1TEFA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
b'VEVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 and 1.96 resolution, respectively.
rcsb
source organism Spinacia oleracea
molecule tags Photosynthesis
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tefA00
3SBPA 1AG6A 2DYSB 4DP4X 5F7AA 5B1AB 2A3TA 3OMNB 4GXFA 1UATA 4AKQA 3EH4B 1FA4A 3ZX1A 4G72B 1AS6A 1KDIA 2B08A 2AZUA 1GY1A 4G7RB 2EILB 5I5IA 4NB7A 4UAHA 3X2QB 3PAVA 1JZEA 4E9VA 1W6WA 1ETJA 1HFUA 1NIFA 4YSCA 5B1KA 1PLBA 1PMYA 3GYRA 1SDDB 5FC9A 4GP8B 3FU9A 2AFNA 2X87A 2BP8B 1AAJA 1J9QA 4AZUA 2GC4C 4FAAB 1KBWA 1MZZA 2VSKB 1GS7A 1CUOA 3QJQB 1URIA 1ILUA 1IBZA 2FTAA 2CBPA 3UAEA 1OOWA 4QKTA 2W8CA 3H4FA 2UXVA 3TA4D 1ET7A 4YSSA 4JHUA 4WTQA 3H56A 4YL4A 4KO5A 5I28A 3AZUA 4E9WA 2PCYA 1NIBA 3X1EA 2PP9A 3CDZB 2XV0A 4DPCX 4KNSA 2VW6A 2UXGA 1X9RA 3FQ1A 2HZHA 1A4AA 3ASNB 4KOCA 3NYKA 4BWWA 1W6LA 2HX8A 2YAEA 3QJVB 2BZCA 4YVUA 2BO0A 2H47C 2TSBA 1QLEB 3AG2B 1ET5A 2J56A 5B3SB 4BXSV 1TKWA 1BEXA 2IDFA 1JZFA 5AFAA 3TU6A 4PCYA 2FNWA 1BQRA 1SJMA 4BDVB 5A7EA 1BXAA 2J5WA 4AX3A 2BWDA 3QJSB 2J55A 1IC0A 2VW7A 3EF4A 4M4RB 3ERXA 2IDTA 4X4KA 1PF3A 3S3CB 3TASA 3NJKA 1ZV2A 1CYWA 3NP3A 1ID2A 5I6OA 4DP2X 3FSWA 3QJRB 3IBOA 1GSKA 2WSDA 3NJJA 4A2EA 1RZPA 1WAEA 1AR1B 2VM3A 3ASOB 1GS8A 2IDUA 1NWPA 2GI0A 1QNIA 4JKNA 2QPEB 1ET8A 2YAFA 3ABKB 2AANA 2PLTA 3ABMB 2R7EA 4UANA 3CZUB 1SF5A 4YSTA 4N8UA 2JFCA 1L9SA 3SBQA 4HAKA 4HALA 4YSUA 1E65A 1NWOA 4W1TA 4KOBA 2I7OA 4AKOA 2YXWA 4ENZA 1KBVA 5B1JA 1RZQA 3T6ZA 1M57B 2IH8A 5B1BB 2XXGA 3NP4A 1PCSA 5AKRA 4DPBX 7PAZA 2B3IA 4KNUA 1PY0A 4G7QB 1ZDSA 6PCYA 1XB8A 4MFHA 4CSZA 3BVDB 3GDCA 3NJFA 4A2HA 2DV6A 3NJIA 3WG7B 5I5JA 1XB6A 4G7SB 1SFDA 1GW0A 3C75A 2WO3B 3KW8A 1BQ5A 3OMIB 2FT8A 1JZGA 3PAUA 5B7EA 1ZDQA 2IWEA 2UX6A 2QT6A 3DKHA 1E30A 2BP0A 3OM3B 4GY4A 3N55A 3ZBMA 3D12B 5I5MA 1N70A 1L9OA 4FA7B 4NERA 5AZUA 2Q9OA 1IUZA 2EIKB 1MZYA 2R7EB 3OMAB 4TXVB 4F2EA 5I6KA 4P5SA 4DP1X 4KO7A 1AG0A 1AQ8A 4KO6A 4A68A 4GP4B 4CSPA 2FQEA 9PCYA 2XLLA 2FJSA 2PPDA 3G5WA 2GHZA 1A8ZA 2VMJA 3NT0A 1BQKA 1GY2A 4WKXA 2XU9A 3UADA 3FU7A 2UXFA 2E86A 4Q89A 2HRGA 1ZPUA 4GP5B 2I85A 2JKWA 2ZONA 3AY2A 2MTAA 3FYIB 4YSOA 4E9TA 1HAUA 2EINB 1ASOA 3H4HA 2IDQA 3V9EA 3WIAA 5B1JC 2X88A 1JZIA 1KV7A 1NPNA 3EH5B 1I53A 3X1BA 1AS7A 3UACA 1AZUA 3DIVA 3NJMA 3FPXA 4E9SA 3WI9A 1OE2A 3T9WA 1XB3A 3WKQA 3OD3A 1PNCA 2IDSA 3WNJA 2H5UA 5B7FA 1GYCA 2GSMB 8PAZA 1KGYE 2PP7A 3IE9A 1XMEB 2QDVA 1AZNA 4N4YB 1M9WA 2BW4A 2YAMA 3IEAA 4RH4A 2LLNA 3TBBA 1OV8A 4DP6X 1QHQA 5LDUA 3IN2A 3AW5A 1AIZA 2P80A 3S3DB 3QPKA 3KW7A 5PCYA 5I6MA 2Q5BA 4HHWA 2VN3A 4G70B 4M3HA 4A67A 2VM4A 1RCYA 4EF3A 4YSPA 2ZOOA 3N2JA 1CC3A 3FS9A 2AVFA 1JVOA 4GYBA 2EIJB 4HZ1A 2N0MA 2IAAC 2TSAA 4E9RA 3BQVA 4DP0X 4ZK8A 1JXFA 3WNIA 2XX1A 4A66A 2FT7A 2FQFA 1SHXA 1W8EA 3CVBA 3AG1B 3FQYA 1WS8A 2GIMA 1NDTA 1SF3A 1JXGA 3PLYA 5D4JA 1WS7A 2IWFA 2YAQA 3FSZA 4BK5C 3DTUB 2QPDB 2BZ7A 5I26A 1ILSA 3PPSA 5B7MA 4F2FA 2HX7A 3T6WA 3MX0B 4E9YA 3OQRA 1OCRB 4KO9A 3WKPA 1JXDA 2HLEB 1NINA 1AS8A 3S8FB 4PAZA 1L9TA 2GC7C 2DWSA 1SDDA 2YARA 1TU2A 1PZBA 2OJ1A 3TBCA 1L9RA 3FSVA 4L0PB 1ADWA 1GS6X 1GR7A 1HAWA 3FU8A 3UGEA 2XUWA 2BP8A 2GB2A 3X1NA 3AG4B 2FQDA 3T6XA 1SHWA 2IWKA 2HX9A 4BWUA 1JERA 1AANA 3RYMA 3ZDWA 1MG3C 4NAJA 3X1FA 2YAOA 3SBRA 1OF0A 1BXVA 2P80D 1CYXA 3ABLB 1FWXA 2ZWNA 2BHFA 1BYPA 4A2GA 1E5ZA 4YSEA 1N68A 4E9QA 2YAHA 3CDZA 3FT0A 4K9JA 1PAZA 1RKRA 2XXFA 5D4HA 1KYAA 2JXMA 2DYRB 3T6VA 4E9XA 3CG8A 4YSDA 1PLAA 3PCYA 4YSRA 4Q8BA 4A2DA 3JTBA 1B3IA 1F56A 1JOIA 1MG2C 5ANHA 1NIAA 3S8GB 2MRYA 3CVCA 1VLXA 2YQBA 3T71A 3NSYA 3V9CA 4BDVA 3CVDA 1EZLA 1ZIBA 1T5KA 5TK2A 3NJLA 1ASQA 1SNRA 2PPEA 4HCGA 1SFHA 1KCWA 1V10A 1E5YA 1FFTB 1PNDA 4JHVA 5IY5B 1AZRA 1J5CA 1NIDA 2I7SA 1X9UA 2HXAA 1BYOA 4DP5X 3QJTB 2OV0A 1J9RA 3NJGA 1MDAA 1L9QA 3EHBB 2VW4A 1NTDA 1NICA 2CAKA 2FT6A 1V54B 3JT2A 2PCFA 5F7BA 4YSAA 4HHGA 5I6PA 2PPFA 3FYEB 1J9SA 1TEGA 1OE3A 2BWIA 2H3XC 1KCBA 1EHKB 4HIPA 3NSCA 2BP0B 3HB3B 1BXUA 1M56B 1A4BA 2WO2B 3L45A 4W9ZA 5EHFA 3SQRA 1IKOP 1NIEA 5D4IA 3AG3B 1OCCB 4UF7C 1AZBA 6PAZA 2CALA 2UX7A 4BXVA 2BW5A 2CJ3A 2EIMB 1J5DA 2PPAA 2YAPA 1AOZA 1OE1A 2UXTA 2XV2A 1A4CA 2FWLB 4F7KA 2XYBA 1KDJA 2CUAA 3UAAA 4AKPA 2XX0A 2QDWA 1JZJA 3HEIB 1JVLA 3QQXA 4P5RA 2W88A 3PAZA 3FU7B 3ABGA 1A65A 2FQGA 4YVNA 1CURA 2VSMB 5PAZA 2NRDA 3EH3B 4DP8X 1A3ZA 3PXLA 3NJNA 1AZCA 1JZHA 1V55B 3FPYA 5E9NA 1PZAA 3FQ2A 3IN0A 4DPAX 2ZXWB 1IBYA 4BWTA 3NSDA 7PCYA 2XWZA 2Y69B 2HRHA 4DP9X 1WA2X 2RACA 4HCIA 4QLWA 4HCFA 2XVBA 1ZIAA 3MBWB 3GXUB 4G71B 1R1CA 1WA0X 1PLCA 1PZCA 3NSFA 1NPJA 3ZIYA 2YXVA 1DYZA 2OCCB 4A2FA 3FSAA 4DP7X 2XV3A 4KNTA 1NZRA 1WA1X 2GBAA 2PPCA 5I6LA 3U25A 2Y1AA 5I6NA 3NJHA 3QJUB 1YLBB 3X1GA 4YSQA 2J57A 2DY2A 1J9TA 1E67A 3S3BB 3UABA 4AI7A 1L9PA 2CCWA 1ASPA 1DZ0A 2DWTA 1OCZB 2PP8A 1OCOB 1TEFA 2IH9A 2AZAA 1AACA 1BAWA 5TK4A
chains in the Genus database with same CATH superfamily
5F8RC 5L88H 1URZA 1ULVA 2DYSB 1B3JA 1CK0L 2K6WA 4W4OA 4MBOA 2FLMA 5EU5A 1KYOK 5LBSH 1DJYA 1AH1A 2JJTC 4LPTA 4PQXA 3TZVA 4G6FD 3MMEA 1RUQH 4N2EA 3SGJA 3O6ML 2WLHA 5DYFA 3E0GA 3IFOA 3W0WA 1FA4A 4UOZA 5BJTA 1R6VA 3GHBL 1R34A 3BPNC 3QISA 4X6BA 2AZUA 4X6FB 1IBGL 3NAAH 3SE9L 4TQHA 4DW2H 4U1HB 2WN2A 2CHXA 4JDEB 4NQSB 4M1GL 2GEQA 2ZKHH 4R2GC 5IBTH 4MAYC 1INEL 1O7DC 1PLBA 1TIUA 1PMYA 4PWIA 3O2DH 3GEFA 4JGJA 4NT6B 5IFAL 4HSCX 4N2HA 4YUEL 1ZHLA 4PJ7A 4KK9D 3VFTA 1JCKA 3WIHA 3ULVF 3JWOH 2IG2H 3BKJL 5E5LA 5HJDA 4KJWC 3U46A 4H13C 3ALXA 1WAPA 3F7KA 2YD9A 1TZIA 2QPUA 1OT2A 2VMCA 3D5OF 4X8JB 2XKSA 3VD7A 2NY6C 2JKJA 5F9JB 3DX0A 3FB8B 3VXSD 1ILUA 1A4KA 3S34H 4PCKA 3FBKA 4XNUH 4FXKB 2FTAA 1RP8A 1W2KT 3F7LA 1PKQE 1HEJC 4FP8L 2A5UA 5T3ZE 1RZKC 3H7BB 1NCAH 4XVJL 3ET9F 1YN6B 2H3NB 2Q0ZX 3T8XB 2FX9L 3NIFF 4I18B 3QORA 1NUNB 3WFCL 3K8KA 1IGYB 2P8PA 3MV8A 4MB3A 3V0VB 4BWWA 4ZFZB 4GBXD 3S36X 1G7MA 3MX0A 4Y2DD 2YAEA 4FI7A 5AVYB 2KLTA 1VERA 2DW5A 3MV11 4W9IC 5IVXA 3Q06A 4POUB 2VC2H 5HGAA 5KVFH 5E94B 1J8HB 4JZNA 4X42A 5CZVL 3R4RA 4FI6A 5JOFA 3B3IB 3QIBC 4F2MA 2JTYA 2J56A 1J5HA 3TC9A 3WSQL 5L2JB 1JNLH 4FZ8H 1KPUB 1YEIL 4XCFL 3MRQA 1MDTA 5EC1A 5HHOB 2YSSB 3HFFA 3C6LD 5J4MA 3QR2A 4NO3B 5AZEH 1SJMA 1HOCA 2DDQL 1Q9LB 4ZPVA 4N8CH 1QFUH 3VXTB 4YHYB 5EC2A 3V4PA 1KY7A 2WIMA 1Z3RA 3I84A 2E6JA 5DRWA 1HDMA 4KQ4L 4S1RH 5DZLA 5EIIB 4N2NA 4Y4FA 2BJMH 2C9AA 2GUYA 4CN4A 4GKLA 2YKKA 3UTPE 4P4RA 4HBCH 3TT1H 1IV8A 2D3VA 4GRLB 1E3XA 7FABH 4P5KA 4XX5A 2Q7YA 2WZPD 2EDHA 2F19L 1PX4A 2YQ3A 3F05A 4JKNA 5F2FA 4PU2A 5I6XC 5CJQL 4UV7L 1KCKA 1MH5A 2QVKA 2MPAL 1KEGH 1P6AB 2EIEA 1HXYA 3P4NA 1XIWC 3NCCB 3WN5B 3LEVH 4HJTA 4JDZA 5F0PB 1MCRA 1ZPLA 4P9ML 2A6DB 2PW1B 4YGAB 2VDOH 1XSKA 5E99H 4UNVA 2AQPA 3VG9C 5DFVC 5CEYA 5LAPA 1ZLVK 4RZCB 5FOBA 4AQ1A 3BPCA 4DPBX 3BQUA 3A6BH 3FQNB 2YPLB 4Z3JA 3L16A 1P2CA 3MJ8A 4W9CC 1S7QA 2IFGA 2IQ9H 1I82A 1U93A 4A6YH 3IDGB 3EXLA 3GDCA 1A4JA 3D3VE 2ZIDA 1IRAY 1CE6B 2VABA 5E5RB 1GW0A 1T21A 3VGHA 2WO3B 1MHCA 4M61A 2R23B 4F9LA 4L1HA 5TDPA 4G6KL 2Y5QA 4N0YH 3TVMA 1OCWL 1BOYA 3IK2A 3AREA 4M7LH 3EYOB 3OM3B 3T3PF 1Q9OA 2YXMA 1R5WA 4XVUD 4PGBA 4HIJA 3SDDD 2FO8A 4O4YH 4PRHB 3EOYG 1OGTA 5AZUA 3MNVB 1TYRA 5AW4B 3IWVA 3BHBA 4K8RD 4RAVB 4H0IA 3HUJA 2VQ4A 2WAHA 3I9GH 2ROYA 2R2EA 4Q14A 5DVKA 5I8KL 4F5CA 4GG6A 1KY6A 3BN9C 3GB7B 1EERB 5DEGB 1YEDB 4G8GD 2ZYSA 2KZBA 3S35H 5CJBA 1A9BA 1I8IA 1MF2L 2Y2TA 1MXDA 4HKBA 4NN5B 3IAQA 3OKYA 1WBZA 3QUYB 5D1ZC 1UXSB 2H7WA 3L5WB 1V3LA 3LZLA 2KQNA 4DT2A 2UXFA 1DVFC 2BSSB 4H44C 1JK8B 2RAMA 3KYAA 2ZONA 4OZFA 4YSOA 2UY7A 3RWHB 2AHIA 4RIRA 3N04A 4LLVA 2NYKA 2WN3A 3DO3A 4AEHL 3QDGA 1JGEB 3TPUA 5ERWB 1G0XA 3HE7D 1U91B 1CXIA 3AMLA 3BVWA 3HVNA 3VX0A 4RFEB 2P44B 2NSXA 1NGZB 2JELL 4WNJA 4DGVL 4NXKA 3TT3L 4DZBB 5AL0A 3S2CA 2W9EH 1OSPH 2N7SA 4JPWH 4YDKL 1FF5A 4Y16B 5EZOL 3NQIA 3L4WA 4BGDA 4FERA 1G87A 4DEUA 1S3KL 2YAMA 1XR8A 1GGBL 3CXHJ 1MPAH 3N1GC 4XCNA 4HPOL 1FL6A 3RWJB 3N85L 4MNGE 2HVBA 4WCYL 4ZFOB 4A7GA 5MERA 3QB7C 1CF8H 3SCMB 4M3HA 3TNMA 5DHYA 3IS0X 3W2DH 3KPRD 3WYRA 5K9QG 3P11L 4HULB 2VLRE 1KJMB 1IQWH 1QI5A 2HCZX 4IU2A 4XWGH 1JVOA 4JN1H 5C70A 4Y2LA 1LEGA 4GSUA 1RZKH 1UD4A 1QWNA 5HP5A 3IMSA 3FUMA 3PWLB 5EU4A 1G9MC 1BD2E 4AWJC 1P7KB 3VSUA 4DN4H 1GH7A 3QNYB 3QJXA 3FDWA 3DETC 4ZW3A 1EO8H 3IFPB 3UZVB 4Z7QF 3PLYA 2YK1L 1SJEA 4GT0A 2B59A 5DJZB 4AIZB 3LQAH 4MMYB 1T3FB 3BZEA 3VGGA 3U7WL 2WNKA 3OKDA 2XWJB 1AFVL 1AGBB 1ORSA 4AIOA 4HAGA 2XJKA 2ED7A 5CLWA 2IANB 3GMRA 3QQNA 12E8H 2HLEB 3MLUH 3WLWD 1TXKA 1OARH 4NKOA 3GMMB 4M1DL 4LLAA 3GSOB 4QCIB 1CICA 1YYLL 3T3MB 2OTUA 3QNFA 3TIDB 2X4NA 1T1YA 1KGCE 5HYJD 1GAFL 3NABL 3PY9A 3QPXL 1BZ9B 1WFTA 5K9OB 2BP8A 4ICXA 1IKFH 1OZTG 4YH6A 1OALA 5AW7B 4UQ3B 4POZD 1NFDE 3AG4B 1O7VA 1RSFA 5KSBB 4HT1H 4OAWA 4AITA 1A6UH 3PABA 1BW8A 1JERA 3I75A 4P2OB 1MFAH 5IW3A 2ITCA 1KYOJ 4I5BB 2NY7L 4L4JA 4PWFA 4TTDC 3X1FA 3BIBX 5T1MB 5JW3L 4OCYL 2E7BA 4ZXBA 5BOPA 4YHIA 1FWXA 2ZSWA 1AQKL 1KIUA 1MCNA 2BOLA 4D0BA 4XC1L 3D39A 5GGRA 4FTVE 5BV7B 5FYLH 3WKYA 4LCUB 4Y4FC 5H37H 4PSRA 3VFMA 2RMNA 4NQEA 5E8NB 2W0FB 1NEZG 5G55A 4L2LA 1WICA 2E47A 3NZ8B 3GHEL 4JK0D 1P4LB 3K4DA 3FQRA 2B14A 2ZWZA 3GIZH 3BP6A 3VW3H 2O6FA 1FH2A 1DBML 3FN0H 3CVHA 2WXPA 4UT9H 4LIQH 5ICYB 3SOBL 3A6CL 1EAQA 2OULB 3ARFB 2HFFB 3AM8A 3II1A 1EFXD 1WFIA 1ZIBA 4MJ6A 4QRRA 4JFHD 4JGUA 1ASQA 3PHSA 4L3ED 3V5HB 5EUKA 3WUWG 1SNRA 3IDIB 3TJEH 4EN3B 3ECVA 2GI7A 3IDJA 4JO4H 1IGCL 4PLKC 3U1PA 5EA0L 3JBG7 4OGXL 1R3LB 3UJTH 1OSZA 3HRZA 5LN8A 3HE6D 3DJRA 4NQDB 1LO0L 4N8VB 1SLWA 1HYRC 4AQ1C 1BYOA 3GJEA 3TBVA 1MDAA 3CUPB 3EHBB 4NM4H 1QSEB 3VWJA 3RLSA 3N1FC 4U31A 4ZMQA 2EIBA 3TBTA 3HG2A 4KTEL 2N3JA 1IO4C 3FYEB 1OAKH 2BFGA 3GRBA 3K2UH 1OD9A 2F7RA 1YMMD 5T3ZL 3CMOL 2FJGB 4WTZG 4P23A 1S9VA 1VDGA 4DUWA 4UM9B 3WHE0 1H3VA 1QTSA 4A7VA 1AE6L 1F3RB 3JZ7A 3OGOE 3EYUL 5EU6B 2YA1A 1C5BL 2Z7ZA 4JAMB 4F9LC 3T0EC 1FVEA 1XCQB 4MA7L 2FWOB 2D3LA 1MRDL 2E7LA 1VGEH 3AREC 3G04A 3VMOA 1KJVB 3L3IB 4G7VH 2ATKA 4DVRH 3K71B 2B5IB 4QYAA 1UCBH 1J8SA 3ZMEA 1AXSB 3VXRA 4KKZA 1UOLA 4LPXA 2G0KA 4AKPA 4PJDF 3H2QA 3P9MB 3ZZSA 3BYYA 4BHUA 3HEIB 2BNRE 1PD0A 3I85A 1KIPA 4LSUH 2IQAB 4YZWA 4TVPD 3ZE2B 4NNXB 5C0CE 5DSCA 2ZUUA 1DBJH 5KBPA 2C3VB 1ACZA 15C8L 3NJNA 1MNUL 2IEPA 3BFOA 3V5DA 2L8AA 5JO5A 5GHWH 2XCMC 4PJ8D 1MRCL 1U92B 4JFDA 1Z3GL 2ZCKH 1XCTB 3CZFA 2EXYC 4FFWD 4NJAH 3MA7A 1YNLH 2X4TA 3WKNA 2CDFA 5J13B 3QXTA 2X4QB 3HG4A 3DV4B 1ZIAA 4HK0B 3L3GB 3QXWA 1X7SA 1BIHA 4U6XA 2D4DA 2RHEA 2WQXA 2FWUA 2WQRA 3NSFA 5K69A 1EZVY 2QQQA 3C5ZD 1DYZA 1CPUA 3UGUA 4DP7X 1MFUA 4JM2B 3LYRA 1DQLH 3OR7B 4EDWH 4BM7A 2V37A 5CZRA 2CKNA 1YLBB 1XF4A 5MEQA 5TE4H 2ZF8A 1IZJA 1OT4A 2I5YL 1QO3B 1J9TA 3KPQB 3D9AL 3NCBB 1DZ0A 3H7BA 1AMXA 5JHDE 1KCRH 4J3OD 1A6AB 1ZTXH 5LXVA 1VKXA 1KTDB 1YN6A 4IEFB 1VACB 1E0OB 4DCQB 1DVZA 1B2WH 4PJ5E 5HHVH 1IGYA 1Q0YH 3Q01A 3Q5YA 3QQDB 4N85A 5EG6C 2XQYG 4YDJA 3AC0A 3PL6D 5FYJU 1DANT 4ZFZA 4G9FE 3QR1A 1J1OL 1S9XA 3F7YB 4MJID 2J12B 1DQQB 3ZQ9A 1QP1A 5E6UB 1J8HA 5D7LE 1MCPL 1D7CA 3B3IA 1JI2A 4PWHA 1JK9B 2EKJA 4IRJD 3DRTB 1XGUB 4M6NH 4NB7A 5DT1L 3SPHA 2SEBA 2X0UA 4M62L 4NO3A 1BQSA 1BSIA 1GJIA 1HILA 4N6RB 3UZEA 5LXGH 4OQTA 3BH9B 1TCMA 4QTHA 1BFVH 3E38A 3KPOA 2NY3D 5AW0B 5KAQF 3C87A 3LNGA 4AV0A 3HPJB 5DMIH 1IAIL 5EIIA 1IVLA 2ETWA 2EJ1A 4PIRF 3RIKA 5E6SB 1CICC 4TULH 1SOSA 4ODXA 2FCBA 4M02A 3KWUA 3EZ8A 4IBZA 1U0QA 3QDMD 1RFDL 1WWAX 4JHUA 4LBEB 2X9WA 1KCVH 5E08L 2M2DA 3OHXA 3DOHA 2F54B 3HNVL 4UINH 5EBLA 2WSPA 3ESNA 3UO1H 5JIDA 4N2OA 2VXQL 3MZGB 5DCCA 1CD1A 2JXMB 2VW6A 2UWEA 3P02A 3B9DA 4IOIB 1IB5A 2VLKB 4P2RD 4AK1A 3UYRH 2HX8A 3MVSA 3PHOA 5DK0B 1MFMA 5I18L 2BO0A 2ADFH 1A22B 3DK2A 4J8RA 1ZGLP 4RZCA 3VD9A 2WGXA 3B9VA 4J28A 4UB0H 3ARUA 4BXSV 4KKLD 5CSZB 2AEPL 1JZFA 1JUFA 2DQIL 4OLWH 2OMWA 4PBXA 1Z1WA 3OBAA 3IDGA 4WO4B 1R3KB 4LEOB 2PTTB 2OMBA 4JQIL 4XPBH 5E6IB 1CE6A 1GYWA 2AJVL 2OSLB 1LILA 5DDHB 3ILEA 4YPGA 5IHHA 1Q38A 1RIHH 4EOWL 5KBLA 1T03H 2A83B 3FSWA 2CBQA 3JWDL 1G7HA 2VM3A 3U79A 3BSHA 5IHZA 1T04B 3EJZC 2G4EA 2OTWA 3ZHKA 3CX5K 2QPEB 4MWFA 1IGML 2WMPA 4R7NB 4DAGH 2MEJB 3ABKB 1EWHA 3QRBA 2PLTA 4L4TB 4RAVA 3V0WH 4APXB 1TVDA 1JNHB 2VN4A 1FL5B 2Z1KA 3VWJC 1BF2A 3EYVB 3GB7A 1ZT7B 3SD5A 1I8LC 3KCWA 2JFCA 2GBUA 2AXFB 3FO2B 3GGWA 3D85A 1S5HA 4MJ4A 3ZTNL 1A7RH 2DIAA 1UGKA 4X9HA 3U9WA 5C71A 1BM3H 4ENZA 2JKLA 3DPBA 3B9KB 3IDXH 1DQKA 1JPFA 1UXSA 4P23C 2DQCH 3EH1A 4AYGA 2XC8A 1MW1A 4CN6A 1MJJA 4LP5A 2X9ZA 3CSBA 4K94H 3MU3A 3GUTB 1YY9D 5ECJE 2G9HB 3QCTH 1KG0B 4WO0A 3MRLB 5HHME 2Q8BH 2E7LC 2B1AL 1ZDSA 2MQ0A 3GBNH 4BK4A 3FZUC 1IAKB 4I48B 4KXCA 1I9IL 2XQ0A 3QCUH 3KLHD 4TLSA 5ERWA 3BPNB 1UZGA 2A74C 4OZFH 4G7SB 5KTEL 2GTWA 1H5BC 2K3TA 4LCCA 1E90A 3CFBA 4LOFA 4RFEA 2O5XL 5GRYA 5HI3D 3BT2H 2HB0A 3P4LA 4IM8A 4KXZI 4QHKI 3ZL1A 4Y4HB 4HUNB 3MR9B 4Y16A 3X14B 3VI3F 2Y6SC 4XNYH 1NBVL 5AW8B 1E30A 2OK0H 2ZYHA 5KANI 1CB4A 3B3BA 3IRZA 4OZIB 3QFGA 3BWAB 2H32B 4DO4A 4EAEA 2X1QA 5LGJA 4M9PA 5C07E 5JMOC 2JJWA 4CMHC 2B16A 4ZMVA 3P2BA 4JPKH 3FL7A 1N67A 4H0LC 4MCZB 2DYPD 2VISB 5CF3A 4XVTH 4Z7OE 2CDEB 4GKSA 3G6DL 3PWUA 1QFOA 1FGNH 3DGDA 5FO7B 5JXAL 4CSPA 3P9LA 4E2OA 3D0VA 3GRGA 3L9RA 3PWLA 4G7YL 4ZMYA 2JVUA 1PCXA 3NT0A 1EGJH 2XN0A 4HYTB 4PR5B 5IFJB 1I1CA 3INUH 4JPIA 1IEHA 4NCC1 5LQBL 2P8MA 3IFPA 3MXWL 4OZGE 1DLHB 2EKSB 5DJZA 2CLRB 4XP6H 4MMXC 1T3FA 1JS4A 2WW8A 2EAEA 1CO1A 4U1GC 5I75B 4F3FA 4PY7B 3C2AH 2PWDA 2NNCA 1ZGLB 4H25B 1U58B 4Y9CA 2N59A 5E1AA 4LF3B 3L3DA 3S3PA 1J5IA 2IANA 3STZB 2Z64C 2JB5H 4XXWA 3FOLA 4J7RA 4X6DA 1D9KC 4XXCA 2CIIB 4KROB 4C56E 1E5CA 4OF6A 5E2WH 3IAGC 2P5ED 1WIOA 4QCIA 5B21A 4GUOA 4TNVF 3RVUD 2LLNA 2VO8A 5K9OA 4Q9RH 5DJ6A 3QFJB 4P3DB 3GZQA 4U0RB 3HZKA 1YY8B 4N28A 5GRWA 3QDJE 3AAZA 2BVYA 2VM4A 2ZAGA 4YSPA 1DDHB 4P2OA 3EYSH 3FO9A 2N7AA 3LCYA 3VYOA 4HOMA 1CVRA 2NY1C 1U8PA 1B4JL 3RY4A 1AO7D 1BZ7A 4BQ8A 4F9PC 3Q8EA 5F7DB 3TPKA 4KNQA 3BPLC 2MSPA 2HT2C 2EEAA 4ELME 4EZJA 1RXLA 3UEZA 4A66A 2VR7A 4H2AA 1FZOA 5C0GA 1TMQA 3FQYA 2APSA 1R3IH 4FFVC 1QNZL 1SM3L 4D9QE 2R29L 4Q6IB 2BXYA 3ML8A 1KN2H 4F33A 3IMRA 2HFEA 1ZLSH 5BRQA 4CJ0A 3GJFH 3OHXC 2FHBA 3DURB 5AOMA 3VXOB 2EDDA 5IB1B 5CEXB 1S7VB 3KLDA 1IAII 4K5OA 3V5HA 3BAWA 4KK6C 3FUJA 3IDIA 2R56H 3CVHH 3RKDC 4JFZH 4KH9A 5FO2A 5E2VH 4PJCF 2XUWA 2WINB 1R24B 2YKLL 4N8VA 4ELDA 1LE9B 4FD0A 4JM0A 4Z8FL 4FQJH 3O45B 4BE5A 3VGAC 1H19A 2K7PA 4L1LA 1S8DA 1QSEA 1LDSA 4BUQA 1UCTA 5BO1H 1G7LB 2VMDA 2XPYA 1I31A 3CSPA 2XKUA 4YGVA 4DKEL 2W65B 3P77B 1NJ9B 2FJGA 5ETUB 3L9BA 4NYLB 4G83A 1OLLA 4QRBA 1D6EB 1H0DB 3VXSE 1O6SB 4K9JA 2COVD 3V9FA 1GYUA 4E5XA 1XCQA 4NKIL 3UC0H 2CGRL 3FFCB 4XMUA 4QHMA 3QIUD 1PLAA 2WQWA 3BMVA 1C08A 2YOCA 5BQDA 3VSQA 1C7SA 3O6KL 2EXWC 2KZ1B 3BN3B 3ARDC 1KJVA 1MRFL 3L3IA 5AUMB 1XF3A 2B2XL 5GRXG 1JOIA 4LSSH 4NKDB 2K7QA 1AXSA 4TS6A 4PB9L 3GI8L 5I1JH 5F1OB 1XVSA 2Y1YA 2HWZH 4ODWA 1KELH 1FIGL 4ISVB 4JUTA 4XB7A 1GMIA 1RUKL 2MCAA 3TV3L 3K2MC 3RBGA 1ERNA 2EYRA 3T2PA 3QRFM 2IADB 4WSJA 2COQA 2E9IA 5MHSD 2UY6A 5J12C 1ZK9A 2P5WB 1YCSA 1U8MB 2IO5A 1Y1DA 2CR6A 2VDML 2VDRL 2ZWYA 5FM5O 4ZDHA 3AXLA 3FW6A 3COOA 1D5IL 1GGCH 3P0YL 2ZYRA 3ZHDA 5CINL 1CFQB 2X4QA 1DQTA 3BAKA 4HK0A 2EACA 2IAMC 2EVHA 3ZE0F 2BRRH 5AG8A 3BLBA 2OL3B 1DVTA 4B27A 5TGBA 3BW9A 4JG9A 4KDTC 4LCCC 5FKPA 1DLFH 1BXUA 2R1XB 3WTSA 5ABDE 2WO2B 1KGWA 4J12A 3LS4H 4JM2A 4RWYH 5ALBL 3OR7A 4GI8A 1IAOA 1MW2A 2HFGH 5KYUB 4ETQA 3LZRA 3TEZA 3RIFF 1QO3A 1B6UA 3KPQA 3PNRB 1D5ZA 2HLAA 2NX5D 3EJUA 1F90H 1IBDA 1OKEA 2CK0L 4WI2A 4DEPC 1GTNA 4H88L 2YN5A 4P2AA 3MXVL 3V0HA 1ITBB 1U36A 4IEFA 2CCLA 1RVFL 5IP4A 3HHSB 4CBZA 4GS7B 4PJFA 3CHSA 2CG9X 4YVNA 3SDYL 5EO0B 1T5XA 3CX5J 2R0KL 5GRVK 2QSCH 2YRBA 4KH2A 4DJMA 3KWXA 4MYWB 2AQSA 3VFVB 3BKML 3FPYA 1ZHNA 3DROA 1IAIM 5GJTL 1FDLL 2PYEE 1G9NL 2J8UA 4TNVK 2WUBH 1JK9A 3MDJA 5FYKD 4XWOD 1KENL 1S78D 4G1MB 4BWTA 2DAVA 1AGCB 1EDYA 1MAML 4AM0B 2H9GB 2N4IA 3RVWC 2XVBA 1THCA 2OR8A 3QEUB 3BYTA 4GQ9H 1PZCA 3LXCA 2ZP0T 3WJMA 2DM3A 2V8LA 1XO8A 1F4XL 4HJSA 4XXWC 4OQTH 2OXHA 2XV3A 3MRHA 1NZRA 2QLVB 4M9OA 2OMUB 5KUMA 3TJHC 1QG3A 4XTRC 3U25A 4PJAB 5I1GH 3D25B 3MV9A 2B9AA 4JRXA 3SGDH 1A6WL 2BSEA 3FT4B 1WUNT 1FL3B 2R4RL 3R4DA 4LBEA 3S3BB 4FABL 1K4CB 5EFIB 3DIDA 4AJVA 4JFQA 2F54A 3H55A 4FQXA 2WTRB 1IM3B 2CHZA 2H1LM 5AW2B 2AZAA 1J8KA 2IALA 2NTFA 5TK4A 2ICWB 2ESVE 1AG6A 3UH8A 2CO4A 4DP4X 2VLKA 5HY9B 1N59B 2X6AA 2QVTA 9CGTA 3V5KA 3PP4L 1K6QL 1NAMB 1AS6A 1UD3A 2VNCA 3QXUA 5DZVA 4WZ9A 4HLEA 3MJ9H 5TPWH 1JV5B 3U4BL 1QBAA 5C6WH 1L9MA 1BREA 1EEZA 1CD9B 1N4XH 3PAVA 4NO5B 1DFBL 2GTZA 1QHPA 4JFFA 2AEWA 3GYRA 5ANMA 1QSFA 4KV5F 5DDHA 3KPSB 3AUVA 4M43L 1T22A 3NA4A 4E0RA 1KTLB 3P30H 1KZYA 4PRID 4OLZH 4LCVA 2A83A 1BLNB 2GUOB 1JGDB 5FHBH 2GC4C 4CU8A 1TO4A 3THMH 4AQOA 2DKMA 1F6LL 3QJZA 4FG6C 1F8TL 4GUPB 5DC0A 4N1EA 1MHPL 3NCEB 4R7NA 4RGND 1OOWA 4TQPA 4YSSA 2D7PA 1TTBA 3KPNB 1FRGL 3RVXC 2DQTL 2HLFD 1NIBA 2FSEB 3HPLB 3DMMA 1CMOA 4YC2B 2PP9A 2KZKA 3ESVF 4RZKA 5GSRA 5KZCD 3DTXA 5EEVA 3KPPB 5CGMA 4KUCF 3P2DA 1X5ZA 3DRQB 5F6HI 4CJ1A 3B9KA 2VR5A 3QJVB 1G6RL 2BZCA 5IBUB 5IJDC 1W16A 3CCHA 4FQ1L 3UP1A 4NQUA 3BWUC 3C12A 3SDXF 1E8YA 5FLUA 1ET5A 3L5XH 1ZY9A 5DURB 2G9HA 5KS9B 5IT2H 2FVNA 5AOKA 3MREA 1HHIA 1OTUC 2VLLB 2VUYA 3QEQA 4XMVA 4NRYB 2AK1L 2H8PB 3WLBA 3IMTA 3CZLA 4Z7OF 2G5RA 2TRYA 2BCKB 4AL8L 2Z6FA 5FA4A 2IDTA 5C6PB 4N0UB 3GRWH 2OS7A 2Z1PA 4MA1B 4QT5A 4U1JA 5GGVH 3TGXA 4UT7L 4PTUB 4Y4HA 1GSKA 1ML0A 2VZTA 1Q90A 5BZDA 4NBXB 5KOVC 1HXMA 4RESB 4NNPH 5D1QB 3UYOD 2VH5L 1S4IA 2GBTA 2XBTA 4KXDA 4Z7VA 4WW1B 2PCFB 3DX1A 2YQGA 4QHUB 1IVTA 5I0WA 4H8WL 3M17B 4FQLL 2W07B 3GK8H 3VH8G 4CGTA 2JE8A 5EULV 4HPYH 2CDEA 3RIFK 1EJOH 1GCFA 1CI3M 1QKZH 1JXKA 1VIWA 4HALA 4GRWB 4KOBA 4AVJA 1KBVA 3NEOA 1EDQA 1YPZE 5FO9B 1JHLH 4YE0A 4XN7A 2CGYA 1RIVH 4Z7UA 2R83A 5CWSA 4LB8A 3MRCB 4NNYB 5B1BB 2VKXA 4KNUA 5SX4I 2J1XA 5E0FA 1FAIH 3FCGA 1Q9WB 2CLRA 3O4LB 3ATFA 1RPUA 5DQDH 1NMCC 2WXJA 2CJUH 2EVJA 4I77H 3BVDB 3T08A 2YO3A 1U58A 2DQHH 3JUYA 3GUFA 2UYLA 3QJHB 5FW8A 2NDGA 1OGAA 3STZA 5LUMA 5JNYA 5BS0D 3D69B 2VITB 1IJNA 1T2QL 1G7QA 4YNYB 3V0FA 4AQAA 2ZWSA 2CR0A 2UZIH 2ZOTA 5I76A 3Q13A 4UTAL 3KLLA 5CIPB 2D7MA 4B9JA 3D12B 4P3DA 3G7TA 1I7UB 5E6ZA 1XGZA 4YFDB 4BZYA 1YY8A 2R0ZH 3NCYP 4D3CH 2BVOA 2AF2A 4TKWA 1IUZA 3VXMA 4EI0A 1A1MB 4B3VA 5A2KH 1OLZA 1DDHA 4L37B 4LCIL 5ADPH 2OFQA 4KO6A 4O9HL 1EMTH 4GAJL 2Y7NA 5DS8B 4JFEB 3WD5H 1A6VH 2B7DT 1LP9B 3PWJB 5D1XA 4CSTA 1CBVL 1NCCL 1A8ZA 2ODHA 3N41F 2GITB 4L1DA 5DD0L 35C8L 3VDBA 3H0TB 2XG4A 1VZHA 1N18A 1F18A 2H6OA 4UMSA 1M9SA 3H4HA 5KW9H 1WHOA 4AZ8B 3JWNE 1YECH 1I9RH 2FHCA 4Q6IA 5LCVL 3VI4E 4XRCB 5BV7H 1N2RA 3Q8BA 1I53A 4K3JL 4XC3H 5JXED 4E9SA 3QUGA 2ZAHA 1KUMA 1OQOA 2V5RA 3CFDA 3N9GL 3LQMA 2NY2B 5L4JA 3HAEB 3VFRB 2GCYA 4I3RL 5CEXA 4NZDA 4PJHB 1X9LA 2DM2A 3O6MH 5EF1A 3TH4T 5EH1A 5LG1A 4LLWB 2BW4A 1NPUA 4PJ6A 1VPOH 1IBGH 1BGXL 1RK1A 1ZCRA 1P9MC 2ZJSL 3IN2A 3CBKB 3HC4L 5CEZE 4RMSA 4M1GH 4WVRA 3FB6A 4RMWA 4GXUN 5E7FA 2WBJD 1IKNA 3WNPA 4EF3A 1IQDB 5IFAH 4YUEH 1G7LA 1SHSA 1GKOA 2ZD0A 2ZOOA 4P49A 3ULSA 3ABZA 4YHPA 3GT6A 3WL9A 2EIJB 2J4WL 3BKJH 1XGYH 4GW4B 4L8SB 4BFIB 1NJ9A 5EDXA 1GVIA 2R69L 5ETUA 1FYTA 5L9DH 1U30A 2CPUA 1NCDL 2OAAA 1H0DA 1D6EA 1CXLA 1JHKH 2YGQA 3BUBA 5DJ0B 3CFQA 5HGHB 1OP3K 4E36A 3VXNA 1VA9A 3ELQA 4MNQB 2LFGA 5INDB 5AUMA 1RD6A 1OAXL 3R19A 1KMGA 2DMGA 2FX9H 1WT5A 4OZHE 4LL9A 4KO9A 3DMMC 5GGTA 1CLOL 4XBMA 4IIZA 5JORA 2XIDA 5EEWA 3WFBL 1SDDA 2A74B 5DJ2B 2LR4A 1H5BB 1M3JA 4YEEA 2VZSA 1GS6X 5CZVH 2C8NA 1R3HB 4LKCA 5JPNB 2Q87A 3GIVA 1SYSA 1FFOA 4KPHH 3L7EA 3WSQH 2NW3B 1JMXA 2BVEA 1OGSA 1YEIH 2EUZA 1WP6A 5DJAB 3V4VL 4PGZA 3H9HB 2NLJA 3KS0J 5EEZA 4K8RL 2G5UA 2GSIA 1ZTMA 2HX9A 3IDYB 3MRKB 4OLYL 1E28B 3RPBA 3W3BA 1VSCA 3OX8B 5L6YL 3FFDB 4KQ4H 4HUVB 1XAUA 1SY6L 4CMHB 5HVFB 3WHXA 3W9EB 4ZFFB 1WSST 1NUGA 4A2GA 1JZ4A 3RWIB 5C3IA 4NSKB 5F7MC 2FLBT 2X5PA 1GOFA 2F19H 2VXQA 1QX1A 1J10A 4K3EH 4ZMAT 4S1QH 3TYFB 5CJQH 3OJMB 1SEQH 4Y5XA 5C9KA 2OI9B 3HR5B 4AE1A 4KRPB 4Y1AE 5JPMC 1I1AD 1JGVL 3BAXA 2Z31A 1XX9C 5FB8B 1QACA 2AK4B 2K70A 4N5ED 2W95A 4ZTOL 4NWUH 3VX1A 4P2RE 1P1ZA 3WDIA 3CVDA 2IVFC 4U6HA 3BDYH 1XGTB 2I9LB 4JJOA 3US0A 1DN0B 3RVVC 3SYCA 4LLUB 2PPEA 4S0SD 4QHNA 1G5GA 5HDLA 3V6OE 2TRHA 3CAFA 1F4AA 5ALCL 5L2KB 3OB0K 1RJYB 2QGBA 3RTLA 2AJZB 2JCWA 3N44F 2Y5EA 4I2XB 5ABZA 3MRRB 4OCWL 3HS0C 3QO0A 5EOTB 5IY5B 2BNQB 4X5XB 2G60H 4RRPM 1JG9A 3FUDA 3DXAD 3QIWA 3BEVB 4WHDA 2H9GA 5BVPL 1NLBL 3EYQC 2PPFA 4AUYA 1ACYH 1TEGA 4TPRL 5E2UL 1MSPA 5FYJD 1R5IB 1EHKB 2VAAA 3B43A 3NSCA 4YHOL 1QRKA 2BP0B 1OCWH 3RZCA 3WY2A 2EH7L 3V7AE 1FZJB 1HS6A 2EDXA 5CZKA 5E7BA 4XHJC 2WLMA 4B9ZA 5C9JB 4UNTA 1NIEA 1EHXA 3D25A 1WUZA 2QFRA 1AD9A 1NM9A 2UX7A 3B56A 2BS9A 3N40P 3QRLA 3DSFH 4MTMA 5FGRA 1MCLA 1J7VR 1EFQA 4QOKD 4G8FB 3T0VA 3H53A 1MF2H 4B95C 4AIEA 4H8VA 1LWRA 4ZAKB 3U30C 3PAZA 4WQOA 4ZYKB 3VB8A 2BP5M 1PKOA 3EADA 2FJUB 3LRMA 1W72L 1KZQA 1N59A 3AABA 3MFFB 3H8NA 1NLDL 3FQXB 3RGVB 2NRDA 3CDCA 3NDYE 3EH3B 3LKSA 4S2SB 4YE4L 5D1XC 4Z95H 2A6JB 2QFPA 3LVEA 2IFFL 3SJVB 1HYSD 2HKFL 1AZCA 3HG1A 1RUAH 4HAFA 1WGVA 4LEBA 1TQCC 4YLCA 4WNSA 5FIEA 2ZF9A 5TDNA 2WB7A 3EIFA 3WFZA 4GW1B 4Q9CA 5IK3B 3KVDD 1TPXC 3QQ3A 2XFXB 4R5VA 2JELH 3C6SA 3TT3H 1IFHL 2WCSA 2P42B 1OM9A 1WA0X 3FCBA 3L95B 2H26B 1CD8A 2V3FA 4OF8A 1J0YA 1KTLA 4HKXA 4U1KB 4BZ1L 1S7WA 3BUQA 5C0AB 4JY6A 2WQSA 1SXCA 4A7QA 3GBEA 3KEDA 4ZX3A 1K3IA 2VXTL 4N9GA 5B3JE 1U8QB 2VB5A 3D2UD 1FC1A 2YGVA 3GSNL 3T1FB 2ZX6A 3N85H 1QR1A 1A1NB 4IBLT 1QFWL 4O00A 4OV5B 4QHLA 2Q3AA 3A24A 2VKWA 1EXHA 4FXGB 3S96A 3NJVA 2LW3A 3U1SH 5E9DB 1OCOB 1IKNC 2FSEA 5JA9A 1GC1H 4EDXB 4Y89A 5MEOA 2FGWH 3RX7A 3JXAA 1AGFA 1IM9A 3DRQA 3O41A 5ISZE 1CBJA 3CHPA 1A6TA 1PZ5B 2QADB 4AC4A 4KJPC 2X2UA 1W80A 3IMWA 3QUML 2R1YA 4LEEA 5D7IB 5DR5H 5J1SC 3I3DA 3O3EA 1UB6A 3Q44A 5HJGA 5I5IA 1N7ML 4HBQA 4U7KA 2LT9A 1C16B 4RGOL 2HPOA 1AR2A 4AG4L 1NIFA 5AW6B 4YSCA 5C08B 4HXAL 3X13A 2WD0A 3BZDA 4YHKL 3O8XD 5GGUB 4M1DH 4CMMB 1H3WM 3FTGA 3N0PB 4KMQA 4A7UA 2OR7A 4HU2A 2EQDA 4CVZA 4LGPB 1YPZF 5KVDH 1GAFH 1Q72H 2IAMB 5ESAB 1SOQA 3KZ8A 1CL7L 1XAKA 1JZ5A 4U3CA 3BO8A 3AQXA 3QHZL 5KBDA 3WEXA 3STLA 5E1IA 5FK9A 1IEAA 2VOTA 5E2TL 3S88L 3CFUA 2FECL 3DUSB 3U4EB 3GHPA 4BQ9A 4WAFA 5KSAA 3H2WA 5DQ9A 3IETA 3NIDB 3KLAB 1AO7E 2W81C 3DARA 3ZKXB 1N19A 5JW3H 1CR9L 3GM0A 4R4ND 2H32H 2R29A 3ZDXE 3NPSC 5D70H 5EORL 1DJXA 4XC1H 1FP5A 3POCA 4GIOA 4O5LL 1ZLWK 4DEPB 3WNOA 4KI1A 2PWFA 5IKCB 1NCBL 4LASL 4TVPL 5IROA 4NHCH 5CLXA 3BQUD 3RUGA 4MAUL 1WCBA 3KHOA 3MZTA 4XBEH 3SPJA 4LSRL 2H47C 5DGRA 4NNYA 3MRCA 4GSQA 2ZP8A 4LBAA 2HVKB 3B6SB 4PJBF 3IFLL 2P24A 1A1OB 4Y9EA 1FVCB 4Y5XC 2NNXA 1DBMH 3FN3A 1UVQB 4JFOA 3RWEB 4OFYA 2EICA 3A6CH 4P5TB 5IMKB 5L4MA 1TZGH 1QLRA 1JRHH 4XN9A 2Z31C 2PW2B 2B4CC 2YD4A 4U3HA 4WW2F 1G7JB 2XI9A 3WFDH 4FNLL 3W39B 2VITA 3HI6L 2G5BA 4B9KC 5IQ7L 3B2VL 3BUDA 2C7UB 1Y7VA 3QUKB 1GS8A 3BAJA 3Q48A 4EVNB 5KYXA 4S11A 2XACC 3D4GA 2IPTL 1I7UA 5AKVA 3JYCA 2XTJD 4OD2B 3FNKA 4HOZA 4JY4A 4XR8C 1KBKA 1N6QL 3BUPA 1A1MA 2B20A 5F3HB 4PLNC 1ITCA 2NUTA 4WFHE 1BWWA 4L37A 3RDTD 3SGEH 3QIWC 3CMOH 2DQDH 1NBZA 4UZGA 4A37A 1BQHA 4OGYL 4YSUA 5TF1H 1AE6H 3DO7A 2BOCB 1LP9A 3B5GA 3S35X 2BMKA 4GSDL 4G82A 3RX8A 3RZCC 3H0TA 1AI1H 2X89D 1RMFL 1AGEA 4OD3H 4KAQL 3P3YA 1L6ZA 2YD6A 4HISA 1ECZA 4G8EB 5JIPA 2DLEA 2FIKB 1T2JA 5E51A 3VM5A 4ENED 2R0WL 4ZQKA 5DUPL 1CF1A 4IS6A 3BE1H 2XYCA 4NZRL 4X7DC 3KW8A 1RJCA 1EEUA 4PYGA 1SBSL 4OGQC 4DETA 3TS8A 1A02N 4EMZA 1YYMH 2R51A 1ACXA 15C8H 4XXDB 1VF5C 5MHSE 1PX8A 1ORQA 5DJXB 4YJZL 1S7TA 5T33H 1QRNB 1MRCH 4GY4A 3N55A 5I5MA 3QZBA 1FV1B 4R83A 2AI0H 3BD4A 5B8CB 3Q1SL 2A77L 4ZW7A 1Z9LA 3IDUA 1MZYA 1HCVA 1W0YT 2ADIA 4CDGC 1IQDA 3MC0A 3S4SG 4XMZA 4AENB 4KZEL 2WXNA 2H2SC 3KEHA 4GP4B 4BFIA 4F93B 4MASA 4N26A 3RVTC 3LMJH 1BQKA 1JFQH 3FO1B 3BIKB 2V2XA 3MJ6A 5GS3A 2IH3B 4MSWA 1KC5H 3D9AH 2J1YA 1ASOA 3C60C 3WIAA 4WDIB 5B1JC 1FVDA 2R4SL 1MQKL 3S5ZA 1YN7B 1S7SA 5F7KC 1DBBH 4AYFA 4V33A 2BERA 4O02B 4QGYA 2JKTM 3KVQA 3WI9A 1IGFL 1OE2A 4KQ3H 1YUHA 2HJFB 3IJ7A 3ULUH 4PGEA 3L9YA 1U8KB 2E56A 1D5XA 2DJMA 1RUML 3VRJB 5I30L 5T3XH 1AZNA 1TVBA 3OL2A 4BV1A 2Z93B 2YD5A 1CLCA 5JPNA 5H4YA 4U6VL 1QFWI 2LU5A 5C92A 1HHHA 5GGTH 3HNTL 5DT1H 3UDWA 4M62H 3U1QA 5IFHL 3UIYA 2V5SA 4LOEA 5AEAA 2Y25A 2V5MA 4X9IA 4G70B 4LCWB 1HJCA 4RRPA 3LRGA 5JMRA 3WFHB 1C7TA 5I1HH 2GJ6B 1HX0A 2AJXL 3OAZK 4WFGE 3IMUA 4HUVA 5IREA 4H1LG 1IGTB 2AV7A 3QYCA 1HIMH 4NQXB 3V0DA 1XXDC 4HS8H 1MCSA 4IU3B 5H2BA 1JXFA 2UVFA 3QO1B 2G2NA 4PRDB 2UUDK 3CH1B 2Q7NA 1W8EA 1WBYA 1P5UC 5AKSA 3TO4A 3DIFB 1KYUA 1Z9SB 4LP4A 1W0VA 4G3YL 1NDTA 3TYFA 1RFDH 1SF3A 2OL3H 2J73A 2JH2A 5I0VA 4HF5L 5K9JL 4JFXA 1SN5A 5CN1A 3RU8H 2EIZB 3WEOA 1D3CA 4XNXL 1WCQA 3HNVH 4DN3L 2ADYA 4PV8B 2JKNA 5FUCE 3DTUB 2QPDB 2VXQH 3BP4B 3LZPA 2AK4A 1U3NA 2VZOA 4PUBH 4F15C 5JW4N 1P4BH 3CHOA 3KLSA 3QHFH 4Q9QL 3EGSB 3SDCB 3WJJA 4WJ5A 1EX0A 4JKPL 1WF5A 1RP9A 1FNEA 1L9TA 4WFFD 1BDYA 3BSZL 4LLUA 5EV7A 1G6VK 3S48A 2OJEB 1TKWB 2NW2B 5HHNA 5L2KA 5IROC 5CFHA 1A3RL 3UPRB 3MRRA 1YEEL 4N90E 3I6LD 1WFNA 2FECI 1PBYA 3ILQC 4XCCL 4PV1C 3QAQA 2YN3A 5IHUL 2KQMA 1JDCA 1ZHBA 4IOFD 2C1OA 3BEVA 4P2QE 3OZ9L 3DDFA 2PXYC 3MJ7B 4Y4KB 4LSVL 1GOHA 3JVGA 4XCYA 1I1YA 4NZUH 2CZNA 3JWDH 5DRXA 2Z9TA 1YJDL 3CDZA 3CQQA 1IC7L 4PIBA 4OZGA 4M00A 2O6CA 3CLEH 3WNKA 4CU7A 2J71A 2IGFH 3KJ4B 3FJTA 3UTOA 5I2IB 4KK5D 4V2CB 5BQ7A 5I1IL 1SN0A 3OKNA 1KGIA 1N5YH 3IKKA 5KVFE 3VXRD 1RJLA 1B3IA 4DFHA 1TO5A 1MHEB 3DX8B 2XICA 1Z32X 4L3EB 2Z8RA 4MX7B 1MG2C 1G6RA 3ELAT 2WP3O 3QUMB 5EUOF 4C56A 1AY1L 4G8FA 3D07A 4TNFA 2HG0A 1UYWL 4EI5C 3RRQA 2YQBA 3PUCA 3MLWH 4BDVA 1NH6A 1QLFA 3WGUB 1UACH 3D05A 3GZKA 3NJLA 3PYCA 5F6IB 1GCYA 3FQXA 1CZ8H 4LDLB 4FMFA 2A9NL 2F53E 3TTSA 4WHTB 4EUPA 4UBDC 4BELD 3QDJA 3O6FB 1KCUL 4DOHE 2B1AH 1N26A 1O6VA 1YMMB 3OSVA 2I7SA 4U1NA 2F8VA 1X9UA 5FF6B 2DLGA 3V6FB 1I9IH 5FWRA 4LXFA 1R3JB 2OV0A 1J9RA 1AYOA 1XGRB 2GW5A 4Z7QB 4B0MB 1RZGB 1QFWM 3O3AA 4GW5B 1TJMA 3NG5A 1NAMH 4KK8D 4IJ3C 4ZUWB 2ZUQB 4MS8C 3L95A 1FNSL 1BIIA 4L8DA 4POYA 2Z91B 1KPRB 2F8XC 1LLAA 1NBVH 3HB3B 1KNOA 4M1CC 4WI0B 2XZQL 3CK0H 4APQB 3NZHL 3T0AA 1TFHA 4XI5D 3VA2C 4J6RH 5AOZA 3SGKA 4R5TA 1OAQL 4Z76B 5I71C 3ZT7A 1CFVL 2BW5A 4ABVA 1FNAA 4AMWA 4FXGA 4EZLA 2ENQA 4XP4H 4HX1A 2OX5B 2PO6B 4JFUA 4ZD3H 3HCVB 4OTXL 3FTWA 2VDNL 3LAFA 3VQ2C 4BCXA 4F37F 4V1DE 2XX0A 1FZKA 1JZJA 3T0DA 4HS6A 2DJSA 3K5SA 1IFGA 4WGKA 4PJ8B 3V95A 1JWMB 4UDUB 2GFBB 3QUXC 3Q5OA 3MLYH 3VTAA 4E41B 1H3GA 5K9KB 2VIRB 3WBDA 4OI7A 1PZ5A 1NCGA 3C09C 4J2XA 4JR9H 1NBCA 4LU5H 5HHOD 4PRBB 5E4IA 1NEUA 1F1GA 4CAGA 3BX7C 2GPZA 4TRPL 1XSIA 4B0MM 4B9CA 2X1PA 5F0LB 4YHML 4WK0B 1F3DJ 3OKEB 5GSVA 2HRHA 4UTAA 4EKJA 3ZK0A 4V11A 5E23A 1RQ5A 4QXGL 4XGZA 2DOCA 5SV3A 4KI5F 3NFSH 4G6AD 3TOPA 3MGTB 3VXSA 3KYKH 4CMMA 2IGTA 3GSUB 1G7PA 3NFPA 3U4KA 1G9NC 3CVIL 3SDAB 4GRLD 5CKGA 5DK2A 2ADGA 2GBAA 2E75C 3TONA 5IMMA 4FLHA 5IF0A 1N64L 4PBVC 4QYOA 2A9AA 2P47B 5SWQB 1DE4A 3ZR5A 3MYJB 3B8YA 4PJEE 2X6VA 2V17L 3DUSA 3QZWB 3VRLF 5ESQB 4ADIA 4GBXA 4XCEB 3QBTB 4Y2DA 4ABQA 2HH0H 3KLAA 1CGSH 1TQBB 2PP8A 3N5AA 4AI7A 2VJ0A 2PR4L 1TEFA 2HN7A 1CDJA 4JHAL 5C09E 3F7VA 1FFNB 3VFMB 5JPMB 1R19A 1REIA 5LCVA 4EE2A 5A7BA 5ICZA 5EZJB 5T1JA 1VJSA 2VL5B 3C6LA 1E42A 3G5VB 4N0CC 2MQGA 4JZOA 2YPLD 4DH2A 3UC2A 2GABA 2YGNA 3BC9A 5EBWA 3SKJL 1Y0LB 3TO4C 1PZSA 2SODB 3MRNA 2NYYD 1UZ6F 4ZNEE 3ARBC 3FU0A 5IB2B 3H2PA 4GRMA 2C1PB 1BAGA 3INOA 5HI4D 5B1KA 3LHPH 2VMFA 3EO9L 1BMGA 1ZSHA 2WZPA 3H9SE 1JPEA 3QDMB 5DWUH 4PJDB 3F62A 3WJJC 1EHNA 4M8VA 3L13A 2ZX7A 1AAJA 1NGXB 1BFOB 4X9BA 4U3SB 2XWRA 3M88A 4PRHD 1BAFL 3L1GA 3T3MF 2YKLH 5A16A 4ZNCD 3Q6GL 3PDOB 3RNQA 4QF1A 2EZ0D 2VLJD 3KPMB 4YX2L 2LU4A 1I3GH 2XN2A 4U6TA 3UAEA 2UXVA 4Z3FA 1ET7A 3MODL 3LIUA 3P4MB 5F21B 4R26L 1XF5A 3E1F1 1F4WL 1U42A 3NH7H 2PNDA 1GZHA 2Q76A 5CIPH 2D2OA 5DD3H 3UERA 1PKQB 5EPMB 1HHJB 3QQ9D 3QUYD 2DN7A 1JZ7A 4PLJD 4OFKA 5ENWB 5B3NA 2Y0SA 3JVGC 3KYNB 1RUPL 1LM8V 3D4CA 1DUZB 4PJXF 4P05A 2DBLL 5CKAA 4P46B 1F5WA 1A7PH 5D2NB 4BFOA 2QSTA 5IIEB 3O6KH 4AC2A 2TSBA 1QLEB 1HNFA 1ETA1 1KT2A 1UD5A 2AMUA 2OZ4L 3II3A 4KI5D 4G8EA 4GI6A 4Z7NE 4RCAA 3QNZB 4HIXH 4PY8I 2FNWA 4PB9H 5FYKL 5HGDA 4KKPA 3P3RA 5J6SA 2H1PL 3E9UA 4Z77B 2H1XA 1FIGH 4Y16D 5D2LF 3B2UC 2ARJQ 3SDDA 3IGAB 4HWBH 5DVOA 1OM3L 1RUKH 3EJQA 4HGMA 3WE6A 1TPXB 4M93C 3WIIH 5FFLA 4RISL 2OMXA 4UOQA 1XR9A 2A9MH 4NGHL 2ZUWA 3ASOB 1J05B 1ZAGA 1SY6A 2GI0A 2Z92A 4QIRA 5FYLE 2BIHA 2VDRH 3G6JE 2V2WA 4G8GA 5EBMB 1KB9K 3HAEH 4QRPE 5HDBE 3SCMD 3ZHFA 4AL8C 5LJYH 3VFPB 4U0QB 2YAFA 2JIXD 1BYNA 1HTYA 1FJ1A 1QVOA 4JO2H 4R84A 1RUQL 4IIQC 4OM1H 2ZCZA 4RX4D 4DHLA 3FOMB 4EQ3A 1L9SA 2Y36H 3F04A 4LIQE 3P40A 5CD5D 4HUXB 4FHKA 4F37K 2ARJB 1A7OH 4NQVB 5IBTL 3N91A 3MBEC 5ALBH 3KPTA 4H8WC 2CNYA 1Q1JH 3HE7A 4GLRI 1I7ZB 5CCKL 4WI8A 4GNKB 5LGYA 2GKIA 3VD1A 1IFRA 3SKMB 3LZQA 1U9KA 2Y7OA 2YLHA 3SGKC 2BC4A 7PAZA 3JWOL 2IG2L 4TMPA 3DNKA 1TETL 4WDIA 3SY0B 3WMPA 4Q7DA 2CK0H 5E56A 4DKFH 4NHUB 4R90H 3E6HA 1HHGB 1UT1A 2CLZA 2F7OA 5EO9A 3D0AA 1RVFH 2BSTB 4WSGA 4NX0A 4BKSC 4LPYA 3S34L 2EDEA 3ARGB 1F3JA 4DERA 5KOMC 2MOQA 5HPMB 3D3VB 2XTLA 3RILA 1ZE3C 1J88A 3QH3B 2A9CA 4J4PA 2IWEA 2WKGA 3U83A 1JXJA 3KPRA 2NSQA 5DZ9A 3NCYS 4GAYB 1UH4A 3LXUX 2V6HA 5GJTH 2H0EA 1FDLH 3QZLA 3W1ZA 4YAQB 1KENH 3LRHA 3CE1A 3FT1A 3DGGA 1T1WB 2DEYX 2WGNB 1P7BA 4NQTA 4O51A 3VQ1C 2ERJC 4KK9C 4PBDA 4KO7A 2DMHA 2VDLB 3V79C 4JQVA 4A68A 3CFNA 1IGTA 4IOSD 3TWCH 4Q4IA 2OMYA 4NQXA 4PB0L 4CC4C 4DGWC 2PPDA 5AZEL 2CHNA 1NC4B 3GQFA 4K9EH 3RX9A 1YNKL 2XU9A 1QFUL 5KVEH 3DIFA 1A6WH 4OKVB 3ZYJA 3O0RL 5HJ3B 1ICTA 3BCDA 2BNUA 4S1RL 1K4DA 2YOAA 2IDQA 1W72A 5FCUH 2JK5B 1JPSH 2EIZA 3KXFD 1JZIA 3PIQA 4H0HB 3ARFD 4PGCB 3E9TA 4ERSH 3MCYA 3AQZA 3TT1L 3BP4A 4E9LA 4U6YA 7FABL 1ONQB 1XL6A 3L4UA 4GBXC 4MDIA 5HYJA 3W0WE 3ZYIA 3WENA 2A73B 4LOVA 2EO1A 3U9PH 3GBLA 5E70A 4EN3D 4X7TB 3BLPX 4WEBL 1P6WA 1KEGL 4TSAH 1MKFA 3BVUA 3I2CL 3PP4H 4MB4A 4NQDD 4EIUA 4ZFGL 5IV2B 1AIFA 3C6LC 3EHBD 3GTNA 3IU3B 4BZ1A 1PEZA 3LEVL 4LLQB 5F97E 4PJ7E 5FHAH 1L6PA 2LLGA 3LRSB 1DFBH 2MOVA 1QQDA 4FNQA 4M56A 5F1NA 5DJYB 3ROLA 3GSNA 5KSUA 2VDOL 4MNGB 4JN2B 3M6DA 2I9TB 4YL9A 4LSDA 4X4YB 4B6ZA 5DHEA 2HT3D 4UM9D 3A6BL 3MACH 1ZTXE 4LLYA 3V8CA 4E9RA 5EU6D 2CH8A 2VLRB 3ARRA 2X0WA 1RZ7L 5DF0A 4DP0X 3HS8A 4A6YL 2VDNB 3TO2B 3QFDA 2FQFA 1F8TH 2ARWA 5I2IA 1JIBA 2G9KA 3VI3B 1BD2B 1CGTA 1ZA6B 3Q6FA 5B38B 3TEUA 3ZKMC 1FRGH 1MNNA 3DX7B 3VFOB 2IWFA 3DX8A 4N0YL 4Y2NA 4L3EA 3TIEA 3DYMA 4ZOBA 5IOPB 1XHHA 4WV1B 5DEFB 1CGUA 1F2QA 1ZHKB 4M7LL 3P4OB 1A7NH 3QUMA 1QR4A 5I8CB 5DD6B 5EOQL 4MQXD 4X6CF 3HE6A 3ME0B 4HS3B 4AEIH 5KYWA 1E7VA 3OQRA 4HSQA 3TFBA 3WKPA 4NRZA 1LDPL 3I9GL 4K4KA 4B9PA 4FQ1H 4FA6A 1YEFH 4BBWA 3MLPA 4LP8A 3S35L 1U41A 1ZT1B 3O9WC 1YMMA 5LG6A 3AU1A 2DH2A 5FF6A 2CUHA 3PJLA 3TN0C 3CD4A 1JPGB 4LNRB 2NY5H 4EUPH 4PV9A 4XNQB 1S7XB 3P2TA 1MG3C 3X11B 2QVFB 4ZUWA 2KI6A 3CSYB 3LEXA 4UT7H 3T6QC 2YAOA 3CGTA 5EB9A 2EC9U 4NOFA 2Z91A 4HOWA 3KD4A 5AAWC 4RAUA 3SDDC 2NXZB 2VH5H 3MROB 1HC1A 2XA8L 1TITA 2X4SA 2XXFA 5BO0D 1HSBB 4K8RC 4ODUB 1HQ4B 3T6VA 3VI4A 4E9XA 5AAPA 4X9FA 4YSDA 3JTSB 5C0EA 1OSPL 1T0NA 4JPWL 3ARYA 5FA3A 3TWYA 4QRAA 4UZSA 1ND0B 2PO6A 3MNZA 1H6UA 2ZUTA 4GAFB 1EIBA 1H15B 3C60B 3S8GB 3EYFA 3OPUA 4J23A 1VLXA 4G8IB 4OFVA 3DV6B 5AWNH 3D48R 4PJ8A 1CF8L 5TK2A 3W2DL 4XNMB 4MB5A 4HGWB 1QW8A 5FPIA 4AYID 4F80A 2W60B 5FW6A 4FNTA 1IQWL 2ATPA 3OKMA 1KXVA 1U6AL 1I4FB 4MDJB 2EYSA 4K7FB 3CQFA 4JN1L 1CXEA 1ADQH 2J1ZA 3HE7C 2DMCA 3GZPA 3NUKA 3LN5A 4L8BB 4DP5X 3C5ZA 3PQYD 4PJEF 4DN4L 1F4HA 5BW7C 4IHBA 1L9NA 1NTDA 1M7DB 4O58L 2CAKA 4ONFL 2ZX5A 5EOCJ 1EO8L 4O2CA 1NEZB 3MGTA 2GJRA 1OE3A 1PX3A 2WBKA 5IR1B 1GXEA 2V9TA 1M7IA 1KIRB 4WI6A 1KEMH 4K55A 5CMAA 1Z5HA 1FBIL 4DNLA 2G30A 3HUJE 4F5CE 2ZUSA 1JGIA 2JTDA 1J5OL 2BK8A 2XTJE 4QXVA 3DVNA 1RHFA 3MLUL 4HJ0C 4LDOB 4LVOC 5IB5B 1BMZA 4ELKB 4OZIF 1G7IA 2VT0A 5SWQA 4BXVA 1H8OA 2F54D 1PY9A 3L3KA 1P5UB 2V5YA 5DHXB 5B4MD 3PL6A 4LCIH 1ZLVH 1X5KA 1A4CA 4O9HH 4MJIA 5ECGA 3QI9C 3SB3A 2GVYA 2HJLA 2VLKD 2Q86B 3HBGA 4R7DB 5JLZB 2EVFA 1VADA 2VERA 3P3UA 1NCCH 1CBVH 1QASA 3FTZA 5CS7A 5DD0H 1T0OA 4IRJA 5EZJA 2G3MA 3SE4A 4L5FH 4OM0H 4F15B 2BNRB 1KB9J 2LU3A 2O5YL 1GSMA 1MFAL 3NN8A 3K0WA 5CCGE 5C0CB 1JZHA 1KFGA 4OCLC 1XH0A 5LCVH 3QYNA 3U7AA 1CTNA 1HEHC 2ZUYA 1PZAA 4WO4D 4DPAX 2AV1B 4M7LT 5IQLA 1LJMA 5E6ID 1RU9H 2FYVA 3WLWC 1INQB 1IGIH 2XWZA 2E27H 3NCWA 2J21A 4QUOA 1UOVA 1YNTF 3I9IA 4OIFA 5DJDA 5IQ9A 3V4UH 3HZYB 1O9ZA 2OR9H 4NC1E 3UBGA 2QSVA 3IJSA 4NPJA 4KUZL 2CRMA 4WEMB 3LVTA 2P7TB 3QDMA 2BIIA 3GIZL 1L5GA 1UA7A 1WBXA 4LARL 3ZIYA 3VW3L 2H6UA 1OP5K 2LQRA 2LGNA 1JD7A 3HW7A 2NZ9D 4POZC 1NGXA 2XPZA 1BGXH 3CFKB 4IBQA 4M48H 4LIQL 4XOEA 4A2FA 4IJTA 1OTSC 3IFNH 2AABH 5AZ2H 2VGLM 2WUCH 3MUZ1 4FQCL 1QAWA 5E8OB 2YC1B 1P84K 3PDOA 4L4TD 3TCLB 2VN5A 1FZMB 1Y6MR 3TJEL 1D2PA 3P4MA 5C0BB 4P2RA 1E67A 1TUPA 4JO4L 4HLZH 5E5MB 2BPBA 4L29B 1E6JL 1NFIA 1UQSB 3GLDA 2KLSA 3C6EA 4DTGL 5CCJA 3V6OA 5JOPD 4HIIA 1DN2A 2Y1ZA 1NCDH 1AHWB 3DVFA 3I50H 4NM4L 3IXTB 3RWGA 4WFEE 3ZE0B 1M2VA 1M2OA 4PHXA 4EI5B 5I0XA 3DECA 3LS5H 4PJ5B 4GMSH 3K2UL 2XKNB 5D2NA 3EH4B 5D7EA 3WE1A 2LU7A 1MCQA 1FNHA 5F96H 4G9FB 3HKFA 4NP4H 2WXIA 4XMTA 2ZOWA 3PWNB 1GY1A 2WWOA 3QXDA 4LKXB 1FE8H 2NY0B 4ONHB 4BGLA 5JW5B 3ULVH 5D7LB 3DX9A 1W6WA 3LKPB 5I1AA 4X7EC 1VFUA 2D31A 4R2GD 4UDTB 1VGEL 3L6FB 2XQBH 1CLOH 3HAEG 4Y4HD 4GP8B 3FT2B 5C0JA 3IGAA 2CGZA 4Z3EA 1PFOA 3BZFB 4G7VL 5FYJL 3HE6C 3KYMB 1LD9A 4DVRL 4KKCD 1K3ZA 25C8H 4WHCA 4QTIH 2V0AA 2WZ6A 3MNWB 3K3QA 1KBWA 3GPEA 1MFCH 2VSKB 3S98A 1GS7A 1QZ1A 4AYDC 2QLYA 4LSUL 4NAQA 4UU9B 3FUKA 2XPGA 1DBJL 3Q0HA 4OLYH 4K71C 1T1XB 1PSKH 5F8QC 1SY6H 2G75B 4Z3IA 6CGTA 1M4KA 3L3JB 4W68A 4QMEA 1NCIA 4ZS6D 5GHWL 1QD0A 4NQEE 2YZ1A 5BUAA 4BZ2L 1VFOA 1ZV5A 2W1NA 3B7RL 4YPJA 2ARJA 1RULL 4NJAL 4GFTB 1UEMA 1YNLL 1KXQA 4MJ5B 5C0ND 4WHYH 1HL4A 3HG3A 4NZTL 4N2GA 5J6GA 4I9WD 4HUKB 5GS0H 5IW1A 4EXKA 3JWNC 3SKMA 2DTSA 1JGVH 2Q20A 5JQ6L 4QRRE 3LN4A 3ISWA 3UCQA 5B3SB 3FO0H 5D4QA 4I4WB 2YBRA 3BSZA 3RL2A 4PCYA 2DQEL 3C09B 4ZTOH 1DQLL 5LNGA 2B1HL 4EDWL 3G5ZA 2CCVA 3ECUA 4P99A 1WJ3A 1N0LB 3OXRB 4KROD 4WFFE 5TE4L 1E6OH 5HPOA 3MUY1 2ZOKB 3N06B 3EOBA 2WLNA 3AQDA 4EIGB 4HWZA 4KZ0A 3QH3A 5ALCH 1I85C 3OJDA 4PRPB 5I16A 1FUNA 4D7PA 1Q9KA 3C9NB 1KCRL 1SYVB 3PJSB 4GIAA 1WAEA 1ZTXL 5F88B 3QFJD 5DMKA 3QZNA 3TXAA 2DYPA 3CBJB 2F7IA 4LQFL 4OCWH 3I6LE 4FFWC 4X4XA 3OWEA 1MFEH 4YAQA 2F61A 4AEEA 4FZEL 1B2WL 3RWCB 2O93L 4PJIE 1T1WA 4ZI8A 1BCIA 4G80B 5BVPH 3BJLA 4JL1A 4X9YA 2FGZA 3C5ZC 1MLBB 2XBZA 4TPRH 43CAB 3CZUB 5IJKA 2HT4C 2JJUA 4GIPD 3ROOB 4YHOH 1JNNH 2V7HA 3DX2A 2EH7H 3MLXH 4M6NL 1K8IA 4LLDB 1NWOA 4N2CA 4FKHA 5LXGL 4UYQA 4PJGE 2XWCA 1BFVL 2WXFA 1E2ZA 3VXRE 5ILTH 5IWLA 3QG6A 4JKKA 3FT3B 4OF3A 3ZE1F 1CGYA 3G6AB 2XXGA 4J3OC 1PCSA 5DMIL 2D03H 3W82A 1G9HA 4G7QB 3FRPB 4G11A 5D5MA 2GBVA 2P5EA 3MBXL 2X2YA 3MLTA 4XZUA 5M95B 2WBXA 5HHMB 4Q58C 1L0XA 1FPTH 1EV2E 3PL6C 4R0LB 1MW3A 2DF3A 3ARBB 1ZWIA 3BOVA 4EZMA 4X7TA 3VFWB 4ETYA 5JDSB 2JJSC 1NLDH 5BXFB 2K3HA 1KCVL 2NQCA 3CX2A 4YE4H 5T1LB 4KKAD 3X17A 3RPIB 4UINL 4IRJC 3SE4C 1YEHH 3UO1L 2A99A 3B2DC 3HI5H 1OWWA 1RZIB 3Q2VA 3T2NH 4NDMA 3ZBMA 5HBBA 4GKNA 4TUUA 4R96B 3ETSA 4NENB 3B8SA 1RK0A 3AT8A 2I07B 2XG5A 3EDDA 1F97A 3UYRL 5IW6A 1DEEB 3SDXB 3IBEA 4JFPB 4TXVB 1IFHH 5T1KD 2ADFL 5C07B 4YDIH 1AG0A 5IVXF 4UB0L 4X4YA 1L6XA 5F89B 1CLVA 2OMTB 2W92A 2VXTH 4K5MA 4ZPTA 4OLWL 4Z7OB 9PCYA 3GSNH 2CDGB 5T1DH 1LQBC 2WPGA 1QMUA 4F8OA 3FFCD 2YD2A 2PTUA 1MCJA 1JJUA 1VFAA 4QXWA 4AVKA 3ULUD 1BJ8A 3C2SA 1RIHL 3NGBB 3VI3A 1ZK5A 3V0IA 1T03L 4M5YH 2APWA 5T3XD 2EADA 3DX7A 4HHAB 1I7RB 1F6AA 2WZ5A 3BPOC 3MRDB 5IOPA 2R1WB 4ANVA 3F58H 1U4FA 1UC6A 2VMEA 4F92B 1J8HE 3WNJA 5EZLB 4DAGL 3RWDA 1WZKA 1BXXA 1GYCA 1M6UA 2GSMB 5D7KD 4MB1A 5MENB 1L3NA 2WBJB 2PP7A 3FAWA 1H3TA 4U1LB 3D1MC 3V0WL 3V6OC 3FB5B 1ETZA 4KKLC 3QUMH 4XMPL 4WU5A 3D0LB 3B2MA 2P5WD 3HJEA 2YPVL 2ZXCA 2QKSA 2B15A 3AW5A 1J8RA 1U95B 2AJSL 1A7RL 1E4XH 1BM3L 4L1SA 1EA9C 2Y7LA 3D51A 3GXTA 3FRUB 3IJHB 5D9SA 5PCYA 4AG4H 1TQWA 2X40A 2QEJA 4M8UA 4YBLC 1MELA 1JPGA 4XMKH 3NFNA 1CC3A 4YWGL 4K94L 4WEEA 4DQAA 4GYBA 4MCYB 3QIUA 1UWXK 2FATH 3QCTL 2DIJA 2Q8BL 4HZLB 4R5XA 3O4OC 5CNHA 3GBNL 4IIQB 4FGMA 4CILA 4JGNA 1VFBB 2R9HD 3QCUL 1XZ0B 5I17A 1CL7H 3FB7B 4PWGA 1TQVA 4UQDA 4LAJH 4Y5YB 1UD2A 4OF5A 1KJ2B 3GMOB 1NQBA 4K2UH 5ACZB 8CGTA 2EDQA 5AD0A 3GSVA 3I6KB 3CDGB 4ZMTA 4BH7B 3ZZLA 3BT2L 3S88H 5DK3A 3JTSA 1YMHA 3OKLB 3PGDA 2UWEE 5CU9A 2YAQA 5FFOA 2Z4QB 4IRSB 4XNYL 1CR9H 2YD7A 1ND0A 3EBGA 3DYPA 1XBRA 2WTPA 4NIKB 3MV7B 1EDHA 4O5LH 1SN2A 4G8IA 3ZDZF 1GMEA 4TVPH 2YPLE 2P8LA 3ZZ1A 1V7NL 2IOMA 3LKNA 1N12A 2QHLA 1A9EB 3UG5A 3NJXA 1P84J 4LSRH 1TU2A 1PZBA 1MCDA 4XVTL 4MDJA 1B2YA 4QI3A 4GG6F 2VE6A 1FGNL 3KLHC 3B37A 3IFLH 3N41B 4AGMA 5HHPB 5CD3B 3B7SA 5J0BA 2X6CA 1PDKA 4L8BA 3HZ3A 3BAEH 4PS4H 5HI3C 3U0PA 1CVSC 1EGJL 4JE4B 5DHMC 1U8OB 4TOYH 3TF4A 1QBML 1NEZA 4NAJA 3O3BB 3JTTB 1BXVA 4XP6L 1KIRA 4PRHE 5DUBB 1WC7A 1ZD6A 2EYTA 4URTB 4LPCA 1E4KA 1N68A 5D7SH 3AWFA 3LD8B 3C2AL 3EO0B 2ZQKA 2NX5A 3ZGHA 2WVTA 4H26B 1PTZA 3VAEA 2EDKA 2KZWA 4D8PB 5KWYC 4Y19B 4UUJB 1XL4A 1YEWA 2GT9B 1WISA 2KPWA 4TUKH 5E2WL 5E6YA 3WUWA 4ELKA 4PJCA 5SWZB 1L4IA 1IM3D 3EFOA 5EWIH 1YJDC 1PIGA 1HH9B 3UTQA 1D5BB 1NIAA 4AT6A 4Q9RL 3C08L 3V55A 2MRYA 3T2QA 4R4FH 4MJJA 1HWGB 2OZ4A 4GSDH 4UZUA 1DUYB 5DLLA 2BOBB 4A7GF 3E6FB 5LGHH 3MJGX 4EIBA 2DLHA 3A22A 2L4OA 1LNUA 1U3HB 3TBWA 1XXFC 3EYSL 3WMSA 4XE5B 4A55A 1KULA 3FQTB 1I7TA 2FEJA 2FJFB 5DC2A 3QEHA 1JP5A 4WUUB 4WTZA 2E7CA 1CT8B 2WXQA 4LFHG 4WIQA 3VXUB 4IMLA 3WY4A 2C26A 3MNDA 1BJMA 2IXQA 3JYBA 3KPSD 4O2EA 3CU7A 4Z18A 1CFSB 1JHTA 3HNSH 1R3IL 1CDYA 1HWHB 3HZYA 4JHWH 4ZOCA 2BH0A 3I6GB 1FN4B 2ZTBA 3LZOA 4OZ4B 3RVUC 1BVKA 1KN2L 1U8LA 2P7TA 4MYPA 2J2ZB 4LHQB 3CFKA 1PQZA 5C0DA 4W9ZA 1PG7W 5E8OA 2A77H 3KH4A 1OCCB 4RNRB 1R0AH 3B5HA 5K39B 2R56L 4HMDA 4PEEA 4JFZL 2Y72A 2GG1A 2CPCA 4NO0B 5E5MA 2X7LB 3HZVA 2WWNA 4L29A 5E2VL 1JTOA 2BM3A 4IGBB 2QDWA 4CSSA 2KERA 3ESMA 1FGVH 1CCZA 4XMLL 3LIZL 1BVLA 4YR6B 1KBGL 3ZO9A 1T83A 2A6IA 3ILPB 4LAQH 1R46A 4ACPA 5AYUL 5BO1L 1AP2B 1XH3A 1UUSA 5DURD 1A3ZA 2XKNA 3U7YL 2A38A 2Y7SA 2R4SH 1MQKH 2DRUA 2IANE 2FZ3B 3FQ2A 4X6DE 4IBTA 4PRIA 3ARPA 4OSUH 1PIFA 3O9WB 4MRCA 4DP9X 3UC0L 1RI8A 2EXYD 5IB3B 5FR3A 4ZUUB 1WH0A 3L6FA 4KVNH 3UP6A 4U2YA 5I30H 3AROA 3FT2A 5F3BB 1I3RB 4PTTA 5FUZH 5J1AB 1AGDB 43C9B 5D1QD 3ATEA 1I3UA 4LSSL 2BY2A 5FDYA 5FDWB 2YXVA 4PJHF 2E4FA 5I1JL 5JR1H 1DANU 1X5FA 4LHUB 2XBDA 4KHXL 3MNWA 3HNTH 1Q94B 2HWZL 3DI2B 3G5YB 4BH8B 4AXWA 2VN7A 5CGYD 1DTUA 1LEKA 2XQYA 4K15A 2J88H 2CM6A 1BBJA 3N44B 3GSXA 5DXWA 2L7JA 4RLDA 5ITBH 3U0TB 4I1PA 1BOGB 3CXFA 2NCEA 5DYOB 4RQQB 1JYVA 2JF1A 4E42A 4L4VB 5DU7A 3GMQB 1K2DB 1OGPA 3P54A 5MP6H 3QIUC 1GGCL 1A21A 2MHAB 3MKGA 2FR4A 4IBUA 1W91A 5B1AB 2VDQB 3P69A 2F0CA 2ESVB 5GGSY 3BT0A 2BINA 2Y7QB 5DTFB 3VJ6B 4HF5H 1A0QL 3O4LD 5D55A 3ZX1A 3FH5A 5K9JH 1BX2A 3HVDA 3QS2A 4OFYD 4XNXH 1DLFL 1I1FB 2PCPB 4BSVB 1P5VA 5J7CC 2O6PA 3EO1B 2Y9RT 3K81A 3O81A 1SLUA 1BJ1J 4BSJA 1WYJA 1V05A 1JZEA 3LS4L 3A6OA 4WGWB 3K8LA 2GTQA 2ORBH 3GI9H 1N0LA 3Q8FA 4WTXA 4OI8A 1O7SA 3BFWA 2ZOKA 3OZLA 4NQDE 4JVWA 3E80A 3S8WA 3BSZH 1I9EA 2QQNL 5C97A 3CXDL 3WTXA 2AFNA 1KCLA 3IJEA 3SSGA 1QSEE 3CN3A 1E27B 4K7PY 2F5BH 3BESR 3LKQB 4NN6C 1E5BA 4L1BA 1NAKL 4X98B 4A6YA 1ZT4A 2W8CA 3BRFA 4F7TA 2FX7H 1GHFH 1HQRB 3OZ9H 5A1AA 3V8OA 2AKRB 4QRQA 1KXHA 3AZUA 2AGJL 5EU6E 2Z34A 3ZLQC 1DJHA 4JFED 2CNZA 4YHNB 3UROR 1L7IH 5KYYA 3X1EA 4L9LA 2XY1A 4DPCX 2APBA 1IC7H 5IUCA 1UB5A 5EU3A 4R97B 3KYOA 1Y18A 3F85A 3K6FA 3QI9B 4KJYA 1NOFA 4UQ9A 5I1IH 4QRTB 2VDLH 2LOEA 2Y24A 4FL4C 3OJ2C 4GQ9L 4MQTB 5CP7A 5GZNC 4GUCA 5BS0A 1BEXA 3EUDA 3GS4A 2XJLA 4YBQC 3ZE2E 3CIAA 1AY1H 1UJ3B 3IPEA 4AY0A 4JO1H 2NY2D 4CBPA 4Q2ZA 5FECA 3BH8B 1XGPB 3ARVA 5TDOA 5I1GL 1JN6A 5I1DA 3EF4A 2J8OA 3QAZC 4ZUTB 3EOTH 3B9EA 4KRNA 1PEWA 4OIBA 3BKYL 4IHOB 3QJRB 5H35B 1HESA 3EBIA 2ZPKH 1C8PA 2VDPB 1QYGL 2RGSA 4J3XA 3ZHLA 1A7BA 4BSWB 1QEWB 5I1LB 1NM4A 2CM5A 3EJZD 5EOCL 4OLEA 3W37A 4ZZKA 1DEEA 2XT1B 3BVNA 4XP1H 5IB4B 3HFMH 5IMLB 3GMLA 4P59L 1NGWA 2EIDA 1FNSH 4DVBA 3M45A 4OLVL 3MJ9L 5TPWL 3WHE1 2IMNA 5I73C 1N4XL 3V10A 4OCSH 2YXWA 1PFCA 1T6WA 3RNKB 5DVLA 4G6ML 3B1UA 5JXEA 3PPEA 4MNQD 3D18A 1JFHA 3N42F 4W6XB 4ZNEA 1YPZB 1CFVH 5JIQA 1W9XA 2NCMA 4XP5H 3P30L 5HDQL 3HLAB 5AKRA 5HYQB 4N25A 1P7QB 5BRZD 3WV0A 2VDNH 5FHBL 5FUCC 3ESUF 3THML 4ZMNA 1E8WA 5IESH 3OGCA 1H8SA 5DJ8B 4QNPF 3ZYOA 2BSBA 2XSKA 4KMTH 3ECQA 3LKOB 3G5XB 1EAJA 2IV8A 4PWEA 2FT8A 3PFQA 2WBJA 3JWOC 3MLRH 1FFPB 3IDMB 1HI6B 1I8AA 2QT6A 3D0LA 3M07A 5T5NG 2DWXA 2AJ3B 5GS1A 4LPUA 4TRPH 1U95A 4ES9A 1FG2A 4HJUA 3LZFH 4KTDL 4LK4A 4JM4L 2CO6A 1KTKE 4PJBB 4QXGH 4JJ5A 1PAMA 3T04D 4F2EA 4WKZB 1ZVSA 4HV8B 5C0FB 2CBTA 1J0HA 3T4AA 3CVIH 2YPKB 4JRXE 4K71B 4CW1B 5IT2L 2FQEA 4HIHB 2ZSVB 4WW2B 3FB7A 1N64H 1KTRL 3DX6A 3MNMA 4FFZL 4W9DC 2DI7A 2F54E 4KRPD<