1IAIM

Idiotype-anti-idiotype fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DIQLTQSPAFMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin igg1/igg2a)
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiM01
4OKVA 1K6QL 3OF6D 2A6IB 2XN9A 5I1EH 1BVKA 4JFXB 3O4LE 1PLGL 1YN7B 2XFXB 2Z8RA 3TA3C 3C60A 5K59F 1P4LB 4RNRA 1IVLA 3DYPA 3B5GA 3WSQL 2R9HC 4MLSA 1IKNA 3UC0H 5KSAC 5E8PB 5IK3A 1YYLH 2ITDA 2HN7B 3BWAB 4LLVB 2YA0A 3PGCB 3FJTA 1B0RA 2XZCL 1U91B 2BNUA 1D5XA 4I3SH 4ODXA 3VXOB 3ZHDA 3S8WA 1NEZG 2J88H 3U30C 5F3BA 2X4RB 5JOFA 1FL6A 4PRHB 5C9JA 2H8PB 3X12B 3JWOL 2RBLA 3SOBL 1FN4B 4HWZA 4S2SB 5CS7A 1KBGH 1AGBB 5IFJB 4NC1C 4RGNB 1HHJB 1BJ1H 3V95A 1BGXH 4QHLA 3MYJA 3NFPB 3WIIL 3SDCD 4HEPG 1P5UA 4PGEA 2GJ6E 5MEQA 4KK9D 5SV4A 4Z76B 2GSGA 2QSCH 3LN4A 1JPSL 3LDBB 4UU9B 1MEXH 3QUZC 1F3RB 1MFDH 1YEJH 4N1HB 3X17A 1A7RH 3D0VB 5BS0E 5CZXD 1IGJA 4XNXL 4AENB 5J6GA 4JLRB 1EAJA 1XGPB 1IZKA 2ERJC 5ESAA 3VFPA 1MWAL 2P5WE 4OJFH 2VXUH 2OSLA 3SQBA 4ZNEE 4V1DE 1P4IH 2EYTA 4ZOAA 3P4NB 5IKCB 3UTZB 4YDVB 3P4OB 3QEHB 2Q8BH 4M6NL 3EYQD 5ENWA 3G5ZA 4IDLA 5I18L 3ZYZA 5MEPA 2YPKB 3HZMA 5KVFL 2LTQB 4JKPH 1T2QH 1INEH 3V4PL 4PRIB 1MAJA 1R3KB 1RZ8B 1KIPB 4GBXA 2OZ4L 3BQUC 2A6IA 3IFOB 4WWKD 4JFXA 1QTYT 3SE4C 2XFXA 4LBEB 4LOUD 1P4LA 3RWCB 3UEZA 4KKBD 3TBWB 1X5LA 3QWRD 4MD0A 2BNRE 4IRJB 1W2KT 4EXKA 4Q6IC 3EJJX 4OIAA 2APXA 2HN7A 3BWAA 1AXSB 5BZWA 4JY5L 2FJGB 1H3UA 1QG3A 1U91A 1NEUA 4KVNH 3SJVA 3VXQB 5ILTH 3VDCA 1BX2B 2NMSA 2X4RA 4PRHA 5F6IC 5FYKE 4K94H 5JW4M 2VERN 1DBBH 2XNAB 4P2YA 4S2SA 5J7CC 5LAXB 5IFJA 3KPRA 3QXAB 1EK3A 1HHJA 4ERSH 3A6CH 3RGVC 1WWWX 2O61A 2R4SL 4OSUH 1EJ6A 1OP3H 3AM8A 4YQXL 3GBMH 1D6EB 4GQ9H 5EU6E 1GJIA 1NANH 4ZO9A 3TV3H 3C08H 4RRPA 4Z76A 1A02N 1OCWL 2DBLH 4M62H 5ALCH 2WQRA 3D25B 1CDGA 2IALB 2KZ1B 2NXYD 4XP1H 1EVTC 4GG6E 2X4OB 3VA6A 1QSED 4PGDB 4HF5H 3D0VA 2AK1L 1YZZA 2H9GB 4JLRA 3QIWC 5E8DH 2EEBA 3QXWA 1NCAH 5IV2A 1E6JH 1MJUH 4U3CA 4JDTL 5IKCA 4YDVA 4TSAH 2A6DB 2B0SH 3P4OA 3QEHA 4ETQA 3CFBA 4LKCB 4M5ZH 3CFJB 3RJQB 4JG1H 2EH8H 2YOCA 3QUYD 4LF3A 5EZOL 4DKAA 4FQIH 4QKXB 1G9NL 2AV1A 4IOSD 4GG8B 2PW2A 4OGAD 4PRIA 4X7DC 2GYSA 2ZJSL 2HKFL 4IS6A 2Q76A 5JW4Q 1N5AB 2VXTH 1RZ8A 4RFOH 3TN0C 1KIPA 2OXGA 3MV8E 4KGJA 4XNQB 2QKIB 3GBNH 1SJHB 3IFOA 3D2UA 3UTTB 4FA8A 2X7LB 4LBEA 4NT6A 3MLUL 3MRKB 2VXSL 3TBWA 4FQ2H 1Z0NA 5DK3A 5T1LA 3JSSA 5D9SA 1S7UA 3S4SB 3OSKA 2DQGL 1AD9A 4MCYB 1KJ2B 4NWTL 3LKOB 1VFAA 3RZCC 4JDZA 2YC1B 3ULVH 3QA3B 4K8RL 4GXUM 4P57B 3BKYL 3VXQA 1OTSD 2UVFA 1FFOB 4M7JH 1K2DB 1K4DB 5GISL 3L3GB 2K7PA 3FN0H 2WBKA 3SN6N 3BD4A 4GRWH 1RHHB 5LAXA 3QXAA 5J3HC 3CFCL 5HVFB 4Y2DA 1BQLL 2EKSB 2YBRA 4PBVC 4WV1A 1ZE3C 5EBGA 4WFEE 3UJJH 3UTOA 4P9HC 1D6EA 5D2NE 4IRZL 2WBJD 3V52H 1A6ZB 3QUKB 5LWYL 1KTKE 2F53B 5T3XL 5HDQL 5TE4L 4R97C 4H1LH 4NN5B 1CFSA 5MERA 2X4OA 4N8PA 3EYVB 3FN9A 1J1OH 1J9CT 4UIKL 5D7LD 1X5JA 3LMJL 2VDOH 2H9GA 1RD6A 4YEFA 4P49A 1EEQA 5K93A 2QQKH 2JKXA 3LRSA 4GW1A 5E0QA 2IWGA 4WHTB 2JELL 5F7KC 4UAOC 1EXUB 2A6DA 1XCQB 4NOBA 1FCCA 1RZIB 2DB8A 1VEOA 3OBAA 4RMRA 3BW9B 3CVHL 3OKDA 3VWJC 2PYEB 2IAMB 4GG8A 4PB9L 5ADOH 1C5BL 4YE4H 4XNQA 2QKIA 1SJHA 2XICA 4HS8H 5D6DA 3TJEL 1BIIA 1TCMA 2X7LA 5ANMB 2OS7A 3MRKA 5BV7B 1NBYB 3HC0B 5DA0B 3GO1H 4R4FL 1C08B 4MJID 4MYWB 2I9LA 1HN1A 4X9BA 3U0WH 1F42A 3S4SA 4G3YH 4M02A 1FVDA 1AQKH 4POZD 1N7ML 5T3ZE 3LKOA 4OLWH 1CFVH 2HTKC 3CZJA 4JHBA 3MRDB 1IM3A 2CDEB 1UM5H 3MLWH 2H2PD 1HH6B 4U6YB 3WFHA 3VGGA 1B3JA 1OPGH 4P9ML 2DM7A 2EIEA 4LIQE 1FFOA 4FQ1L 1ACZA 1K2DA 2Z4QB 3IDYC 4O02L 3RI5K 1D5MB 2NY1C 4G80A 4UI2A 2YXFA 5JQ6H 1OW0A 1RHHA 2JJSA 4PD4K 3LKPB 5DMYA 5FDYA 3MTRA 2WMPA 2EKSA 3ZE1E 3VD9A 3FB6B 1QD0A 2P7TB 3RAJL 5L2KE 1KSRA 2NTFA 2BRQA 1OP9A 1ZLSH 1U3HB 1TTFA 1T20B 1JWSA 1FHGA 1JK8B 5INDB 3VFTB 4AJ0A 5C08D 2H3NB 3FAWA 1W8NA 4MXVE 1S7TB 4A6YL 3RIAF 2DQJL 2WNGA 1JF1B 1CG9A 3ARQA 1PQZB 1TQBB 2FBOJ 3LPFA 4U3XA 1ZS8A 1DN0A 4MNGB 1NGXB 4PRPD 5IWLC 1XF2A 1MHPH 3RHWK 1PJ9A 5GGTH 3BSZH 4MWFA 2Q6WB 1JNNH 2EYSB 4R4ND 1OT2A 2VR4A 3VFMB 4FMFA 1NGYB 2X4NB 3GSOB 3ETBF 4PP1D 1NCTA 2YZ1A 1YEIL 4HPOH 4ZYKB 5L8LB 3BW9A 3ISWA 3BRGC 4KJPD 3SDXA 2IAMA 3VDAA 3ULUL 4Z5RA 5GRUL 5CEXA 4OZFA 1UWEH 1DUZB 1HCVA 4PLJC 1DDHB 5DVNA 4IBLT 2B7DT 1RZJL 4CADB 1ZEAH 4KK6D 5FYKL 3WHXB 2A1WL 1OM3H 2EDJA 1V7NL 3T4AB 3NOIA 3KPNB 5MENE 3QEQD 4PGZA 1JZ5A 3EFDL 1IGMH 2KDGA 2X4PA 3KR3L 4NZRL 2CDEA 1J87A 4LGPB 2YMXL 5FYLD 1FBIL 1JIBA 5FHBH 1IAOB 3P11H 4P3CL 1ZHLB 4XI5C 5H8DA 1QVOA 3WKNA 4APQC 4JFYA 3L5WB 5GRYA 3SGDH 5CUSL 1D5MA 5EWIL 1QFHA 2ORBH 3JWNC 3J7HA 1I9IH 1KENH 1WLHA 4GKZB 3MRGB 4LASH 2UWEB 4TNWF 4HIIA 4JO1H 3FB6A 4QCIA 3MRQB 1NFDE 3UJTL 2A74B 2QQNL 1OB1A 2BVYA 5ICYA 1GSMA 1HIMH 2K9UA 5ECJE 3QAZC 1JK8A 3UYRL 4NQXB 1CXLA 2XQBL 3LHPH 4JFDE 2R1XA 1FCGA 4LLDB 1NAKH 3MLZH 4LRNL 1H3PH 1JJUA 4KKLD 2WAHA 4MNGA 4YGVB 1I1FB 1CDHA 5C2BL 3QDGB 1D9KB 3FB5A 4E9LA 1CVSC 5AD0B 3VFMA 5B4MD 1NGYA 4K3JL 1KIRB 4PJGF 1U3YA 3KHOA 2HYMA 3SQOL 1SJXA 3O11B 1YEHH 1G7LB 1KB5L 4OCSH 2VXQH 5D7JB 1EHNA 5GRXG 2YK1H 1KC5L 3WHE1 2OR9L 5L0QC 1DDHA 2F5BH 2ZZUT 2L0DA 3F7PC 1PZ5B 4CADA 1BBDL 2AJXH 5EIQA 3T4AA 4YHYB 3KPNA 1PLGH 1Q0YL 2B4CH 2XTJD 3QUXB 3WSQH 4UTBL 3KVQA 1ZTXH 4J3SA 4FQXC 3BN9D 5TE7L 4AY0A 3WUWG 2OJZL 5DHXB 1N4XL 1EEUA 1QFPA 1XGRA 4GBXC 2VYRE 2XZCH 5M94B 1T7YA 2OCFD 3V5KB 3AY4C 3H3BC 2RB8A 3TH2T 1ZHLA 5E70A 1B0WA 5HJ3A 1DLFL 4ENEC 3FQWB 3G5XA 4LPWA 4D94A 5J13B 1RIUH 1R3HA 2D03L 1ZGLA 2R9HD 1HKFA 4G6ML 1PEWA 4EDXA 4TRPH 4HK0B 5KSAD 3IKKA 2ZCKH 3S97C 2NCMA 2UWEA 2G5BB 5GJSL 3QWQB 4NO5A 3MRQA 3RDTA 4JVPA 1E4KA 5I9QB 3WDIA 4Z7UB 1A7BA 1I7RB 4J7RA 4HMDA 1QSEE 3KPPB 3THMH 1IAKA 2BSSB 2FYYA 5C0RL 2W07A 3LEYL 1TZHA 3KPOB 4ZFGL 1KLFA 5KJRL 4W6WB 3VXTA 1RZKH 3AM8C 4JQIL 1NAMB 3X11A 5I8KH 1D9KA 2VKWA 5IIEA 3VFSB 2CKNA 4G9DA 4OCXL 5AD0A 1ZA3A 2PO6B 4NUJB 4Q74A 4BK5A 4NNXB 3QUZD 1DQQB 4M6NH 3GMRB 5T3ZL 5I18H 3ESVF 3CVIL 2DMCA 2I07B 4JY6A 5C07D 5D7JA 4ZO7A 3V4PH 1MIMH 5E6IB 5KANG 1A7QH 2FX7L 2A73B 3FQRB 1C12B 2UZIH 1AC0A 4OZGE 4DCQA 4KU1A 3QH3B 4OT1H 1UZ8B 2OZ4H 3EKCA 5IMKB 4PRNB 1FZOA 4ALAL 3CLFL 1NUGA 1RU9L 4BKLB 4PPTA 1EZVY 2Z8WC 1NGZA 1PAMA 5I1AB 3S5LB 4UQ3B 5JLZB 2P8PA 3N1GC 3NZHH 2CLVB 4O4YH 4M1DH 4NM4H 1MUJB 5DGRA 4ZUUA 2W0LA 5ALBH 3V5KA 5I8OL 1MAKA 5EBWA 3BQUD 1T7XA 5D1XB 5B22A 1F6AB 4AQOA 4MQ7A 1FFNB 3EBAA 4JN2A 3S3PA 3BE1L 4ZPTA 4U1SB 5TE6L 3REVB 3KGRA 4S1RL 1IC7L 2HG5B 5DRZB 4HK0A 4UUJA 5K9QI 3B4NA 5DQJB 2R4SH 3ZHLA 1I7ZB 2G5BA 1M4KA 4J3XA 2HFEA 5I1CL 4TULL 1CQYA 4FG6C 1LK2A 1NCDH 4E0RA 1UEMA 5D5MB 3D39D 4Z7UA 1MCOH 4B41A 2HVJA 1MHCB 1MIEH 3H9SA 4Y2DC 3KPPA 2WM0A 3P4LA 3KPOA 5D7LE 4WV1C 1IILE 2BVQB 3RGVD 1YDPA 5LJYH 3DYMA 5GRVK 2FWOA 3UO1L 1K3IA 4QXUL 3VFSA 4Z7VB 1KCLA 3HNSH 3MV7B 4OLEA 2X6MA 1T7VA 5HGGS 5C0FB 4NUJA 3EOBA 5JOPD 4NNXA 4HUKB 2ARJA 4WWID 4JDTH 5F6HI 5IJKA 1ES0B 1DQQA 1T1XB 5ERWB 2FSEA 5I1KL 2PYFB 4I8DA 4XVSL 5C09B 3PE9A 2D0GA 4PYGA 5FHAL 5E6IA 2VQ1A 3DSNA 3EGSB 3RNQA 4JHZA 2Y5TA 2ZJSH 2X89A 2ZUXA 3QIWD 3U4EB 4XC1L 4Z7WA 4C56D 5JNYB 1UZ8A 5IMKA 3R8BB 4PRNA 4LVNB 1X5AA 3RWGA 3TT1H 2APWA 1HHGB 3BP7B 2W1NA 1T3FA 3NGBB 4MJIE 15C8L 2VXSH 2NX5B 2HFFB 2X44D 3MR9B 1ERNA 4JAMB 3V5DA 2UVEA 2Z31A 4U1NB 2DQGH 5SWSE 1EEYB 1CN4A 4A2MA 4M43L 1MUJA 2DKMA 5D6DC 3TN0D 3BKYH 3BRFA 1CK0L 1AXTL 5D1XA 1BFOB 5EOCH 2HH0L 1YJDH 3CFCH 1UQSB 2HG5A 1CE6A 1BQLH 1MRFH 1CDCA 4EVNA 2O5YL 5DQJA 5EZIL 4O2CA 1BM3L 3DROB 2VDRL 3GRWL 1KCVH 3RZCD 1K9TA 3FFCD 1R24B 3IDJA 2FD6H 5LWYH 5D5MA 3WE6B 3CMGA 4QTIL 4GAYB 5HDQH 1MHCA 2JJSC 2RQ8A 5TE4H 1G6RH 1J8HD 5IHBA 3VGFA 5DK2B 3LAFA 3QUMH 1I8IA 3LY6A 4UB0H 5J3HD 2CRYA 4UT6L 5GQBA 2CIIB 3BIBX 3UPRB 4XBGB 5D72L 4Z7VA 1D5BB 5CEZD 2VZTA 5T1KD 5C0FA 2RIKA 3IJYB 5F7WC 3K3QA 3LKSB 3VGHA 1AR1C 3B43A 4OTXL 5HI5C 1NGQH 1ES0A 4F9PA 1T1XA 5ERWA 1DUYA 2JIXA 5E2TL 3ZT7A 1FNEB 2PF6A 1CLOL 1NLDH 2DQHL 3CVHH 3OKYA 4POYA 2AJYL 1LEIB 3UTPD 1C8PA 3P9LA 4XP4L 4LAQH 1NBVH 1A1OA 1C5BH 3U4EA 1J1XL 2BNQB 4U1MB 5LQBL 3CPLB 1CDYA 3O3BA 2AK4D 1RPQA 5T1DH 3QEQE 4HD9A 1E6OH 2ZOLB 4PTTB 2NX5A 3RA7L 4AYFA 5CSZB 2R56L 3BUYA 3VWJD 4XP6L 1EEYA 5FYLE 5EOTB 1M71B 4N9OB 1QEWB 4LDOB 4L9LA 4AIZA 2VUOA 4BH7B 3T0EA 3RVTC 3C8HA 1ZAGA 1MAML 1W8OA 3KPQB 1WZMA 4PP2A 1BFOA 4O02H 2D3VA 3VGAC 2C7UA 4PJ9B 3AU1B 5F7LB 1M6OB 1UQSA 4ZFOL 3TIEB 1FIGL 2NR6C 2VDKL 4KGLA 2NY7H 5T5NF 1N2RA 4X6BB 1DE4B 2HTKD 4WW2B 4BFBD 4H0GA 5GSRB 1R24A 4MAYC 2ZUQC 3V7AG 3TNMA 1DQLL 4XB7A 3WE6A 4GAYA 5I1IH 2RFXA 3BX7C 4CN1A 1U6AH 3AB0B 2NY6B 5E08L 4HC1A 5K9JL 4ZS6C 2NY1D 2DQJH 5IVXF 2ZSVA 5CEYB 3PP3K 1SYSB 3Q6GH 1W0YT 4PJBE 1T21A 4HBQA 2HT4C 1LILA 3HCVB 2CIIA 1XF4B 3D18B 3UPRA 4XBGA 2DLHA 3R8QA 5I0ZA 1D5BA 1UWXH 4HJGB 4N0UB 2BMKB 3TBVB 1XIWC 5IW3A 3IJYA 1HE7A 3LKSA 4R0LA 4FNLL 4RMSA 3MA7B 5MI0C 3KNBB 5GGSB 2DQDL 1YEIH 4E5XA 3TZVB 1LEIA 5J4MA 2DYPA 3IDIB 2MNUA 3ULUH 1TDQA 1U8OB 1N0LA 1W0WB 3MJ8B 3PV6B 4UILL 2EC8A 4XPAL 2ZNXA 5KS9F 3VXRD 1MY5A 5K59E 1FYTD 1RZJH 2GSIA 4HEME 1AGDB 4CW1A 2XTJE 4RIRA 3QFDA 2ZOLA 5F7FA 5FXCH 4Y4KA 3EFDH 1KN2L 4LQ1A 5BOPA 4PR5A 4PRDA 4OQTA 4ZUSB 5DJ6B 4LCUA 3QCVH 1QRND 1XZ0A 3KR3H 3NFNA 3QIBB 3GJEA 5IT2H 4J23A 4NZRH 2F54D 5I30H 4HH9A 3B5TA 4PLJD 5EUOB 4BH7A 4DVRH 2D7PA 1VDGA 4JKWA 4NQCD 3S34L 3WCYA 5AAMA 5CUSH 5EWIH 4NO0B 1Q0XL 1UB5B 2WIIA 4PJ9A 3AU1A 1M6OA 1IKFL 3CSYB 4RBPH 4HAGA 4U7SA 5DMGC 3TIEA 5FA4B 3KWWB 3PQYA 2VITB 5EIVA 4WW2A 1JP5A 3WFZA 2CPCA 3BPLB 3UJTH 1ADQH 5DJDB 2XN9D 4DN3H 2VLRB 3CZFB 3C60D 3MUGB 4OLZL 4MNQA 4XI5D 3T08A 3MODH 4APQD 1JUFA 1X44A 3BP6B 2XQBH 5DJZB 1N8ZA 4NC1E 4LQFL 5B38B 1SYSA 4LRNH 2FJHA 3WXWH 4RISL 2HWZH 3RDTC 2CLRA 4NRZB 5C2BH 3D18A 1E4KC 4HJGA 4N0UA 4CRPA 3IKCA 1G9ML 4NCDA 4ZDHB 3PGFL 1AR2A 3BOVA 4K3JH 3U9PL 4H20H 3GMOB 3GI8H 3F8UB 4LLWB 5TF1L 3MA7A 3KNBA 4LMQE 1RJZA 3SQOH 1CWVA 2HLFC 1MWAB 1KB5H 5FUOL 4K9EC 5SX4I 3NA9L 2L7JA 2XWBB 3W9EB 3AGVA 3IDIA 3EDFA 1Z0MA 1Q9LB 1U8OA 1W0WA 3IDMB 2H26A 2VDQL 2FECI 4RGOL 4UOJA 1AGDA 4JFPA 3IGAA 2J5LB 3S36X 4PGBB 2P5EB 2NTSP 4PG9B 3G6JF 5E8EA 4YH6A 4ZUSA 3CNKA 5DJ6A 2EH7L 2JB6B 1S7QB 5TE7H 5I1LB 3QYCA 4L4VB 2OJZH 2GTWB 3QIBA 4OUOA 1N4XH 2XG5A 1XGQB 1ZVSB 2AEPH 1BD2B 2Y07L 5DVLA 2OJEB 2QADC 1EIBA 3C2SA 4JZNB 1VADA 4NO0A 3F7VA 2DF3A 1P9MA 1X3DA 2ATKA 4PJAF 5M7QA 4LSSL 1MJ8H 3CSYA 1FDLL 2VDPL 4G6MH 4G8GB 5FV1L 5FA4A 3B9KB 4FQXD 1OP5K 4IRSC 2HJFA 3GSXB 1PZUB 1YECH 5HDLA 5FO7B 1KIQB 3MJ7A 2ENYA 4GBXD 5EUKB 5TPWH 2YRZA 5I74B 3D39E 3QFJD 5FDWB 3MUGA 1FIEA 5CP7A 4ENED 1ED3B 32C2B 1JPTL 1Q9OA 2F19H 2NW2B 3BP6A 3OAYK 5IFHL 1JZ8A 5DJZA 5C0RH 3LEYH 5B38A 4ZFGH 3QZWB 2DQCL 5KJRH 3UPAA 2XWTB 5EPMB 4OV5B 1JGVH 3SJVD 2F8VA 3KLDA 1TVHB 1MFAL 5ITBL 3G9VA 1A9BB 5DFTA 5BMFL 1MCSA 5KSVA 4LLWA 3KPRD 1QBAA 5CHNA 1DVFB 1I7TB 3CVIH 5FYLL 5A3IC 1KT2A 1U41A 4BQ9A 4DQOL 3MRJA 2VISA 2XWBA 3W9EA 4L3EA 3V6FB 1K8IA 3GSVB 4C56E 1X5HA 4PJCB 2R1WA 2RCSL 4M7LL 5FV2A 1VPOH 4LCCC 2P5EA 1RU9H 4FTVE 4X6EB 4PG9A 4EIGB 4TSCL 5E6IC 2BSTB 4LSQH 5I1LA 4L4VA 1KULA 4HS3B 4Q2ZA 2V17L 3WKMH 3SE8H 2BVUA 4JFOB 1F90H 1XGQA 1ZVSA 2DKSA 1ZOXA 4MQXC 4NQDA 3LN9A 1E4WL 3HE7C 4PTUA 3ARYA 2Z31C 3NCBB 3BE1H 2FRGP 1RJYA 2AJZA 4S1RH 4KDWA 4BFEA 3B9KA 2WIMA 3N9GL 1MVUB 5GS2D 1QA9B 2NLJA 4QXTA 5FA3B 1KIQA 5I1CH 2CMRH 3FFCE 3CFEA 1HDMB 4H25B 3QWOB 5L88L 5CGMA 3D2UD 3O2DL 4JFZH 1MLBB 1NLBL 1J8HE 1I9JL 1LP9B 2Y06L 1ED3A 32C2A 4F80A 5T1LD 2NW2A 2NW3A 3WEXB 4K7PX 3HZVB 3QZWA 3GIZH 4QHKI 1I1AB 3MCLL 5ITFB 2ADJA 3MJ9L 2IH3B 4PS4H 3UO1H 1BBJB 5CEZE 4OV5A 4HUWB 3SGJC 4FG6D 4U1GB 1TVHA 4NKMA 2Z91A 3FONA 1DBAH 5B39G 3WNPA 4L29B 4C83A 3O41A 2D31B 2AJVL 2DQTL 3M8OL 3WJLA 5HHVL 3Q0HA 4Y2DD 2W9LA 1DVFA 4KQ4L 3O4LB 4UNTA 3UTPE 4XVSH 5T5FL 4ZOEA 2YD2A 3V6FA 4XPTL 2NY3B 1S7SB 4XC1H 1S5HB 1JNJA 4PJCA 2AK4E 2CJUH 4NO3A 3NCJL 1O7VA 4S1DC 4F9PC 3DX6B 1LO2L 4NKIH 4MQTB 4DVBB 4X6EA 3G04B 1CD1B 2R0WH 3WMSA 4NKOB 3U1SL 2BSTA 1KN4H 4JFOA 4GAJL 4HIHB 1F2XK 3OKLB 4M43H 4ELKA 1KELH 1NCWL 2B1HL 1DL7L 1QNZL 3FHAA 1S7XB 3DVIA 2BHYA 2Y9RT 1CK0H 1CL7L 1IQDB 3BGFB 4RCAA 2GJ6B 1EO8L 3EYOB 4NQVB 3B3IA 1NCCL 3V5HB 5C0EA 3D0LB 2EDOA 2HH0H 3MRHB 5IF0B 2YD9A 4L9LC 5EZIH 5TDPB 1BM3H 1H9VA 1L6ZA 4ZSOA 1QA9A 5FA3A 3T0EC 4U7KA 3D1MC 4H25A 3QWOA 5DRNB 5BS0B 3IETB 5JIKA 1TLKA 4KRNA 3S96B 3T0VA 1A47A 2YKLL 5DJ0B 3KYNA 4QTIH 1OF2A 4D9QD 1HI6B 2X10A 2JJTA 3WEXA 2P5WB 2JCCA 5JIHA 4WEMB 5DR5L 4HPYL 1G1YA 4V1DB 3LVEA 3MNVA 2P42B 1I1AA 4K3EL 3LB6D 1IRAY 4UT6H 1LNUA 2W92A 2WV3A 1NC2B 5E95B 1BBJA 4NJ9L 4A6YB 3KPSB 5D72H 5ISZA 1YEKL 1QFWL 3OB0H 5I16B 2E7BA 3ZYJA 3ILPA 4L29A 5GHWL 4HG4J 2D31A 4OTXH 4HIXL 4Y8AA 3WXVH 1MF2H 1ZT7A 4TUOB 5E2TH 5C6TL 1CXKA 3GSNL 3LS4L 4L3AA 4YXKL 2W0FA 1CLOH 2WP3O 1CCZA 2AJYH 5DD5L 4XP4H 2BNRB 3VXRE 3T0BA 1FYTE 2HRPH 1S7SA 1QZ1A 1J1XH 1G7IB 4R0LC 3U9UB 1S5HA 3QI9B 4WGWB 4YXLL 5CINL 4HIEA 4KV5F 4HFUL 4YK4C 5DVMA 1AR1D 5K9KB 5HI5D 1TPXB 3LQZB 1QRNE 1IFHL 3EUUA 3NN8B 2WANA 3LS5H 5C2UB 2R56H 2F54E 5ID1A 4AT6A 3QIUA 1HINH 4N68A 4F7MA 3OKLA 3HPLB 4YPJA 4Y16A 4Z77B 1OTUC 1LVEA 5E00B 1S7XA 3MJ6A 3CU7A 4NQCE 2YRPA 4Y4KC 3QNYB 3S7GA 5EU6B 2GJ6A 5F9DC 4J2XA 3EYOA 4NQVA 2QL1A 1ACYL 3D0LA 1QACA 3MRHA 3DMMB 3NVQA 4KROC 1U92B 2IAMD 4GG6B 5GS1B 2GHWB 3EOAB 3WJJA 5A43C 4R26L 3K2UL 3MBXH 1XGYL 4MQSB 5DJ0A 4M5YL 1G0DA 3RVTD 1KCSH 5D96C 4EIZC 2HFTA 4PJ9C 1BWMA 4P0DA 3FCTA 4JM4L 1HI6A 4OCMC 1BOGB 4Y5XB 5E08H 2W9EL 1C5CL 1MY7A 4ZNEA 2FL5A 1OLZA 3HMXA 4V1DA 3B9DA 1F58H 2VZSA 2GK0A 2PCPB 3JZ7A 2CKBA 2NR6D 3R1GH 4MB5A 3Q3GA 1XF5B 5E1HB 4PJGE 3L5XL 1F6FB 1VACA 4MAYD 4X7FC 3ECBB 1J88A 4JJ5B 5HYIA 4FNLH 3MV8B 3HC4L 1ZWIB 3FT3B 4NQED 4TUOA 1CZ8L 2V9TA 4ZS6D 3V6ZB 3VW3L 4LCWA 1EPFA 3C5SB 1OAKH 4K23H 1R3IL 1WSST 3TM6A 4F7EA 2HT4D 3LD8C 1KIUA 1F3DH 1XCTA 1DLHB 3MBEA 4UILH 4XPAH 4QYOB 4WW1A 4N90D 5F9WB 1G7IA 3QI9A 1WWBX 1V3KA 1HQ4B 2HTLC 2LU4A 1XIWD 2AW2A 4IIQB 1H5BB 2DAVA 5K9KA 1JGUH 4M9OA 4N9GB 3KJ6L 1F4YL 1I85A 1KN2H 3LQZA 3S3JA 3F58H 3NN8A 3RIAK 3VI4F 1T22B 1T04B 3DARA 1YUHB 1YMHA 4FXKB 3NZ8B 3LRHA 3HPLA 2OL3H 3GKWL 2NXZB 1NFIB 5A16B 5E00A 4LEXH 5EA0H 3KPLA 3QNYA 3ALWA 4G8EA 5D2NB 2DKUA 1Q0XH 4LGSB 3RQ3A 1NDMB 3MRFB 4PJIF 1IKFH 3DMMA 2DRUA 4F8TA 4X83A 4G43B 3D87B 3HI6L 1WZKA 4P9HL 1D3CA 5CEZL 3DV4B 5GS0C 4GG6A 2LAGB 1KJMA 3VG9B 4P2RA 3EOAA 3NCCB 3I50L 4KHTH 5HGBA 3QFJE 3QPXH 4BJLA 5HY9B 5D93B 1KJ3H 3U83A 1M1SA 4OLZH 1AKJD 1FSKC 2P44B 4I48B 4Y5XA 1BOGA 5D1ZC 5DK0B 1EHLL 3QO0B 3CMOL 3CJJA 4NBXB 4LQFH 2EC9T 1VERA 1OARL 2LU3A 3VH8B 2D4DA 2FATL 2HFGL 5DMGD 5SX5K 2Y1VA 1JZ2A 4CN6A 3SJVE 3D48R 1MSPA 4P99A 2EO9A 3MOQA 3IDGA 2OQJB 3DX9B 4NM8L 2W65B 3KHQA 5C8JB 1MELA 3U9PH 3UPCA 5D70L 2ZG3A 3SY0B 3KPRE 1D5IH 4AEHL 4QHUB 1ZWIA 3FT3A 2DQIL 4NFCA 4PG2C 1SY6L 5BRZA 1P53A 1MRDL 2AABH 3GSWB 3HPJA 5FUOH 3NA9H 1EFXB 3P3YA 3RDTD 1QHPA 3FQNA 1RY7B 4QYOA 4O00A 2R2HA 5H94B 4XBEL 4TNWK 1FLTX 5I66A 1H3WM 1FGVL 1H5BA 1XGTB 1A0QL 2APFA 4YHKL 2ICWI 4ODUA 3VFWA 5EU3B 2EH7H 2HLFD 3ZHKA 3PL6B 2DD8L 2SEBB 1RZGB 3OJMB 1T22A 1F00I 2CK2A 2HA1A 1YUHA 2JB5L 3NZ8A 4UMGA 1BLNA 1EAPB 3KS0J 3O6KH 2Y07H 3SE3C 1U3JA 1NFIA 3C5ZA 4I77L 2J5LC 4PGCB 3X13B 5L2KB 4M8VA 4RFEA 2FCBA 1NDMA 3I6KA 3I2CL 3BD3A 3GFUA 4LSSH 3CDFA 2VDPH 4MCZA 3QQ4B 3O9WB 3DV4A 1I4FA 4TVPE 1RUKH 3VFGH 5I19H 2V5SA 4P5KB 5HY9A 1F3JA 4KQ3H 4DEPB 2QADD 2G75A 5I75B 4Y4FB 5DK0A 4I48A 3A67L 4ZO6A 4GAGL 1SM3H 5EZLB 2N1KA 1NL0L 5HTSA 4YUEL 3JTTA 3VH8A 2DQCH 3SO3B 5T1MB 4XTRC 3SDDC 5KTEL 3IAPA 4OI7A 4U1LA 4F9LA 5CCKL 4UT9L 3VMPA 3OKNB 1MFAH 2AQ3A 3DX9A 5C8JA 2W65A 3V0VB 5ITBH 4M7KL 3Q1SL 1WV7T 4R7NB 3SY0A 4Q0XH 4HCRL 3FB7B 3OB8A 1QFWM 1D5ZA 3DUSB 4H88L 3T65A 3GSWA 5MENB 1MHEB 1MI5A 1EFXA 1HQRB 4M93C 4NN6C 2BOCB 5DFVC 3LCYA 4GW5B 3H9SD 3TH3T 1TIUA 4XX1G 3WJLC 4M7LH 2VAJA 4HJJL 1XGTA 2R4RH 3LQAC 4KUCF 3FQTB 4TSCH 5EU3A 5I71B 5A3ID 2V17H 4Z7QF 1RZGA 4MA1C 2DIJA 1ZA6A 3PG2A 4XGZB 1QR4A 1EAPA 3JUYA 1F4WL 1S3KL 5BO1L 2OR7A 5FOBA 4U1JA 2FNBA 2O5ZH 3SDCB 1NJ9B 4G7VH 1N59B 3BYTA 4PD4J 4Y1AD 3G5VB 1FJ1A 3SKOA 1YY9C 5SX4H 2Q87A 1A4KA 1E4WH 4M8QA 2BDNL 1NFDB 3MV11 3UBXI 2XT1B 4OBRA 4CMHB 4OLYL 3OG4B 1KYOK 4RGMB 2R29L 1AIFB 5E6ID 5F9AC 3ZDXF 1SQ2N 2VAAA 1VFBB 4JFDB 4KI5C 1YQVL 4GKSA 4ZUVA 4E42B 4XWGL 3CXHK 1S8DB 3PABB 4P5KA 4LVOC 4MJ6B 3O2DH 4MQXD 4D9QE 1NLBH 3HR6A 1JHKL 1UACL 3BDYH 4Y4FA 5HHPA 3HE7D 2GTZA 3MGTA 4ISVA 5EZLA 4NP4L 2AJSH 2Z31D 4JPVL 5I1DA 3T1FB 2P4AB 3S36L 4WUUA 4Z9KB 1H3XA 3GMLA 4XNUL 2Y36H 3MCLH 3BZFB 3MJ9H 4QNPF 2X5PA 1IC5H 4XP5L 2XG4A 4S1QH 1WAAF 4KI5F 3OKNA 4OLXL 3S4SG 4EN3A 3IDXL 2JJTC 2DLFL 1L9NA 1LO5A 2CUHA 2DQTH 2ADGB 1M05A 4PYHA 4GSDL 1ZHBA 1TVBB 2BCKA 4O2FB 1J1PL 5TQ2L 4CL7A 5HYQB 2DMKA 4XH2B 5MENA 1MCPL 5T5FH 5FUZL 1HQRA 1S9YA 1BEYL 1OAXL 1MFCL 4KRPB 2BOCA 4XPTH 5E2VH 4LK4A 2R69L 3MMEB 4ZPVB 2AXHA 4BSWB 3VGEA 5JDSB 4OAWA 5IBTL 4R8WL 1G7PB 2JCCF 4YR6B 1U95B 3ROLA 3U1SH 5JORA 2X4SB 3MNWB 4JRXA 1HHIB 3ARGA 4GAJH 2VDML 4XGZA 4PJ5D 3WNNA 4C58B 5IR1B 3N50A 1NCWH 2B1HH 4N8VA 3SDCA 1NJ9A 3K46A 5J11B 1J0IA 5HVHC 3G5VA 1HILB 1CL7H 4S1DD 2I24N 2JIXD 4ODVL 4PGJA 1NCCH 4C4KO 3Q5YA 2LFGA 3SDXE 1WQVT 2F8XC 3QIUC 4QGYA 5DC9B 4ZUWB 1AIFA 1D6VL 5GIRA 2DQEL 1PG7W 3EFFA 1QSEB 3RP1A 4Y16C 4JFDA 3SE9L 5IM7B 3FQUA 3IFPA 4L4TA 1I9RH 4M7ZC 4XAKE 1OQOA 1T83C 3PABA 2CO7B 4MJ6A 3RVVC 4JG0L 5IVXE 4ZFOB 1WZ1H 5E94A 1T0NB 1SJEB 3KLAA 3CFKB 4NN7C 4G9FD 4HWBH 1G7HB 2VZ1A 4KUZL 5E56A 1YNLL 4N0CC 4XVTH 2H41A 4MJ5A 2IH1B 5DR5H 1YY8A 4HPYH 3OXSA 2M8XA 4OF6A 4ZODA 4K3EH 3BH9B 2XRAL 3BZFA 1UJ3B 4ZAKA 5E99L 5F93C 4YC2C 3QUYB 3T0ED 1YEKH 5F89A 2FLRT 4X9FA 1QFWH 3VXPB 4OZGB 3QJFB 4NQEE 4HIXH 4LNRA 4O2EB 2QLVB 4O2FA 5C6TH 1WIPA 3GSNH 3LS4H 4YXKH 5KS9E 4XH2A 1U93B 3BPNB 1TETL 4XB8A 3LZFL 4YHZL 3MO1A 2HKHL 1WBXA 4N90E 2UY7A 1P7HL 5DRWA 4M03A 4V2BA 1QSZA 4I5BB 4YXLH 5CINH 1RVFH 4H1LA 5JDSA 2ICCA 3HE6A 1MCDA 2E6PA 4HFUH 1RUQL 4JFFE 5D7IA 3DX7A 3OAZK 1AGCA 1DQML 5F1IB 2R0ZH 1U95A 4K7PL 3MBEC 2X4SA 3TO2A 1A9EB 1HKLL 4QF1B 4YDKL 5IR1A 4EI6B 5HHQA 5B8CB 3VJ6B 1ZANL 2YEZA 1HILA 2XWJA 3KDMA 1JHLL 4OM0L 1I85C 2WBJB 1C16B 4WFGD 1RSFA 3P73B 5DUPH 1HNFA 4HKXB 4ZUWA 4LHUD 1RUPL 2CR3A 2B8OT 2DYPD 1IARB 5I8EB 3FRPA 5D7LB 4K55A 1YQ2A 1CIUA 4JFEA 3MRNB 5E03A 3EDEA 1OTUD 2ZUSA 1A7NH 1XGYH 1EHXA 1MCJA 4RQQB 1AE6H 1T0NA 4M5YH 1SJEA 4OUUB 5IB5B 1FZMB 3I9GH 3W39A 2AVGA 4Y4KD 3DIFB 4JM4H 4YDLB 1G7HA 1BPVA 3DYOA 3V7MA 4IOIB 4W4OA 2AXGB 2A9ML 4WDIA 1C5CH 2IH1A 4D0BB 1YNTB 5FYJL 3UYPA 4ZS7L 1WISA 4HGKC 4KROD 2F74A 4G6JH 2BY2A 3BH9A 1IL1B 1F11B 1PG7X 5I1GL 1UJ3A 4XRCB 1FNSL 3ZDZE 3L5XH 1J8KA 3RX8A 5DTFB 3P0YH 2ZWLT 3BMWA 1Y0LB 4MVBC 2CXGA 3KYOB 5FGCE 4PJ9D 1NBZA 2CO6B 2BHZA 3HC4H 1GGTA 3OXRB 5ID0B 4JCMA 4K3GA 5DHYA 1CZ8H 1URLA 3EOTL 3PQYD 5MEOA 1R3IH 4MJIB 1NC4D 1U93A 1AGFA 4NSKB 4CBPA 1IGYA 3AMKA 4XPHL 5DEZA 3GI9H 2B2XL 2EDLA 2A83B 5SWSB 4I5BA 4MNQD 2D7TL 4K7FB 3U7YH 2XQYK 4D0DB 1DP0A 3G6JE 1PD6A 3K0WA 1F4XH 4BQCA 4DKEL 4NJAL 4U6XB 2XI9A 2GFBB 3KJ6H 1F4YH 5DJYB 4YHML 2H45A 1TZGL 4M9PA 1OY3B 2BRRL 1KEGH 3GKWH 1GIGL 3VJ6A 5HYEA 3FQXA 4PJAE 4HHAB 3BO8A 2HTLD 3MLXL 2WBJA 3P73A 1U3ZA 1AD0B 5DQ9B 4HKXA 4MXWH 2R2CA 2Y5EA 7FABL 3HI6H 5F72S 5CEZH 2CDGB 3C5ZC 1U8PB 4MA3A 3FZUC 4LSPL 4BQ6A 3MRNA 5FGRA 1EO5A 3BH8B 4F57L 2R8SL 1BFVL 3B9VA 1FZMA 2HT3C 2FIRT 2XKUA 2MHAB 3D6GA 3I3EA 2NQCA 5E5UB 1OD9A 4X4ZA 1EHLH 1BJ8A 2FEEL 2BY0A 5ICXB 4P23A 2A9NH 1YNTA 1OARH 2FATH 3AROA 5JHLL 1IL1A 5GS0D 3U4BL 4JGJA 3QJHA 4UIMA 5DS8B 4DGIL 4I9WD 4WU7B 5DJXB 1Y0LA 4NO0D 4XMPH 1FG2A 4I0PA 4AEHH 5D1ZD 4YNYB 4YAQB 3OXRA 5DT1H 4P46A 4PUBH 1JWMA 1SY6H 3QEQB 4MJIA 2KUTA 4F9LC 1P1ZB 5CBEA 4HQQH 3RRQA 2Q8AL 3WBDA 3WFDL 1KCUL 1LO0L 4GS7B 5SWSA 3H9SE 4K7FA 1UM6L 4ZTOL 4D0DA 1FGVH 3RY6A 1J0HA 1H3VA 4DW2H 4KDTA 5KZCB 2DTSA 4HV8B 3GNMH 3L5IA 4U6XA 1C7SA 3O8XC 2FX8L 3T77B 3V0WL 1A0QH 3HI5H 4Q9BA 4YHKH 1L0QA 4QO1A 5DJYA 2BY1A 1NSNH 4CU7A 5F7HA 1AQDB 1CFBA 1JPGA 4OCLC 2DD8H 1RJLA 1S7WA 2WWKO 2X4QB 1DBMH 3FOLB 1HEZB 5BV7L 2DM2A 4Y1AE 2VXVL 2R1YA 5EN2B 2EE2A 5FK9B 2R0LL 4I77H 4L8DB 3A6BH 3MLYL 2R0KL 1CFNB 4NZTL 4QRUB 3RPIB 4GAFB 3QCTH 5D7SL 3MA9H 5E24E 4N0YL 4P5TB 5DQ9A 1LE9B 3BWUC 1JGEB 3GJFK 4L3ED 5KSBF 2IANA 1GGYA 2XA8L 4Z7WE 2W91A 4ZFFB 4NRXB 2CD0A 1EGJH 4PJBB 4U4BA 5DXWA 3B5HA 3BH8A 2BSRA 3B8YA 4QRRA 2P5ED 3A67H 3RU8L 5FM5M 3L9RA 1JTOA 3BT2L 2R15A 4YUEH 4HKBA 5KTEH 3E1F1 4KKNA 2VDLL 3L7EA 3ARFC 5CCKH 4NQDD 5DS8A 1T03L 5TQ0L 4WU7A 1PW3A 4K3HA 4XAWH 3Q1SH 5DJXA 3CX5J 3S5LG 1X9QA 4NWUL 5EO9B 3Q48A 4YAQA 2V2TA 3SBWA 1OAUH 2DM3A 1TXKA 2XTJB 3QEQA 3PHQA 2CLZA 1A6TA 3ZYIA 3P2TA 4XTRD 1P1ZA 3HMWL 3SDDD 3IS1X 2UUDH 3FO2A 4B50A 1ZHKB 4EN3C 3U6RB 5DLML 4OM1L 4K94C 5DJ8A 3ROOB 1RK1B 2IG2L 2EDHA 1FVEA 1DJSA 1GHFH 3CLEL 4JHWL 3QNZB 4KUCD 4HV8A 4KMTL 2VL4A 3T77A 3BGMB 4HJJH 1UYWL 1DTUA 1U8NB 3TA3B 2XZQH 4PJ5E 3DTXA 2X4QA 5JO5A 3TBTB 2V7HB 4OGXH 4NNPL 1PDKA 3ZO0A 3FOLA 5KSAB 1F4WH 5BO1H 1Q72L 3OZ9H 5EN2A 4OCYL 5DFVD 4MSWB 5FK9A 4L8DA 2X70B 5GZNC 5C92A 1I1YB 3EDKA 3DRTB 2X2YA 2M2DA 4OLYH 1E4XL 3ARGC 4P5TA 3BD5A 2R29H 4UV7L 3RPKA 5J1TC 1H15B 3IRPX 3GMNB 4OGYL 4ZFFA 4NRXA 5IB4B 3ARRA 4A2LA 1CLZH 1B4JH 4LNVA 2GT9B 4G9FE 3EIFA 4CMHC 5JOEA 1YY9D 3L3DA 4LRIC 2G2RA 4RGMC 3MRIA 5GGQL 4X7SL 4FQLH 1CIDA 5EC1B 5EBLB 5KN5B 3S36H 3QUZB 4XNUH 1A5FH 4OIIL 4KI5D 1RZFH 3T0EE 4BFIB 3IF1A 4YHOL 1FAKT 5D2LF 2FIKB 1S9KC 4EZMA 4TNVF 3FMGL 1L7TL 4OLXH 5JIPA 3IDXH 1TJGH 3BUTA 4JHAL 2DLFH 2ERJB 2H32H 2CGRL 5EO9A 3RGHA 5JUEL 4F7TB 2XPGB 2ZSWA 1J1PH 1KLGA 3I3BA 4ZAKC 2H1PL 3ULVC 1MCPH 1NMBL 1A14L 1OAXH 4Y0GA 1MFCH 4KV5E 1LEGA 1ZHKA 3U6RA 4NO2B 4LLQB 1BMGA 4LCYB 1RK1A 4UT7H 3QSKB 1QP1A 4HUUB 1UCBL 1RJCA 2XY1A 3QNZA 5E2UH 3GUTA 5IBTH 2FZ3B 4DGVL 3BGMA 3BQUB 4KZEH 1T2JA 2EYRB 1HYSC 2R2BA 5F21B 4L5FH 2UZYB 4Y5VA 4V2CB 3TA3A 4DZBB 5GGRB 3WIHA 4KRPC 1F13A 1A8JH 1FFRA 5ISZD 2VDMH 2F58L 2V7HA 3Q6FB 5FECA 3ULVF 5KSAA 4WJ5B 4RWYL 1N5YL 4I18A 4Q6IB 3K8LA 5SWQB 4YDIH 3HE6C 2C3XA 1I1YA 5CKAA 5DHVB 4WFGE 4AH2B 4QRPD 2HRLA 4R6UA 3D39B 4GRWF 4CVZB 1WK0A 2W9DH 5F6IB 3LH2H 2DQEH 4J4PA 3NABH 4HSQA 1BOYA 3GMNA 1P5VA 1FL5B 5I76B 4HBCL 2OMNA 4D3CH 1IM9A 4QHNA 1MQKH 3FT4B 3RGVB 1H3GA 1TNNA 2UV3A 5JPNB 5DD6B 3T8XB 2GT9A 5TDNB 5CJQL 1HHHA 4JPIA 1J11A 1GGCH 3TJHC 1RURL 4KUZH 5KVDL 3HI1A 4GO6B 1CLYL 4Q9QL 5EC1A 5D7IF 5KN5A 5EIIB 3QQ9C 1GRWA 3NFSL 1MJJA 3QIUD 4J3TA 1MCWM 2XRAH 4Y16D 1ZXQA 2D9CA 4MD4B 2IADB 3STLA 1JPFA 3RVVD 1DBJH 2GJ6D 1HOCB 4W4OC 3QIWB 2XXMB 1MCKA 2EDTA 5CMAB 2E7MA 2IQ9H 3IJHB 4C56B 5DQDL 1CXEA 2YUZA 1A7OL 1XR9A 4F7TA 1U2CA 4N0CD 3PQYE 4LCIL 4JO3L 2ARWA 4ZD3L 1K4CA 2E6QA 4FTVB 3LZFH 1TVDA 1VFUA 4AG4L 4LLQA 4MNQE 4KJYB 1P6AB 4G8IB 2YPLD 4U7MA 4HUUA 2VIRB 2YN5A 5DRXB 1G6RA 1KPRB 3ARSA 1EJOL 3TN0B 1MPAH 3VI4E 3LPGA 3QUMA 4X0KA 2GIYA 1X7QA 3SE4A 3FN3A 1BZQK 5BCAA 3OL2A 1JGLH 4Z78B 3CIQA 4JKMA 3GMMB 1IGIH 1HKLH 3KPMB 4WJ5A 4YDKH 4Q6IA 2ESVA 3MGOB 5SWQA 1NEZA 2PXYA 2ZCLL 3E2HC 3RZCB 1HXYB 4PJIE 1I3GL 1RFDL 4WTXA 1JHLH 3MRPB 3FFCB 2QQLL 4OM0H 2A77L 4X6FB 3LKQB 3MRMB 3DHMA 4YZFF 3D39A 4LCWD 3VD7A 4CDHA 1J8HB 4WHYG 4JCLA 5GGUB 2D9QB 1RUPH 5B39B 4OZ4A 3MBED 3S88H 2DDQH 1FL5A 4Z0BL 1QLEL 3FT4A 3RGVA 3EO0B 4UOW1 1RMFL 3VFNA 5DI8A 4FOMA 4MAUH 5TDNA 3QB7C 3UTSA 3V0AC 3OMZA 3L3OB 5T1KB 5TF0A 5D7KD 3WL9B 1MRCL 1AGEA 3MLTA 5H2BB 2I26N 4NDMB 4U6VH 5FYJH 4R97B 1KG0B 3DUHA 5DD1L 4ZS7H 3I02B 5FO9B 1EDQA 5I1GH 5F1NB 1FNSH 4GXVL 4M00A 1C5DB 4MD4A 4I9WE 3F5WA 2IADA 5CIPA 5EG6C 1L7IL 4YHLH 5C0GB 5I17B 3H0TB 4BUGA 3QIWA 5CMAA 2J12B 4P23C 2CIKB 4C56A 3WD5H 3EHBC 5JTWA 5FCSH 2AK4B 3SKMB 4CMMB 5F88B 3DBXB 4L8CB 4UAOB 2DQUH 4P2RD 4FTVA 1FH5L 1Z6JT 4M61B 3AXLA 4XPHH 5FM5O 5HI3C 2B2XH 1AY1L 3VWJB 4WUKL 4P2OC 2D7TH 3VE0A 4I0PC 4G8IA 2VIRA 5DRXA 5JMRA 1CFTB 4RX4A 4GKNB 1P7QA 3FRUB 4P46C 4MVBD 4NJAH 4DKEH 2Z93B 2GI7A 3L3KB 2M1KA 1OAYL 1UM4H 3CUPB 3K4AA 3VA2C 4JPWL 1U8KB 4HJ0C 4I3RL 4YHMH 5EFIA 2MKWA 4U33A 3L7FB 1TZGH 2P45B 4HKJB 2EXWC 5LVEA 2BRRH 3RY6C 4BQ8A 3MGOA 2YD4A 5B38G 3RZCA 3MLXH 1KJ2H 4JKLA 5BRZD 1ZV5A 3DURA 4L3EE 1ULVA 3IDYB 3DGCR 7FABH 2NY1B 2AXJA 4TOYL 1ORSB 5E5MA 4LSPH 5EOCJ 4YFLI 4MA8L 5M95B 3L3IA 3U0TA 5HGDB 1BFVH 4HX1B 2K7QA 3G9AB 1KLUB 4GW4A 1PX4A 4C4KT 4L8BB 4YFLF 1OL0A 1RIVH 1Y6KR 5DEGA 2Y7QB 5H2BA 4NDMA 4PREA 4OF0A 1KG0A 3I02A 1RHFA 5FO9A 5F1NA 3C5ZD 4NQDE 3FOMA 3S37X 4HC1L 2P47B 3F7YB 4DGIH 3FZUD 1E27A 4M7LT 2B4CC 4WFED 3UP1A 1FRGL 5I17A 3BJ91 3VXRB 1BVLB 5ELIA 1FYTB 2HT3D 5HHOD 4LLMB 4NFDA 3HRZB 3DBXA 1FNGB 5F88A 4EUPB 1U8IA 4JVUA 1MJ7H 5IW1B 4D2NA 3WFEH 4YX2H 1QRNB 1ADQA 1A7PL 4JZOB 2Q8AH 3WFDH 1T5XB 3VWJA 5C7XL 4Q9RL 3TCLB 3AS1A 2F54B 4ZTOH 3CDYA 3WS3A 1IEHA 4GKNA 5D71L 1FE8L 3L3KA 3V0WH 4XXDB 4Z7QE 4NQCB 3DO7A 4FP8L 3MRLB 1AH1A 1HCFX 2A0LC 3PWJA 1OTTD 3FT2B 4LSVL 4OI8A 4PJFA 1CICC 1G84A 5I0DA 4HKJA 1LD9A 4XCNB 1JI2A 3HN3A 5CLTA 1PG7L 5BV7H 1TTUA 2E7HA 2O5XL 6CGTA 4OQTL 2P24A 3QZWG 1KFAH 4LVHC 4OKVB 4U31A 2R0KH 5EORH 2AGJH 4NZTH 3ZDXE 1RZKC 2J3SA 2VLLB 1Z9MA 3O8XD 5D7SH 2C4XA 4EI5A 4APQB 1MI5D 1EFXD 3C6LA 4U6HB 1P7KA 4R2GC 3HTLX 4OD1L 3STZB 1WC7B 3Q5TA 4RAUA 5BXFA 4HT1L 4G6AC 5DD0L 1KTLA 1B0RB 3IU4L 4YBLC 3GMQA 5HGDA 2BNUB 1D5XB 4ODXB 4UNVA 5F3BB 4P5TC 5JOFB 3RU8H 1CYGA 1FL6B 2CXKA 2EDKA 3VWKC 3ZKMD 2QJDA 5ACLA 3QAZB 2Y7QA 3BT2H 4HWZB 1JGDA 5JW5A 3W5NA 1N6VA 4L4JA 4WHCA 1G9EA 1WAAE 3LV3B 4KI5E 1S7RB 3MYJB 4JREC 4ELMA 3QEGL 3WNOA 1U0QA 1T03H 5TQ0H 1MREL 1MLCB 4F3FB 2FEDC 3RBSA 3TYFA 4HMEA 1NMCC 3RVUC 4M4RA 4NWUH 5DMKB 3QG6A 3UYOD 2HLAA 3HRZA 3K74B 1FNGA 4ZSOE 1HH9B 1GL4B 3U2SB 3HMWH 5JA9A 4PBWD 5ABDE 4JZOA 5DLMH 1T5XA 4CUCA 3ARFD 3TCLA 5IQ7L 2D7OA 5ESAB 3VFPB 2BJMH 2JCCE 3SGEH 4JHWH 5L0QB 2OSLB 1NCBL 2EYTB 4ODTL 2XZAL 4HZLA 4F33A 4I2XA 2GAZB 4WUUD 1UYWH 2DL2A 2IBZY 5DWUH 3MRLA 1WWAX 4H5SA 3INUL 1QLRA 5ENWB 3G5ZB 2R23B 3T2QA 3TF7C 5ISZE 1J86A 3HZMB 3EO9L 4HG4K 4XCNA 3FB8B 4OD2A 5CJXA 1XGUA 5EH1A 4FQXB 2ZNWA 3N1FC 4EN3D 3GHBH 4UV4H 4QRPE 4GBXB 1V7ML 4W70A 2QSVA 2ZPKL 3QFJB 4Y5VC 2VLLA 2N7BA 1E4XH 5GS0L 1ZKAA 5MEND 4APQA 4U6HA 4KMQA 4MD0B 1QSFD 1CLCA 3STZA 1WC7A 3QDHA 3IVKB 4I18C 4OGYH 4ODHL 2W0PA 5BZWB 1CDIA 2YUXA 3PWVA 4XHJC 3X3FL 3SJVB 4JB9L 1UT9A 5GZND 3UX9B 4PJGA 4M1GL 4OCRL 5GGQH 1IGFL 1INQB 2KH2B 4X7SH 4J4PC 5A2IH 3M07A 4JRXD 4QEGA 3ARGD 3KPRB 1OD7A 2ICEA 3LV3A 2O61B 1S7RA 4U0RC 1KUMA 4YBHA 5L9DL 5F7UA 3FMGH 5F9JB 4JEGB 1JCKA 5AYUH 2L7UA 5KVGL 1MLCA 4JHAH 3ALPA 4F3FA 2VL5A 4QLRA 1W72B 5GRJH 5DMKA 5A40E 5JUEH 4FQCH 1NDGA 1FG9C 3NTCL 1HH9A 1I3RA 4JFDD 1NMBH 4AIXA 4L4TD 3U2SA 4G6KH 5DD3L 3HS0A 3QDMD 2YPLE 4FQPA 3U36A 4F2MB 2NY2C 3QG7L 1UCBH 4OF3A 5IV2B 1YJDC 3BEVA 4B0MM 5FB8A 4DGVH 4G7YL 1RULL 4FABL 2GAZA 4ETQB 4U49A 1WBZB 4MX7B 3CFBB 2ADIB 2R23A 2BP3A 3ULVD 1FLRL 4ZAKD 1CF8H 1Y6MR 2ADFL 1U8QA 4LF3B 3T0AA 5DC0A 3FB8A 2AV1B 1A1MA 2PW2B 4FQXA 4RWYH 4IS6B 3L6FB 2Q76B 3VXME 2LV4A 1DBKH 4BZ1L 5HHNB 3KYMA 5JW3L 3D2UB 3QFJA 4LCWE 5SV3A 3AY4A 1KXTB 4NT6B 4MB4A 1HYSD 4MHHG 3DV6A 4X4YB 4WEUD 5T1LB 5D9SB 1S7UB 2C1PA 2WWKT 5C71A 3PXHA 4KRPD 3IVKA 1LP9F 3RTQB 1AD9B 1MCBA 4HBCH 2QHRL 1VFAB 2PXYC 5F9OL 1FNHA 3ZLQC 4JDZB 5JQHC 1UZ6F 1QRKA 3HE6D 5CJQH 3FO0H 4PJDA 3VXSA 5D7KE 2AKRB 4RMTA 3DNKA 1L0XA 4KTYA 4PJXF 1RURH 1INQA 3ULSA 1CLYH 4Q9QH 3CK0H 3SKNA 3NFSH 4Z7NF 2WUCL 4Y2DB 1A3LH 3MZGB 4MZ2A 5DC4B 1HK6A 3D3VD 4IEFB 2YBRB 4WV1B 1I8MB 3SCMA 4ODSL 5IEKB 5F9JA 3O2WL 2GY5A 4JQXA 3M1BA 2FX9L 1NAMH 1W72A 4JM2C 3TJHD 2DICA 5DJ2A 1CFSB 1Z9LA 5MERB 5CD5C 1AI1L 2JTDA 3QQ9D 3JWDL 4JO3H 4P2RE 3V4VL 4ZD3H 2C5DC 3HFML 2V2WB 1XFPA 3UJIL 4JFED 4AG4H 2KKQA 1UENA 3O4OC 1FL3A 1YYML 1SEBB 5ESQA 3LRSB 4GW1B 4PBXA 4F2MA 1R3LA 4QOKA 4H0IA 1EJOH 4JO4H 4OZIF 3JV4B 5F7EH 4YHPB 3OWEA 1YEGH 4IDJL 5FKPB 1WBZA 1MHHB 5TDOB 4MX7A 3H42L 3WUWA 2ADIA 4YHNA 3OKMB 4JM2F 4BSVB 3OKDB 1VKXA 5IB1A 5CGTA 3L6FA 2HMIC 5A2LH 3RUGF 2GUOB 5HHNA 1ZHNA 5GPRA 4WI6A 1A21A 5BRZE 4CJ0A 2F15A 1BIIB 3N1QC 4FRWA 1TCRB 4YXHH 1G7QA 2WLYA 4X4YA 2I9LB 4WCYH 3OKEA 1GPOL 1FVDB 4WFHD 5KVMC 1B2WL 3RTQA 1QLEH 2ZCHL 1GC1H 1IM3B 2VMFA 1RMFH 4X99A 4MHHI 1A2YA 3WFHB 2AKRA 2DWEA 5HDBF 4G80B 1MRCH 4G5ZL 2JLLA 2P8LB 3ULUC 4TSBL 5DD1H 5I15H 3AUVA 1RZJC 4P4KB 2MOVA 4ZUTA 1I8MA 5IEKA 1CD0A 2DWDB 3TPUB 1OVZA 1ZT1B 2NTFB 1NFKA 5E4EC 2ED8A 1ZLVH 1A3RL 3A0OA 4WIQA 3NIDF 1JWSB 1GOHA 4K71C 5HHOE 2E27H 3OHXA 1QLFB 1QO3A 1CG9B 1JHTA 3ALXA 3NA4A 5HGAA 2V2WA 3HG1A 3ULUF 1ZS8B 1DN0B 1RK0B 1XF2B 2NY0C 3GSQA 1SEBA 4WUKH 5CJOL 4G6FD 5LBSL 4MWFB 4LARH 5E6YA 1RUML 3RJDA 3DPBA 4OFYA 3JV4A 2ATPB 1TQCC 2OP4L 4YHPA 4P23D 3JV0A 2VZVA 4XMLL 3NPZB 3EHBD 4BFGA 5FKPA 5TDOA 1MHHA 4JPWH 4O5LL 4OFVA 2ZUUA 2DI9A 3OKMA 4BSVA 2X05A 5B3NA 4TUJA 1J12A 5ADPL 5DGQA 2J2ZA 4N1CA 3SDXB 1K8DB 5JR1L 4Z5RB 1R0AL 5HI3D 5CEXB 4OZFB 4NQTA 1BAFL 3NCEB 4P2OD 3P0GB 2EO1A 1KYOJ 2GUOA 3VH8G 4I0PD 4DTGH 5FO8A 3VXUA 5DUMH 4P46D 5KSBE 2PKDA 1TCRA 5IVXB 2VE6A 1MI5E 1B6DA 4JQVA 3CXHJ 5LGHL 4XPGL 4HJ0D 1T4KA 4Z8FL 3VGAB 4TOYH 2X4PB 3BXNA 4ZO8A 1MOEA 1KGCE 5GGVH 5SWSD 2EXWD 6FABL 2X4TB 3CCHA 3TT3L 4QHMB 4K2UH 3MLSL 4MA8H 2IPTH 4HUVB 1FNAA 4EI5C 1QVOB 4MAYB 4MA7L 2AEQL 2ZUQB 3RKDC 3C6LC 1MH5A 3D85A 4JFYB 4P5MB 1U36A 3O0RL 1DSFL 2P8LA 4D9RD 3TPKA 4NGHL 4RAVB 3SO5A 4KVCL 4NQEB 2F5AL 2OL3A 4P4KA 4PJFF 4LSUL 4HIIB 5KS9B 4QCIB 2DWDA 3TPUA 1ZT1A 1OB1B 3HMXL 2E7LC 2R39A 5ICYB 4ONOA 1PKQE 3ZKSD 2CKBL 4S11A 1KF9B 1XIWB 4HS6B 4MJ4A 3VI3F 1IEBA 1JTPA 2R1XB 1QLFA 5F3HA 3U46B 2IAND 5E7BA 4JFFB 5MI0B 4WEBH 2A6JB 3AS3A 4LLAA 4IMLA 2P8MA 1RK0A 1A7PH 4WI2A 3FB5B 5C7XH 4Q9RH 4XP9L 4QRRD 4Q9CA 3RWEA 5KG9B 1BP3B 4B7IA 4NQUA 2ATPA 5D71H 1FE8H 3NH7L 4WUUE 43CAA 3ARDC 3PWUB 4FP8H 3OGCB 1UEYA 1P2CB 3K7UA 4LSVH 2XACC 2DIAA 3ZT6A 4J6RH 4XZUA 1K8DA 1FAIL 1PG7H 4ELMF 2O5XH 4XPFL 2AJUL 3EDDA 1OGAD 4HUXA 1T66C 4HWEL 1WFOA 5IVXA 5F6HJ 1AKJB 4QRQB 1QSFE 2C1OA 3T09A 4ODWA 2E6JA 1I7UB 2A0LD 5CJXC 1CVRA 3PDDA 5FIEA 1CICD 3V6OA 4JR9L 2ITCA 2PTTA 1XGRB 2X4TA 4QT5A 3WO4C 4I13B 3IU4H 4QHMA 2EDDA 3VMNA 1U42A 3MRCB 3VFRA 5KZCD 4HUVA 3ZL4L 4YHIA 2D0FA 4MAYA 5HJ3B 4P5MA 3GJFB 1Q9WB 5AZEH 3G5XB 4UQ2B 4JRXE 1HWGB 4NCC2 5FGCB 1R3HB 4RAVA 1ZGLB 5D2LE 3PHOB 1CR9H 3PHSA 4LPVA 4NQEA 4R2GD 4EDXB 4DUWA 1V3JA 3UAJC 2HP4A 3QHZL 4OD3L 1J0ZA 43C9B 3QRGL 5KS9A 4YEEA 4G6AD 2I5YL 3NIGF 4NFBA 2FO1A 4NO5B 3RDTB 3V9FA 1SYVB 1MREH 4IJ3C 3L5JA 1SEQH 5GRZA 3GM0A 3DSFL 1FO0A 4P5TD 4DAGL 1XIWA 1F8TL 3O3AA 3AREA 1MFEL 4HS6A 3G6JB 2YD8A 1IAKB 2FYYB 3U46A 2EDRA 3MXVH 4WHYH 1TZHB 4L4TE 1PBYA 4OLVL 1CBVL 4JFFA 5J1AA 4LL9A 3VXTB 2A6JA 3X11B 2LVEA 3ZTNL 3QDME 3PP4L 4TTDC 1KXQE 1DFBL 4QXWA 5IIEB 3SPVA 1CDUA 2EIBA 4G9DB 5T33H 4G42B 5KG9A 1ZA3B 3GDBA 2J8UA 5LG1A 3V2AR 1X4ZA 3DGGB 2BVEA 2FEDD 1NCBH 4ODTH 2XZAH 3PWUA 3RVUD 4HFWA 4PJAB 3OGCA 3ULVE 5L7XH 1P2CA 3CU1A 4F15C 1EMTL 1HSAB 4JY6B 3R0MA 2IMNA 4DCQB 3S37L 4GRWE 4XC3L 4NKDA 1K6QH 4KHXL 1FZOB 1LEKB 4PJ7F 1VCAA 2QADB 1IQWL 1AKJA 1U8HB 4QRQA 5FCUL 3T2NL 1CU4L 4H0HB 1I7UA 5C6PB 1BREA 1NGZB 3QO1A 3MCKB 4ODHH 2P8PB 4GMSL 5IQ9B 4AM0A 4IRSB 4ZUUB 3MRCA 5D7IE 4L3CB 5EBWB 1AP2B 4M1GH 4F58L 4XNYL 4XXCC 3GJFA 1Q9WA 5FKAA 3JWOH 4MQ7B 4UQ2A 1PEZA 4XMKL 3SOBH 3TA3D 4JN2B 4ZPTB 3PHOA 3D3VE 4UUJB 4U1HB 3WIIH 4XVJL 5ACZB 43C9A 2HFEB 3OX8B 2F8OA 1LK2B 1SYVA 4U2ZA 4E0RB 3H3PL 1GZPA 1YEFL 4XHJD 4JRYA 1JPSH 5KVGH 4E41A 1AXIB 3FFDA 2HVJB 1F4HA 1BFTA 1CGXA 3REWB 3H9SB 2CH8A 4PB0L 2Y4SA 3G6JA 3L95A 4HGWB 1UA6L 4J4PD 4I3SL 4GQPH 3NTCH 1XF1A 2J88L 2MSPA 3CC5A 1IM9D 3JXAA 3EO1A 1CDJA 4F7CA 4JFEE 1T89A 2PTVA 1YDPB 3SCMC 4XNXH 2FWOB 5DD3H 4NZUL 1KNOA 3LSOB 2VABB 1OP3K 3LEXB 4JQXC 4G42A 1JN6A 3QG7H 1MWAH 2FJFB 4FQQB 1FNFA 3EOBB 4Y1AB 3DGGA 4PJDF 4UBDC 2ARJB 4G7YH 3S9DB 3BDXA 2RHEA 3HC3L 4PJAA 4F8QA 3I6LD 2FSEB 4NYLB 1Q9KA 4LCCB 2G9HB 5HI4C 1LE5A 1OWRM 1HSAA 2ADFH 5KVFH 2VQ1B 3MFFB 3RNQB 2Y5TB 1QHOA 2FR4A 4Z7WB 3SDYL 4LIQL 4BZ1H 3AAZA 2NY2D 4TNVK 3RWGB 1LEKA 1ZSDB 1T3FB 3MUY1 1U8HA 1WIOA 3QULB 3HE7B 4OJFL 2VXUL 4WWKC 3V5DB 1I9EA 3O6FC 4WFHE 2Z31B 1P4IL 1KOAA 3LKRB 2Q8BL 3MCKA 5D6CB 5F9OH 5CJ5A 5IQ9A 1T1WB 4JY5H 4IRSA 1MFNA 4X7EC 3DETC 2KQNA 4JKPL 1T2QL 1INEL 4L3CA 5JW4N 1K5NA 1AP2A 3WS6C 3FO1A 1G7JA 3T0DA 2D7NA 1REIA 4I1NB 3DO3A 3RTQC 1GOFA 1CE6B 4ORGA 4EVNB 2NY5L 4U1HA 4O2CB 4K07A 2ESVD 5ACZA 1U8JB 1SVZA 2PXYD 3B6SB 3OX8A 4FS0A 4YQXH 2BY3A 4R4BA 3O2WH 4X80L 3IDJB 1OCWH 4LP4A 2APTA 4QRSB 3G6DL 3VXNB 3PWPA 2FX9H 4X5LA 3REWA 1Z9OA 5IROA 5EBMB 4HGWA 1NGPL 3JWDH 5ILTL 1I8IB 2NXYC 3QCUL 3M45A 3HFMH 3R06A 2AK1H 3TFKC 4XCCL 3UJIH 5IFAL 1DBBL 3JV6B 4JO2L 2D7MA 4GRMA 3UTSD 2CRIA 2VOTA 2VABA 3LSOA 4ERSL 3A6CL 3IJSB 3LEXA 4PJ5B 5I73C 4HWBA 4DN4L 4C54A 4X6DA 4OSUL 3E6FA 2FJFA 4FQQA 2CRZA 1WBYB 4Y1AA 2AJ3B 4JM2D 1PSKL 1Z5LB 4W81A 3TV3L 2DBLL 3H42H 1DUYB 2JIXB 5CD5D 4NYLA 4LCCA 2G9HA 5EZOH 5I2IA 1G9NH 3P9LB 3MFFA 5CILL 4HF5L 3UTQB 2HKFH 1A1OB 4R96B 4JDVB 3O3BB 4WY7L 2IC2A 2O93L 2DBJA 1ZSDA 2DQFA 2PW1B 3T2PA 4RSVA 5KANI 3MLUH 4G9FB 4TN9A 5JHDD 1IE5A 2A6KA 5TH2A 1B0GA 3QULA 1E6JL 3HE7A 4FTVD 1MJUL 2UYLA 1GPOH 3ARBA 4R9HA 1HWHB 2GK2A 2X9WA 3MC0A 3AVEA 3BUYB 2C26A 4TSAL 3LKRA 2B0SL 4GXUN 4KJWC 4NWTH 5FF6B 4WI9A 5D6CA 1T1WA 4L9LB 5IP4A 4AIZB 1IAIL 4K8RH 2HMID 4RX4D 4EBQL 1P7QD 1YC8A 5ETUA 3T0EB 4FQIL 4OCNC 4BZYA 4JQVC 4PP2B 2HJLA 2X4UA 2AV7A 2VXTL 5GISH 4D9RE 5L8KB 5KOMC 2C7UB 4TSBH 5HYSA 3GBNL 4J8RA 3S35X 4LEOB 5EULV 1KTRL 1N2RB 4FQ2L 3KLHC 1U8JA 3B6SA 5JIIA 5HPMA 4IRZH 3TNMB 1T0PB 1HZHL 4PV8A 2QHLA 4QRSA 3SGJA 3VXNA 5T3XH 4CVXB 5GRWA 2RFXB 3ULVL 4FFYL 5EBMA 2IANE 1T1ZA 4FZEL 4ZOBA 2ZSVB 5DMJB 5J6HA 4P4KC 1T21B 4M7JL 1VEPA 4UIKH 3LMJH 3W0WA 3JV6A 5C0BA 1FGNL 3BKJL 1J05B 4QRRE 1I8KA 5LBSH 2Q3AA 3IJSA 4PJ5A 5GRVL 3GGWA 3LN5B 1VB9A 5B3JF 1RUMH 1IZJA 4Y19D 4QTHB 2JELH 1M7DA 1WBYA 3HHRB 2AJ3A 4YBQC 2OP4H 4R0LB 5SWZE 2IQAA 3QPQC 2VSDA 1Z5LA 3UDWA 3V52L 4EOWL 5F71A 3PWLA 2DN7A 4E5XB 4YK4B 1AO7D 4YFDB 5ADPH 3CX5K 1CGUA 1O5DT 2FO4B 4LHUB 2DYPB 1X4YA 3ZSSA 1R0AH 2NY0D 4PB9H 3UTQA 4MB3A 1J1OL 1QR1A 4R96A 3MRBB 2VH5L 5F1SA 2G5RA 1OGAE 4KI1A 4JDVA 2GSIB 4RA0C 4CW1B 3TJEH 1SMAA 3HUJA 3WLBB 2PW1A 4RIRB 4G9FA 3QFDB 5DVKA 1I8LA 4R4FH 4Y4KB 3MACL 5LGHH 4PR5B 4XPGH 4PRDB 4PRAA 4LCUB 1XZ0B 4ODBD 1S9WB 3NFNB 3GJEB 1N7MH 3O3UN 4PLNC 4MJ2A 5FF6A 2V9QA 2EDWA 4KROB 5BVPL 1QPXA 3TT3H 4HH9B 5C0CA 5JA8B 2OTUA 2C4FU 4MDJA 4P9MH 2LU7A 3VDBA 4MA7H 2AEQH 4FQ1H 4QGTA 5ADOL 3O0RH 5D96B 4JN1L 2WIIB 1AC6A 4NGHH 4M6AA 4HS8L 3V6OC 4LEOA 4KVCH 3CDGA 3HAEB 2EC9U 2PR4L 2F5AH 3GO1L 3PQYB 1PVHA 1NC4B 3OR7B 3KXFE 3U0WL 4PLOB 4G3YL 3RAJH 2L4OA 5DUBB 1AQKL 1J0JA 5BQ7B 3HMXH 4OLWL 1CFVL 5J57B 4MNQB 4CVXA 1BZ9A 4EI5D 3QHFL 1T5WA 3RKDD 1JUFB 3C6LD 3GMPB 2B5IC 4A6YH 2BOBA 3MLVL 1N8ZB 5F7NC 1OPGL 1A4JA 1W0VB 2FJHB 1DEEB 4WI8A 4XCEA 2CLRB 5JQ6L 1J05A 4Y5YC 3MV9D 4XP9H 3LD8B 1AHWA 3LN5A 3IKCB 3HZKB 1GGIL 1WF5A 4FMKA 5E4IA 1PY9A 5H35A 4QTHA 3AREC 3GBLA 4LPTA 3KLSA 4PJIB 4M1CC 1RJZB 3D5OF 4YIQB 4ZQKB 3KPTA 3MUJA 3TIDB 4QHKJ 4JZJA 2FO4A 2NY4C 4LHUA 1FAIH 3RVXC 5GRUH 5C86A 3MRBA 5IOPB 4XPFH 4WI3A 2H26B 5FYKH 2A1WH 1V7NH 1MHPL 1WCQA 4JFPB 3UCRA 3O3DA 4HWEH 3WLBA 5I1HL 3IGAB 5L2JA 4CAGA 1EEZA 4S10A 3ARDD 4AZ8A 4RDQG 5E8EB 4WO4A 2YD1A 4H8WL 1X5GA 3AS2A 1GVIA 5D1QA 1S9WA 3JVGA 4FFWC 1NKRA 4JR9H 4M3JA 2YMXH 1FBIH 3MCG1 3ELAT 4HPOL 2D0HA 1TJHL 3ZL4H 4P2QD 4P3CH 4J1UA 3RL2A 2J8UF 4N0FB 1T66D 4YWGL 1UWEL 3TVMC 1VADB 3F7VB 1ZEAL 1FSKB 2ATKB 5D1ZB 4X6CF 3HAEA 4RFNC 5FGBA 2HJFB 4OD3H 1NC4A 3OR7A 3MJ7B 3EYFB 2I5YH 5DUBA 4X4XB 2QQNH 1WJ3A 5BQ7A 3D69A 2YWYA 3TO4A 1QBLL 2FGZA 3DSFH 5CP7B 3QP3A 3UYRH 5FHBL 4DAGH 3GMPA 1F8TH 1Q9OB 4R7DA 5J06A 4NUGL 3BP5B 1W0VA 2P46B 4OLVH 3WN5A 1ONQA 1CE1L 1ZT4A 1EGJA 1BQHB 3BP4A 5CLWA 1DEEA 2ICWB 1WIUA 3UAJD 2OBGA 3WO3B 2IPUK 3PP4H 5IB2B 1TNMA 2NPLX 5JPMA 1I9IL 4KKLC 1R3JB 1KENL 3HZKA 1U8LB 3MZTA 4LASL 4X7TB 4PJEA 2EDXA 3FKUS 4JO1L 5LGJA 5KSVB 3AS0A 2VDNL 3I6LE 4PJIA 1T89C 5CHNB 2GKIA 4YIQA 4ZQKA 3MRRA 1O0VA 3N85L 3ZKXC 1KT2B 3TIDA 3MRJB 2VISB 1JNHA 4L3EB 1KC5H 4N5EC 1FYHB 1CGVA 2OR9H 1H3PL 1K8IB 5A2JH 3RY5A 5IOPA 4FFVC 4XC3H 1BBDH 2R1WB 5MP6L 4PJ8A 1BZ7A 3RWIA 1Q0YH 1X5FA 1IQWH 5FCUH 3T2NH 4UTBH 1UZ6E 5TJWK 3G6AA 5DZNA 4RMQA 4Q2ZB 4JFHD 4GMSH 3B9EA 3BVNA 4PJXE 1YEHL 5KVEL 4OCSL 5JXAL 2VXQL 3TC9A 4X98A 4KRLB 1YPZF 4NQDB 3CAFA 3QEUB 4Z7NE 5BOZG 1DLFH 1YA5A 4N0FA 4PTUB 1RIHL 2HVKB 1IAIM 4CVUA 1FV1A 3T4YA 2AJXL 1RJYB 2AJZB 5D1ZA 5J12C 2D03H 3GIVB 2ESVE 2CDFB 1T1YA 2B4CL 4XVJH 5HYJA 2NLJB 4QXTB 1IGCL 1ZTXL 3EYFA 5GJSH 3CFEB 4HZAA 3SDDB 4X4XA 4DZ8A 3P77B 3H3PH 1YEFH 2AEWA 4HUMB 4HLJA 3C9NA 3IDNA 3I75A 4PJHA 4PB0H 4MNHB 2NW3B 2MCG1 1UA6H 3BP5A 3VMOA 1BQHA 2ICWA 4JQIH 2ADJB 4PG2A 3UTSE 4OZIE 5IB2A 1ORQA 1UFUA 1RIUL 1P69B 4NZUH 3WDHA 4BYHA 1JNLL 3LRGA 1L9MA 4M93B 4NN6B 4TRPL 1R3JA 4OCXH 4NIKB 3VXSD 5IROC 1U8LA 2ZCKL 4NKMB 4X7TA 4JPKL 2Z91B 3FONB 2B20A 3DUUB 4C83B 2Z35B 3O41B 3P9WB 3HC3H 3IRZA 1JYVA 2EXYC 1YEDB 3C8KA 4M6ML 3RNKB 5HXMA 3UBXB 1H8OA 5T3ZH 1MNUL 3I84A 3PGDB 3RUGE 1CL7I 3SCMD 2QR0B 4CKVX 3THML 5C9KA 4L8SA 2FX7H 2APBA 4MA1B 3M17B 3SDYH 4LIQH 1RZKL 4NO3B 2H32A 1JRHL 3QXDA 5I8KL 3SE3A 3W11C 3OKOB 1Q8MA 3FO9A 3N06B 4ALAH 5JHDE 4UBDD 3CLFH 4HW6A 4YGAB 2J8HA 1LK3L 1FP5A 3U7AA 2DJ4A 1H8SA 2GY7B 5IB3A 5HI4D 2LE9A 4LMQI 3TNNB 4QOKD 4ELKB 2OI9C 3KPSE 5HDBE 2IEPA 1IGTA 4FHBD 5I8OH 4W68A 2AS5M 1MIML 3QEUA 4X6DF 1XMWA 3SDAA 1A7QL 2W38A 4LVOB 1UXWB 3H6JA 2UZIL 3F6LA 2HVKA 3ARBC 4YJZL 3B3IB 4OZHA 5C0EB 5TE6H 4OT1L 1ETZB 5HPOA 1IC7H 1KJVB 1QFWI 1JL8A 3GIVA 3O6FD 1YN7A 2NY5H 4R3SB 2CDFA 4ZSOB 3NIDE 4TULH 4W6XB 4P2CG 4TVPD 3SDDA 2GITB 3P77A 5E8PA 5FYKU 3DETD 4X80H 4J3OC 3KYNB 3NZHL 3G6DH 4LLVA 1OF2B 3PGCA 4O4YL 4M1DL 4NM4L 4MNHA 5ALBL 3ULUE 1XAUA 3QHTC 2JCCB 1NGPH 3VXOA 3RKPA 3RTQD 3QCUH 2MMXA 4NKQB 3MNVB 2H8PA 3X12A 3NIFF 4XCCH 1LNUB 1FN4A 5IFAH 4JO2H 4QXUH 1AGBA 3UROR 2VUYA 5ISZB 1EO7A 1U9KA 2DOCA 4Y19E 4DN4H 1O7SA 2CQVA 3NFPA 1MCWW 3DUUA 3ILPB 3J8F7 2Z35A 3T3MF 1NUNB 3IAGC 1PSKH 4J3UA 4QRPB 1NCDL 1EX0A 3WFBL 1AO7E 1ZT7B 1YEDA 2F9BT 1MCOL 3RNKA 3UBXA 5I1KH 4UU9A 2W0FB 2BZDA 3PGDA 1MIEL 4GRLC 1UKTA 3TFKD 1GGBL 2QR0A 2VLJE 5FHAH 5E8NB 5CILH 4D8PB 3JBG7 3CH8A 3M17A 3UDWC 3WIHL 4AENA 1AFVL 4HIEB 3OKOA 4WY7H 2YN3A 4WFFD 5HVHB 15C8H 3HNSL 1XGPA 1IAMA 5A2FA 3HG1D 4GUPB 2YWZA 1TITA 3P4NA 3UTZA 1IJ9A 5ID1B 4AT6B 3QIUB 4MZ3A 4F7MB 3TNNA 1WAAA 4NQSB 4Y16B 1VSCA 1IAIH 2YPKA 4OFYD 4EBQH 4M7ZB 1Z2KA 4NHUB 1I8LC 4Y4HB 3RL1B 1AXTH 1QPPA 1UXWA 1R3KA 1TZIB 3MROB 4U1IB 2N7AA 4PJFE 4NN7B 4XHQA 1FZJB 1ETZA 1LDSA 2ICWJ 2ZG2A 2AP2A 1KJVA 3TT1L 2O5YH 4ZXBC 1KPUB 4R3SA 3RWCA 2VDRH 4KJWD 1B4RA 3GRWH 2V5YA 1E4JA 4IRJA 2GITA 3VI3E 3VXUD 2ILLA 2VLKD 1HZHH 4YC2B 1LO4L 1AXSA 1JFQL 4ZTPL 4OB5L 2YPLB 2FJGA 3FCTB 3U79A 2ZUWA 4OF5A 4FFYH 3HUJF 5HSFA 4FZEH 5F70A 2FL5B 1BX2A 2ED7A 2GK0B 2VZ3A 5EOCL 1J10A 2CKBB 1FORL 2XNAA 1FGNH 3BKJH 3MV9E 3OQ3B 3Q3GB 4RMVA 2V7NB 1YJDL 4OCWL 3KLHD 1YMME 1MRFL 1VACB 1EZVX 3D85D 4NZDA 4NRYB 1JTTA 2WSKA 1KCVL 1OQXA 3VXMB 4QRPA 2W0KA 4EOWH 2FD6L 3D25A 4ELME 2IALA 4LCWB 4P4KD 3OKKB 3PIQB 1G6RL 2DQHH 4Q6YA 4F7EB 1U58B 4HXAL 5IJVB 1AHWC 3I6GB 2I27N 1XCTB 5E8NA 4PGDA 3MBEB 3QUML 4D8PA 4UB0L 5E9DD 5DJAB 4WW1B 2VH5H 5LQBH 4LSDA 1UWXK 2MPAL 5FAAA 4PY8I 2WWMC 4YBQD 3RFZC 3QPQD 1BQSA 1ZGLP 2GJZB 2VO5A 3MACH 1FFPB 4JZJC 3RA7H 5F96L 4NNYB 4GUPA 4XP6H 1NGQL 1YMHB 4LKCA 5BVPH 3GZKA 4LFHD 3BKCL 3CFJA 4NQSA 4EUPG 4P2QE 1NLDL 5JDJA 3UZEA 3KPLB 4I2XE 3ZSTA 4NHUA 1T83A 1MAMH 4LAQL 4Y4HA 4G8EB 3RL1A 1NBVL 4UINL 1TZIA 3MROA 4U1IA 1N5AA 2C3VB 4WO4C 1WITA 1FZJA 4JN1H 4EJ1C 5D1QC 4HUNB 3JVGC 3NIGE 3UTTA 4X7CC 5T1DL 2PR4H 2Y25A 1FIGH 1G7MB 1E6OL 1KPUA 2VDKH 1GCFA 4I3GA 1KJMB 1QYGL 4P2RB 2VJXA 5HGBB 3BGAA 3AFLA 1VESA 4XAKD 1DQLH 4MCYA 1KJ2A 4X4MA 1KB9K 2YPLA 2YC1A 3QHFH 3QA3A 5EOQL 1ODAA 5IUSA 4P57A 5K9JH 4PFEA 3MLVH 1X4XA 1DQDL 5FGBC 4Z95L 5IMLB 1K4DA 4RBPK 3L3GA 1DN2A 2DLTA 2V7NA 3PDOB 4I0KA 3TO4C 1GGIH 3IDGB 2YS4A 2OTPA 2VLMD 4URTB 2NY7L 4NRYA 5DZOA 3VXMA 3WN5C 2DQDH 1A6ZA 3QUKA 2NYYC 1UGNA 2YUWA 5BRZB 2F53A 3DXAE 3OKKA 5I1IL 3PIQA 3HPJB 1U6AL 5BJTB 1U58A 5I6XB 5IJVA 3S35L 2VTFA 3I6GA 3EYVA 3FQNB 4PJ7E 3Q6GL 5BZDB 3KJ4C 5DJAA 2R2HB 4YO0B 3MV01 5I66B 1T80A 4W4NA 2VZOA 2DMBA 3ARED 5I1HH 2GJZA 4JFFD 3VFWB 4ODUB 4WHTA 1FFPA 4M1CD 3K1KC 4NNYA 4H8WH 3B2VL 3ZTJG 4JFHE 1EXUA 1XCQA 3QBTB 2NY4D 1BLNB 1JPST 1RZIA 3RVXD 2K1MA 2Z0BA 4F7PB 3C5ZB 1X6LA 1TJHH 4PJ8C 3OG6B 2PYEA 3LIZL 5C0AD 3VRLF 5EC2B 4PJEF 4X9HA 4YWGH 3S34H 4J3WA 1CTOA 4RFEB 2C3VA 3K80A 1PX3A 3I6KB 5HHOB 2P43B 3MNZB 4MCZB 2P1YA 1OHQA 5ANMA 1G7MA 5INCB 1I4FB 1NBYA 3HC0A 1KTDB 1C08A 4FFWD 1TTGA 2C4FT 3QCVL 4KTDL 5CKGA 1F3JB 5IT2L 4BZ2L 3BJLA 4JKKA 3MRDA 2G75B 3OGOE 4CNIB 5HYFA 1QBLH 5I30L 4ZNCD 1HH6A 4U6YA 3QDAA 3TVMD 4NUGH 4DVRL 1HYRC 3C60C 3VGDA 3JTTB 1CE1H 4RISH 5IMLA 2Z4QA 1EBPA 1IKNC 1SMOA 3PP3H 4U1LB 2ZUVA 4PJDE 3LKPA 3VXSE 3PDOA 4WRLA 3QT2A 1G9MH 2QBWA 3EAKA 4ETYA 3PGFH</