LB 5BS0D 5JDJA 3H9SB 5HI5C 3REWB 3DIFA 2DL9A 3OMZA 1JF1B 3MLPA 2ATPB 1BZ9A 1XR9B 2NPLX 3UO1H 5DEFA 2HTKC 4F33B 5L2JB 4QTIH 2VH5H 1M6OA 3UTPE 3TBWA 1E6JH 1U8LA 5HD8C 1A3RH 3MX0A 4YHKL 2R29H 4H0IA 5FHBL 3ULVL 4WVRA 2X4OA 4BZ1H 4HZLB 4MQTB 3W0WA 1X7QA 1K3ZA 1IEAA 3ECBA 1RUAH 5SWQB 1C16A 1YEKH 3BEVB 5ESAA 4DZ8B 4BH7A 3TIDA 4G8GD 4MNGB 5GJSH 3RNKB 1XGUB 1Q8MA 1JTOA 3M07A 3NFPB 3LS4H 3MJ9H 1TPXC 1W2KT 2VDOL 5HHMD 2NNAA 1RZJC 2CGRH 4LLDB 4P46D 5KSBE 3OGCA 3CZJA 1N3NB 3GFUA 1CGWA 5I1DA 3HAEH 2V2XA 2GAZB 2A9MH 5D7IA 5E5MB 2J8HA 4EZMA 2C26A 3MRFA 5B21A 4L3ED 4EI5C 1ONQB 3NFSL 1J8HB 4ODVH 3RWIB 2H2SD 1U8KA 4XXCC 4N0CC 1V5JA 1IC4L 4OFVA 4PJAB 1FO0L 2HN7A 2FD6H 5DJCB 2Y7QA 2C3XA 2XNAB 4KUCD 3WFEL 3HC0B 5CJQH 1EHLL 3JWDL 4OKDA 4C4KT 3EOBB 2MHAB 4PJ8B 5DO2D 5J12B 5CCKH 2QEJA 3G5ZB 4HXAL 5IVXB 1LO2H 4NC1C 4OI7A 4M62L 5JPNB 2V17H 5D7LD 2IAND 3MRRA 4D9RE 2B4CL 2BVQA 4HW6A 2P5WB 4XCNA 4QTHB 3LCYA 5DJAA 4RNRA 4ERSL 1NUGA 3RJQB 1E27A 2OL3L 1VADA 2GW5A 1UVQA 1MJ7L 1RY7B 5IIEA 4JFFD 2PW2A 4R97B 3RVTD 3NIFE 4Y1AA 1KUMA 2EEDA 4HIXL 3EYFA 5CEZL 1BFTA 2AKRA 3DX6A 5IJVB 1UVQB 3GM0A 4YAQB 5DLML 4U1NA 4E0RB 1XF3B 2J8UB 4NWUL 4TSAL 1CLYH 3RTQA 2N56A 2OK0L 4EVNA 1I1RA 4M8QB 1FDLH 4LAJH 2DQUL 5I16B 1AR2A 4U1NB 5JDSB 5L2KE 5GRVK 1WITA 2E8ZA 4GS7C 3RWFA 2HT2C 4GRMB 5T33L 4ORZC 4UT7H 4G80B 4X6BB 2XZQL 3UTQB 1X4ZA 4WI5A 3D0LB 3I02B 5ISZD 4P46C 2YKLH 1NDMB 4OUUA 3VFUB 4LEOA 7FABH 3VG0H 4MQXC 3DO3A 2DQGH 5KSAB 4NC1E 3DO7B 5I9QB 3ARRA 2ADJA 1U58A 2F53B 2NY2D 5DGQA 1WCBA 2H32H 4BQ9A 1JPGA 3Q2CA 3GGWB 2ITCB 4HK0B 1A21A 4YHKH 1NFDE 5F7FA 3RA7H 4GLRI 1FPTL 3EOTH 4KK5C 4WI6A 4RMSA 4UDUB 3NZ8B 1YECH 4GXUM 1NCBL 3S37H 4X6FB 3P77B 1CGTA 3MRCB 3U0WH 5E24E 4JHAH 3RHWF 5EN2A 3OR7B 1WZ1H 4XVSH 4NPYA 5KSAC 5DRNB 4JM4H 3SKUD 3G6JE 4KDWA 3WDHA 2DJSA 1LP9B 4HJ0C 1MFEH 1MCQA 1QFUL 4NKQB 2YN3A 2F8XC 2H9GB 3C2AH 1A0QH 3L1OH 5GZOD 2YD1A 3KPSB 4X5LA 1XF1A 4LHQB 4OSUH 3R1GH 3R06B 5C0CE 4D9LH 3QQNA 1F3JB 4H0GA 4JHAL 1G7IA 4F7MB 2SEBA 4MXVE 4XB8A 4NO2B 1DVFC 3WIFB 2YD4A 3FB6B 3P9MA 4R8WH 4A6YL 3QUYC 2EYSB 5HYIA 2DQHH 4KK8D 1CLOL 4HIEA 5EBLB 2ZKHL 5D6DA 1S5IL 1UCTA 4WWKD 1U0QA 4KY1L 1QZ1A 4JG0H 2ICWJ 1TQCB 4TUJB 5D7KE 5HHPA 4X7EC 2VLRE 3DRQB 5IMLA 1EGJA 2ICWI 2VQUA 1IVLA 3LVEA 3MV8A 2GTWB 3VH8B 2VC2L 3QZWG 1RZJH 4PRIB 2V7HA 4ZOCA 4OBSA 2W07A 4UBDD 1N59A 1G6RL 4O5LL 5FDYA 4NM8H 1FGVL 1MEXL 2XN9A 5E2WH 3VWJB 5CGTA 5GS2H 4JHWL 3BPNB 1TQCC 4JZJA 5EG6C 4ZFOB 5DVMA 4XHJD 2LU7A 3RU8L 2G5BA 2ZG2A 1UZ6F 3BVNA 4OZ4A 1JGLL 4MJID 1TQBB 2XRAL 2NY1B 3VA2C 1K8DA 5E1AA 4HWZB 3PWPA 3P30H 2IAMB 3QH3A 4RIRA 3O2WH 4YR6B 1IL1B 4YPGA 1AIFA 1MWAA 4QXTA 1N4XL 4LPXA 1GXEA 4PJBF 4OZIE 1MEXH 5F7EH 5EBMB 3I75B 3UZVB 2XI9A 1XH3B 3P40A 3BPNC 2AI0L 1T66C 4P23C 4XBPB 5BS0A 3RTQD 4NQEA 4LDEB 4OZFH 4GRWH 1JI1A 4LIQH 5BMFL 4HBCL 3CFBB 4Z6AT 1YYLL 2J88L 4JQXC 1AC6A 1XF5B 3OKMB 5FO8A 1GOHA 3LH2H 1T03H 3PQYA 4MXQD 1JGUL 5D72L 2P5EE 5D1XC 2APBA 4AG4H 2R2CA 3BWAB 4HHAB 4Z8FH 2CO7B 2WLYA 4HJJL 3QEUA 1FRGH 15C8L 4UILH 3DV4B 5C07A 4OIAA 1FZOB 1ZVYA 4R0LC 4OIIL 2ZNWA 1IC4H 1KIUA 1JPTL 3EZ8A 5T1DH 1MRFL 3SHSA 1B0RA 3PDDA 3EO1A 5D70H 4TNVF 3WUWA 1RUKH 1T04B 3PHSA 3RVWD 4GMTH 4GRLD 4PGEB 4HUNB 5FUZL 3VXNA 1BBJA 1QACA 4D94A 1NGQL 3HFML 2EDWA 4I0PA 1SJEB 4FN0A 4P9HC 3ZDYF 3GDBA 4C59B 4W70A 2CKNA 4U1MB 4LCCC 5FUCE 2VDOH 5A3ID 4X7TA 4UV7L 1A0QL 3ZL4L 3OPZH 4K2UL 1KG0A 2EDXA 3PE9A 3V0VA 3D25A 2GITA 1I3GH 3EJZC 3TO4C 1IKFH 4D3CH 1IAKB 1CFSB 4ODHH 4CMMB 2ITDA 4XP4H 4RWYL 5JXED 2FH6A 4UOJA 5H8DA 1N0XL 5KAQF 3HC3H 5D6CA 3VXOA 4OZIA 1BX2A 4JFEE 2W65A 3SGDI 4XPBH 2MKWA 5MENA 3MFGB 3ARYA 3N1FC 5DZNA 1QG3A 1IM3B 5CD3B 1CGSH 5F7HA 1FNHA 4N8VA 5EOCJ 3RI5F 2YWZA 4LLYA 5EBWB 1P84J 2Z8RA 3IDXL 4QHMB 2AXGB 2VKWA 1F3RB 1QLFA 2ENYA 2VLRD 4MAYD 4OCWL 4X6DA 4DN4L 3DMMC 1GC1C 5HGHB 5BZDB 2ZUVA 3BJLA 3ARVA 2EZ0C 4O2CA 5IUSA 2P4AB 1NUFA 1S7UB 4N0YL 1KYOK 4OT1H 4K3DL 6FABH 2ZJSH 2N7BA 3IAGC 1A7PL 5E99H 4D3CL 2AJ3A 2Z8VC 3QXUA 1YY8A 2Y25A 5FO7A 5JNYA 2J2ZA 3VFVB 1R3IL 3OSKA 4JO1L 2BFVL 3MBXH 1J1OH 1K8DB 5E1AB 2P5ED 3LRHA 4R4FH 2LABA 3BEWB 5KS9A 4XI5C 2EC9T 1F97A 3IS1X 1RK0A 1UM6H 4CDHA 4ZTPH 5B4MC 3DRTA 3MBEC 1I8KA 3BEWA 3MJ6A 5IK3A 1EH9A 1FZMB 1CG9A 4XP5H 2VLMD 1R6VA 3GBLA 4S2SA 2V2TA 3JWDH 5E5UB 1AI1H 1V7MH 1QQDA 3OG4B 1A8JH 4PJFE 3H9YA 4I9WD 2ESVE 4S1SL 3M1BA 5J11C 5E94B 3ELAT 1FNSH 1E4WH 5C0BD 4JFEB 3UPAA 2GY7B 2DQCH 4P5KA 1NL0H 4U7KA 4D8PB 4PUBH 2BVOA 5FGBC 1EHNA 3CFEA 3F62A 1HSBB 4EUPB 5FUZH 1MLCA 2VXSL 3X3FL 3L3GB 4X8JA 3CDGB 1DTUA 4JFEA 5F96L 5L9DL 2FO4A 3VXTA 1N6QH 1F58L 4PJGF 1MFBH 3FOMA 5EU4A 2YN5A 5DHVH 3RWDB 3HE6D 3FN9A 1QYGH 3BN3B 4TPRH 5KVMC 3FB8B 3L7FA 5J12C 1ZA3B 5AYQA 5C0RH 1SJEA 4OI8A 2DQDH 2E3VA 1T4KB 4UDTB 1T6VN 2GJ6D 5BXFA 3VXUA 2DIBA 3FZUC 1MPAL 2D7QA 5I76A 4JE4B 3QEQB 3MRLA 1AP2B 4N8CH 1KEGH 1WFNA 1MNUL 3P30L 4G3YH 1KCVH 3FTGA 1K4DA 1X5JA 1YEKL 4HKJB 3OB8A 4K9EH 4W6WB 3D3VA 1IC7H 4Z7WF 5INCA 2IH1A 4JY5H 5F9WB 5FYKU 4XRCB 3PWJA 4NQVA 3M17A 1GHFH 1KBGL 2F15A 3HNVL 4LAQH 4U7MA 3VFMA 1ZLWH 1CZ8H 5EFIB 1EMTL 4BJLA 4BZ2H 1J18A 3KPRD 5TQ0H 2XPGA 1PZ5A 3M17B 1A6AB 3P9LB 3AU1B 1NAMB 2GQHA 2EE3A 1K9TA 3JWOL 3E3QE 2BNRE 5DHVB 3EO9L 1RZGA 5J8OA 1A7BA 2JCCB 2NY6D 5FF6B 5ADPL 12E8L 3IFOB 5D7LA 1IAIH 3NCJL 2UY7A 4MX7B 4RAHA 3LMJL 3VRJA 4Z18A 4NQSB 5EO0B 2ARJQ 3U4BH 1UQSA 2YPLE 3MLUH 4YK4B 4ZPVB 3X13A 2LTQB 4D2NA 2Q8AH 2YD2A 3MCKA 1IGML 2CKBL 4KDVA 3KGRA 4ZQKB 1BZQK 3F7VA 4MJIE 5F1NA 4ZUTB 2ARWA 3MJ9A 1MFNA 5DFVD 3ZKNC 5J13B 4NCC2 2ZOLA 5ADPH 2VN7A 4I0PC 4L8CB 2Q86B 3SDDB 3QWOB 5DUMH 2I26N 4LLVB 3RGVD 2YA1A 1QD0A 3RWCA 5CD5C 5DJXB 1CLZH 2DM4A 1BQHA 2NLJA 1XZ0A 2ICEB 5D4QA 3UX9B 4FS0A 4Q2ZB 3EJZD 5KVDH 4G9DA 2DJ4A 4UTAH 2EXWD 4HWEL 5KVEL 2NXYB 4IS6B 4Z7VA 1OQXA 2BXYA 4MJ6B 5DURB 3S36X 3N85L 1AHWC 3GHEH 1CDBA 3T8XA 3SDXF 4IRSB 2DIJA 2F5AH 5HHNA 3FQXB 1NFDA 2Y07H 1R5VB 4NKIL 3WXVL 2DQGL 5BOZG 4PJGA 2B4CC 4Y5XB 3MROB 3D48R 2FX9L 3N1PC 5JORA 3HAEA 2OJEB 2XQBH 5B39A 5BRZD 2X42A 4WV1C 3QIUB 4HAGA 4YAQA 2CIIB 2ICES 1AR1C 1XF2A 1IE5A 2VDML 2DICA 2O5XL 1LP9E 1EEYA 4HDIA 3THML 1QPXA 2DLTA 1K85A 3CDFA 1WWCA 1HYSC 4YXHH 4AEIH 2OSLA 3B2VH 5B22A 1D6EB 2A6IA 3GO1H 2R0LH 3ARFC 3O2DL 3C5ZC 5CP3A 1D6VL 4HV8B 4NO5B 5ESVA 4H88L 1XT5A 1A3QA 4ELKB 5GGRA 4MB5A 4KTEH 4XWGL 5I1CH 4CU7A 3ARGD 4LCYB 5T33H 2EE2A 3MRNB 3V9FA 2R0WH 5MENB 4KJYB 1JHKL 4G8GA 4M1DL 5F7KC 1VPOL 1RMFH 1LO5B 1PLGH 5DSCA 4JKPL 1BQLH 1Z3GH 5CIPH 4U6VH 4YQXL 1UB5A 2H32B 1BJ1J 1FNAA 3PWLB 4RMRA 4XNUL 5GJTH 4YXLH 5T1LD 3TVMA 3RX8A 2VOTA 2O93L 3F58H 3OL2A 2F5BL 1OARL 1FV1A 1NGPL 4HEPG 3LPFA 3WNMA 4KFZC 2OMBA 4PTTA 1J8HA 2R2EB 4XNUH 2VXVH 1QSEA 5HYSG 1YEJH 4WW1A 1JRHH 4PJ9D 3QEHB 1P4LA 4NT6A 4L3EA 5GS0H 1AO7B 3JTSB 1LO0L 1T1XA 2DTML 4Q9RL 4W81A 2R2EA 5FDWB 4U0RB 1UXSB 3MUGA 1ORQA 2EEAA 5D1QD 1AHWA 5I66A 3QQ3B 3Q1SL 3CH1A 2YPLB 3KPMA 4YXLL 4LSTL 4KJWD 5CZXD 4R4ND 4F7EA 1KIQA 3KPSE 1U6AL 3SDDA 1NAKH 3DXAA 3WHXA 1HYSD 1IGCL 2ZPKH 4G8IB 3BP7A 1HYRC 3KPMB 4ZPTA 1RZKC 5EU6D 2BVQB 2P5WA 1CL7I 3DWTA 1U91A 4XXDB 1TVBA 4JY4A 5FFLA 4NUJA 2ESVD 2AV1A 4S1RL 3MJ9L 1F3DJ 3ESVF 4JFFB 5D1ZB 3CVHH 2VZTA 4Z0XA 1CICB 4DVRH 2C3VA 2E7MA 1CXHA 4N9OB 3BGMA 4PRDB 4J3WA 2P47B 1D9KD 35C8H 1S9XA 4JZJC 3CSYA 1MI5E 3TO4B 1AD0B 3QHFL 4E42B 3BP5B 4JFHE 1JGVH 1FH5H 2OQJB 1R5IA 4KAQL 2PTTB 4DUXA 4HWBL 1KCSL 2AK4D 1XCTB 4NQEE 4XPTH 3PWPD 1OM3L 1CXKA 4IRJD 4MJ5B 4K8RL 1CLZL 2VMFA 4JRYA 1XAUA 3B6SB 3T4AB 5FGCE 1I75A 5C09E 5KSAD 5ALCH 1XCTA 2F53A 3GSNA 4LNRB 2OMNA 5IW3A 5FM4A 4QHNB 4OAWB 4BQBA 3VFWB 3CFDA 2BVPB 2K3TA 1T0MB 4NQED 4BK4A 1OP9A 4FFVD 5K33A 1U8IA 3DMMB 5SWSA 4CMHB 5DJDB 4MJ2A 1NANI 5TQ2H 2ZCHL 3AREC 3AC0A 2RCSH 3JVGA 2V6HA 1YQVL 4MMXC 1BQSA 5FA3A 5DJYA 5FCUL 2PW1A 3UJJL 3PUCA 3GSQA 3QRGL 4DKEH 4C4KO 1KTKE 3S35X 5KSAA 3MLZL 5L2JA 3VFNA 4H26A 3VI4E 5T3XD 5IMOB 2RQ8A 1JGUH 1KLUB 2AJXH 4CDGC 5BV7C 3MV9D 1TZGL 3ISWA 4NQCB 4WV1A 3MRNA 3WYRA 1JWSB 3QO1A 4I13B 3F12B 4UQ2A 4XAWL 3SKMB 4P2RD 1ZHKB 1AQKL 2VDQH 4LOUD 3DGGB 4FTVA 4XP9H 5GGUA 4ZS7L 4G7YL 5IVZA 4AH2A 1HH6B 5C08D 2FEDD 1T1YA 3Q3GB 2CDEA 3CK0H 2Z4QA 5JLZB 4P23B 3PGDA 2YA0A 4FTVB 3DROA 4UINL 2I9LA 5DEZA 5F9JB 3IAQA 5FYKH 1RHHA 4HX1B 1EJOL 3IJSB 1NUNB 4JM2B 1YNTA 2A1WH 5TQ0L 4J4PC 3K1KC 1C5CH 4JDZA 1UWXH 5ILTH 2NY3D 5B8CC 2JK5A 3OG6B 3MJGX 3WL9A 3RGVA 4GRWE 4PRHD 5CMAA 3VGGA 5EBLA 3O4OB 4PJAA 5E6IB 4HWUA 4PREB 1IC7L 3UPCA 1T66D 5CEYB 1MCOH 1RJZA 1D5XA 3DXAB 4ZXBA 3OKDB 3UDWC 4Z7VB 2JIXB 4ODXA 3DYPA 4KVNH 4ZAKD 3QG6B 4UV4L 4Y16A 2MHAA 3GHBL 4LGSB 1E4XL 4QRSB 1MFDH 3CFIC 3KJ4C 3WFBL 5C0DA 1AD9A 3JV6A 1N5AB 2ICWA 1H5BA 2IANB 4EOWH 1CD9B 1GIGL 4NRXB 2JB5L 1BWWA 1CICA 3VRLF 3RVVC 2R8SL 1KCUH 3ZSTA 1JHTA 2AJSL 1HHGA 4NCC1 4LPVA 4X5WA 3G6DL 2YXMA 3O3BB 5BVJA 5IVXE 3QDGA 3HI5H 2VXUH 1S5IH 3P4NB 3BZFA 5FB8A 1RIHH 1NLDH 2EDTA 3KJ4B 4D0DB 3TPKA 4TSBH 2RR3A 4O9HH 1I7ZB 3FT4A 5KVEH 1UG9A 1FVDB 2XFXB 3RVXC 3FB7A 3U0WL 5JR1L 5IEHA 2VIRA 3MV7A 3PG2A 1D5BB 4CVXA 4OM1H 5TE7H 5LBSL 4GAGH 3BT2L 4S11A 3IRPX 3STLB 3QSKB 4Z9KB 5IVNA 1UB6A 3EFDH 4R2GD 1QFUH 3FO2A 3VXUE 5JOPE 4NO3A 5EOCL 1FFNA 1IEBA 5TFSL 4PV9B 3GI8L 2RFXA 3QUKA 3EBAA 1FG2A 1PKOA 4OD2B 3D3VE 3FQTB 1XGTA 3RZCA 1JNHB 3N1GC 4PJ7E 2J4WL 4DQOH 1JZ6A 2VR9A 1GCFA 3RWHB 4O2EB 4RFEB 4WEBH 5GQBA 43C9A 1KN4L 2OX5A 1PQZB 3T0DA 4GW5B 4KKLD 3QEHA 4NT6B 3SE9L 4LKCB 4L4JA 2GIYA 4ETYA 1HSBA 1EFXD 1J1PL 3DROB 2GITB 4LASL 4K3DH 2AQ1A 4I0PB 2HJKB 4H8WC 3FQRB 2FJHA 2IALA 4R3SA 1LE5B 4NZJA 1KNOB 2H1PL 3S98A 5IKCB 3ULSB 2A73B 5LGKA 3BGAA 3HLAA 4UNVA 1OAZL 4I77H 3TFKD 3LV3B 4YHOH 2C5DC 1FIGH 4AMKL 2NXYC 1F6LL 2UZIH 5J1TC 3N1QC 5DEGA 4WHCA 4IRSC 3WIFA 5EU5B 1FL5B 4OF8A 1U8KB 5HJ3A 5IVXA 1KCVL 2NY5H 4NIKB 3QCTL 3N1MC 1MFAH 1UEMA 3S36H 4AQ1B 1C1EH 4Y4FD 2FBJH 1BM3L 2R56L 3WIHA 5E8EA 5DMKA 3ULUF 5FO9B 3MRIA 1OP3K 5I6XB 4FQIH 1QRNE 4NNXB 1AKJB 4UIKH 5EIVA 1XGQB 3UTSB 1RZFH 1I8IA 1IEHA 1EEQA 4LSRH 4LPUA 2FZ3A 5T3ZL 4J12A 1QLFB 1QRND 1T20B 3LY6A 2PNDA 1A7RH 2NY4C 3EHBD 1D3CA 3IETB 4JRXE 1H8SA 4XNMA 5DHVA 3QEGH 3NOIA 5EC1B 1PFCA 5C0FB 3NFNA 1OW0C 4R7DA 1N6VA 5AZEH 1F4XH 4F2MB 1LO0H 1FGNH 1OGAD 4I3SH 4H5SB 3LSOB 1QFHA 4AENB 1KLFA 3KYNA 1WBZA 5EU3A 1A7OL 3SE4A 4HJGA 2Q7YB 5FA4A 3FL7A 4PJDB 3KPNB 2QQLL 3IVKA 5ESQA 4K94L 1EK3A 1WC7B 1U95A 3PV7A 2DMBA 2FBOJ 2HVJA 2GT9A 5I1JL 3FT4B 3SJVD 25C8L 4NM4H 5JDSA 3I9GL 3VH8G 2X4OB 1MCOL 2DWDA 4V1DE 4YIQB 3WNLA 3WFDH 1S9KC 4YFDB 2UUDH 4PRNA 3H3PH 3MRMA 4WFFE 1KLUA 1AC0A 4M7KH 3GRWH 5KSUB 3CFKA 3K7UA 1BIHA 3G5XA 1OWWA 4ZUUB 4NJAH 3HZVA 5DD0H 5H35A 4TQEH 2BX5A 1QO3B 2BSSA 2VXTH 1EXUA 4QRPE 5E94A 5I1JH 4HWBA 5HI4C 4OGYL 2XRAH 2BSTA 1QEWB 5DF0A 4P2QE 2R2BA 4XMLL 3I6GB 5GRUL 2BHZA 4RZCB 5D1XD 1IKNC 3IU4H 5DT1L 4KJPD 4X6CF 3CFEB 2I25N 3PABA 3OGOE 4OF6A 2LTQC 4YHIB 5CWSB 1INEH 4DN4H 2XWJB 1ZLVH 4KKCD 1MCPL 2YBRA 4EXPX 4RGNE 4DCQB 1K4DB 4HKJA 1FN4B 1Z6JT 4F8TA 4PRAB 3S3SA 3TN0A 3W9EB 5DEGB 1ZLSL 1QSFD 4OCYH 2XNAA 5K59E 1XMWA 1FL5A 4PRHA 3PWJB 2PO6B 4NQVB 4WHYG 3V6BR 1G6RH 3VDCA 4UI2A 3SGEI 5C92A 1EPFA 1NAML 1CR9L 2UYLA 2QQKL 5FV2A 4R96A 5CP7B 5TFSH 3LIZL 2X10A 2FCBA 4Y19A 5DQ9A 1D9KC 1DUZA 4Q6YA 5IT2H 4MQXD 1F11A 3L1OL 2NY0D 5JMRA 2NTFA 2P5WE 5HVWA 1EHAA 5C9KA 4D9LL 3C6LA 3CX5K 1JRHI 1HWHB 3LKQB 3WJJC 4Y5XC 5ALBL 4JN2B 1H3PL 3UBXA 3SY0B 4EIZC 3O45B 2NCMA 3SBWA 3EUUA 3W5MA 2B1AH 4UUJB 1X5IA 5IV2B 3NTCL 4GQ9L 1BJ1H 3IXAB 5EZJA 5FUCC 3U36A 4TNWK 4PRPE 5DMJB 1BEYH 3GNML 2HFEA 1F5WA 5I1AA 1A6PA 1HZHL 1HIMH 1X6LA 4HJGB 4CMHC 4D0DA 1YN7B 3FCTB 5TDNA 3AREB 1PBYA 1HXMB 1RVFH 5FDWA 1CFVL 3OB0K 4M7JL 1BD2E 5T3ZD 1QBBA 5HYFA 3IJYA 3BH9B 3O6FB 2GTZA 1BREA 3LRSB 3I3DA 1NMAL 1C12B 2J5LC 5F88A 4DKAA 1NCDH 3FCTA 4BSVA 5BV7B 5EIIA 4F7EB 4QRQB 2FR4A 2P7TB 2NY6C 1BD2A 1Y0LA 3N50A 3BH8A 4OFKA 1T0PB 4HH9B 1B4JH 1HH9A 2CXGA 3IFPA 1T5WB 5GS1C 1QFWI 1C7TA 1ZHLB 5FM5O 2RFXB 1G7LA 4LVNC 1U42A 4U3HA 1U6AH 4X99B 4JPKH 5KVGL 3PQYB 1VACB 1NEUA 1Z0NA 3QCUL 2X2YA 3WS6C 4GJTB 3L5XL 3REVB 3O3AA 3ZDXF 4EI5D 4LLQA 4KRPD 1G7MA 1Z9OA 1GRWA 1KFAH 5DK0A 4L1DA 1P69B 1F42A 3RIAK 1P7QD 3UTTB 2IAMC 4TUKL 4P2OB 5K9JL 2OL3H 3OPZL 1MRCH 3OAYH 4JGUA 4G43B 4DTGH 2GJZA 3GMLA 1ODAA 5DK0B 1VFAA 3A6CL 2OR7A 1FNEB 1KIRA 2OLDA 1ND0A 5I1HL 5B3JF 4ZTOH 3VXNB 1MVUB 5DXWA 4HIHB 1M4KA 3KXFA 1ZAGA 1YMHB 2A77H 4MGXA 5JZ7D 2VXQH 2CIIA 3T1FB 4RRPA 3MGOB 2FJGA 5GSRB 4CMMA 4PBVC 3SO5A 1L0YA 2X9XA 3IU3A 4MD5B 4RMTA 3RP1A 3KYAA 1SEQH 4HIHA 1AXTL 1MCFA 1Z9LA 2IADB 5SV4A 3SCMC 5CWSA 4ZTPL 4HQQL 3TYFB 1SYVB 4Y4HD 3TBSA 2XKNA 1NC4A 1RFDH 3FQNB 4RAUB 1AXTH 3H9HB 2YEZA 3KPQB 3D0VA 3RUGF 4FG6D 3PWUA 2V7HB 4L1HA 4M6ML 2PETA 2O5YH 4YHPA 3P11L 5EUOB 1XIWD 4LGPB 2WNGA 2A77L 2XT1B 4FTVE 1IAKA 1OHQA 2IBGA 1WAAF 3VD9A 3WFEH 2AGJH 4FQXA 1R5WA 1L9NA 5JA8B 5HGHA 4JZJB 5E08L 1OAQH 1T22A 1HK6A 1U93A 4X4XB 1HQ4A 2FBJL 1MAMH 5HYSA 5I74C 3DUSA 2EH7H 2YD6A 2VQ1B 4P9ML 4QKXB 5I18H 2BFVH 5HBBA 3CH1B 3H6JA 2W92A 3V79C 1J0ZA 1T1WA 4NKOB 5MEQB 1PG7H 5I8CA 5JW5A 1R3KA 4FQHB 4QXUH 4ZFZA 3VCLB 2WZPD 4P23A 3O4LE 1U8HB 3P4OA 4LEXH 1AO7A 3JTSA 2DI9A 3KPNA 4X9GA 5MERA 3VGHA 4ZSOE 4Q6IC 5D93B 4JQXA 2BNQE 2V9RA 3HNTL 3RA7L 3RWJB 4HWEH 5HHQA 2NW3B 3FONB 3QFJD 4IOFD 1OTTD 1IFHH 4LHUG 3IYLW 4OLUH 3E8UL 4ZUWA 3EOAA 1C5CL 2H45A 3LD8B 4OCXL 1UXWA 1L7IL 4JFYA 2JELL 3AM8A 1YEGH 2WANA 3UAJD 1BD2D 5T3ZE 1ZGLB 1UT9A 1FIEA 1HDMA 1OTUC 3GSXB 3SDYH 2IGFH 3BMVA 3CU7A 4EI6B 2FWOA 3S97C 3O8XA 4JCMA 1FZMA 5IJKA 4FNLH 5D9SB 4PJGB 3LD8C 1RD6A 2MSPA 3D39D 2Q3AA 3R0NA 2EDKA 3MJ7A 4CRPA 1UYWL 2P49B 5L0QC 1BF2A 3MFFB 1NMAH 4OV5B 2JB6A 4HS6B 4KXZI 5D9SA 5A2JH 2IG2H 1H3VA 3U6RA 4OSUL 4IJ3C 5CZXC 1CDHA 4JRXA 3FQXA 3KS0H 3BQUD 3LEVL 3BDXA 4F9LC 4M61A 3QXAA 1MHPH 1JTPA 3QDGB 4HWNA 4JANB 4ZNEE 4Q0XL 3D87B 2ADFL 3V7MA 3UTTD 2KZ1B 3ULVF 3ARZA 4GKNA 1FBIH 5LCVL 5DD1H 2GUOA 1KJ2A 3MUJA 5F1KC 2YXFA 1UZ8B 1DQDH 1M05B 1KENL 2FEDC 2ZSWA 1HKLH 1TJGL 1U3JA 1OD7A 1F4YL 5TDOA 1RJYB 4LSQL 5DYOB 1URLA 1YUHA 4HMCA 4C56B 5JQ6H 4HFUH 4KKBC 1A3LL 4G7VH 4WUUE 2XZZA 3SDAA 3BISA 4PJ7A 4QRRB 3HI6H 5FYLH 1FRGL 3MXVH 3GUTB 4X4XA 2P8PB 4N9GB 3UJTL 5TPWH 3S34H 4ELMB 3MLXL 4UV4H 3VXPA 4ONFH 5B3NA 2FHFA 2DBLH 4X6EB 4Y8DC 1NCTA 3FKUS 4KVCH 4PLKC 5BO1L 3GIVB 4WFHE 1HHKB 3Q6GL 1B0WA 1FFQA 4WJ5A 1JK8A 1DLHA 2C1PA 3FAXA 3O4LD 3T04D 1UB5B 1YEDA 2EDQA 2ZPKL 3JTTB 5F8QC 3MGAA 5C9JB 2CLZA 4FFWC 4KVCL 4Z7UF 5BO1H 1DQLL 4P4KD 1KPRA 4ALAH 1X5YA 1Y18B 4JLRB 3RJDA 3AU1A 3OGCB 5I1IL 3BP4B 5E95B 3BGFC 1EFXA 1F6AB 3RDTD 3WIIH 3BN9D 2ADGB 5J0BA 4K7PY 1EA9C 1GAFH 4U2ZA 3MQIA 4U49A 3FO9B 1WGOA 3TN0C 2VDNH 3SE8H 1IGJA 3MACH 1N7MH 4GAJH 4PJBA 4I5BB 4ONOA 3MLYL 3P0GB 5IQ9A 4M1CD 1OD9A 3O8XC 5HYJD 1MHHB 4N1HB 3BKYH 3FO9A 1HDMB 3WEXB 3BRGC 4QRSA 5GGSB 4GO6B 3LN9A 3FZUD 1LQSR 4PJIA 3WL9B 4M6OH 4X99A 2I9TB 1FJ1A 5AZ2L 4PJFA 5DFWH 4HPOL 1UJTA 4MJ6A 1OGAE 4L3CB 3R1GL 1OWRM 3Q5OA 5KG9A 4CN1A 3E6HB 3KAAA 2WUCL 3OBAA 2LE9A 2ARJB 3PIQA 5MEPB 3LS5H 4GG6E 4J1UB 4HK3N 4ODXB 2ZCKH 3UJJH 3JWOC 4A6YH 1Z2KA 2P8MB 1U3HA 4RNRB 2Q8AL 4DZBB 4JPIA 3NFSH 3C6SA 3PGFL 4XAWH 3NCEB 1D6VH 2W9EL 4G6AD 5L2KA 1A7OH 3MZTA 3OXRB 1Q9KB 4JPWL 4WI4A 4V1DB 3WHE0 4MJ4A 4DOHB 2AJUL 4PJGE 1EEYB 2AABL 4YK4C 3MCLH 4QRRD 2CUIA 4HUWB 1ZA3A 5E4EC 1XR8A 4B5EA 2IQ9L 5B39G 3S88L 4V1DA 4WWKB 3VJ6B 2VDMH 1ZHBA 5JORB 3SDYL 4OF0A 1TVHA 1UJ3A 3TBVA 2VDRH 5DK2A 3TZVA 3W0WD 4YBLB 1FNGB 4PJDA 5GJSL 1LK3H 4IHOB 4YDJB 3CCHA 3NA4A 5TF0A 3BXNA 3JWNC 1MI5B 5C0BA 4X83A 4MS8C 2QKIB 1KB9J 1DFBH 5E70A 1MQKL 4JO4L 1S5HA 1KJ2L 3QHZL 5ITFB 4AEHH 4HK3J 5T1KA 2YK1H 3DETD 5J9PA 4JO4H 2RGSA 3CPLA 5K9KA 2AK1H 3QNZB 4HUUB 5ELIA 1T22B 3L5JA 2ZUSA 5I30H 1FFOA 4PJBE 3DURA 2WAHA 3TA3D 4LCYA 1B0RB 1T1YB 1HNGA 4AEFA 1PZUB 1VA9A 3LB6C 5LGHL 4JRWA 1ZVHA 5CSGA 2UWEF 5D7IB 5E5MA 5AG9A 1KJ2H 3QDAA 3QHZH 4K2UH 1XF4A 1ADQH 2DQUH 5KSVB 1SBBA 3I6GA 1JWSA 3QO1B 3KPLB 2NY6B 2X4SB 1NC4D 5EO0A 4HC1A 4ODHL 2D4FA 5FOBA 1MF2L 5JUEH 3ARBD 2DIAA 1H3UA 4G5ZL 2A9NH 2ORBL 5DVOA 5ICXB 3QXWA 1ORSA 1W72H 5F7WC 5DD3H 4U1HB 3DNKA 1OAQL 3IT8D 5SWZD 2FO1A 4JDTH 1G9MC 2I9LB 1UA6H 5D5MF 1AGCB 1G0YR 4ZO8A 1X5LA 3AS0A 1NAKL 3QWQB 4GH7B 1C8PA 2PYED 3V6ZB 5E2UH 4LSPH 1RJCA 2VITA 2QQKH 2DYPA 3DVIA 4QRTA 5FOJA 1BGXL 3ARBA 1SEBA 5KANI 4FXGA 4WO4C 3PF2A 5C0DB 3RX5A 1JMZA 1RULH 1GHFL 2J6EH 3D69A 4RA3A 3K4DA 1I9IL 4PV8A 3OJVC 1AJ7L 5DFTA 2R9HC 1CD8A 2V5TA 4GKZA 4QHMA 4EJ1C 3WLBB 1KEMH 2XWTA 4KTEL 3RAJL 3O45A 1FLTX 3DECA 4WU7A 2F54E 2Z31A 1T7XA 2X4UA 5C2UB 5ENWA 1RIHL 3U4EB 3U46B 4HMEA 1J10A 2I07A 2BVEA 3QR2A 1KCRH