1TEFA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Plastocyanin, chloroplast
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 and 1.96 resolution, respectively.
rcsb
source organism Spinacia oleracea
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tefA00
1PLCA 5D4HA 1JZEA 2BZCA 3AG3B 1AOZA 3FU7A 2VSMB 2MRYA 1MG3C 3ABKB 3UADA 2PP8A 1MZZA 2PPEA 2YAQA 3L45A 2FT7A 2IWKA 1SHXA 3FSAA 1E5ZA 3OMNB 1PZAA 1XB3A 4A2FA 3AG2B 3CG8A 1W6LA 2PP7A 1E30A 1EZLA 1OOWA 2FQGA 1NWPA 1A4AA 3FQ1A 3MBWB 2IDTA 3PCYA 2HX9A 5B3SB 1AZBA 4G71B 4WKXA 3NJJA 3S8GB 1KDJA 4N4YB 6PCYA 3KW7A 1V10A 3SBPA 1ILUA 3TASA 1SJMA 2VM3A 4HCGA 2IWEA 4KNUA 2AZUA 1NIEA 2YAHA 3U25A 2YARA 1CURA 2AVFA 3FSVA 1JZIA 3BVDB 2ZWNA 4A2EA 1BAWA 3CVCA 1YLBB 4YSEA 1BXVA 3C75A 3OMIB 1GYCA 4YSRA 1TEGA 4FA7B 2VW6A 2VMJA 1IC0A 2GI0A 4M4RB 5F7BA 5AZUA 1WS8A 3OM3B 5EHFA 1NDTA 3G5WA 4MFHA 3X1BA 1HAWA 4HIPA 3NJMA 1NIDA 1RZQA 3H56A 1SF5A 5TK2A 1TU2A 3ABMB 4DP6X 1GY2A 5B7MA 1W6WA 1A8ZA 4ZK8A 1BQKA 2VN3A 2HRGA 1L9TA 3H4FA 4BWUA 1NPJA 4E9WA 2XWZA 2B08A 2HLEB 2BW5A 5I6PA 3T6XA 1B3IA 3FS9A 1KV7A 2X87A 3PXLA 2YAFA 1KBVA 2Y69B 1PLBA 1NWOA 4PCYA 3CDZA 1KBWA 3GXUB 2UXGA 4YSUA 1SFDA 3TBCA 2EILB 4DPAX 1SF3A 2I7SA 4AZUA 1IKOP 2CCWA 3FPYA 1F56A 2PPAA 1I53A 9PCYA 2X88A 3GDCA 4E9YA 2I7OA 2XYBA 4AX3A 4G72B 5ANHA 1QNIA 2TSBA 1AS7A 4BWWA 3NSYA 4GP4B 3N2JA 1AZCA 1M9WA 4E9XA 3NJIA 3DTUB 2WSDA 2TSAA 1X9UA 2DY2A 5F7AA 2XV0A 2XXFA 2EIMB 3QJQB 4M3HA 1N68A 2P80A 2BWIA 3FYEB 4DPCX 2W8CA 1BXUA 2BW4A 2H3XC 1AG6A 1BQRA 1ET8A 4GP8B 2GIMA 4A66A 5I28A 4YSPA 1PLAA 1AIZA 2CAKA 4CSZA 1HAUA 5TK4A 2GSMB 2WO3B 5IY5B 3V9EA 3QJRB 3SBQA 2BZ7A 1NZRA 3NJLA 1GS8A 3X1EA 3IN0A 3NJHA 4RH4A 1E5YA 1FWXA 3EHBB 4E9QA 2BP8B 1GY1A 2YAMA 4G7RB 4W9ZA 1NIBA 4BDVB 1XB8A 1RCYA 4YSSA 3S8FB 1AAJA 4QLWA 2DYRB 4UF7C 1PNCA 4KO6A 3T6VA 1OCOB 3NJNA 3UABA 2UXTA 2YQBA 1E65A 2YAPA 2J55A 2QPDB 3WG7B 2YAOA 5I6NA 4GYBA 3X2QB 3NSCA 3OQRA 4L0PB 4YVUA 1JXFA 4GY4A 4HCFA 4BXSV 2FT8A 1PZCA 2GB2A 4KO9A 5A7EA 4X4KA 2H47C 1AS8A 3HB3B 1PZBA 5B1AB 3ZX1A 1MDAA 3X1GA 2J57A 2J5WA 3WIAA 1ID2A 4KOCA 2N0MA 3BQVA 4F2FA 3T9WA 5I5IA 1QLEB 1XB6A 3N55A 3MX0B 1ZDQA 2H5UA 4KO5A 1OCCB 2OCCB 1EHKB 3FQ2A 1JXDA 3NYKA 3T71A 1WA2X 2PLTA 1A65A 1JVLA 5I6LA 2FQDA 3V9CA 1BEXA 2XV3A 1KGYE 4AI7A 3JTBA 1XMEB 3NJGA 4E9TA 4NAJA 3FQYA 1WS7A 1GSKA 4AKQA 2OV0A 1OV8A 2EIJB 4G7SB 2ZOOA 1BXAA 1ETJA 4CSPA 3T6WA 1PNDA 2XVBA 2CUAA 4G7QB 1ASOA 1CYXA 4W1TA 1AANA 1L9PA 4BWTA 3EH3B 4DP0X 3JT2A 3OD3A 2E86A 1M57B 3NSFA 2IDSA 4YSDA 2FJSA 2XXGA 3EH4B 1AACA 1JXGA 2IDUA 2Y1AA 4F2EA 4Q8BA 4UANA 2BP8A 4A2HA 3IE9A 4YSAA 2PCYA 5B1JA 1L9RA 3AW5A 4BDVA 3X1NA 4YSTA 2DWTA 4EF3A 4N8UA 1CYWA 4BXVA 6PAZA 4Q89A 4YSCA 2DYSB 2XUWA 2XU9A 1AZRA 7PCYA 7PAZA 2JKWA 5I6OA 4NB7A 1L9OA 4DP8X 2JXMA 3QJSB 2QDVA 1GR7A 4A67A 3PAZA 5PAZA 1AZNA 5AFAA 3AG4B 1PAZA 2HX8A 2XLLA 1IUZA 5I26A 5B7FA 2FQFA 3UAEA 3DIVA 1NIAA 4WTQA 1SDDB 4PAZA 2VSKB 4HZ1A 4BK5C 2XX1A 1OE2A 5I5MA 1ILSA 1NIFA 2AZAA 3IN2A 1MZYA 2QT6A 4A68A 1TEFA 5D4JA 1JZJA 2CBPA 1J9SA 3AG1B 1A4BA 1ZIAA 3QPKA 1IBZA 3QJVB 2UXVA 4E9SA 2WO2B 1JOIA 1GS6X 3PPSA 1HFUA 4DP7X 3EF4A 4NERA 4KOBA 1VLXA 3FU8A 1NPNA 1NINA 2UX7A 3ABLB 3UAAA 8PAZA 1ZIBA 3CVBA 2PPCA 3AY2A 2HRHA 1OF0A 3WNIA 1TKWA 3PLYA 3RYMA 1ZDSA 2UXFA 2DWSA 2R7EB 1J9TA 2B3IA 2QPEB 5PCYA 4TXVB 2IAAC 2AFNA 3FSWA 5E9NA 4AKPA 4KO7A 2DV6A 2I85A 2FT6A 1X9RA 1JERA 3FT0A 5AKRA 2IH8A 1BYPA 3HEIB 3NJKA 1ET5A 3X1FA 2CJ3A 3S3BB 3FYIB 4FAAB 3SBRA 4DPBX 1OE3A 1PF3A 3ASNB 1RZPA 3S3CB 2FWLB 2FNWA 3H4HA 2PCFA 2CALA 3KW8A 3QJUB 1L9QA 3UACA 5B1BB 3TA4D 1ASQA 4DP4X 2YAEA 3TBBA 3AZUA 3PAVA 1JZGA 4HAKA 2J56A 2BP0B 3FPXA 4QKTA 1RKRA 2BWDA 3QQXA 4K9JA 3WKPA 5I5JA 1JVOA 1CUOA 1CC3A 1IBYA 1DYZA 2PPDA 2VW7A 5I6MA 4HCIA 1J9RA 2OJ1A 1AS6A 1GW0A 1URIA 1T5KA 2HX7A 3IEAA 1JZFA 5LDUA 5I6KA 1SDDA 4F7KA 2EINB 1V55B 4UAHA 2Q9OA 4DP2X 2GHZA 2EIKB 5D4IA 2PPFA 4KNSA 1BQ5A 1KCBA 1WA1X 3GYRA 5FC9A 3FU7B 1AZUA 2ZXWB 5B1KA 4HALA 3S3DB 2XV2A 3FSZA 1A3ZA 2A3TA 2BHFA 2ZONA 2MTAA 2P80D 1NTDA 1OCRB 4GP5B 1ASPA 1J9QA 2HZHA 4G70B 4DP5X 1BYOA 1N70A 1WAEA 2Q5BA 4A2DA 4GXFA 1OE1A 3DKHA 1SHWA 4E9RA 3NJFA 1R1CA 1ZV2A 4HHWA 3CZUB 1PY0A 4JHUA 5B1JC 1AG0A 4DP9X 4A2GA 1FFTB 1A4CA 1GS7A 2LLNA 1AQ8A 1PMYA 3ABGA 2R7EA 4YL4A 1AR1B 2FQEA 4YVNA 1NICA 2UX6A 2IDQA 3NP3A 4KNTA 1OCZB 1W8EA 4HHGA 1SNRA 2VW4A 3TU6A 1KCWA 3WI9A 1M56B 1KDIA 3IBOA 3FU9A 1ZPUA 2BO0A 3ZBMA 2GC7C 1E67A 4JKNA 3ERXA 2YXWA 4ENZA 2AANA 3D12B 2IH9A 3ZDWA 1DZ0A 4YSQA 1WA0X 4AKOA 2YXVA 3OMAB 2IWFA 2HXAA 5B7EA 3SQRA 2NRDA 4E9VA 2IDFA 3ASOB 3QJTB 4JHVA 2BP0A 2FTAA 2JFCA 3NT0A 3NP4A 4P5SA 2RACA 3NSDA 3ZIYA 1JZHA 2VM4A 2GBAA 1V54B 2PP9A 4P5RA 1SFHA 4YSOA 1FA4A 3PAUA 2W88A 1L9SA 3UGEA 3CVDA 1PCSA 1J5CA 3T6ZA 1MG2C 2QDWA 3WNJA 4DP1X 1KYAA 1QHQA 1ET7A 1UATA 2XX0A 3CDZB 3EH5B 3WKQA 1ADWA 2GC4C 1J5DA
chains in the Genus database with same CATH superfamily
1K4DB 4XCNB 1U8HA 4OCSL 1N9PA 4Q6IC 4WTZG 1E5AA 1MG3C 3QXAB 2FT7A 5JIDA 4HZAA 1FC1A 2QPSA 3X3FH 1J0HA 1I7UA 5LDSA 1F90L 2DLFH 3BHBB 3BMWA 4F9PC 4KKLC 4W9IC 1WZ1H 5IF0A 2K7PA 1CQYA 5KBKA 4X99A 3WXWL 1Q38A 5LO7A 3TH3T 3CLWA 2AK4B 3NJXA 3MUJA 1PD6A 1UA7A 4ZFOA 3F65A 3LSOA 3KPRB 4XVJH 3T8MA 1C5CH 1G1OA 1HSAA 1FGVH 1XCXA 3NJJA 1KDJA 3FO1B 4LDLB 4M5TA 4P3DA 5T1KD 1YEJH 1JDAA 3B7YA 1SM3H 5I17A 3FQ4A 2OBGA 3SPCA 1S9WB 4GINA 1HCFX 3D2UA 5BS0A 3KEDA 2Y5TB 5AWNL 2BVTA 1KGXA 4KK8C 3FRPA 3S7GA 3WY2A 1TLMA 3QGVA 1EAJA 4WWKC 1SLUA 5A2LH 3VJ6B 2WN3A 2EAEA 5BS0E 1BXVA 4IRSB 1IQWH 4KRLB 4PH8A 1KGCE 4WHCA 5IWLA 1JZ5A 4QXGL 1PFOA 2NNFA 3KCPB 3LKSB 4BKTC 4QOKD 4Q9BA 2G4EA 3GM0A 2VN6A 5F7BA 1WS8A 4OI8A 1PD1A 3C6LC 4LZKA 1FO0A 3D5OF 4DZBA 1R5VA 1UZ6E 3ARZA 3V4UH 1CLZH 3KLSA 3PDGA 2NT0A 1KT2B 1N5AB 1YN7A 2PO6B 2W9EL 4JFZL 4WW1B 2PWFA 4LLUB 4KX9A 4KY1H 1A8ZA 4CBZA 5BUPA 1OP3H 3NK3A 1SLXA 3VFPB 4MMZA 2XQ0A 4P2QB 3QNFA 1FVCB 4MYPA 3U48A 5C09D 3BXNB 4TVPL 1SN5A 5CNHA 1KV7A 4XP1H 4LLDA 1T5XA 2WUBH 3QO1A 2H45A 2I27N 3MUHL 1Q1JH 4ZFQA 3GEWB 1ZLDA 1DQQA 1FYHB 4PCYA 1KJ2H 4PLOB 5FKPA 1ZVSA 4HF5H 5AW4B 4M8VA 3KLLA 3C60C 4HKBA 3B9EA 4NKDA 5E2TL 3EOBA 3MLTB 4XMUA 5D7SL 4L4VD 1RZJL 4DHLA 1JZ7A 1CBVH 1W0YT 3QZLA 2EKJA 2JKLA 3ESMA 3BE1H 5IEHB 4OLUL 3VI3B 1JPGA 3QAZB 3V6FB 1Q9KA 1M6UA 1F4XH 2O6CA 1TZHB 4UQBA 1MCEA 3N9GH 1CPUA 1EQWA 3L6FA 3P4NB 5DK2B 3ZKSD 5L6YH 4E9XA 5J6GA 4KBPA 1QBAA 3ARGB 4P5TB 1O7DC 1HNFA 5DQJA 3RIAK 3UJTL 3W82A 5I0YA 2XV0A 3CFKA 3VXSD 4QNPE 4M3HA 1L5GB 1INEL 2NY6B 2BX5A 2H3XC 5F93C 1AG6A 4BE5A 1QRKA 2AXFB 1BGXL 3DLQR 1ITBB 3IS1X 1RMFH 4NGHL 5TE6H 3QE5A 1VESA 3P3UA 4KRPB 1IMHC 4LEOB 4R5XA 3HOGA 5JQHC 4ALAH 3Q8CA 2DH2A 4IM8A 1FRGH 4L1DA 4BZ2H 5JNYB 1S7UA 3K8KA 1A7RH 1LP9F 5CU9A 5DC4B 5H8DA 1BMWA 4HA1A 2ICWA 1F5WA 3REVA 2A9NL 3CQQA 4K5NA 5AYTA 3IDJB 1GS8A 3CLEL 3N85L 2VAJA 5J56B 3NAAH 1E5YA 5FGCB 3X17A 1BQHG 3MFGB 2H8PB 4GO6B 3FMGH 1UYWH 1H9DA 2VR6A 5INCB 3ZRCC 2V9QA 2F6AA 3DPBB 3VMPA 1MXDA 4QLWA 2BHUA 4FP8H 1HE7A 2DQCH 2ADJA 2VERA 4LSVL 4O51B 5AW6B 3EYVA 3BRDA 2YAPA 3I6LD 3ARRA 1NDGA 2RAMA 1OGPA 1F45A 1CL7L 4FXKA 4LNVA 2ZNXA 5CSBA 4CL7A 4ZUUA 2UWEA 2NXYB 2Q7YB 3L54A 2JH2A 4XN1A 3DHJA 3EFFA 4XNMB 1R3HB 4JQIH 5HHNB 2EVJA 1ECYA 2UWEE 3GO1L 3MV7B 4TOYL 3PPEA 3U2SA 5I82A 1A2YA 2ITDA 1MVUA 4WWID 1C5DA 2HTKD 5I5IA 1D5IL 1E4HA 2E9WA 5E2VH 1PG7L 1QO3B 2B2XH 3ARBC 2XN1A 3KDMB 3QRGH 3LRHA 5TFSH 4TNWF 1RZIB 5FIEA 2FX8H 3WIIH 4QRFA 4Q97A 3ATBA 3NYKA 4NM4L 5F1NA 4ODVL 3BVUA 4I48A 2VC2H 4FG4A 4ZMAT 3HB3D 4PD4J 2G2RA 3JTBA 5D96C 5DZJA 5ICYB 5F9OH 3ESVF 1GAFH 3W57A 2YD5A 3Q43A 4PJFB 1OW0A 4FYRA 3ZU8A 2WANA 1WIUA 3ZPDA 1BXAA 4NHCL 3UYPB 2ENJA 1E4JA 1I3VA 1WYJA 3I74A 2AJYH 4NHUB 3JT2A 4DP0X 4W4OC 2A9AA 3QIBD 1DQDH 2NYZA 5T3XL 3UP1A 1IKFL 4QGYA 4M7KH 5D7IB 4X6BB 3QQ4A 4N2LA 1S7RA 2GBVA 5D7EA 3V6BR 1MRFH 1YYLL 1VADA 5DVOA 5I24A 3F6LA 2PCYA 3DRTA 2O61A 3L9RA 1QHPA 4CSSA 3T0XA 5D6DA 4KI5E 3GI9H 2Q87A 4XBGA 1Q9WA 1ITCA 3O6FC 3HR6A 3T0AA 5LUMA 3BKCL 4KAQL 4FN0A 4GXVL 1CO1A 2B59A 2JJSA 1GJIA 3ATFA 3ZE2F 1P9MC 2YLKA 5DRNB 2VJ8A 4RWYH 1BQHB 4XP9L 1FL5B 5AVYB 3F7VA 5BOZG 2P42B 3RX7A 1DFXA 3PFQA 2IOIA 3KPPB 3K1KC 1UA6H 3OR6A 5CCKH 4YOKA 1MFBH 4FADA 1E8YA 5MERB 1G87A 1WBZB 5DC2A 1GGCH 1YPZF 2PTVA 3MX0A 4FLQA 4GKZA 4J28A 5E5LA 3VCLA 4R7VA 4XP4L 3O11A 5AOMA 3POHA 1MJJB 2IO5A 4I8DA 5FHBH 1RXLA 3OB0K 2HCZX 3SQOL 1HSBA 3C08H 1NCOA 1NMBH 4JFXA 4BD4A 2QVMA 5BQ7B 5F97E 3GMPA 5C0BB 1ZT4B 2FJFB 3TYFB 4EI6A 4QHKJ 1JPTH 1DN0B 2I26N 4MCZB 5A16B 4PV1C 1QA9B 5D1ZA 1LK2B 1KCVH 4RA3A 7CGTA 4I3SL 4M4PA 2FT6A 2DQFA 1DVFA 1RUKL 1AGCA 1E4XH 2HLFD 2XXCB 4UIMA 3W56A 3X1FA 3OPUA 4PG9B 5GSRB 4JB9L 3ME0B 1S9YA 3RHWK 3SCMD 3BGMB 4JGMA 4F9PA 1HOCB 3U9PL 5MP6L 1ZHLB 1SYSB 2WVUA 1WBYA 2X4SA 4APXB 3QO0B 4L2YA 2E47A 2WC7A 4JM0A 5JW3L 4FJZA 3QAQA 5IVNA 2J56A 1RKRA 2YGNA 3QQXA 3WKPA 3C2AH 2P24A 2Q20A 3G6JF 5I8CA 5E6SB 1P0SE 4TUOA 1SXZA 3OL2A 5BJTB 1CFBA 2Y7SA 4YJZL 5I73B 4AXWA 1DCEA 3C5ZB 4WU7A 1HH6A 4YXHL 4GAJH 5LAPA 3GSNB 1UWGH 1U8MA 5AKTA 3IJEB 2NDGA 1SDDA 3IFOB 1YEHL 5DJ2B 1U91A 5EOCH 4GNKB 3TA3C 4EN3C 1S78C 4TSAL 4KNSA 4CVWA 1K2DB 3QCUH 5SWZB 3C6LA 4KFMA 1WK0A 2EEAA 4YHIB 5BZZA 2X4NA 1E9PB 1H15B 2XJLA 2BVQA 5I15L 4MD4A 1RZKL 3F05A 5HYEA 2IH3B 3WHE1 3WEAA 1H3UA 4IBUA 1KEML 2YIHA 4Z7VA 1UT9A 2EYRB 4QYOA 4WEMB 2FBJL 1FJ1A 3WO4C 2RJMA 2WJ7A 3GRWL 1DQKA 5CJQH 4Z7VE 5ALBH 1ZV2A 4G2AA 3QG6B 4PJCF 5EUOF 5JORB 1S3KL 2ZYSA 3MV8D 3MRRB 4WV1C 1F6AA 3WSQH 2LLNA 4LMQI 4GAAA 4K7PX 4XP6H 4HIXH 1OVZA 3UEQA 5CCHE 4YVNA 2JKTM 1TTFA 3LH2L 4N0FB 1TZGL 3L7EB 4QTHB 1OTSD 4APQB 2VISB 2X6MA 1UURA 4OF3A 4GT7A 1LVEA 3E3QC 3V7MA 4FI8A 5KSVA 1RZGA 4YC2B 4B5ZA 2ZXAA 3U0PB 3S6CA 3GHBL 2A6KA 2VDMH 4I4WB 4KHTL 3UDWC 5IV2B 2IH9A 2R4SH 3BWUF 1K8IB 4XVTH 5DF0A 3O81A 3SY0A 2HTLC 2GK2A 3M17A 4Y4HC 1TG8A 2WB1A 4DKEH 4N0RA 1QW9A 4CMMB 5ELIA 1GSMA 2AJXL 4G6MH 3P2BA 1A02N 1C16A 4ONFL 3QQNA 1O7DE 3ZHLA 1DJZA 4LDEB 4RGOL 4E68A 3QQ9D 2P5WA 3WMSA 2W88A 1L7TH 2BNRB 1KTDA 1MUJB 1M7DB 1X5LA 2VDNB 3DVFA 3U6XA 4D0DB 3EH5B 3ARFC 4AGNA 3RFZC 5T3ZD 4TLUA 5T1KB 3FZUD 1YNKL 1VEOA 1JHKL 4LLQA 3N91A 1EJ6A 3D18A 1JZ8A 4LARH 5LN8A 1HDMA 5F8QC 4UQIM 3K6OA 2IPUG 1BZ7B 1AQKL 1WHPA 3PFUA 2HJLA 2WGNB 2XZAL 3ILPA 1NFIA 1SYVA 1EZLA 3L5HA 4OFKA 5H37G 1TJXA 3FFCA 2R9HC 1CYGA 4BA8A 2ZCZA 4JR9H 3ZE1F 4K23H 1HHKB 1QEWB 4GUPB 4U6XB 2F0CA 3FFCE 1AZBA 1TZ8A 3Q6FB 4NSKA 1NLBH 5AVUB 4NZUH 3RL1A 1U3HB 3MRNB 3WLWD 4R5TA 1ML0A 4D3CL 1FLTX 3IPEA 5HYJA 1MF2L 4DUWA 3EOTH 2WWNA 1MHCB 2NY2D 1GMEA 3TFKC 4DESA 3CN2A 5HYJE 3JV5A 2DQEL 5MI0C 1ZE3C 3TV3H 3LH8A 2EE6A 1ZS2A 2V3DA 1RK0B 1KACB 2QR0B 3ARBA 2WP3T 3BT2L 5C09B 3MCG1 3WJMB 3NIDB 4HX1B 2VMJA 3QCVH 1LL1A 1XZWA 4OLVL 1OD9A 5E8EB 3BAWA 1KPUB 1SOXA 4JFOA 4NPYB 1G94A 3L5WA 5IVXA 2HRPL 1XEUA 1FG9C 4NAMA 5DMIL 3CN4A 2P9RA 2FBOJ 4FQXC 1MWAA 3RURA 3PWUB 2DLIA 3H56A 3MLWH 1SF5A 2ZCLH 5IVXE 1JVKA 3K71B 4YBLB 4NJ9L 2HJFA 4N3TA 1ZGLP 1FZKA 4PPTA 1GZHC 1W6WA 1IFRA 2FYYB 2NYYD 4MD5A 3UTSA 3WKYA 2FL5A 3HRZC 1NAMB 4JRXD 4TVSa 2CIKB 3HBGA 4PJ8A 4E41A 3MACL 5E6IB 3KWWB 1QMUA 3HS0B 4HK0A 3WD5L 3UTSE 4UT6L 4DEPC 3QJFA 3K2MC 4S1RL 2WNKA 5DWPA 4E41E 5I16A 1RH8A 4LSPH 2C34A 2GPZA 4YHML 4FQ1H 3ZHNA 5C92A 3TEZA 4B53A 3AXLA 3GXUB 2EDTA 5LWYH 2FBRA 2HKAA 4M56A 4KGLA 1U30A 4XNXL 3KPSD 4XPTH 1UGKA 1SVBA 3FFOA 4EI5B 4YDIL 5DUPH 5D2NB 1F8TH 1JF1A 3EJJX 4NKQB 1EWHA 2WAQA 3QBTB 4FF9A 3BFQG 4G43A 5EN2A 1I1FA 3QJZA 3RTQC 1TJIL 3MYJA 4PGZA 1QRNB 4TKWA 1Z3RA 4XVOA 3DV4A 3FOMA 2ARJB 3F7KA 1BREA 2XZCH 4KMTH 4PR5B 5BVPH 2D31B 4ODSH 2YD8A 4ODUA 5DEFB 4KZEL 3TBSA 2H9GA 2XTJE 3P69A 1ZLWK 1I82A 5GJTH 2F1AA 3VSTA 1RU9L 2X6AA 1IGCH 3ULVE 4JO3H 4LIQH 1UTDA 1G4MA 3CHXA 2O6EA 2BW4A 4HUWA 1OF2B 4K8RC 4GP8B 2W0LA 5JUEL 4KXDA 2DQGH 1ZHNB 4AGQA 4K5OA 3T2LA 4ZMYA 5HVGB 5G5DB 1G6RB 1XAUA 5AW3B 1D9KD 1FBIH 4J39A 1D5MA 1L0PA 4XMPL 2WXQA 4XGZB 4LRNL 1YY8B 5HHMD 4D0CB 1P5VB 3I02A 3PWVB 1RK1A 3FH7A 5JDJA 2J4WH 1ZS8B 3OB0H 4U1MA 1HKFA 4B9YA 2D7MA 3ILDA 4Q2ZB 2R2HB 2WBKA 2NW2B 1HQRB 2ZWYA 1K5NA 1OLZA 3VTAA 4KUCF 1M2VA 3W38A 1U8OA 5GGQH 4X5WB 4L1HA 2D4DA 2QHRH 3F7LA 4F2MA 5EORL 5BZWA 5I19H 3QHTC 4KO9A 5BRZD 1JSYA 2AJUH 3HB3B 4F2ME 3HZ3A 3DX3A 4PJGA 2GCYA 2G5RA 3NIGF 2H0JA 3OKOA 5AYUH 5E9DD 4XO5A 4A04A 1C1EH 4PSRA 4ODXB 5HGHB 2FO4B 3TNMA 1D7FA 5J1SC 1CXHA 1ZT1B 4PJGE 4F2FA 3T9WA 2C3WA 2D2CC 3MRQB 2RFXB 5DRXB 4F3FB 1LM8V 2GUOA 5EEXA 3TS8A 3ISWA 4LPTA 4W6YB 3VA2C 5LNGA 1SBSH 5ENWB 1AIFA 4TTDC 2OR9H 3OGCA 1FHNA 3LEVL 3VWKD 4Y16B 2GI7A 1B4JH 2WVVB 3QIBB 2VZTA 3RB7A 1MLBB 5EC2A 3V4VA 1ACYL 4GQ9L 3RVUD 1ORQA 4DO4A 5CEZH 5HDBE 3BSGA 4A6YB 4YDJB 1FL3A 1I8MB 3MRKB 2XRAH 1B2WL 1OOAA 5DJCB 2L3BA 3BSZL 5FYJD 4MA8L 4CN1A 5HDLA 4AJVA 1E5BA 4WWNA 5TDOB 4H8WC 4L5FE 4XOCA 1DVUA 1N8OE 1JXJA 2VN7A 4Y5YA 4CSPA 1EFXB 1YMMB 4KQ3L 3ATDA 3NFSL 4Z7NB 3VFWA 1D5ZB 5JHDD 1CLOL 2QBWA 1IAOA 3BP5B 1G7JB 1V7ML 8CGTA 3IDMA 4C59B 1KB9K 3N43B 1YMHB 4A63A 4YFEA 2YPLA 3VXNB 4FG0A 4KROC 4YK4C 3TV8A 4ETYA 1ZLSH 4M6ML 4LHUD 2GITB 2WOYA 4F2EA 2BP8A 4RMBA 2YPLE 3RVXC 3PV6A 1R9FA 1A6VL 2JF1A 5HPMA 1USZA 3DGCR 3BAKA 3GSNL 3K4AA 2OMNA 3B9KB 5CJOL 3ULSA 4KTEL 4CVXA 3L5XL 5L2JB 3EJYC 4FNTA 3RDJA 4JFHE 4NJAL 4Z0XA 5KVGL 4LASL 1GVIA 2YKLL 3FU6A 2H26B 5F7DB 3KR3L 3KXFB 3KWXA 3QWOA 3JWDH 1HILB 3FB7B 1IM3A 1NCIA 2QSVA 3PAZA 4OZFH 1BLNA 3T3MB 5LNDA 1N6QL 1IUZA 5CLZA 4DQAA 2X4RA 1RJLB 3KYAA 5AAMC 4N2GA 4UM9D 5AZ2H 3GMLA 1OCWL 3E3QE 3UDWA 4LCYA 1G9NH 2A9MH 1DDHB 5FDWB 2QT6A 3DUSA 3H9HB 3TH2T 4KTDH 4UB0H 1TEFA 2BIPA 1AXSB 3BMVA 3MGOB 3M46A 4D9QE 5DVKA 3FONB 2O5NA 4RNRA 1XEDA 3RJOA 3V8CA 1TU2B 4Y4HA 2GJJA 3MRIB 5GGTH 3VWJC 3R8QA 5ADPH 3MA7A 3D3VB 2WMPA 3ABLB 3QWRA 4J3BA 4QRUA 1D2OA 3GMRA 1KF9B 4GOSA 3FRPG 4HC1L 4WWKD 1FZJB 3FO2B 1E27B 1I3RB 2PPCA 2IG2L 3LKOB 4U1JA 1T1ZB 2HRHA 4FFZH 4YIQA 2X41A 1JK9B 2EH7L 2Z91B 4MHHI 1FFNB 1QFWM 1MCKA 1XZ0B 5GS2D 1J9TA 2OK0H 1MW2A 3MV9D 5PCYA 2OW6A 4CU8A 4PW9A 3MCLL 1P5UA 2ZOKB 4RQQB 1KFGA 4F9LC 4UUJA 2UZPA 3AJ7A 3T08A 4MJHA 2B7DT 3LN5B 3E2HB 3M6DA 4ZO6A 2R1XB 3DX6B 3L3OA 3ZDZB 4I9XA 4O58L 3S96B 3CFEB 4AV5A 3TEWA 3S3CB 4PJ7A 3SE3C 4UT7L 4ZUWB 4MB5A 3I3EA 4LOUD 1J8HD 1F6LL 3PWPB 4PLNC 4PJ7E 1JWSB 2A77L 3QS2A 2D0HA 3DX9A 2Y2YA 4KPHL 4K5PA 1SJXA 3H2PA 1I7ZA 1NLDL 2VDNL 3HN3A 1FE8L 4OF6A 4OCSH 5DRZB 1CUOA 3C60D 3VE0B 1HH9A 3QYNA 4HCIA 3ESOA 4WHYG 1CGSL 1WZLA 3A5VA 1F90H 1DLHA 4NRYA 1IU1A 1KCSL 3FT3A 5J3HD 4XO4A 4B0MM 1V55B 3MV8B 5K33A 3WXWH 3K8MA 5IOPA 3FF8A 3OWRA 4NO2B 3V0HA 1DUZA 4HSQA 1U8HB 4A37A 3UMTA 5J13B 4MDRA 4R6UA 4FQXA 3O0RL 3Q1SL 4KDWA 4WI7A 1HXMB 3JZYA 1J9QA 4S2SB 5IM7B 2HZHA 1D6EA 2X38A 1N70A 2CO6A 4QY8A 1XF5A 1Z3GL 1FZOA 5IBTL 5AWNH 1NUNB 1WCBB 3O3AA 2F1EA 1F02I 4E5XG 4X99B 32C2A 4MKMA 1M2OA 3B5GA 3LSOB 3T65A 4XNUH 4WKZA 4A2GA 1HSAB 4QXGH 4HWZA 5DHMC 4PRHA 1I1CA 3WFCL 2V2TB 3M1BA 3GDBA 4P04A 4P3DB 5CD5D 1M05A 2R1YA 1MFDL 5I18L 4PVMA 1A4JA 4BFJA 2OYKA 3I2CL 4PRHE 5D9SA 1FNSL 3D2UB 3TNNA 5BS0B 3SGJA 2WWOA 1ED3B 2KHAA 3EKCA 3FRPB 2E7HA 5IQMA 3U46A 2W9EH 4JFZH 2APSA 1TITA 3M7OA 4KHXL 1FSKC 4Z9KB 2BFGA 4WNQB 1GJWA 3APDA 4FFVC 4I1NB 2ALAA 2MQCA 4AC4A 1RIVL 1D7CA 1NAML 5HXMA 4TVPH 3OMAB 1FO0B 4DZBB 1YA5A 1R5VB 5B38G 3BCDA 4JHBA 1ZLWH 2K45A 4R0LA 4GRLC 2ZOWA 3BEWA 4FXTA 5AOLA 4NO0A 3V52L 1AJ7L 4NUQA 3WEOA 4OV6F 4FFYA 5E2TH 3QWQB 2XVKA 4MZRA 3DX7A 1SFHA 5D7SH 4FC3E 1RZJH 5T1MA 2X2UA 3WTVA 1L9SA 4BKSC 1Y6MR 3HLAA 4HUCA 4OLUH 4P46C 4EOWL 4LLDB 3QO1B 4IJ3C 4WO4D 4DP1X 3B2XA 3KL0A 3QQ3B 1ADWA 4ZW7A 5FKPB 1BQSA 1ZVSB 2E56A 1I1AC 5DQ9A 1H6FA 4HKBB 2NY1B 5LBSL 4NKDB 3WS3A 5C0RL 3UJTH 3AB0B 1FNEB 4OFVA 4B60A 4PU2A 3EOBB 3NBNA 2F19L 1TO4A 1INEH 5IIEA 3DDFA 2Z0UA 1UWXK 2E7LC 2LOEA 1WD8A 2R69H 4K07A 2K3TA 3N41B 4HOWA 5JW4Q 1XMWA 3EIFA 1BGXH 1Q9KB 2VAAA 1Z6JT 4NGHH 2N7SA 4LU5L 3F84A 5F0PB 2MOGA 2WCGA 2GK0B 3P02A 3QZWA 4KKBC 3RPIA 3DI3B 1IL1A 5DQJB 1G6RL 1MEXL 2C9VA 5I66A 3IJ8A 2WQAA 4AGMA 1QSFE 2A9NH 3CFKB 2Y07L 1Z5LA 1TZIA 3CLEH 3N85H 3QPQC 3DIFB 4U1KA 2AZUA 3RWFA 1ZHKB 4TS6A 2RTTA 2WZ6A 4E5XB 2ZWNA 4WUUA 4UT9L 1MNUH 4KI1A 4F5CA 5T1JA 4NUJA 3BWAA 4JPVL 3ML9A 4LSVH 1TEGA 4WUUE 2X3CA 2XG5A 5FGRA 2P8PA 2LFEA 3B6SB 2ICWB 1J10A 3QP3A 3REVB 3K6SB 1CL7H 3ZL2A 3QUGA 2P1YA 1MRCL 5AVWB 5AZUA 3IPBA 1EXUA 2ZXDA 3OHXC 2J1ZA 1OSZA 1KCKA 1Q94A 5ANMA 4QHKI 4X0NA 3OXRA 4N6QA 5BZDA 3TURA 3T1FB 3BESR 4TOYH 1QASA 2ADJB 5T1LD 1N59B 1BQKA 2W81C 1U21A 2J25A 1F0LA 1ZSHA 3EYVB 1D5IH 5ANME 5E8OA 3N6YA 3OG4B 1YEGL 4BFBD 2FECI 5F9JA 5DGRA 4N5UA 1PG7H 3AY4A 2B08A 4H5SA 4YHOL 1EJOL 2FLMA 5C8JB 4M8QA 2V2XA 5B38B 2UWEB 4PCKA 3RWEB 1VFAA 1PLBA 4NM4H 5F7WC 3CDZA 4ODVH 1VFUA 3RIFK 3SSGA 3BZFB 3HE7C 1XHHA 3U2SB 4F7CA 4BFNA 1A2YB 5DO8A 2EILB 1MVUB 1C5DB 4GBXC 4X8CA 3II2A 3H2QA 5IMLA 3I9GL 2Z8WC 2GJ6A 4A6YL 3BQUC 3VVVA 3MU3A 4CC4C 4NHCH 5HHVL 1H8SA 3K0YA 2P28B 4NZJA 2GJ6E 2N1TE 4G8FA 4I48B 4G59C 3L2MA 3WAKA 4NQVA 3N42B 4LLMA 4C83B 1NA8A 3SHSA 5DUML 4N6RA 3JSSA 4Z78B 5I30L 1RUPL 5T3XH 2BCKB 2DDQL 1IKFH 2G2RB 2I32A 4MB3A 4R3SB 2QQNL 1N5YL 2E0PA 3KS0J 1QYGL 5C3LD 3BH8A 3T0DA 1P1VA 1YYLH 4OD2A 2F53A 4L23A 4ZO9A 4A66A 4F1ZA 4NQCA 2A5UA 1CLCA 1LP9A 1BVKA 1JDDA 1YEDA 3DX1A 1WLHA 2F53E 2XWTA 2CAKA 3MUUA 4EVNA 4DKDC 5J11C 1UG9A 4NQCE 1LP9E 2Z7YA 4KAQH 3VFMA 2DBLL 1D5XA 5F2FA 1EK3A 3HFML 1K72A 2Y24A 4GXVH 3KNBA 4OJEH 2F8OA 3QQ4B 4PTUA 1S7RB 2OR7A 4HP5A 4R84A 1R19A 2WXLA 4QWWC 4XI5C 1GY1A 4XP9H 4RA0C 3SDCA 2ZX7A 5E9DB 1VADB 3QEQA 1M1XB 3DRTB 1PKQB 2P47B 2O61B 3L9RB 4YSSA 3TA3D 4EN3D 4GQQA 1HOEA 2N01B 4KJWC 3QEQE 2H2SC 1C08A 1OCOB 4AC2A 4XBGB 1KBKA 4Y5XC 3X13B 3G5VA 3LZRA 5D4QA 5EFIA 2MCAA 4MMXA 4N22A 4QHNB 2RA1A 4XPGL 4F9LA 1NFKA 3OQRA 2WQWA 4XP4H 4FTDA 4GY4A 1E90A 4GMTL 5FW6A 3BP7A 4YZFF 1PZCA 1KXHA 3F7VB 1BOYA 1DVXA 4OJYA 5IJBC 4KK6C 4FABL 2DH3A 2ATPB 1G6VK 3SQOH 1BJ1H 3SDXF 2RMNA 1KJMA 4BK8A 2WYTA 2N0MA 3TF7C 5CSZA 4RFNB 1QLEB 1QW8A 3UZEA 1TTCA 1BX2B 1XH3A 4A1RA 3A23A 3MX0B 4GKZB 3VCLB 2YPVL 1L7IL 3IDIA 1CFSA 1EHKB 1FC2D 4JY4A 5C9JA 5IB2A 4I3SH 3IDGB 4F93B 1RUKH 3KHQA 3GBLA 1HSBB 1NL0L 4AQAB 1TPXC 4JFXB 3IU4L 4JB9H 5J4MA 2APWA 5L0QB 1JRHI 1Q0EA 1HE8A 1UH4A 4NLHA 5F9WC 2X70A 3UTQA 5MP6H 3U9PH 3B43A 5DO2C 3ECWA 4GJTB 2ZOOA 1ETJA 5IQNA 3LEYL 4XN8A 2NNXA 2P48B 2HRLA 5J0BA 1L9PA 3M7FB 5D8JL 4UIMB 3S0PA 4ZFFA 4QXVA 1DCLA 1M57B 4IRZA 5E5RB 5LAXA 3EH4B 1ZSDA 3FT4B 4OY9A 1REIA 2GTWB 4UANA 4YXHH 1HN1A 4WTXA 3GQFA 2X4SB 3FFDB 3WOVA 4MBRA 1XF3B 2EDRA 3LKNA 1YEHH 4RSVA 2DIAA 4P8QA 4A7UA 4WY7L 2W91A 3AU1B 4MQTB 4TSAH 3TT3L 3V4PB 7PCYA 3CBJB 2JKWA 2P24B 2XQYG 1KZQA 4JFED 2WLHA 3RPKA 2B0SL 1NC4A 3VXUA 4AXWB 3RGVC 5I15H 1BD2D 4BZ1A 2ENQA 2ZCHL 4LEEA 1HH6B 1RZKH 1BHGA 1PAZA 2F61A 2X10A 4LEXL 1KEMH 1II4E 1M9SA 1U8MB 3VXUE 2GYSA 4WTQA 3UAEA 5MENA 1SDDB 2PCPA 2FBJH 2R9HD 3KLKA 4MZ2A 1U91B 3GRWH 2XNAB 1EBPA 2ZUXA 5MENE 2AZAA 1I9RL 3KJ6L 3IN2A 1S3KH 5JW4N 3C6LB 2C5DC 5GRVK 2CBPA 2X4NB 4ZX4A 1AKJB 2VLLA 1EBAA 2BVQB 4MD4B 3IAPA 2H6OA 4GRLA 4B9KC 2JV6A 4Y9FA 3LH2H 1TZGH 1XF2B 1K5WA 5ACMA 3TFKD 1I75A 4Z7VB 5LQBL 5BUAA 4XHJD 4QYOB 1QSED 1FJ1B 1QNZL 4TLKA 1P2CA 1MXGA 2BS71 4FQLL 1CLYL 3L1OL 4JREB 3MR9A 3GHBH 4X7TA 1F6AB 1H5BC 4YBHA 4KHTH 4P46A 1ZVHA 2VT0A 2CUHA 5DHYA 4MNQD 5MEQA 1E40A 3GGWA 5I1KL 3AC0A 4BQ9A 3CFCL 3SPJA 2C7FA 4U31A 2DV6A 4N85A 1FO0L 4QRAA 3FT0A 2EYSA 2AJXH 5KSVB 1RZGB 5ABDE 4ONFH 2AV1A 1UWXH 3FYIB 4CA4A 2JIXD 4OGXL 2A6KB 3QDMA 4RGOH 4RRPA 3WNOA 1XTLA 4AUJA 4DCQA 4BA0A 1KTJA 4NWTL 3B83A 1E9QB 5B1BB 3QDME 1QABA 3N1GC 3A4EA 3TBBA 4L8SC 4OGAD 4ACTA 3G6JA 4HVBA 1LYQA 3UTZA 2BJML 1IGYA 2D9QB 4FI7A 3WKML 1YNKH 3QEHA 2Y6TE 1JHKH 2DQTL 1C16B 3ARPA 3NZUA 3G6JE 4G1EA 1CC3A 2NSMA 5HYSA 1KGJA 4DEUA 1CVSC 1TVHB 1AQKH 1GW0A 2D7OA 2XZAH 1QSVA 1SXAA 3FKUS 3T4AC 3H0TA 5I75C 1UC6A 2DWEA 4UMSA 2GBUA 4S0HA 3CSYA 1E7UA 1MDTA 2EIKB 2W0KA 1X9QA 2EE0A 2FDBP 2H0PA 3O9WC 5D1XC 3KM1A 1DFBL 4YAQA 2P52A 3O6ML 3TBYA 4I0PA 2XV2A 5JW4R 3D18B 3GWJA 3OKYA 5KVDE 4YHKL 2BHFA 1HDMB 3DOHA 3UZVA 2PWEA 4D3CH 3LVTA 5FO8B 1MF2H 2YPKA 3PJLA 3OV6A 4KX8A 2HJLB 2Q6WA 1Q9LA 1NFIB 1T2XA 3BIKA 3ILPB 1PEWA 5EUOA 4PJCA 5F71A 3MNWB 1W80A 3FFCB 4K3DL 4K7FA 5DLLA 4JY6A 4ZPTB 2DQEH 4E9RA 1WG3A 3ENEA 4YDNA 1R3LA 3HG1D 3JTSB 4I18A 5EUOE 4BSVB 4PJCE 4F7EB 4XPAH 3BT2H 4NP4L 2R0ZL 2ZWLT 2ADIA 5DEGA 4NSKB 4F33B 4OLVH 1F3RB 1E2VA 2YA2A 2AJVL 3RL1B 3TO4C 1HJBC 3Q05A 4XVUD 2HRPH 1IRAY 1HINL 1MLCA 4NRXA 4ZMPA 5DJ0B 4Z3JA 5DMIH 2QVTA 3VX1A 3E8VA 1F3DH 4KNTA 3WNPA 2GIYA 4LPVA 3ZHKA 4Q4EA 4NJ9H 4GBXA 1HESA 3NFNB 4X6CB 1F4WH 3ARED 4MKTA 3WUWG 5TGBA 1URLA 3ARBB 3ULUC 2DIBA 4HLJA 4CC0A 3I6GA 5CBEA 4ENZA 3L95A 3MACH 3MZGB 3WD5H 4UT6H 1EJFA 3L17A 4FQPA 5IVXB 4S1RH 1UH3A 5EZPA 4OCLC 1CFVL 1MWAB 3BVNA 4E9VA 4YHMH 3GZKA 5LBGA 1QLRA 2HJFB 2VMFA 2BP0A 2JFCA 4WRLA 3NSDA 2WLLB 3UTSB 5IOKA 1BV8A 3IRZA 4XNXH 1N0XL 4MLIA 1SXCA 4PJ8B 4YDIH 1O7SA 5G4MA 2PXYC 5FK9A 3QJFB 4W4NA 3KPSA 3S4SA 4RX4D 1RVFL 1TJIH 1ZOXA 4CJ1A 5FYLD 1MG2C 1QBBA 1I8IA 5ACZB 4PJXF 3MRGA 4TTDD 3WFBL 4R8WL 5FFGA 3KPSE 1JS4A 4HGWB 4HXBL 3VSUA 1DSWA 1G0XA 1U9KA 3QZOA 5EEYA 4KZEH 3VFSA 4X4ZA 4DSYA 1S7XA 2X1WL 3UO8B 3WJLC 3V5DA 2CKBB 3IETA 3VRJB 3L45A 3QI9A 5IB5A 1TCMA 3IGAB 1PYWB 1RU9H 1W9XA 4PLKD 5JMRA 3BT0A 3GSXA 4G43B 5EN2B 5C0NC 2CK0L 1E30A 3D0LA 5JUEH 3GUTA 4AEFA 1U6AL 3O6FB 2I24N 5DHVB 3ZE1E 5KYNA 3BZ4A 2IDTA 3L3HA 3GK8L 4U0RC 2FHBA 3TBSB 4W9JC 2J1KA 3D85A 4XMPH 3RX9A 4ECNA 1W72A 4LRNH 3UYOD 3JQOB 5BO0D 4N4YB 4C56A 4AGOA 4KROD 3SGEI 4U1GC 3VMNA 5EBMA 2X6BA 3T0EC 4OGYH 4AY0A 4HUWB 1LWJA 4LRIC 4C56E 3AQYA 2OSLA 1RJZA 4TULL 1HQ4A 1QFUL 5CJ5A 1WSST 2WK2A 2I69A 3CVCA 2IPUK 5B4MC 3EJYD 2AERT 5IMOA 3K8LA 4PW4A 5ICXA 1B0IA 2C9RA 1E5UI 5IP4A 2G5BA 3I02B 1GOGA 4H25B 1TTBA 5HHXL 1PLGH 1KGUA 6FABH 3ZW3A 5EORH 4XO8A 2APTA 4A7TA 1IZKA 3F7PC 1HAWA 4O2CB 2I9TA 4WI5A 2EC8A 2WJ5A 2VABB 4PIBA 4S11A 2BRRL 1QEXA 1K5NB 2WVTA 3SPIA 2R0LL 5CAYB 1KB5A 3WUWB 2FO8A 4O9HL 4G5ZL 1UUSA 1M2VB 3EDDA 3TBVB 1U8OB 2P8MA 3KWUA 1HL5A 5FYJL 1J8KA 2Q7AA 1MAKA 1SDAB 1QLEL 4F2MB 5K1VA 3RKPA 3VWJD 4H0HB 2P49B 1S7VA 2FJHA 4XXWC 3IXAA 4LEBA 3LEVH 4YSUA 4PJGB 3DMMC 5DYOB 1JRHL 3A24A 1JPFB 5AOZA 1ACYH 4GQ9H 2JI3A 3D08A 2CCWA 4FTVA 4HOZA 1U8PA 1U8KA 1XSJA 2WTPA 4H8VA 1B2WH 1JUFA 3GDCA 3H7BA 3BSZH 2A73A 4MA8H 3W0WD 4PTTA 1J5HA 1AGFA 2XOTA 3PDDA 4FTVE 2XSKA 3EBAA 3F6IA 4TPRL 4KQ3H 4I7ZC 1AIFB 4Y4FA 3OGCB 3NFSH 2WGXA 3L4YA 3RY4A 5DUBA 5HDBB 5E1AA 1CLOH 1K3IA 2Z4TA 4XCYA 1V7MH 2V5MA 4W9LC 2ZUTA 3V4VB 1C5BL 1NOLA 1ORQB 1JI2A 2D3LA 4B95C 2IQAA 3CHRA 4IYKA 1IFHH 4G6AC 3SPVA 4Y2DA 4M6MH 5HGDB 4OI7A 2IBBA 2V17L 3PWNA 4X8GA 4YFLF 4XRCB 1A6VH 3MAWA 3CH8A 4KVPA 3QIUD 5FM5O 4EN3B 2EVFA 4ACPA 2VMCA 4LHUA 3GSNH 1B0GA 1G9NC 1W15A 5CJOH 4JPSA 3JWNC 3VFWB 4KTEH 4TQPA 3L5XH 1IAOB 4G7YL 3FUNA 5SWSD 4P23C 5KVGH 4NJAH 4TUJA 3A3YB 4LASH 2YKLH 4HKXA 4OLYL 1OAXL 3ROLA 3V4PL 1NUFA 2YPLB 3QJRB 3V9EA 5IY5B 3MROA 3KR3H 3NJLA 4X9GA 4QD2E 3CNKA 2ISDA 3WO4B 2BP8B 1L6XA 3ARDC 3PV6B 4F91B 1IBGL 1N6QH 5IQ9A 4ZUVB 5HPMB 1XR9B 5GSVA 3IWVA 3H3PL 1H5BA 1OCWH 3II3A 3ULSB 3S8FB 4CVXB 2HKHL 4XXDB 3MLVL 3LD8B 4Z0XB 3NDZE 4JRLA 4GI9A 4U1HB 5DJDA 4C55A 3ATAA 3IFNL 2J55A 4TLSA 2APFA 2NY3D 1RP8A 4N86A 4Z7UF 2YMXL 3QWOB 1WFTA 1PZ2A 3AWFA 3ML8A 2W65A 5E00A 3EADA 1BLNB 5JXEA 1ONQB 1V8HA 2DB8A 2MHAA 43C9A 2ZUQB 1FV1A 5D93B 4HC1H 5FA4B 3RWGB 3U4BL 2IG2H 1A6TA 2C4FT 1KYFA 2RQ8A 1KBBA 5FW8A 2FIKB 3I50L 2EH7H 5JYLA 2J5WA 2ZAGA 1P7BA 3DUSB 4KOCA 4LVHC 5JHAA 2MNJB 2ADGA 4LCIL 4FQCL 1XCTA 3H53A 2QLVB 3DGGB 4RNRB 2NUPB 4PJBF 5J06A 4Y4HB 3MCLH 3MA7B 3L9YA 3QHZL 3B1UA 4J3VA 3MRJB 4IW4C 3GMRB 3FW6A 2YQ3A 1RHHB 4U1JB 1OM9A 4YIQB 5KYUA 4O58H 1JE6A 4FFVD 5C3IA 2CWRA 4UT7H 3HUJF 1Z9LA 2MPAL 5DU7A 2R83A 1OV8A 3ARFB 3CZJA 3L3IA 3RFZB 5FM8A 1P5UB 4Z77A 1EX0A 4NZFA 1IBDA 3C9NA 3O9WA 4UUJB 2W94A 4KPHH 5D1XA 2BH0A 1KIQB 1WWCA 2FNBA 3I75A 4DERA 1NLDH 3UJJL 2VDNH 1EAQA 4X9YA 1FE8H 4Z76B 3QRFM 1SJEA 2DD8L 3CXDL 5D1XE 35C8L 3ULAB 4OZ4A 3VQLA 4KTGA 4M93C 2VZ1A 3S48A 4PJ7B 2DRUA 1VENA 1CGSH 4RIRA 1T20A 3UTTD 2XN9D 3WE1A 3O3DB 4NBZB 4QHUA 4FNRA 3UG4A 2ZKMX 3UC2A 2Q10A 1B0WA 3FO0L 1I7TA 25C8L 3OKDB 4MJ6B 4LHQB 1KCSH 4BQCA 4NCC1 2KLSA 3MLYL 3H6JA 1I7ZB 4IOSD 4BXVA 2XCMC 2WLZA 3FSOA 1I1AD 2VGLM 3FUFA 5IJVA 3K6NA 2Y6SC 4FLOA 1ROWA 3WJJC 4ZQKA 2VSCA 4PJAF 1KJVA 4R4ND 4JNXA 1HH9B 2VLMD 5IR1A 1LTXA 5LGKA 3O0RH 1JP5A 3GXFA 3Q1SH 3QJSB 5KBMA 4DAGL 1I4FA 3EYSL 2VLRA 3NRQA 3US1A 5MI0B 2HX8A 1Z3GH 2H6UA 2YFOA 4RGMC 1JWMA 4PYHA 5IBTH 1OD7A 4CC1A 3FT3B 4FJYA 5LGHL 3KLAA 2VLRE 4HZ1A 4IMLA 5IOPB 1VB9A 5I1DA 1ILSA 1DUZB 3LY6A 3LZQA 4KKBD 3NZSA 3QZWG 1IBBA 2XA8L 4TNEA 4ZFZA 3RE0A 4A68A 1KGIA 2JLPA 4FJ6A 3WFCH 3ZL4L 3AG1B 4FQXB 1J05A 4NS0A 3K2UL 1MFDH 5I18H 3X11B 3I2CH 2XPZA 1GS6X 1FNSH 1UACL 1VGEL 2AABL 4DP7X 3IFLL 5IW1B 5BMFL 2CO6B 3HR5B 4QY8B 1FZOB 3IXTB 4M4RA 3ZTNL 4ODHL 3O3AB 3HRZB 4P59L 5DXWA 2B5IC 2V8LA 3ZLQC 2WZPD 1BVOA 4XTRC 4HUNB 5AVQB 4KHXH 1LDSA 2G9KA 2PXYA 2IDCA 4DEPB 5IHZA 4WKZB 5TDPA 4PP2B 3WEXA 3O4LA 3MBEC 4PRHB 1ULVA 3M1BB 2SEBA 1RIVH 3GZPA 1M05B 2R1YB 4U1NA 1NAMH 5DFAA 5BOJA 1X7QA 5KZCB 4M1GL 4XO9A 3VFOA 3O4LE 5CU5A 2R1WB 5D9SB 2KL6A 4YHLL 1NJ9A 1Q0YL 1KV3A 3QORC 1A6AB 3GS7A 3UPCA 4Z7WF 2BIOA 1XVSA 3VX0A 2FR4A 3NZ8A 1JERA 3D9AL 1DQJB 1EUTA 3U46B 2EVHA 1M42A 1MWAL 2HVJB 4NCDA 4C47A 1OGAD 4HJGB 5HDQL 4P9HC 1U8IA 3V52H 5DFWH 1AJ7H 1EA9C 3O2WL 3QA3B 2X40A 4LPYA 3RTQB 2YZ1A 4MRBA 3WUZA 1MWOA 4GW1A 3GI8L 3L3DA 4W6WB 4FDWA 3VD9A 1NCAL 3MNZA 3QUXC 4NYLA 4EOWH 4EJ1C 2AQPA 2F1BA 3I6KB 3GIZL 3EYOA 1RLWA 1OM3L 1HZHL 2Q0ZX 3FH5A 3TF4A 4ZG1A 4R0LB 4PD4K 3HE7D 3OJMB 5TDNA 5C0CA 2WQRA 1S2EA 4NO0B 1OEZW 4M9PA 4DF9A 5LBSH 1EJ8A 5C0RH 4Y9EA 1BIHA 1XGQA 4HUUB 5C0CE 5JPMA 1OWRM 2F19H 2R0KL 2DQ6A 2CKBL 4PRDB 4XBMA 3VFRB 4LSTH 1VFOA 3VFVA 3BVXA 3BQUD 3HLAB 2C8NA 3VG0H 2Z7WA 3HG1B 3UP6A 1YN6B 2ZKXA 3V0FA 2N56A 3U0TA 4HPYL 4LU5H 5KYWA 5H37H 2Y2TA 1U36A 2NY5C 3GMQA 3KL5A 3NABL 5DQ9B 2G0LA 3QIWD 3T0WA 3TBWA 2XZZA 1G6RH 1MEXH 3WS3B 4HJ0D 3ZQ9A 4X7DC 2ZYRA 5DVLA 5G4OA 3UBGA 2R29A 5IIEB 1P4BL 3FL7A 4BRVA 4M7JL 5AD0B 2TRYA 1WAEA 4JRFA 1I8LA 3BJLA 1QKZL 2VAAB 5EBLA 5C97A 1DQLL 2BVEA 1EO5A 4UT9H 1SHWA 2FZ3A 3TGXA 3ESUF 1QSFB 4JPVH 1RERA 1BM7A 3QZWB 5AW8B 3RPIB 1UD4A 3C12A 1IL1B 1IBHA 2F8IA 1JHTA 3STLA 3ETBJ 1KWKA 1MRCH 1Z5LB 1TZIB 4U1KB 3OJDA 1NICA 4QWWD 4XPFL 3DMMA 4JKLA 3RWFB 4TNVF 4PB0L 1W8EA 5JPNA 2VW4A 1QR4A 4ZBJA 1U8NA 4L4JA 4XH2A 4NUJB 3BWAB 2H2PC 1GGTA 2H2SD 3JV6A 4FCHA 3L7FA 2E7MA 2WXNA 2JTDA 4HSCX 4PWJA 2KUTA 2XG5B 1YEGH 5KSBF 2YSSA 4HS3A 1DBJL 1FH2A 4YHOH 2VDPB 2QV4A 1EJOH 3P3SA 5T1LA 1EXUB 1RK7A 4LKCA 1NCWH 3NRPA 3BH4A 3TN0D 2DYPB 2I9LA 3T77A 4KK6D 1OSZB 1S5HB 1ZVYA 4PRAA 1R3KA 1S9VA 3OXRB 5BZDB 2MQ0A 1VPOL 5DA4A 2EYTA 3BD5A 4LO9A 4NNYA 3WMPA 2VLJD 4PJIB 3LS5L 3I9GH 3ZUCA 4ZW3A 3DYOA 2C9PA 4H5SB 2WQXA 4Z7OF 2DJUA 2EDNA 3FQNA 2W92A 4JUTA 3UCQA 4A6YH 3PY9A 4OJDH 1G1KA 3EFOA 3KAAA 2V2XB 4GQZA 5GHWL 3V0VA 5GS1A 5HHVH 4YEEA 4D9LL 1UATA 3CDZB 3D4ZA 3JWNE 4YK4B 2CPUA 5E4EC 4GFXA 4JFFD 5DZAA 5AW7B 3O3UN 4F7CB 1AOZA 1CF1A 5DUMH 4ZAKA 5I30H 1RUPH 2WLMA 2PPEA 2YAQA 5DD1L 5HGAA 3V4VL 3CFJB 2DDQH 5IMLB 3QPXL 4MJ5A 3C5SB 2QQNH 5BV7C 2NTFA 1N5YH 4XAWL 4WFGD 1XB3A 4L5FL 2GJ6B 1QYGH 5DO2D 2PP7A 3FN0L 1G4RA 4PCSA 4IGBC 4G8FB 4MDIB 2X9YA 3LPWA 3PCYA 3NGBC 4NQVB 3L4VA 4LLMB 3SJVD 5DMKB 5HDRA 1X6NA 1FAIL 1H6UA 4LLVA 1NBZB 2OPCA 3KW7A 3HFMH 2F15A 2Z6FA 4W6XB 4UYQA 3HBPA 5E4OA 1E9OB 1MFEL 2HN7A 2CR6A 4Z7QF 4UOW1 3TJEL 3BDXA 1LJMA 1NDMA 3BH8B 3VI4B 5F89B 4ZDHB 2F53B 4OD3L 2AVFA 1CURA 2C3XA 4XNYL 1BVKB 2Y06H 1YEDB 3WV0A 2HH0L 1IKNC 2E9IA 4JFDA 1JZ4A 1EAOA 4W9DC 3VFMB 4AL8L 4G9DA 1D5XB 4XPGH 4JFDE 1RUAL 4JS7A 5DZLA 2NQ3A 3RGVD 3KNBB 2EACA 4GMTH 5EHFA 3FN9A 1QACA 4HOXA 2FJGA 1UUNA 2H3NB 1HL4A 3QEQB 3K2KA 2G0KA 2HFFA 4FABH 1MJ7L 5D5MF 3MI6A 4Z7IA 5FCSH 2VDRB 2NR6C 1U8CB 3C6SA 1P1ZA 1C08B 2WB7A 3PQYA 3QXDA 3OF6A 5I74C 2VN3A 5EFIB 4MMXB 2CXKA 3PQYE 1ANUA 4U1SB 5FX3A 1UH2A 1V5JA 2YPVH 1CDIA 1L7IH 3CU1A 3CXFA 3ETTA 4N90E 2CHWA 3IVKA 3BP7B 4IIZA 5SX4I 3GXIA 2IAND 3AS3A 4HUVB 1O6VA 2JJUA 3INUH 5C9KA 1NL0H 2Z1PA 3BW9B 3S5ZA 3AM8C 1MOEA 3IU4H 1KJMB 1D5RA 5DGQA 2NY0D 5CSZB 3FPYA 5FYKE 5A40E 1OHQA 1SEBA 3OWEA 2D3JA 2BVOB 2FRGP 4QLRA 1TTUA 3IDIB 1CFSB 3OXSA 4OCNC 4UDTA 4JY4B 5C9JB 1IGJA 2FLRT 5IB2B 2TSBA 3LEYH 2IVFC 2AV7B 4ZX6A 3RKDC 3RUGB 3J8F7 4X4MA 2IWGA 3U6RA 3NG5A 3CPUA 5D8JH 5CS7A 4FG6C 2JKNA 2WINA 4R2GB 4X4ME 1X9UA 2OJEA 4OCRL 5FECA 4L8BB 4NC2B 4LPUA 3N06B 2X70B 1U8QA 2B15A 4P57A 1XDTT 2ED9A 4MQ7B 4FNQA 3DSFL 1NCNA 1ZD6A 2CG9X 4ORGA 3RX8A 3U1PA 1UVQB 1WBXB 3OVUB 4WY7H 1JCVA 2IGTA 3HTLX 4XMZA 3TT3H 5C0AA 3VXQB 1PTZA 4EEEA 1KTCA 3P73A 2JCCF 5LAXB 2B0SH 3MNVB 5IEKB 1K9TA 1ZSDB 5C0AE 4RH4A 2ZCHH 3TWYA 3MKKA 1MI5D 3M1CA 4LEXH 1JGUL 4Q58C 3DROA 5HI4C 4OLWL 3LKNB 1PAMA 1ZHBB 3MBEA 1AAJA 2DYRB 1M4KA 3PHSA 5AAWC 1I9RH 3KJ6H 3FN3A 1N8ZA 4FCAA 3UABA 5KVEE 3SYPA 2HJKA 1OGSA 4PGCA 1LGVA 5I6NA 1NMCB 1BMZA 3X2QB 3QORA 3PXHA 4LCCC 2WWKT 3UAJC 1KENL 5AKSA 3WY4A 2A38A 4YZFE 5A7EA 1XCQA 2R15A 2BSED 4HH8A 4RETB 3VO0A 5F7UA 1FSKB 5LQBH 5MENB 4I1PA 1KULA 2PCPB 3G3LA 1QNZH 1UWFA 4XE0A 4FQLH 1MDAA 3ETSA 1CLYH 4R96A 5T5FL 2QTVA 4N1HB 4OKDA 1DEEA 4WJ5B 4J12A 1BZQK 4WDIA 2CDGA 3O6KL 5ESAA 3RHWF 2UVEA 3TO4D 2VLLB 3S97C 3LHAA 1HI6A 2V7NB 3H42L 4GRLB 5EU3A 1D7DA 5I1KH 4HH9A 3L81A 3CFCH 4S10A 1IV8A 4I77L 2D7PA 2EZ0C 1WA2X 1FO0H 1H3XA 4G5AA 4NI6A 3LVEA 3KPNB 4L1LA 1HHJA 2VRKA 3LQAC 4YXLL 5I6LA 2AEQL 3EJPA 3ULUD 3MR9B 2XN9B 4P5TC 4F8PA 3SKUD 4X7TB 4OGXH 4PJ9C 4DKTA 4AI7A 4JCMA 4P46B 1BZOA 2XKUA 4E9TA 5MEQB 5DHYB 3D87B 4AKQA 3FULA 2NY6C 4M8RA 3GGWB 2JIXA 4NWTH 3ZYJA 4YX2L 3RJQB 1QQDB 3BVWA 3L3JB 1I1AB 5FWRA 4N2NA 1CYXA 4WCYL 1JGLL 4ZS6C 2BJMH 3WKMH 2WLJA 2EYSB 4BWTA 2AMUA 3CFDA 2DQTH 5GGSA 3TVMC 4LQ1A 1FVEA 2AV1B 2WTOA 1X5KA 4NO5A 5EIIA 3QDMB 1GIGL 3H9YA 1JXGA 5LNEA 4XO3A 2OL3A 4FFYL 4DCQB 1WVZA 4K8RL 4QAWA 4LCWA 4WHYH 1H6TA 2X44D 2C3HA 4XB7A 2OX5A 4WNSA 3HG5A 2J12B 4NCC2 3V6ZB 4LCWE 3L3KB 3UTZB 3OAUL 1IGYB 3BZDA 3JVGA 2G2NA 2DYSB 4X7CC 3QEHB 1DFBH 1A9BB 5ABZA 3O6MH 1M1SA 4G1EB 4POZC 2AC0A 2V2WA 5I6OA 5IHHA 1L9OA 4N2BA 4YHKH 2BLFA 3KGRA 43CAA 2BSBA 1WQVT 1XR8A 4J2XA 3P0GB 3BIAX 4JHZA 4EAEA 5JOPD 2DTML 5C0ND 5I5RA 3TTYA 2G3NA 5EUKA 1OB0A 1OHZA 4K3DH 2B20A 1RP9A 4Z3HA 3OLIA 1H8LA 3BKML 1A8JH 2ZP9A 3CSYB 2D03L 2Y23A 1CDCA 1X5IA 4X8XA 2VR4A 3KHOA 1NIFA 4X2UA 4KRNA 5FYJU 4NP4H 2R0ZH 2VN4A 4YAQB 3MXVL 3TBYB 5KYXB 4I0PB 3LOWA 4OW6A 3SOBL 1KLUA 1E8ZA 2C9SA 2AJVH 3Q01A 1FIGL 1M7IA 4GAFB 4P2RD 4M6NL 2FSDA 4RAHA 1DVYA 3G7TA 4AK2A 5JA9A 1HINH 2WIMA 1XGTA 4EO5A 1MFAH 2VXTL 1OGAB 1Q9LB 4KK5C 3BIKB 4NBYB 3CH1B 2RGSA 4PJCB 4I0CC 3S35L 1VDGA 3CVBA 4B9PA 2YGQA 4L8CB 1S9XA 2E5EA 1B6DA 2FX7L 1R3LB 2YMTA 4I18B 2CM5A 1TKWA 4DPRA 2ADIB 4YE0A 4LHJB 3RYMA 3ZMRA 1LD9A 1PEZA 1Z9SB 1QI4A 2VXUL 5KANG 2XBDA 1MLCB 5ISZD 3Q7JA 1IEAA 3HE7B 1CFVH 2VDPL 4J6RL 5CD3A 5C0DA 5I0VA 1OAUL 4YDVA 4GBXB 2COVD 3R7QA 5CEZD 1S7SA 3B3BA 4ZPVA 2CJ3A 5TGBB 3EO9L 2BP3A 1N0XH 1OT2A 3I6GB 5IROA 1SGKA 5CBEB 2D0GA 1UKTA 4JG0L 3G5XA 2ORBH 3KPMA 4H8WL 3IJYB 3QZBA 4KJYB 3CQFA 1RVFH 4ADJA 3A6BL 2Z93A 2FLBT 3BVNB 3WFBH 4JO2L 1IZJA 1H0DA 1QLRB 2XPGA 1M3IA 4HXBH 2AJSL 2BP0B 3O45B 4LAQL 4QKTA 5DFVC 3EF7A 5J6HA 1EHLL 4JE4B 3HHRB 3QDJD 4BFRA 5DMGD 1U33A 2VMDA 3WTSA 5D1QC 4J2QA 5FYLE 2V5SA 2VW7A 5KEZA 3T4YA 1OTTD 1J0IA 5IB4A 2CK0H 3TFBA 1JZFA 3BVVA 2H1PL 5L4MA 2KZ1B 5J11B 4F7KA 1U6AH 4XWOC 1KTLA 1SOKA 3A4DA 2GHZA 1BZEA 4C4BA 1WIOA 2JNZA 3DNKA 3N44F 3QUZC 3GK8H 3GYRA 3AXHA 2ZXWB 3UPRA 4HALA 3HHSA 3LXCA 3V5DB 3HC3L 4G6AD 1BZ9A 3W39A 1LXMA 2FVNA 3MNMA 5IB5B 1NGWA 2E6PA 2PABA 2W0FA 2CDFA 4D9RE 1NTDA 1IAMA 3HE6C 3L9EA 2IGFL 2NR6A 4TULH 2DWDB 2KQMA 4A2DA 3GUTB 1QFUH 1WT5C 4B5EA 3FCTB 4DOHE 1NCJA 3BZ4B 3L3HB 3OZKA 5KBDA 3JUYA 4P23D 1CGUA 5B1JC 2ROYA 4W81A 4MA3A 1QI5A 4FQHB 1FL6B 1W72B 1GS7A 4PGDA 4C56B 5EBMB 5IMMA 2FQEA 5GS3A 4QRRD 3NN8A 1TTGA 1KLFA 3ARDD 4OU3A 2NZIA 1RJZB 2XN0A 1HQ4B 2JI2A 1NM4A 2BRRH 1UOLA 4WW2F 2R0LH 5FW7A 3RZCC 2X7LA 3BRGC 1HEJC 1UASA 4GB9A 3RWJB 1ZT7A 1HU8A 4O9HH 5IMOB 4G5ZH 2VDRL 1CB4A 4KXBA 3J07A 2A2QT 5FYJH 3RWIA 2ZCKL 2IAMA 2WYHA 5DC9B 5FDYA 2ATKB 1QLEH 1JWUB 3DURA 4LDCA 3HPJA 5LGJA 1NFAA 3IGKA 2Q2EB 4G9FD 2I9TB 1TPXB 4Y7OC 1Y7VA 1XIWC 3VFUA 4Y9GA 5FOBA 4HPOL 4XNQA 1MFVA 4NKOA 1JRHH 4O4YL 5KANI 1KB5B 2ZXBA 3E0GA 2Z31A 4Z3GA 1SOSA 5F9WB 4OQ1A 4JM2C 4LGPB 4PRPD 3O2VL 1KPRA 1H9VA 2EP6A 3NK4A 4JFQA 4IU3A 4PJXA 1S7VB 5I1HL 4TPRH 4UQ3A 2FJHB 2C1PA 4PJXE 4U3SA 4X98B 3EGXA 3NA9L 2I07A 4M1CD 1IVTA 1C5BH 4Y19D 3RWCA 4OSUL 2PP8A 3HC0B 5TE7L 4FTVB 1OLLA 4XNBA 1QUNB 3OKKB 4FD0A 4G7VL 2V17H 1CCZA 3AVEA 3ALPA 4PBVC 2ZWKA 3V5KB 1AD9A 4OCMC 1LLAA 3NSXA 5AAWA 5F1SA 4HMEA 2EADA 2PW1A 4PY8J 5DUBB 1BG9A 5E1AB 4G7YH 4XZUA 5HI3C 1KELL 2MPVA 4LCCA 4X7EC 4G71B 3RGVB 3UAJA 2OQJB 4OLYH 2IQAB 5J8OA 1OAXH 1RUML 4OFYA 2YBRA 3V4PH 5CN3A 3LRGA 1UQSB 4OGQC 5SWSA 3SPVB 1JCKA 1VCBC 3F04A 4LNRA 1CF8L 2QSCL 3VD2A 1IBGH 1ND0A 5KJ4A 1VZHA 4EXPX 3FSVA 4LP5A 1T89C 1OP9A 2Z0BA 1B0GB 3KPTA 4YHNA 3KWTA 3H3PH 1S7WA 3D39A 5CZVL 3D4CA 4M61A 3TCLA 2HKHH 3KG5A 4YC2C 3MLVH 4BV1A 4TUJB 2ZXQA 2JB6B 3D39E 3IFNH 4HKXB 4FA7B 2GJZB 4S0TD 1T1XA 4MJIA 2W59A 4GRMA 3UZQA 1NGXA 2DLTA 2YMXH 3MROB 2IANB 1A9VA 1E7VA 4MJIE 4QHLA 5IQ9B 4I87A 2N3JA 5GSVB 3T1WA 3EOYG 3U4BH 5DA0B 1H5BB 4PJ9A 4GSDH 4OIAA 2VL5A 2B1AL 1CS6A 3I50H 5IG7A 1G7MA 4F20A 1T7XA 1TSHA 5EO1B 1G5AA 4MRCA 2GKIA 4LCIH 4FQCH 2B16A 5GJSL 3VD1A 1KMGA 4OUOA 5FWQA 3ZR6A 1MH5B 3OLGA 4PJDB 1CXLA 3D09A 5EU6D 2YAFA 2MFNA 3QHZH 1CIUA 2MHAB 43C9B 3VMOA 5IW3A 4BRJA 4XTRD 3ZMNA 2Z7ZA 2QLYA 1K4CB 1A6TB 4NQDD 5CLXA 1I3UA 2WM0A 3MOBL 1JAEA 2IEPA 2E76C 3GS0A 3D0VA 4Y1AA 3MHZA 2NMSA 2ADGB 3VAEA 2JKJA 2MPAH 1XCTB 5EZOL 3AQDA 4MDJA 1FYTA 5DURB 2KDGA 5EWIL 4Y1AE 5KS9F 1QNIA 3ZQWA 4J5VA 1LDPL 4FKEA 3G6AB 1AP2A 3L9BA 2HFTA 1FYTE 3UJJH 1VCAA 3I9AA 1JK8A 1TVBA 2DD8H 5IJKA 35C8H 5KYUB 3ZKQD 5ECJE 4Y5VC 3ZZSA 3HI5L 3C87A 3R4DA 1ZLEA 4DUXA 5I75B 2VDLB 3I9IA 3QUXD 5GGRA 2VQ1B 3U1QA 3FO0H 4NENA 25C8H 4NZTL 3O8XD 3C9NB 3O9WB 3MLYH 4N5ED 1R3IL 5D1XB 4I3GA 1OPGL 4N24A 5I28A 3I75B 2G75A 4DTGL 1RURL 3WNLA 1LNUB 2PTTA 3QISA 4LPXA 2P8LA 3PHQB 3SBWC 1NM9A 4BZ2A 4OFIA 4OZ4B 1IBFA 1BFVL 2BC4B 3BPLC 3V0GA 1VFBA 2V5YA 3B5TA 4LP8A 4RIRB 4DAGH 4RBPK 4M29A 2EDYA 2VIRA 4OZHA 3EYSH 3NJHA 4GLRI 4ZS7L 2YAMA 2HKFL 2YR3A 2AK1L 4MAYC 4W9ZA 1VFMA 3HLKA 4XODA 5LGHH 1WAPA 4OZHE 3STZA 1CICD 5CR1A 3MXWL 4I5BA 2BSDA 4NP9A 4HWBA 4UF7C 1A7QL 1Z66A 1AHWA 3TO4B 1DBML 2CNYA 1J1OL 2XA8H 3VXMA 5IJVB 2YQBA 3W81A 1F00I 3LQZB 4WHTA 3ZL4H 2QPDB 3RP1A 3GHPA 4IRJC 2QPUA 3K2UH 1KXVC 3VXME 1I4FB 3DA0A 3CSBA 5C0JA 1UACH 1VGEH 2M8XA 2VLRB 1Z9MA 3IFLH 5BMFH 3N0AA 5ESQA 3P4MA 4X4KA 2IH1A 3Q0HA 3REWB 1JWMB 3EYQC 3ZTNH 4ODHH 2DMGA 5KYYA 4P59H 3KM2A 3SD5A 3KLAB 1WDAA 1J0YA 4HMCA 4IMLB 4L0ZA 3UPAA 2ZUWA 4JQIA 4TN9A 3V2AR 4ZFZB 2HA1A 2NY4D 1EUUA 4PJBA 3PL6A 2CRMA 1JN6A 1J05B 5CO1A 1R6VA 4M1GH 1F4YL 4PJBE 4YHLH 5I76A 3F83A 3NZHL 4DKFL 1Q0YH 2Y2WA 3MO1B 5DRWA 1PW3A 2PYED 3D9AH 3DSNB 4ENEC 1MWAH 4F15C 5HDQH 2HPOA 4NZRH 1JVLA 2H2PD 3NCJL 1YNTF 2QFRA 2UUDK 3HUJA 2PXYB 3LV3B 1BEXA 3O2WH 3BCFA 1DR9A 4L3CA 3WEXB 2P45B 3O4LB 2OXHA 3DX4A 3L16A 5DD6A 4JDZA 1MHHA 2P5EB 4ZTEA 2CZNA 2SEBB 4U1NB 5AZEL 4B41A 4UV4L 3GI8H 3HUJE 5AL0A 4EBQL 1GSKA 3GPEA 1NCAH 3LYRA 3VNYA 2V5TA 3GIZH 1OM3H 1HZHH 3T6WA 1DP0A 2QSQA 3NZ8B 3C5XA 1DQVA 5T5NF 4XC1L 3KLHC 1F58L 4WI0A 4CNIA 1U8IB 5T3XD 3IMWA 4QCIA 4UM8B 5JQIB 2GEQA 1Z1WA 5HHOD 3QNXA 2R0KH 4M62L 1BDYA 2CKBH 4GW1B 1J87A 4Q6YA 2ZJSL 4Z3TA 1WT5A 4GUCA 4DETA 2GHWB 2M1KA 4KKCC 2VZVA 3RU8L 3JWNG 5F0JB 2X3AA 3IE9A 1ACXA 2J43A 5ESVA 5B1JA 4U0RB 4HPYH 4KZCA 3RI5F 4PJAA 1CDYA 4WVRA 4Y2NA 4YSTA 4RDQG 3L4XA 5A3ID 3SYQA 1JFHA 1OZUA 1T0MA 4OUUB 4I2XA 3NABH 5TDNB 5DHVH 4U1GB 3PP3K 4GO9A 5E4AA 3MBWA 4PJAE 3T0EB 3DVGB 4DP8X 3CDGB 3PU7A 1XGQB 2YC1A 3MJ6A 4I2XE 2BMKB 2CLVA 3VFVB 5F0LB 1P4BH 1UHVA 4RVBA 3AS0A 3RZCA 4M7JH 5B8CA 4R7DA 1MN4A 3NOIA 4IGBD 1QKZH 1DQLH 4J4PD 4XVSL 2Q2LA 1H3TA 5K9KA 4P2YA 3SDAA 3GMQB 4I9WE 2D7TL 4ODWA 3TBWB 1NGYB 5CWSA 2NZ9C 5ISZB 4WAFA 5G4NA 4OGZA 1W72L 1XIWA 5HYIA 4JJOA 1HL9A 3PWJB 1BBJA 2ADFL 4XPFH 4GPVA 1JNHA 5C0FA 1T83C 1NPNA 3VNZA 4PB0H 1TZOA 2DQDL 2PWHA 1MCJA 3F5WB 4JM2A 4Y16C 1HIMH 1YEEL 4FERA 4GEJA 5F7NC 2XACC 5IUSA 2XY2A 2I60L 5C3TA 1NQBA 4YBQC 1FF5A 2Q86A 3R7RA 1JHTB 1L0YA 4NDMA 1DBJH 2B3IA 2XWEA 1PZ5A 3EYFA 4LP4A 3HZKB 4Z7WA 2PF6A 5DSCA 1UD6A 3DV6B 3OJDB 3T3PB 1CZ8L 3DMMB 4G6FD 4LT7A 2XWCA 4JPQA 4RGNE 2A74C 2AP2A 3EGSA 4KO7A 4Z7WE 4M02A 5GZNC 1CE6B 4YDLC 1RL1A 3TN0A 1U8NB 3VFGL 2NX5A 1J1PL 4XH2B 4POYA 1VPOH 1BCIA 3EO1A 3IGUA 4IEFA 1MVFA 2M2DA 3HJEA 4DPBX 1KB5L 4NQED 2NX5E 4IHOA 3LS5H 5GRXG 1SZNA 4HS3B 3ZL1A 3U36A 4FLHA 4KJQC 4OF8A 1Z5HA 2LAAA 2CALA 1R5IA 5F1OB 4LKCB 2XFXA 4IQHA 4EDWL 1QFPA 5GHWH 4DP4X 3HZMA 3T77B 4D9LH 2F8XC 3B9KC 2MQ3A 4PRAB 1R3KB 1LK3L 2FH8A 2QVIA 4EDXA 5C0EA 2EYTB 4KK9C 4B3VA 4ETQB 3V4VH 1SOQA 3IJSA 5DD1H 5D2LA 1N64L 3QPXH 3MRHB 1UOKA 4JFFA 4XAWH 2IADA 1FN4B 3EH1A 2XI9A 4L5FH 1Q90A 3FQNB 4XWGL 2OJZL 4V1DA 2IALA 3EFOB 5D2LE 4UU9A 3FN0H 2E27L 4JFFE 3X12A 3CPLB 3LX9A 4N9GA 4V1DE 5DS8A 2PPFA 1G9EA 1J0ZA 3KPRD 3PGDA 5I1CL 4FG6D 2CPCA 1FAIH 2A1WL 4ZAKB 5B1CA 4BFEA 4Q9QL 5C08A 4QRRB 5GGRY 3NCMA 4MJ5B 3F2LA 1MFEH 2NTFB 4URTB 3TJEH 4ZUTA 4ZXBC 2ODHA 5C08E 3RBGA 1BZDA 2FGZA 2Q5BA 4OF0A 4OD3H 4AMKL 1N4XL 3B7SA 3QR0A 4XNYH 1BAFL 2MKWA 1CU4L 4NPJA 2DI7A 2HH0H 3MJ8A 3OHMB 5GZOC 4IRSD 2FHFA 4ZMOA 1OSPL 2R4RL 3GBNL 1YCSA 2OR8A 4LLVB 4AL8H 1HHIA 1A1MA 3ABGA 3DUHA 4NC1C 5FPIA 1RUAH 3E9TA 4G9FB 1PJWA 4FHKA 1U95B 5MEOA 5GPRA 2HN7B 4FLRA 2UX6A 1PJ9A 2VERN 5DZPA 3FOLA 1KCWA 1RJCA 2PO6D 3CZLA 2F58L 3IDYC 2ZKWA 4FMFA 1SJHA 4LVHB 4PRPB 4CKVX 5KSBA 3NIFE 4JFDB 3K81A 3KJ4C 2MEJB 3UBHA 2K4WA 5KSBE 3D12B 2HLAA 3DOSA 5H4ZA 1NBVL 2BNQA 4XZ4A 2PN5A 2Z65C 1ETZA 3SKNA 2YXVA 1BFOA 1XQ4A 2OMYB 2Z4QA 3PNWB 4JJ5A 5FO7A 4EZLA 4RZCA 4DWHA 2HFFB 3ASOB 2BNQE 2QKIA 2CHXA 4AM0B 1X5XA 4LCVA 4NEHB 4Y5VA 1E28B 1W8NA 3CFMA 3PQYB 4X5QA 3QXDB 2L04A 3WL9A 3CVHA 4PRBB 5I1GL 5JOFB 1V54B 3FQWA 2ZYHA 2ICEC 2H7WA 1H8NA 1CWVA 1KG0B 4K5MA 3QH3A 4G80A 3UGEA 1EXGA 2OMVA 1J5CA 5BRPA 1IVLA 7TAAA 4D8PA 2EZ0D 1DJYA 3MYZA 1QHQA 3E1F1 3RWDB 4AT6A 3F8UB 1RUQL 1AD0A 3G9VA 1EAPB 2A6DB 3HI1A 1W2KT 4JEGB 4L8DA 4M93B 2Y0SA 1F13A 1OB1B 4RBPH 5TF1L 5IVZB 5KSAC 4P5TD 4PJFF 1Y0LA 3HAEG 4PRID 1F11A 1VIWA 2AAAA 2VRQA 1SEBB 3U1SL 4FA6A 1MCSA 2GAZA 2NY6D 3Q48A 3FUIA 1YC7A 4UDTB 3OXSB 4JO1L 3DSFH 3V0IA 2VDLL 3O41A 1OO2A 1SMDA 4RMVA 4KXCA 4TNWK 4KRPD 3U6RB 1E50A 5D7IF 1F2QA 1QWUA 2KERA 3TVMD 1KXVA 1NCUA 3MA9L 4L9LA 3HNTL 5CGBA 5ETUA 5JDSB 2WINB 1R5WA 2CO2A 6PCYA 5EIIG 1ILUA 3R18A 4RGMB 5DK0A 3WTXA 1N7ML 4Z7QE 3TWCL 2GTQA 3ZTJG 1U8QB 4MNHA 1UXMA 1OP5K 4P57B 1NIEA 2QFPA 3T2OA 2YARA 1U8LA 1ZV9A 4ORGB 5EIVA 3S3PA 3BVDB 4OLWH 3ZKNC 1ZE3H 4EQ3A 3QXUA 3L1FA 1KN4L 3PWLB 1ZLVH 5IWLC 5C0AB 2XA3A 1JZDC 5D7JA 3R8BB 4Z23A 1IAII 4K0OA 4ANVA 3P73B 2XPYA 3ILQC 3PHOB 4XBPB 3RRQA 1KENH 4NNXB 4Q4IA 4XNZC 5D5MA 3QUHA 4MFHA 2B5IB 3WBDA 3LDBC 3GSQB 3JUZA 4S1SL 2UUDH 1U4EA 2DM7A 3DROB 5D5ME 4GAYB 5CIPA 2ITCA 4DP6X 3MBEB 2LHAA 2B77A 3ULUL 2FIRT 3U4EA 5T5FH 3GB7A 5D7KD 1DTUA 2CM6A 2HRGA 4MMZC 2VITA 3O6KH 4G8AC 5E6RB 2YS4A 3QORB 4AQEB 1LE5A 3P40A 2YQGA 4EIGB 1B4LA 5HDWA 3B3IB 3H42H 4G8IB 4JN1L 5AOIA 4EIBA 4NRZB 1FGNL 3PXLA 3GRGA 4P4RB 1HCYA 1XCQB 4LVNC 4I77H 2YA0A 2UXGA 1J86A 3T0BA 4BFIB 2EECA 4YXLH 3TBCA 4FG2A 4R96B 2AEQH 3TIEB 5IHUH 4ABWA 1DEEB 3PG2A 3JV0A 3AB0C 3QUXB 4WDIB 2CDGB 3C09C 1I53A 4RLDA 5ESAB 3RVTD 1U42A 2CK2A 2X1OA 4WEUD 5AB2A 5I8EA 4E0RB 4L1TA 4QRPA 4YX2H 5EU3B 2BCMA 5C0GA 4HH9B 4HG4K 1JHLL 2XVLA 3PP3H 2YUZA 2J2ZA 5J9PA 4QRPE 3TIDB 3ZT5A 4WCYH 1JGLH 3AUVA 5CFHA 2Y4SA 3WS6C 1AZCA 2D3NA 2TSAA 2KH2B 3HAEB 4A7SA 1LEIA 3AGVA 4JM4L 3WHE0 2P80A 4FFYH 2DLGA 2OXGB 4K8RH 4Y8DC 1I85A 1CTOA 4AIEA 3SKOA 3SODB 1A5FL 3DHMA 5DVMA 3UC0L 2BSRA 2OMUA 4P48A 5I2IA 4Y7MA 5AVRB 4GIAA 3OAUH 5DFVD 1YY9C 3VH8A 1NANH 2JCCA 3S88L 3VACA 5GGSB 1ZWIB 2WXJA 3U4KA 1FVEB 4ANKA 2DL9A 2AS5M 4ZNEA 5EIIB 2JCCE 3SBQA 5JIPA 5KBNC 3BLPX 3N3EA 2OL3B 3CUPB 1A0QL 2FWSA 2R56L 2DTMH 3EW3B 4QRQA 4ZNEE 1FWXA 4LCWB 1AGDB 3C8KA 5DWUL 5HY9A 3THML 5F3HA 2OX5B 2GFBA 4FI6A 4XWOD 3BKMH 3FO9B 4BZYA 2D03H 2MWCA 3L4WA 5CMAA 3SOTA 4MCMA 1DJIA 3BYTA 3G5YB 4QT5A 2C1OB 2R51A 3HZYA 4U0QB 3MXVH 2WXIA 1JGDA 1KNOB 1M6OA 4U49A 2V2WB 3TPUA 3B34A 3SOBH 4GYBA 2A74A 4M6NH 4MXVF 1GGBL 4FXKC 5EC1A 5H2BB 3SDDA 4TUUA 3MMEA 1QLFA 4Y88A 5ICZB 1CD9B 2VXTH 4Z3IA 2R29L 1AQDA 1F3JA 4OKVA 1LWRA 2I25N 2H47C 5TPWL 3S35H 1I9IL 2P46B 1WFJA 4E42B 2FX7H 3A6OA 4JAMA 1AQMA 5JIMA 5C0BD 4JW3A 5C07A 4FNLL 2X4OA 3W3BA 1KLUB 1T0OA 1GZQA 1U3JA 1AC0A 2VXUH 4IOIA 5C07E 1XGTB 2VDPH 4J6RH 3ZDXF 3ZUNC 4JDVA 3MVSA 1OAUH 4YO0A 3V6OC 3GMMA 5DJX