1TEFA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 and 1.96 resolution, respectively.
rcsb
source organism Spinacia oleracea
molecule tags Photosynthesis
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tefA00
1GYCA 4RH4A 1WAEA 4KNSA 2GI0A 1E5ZA 2PP8A 2BWIA 3FU7A 1AOZA 1NPJA 4E9XA 2I85A 4HCGA 2Y69B 4E9YA 5F7AA 1PLCA 1NICA 2EINB 4HCIA 2FTAA 5I5JA 1WS7A 2HRHA 3ABKB 3QJVB 2IDQA 3UABA 1KYAA 3UAEA 4DP1X 2EIJB 2Q9OA 2VM3A 2VW4A 2QPDB 1ASQA 4G7SB 1WA1X 3FQYA 1YLBB 4M4RB 1NIEA 2UXFA 3CZUB 5TK2A 1F56A 2BP0B 1ETJA 1NZRA 1A4CA 5B1JC 4DPBX 2EIMB 3NP4A 3S8FB 1BAWA 2Q5BA 2ZWNA 3QPKA 3FU9A 6PCYA 1RCYA 2R7EA 2ZOOA 1SDDA 3H4FA 2CCWA 1JZFA 1OCRB 3NJLA 5B7FA 5I6MA 2FQDA 3EH5B 2AZAA 2HX8A 2XV2A 1IUZA 1VLXA 2XXGA 1GS6X 3U25A 1AZUA 2DYSB 1HFUA 1BQRA 1JERA 2FQEA 3UACA 1L9RA 3SQRA 3X1EA 2BW5A 2VN3A 1GS8A 3T6WA 3X1BA 2CJ3A 2IDUA 3IN2A 4AZUA 1XMEB 2CALA 4HALA 2UXVA 1CC3A 3EHBB 1OCZB 1NWPA 1KGYE 2OCCB 2FT7A 4E9QA 3PCYA 1V54B 4NAJA 3S8GB 1J9QA 1ILSA 3UGEA 2MTAA 5A7EA 4YSTA 4F2FA 1AS7A 2XUWA 5I5MA 1RKRA 4UAHA 3V9EA 1GY2A 4A2DA 5I6OA 2BHFA 4PCYA 2YQBA 3NP3A 2XX0A 1W8EA 1JOIA 1NPNA 1J5CA 2BZCA 3FU7B 4AKQA 1SF3A 4FAAB 1B3IA 2J5WA 4F2EA 2J56A 5PCYA 3OD3A 2QT6A 2ZONA 2AFNA 1RZPA 2YAHA 3T6XA 5EHFA 1EZLA 1CURA 5B1JA 2DWTA 1GY1A 4YSRA 4BWUA 3FPXA 1IC0A 4G72B 2IDFA 3NSYA 3TASA 2JFCA 2BZ7A 1UATA 3OMIB 5B7EA 3NSFA 5I6KA 3IN0A 1CYXA 3D12B 3KW8A 4MFHA 2TSBA 2AANA 1NTDA 3BVDB 4BDVA 5AZUA 2BWDA 2PPAA 1TU2A 4ENZA 2R7EB 1SDDB 2HXAA 4FA7B 2GB2A 1PCSA 2A3TA 3ABLB 5B1AB 3T6VA 1NWOA 2YAPA 2IWEA 3FSZA 2Y1AA 3L45A 2HX7A 1E5YA 1ET8A 1JZEA 2FQGA 4ZK8A 4DP9X 4DP0X 1SFDA 4AI7A 1I53A 2GHZA 1PNCA 2IAAC 3FT0A 1DYZA 2XXFA 1CYWA 1ADWA 2IH8A 1AZCA 4A2FA 2AVFA 3TBBA 4DP6X 3DKHA 3T9WA 1BXUA 3C75A 1BEXA 1BXVA 1JZIA 2LLNA 3NJGA 2HX9A 4WKXA 2I7OA 4CSZA 1KBVA 1GS7A 2XU9A 4YVNA 4E9SA 3WI9A 2E86A 4P5SA 1ZIAA 4F7KA 1AG0A 2H3XC 4G70B 1TEFA 5PAZA 1JXFA 3T6ZA 2VSMB 1NINA 1QLEB 3QJRB 2IDTA 3X2QB 4YL4A 3NJIA 7PCYA 3T71A 2YAQA 3ZBMA 2YXWA 3NT0A 1TKWA 1SF5A 1ASOA 5AKRA 4YSSA 5LDUA 2VMJA 9PCYA 3BQVA 1JZHA 1ZDSA 4KNTA 1JZJA 1SNRA 2CUAA 3CVBA 4YSEA 1MG2C 1N68A 2HRGA 1WS8A 2JKWA 3NJJA 2GC7C 1L9QA 3SBQA 1PMYA 1X9RA 4NERA 3AW5A 1OE1A 3WKPA 1QHQA 3HB3B 1R1CA 1V55B 2YAMA 3GDCA 2QDWA 4BDVB 1J5DA 1WA0X 3H56A 1KBWA 3NJHA 4AKPA 3CVCA 3ZX1A 4YSCA 3FYEB 4K9JA 2DYRB 1AQ8A 2WSDA 4KOBA 4GY4A 4A67A 4E9RA 3ABGA 1AIZA 1MDAA 3X1GA 5I28A 1SHXA 3WNIA 3EF4A 4DP5X 1BXAA 8PAZA 4KO9A 4QLWA 2XLLA 3AG3B 2X87A 1OOWA 1OV8A 2BP8A 3MX0B 3PAUA 1BYOA 3IE9A 4A68A 1NIBA 2DV6A 4NB7A 4GP4B 1OE3A 2EIKB 1EHKB 5I6LA 1HAWA 2CAKA 3NJMA 2ZXWB 3NJNA 4Q8BA 1L9OA 3WG7B 3EH4B 1JXDA 2CBPA 4YSQA 4YSUA 4HCFA 2VW6A 1NIDA 1QNIA 2IWKA 4GP8B 3ASNB 1HAUA 1W6LA 2PPFA 4HHGA 2XWZA 3CG8A 1ET7A 4PAZA 4EF3A 1NIFA 1XB3A 3WKQA 7PAZA 3TBCA 4DP8X 2FT8A 3ERXA 1OF0A 2FJSA 2WO3B 1JZGA 4JHUA 5ANHA 1IBZA 4JHVA 2XYBA 2YARA 3RYMA 2UXTA 2YXVA 2DWSA 3G5WA 4Q89A 3NYKA 3NJFA 1WA2X 2VM4A 4YSOA 1KCWA 1M56B 3N55A 5D4JA 3WIAA 4TXVB 1NIAA 1J9SA 2AZUA 2NRDA 2GSMB 4BXVA 3FSAA 1PF3A 4G71B 1ZPUA 2UX6A 4KNUA 1ZDQA 3QJQB 2XVBA 5I5IA 1URIA 2YAFA 4G7RB 4L0PB 5IY5B 2GBAA 1XB8A 2IWFA 3V9CA 1KCBA 2VW7A 1L9PA 1ZIBA 4A2EA 1A4AA 4E9WA 1T5KA 3FQ1A 1ET5A 2N0MA 4CSPA 3X1FA 3ZDWA 5AFAA 1GSKA 1FWXA 3JTBA 3QJTB 2QDVA 3X1NA 3OMNB 1PLAA 2J55A 4YSAA 1PZAA 2X88A 3S3CB 3TA4D 1OE2A 2RACA 1M9WA 2IDSA 4HHWA 4A2GA 4YSDA 1N70A 3SBPA 2H5UA 4E9TA 4P5RA 3S3BB 4A2HA 4JKNA 1ILUA 2W88A 5D4IA 4BK5C 5D4HA 4UF7C 1AAJA 2PP7A 1A3ZA 1E30A 2BP8B 3MBWB 1FFTB 2GC4C 3DIVA 5I26A 4DP7X 5I6NA 2BW4A 3N2JA 3KW7A 2XX1A 4AKOA 2PCFA 2YAEA 3ASOB 3CDZA 1AZRA 3NSDA 2P80D 3FYIB 1IBYA 3PLYA 4DP4X 1KDIA 3QJUB 4GXFA 1MZYA 3OM3B 4N4YB 2J57A 4KO6A 3TU6A 1MG3C 4M3HA 5F7BA 3IEAA 4A66A 2EILB 1AG6A 3H4HA 4W1TA 3PPSA 1NDTA 3UAAA 1GR7A 2W8CA 2BO0A 1SJMA 2PPDA 2XV0A 3GYRA 4YSPA 4HAKA 3EH3B 2FT6A 1J9TA 3FPYA 4GP5B 4KO7A 4W9ZA 2JXMA 3AG1B 3PAZA 3S3DB 1KV7A 5B7MA 1JXGA 2B3IA 2TSAA 2OV0A 2HZHA 3PAVA 3UADA 1OCOB 2FNWA 1A8ZA 3FU8A 1E65A 5B1KA 1PZCA 4HIPA 5FC9A 4X4KA 1W6WA 3AG4B 1GW0A 1OCCB 4WTQA 2GIMA 1AZBA 2H47C 5B1BB 1AZNA 1TEGA 3OMAB 2PPCA 2P80A 1XB6A 3PXLA 3ABMB 1KDJA 4DPAX 3NJKA 5TK4A 4HZ1A 4KOCA 2QPEB 2MRYA 3SBRA 1ZV2A 6PAZA 4BWTA 1ID2A 1BYPA 1BQKA 1A65A 2BP0A 4GYBA 1L9SA 1RZQA 3FSVA 2VSKB 3NSCA 1V10A 4UANA 2IH9A 1CUOA 1X9UA 3IBOA 4YVUA 2UX7A 3FS9A 3QQXA 5I6PA 4DPCX 4DP2X 1BQ5A 1M57B 1SFHA 1JVOA 3FSWA 2PCYA 2B08A 1AACA 3CVDA 1MZZA 1IKOP 3AY2A 2OJ1A 2WO2B 2PP9A 1PAZA 4BXSV 1PY0A 2UXGA 5E9NA 1JVLA 2DY2A 3DTUB 3GXUB 3ZIYA 3FQ2A 3CDZB 2XV3A 2YAOA 1AS6A 4G7QB 1A4BA 2PPEA 3HEIB 2HLEB 1J9RA 1AR1B 1E67A 1ASPA 2PLTA 4AX3A 3AZUA 1AS8A 3QJSB 1SHWA 3OQRA 4E9VA 2I7SA 1PLBA 4N8UA 1AANA 5B3SB 4QKTA 1PZBA 1DZ0A 3AG2B 1FA4A 2FWLB 4KO5A 1L9TA 1PNDA 4BWWA 3JT2A 3WNJA 2FQFA
chains in the Genus database with same CATH superfamily
4KI5D 5AENA 3HMWL 1SMDA 3GKWL 3W3BA 1FFNA 3FUJA 2PP8A 1Y18A 4KY2A 5KYWA 4JG5A 3V4PH 3S4SG 1Z32X 4UM8B 1R3LB 3D87B 3UL4A 3IT8D 1NICA 4I89A 4DSYA 1TQUA 1XR8B 4I0PB 2Y25A 4ZTOH 4G42B 2A74C 5ID0A 3VCLA 2AK4A 4Y19E 5AL0A 5C08D 4QCIA 5CZXD 1ZHLB 4LCUB 2VW4A 1XGQA 2XWBB 4IOFC 5B8CA 4KVNH 2XVKA 2FSEB 1BD2E 3STZB 4FZ8L 3UFIA 3K3QA 4P2RD 3KPLB 4QT5B 1YPZF 4OFYA 1TJIH 2QLYA 4HXBH 4HKXA 5TK2A 4XCNA 1LO2L 1MHEA 5KS9A 2A6IA 2NR6D 3PIQA 3JQOB 2XZQL 3FRPA 1MQ8A 2ESVD 1Z6JT 2GTZA 3FU9A 4PJHF 3JV5A 1PX4A 4R7DB 4M62L 1B4RA 1FVDB 2GUYA 2GJ6B 2MMXA 4PJGE 3DX2A 3WEAA 2RCSH 2OXGA 2XV2A 1ORQA 2ENQA 1ZT1A 4PJAE 4ZMQA 3C6LD 2NXZB 3NIDB 4X4MA 5FW7A 3TWYA 1N6UA 3HPJA 3V0AC 2QVFB 2J88H 3SQRA 3I2CL 2N01B 5C8JA 4PSRA 4EI5B 4MHHI 3ILQD 2EYSA 4KZCA 2A4ZA 3BGFC 3HE7C 4ZFOA 3K6SA 2ADYA 1JPSL 2G9KA 1YA5A 3BHBB 3GSVB 4PRIA 5GGSA 4RSYA 3MNVB 4MA1C 5DZAA 2W59A 4XMTA 3BZ5A 4JR9L 5F9JB 5IJVB 5J1TC 2XUWA 5DRNA 3Q9QA 3OPZH 2CO6B 3L7FA 2B5IC 1OHQA 3U4EB 1WGOA 4XWOC 1NGWA 4NN6C 1IGIH 4OGYL 2ENJA 2FWSA 4N2IA 4I18A 4UAHA 1BF2A 4B3VA 5JIIA 4QHMB 1NDMA 1RH8A 1MCIA 4Y2LA 4AYFA 3F7YA 1L7IH 2YQBA 1IX2A 4TPRL 3J27A 3LRMA 1CICC 4BKLA 4NGHH 1FCCA 5DSCA 1M3JA 2Y23A 4HEMA 5FOBA 4GG6F 4WI6A 4L4TE 4AQOA 4OZHA 3HZ3A 4XP4H 4R0LB 2ZTBA 5CLZA 1LQSR 2ZONA 2GJZA 2V6HA 2FCBA 2ZT9C 1ZOXA 2WIIB 4XCEB 4HV8A 3SODB 3NMEA 1SZNA 4PJGF 3PWPA 3CBKB 4BUQA 5JIDA 3OMIB 2VJ0A 3IXAB 4RRPA 1VGEL 5I6KA 4NRYB 4XBGB 1MWOA 1RJLB 2X4PB 1H5BB 2WLJA 4PJAF 5AKVA 4DO5A 3GMQA 5CZVH 1OAXH 1TG8A 5KSVA 4UDTA 2YIHA 2P8PB 1FVEB 2V7NA 1EO8L 3BVDB 4Y5YA 5AOKA 3KLHC 5F6IB 2CPCA 2VR8A 3IMVA 1JNHB 1OTUD 2ROYA 4U1KB 3FCTB 5HVWA 1EEZA 1RY7B 3BRFA 2CPUA 3JV0A 1HXKA 4F7PA 4CN1A 2QGEA 3WNNA 1K6QH 1E2WA 2WKOA 3BGMA 1TQSA 4PLKD 4YWGH 5LBGA 4Z7QB 3DX8B 4I0KA 2CMRH 1JYVA 4J3SA 3BUDA 4ZK8A 1TR7A 4K3GA 1N8ZB 2CCLA 1T0NB 2O5YL 3KPRE 1WIOA 1TCRA 2J4WH 2W60B 1NAMB 1S9XA 3BFQG 3IU3A 4PP2B 1J05A 1MFDH 3CXHJ 5JXEC 2W0PA 3G5VB 3MV9D 3WXVH 4MAYA 4HJJL 2E7BA 1Q9OB 1LXMA 1Z9SA 2WIMA 3BUTA 4MNQD 4Q4EA 5FGCB 1R3IH 4XX1E 1BBJB 3LTVA 5CN3A 4PW4A 5C70A 4BFKA 4YBLC 4QWWC 2YQGA 1CGUA 3DSNA 3C6SB 4IGBB 3I9GL 1CGXA 5ALCH 1AG0A 1JGDB 1J5OL 2HFGL 4F7EB 4OF7A 5SV3A 4JO4H 3VJ6A 2F53E 4KX9A 4GAYA 3PGCB 3VGFA 2OZ4L 4PRPD 5F44A 3MMEA 2WQWA 1KFAH 1D9KC 4UTCA 4RWYL 1PGRB 1OALA 4FLHA 2RQEA 4HUVB 4ONHA 4A6YB 3P0YH 2BJML 4OCSH 1S3KH 4GB9A 2EDRA 4WW1B 5TE4H 1FV1A 1DBAH 3D9AH 3QZBA 4UIKL 5EIQA 5HVHC 2YMTA 4PS3A 2Y22A 3VTAA 3AS3A 5G55A 2Z31A 1BPVA 3FCSA 4KKBC 4WU5A 4N2NA 1USQA 4B7LA 4HPOL 3RZCA 5HYSG 4HUMB 2EUZA 4K3DH 5I1KH 1OB1B 2ZPKL 3BEWB 5LBSH 3CPUA 5J6GB 3S34H 2NUPB 3CFCH 5DO2C 3WKPA 3A21A 4U05A 2FHCA 2X4RB 4WAFA 4M61B 5ANMB 4PCTA 4F24A 3TFBA 1NUGA 2HTKC 1XGZA 4IKJA 3KYOB 4JRXD 2JK5B 5JPNC 4DEPC 1OK8A 3EXJA 4ELKA 1WBZA 5FGSA 4DP5X 3FUNA 1JV2A 5EO1B 4H0LC 1MWAA 2VE6A 3JWNC 4QLWA 1KJVB 1P6AB 1UA3A 2OMVB 5HDQH 3RE0A 5JW4N 5I6XB 1MJ8H 5HHPA 1A02N 2HJLB 3TYFB 4LPUA 4EE2A 1J0KA 3PAYA 4RDBA 2GK0B 2E4TA 5GZOC 1VFUA 4HIEA 1A9VA 3FUFA 3M1BB 5TF0A 3I74A 2IQ9L 1E4WL 4JGJA 5DD1L 4N90E 3DMMB 3EO9H 1IB5A 2IDCA 5EZOH 3ZTNH 5I76A 4E0RA 1K8DB 2CAKA 3A6CH 3K72A 4RZCB 5TDOA 1WWBX 4WO0A 1JZ4A 1LGVA 3GTNA 2EUVA 1VENA 3V6OA 4EZMA 5TDNB 3LHAA 3MXVH 4ORGB 1SLXA 5EULV 5B39G 5GRXG 1DSWA 3S35X 2BSSA 3SDDD 3ZRFC 3BZDA 4N2EA 4WTXA 3I50L 5D1XA 2Z35B 3GBNL 4HJSA 1RVFL 1JGUL 3QS2A 5JHLA 3J2PA 4QRRD 3LN9A 3W9EB 4MQTB 2WQAA 2QADC 2CK2A 3BPOC 4LCWA 1JZGA 4BA0A 4P3DA 3MXWL 2UXTA 5ACZA 2WYIA 4KXDA 1HX0A 3UYRH 2NY0B 3L95B 3GXMA 2IV8A 2LE9A 4DGVL 1FL3B 3HOGA 3FT2A 2D7NA 1WTLA 3HI1A 3PGFH 3ZZLA 1T4WA 3PU7A 5HJBA 3MBED 3FQUB 5FCUL 1DJHA 2EJ1A 2VLLB 2D3LA 5CLYA 3BGAA 2VXSH 4KTGA 4KDVA 2YA0A 2QSQA 4A2EA 2QTVA 3JBG7 3CAFA 1T5WB 1ZV5A 4JHBA 1E3FA 4JW3A 4MCYB 2ITFA 3JTBA 5D1ZC 4Y16B 1EJ8A 1AD9A 1PLAA 4ODBD 3L3HA 4AZ8B 1L9NA 3GF8A 2ILLA 3KBHE 3QXDB 1IQWL 3DDFA 4P05A 2IDSA 5MERB 3ZE1E 4K9EH 4ODTL 3BPLB 3H9YA 4W4OC 5D7KD 4YHOH 5EWIL 4LGPB 4NKOB 2ZYRA 5D7JA 5F7LB 5J12C 3MGOB 1F00I 4NWTL 3GIVB 3SGDH 3BVNA 2UVFA 1A3ZA 4KJQC 1SVZA 1T66D 4PS4L 5DK2A 1QFWM 5T3ZL 4NC0B 1LEIB 5FLVA 3LIUA 1SEQL 2LABA 2ZUQC 3KWWB 3TO4D 1YC8A 1EH9A 3WS6A 4L4VA 1QATA 4MJIA 3LHPL 3OXRB 1KYFA 3ZDYE 2YAEA 5FFGA 1XF2A 1MEXL 4H2AA 2MPAH 2XTJE 1T83C 2EZ0C 2R0KL 3UCQA 2KZKA 3VXOB 1WHOA 2P7TA 3DECA 2DQ6A 1PDKA 3M7OA 1G7MB 4EMZA 1PCXA 4GBXA 3DBXA 4C59B 5SX4H 1MG3C 3O4OC 5DR5H 1QRKA 2D31B 4JFWA 3EG9B 4EBQL 2W8CA 2I07B 1SJMA 5E4IA 3HRPA 2ETWA 4KO7A 4P46C 4W9ZA 2G3ZA 1G0XA 1L3WA 2BVPB 1K4DB 1JPTL 5DVPA 3MGAA 4Z7UE 2ATAA 1NBZA 1LDSA 2WD0A 4IKIA 1T4KB 2HZHA 1OD7A 4EIUA 4YDMA 3IVKA 4HU2A 1BIIA 2FBJL 2Z65C 4LBAA 3FHAA 3LH2H 4MLSA 4A7TA 4HIPA 3TZVA 4A7GA 3EADA 4UMSA 5EU3A 3RBSA 5AW6B 2XXMB 3ZDXB 1NCDL 4HUWA 1A22B 3F04A 3ZHLA 2BSCA 4QRQA 2VO8A 3K2UL 4F92B 3FUHA 4JN1H 3AB0C 4OI8A 3PXLA 4PJIB 1ITBB 1I9JL 2EH8L 3ZRCC 1MNNA 3U9UB 2IFFL 3HG1B 6PAZA 2FR4A 1MNUL 2FX7H 3QDJE 1JZ3A 1AYOA 3D4GA 3HE7D 3KYKL 4LT7A 1FE8L 3DJZA 3DVGB 3ZDYF 3PDGA 4MBRA 5LAXB 1U8CA 4RMRA 1A6TB 3WDHA 1EZVY 3HJEA 3QK0A 3V52L 15C8H 1UACH 3P2BA 5GRVL 1MW2A 1XWVA 1K8IA 4P0DA 2A99A 2YA2A 2K4WA 3OAWA 1DVXA 4XWOD 1S7QB 2VXVL 2F9BT 3C2AH 4TSBL 4ALAL 3EYQC 5EDXA 4NQED 3SDXB 5AVZB 1DLFL 1Q0EA 4H44C 4NZDA 3K1DA 5F0JB 3FH5A 3P9LA 3QDGE 3L7EA 1ZKAA 5SWSA 1TOXA 2YAOA 2NYZA 4Z7UF 2NDFA 4OSUL 3QULA 3CV5A 4MCNA 2YKLL 4WHDA 4PWFA 4HC1A 3US1A 2P24A 1B9KA 3IDYB 1VFMA 2G5BA 1PIGA 1KIQA 3RB7A 2CIIB 2CDGA 2R23A 4PRDB 5GIRB 4UM9B 1E4XL 1YEJH 2AP2A 1I7UA 4OM0L 4M4PA 1FLTX 4YDKL 1T1XA 3EYSH 3EGDB 2IEPA 1NGZA 1ONQA 2BSTA 3G9VA 4E42B 5AAMA 3ULUD 2P5WA 3NABH 3T0EE 3BZEB 2VZ3A 3RPIB 5D7HA 4D3CL 1QVOB 5HD8C 1F45A 4XPAL 1XFPA 4JRYE 1ZHNB 3VX1A 3ESUF 1JF5A 1N18A 5ELIA 3ZN6A 4CKQA 3DO4A 3RWEB 5IQNA 2VIRA 5C0JA 4UAOB 3KLHD 4OB5L 2E9IA 2Y69B 1BVLB 1T1YB 1N3NB 3SO3C 1F6AA 1PLCA 2FTAA 4KFMA 1I8MA 3MV7E 4HDIB 5KBLA 2GIYA 5AB2A 4N9OB 1GGBL 4ABUA 2D7PA 3VD5A 5DVOA 1NOLA 4DESA 4IKLA 5IQ7H 1IEBB 1WVZA 2MQCA 4X7DC 2CA3A 4PHZA 1KEGH 3QUGA 4Y2DC 3VXPA 4CADB 3RKPA 2BVOB 3MV8E 4Y1AB 2NLJB 4F9PC 1DSFL 4F57H 3E2HC 4EIZC 1J5IA 4NQDB 4CMHB 3GMOB 4U1MA 4WFGE 3QB7C 1C16A 4AOFA 4QWWD 2RH0A 1S9VB 3QG6A 2CCWA 3BAJA 1QI4A 3DOHA 2YBRB 5C09B 2YQ3A 3EJJX 4OD3L 5B7FA 1NCBH 4OJFH 2MNJB 3A5VA 5AL8A 3UROR 5AW3B 3LKOA 4TULL 2ZUTA 3U4AA 2O61A 4XNUL 4MBOA 4HMDA 1J1PH 5HDOA 1BQRA 1D9KD 2EXYC 3O2VH 4PREA 1G7LA 2VISB 3KLDA 1ZD6A 5C6TH 1KPRB 3UTPE 4FFZH 1MN4A 2IV9A 5DHVB 1CL7H 4NLAA 3BEVB 4ETQA 2AEPL 2VMEA 3AREB 1WIPA 5AQ0A 5C08A 2JELL 4ZFOL 3BWSA 1V54B 5J1AA 1UB5A 5DFTA 3VE0B 1A47A 1ZV9A 1TSHA 3MJ8B 4KKBD 4N2HA 1QYGL 3SPVA 2R0LL 4P2RA 4HK0B 5EU5A 5DC4B 4D0BB 2HTLD 4ZX6A 4ZUVA 3FRUA 5DT1L 3MLYL 4UQ9A 1I3RA 1Y6NR 2Y0SA 1SYSA 3QJZA 3NH7H 4IRZA 1OM9A 1OM3L 3V55A 1N5YL 1EFXB 1NCCH 1SBSL 1UGKA 3FB6B 3GM0A 3VM7A 3PNWA 1TZGL 5DO2D 3VH8B 2NR6A 2CO3A 2R4RL 1EHXA 2ESVA 4PHXA 3W0WB 4APXA 3KDPB 4IIQC 4AKQA 2YN5A 1QLEL 2JQMA 3ASWA 5FA4B 4KUCF 2HTKD 4LSUL 3DPBB 2N7BA 4DEUA 2ZUXA 3BQUC 4RMUA 4QAMB 5I30L 1UXWB 5CGMA 1XAKA 3HG5A 4U6VH 1VESA 4ZJ9A 3C6LA 4W9DC 3G9AB 2BY3A 3VFRA 2Z34A 4YHMH 2NY7L 1S7XA 3EYOB 1OOAA 2NY6C 4P2CG 1XMWA 5C0FB 5K9JL 1XF4B 5GZOD 2H3NB 1UATA 3V5HA 4JFSA 3RY4A 3TA3D 4UQIM 4P2OC 3M8OH 5IFJB 2P8MB 1T0PB 2GITA 1WZ1L 1KN4H 3SD5A 3QCTL 3T8VA 5ITBL 2BS8A 2QKIB 4AT6A 5B3NA 3CLFL 1EXGA 3BVTA 3JWDH 3DVFA 3ZTDC 4QTIL 1IAKA 1U8MB 5E6IB 3ARVA 2B9BA 1UXSB 5BRZB 1I8KB 3CBJB 5HHMB 4L2LA 3HFML 3ABLB 4A63A 4FDWA 3QCUL 3T6VA 2YLKA 4ZOEA 3QRGH 3SSGA 3O41B 1HHGA 3HR5A 3S2CA 1JSYA 1A7QL 4MZRA 3CUPB 2E0PA 4HUNB 5IESH 4Y9EA 4H4NA 4UT9A 4OZIA 5DD0L 1U6AH 1VIWA 1CFNA 2HPOA 4OAWB 4RA3A 4A2FA 4CW1B 4X6DB 5TPWL 1EHLL 2WQUA 4PWJA 3IMRA 1J1XL 2G30A 3P73B 4NO3B 1UYWH 2C3HA 4EUPB 1Z7JA 5T5NF 3U6XA 4F2MA 4P4KB 4OV5B 3X12B 5C0DB 5IOPA 2DQIL 1EA9C 4GAAA 1ZIAA 3P4MB 1RJZB 3QIWB 3CFKB 4G70B 4NFBA 5EZJA 5GRUH 4ONGL 1YNTA 5D1ZD 5DS2A 3EW3B 1UKTA 5KJRH 4MHHG 1AO7B 2Q86A 3MLZL 3PQYB 3OTTA 4AYGA 3T5WA 5F96H 4KJPC 7FABH 3IFLL 2RB8A 4F27A 2OMTB 43CAB 4NYLB 4X98B 4CC1A 1ZT7B 1BIHA 4QTHB 1LP9E 4KJQD 3CNKA 2AQPA 5EN2B 4Z7VA 3EFFB 1RU9L 4G3YL 4G9DB 4OBSA 5A16A 5E00A 3O3EA 5C0RH 3MV9A 3GGWB 2GC7C 3WD5H 5FV2A 4MNQA 4Z95H 5AAWC 2LLGA 2A9MH 3ATBA 3NFNB 4JFOB 3WAKA 2EZ0D 5ISZD 3EGXB 2PTTA 2B1AL 2O30A 3RFRA 2EE6A 1WLHA 3G6JB 3RPBA 3H42H 5KVDE 1V55B 3KH3A 3Q01A 1ZLUK 1U8KA 3OJMB 2FBOJ 3W37A 3CVCA 4OLWH 2DYRB 2X4NA 4HHAB 4JUTA 1T6BX 4NO0B 4NZTH 1A6AB 5IV2A 1JGLL 2EXSA 3N9GH 5FO7B 3GUTA 3WNIA 3KLAA 4TUUA 5FEBA 2Y4SA 5D96B 3EOAB 4PRPA 4P46D 4UTBH 2PCPA 2W81C 1YPZA 4PG9A 2R2HB 3SZKC 3MX0B 1MVFA 1BYOA 3IE9A 5KWYC 3KLSA 5GS0D 2VMCA 1MCLA 1Q72L 3S96A 4MNGA 5AVTB 1BOGA 4KI1A 5EU6D 3QUMB 5I8EA 4JQVA 2AJYH 1JNLH 3UTTD 1QSFE 1IFHH 2EYTB 2RFXB 3T3PE 5IB5B 3CH1A 3VFSB 4NQCB 4HIQA 4WFFE 4K3EL 3D2TA 4UNIA 3LN4B 4KH9A 3BKJH 4K2UL 3MJ7A 5KYUB 1BOYA 1DVTA 1E3XA 4XVJL 4ISVB 3BO8A 4GUPB 2XWZA 1LP9F 4ILDA 3KEDA 2JIXD 3FFDA 4LLVA 3KGSA 2HT3C 5FB8A 4X7TB 2YPLE 3JWOH 4OZ4A 4ZQTA 2NNAA 5D5MA 3RTLA 5JHLL 2EC8A 3Q6FB 4X9IA 1A7NL 3VNZA 5FAAA 4JRXA 2DWSA 4LPVA 3QUZC 3E38A 4BK4A 2VDPL 1E6JL 1OGAB 2LLLA 4FZEL 2FIRT 1OSYA 4O4YL 4YPGB 4EXPX 4FCHA 4KNUA 3KWTA 2QL1A 2V7HB 4U1HA 2BMKA 3V4UL 4LIQL 3RFZA 4EDWL 3V9CA 5BPPA 3OLEA 1KCBA 3ILPB 4NI3A 1HH6A 1G7HA 3KS0J 4TTDD 1RZIA 4ZDHA 5DD3H 1KJMB 4GG6A 4XCYA 4LHUD 5KVEE 5JNYA 3QEQD 2VDMB 2FGWH 2J55A 3TCXA 2BOBA 4N2FA 3LKPA 3MFFB 4AK2A 2XQBL 3TA4D 1XCTB 2MCG1 3SDDA 3OZ9H 5E9DB 4XNZC 5JDSB 3FO0L 1LO5A 4YSDA 1ZLUH 3T3PF 1PBYA 1E9QA 2X9WA 4ICWA 4QRRA 3MRJB 3UGXA 3ZYJA 4ODXB 1A21A 3NGBB 1D6VL 1ESOA 1S6NA 3LX9A 5ADPL 2BH0A 2IAMB 3LPWA 5KG9A 3MBWB 4NENB 2V9UA 4ZSOE 2EDYA 4DP7X 5I1JL 3RJQB 5HD8D 2CUIA 1H6EA 3UJTH 4ADGA 1BAFH 2DJSA 2EO7A 2ED9A 4L2YA 3MBEA 1S7SB 4HBQA 5AVWB 1S9WA 4FNQA 2OTUA 4RIRA 2M8XA 4R7VA 1SN5A 3GS4A 2XWDA 5ES4B 1NGYB 1TYJA 4PGZA 3Q2CA 3US9A 4NWUL 3V0WL 4A66A 2B15A 3NCXA 4XGZA 5E94B 5TDPA 4M6OL 3CFEB 4G8EA 4XO9A 2P28B 3KMDA 4L29B 4JPWL 1AKJB 1OTTD 4PGDB 1ZT4B 3EH3B 3FPYA 5BMFH 4B3EA 1DVZA 3B3IB 4O58L 3OJDB 4YGVA 2X4TB 1A9EA 3EJYD 5GGUB 3TBTA 4JHAH 4L1SA 3QFJD 3DUUB 4GRWH 4Z7WA 2VAAB 5C2BL 4AMKH 4GPVA 6TAAA 2B1OA 2A6JA 3WFEL 4G11A 2Z6FA 1D5BA 2MQ0A 4X42A 3ALPA 4M93C 4TVPL 3MSPA 3ZSSA 1RIHH 4F8NA 1X5YA 3H2QA 3PP4H 4OI7A 1FYHB 3TO4A 4IYKA 2OK0H 4M9OA 4WSGA 5EO0B 2IALA 2GG1A 4PJ7A 3M45A 1VEPA 3LSOA 4NQXA 2EXYD 4XH2B 3MRPA 4M7LT 2H6PB 2BVTA 3GK8H 3MUGA 2R51A 4K94C 4DN4L 2A74A 1KIUA 3WE1A 1Y6MR 3ZKNC 3VI3A 3FSOA 1QSEE 3NCEB 3D0AA 1JCKA 1KN2H 5KBMA 3V8OA 1ZVHA 2Q20A 3B9KC 3APMA 4G8GB 1J0IA 4MS8C 1V10A 4UQEA 4XPGH 5E2TL 4UIMB 3U7YH 1KPUB 4E41D 4DQOL 2A1WH 1BQ5A 1INDH 3O11A 4MJ6A 4Y4HC 1ITCA 2ZCZA 4TSAH 4C8XA 2JKLA 1OT4A 4KJYA 2GAZA 1X5ZA 1FLRL 1PZUB 5I8OH 3CZGA 1HSBB 5ESQB 5J9PA 4HFWA 4FJZA 1CDJA 1AS6A 3PG2A 5IB1B 3BQUD 1ASPA 1O0VA 5L8JB 3PL6B 4X6CB 3QJSB 2VZVA 3OQRA 5EEXA 5EF2A 2I7SA 3U30C 2H1PH 4ZMOA 2FX8L 5CIPB 4XPBH 2WNGA 2NY6D 1AY1H 1II4E 5CCGE 3HE7A 4MMZB 1FA4A 4PJFB 3T08A 3MV01 1L9TA 3ZMRA 1LVEA 4PJDB 1F4HA 3ZT5A 5ILTH 4UUJA 4HUXB 1I9IL 2AGJL 5C0CB 1CXKA 4LPTA 5I1IH 2FATL 1EEYA 3AQXA 5EB9A 1GOFA 3MLRL 1PU0A 2WM0A 4KNSA 2WVUA 4G80B 4PG2C 4ZX4A 3HMWH 2BWIA 3GKWH 2F1EA 3RY5A 1FZMA 1JG9A 5HI4D 5JOEA 3MRMB 3SQBA 1WZMA 1JCVA 3NK4A 5CEYA 1F11B 4I3GA 2CHZA 2NSXA 3VFPA 4YHYC 4NQEA 4M6NL 2WSPA 2H26B 4KZDL 5A2LH 2DLIA 2Y7QA 2HRHA 1OCWL 2FJHA 3L4WA 1XZ0A 2H0EA 4PV8B 4OGQC 4XPTH 3QXVA 4ODWA 3V95A 4PCSA 1GJIA 1C7TA 1NEZA 2KLTA 2XC8A 3QZLA 2BRRL 2J8UF 3DUSB 4IMLA 2ICEA 1HEZB 3OF6D 4WI0B 5FYJD 4MX7A 3FQYA 4S10A 4WEEA 3K2MC 3K2IA 4OLVL 3PY9A 4FZ8H 1FHNA 5FFOA 1I7ZB 3KGRA 4H25B 4AIOA 1F56A 2HT2C 1NFKA 1RL1A 1H15B 4QRPD 4L3CA 4B96A 4AMWA 5BS0D 2EIMB 2C3XA 3P9MA 2GFBA 2YZ1A 3PJNA 1LO2H 1MAJA 3OLGA 3IKCA 5H35B 4EN3C 2V2XB 5DS8A 1RCYA 2PYED 4TUJA 2XZQH 4YDLC 2ERJB 5INDB 1JPEA 1KWGA 2IC2A 4XNQB 4M62H 3IFPA 1NFIB 3DA0A 4PJ6A 4OF3A 2BCMA 5DHYA 3V0GA 1QSVA 4BRVA 1AZUA 2F74A 4KGJA 1XD0A 2XWRA 3NRFA 5J3HC 3UACA 4KJPD 5DJ6B 4DCQA 4JAMA 2GBVA 2XA8L 1JF1A 1ZLSL 1VEMA 1XMEB 1ZSDB 3I2CH 2IPKB 4QNPE 1JPSH 2EDJA 3QXUA 3LKQA 1MFUA 5A7EA 4P2QD 1D6EB 3BT0A 3MLSL 4NN7C 1OANA 4JR9H 3G5ZB 4XNMB 2DWEA 5I17B 3DRTA 3CHOA 2DI8A 3LEXA 4NUQA 4OGYH 1U42A 3K2KA 2VLJB 4IRZL 4LNVA 4YE0A 4DO6A 3TPUB 2XX0A 4ESKA 4TPRH 5DJDB 4PVBA 1ZLDA 5T1MB 4NUJB 2VR3A 5DWUL 4YHLL 1IBGL 4F37K 3VH8G 1SHMA 2OX5A 4KQ4L 3D3VE 3I6GA 5LJYH 4PLNC 3OB8A 1D9KA 4XZUA 1JPFA 4KX8A 5IW6B 2QELA 3ETBF 2H41A 3UTZB 3BN9D 3ZQ9A 5CJ5A 4S0HA 1H9VA 3O6LL 3QGVA 2OSLB 4QHUB 3KBFA 4NSKA 3MUZ1 3KW8A 1VGEH 2TSBA 4EZLA 3I3DA 2ZYSA 4W4NA 5E03A 5K39A 2OAAA 3FO9A 4D9RE 4Y0GA 3DXAB 3ARRA 2F6AA 3NSJA 1EO8H 4AGOA 1T80A 2I32A 4PJ5B 4QNPF 1KWKA 3O8XD 3IXTA 1NGQL 3BE1H 3OC5A 4B9FA 1M42A 1XSIA 3D69B 1YNKL 3UJJL 4MMYA 4AI7A 1CTMA 3CMOL 3CBRA 4PJCE 5JPNA 1UJTA 2O5YH 5F7HA 1T2JA 5DMKB 2XXFA 2YPVA 4M5ZL 4MA8L 2Q2EB 2VLRB 4DP6X 4JRFA 5IK3A 2G5UA 4HJJH 1EGJA 3PWJA 1I7TB 2NY1C 2DKMA 3C75A 4YXHL 1CLYL 3DX0A 5FA3B 5CSBA 5GZOA 3IMSA 5HHXL 2HX9A 5HHQB 2I7OA 4J8QA 3N85L 3TA3A 1AXIB 3UXFA 2P9RA 1IARB 1BV8A 1UOLA 2B1HL 2C9SA 3I9GH 4EUPG 2PTUA 5GHWL 4P04A 3WMPA 1J8HE 1LD9A 1J5OH 2MSPA 2HFGH 4O51A 3KL5A 2WBJC 3DYOA 3GPEA 5E1AB 1NINA 3BP6A 4YN3A 3QA3A 2OZ4H 2CJSA 3N5AA 5FCSH 2BFVL 2YN3A 3BW9B 4RWYH 5GGTA 3TONA 5DD6B 1HDMA 3GLEA 2BJMH 1SF5A 3GTTA 5ID1A 3LYRA 4NRZA 4PJIE 4PPTA 3X14B 2TAAA 4KNTA 1Z2KA 4UIKH 4UOZA 1KACB 2EC9U 4UQ2A 2H32B 3MKKA 2F19L 4WWID 5D71L 3V6FA 3X11A 4K23L 3JVFC 5GGRY 3CSYB 3FJTA 2IVFC 4U1IA 5EV7A 1R3HA 3BYYA 4JKPL 2VXTL 5K1JA 1ZE3H 4KBPA 1DDHA 4HPOH 3O45A 3UPAA 3NCMA 4AH2B 1WV7T 4PJCF 3PHOA 1TJMA 2ZPKH 3L3GA 2YEVB 1PG7W 1OIOA 1HXYB 2CK0L 2PXYC 1FNFA 1PKQB 4YNYA 3WN6A 3GLZA 1MAML 1X5GA 1TU2B 4GY4A 5D1ZA 4NIYE 4Q7DA 3VFNA 1SHXA 5KN5A 1BXAA 1KLUB 1YEDB 4QRBA 4N25A 4AUJA 2F7PA 1URLA 5F1IB 2X87A 1A4JB 1IJ9A 3IS1X 3MI6A 4OI9A 4F93B 3O6FC 2QGBA 3OKMB 2BCKB 2ZSVA 4LDLB 1KEML 4R3SB 1CFSB 1Q9LB 1K9TA 4J23A 1UB6A 5AB1A 2V2WA 1P7KA 2IQ9H 1E4WH 5DD1H 5T3XD 5CSZA 5DVLA 3I9PA 4HWUA 4IBYA 3O81A 4LLMB 4MDJB 5FYLD 5HGHA 1IRAY 1V5JA 3ASNB 3OJ2C 1IGFL 1T83A 3NESA 2X09A 5ISZA 3VQ1C 5DWPA 1UEYA 5D7IE 2NX5D 1E4KC 4K7PY 5TJWK 3I50H 1BZ7A 3GBNH 3UG4A 2FT8A 4PRNA 1GC1L 1RVFH 1JGUH 3ZKND 3O3AB 3RYMA 1WRFA 1JRHL 3G5WA 3EJCA 2VM4A 2A6DB 3NJFA 4YSOA 5CM1A 1BYNA 2BNRD 3WIAA 1XO8A 3MXWH 4NHUA 5KVFE 4H1LB 3D4ZA 4H7VA 3B37A 2ARJA 3B9KD 4MS8D 1P4IL 2WHVA 4P46A 4DGVH 1N5AB 2H2SC 3S37X 3QORB 2ZSWB 3FCUB 3GZPA 3L1EA 5AYUL 3EBIA 4RDQG 1SGKA 5IY5B 7CGTA 4Y4HD 5FCUH 1HYSC 3KCPA 5EU6A 1R47A 4CVXA 1ZIBA 1PX8A 1ZY9A 5IBTL 1KBKA 1S5HB 2OR9L 1E27A 1AQHA 3MC0A 2D7MA 3UTTA 3TO2A 2C7UB 2RA1A 4E9YA 1BX2B 3F64A 4FQXC 4G8IB 4NC2B 3HLAB 3KYMB 4NQDE 3BC9A 4WUUD 4MCMA 4XI5C 4YLQT 1P7HL 5HY9B 3IAGC 3QJHB 4TVUA 3APNA 1DLHA 4ZPVB 2Z8VC 2DW5A 5LVEA 2DLHA 5GRVK 4DPRA 1IQWH 2J73A 2JIXA 3HBZA 3SBPA 1I3UA 2WTPA 4ODTH 1RD6A 3TBSA 2OJEB 2AVGA 4XCFL 5D4HA 5EWIH 2FH6A 1I31A 2PUQT 3GXFA 4FXGB 2AQ3A 1ORSB 4NWTH 4MQXC 2ZCKL 3EXLA 3MLXL 5JHDB 4PS4H 5CP3H 3TEXA 5CD3A 3N2JA 4WNQB 2FD6L 5D7IF 4K7FA 5T3ZH 2Q7YB 1WBXB 2D7QA 1JHKL 2MPVA 2WQVA 1QI3A 1SEQH 3O2WL 4OVUA 4JPIA 3CDZA 1PFOA 2VR6A 1IBYA 2NTFB 3PLYA 3LHPH 3RVXC 2C4XA 2C9VA 4PJBF 4ZUWB 1MEXH 1ANUA 3CSBA 3FXIC 2R0KH 4IK6A 5E1GA 5IMLB 5DJ0B 3TU6A 4X4YA 3REVB 1YVLA 1UVQA 4LHUA 4D9RD 3UAAA 4W1TA 1NDTA 3NFSL 5DC0A 5KANI 4AQZA 3QEQA 4BSJA 2C9UA 4EBQH 4MZIA 1Z0NA 1B2YA 5FUZL 4HAKA 4AYEC 1FJ1A 3GD1C 3MYZA 3TBWB 3VD0A 1AIFA 1KELL 4LP4A 3FQ4A 3VXQB 1GOGA 1J88A 1HNGA 2WLLA 1JXGA 4DZ8A 3GSWB 2XWJA 3EHBC 2WC7A 1JPTH 1WFTA 1R3JA 5KYYB 3WJJC 1B0IA 4NFDA 5CEZD 3D0LA 1V3JA 1UQSB 1HQ4A 2AK1L 2F15A 3Q5OA 4EN3D 4EKJA 4UQBA 4M7ZB 2ZOLA 2FBJH 2K6ZA 1KLFB 4NKIL 4OKDA 1OCCB 1Z3GL 2DQMA 4WTQA 3UBHA 3UTOA 1MI5E 4AEIL 5I0VA 3ARSA 2CKBB 1YN6A 4MCZB 1BM7A 1NCDH 3QUXD 5AW2B 3RIAF 3U82B 3DURA 1TEGA 2E76C 2PPCA 1ES0B 3K2UH 5EZLA 5F9WB 4WI7A 3ABMB 3AFLA 4KKCD 3ARDC 5AW4B 5J3HD 3BLBA 1I9JH 2EH8H 5HDRA 1ZV2A 1OAKL 3HG0A 1JZ5A 2IFFH 3NAAL 4AV5A 1ZVSA 1TNMA 1MNUH 2VYRE 2EUWA 3CHXA 1XBRA 5EFIA 3KYKH 1CO1A 3OKOB 1FE8H 5TQ0L 5DMIL 2ENPA 3WHE0 3FHEA 5F93C 2VSKB 5HDLA 3TVMB 4GT7A 1QA9A 1RZ8B 1KXTA 3MJ9A 3V52H 4GSXA 3CFMA 2XN9E 5ENWA 3QE5A 2FRGP 1Q1PA 5EU7C 3QFJA 4F9PA 4JPQA 1SPDA 2VXVH 2LT9A 4TSBH 5BXFA 1T20B 2DQEL 4BZYA 1C5DB 2ZIDA 1IILE 3BP7A 2GSIA 3CFDB 1DLFH 3UTQA 1IAOB 3B5HA 1DE4B 4QOKE 4ZXBB 2X2YA 3OG6B 3D39E 3KPNB 2YSTA 4HKZA 3O3DB 1A2YB 1TZHA 1UKSA 3ARGC 4U3CA 3ARBC 2WTRA 4Z77A 4OLEA 1BVZA 4OSUH 1HWGB 3IGUA 2YKLH 3ILDA 5CBEA 1YYCA 3VSQA 4ZFFA 3MA7A 3FFCB 1PLBA 2CWRA 1CTNA 1NCAL 2VDQL 3VGAC 4XWGL 1E4XH 1ACCA 4M1CC 3BUIA 4TNWF 3PWNB 1Z9PA 4OM0H 2FWLB 1REIA 2ZXAA 4YDKH 2H6UA 3JT2A 1EERB 1U92A 2YSSB 4HGKC 2LTQB 5FPIA 3TBVB 3S98A 5D72L 3WLBB 3WNOA 4P59L 3WY2A 4EIGB 4D3CH 1I9EA 1G6RA 5E8EB 2F7IA 4P5TD 4XPAH 4XN7A 1AOZA 1EDYA 4Q6IC 3KPSE 4E41A 4WTWA 3CZSA 5A3ID 4OB5H 2EXWD 1UH3A 3L6FB 3GBDA 4FF9A 3ROOA 4CRPA 1OY3B 3UABA 2F8XC 1P4UA 2NTSP 3QI9C 1UD8A 1AHWC 1EO7A 1HHJA 2QPUA 1GZPA 1GGBH 5FFLA 3BQUA 3L4ZA 4HQQL 1EAPA 2Z92B 1R34A 5FHAL 3OBAA 3AS2A 5KSAB 1X7QB 3DIFA 5L2KE 5AUMB 1GKOA 1E28B 2BP0B 2V9RA 3EFOA 3HBQA 2NY1D 5IJDC 3C08L 2VABB 3GXTA 1BAWA 4UB0L 1DSFH 3DVNA 5MENB 1S7RB 1KTLA 4RLDA 5HVFB 2XZAL 1H3GA 1TVHA 1Y1UA 2JVUA 1HHKB 3EO1B 3Q48A 3GJEB 4GEJA 4JN2B 1H3VA 3ULUL 3H9SB 4NZFA 4M8QB 3JWDC 4OD3H 1NC2B 1VDGA 1VLXA 5CU5A 4FHKA 4UDUB 1WYJA 2SEBA 3F83A 2WBJD 1RSYA 2Z64C 2EDQA 2A9BA 2YLHA 3QR2A 4TULH 1JERA 3FB7B 4XNUH 1KIRA 2XCMC 4HIIB 3SDCB 4J7RA 3T6WA 1IGJA 3HW7A 3ZJAA 1VSCA 4HALA 3KVDD 4G8FA 1MY7A 5FGRA 3TLRA 5EDSA 2CR3A 2HN7B 1NEPA 2BIOA 3QHTC 4FFVC 2OCCB 5ESAB 4D0DB 2AEPH 4V1DE 5KZCB 1SLVA 1A1OB 1A1NA 1F1AA 3IDMB 2JELH 2PR4H 3OF6A 2DQGL 2JJTA 2NY2D 3HUJA 1MLCA 1QYGH 5C92A 2R0LH 2VOTA 4DJMA 4KXZI 3BMWA 4QRPA 4L9LB 5DT1H 3MLYH 4PU2A 5BS0A 3R8QA 3MFGB 1N5YH 1OM3H 2ZD0A 3SJVE 3MRNA 2AV1A 1SBSH 1BVKB 3HLKA 1ID5I 4A38A 1TZGH 2PYEA 2OXHB 2PXYD 3P02A 3WJMB 5DJ8B 3SYOA 2KERA 4FFTA 1IU1A 4F7TB 1QLEH 2C9PA 4F58L 4KKAC 1ZTXL 4LSUH 4ZW7A 1CURA 1YDPB 2DWTA 5I30H 1RK7A 2Z8WC 3A6OA 4LDOB 3CLEL 2Y5EA 3OX8A 4JFQA 2OZNA 2UY6A 5M94B 4ZMZA 4OZFB 3O6FD 4X5XB 1PZ5A 3G08A 2XY2A 4W9JC 4X6BB 2NY7H 4V2CB 2QQQA 4XP6L 4C56E 5DI8B 2CUHA 5K9JH 4TLKA 2GKIA 4H5SA 4JZOA 2WQXA 4D8PB 2DYPA 1I1YA 3EDJA 4N8CL 2MNUA 4JCLA 3RGVC 2X1WL 3RVVC 1E9OA 1L0QA 1NTDA 2GI7A 2PW1A 2YUXA 4NQUA 4P2QA 4DVRL 5DHVH 5KAQF 2Z4QA 1E6OL 1FYTB 4BDVA 1WZ1H 4MA7L 5ITBH 3QCTH 4CVZA 5DEGB 3CLFH 1W0WA 4GO8A 4JG0L 4QTIH 3TBYA 5AAWA 4QPEA 3L4UA 5E0QA 4L3EB 3NTCL 4NP9A 1L6ZA 1PCSA 4QY8A 3FK3A 4PTUB 5H94B 4ZSOA 3HFMH 1KG0A 2D9CA 3QCUH 1P5UC 3L5XL 4LVNC 2CA4A 1R6VA 2YEZA 4DP0X 5F9DC 1I4FA 2JCCA 5IF0A 4HUUA 5LLIC 3VDBA 5CZKA 2J2ZA 1OWRM 3KPMB 2WXJA 1A7QH 1U58B 1HE8A 2FSDA 4KKNA 4RGMC 2VQ1B 1RZKL 2VDOB 1KGWA 3P4OA 3Q2WA 4TF4A 1Q38A 5DD0H 2YPVL 2H2SD 4LF3B 4N5UA 3T9WA 3WDIA 2BNQD 1EHLH 5TPWH 3HBPA 2O6DA 1J1XH 4WTZA 1EGJL 4GRLC 1HYSD 4M3JA 4WKXA 4HS6A 3SN6N 3TJHC 1J5HA 4ABQA 3QIBC 1MHPL 4U1NA 3I3BA 1IM9B 2DQIH 5HGDB 3UOAB 4FQXD 5HDBB 2UZYB 4XI5D 1EZSA 3W5NA 5EIIA 3LN5A 5D1QB 1HJBC 4N1CA 4WHYH 4ONGH 4OH2A 2VSMB 3RJDA 4N1EA 1CG9A 4KQ3L 6FABL 2D3NA 1OAQL 1WT5C 3MLZH 1YMME 4F9LA 1QABA 2VRKA 3BSHA 3O8XA 2VDNL 1SN2A 2BXZA 3IMBA 3JWOC 3IFLH 5GGTL 1ASOA 4GQRA 2VITB 2GBTA 3FQXB 9PCYA 4NOBA 3GQFA 4XR8C 4MQXD 3ARUA 4JFYB 4RNRA 4DKDC 2PTVA 4OGXL 2DAVA 3BD5A 1RU9H 4WKZA 2JB6B 4G3YH 4U6XA 3TNNA 1KIPA 2BVQB 1JUFA 1U8JB 1E9PA 4MAZA 4JKLA 1PG7L 2IWGA 2EKJA 3V0VB 4RAUB 4LGRB 4CU8A 2H8PB 3RVXD 4GQQA 4OCNC 4BRJA 3SYPA 2B1AH 4MA3B 3IGAA 3KPPA 2YAMA 3GDCA 4P23C 1J5DA 3NJHA 1E50A 3RWCB 1A7BA 3AC0A 5LWYL 1CBJA 5E6YA 3NOIA 4KOBA 4L5FL 1FL5A 4HEPG 5F7MC 5BO0D 5I28A 3S97C 2J8UA 1JGLH 4TLSA 2DKSA 1DEEA 4FYTA 3TJEL 1ERNA 2VR4A 3E6FB 4EVNA 4Q74A 3MRBB 3W82A 1ZA6B 2E7DA 3CX2A 4D9LL 3LNEA 4PBWD 5F1SA 2HG0A 1RAMA 1S7TB 4OF5A 1YY9C 2XWTB 3T2NL 2Q8AL 5GS2D 1U93B 5F7DA 2I9TB 1PX3A 4J3OG 4OKVA 3IM1A 1MCOL 2YUVA 5BOJA 1WCBA 3QUKB 3WFBL 4YSUA 1U8LA 3Q5YA 4K3EH 2VW6A 5JQHC 3PYCA 2PYFB 4IBSA 1VB9A 1UENA 1CXFA 3NRQA 4K2UH 3ZE0E 3ARDD 4WHTA 3RWHB 1KULA 4XVJH 2NT1A 4KKLD 2E9WA 4R96A 3WDJA 1OQOA 1INQB 5CCKL 4HD5A 1QLFB 2E8YA 1C5BL 1A5FL 1MLBA 2XPZA 3MJWA 4K3JL 4ZQKA 2DEYX 5IG7B 1F2QA 4IDJL 5JHLH 5IVNA 1A7NH 5FX3A 1BW8A 1W8NA 2WWMD 3MYJA 2VDPH 4GKSB 1E6JH 4FZEH 1GHFL 5EO9A 3L3DB 3TN0B 4O4YH 4ZNEE 5I5IA 2DICA 3BXNB 3GBLA 4H1LG 1QX1A 3IMWA 3V4UH 4LIQH 3M07A 4X99A 3MCKA 5GS0L 3FU0A 4EDWH 2ZAHA 1MUJA 5AW7B 4QRSB 2D3VA 3FB5B 1W91A 2V2TA 2YGVA 5E8OA 4QYAA 3K6SB 3RWJB 5I5RA 3ARGD 3ARBD 4WVRA 5MEPA 2B14A 4YHZL 2XQBH 5DRNB 2BIMA 3SYCA 5HYJB 2W94A 2NX5A 4GQ9L 3FO0H 3QW9A 4N9GB 4YK4C 5T1LB 4A2HA 1D7CA 1R3KA 2W88A 1T1WB 3AJ7A 4KDTA 1NDMB 3AWEA 3LZRA 4IQHA 1AGBA 3T4YB 4DH2A 4WWKB 3EOBA 3D18A 1D6VH 1V3KA 2F54E 4GKLA 2BNRA 3DIVA 4W68A 4AL8L 5ADPH 3PHQA 4PJEF 2ITCB 4K0OA 3B9KA 5I1JH 2YGQA 3ASOB 3SGEI 4C56D 3TNMA 5H37G 5IMKB 3MRDB 5FYJU 3BD4A 1UM6L 2E4FA 3GMPB 2YO3A 5AALA 2X4SB 4Y4HA 2B4CL 2XPGB 4Q6KA 2E9GA 4DKAA 1U2YA 3QQ4A 4HG4J 4N4YB 3NK3A 4WV1C 3V0WH 3KWXA 4NWUH 4WUUA 1GR7A 4Z6AT 1PKOA 2BO0A 2MHAA 3C5SA 4M6OH 5CHNB 1R0AL 2WAQA 4PLOB 4JPWH 4BZ2L 1UWYA 3RVUD 4PIRF 4JFXA 2XG5A 3MO1A 4HJTA 4W9GC 4O58H 1QR1B 3Q7JA 1M6UA 3WMSA 1FGVL 3VXRB 5DJCA 2QR0A 4JFDE 1E5AA 5C2BH 3DV4A 4IOIA 3IJSB 1GMEA 3VWKC 5JIQA 3OKKB 4JJ5A 1COBA 3WFEH 3UP1A 1XH0A 2FJFB 4HD9A 1FFPB 1CDHA 4ZUTA 4TVPH 3AG4B 3BGMB 3RUGB 1L5GA 3ULSA 1AZNA 1OW0C 4CSTA 1VHPA 5DJYA 4KOCA 1VAHA 3O9WD 4QJ5B 3L3KA 4FI8A 3VAEA 4F7MA 3VFOB 3EJSA 5K69A 1QTPA 3FQNB 4BM7A 2W95A 1A65A 4JY4B 1RZGB 4FFVD 4GRWE 3JT0A 2DM3A 1QRNB 4NKDA 3VG9C 1P0SE 4DN4H 1YEEL 2R1XA 3K5SA 5KUKA 4JM2B 4GIOA 2XQYA 5CBAB 3SBWC 1U0QA 4MRCA 2MOGA 5DQ9A 4HUCA 1TQVA 4ECNA 1X9UA 3UIYA 5E2TH 4J3XA 3MJ9L 4OLZL 5JW5B 2Y5TB 5ABAA 1M57B 4LHQB 4IRSD 1QBLL 1Z66A 2PCYA 4FQQA 4U33A 3UO8B 4CDHA 3VYOA 4DQOH 4ZMPA 2CDEB 2DDQL 5KTEL 4EN3A 5C07E 1GAFL 4S11A 4C54A 3FQ2A 3P4NA 2A6KB 3KXFD 1FLRH 4NT6A 4PQXA 2JKNA 4LVHC 3WEOA 1IM3D 1A4BA 2P5EE 4FMVA 3MCLL 3CX5J 3BUBA 3QUXA 4KKAD 1CE6B 4PJXA 4YO0B 4YFDB 4YIQA 5ERWA 2Z31B 4FQLL 1PLGL 1XGTB 4S2SA 5I15L 3NDYE 1GPOL 1YMHB 2QPSA 4LLQB 2CLZA 3T0BA 5I16A 3AVEA 3I6KB 8CGTA 5AOIA 3S2AA 2FX8H 5B3SB 2QFRA 4N2GA 2IPUK 4C83A 3KPQA 4J28A 4C55A 1BFOA 1ETZA 3RGVD 2RD0A 1I9IH 3VXNA 2AGJH 2B39A 5JA8B 4JFFB 4DGYL 5KBKA 3QO0A 2FATH 3CDFA 3FU7A 4OIAA 3MLRH 2HCZX 3L5WA 5TH2B 5CO1A 4P4RA 2VKWA 5DDHB 4GRWF 1MWAB 1QFWI 3FB8B 5KANG 4WSJA 4NLHA 2F5AL 3BOVA 4FQPA 5I5JA 5EZPA 4M6NH 4PS7A 4KZDH 1HC1A 1JFHA 4K55A 1OCWH 3P1VA 5JHBA 1IEAB 2EIJB 2FYYB 1P1ZA 3ZXAC 3MNWA 5E6RB 1SVCP 4FTVB 2YPKA 4TNVF 2C3VB 5E8PB 1WA1X 3WU1A 2BRRH 3ECBB 4YGAB 3A4AA 4XO8A 1GIGL 3VW3L 2AJ3B 3OJVC 3DTXA 4OLVH 5ICZB 2W9LA 1I1CA 4POUB 1GXEA 3COOA 4WJKB 2GTWA 1S7UB 4WI5A 5D1XB 3O4LD 3TJHD 1GGUA 4KAQL 5CIPH 3GMLB 3RIFK 4JM0A 3QIBD 3HA0A 5C0AB 2IBBA 2AXFA 4NPYA 4EI5C 1TENA 2CCVA 2FQDA 2IMNA 2E7CA 1MH5B 2HX8A 1IUZA 4P5TA 2AW2A 5HYEA 3U7WL 3C9NA 5D7LD 3GSNA 5ADOL 2R9HC 5LBSA 4AC4A 3EYFB 4N2BA 1T04B 1E5UI 2K3HA 4R8WL 1B2WL 1LE9A 3LPFA 5EPMA 3M6DA 2XA8H 2MCAA 3HZKA 1NWPA 1ZLSH 5AW5B 1XR9B 5K9KB 4E9QA 2X12A 3U0TA 3NRPA 2XN0A 4U1SB 3OXSB 1HSAA 3UGEA 4BBWA 1BQHB 1GGCL 1UM5L 4AVKA 4OIFA 1JZ6A 4J5VA 1W8OA 1ZK9A 2LV4A 2BC4B 3MLSH 1JHLL 5FYJL 3IJ8A 1EXHA 3TTYA 3FONA 3V9EA 1O6VA 3HIZA 4I1PA 4PJBA 5IEKB 2WBKA 3CPLB 1G7PA 1E7VA 1W8EA 4IRZH 3S35L 1F13A 3U2SB 3IFNL 3HZMB 2YGNA 3E6HB 3GB7B 5CN2A 3K46A 4G1EA 3OGCB 3ZT7A 4J6RL 5DWUH 5B4MD 4YHLH 1IBGH 4WUKL 1GYUA 4WNJA 2WBJA 3BUPA 1BVNP 4KQ4H 4XTRC 1KJ2B 4HH9A 4XP9L 1G4RA 5IVZB 2I26N 5H2BB 2IDFA 3WXWL 1PQZA 3NCYP 4UOJA 1VGKB 5GSRB 5I0XA 1EVUA 2N7SA 3GRGA 1BAGA 1YY9D 2X40A 3PDDA 4UOW1 4WW2F 1CF8L 5MEOA 4OZFG 3O6LH 1FNLA 3Q9PA 2AANA 5AYTA 5DFVC 3Q1SL 5G5DB 4Z78A 5CKGA 1JGIA 2J12B 3MTXA 2X9YA 3PWVB 1ZE3C 5J11B 4KXCA 4UYPA 2EUXA 2CGYA 1OF2B 3GMMB 4N3UA 2OTWA 1I1RA 1MCSA 1AI1L 4MLIA 5TTRA 2H3KA 5DURD 2PXYA 1F86A 1NGQH 3CZJA 3FZUC 2VDLL 2IQAA 3L5IA 4HAFA 1UGNA 1W0YT 2GHZA 1YNKH 2IAAC 4JFED 3HR6A 3UJJH 8FABA 3CMOH 3UBXB 5D9SA 5EU3B 1XSOA 2WYZA 1HEJC 1YNLL 4M5ZH 4JFPB 4HJ0C 4MA8H 3O6FA 4XPFL 3SO5A 2ICWJ 2FZ3A 3FUEA 1YECL 3HPLB 1R5VB 2PW2A 1CXHA 4YXHH 1CLYH 3CC5A 3GXDA 5HHXH 2Y1YA 5F0PB 2Z0BA 1QFWL 3N85H 1U8PB 3LQAL 4JFZL 3VQLA 3NEXA 2EE0A 4NQVA 1KPVA 2OSYA 2B1HH 3CWGA 1WBYB 1YHPA 4NNPL 5EUOE 1ZJBA 5GHWH 3T6QC 1IIKA 5HHOE 4X5WA 1XGPB 1OAUL 4HS3B 5INCA 3FT4A 3NJIA 4Z7OF 3C60B 4OFPA 2BFVH 2WYHA 2A9DA 4L8BA 1I85C 2ZX5A 3II2A 4M48L 5F3HB 2EE3A 3BZ4A 3CDGA 32C2B 2BVUA 5GQBA 3H1ZA 1MW1A 2ADIA 3MKGA 4LXFA 5F89A 3NIFE 4EQ3A 2F19H 1M6OA 4HT1L 4TNEA 5D71H 3EGSA 4K23H 2C1PA 2BOCA 2BNQA 1M7DA 4JKPH 2VXTH 1ZHKB 5GGRB 3NFPA 3OKDA 4RMBA 4AEFA 4ZMNA 2OQJA 3LAFA 5I6XC 4LKXA 4RGNC 4LDEB 1HOCA 2CK0H 1A14L 4IK7A 4FQXA 2VLKD 2J5LB 1E42A 1OSZA 1MAMH 1TPXB 2IANE 4L4JA 5FKPB 3QDMB 3DMMC 4Y5VB 5FF6A 2MKWA 1OOWA 4GT0A 3GSUA 4I2XB 2NNFA 1DUZA 4MKTA 5DTFB 4PGEA 5MI0B 4PY7B 1BZ9B 4UNTA 2ORBL 3SKUD 3UJIL 3C09C 4RSVA 5EUOF 5IEHA 1KEMH 3UO1L 3WKYA 2DWDA 3VWKD 4WHCA 3I85A 4RVBA 1U8IB 5SX5H 4OZGE 3LEYL 4LEOA 4YHNA 1TJXA 4PB9L 5L9DL 4PGCB 1CB4A 3L4CA 1TTCA 3FTYA 2Z7UA 5E5RB 1IBDA 5A6LA 4AM0A 1O9WA 4OJCA 4G6FD 4BELD 1D5ZB 5FUCE 4GRMB 3ZQXA 2JKSA 1IGFH 1FHGA 1KYUA 1FZOA 1OP3K 3F3HA 3QIUC 4JZNB 5DUJA 5DJXA 3TJPA 2HUEA 3QWRD 5SWZE 5JO5A 4P57B 4F33B 3NIFF 1GC1H 2QJDA 2VN5A 3QJFA 3GSRA 4H88L 3RNKB 1JRHH 2VDRB 3RWDA 2OTPA 1TNNA 3SGJC 3VFWB 2UX6A 5JLZB 1MIEL 3HG2A 3H6AA 1P4IH 4IHBA 2XQ0A 1MPAL 2EP6A 4U49A 4Y16C 4N20A 3H53A 5KSBA 4YAQB 5AYUH 1V3LA 3WJJA 3WHXB 3VI4A 2ZOUA 4F37F 1LMIA 4I4WA 4CSPA 5A1AA 4BHUA 1TQWA 1N19A 1ZXKA 2ENSA 4J3OH 4QF1A 5IBTH 4DAGL 3I6LD 2OR9H 4Q2ZB 3DX9B 4GW1A 1DUYA 4XHJD 5K33A 2JQZA 4Z7QF 5G4MA 1WWAX 5T3XL 3ZUCA 2FWOB 5K5YA 3I02B 4HKJA 1PZAA 2X88A 4MVBD 1CI5A 5J0BA 3RG1C 3O6KL 2J8HA 5CJQL 3NIGB 3VWJB 3WS3B 5FYLL 3ARDA 3T77B 5DZOA 4PMEA 1ETB1 5GS3A 3F7VA 4HBCL 1SMOA 3DX7A 4YOKA 4HPHA 2WV3A 3IRCA 1TQTA 1XTMA 3SE3C 1N2RB 4LLWA 4K94L 1Q94B 1KCUL 2PETA 4XCFH 5IR1B 1SYVA 4UZGA 3E1F1 3LKNB 4JPVL 2ZCKH 5D4QA 5I6NA 2X53A 3MLXH 2ICES 4I0PD 4RGNE 3RLSA 1OK0A 3MREA 1GZQB 4RFEA 4E5XA 2FD6H 1JHKH 2P80D 3S3SA 3O2WH 3G5YB 3TP4A 2A83A 1TYEB 3HNVL 3SPGA 4ALAC 3QPQC 2FEEI 5EC1A 1LMKA 1QO3A 4PRHE 1UD5A 4HFUL 4AWJC 4LCCB 3IDJB 3IJEA 3PPSA 4NQQA 1KTDB 1GJWA 5CR8A 3ARGA 4F7CB 3ARBA 1QUNA 3NFSH 4Y4KB 2VSCA 4XRCB 3SKNA 4LSTL 2QMKA 2GEEA 4N8VB 1NM9A 2YD1A 5FUZH 4PGJA 4KDWA 3RWGB 1KELH 2GJ6D 3PJSB 5T3ZE 1IAKB 3N1MC 4WI3A 1L0XA 1S8DB 1QFUL 2MQ3A 2NW2B 1RK1B 4G2AA 3AU1B 5EUKB 2NXZD 4N0FB 5GS1A 4PD4J 5AG9A 1QTSA 5B1KA 2XPYA 3II3A 4Q97A 1W6WA 1XCQB 2AK1H 4XC1H 4EI5D 1AZBA 2UY7B 4X2UA 5D2NC 1TLKA 4J3BA 4NKIH 5TE7L 3VXMB 1Z3GH 3V7AG 3NUKA 3QG7L 4AEIH 4C56A 4WU7A 2CQVA 4Q6IA 4F8QA 3MBXL 1BZQK 1CVRA 1ECYA 5DMJB 4ZOBA 3VO0A 1CFVL 2MRYA 2R9HD 4PTTB 4M02A 1NKGA 2XVLA 1I8LC 2HVKA 4M4RA 5LN8A 3BH9A 4FNUA 3QCVL 1XXDC 3GSXA 43C9B 1OAKH 3ISYA 1N0XL 4LOUC 2NZIA 1NMCB 2NCEA 1AHWA 3NAAH 1JXJA 4F1ZA 3O0RL 4ZPTB 5TQ0H 5DMIH 4L8DB 3I3EA 1CD0A 3F01A 5I66A 2VNCA 2E7HA 4JL1A 4UZSA 2QQLL 5B8CC 1DQML 1HI6B 1MCCA 1TZIA 5EEVA 2R2BA 5I6PA 4OQTA 4YBHA 2X3AA 1PS3A 3FSWA 4JVPA 5IQLA 1WF5A 1JWUA 2PP9A 3K0WA 4G9FE 1BBDL 5E9NA 3DTUB 2DQEH 1MCPL 5EU4A 5CEZL 3PNRB 3BJ91 3RTQB 1AGFA 3W9DB 2H9GB 1DFBL 1IJNA 2EXTA 4FNPA 1TSRA 3QRBA 4BSWB 2E7LA 1ACYL 4XTRD 2IOMA 4NIKB 3O9WA 3BIBX 4N8UA 3UTSE 4XVUC 3HHSB 4TMPA 1G1KA 2V37A 1NCAH 1TTFA 2BOLA 2JJVA 2VDQH 3IETB 1LLAA 2WYTA 3AG2B 3NCBB 4UAOC 4XWGH 5F3BB 5IGXL 4QD2E 1JZ8A 1LEGB 3VXSE 4R4BA 3G6AB 4F15B 5CWSB 5AD0B 4OLXL 2NY4C 2A0LC 5L7XL 5DFVD 1WAEA 4P5MB 2KKQA 1UJ3B 4KK8C 5D72H 5IV2B 4P59H 2BZDA 3GSQA 2ED8A 1AXSA 4ZMVA 2D73A 4IRSA 1NCIA 3JTTB 4U0QB 1DJXA 3JV6A 2DBLL 1FIGL 2DQCL 5FO2A 1U9KA 2HFFB 3ABKB 1FL6A 3MRLB 1I8IB 1UG9A 2N59A 5C0BE 1OTSC 3HE6B 3FZUD 3KXFA 3WSQL 1ED3A 1IM3A 2W1NA 4M3KB 2X4QA 1AQDB 1E43A 4PJHB 5EOTB 5IHUL 2AV7A 2BNUA 4U4BA 2GUOA 3FO1A 4HQQH 4IGBD 1NIEA 5D55A 5FYKD 1C8PA 2YOAA 5FHAH 1XCXA 4IMKA 3GRWL 4HJ0D 5D2NE 3IJYA 2VAJA 1KB5B 2Q8BL 3VRLF 2V0AA 3NP4A 5BRQA 4LARL 3C08H 4DIXA 3DGGB 1DVYA 2BHUA 4LLVB 3FFDB 4UB0H 5FB8B 4WJ5B 1T1ZB 4QGTA 1JGEA 2WXIA 4UOW0 2SODB 3LV3A 1JZFA 3RGVA 4QRTB 2XZAH 4U6HB 1QWUA 4U1JA 5CN1A 1NGXA 4AQ1B 3FUIA 3GM8A 3GLAA 2XXGA 3ULUH 4S0TD 1WK0A 3F5WA 2KDYA 3KWVA 3DUHA 3ATAA 5DJ2B 4LOFA 5F9AC 2CRMA 4U1LB 4HWBA 1YC7A 4NO2B 1PY9A 3QZNA 5LN4A 1AXTL 2AK4E 2J1WA 1MCWW 1U3HB 4UT7L 3GSNL 3KGUA 5DZJA 4AIZA 2F68X 1P5UA 2NOYA 3T04D 4Y19B 1USZA 2IH1A 2CBMA 1MCKA 4HGWB 4ZUSA 1O7SA 4N0UA 1J9QA 4AVIA 4EZKA 1BD2B 1IAII 4PJEA 1NUNB 5DGRA 2HJFA 3ALWA 4LCIL 4EN2A 1JMXA 2ZUUA 2DQGH 2HVJA 4YDJB 5KS9E 1KBBA 5KEZA 1TVBB 2BOBB 1GY2A 3B5GA 2BIQA 3DX6B 4MAYC 3LD8B 3G5XA 2OMWB 1P9MA 3NP3A 1Q9WB 3AROA 3O4LA 2O4EA 2DJMA 3Q8EA 3QIBA 1FDLL 5EORL 5FK9A 4PJGB 1RUQL 5I1EL 1LE5A 5HDWA 5IUCA 5DZNA 4X4ME 2AJUL 2FO8A 1NOAA 3AABA 5GPRA 3AM8C 4HK3J 4PJAB 1H6UA 3F12A 4S1QL 4F58H 1ZTXH 2CLRA 2HJKA 1GY1A 3DMMD 4YSRA 5HYSA 3HC4L 1UOKA 4LDCA 2DM7A 3MNMA 1PTZA 4X6FA 4XOCA 5D7LA 4BWUA 1TITA 3BH8B 3CLEH 4PRIE 2QKIC 3B2MA 5HXMA 3NSYA 3QT2A 2OMYB 4LSPL 3MBEB 3TASA 4JY6A 4D2NA 1O7DE 2OTUB 1SOKA 4IU3A 4XP6H 1TZOA 1VKXB 1J86A 1CYXA 1DN0B 1F41A 4HIJB 5AVSB 4TQHA 3CQPA 1KTRL 3VRJA 5E9AA 4N8CH 3VD2A 1DFXA 2AERT 4PRBA 1E6OH 4YEFA 4MA7H 3ZYOA 4QO1A 1M05B 4WFED 1SDDB 3DGDA 2NY0D 2WSKA 4JG0H 4HEME 4FA7B 1AZVA 2J25A 3SKMA 3K74B 3NTCH 4OZHE 3V4VB 3WEXA 1YY8B 2YAPA 1A9EB 1DEDA 3WMQA 1DJIA 2HH0L 2EVIA 1IQDA 1KLGB 1Q1JL 4L4TB 3GLDA 2X70B 1UT2A 3NG5A 2RAMA 4JJHA 1KTKE 3L5XH 4Y9GA 5KS9F 1PYWB 1BMGA 5F97E 5AZEL 1CIUA 2JWYA 3FT0A 3W2DL 2BY0A 2VM9A 4P4KC 4LE8A 3WAJA 5B39A 1I1AC 2AVFA 3PWPE 3TBBA 2APXA 4QHPA 4ZYKB 1DVFB 3V0IA 3H7BA 4OCYL 1OB0A 1RZKH 3QIWC 5DJAB 5AB0A 3MGTB 1UZGA 2YPVH 4Y16D 3WUZA 1E0OB 2WVTA 3P77A 4HPYL 3UBXG 4JG1L 2NY3B 3V6ZB 4L8CB 1EGJH 3BWZA 3GJFA 1THAA 2OI9B 5IQOA 4WK2B 1DANT 4NFCA 1JNJA 3DX4A 4P5SA 4F7KA 5SWQB 3AGWA 3VX0A 5ESVA 1JWMA 1MHPH 4Y5XB 2XBDA 4JJOA 2VRAA 4HKBB 4I9WD 3PS6A 3WE6A 4N8PA 2EIZA 5FOJA 3IDGB 4FFWC 1XIWB 4MJJA 3TM6A 3V6OC 2YHGA 1JD7A 2WINB 3CE1A 4KQ3H 4KTDL 6FABH 3ESOA 5A40E 2XA3A 1OAQH 1EK3A 1E2VA 5AAPA 1GTFA 3TEYA 2VDNH 3OKLA 4O02B 4DZBA 4XT1C 3NCJL 3KPRB 1JZHA 5GGTH 3S8WA 5BZDB 1HT6A 3B9AA 2FECI 2BSBA 2IGTA 4JFEA 1DQDL 1RULL 4YSEA 2WVVA 1SOQA 1A7RL 3A47A 1SY6A 4OGXH 4DGWC 1IBBA 4OZHF 2DQFA 2Y2TA 3QQ3B 4QHNA 3CC1A 1TJGL 1S5IL 3U46B 4Z18A 4LVOB 1PG7H 4Z7AA 5D96C 3NQKA 2MCMA 1QHQA 4F8TA 4DF9A 3GSOA 4NNXA 3KG5A 4LL1A 1XF5B 3LKSB 1RIVL 2H2PC 4WK4B 5HJ3B 1YJDL 4LPXA 2APWA 1AQ8A 2O5XL 4G7YL 1GGTA 4BFJA 5LWYH 2XDHA 3PV6B 2F53B 4L5FH 3L48A 4ZS6C 4FYRA 4ZODA 4MA1B 2Q7AA 2EEDA 4GLRH 4H0GA 1FZKA 4ZFGL 5IIEA 3TJEH 5JOPE 5FV1L 1QI5A 4ADJA 2B9AA 5F72S 3F6LA 4D9LH 1KYOK 5ICXA 1MFEL 3QR0A 1YAIA 2W9EL 4XVOA 2EDDA 4LQFL 3T2NH 2Q8AH 2WKOF 3AAZA 2ATPB 5E5MA 3BT2L 3H3KA 1CICB 3HG1D 9CGTA 1F18A 4F8PA 2EYRB 2CBPA 1MCOH 1FO0A 3SY0B 1NFDA 3EBAA 3WFBH 1U3NA 3FULA 2VN6A 2LU3A 4PEEA 3LJ3A 2FEJA 2AJZA 4NHCL 7PAZA 2CKNA 4HIHB 2ZYHA 2WLIA 2NY5C 5DUPL 1NC4B 2J7LA 3QHFL 2WPGA 1X5JA 5CCKH 1C5BH 1A5FH 3P9MB 4NNYB 4UBDC 2HFEB 3BP4B 5BZWA 2VLKA 4RBPK 2P1YA 4K3JH 1RZ7L 3HMXL 4IDJH 5CMAB 2AZUA 4OJYA 4BXVA 4ANVA 5DRXB 2D0HA 3QJQB 4P48A 1SJXA 1GHFH 4FXKB 1F1GA 4PIBA 2F74B 3H54A 4X9YA 1U8HB 2YFOA 3SKOB 3UBGA 3V6OE 3VWKA 4ONFL 5GS0H 3AQDA 4UM9D 3TURA 1ZVNA 4QRUB 2ODHA 1LO0L 2ZUSA 4FYQA 1ZHBB 3UEQA 3IF1B 1OW0A 2JI1A 2IAMC 1M9WA 3CN3A 4LCWE 4E9WA 3QXTA 1KBPA 4YHZH 1FNEA 3SQOH 4XVUD 2KLSA 1T21A 2H5UA 3BAXA 1OP5K 1N9PA 1ILUA 3QWRA 4GQ9H 1IL1B 4JY5L 4XNBA 1IGCL 1J8KA 1ZWIA 3FOLB 5F7NC 1FP5A 3UZQA 4AENA 3I75A 1QLRA 4LIQE 4YBLB 3VSUA 1QPPA 3SBWA 2OW7A 2O6FA 4FX5A 4AL8H 1XH1A 3L17A 4CJ1A 4KK8D 1BLNB 3JSSA 5T1KB 1AZRA 1VCAA 3TV8A 4I9XA 3VRIB 1P6WA 1YN7B 2NUTB 1J11A 3LQZB 4DP4X 1KDIA 3H3BC 3WY3A 4LLDB 1UM6H 4NBZB 3QNZA 3D05A 4HJGB 2B4CH 1EUTA 3L4XA 1WFJA 4PR5A 3DHPA 1LO4L 5DQDL 4XMXA 5F7BA 5EBLA 4Y1AD 4YHIA 5C3IA 1WFUA 1C7SA 3ETSA 3GXNA 5DZPA 1A6PA 2CO4A 2ZX6A 1A6WL 4J3TA 3CHQA 4OUUA 5GJSL 2FT6A 4XP5L 4B9JA 1O9VA 1R0AH 3P3TA 5C09D 3ZE1B 4LNRA 2QHRL 4KRLB 4BZ2H 1JK9B 1CGSL 1CFQB 5I18L 1WITA 1N67A 5K9OB 1WWWX 4N8VG 1FGVH 4UM8A 1E65A 3G3LA 3IFOA 1A9BB 3H8NA 1R3LA 2BS71 2EO9A 4L4VE 4MJIE 1PL3A 4HLZG 1X5MA 3X13B 1XR8A 4I0PA 4G42A 4WWOA 3ZDYB 5J7CC 4U6YB 1HJCA 2P80A 4DEPB 2XTJB 4K5MA 4BINA 1ZHLA 4LCUA 3NJKA 3LZOA 2WLNA 2XWBA 2QPEB 3CD4A 2FSEA 2CNYA 2VWEC 4XN4A 3SBRA 3STZA 4QT5A 3KPLA 3PFQA 4B9YA 1EFXD 3PP3H 4DKTA 1W0VB 4FEMA 1WISA 1KBGL 1YEEH 4IHOA 3QJXA 4GIAA 3W0WD 1CUOA 4TVPE 5BW7A 4R7DA 4Z7UB 1FVDA 2GJ6A 3D6GA 3MJ9H 4OLZH 4QR7A 5EH1A 1LILA 3AWGA 4R7NB 4OQTL 1QBLH 1ZAGA 5DEFB 4OFVA 1G7QB 3UC0L 2DDQH 5KTEH 2PCFB 2XV3A 3HZYA 1GAFH 3BRDA 4XBPA 1W72B 3UMTA 4EI5A 1Z5LA 1PJ9A 2QADB 4NRZB 4Y2OB 1PZ3A 1KCRL 4MMZC 3BHBA 1DJSA 3GINA 3MCLH 1HL8A 3BI9X 4KI5C 1F42A 3AITA 2EEXA 2Z93B 3MNVA 1WZAA 3TESA 2VDKB 3EDFA 4FQLH 1PLGH 4H40A 4YC2B 4U1GC 3ZZQA 5IJVA 1JYXA 5BQDA 3QDJB 2CO6A 3E9UA 1S9YB 3U4EA 1G84A 2ADJB 5E6ID 5IHWA 1F6LL 2V17L 1DBBL 5BRZD 4QHMA 1ZS8B 3L3GB 4JO5A 5HHMD 5E56A 3QAZB 3KEHA 1GYCA 1ZXQA 2F2HA 2GIXA 4I77L 2I24N 3BCFA 4DGYH 3HAEB 1YQVL 5KN5B 1NDGB 2AEIT 1YYLL 4HETA 4R0LA 1P4LB 4HLEA 1G9MC 1VACA 4RAHA 3ENEA 4HCIA 4BFIA 2O72A 5SWSE 3KYNB 2F5AH 3SPIA 2WIIA 1XZWA 4WY7L 2EVJA 1WE5A 4XCEA 1TTAA 5J12B 4KROB 3FKUS 2HVBA 5DRZB 1BFTA 3FUMA 1A4KB 2UZPA 3T65B 5M7QA 4P4KD 3IXAA 2E74C 1T89C 5E6SB 1JHTB 4NRYA 4XBGA 1RJLA 5J13B 1W72L 1H5BA 1I1AD 2X4PA 3U9WA 3TS8A 2ERJC 3QIWD 5C0GB 4NN5B 1A3LL 1EZVX 1RZJC 1GIGH 3FNKA 2P8PA 1FVEA 4LKCB 5HHVL 3VW3H 2FJUB 3C6LC 3DX1A 4MWFB 5HGHB 2P5WE 3IAQA 1AO7D 3D48R 5LBVA 2JSFA 3PQYD 1JNHA 4Z7NE 4U1KA 3FCTA 3T0EB 4FN0A 3NN8B 1IVLA 4KAQH 3NJLA 4JRYB 4FLRA 3FTWA 1F3RB 4U7MA 3DX8A 2WCGA 5ETUB 3MJ6A 1NMBL 1H6FA 1N8ZA 3K6OA 1T0NA 4JM4L 2Z91B 1PW3A 1WH0A 2X1PA 2XFXB 4FNSA 3U7WH 1NAMA 4PP2A 3MV7B 4HWBL 4CA4A 2P42B 3G5VA 2FB4L 2IDUA 3IN2A 5ADOH 4R8WH 1B2WH 1OCZB 2KDGA 1LK2B 1KGYE 1SXAA 3X3GL 4M29A 3LKRB 5J1SC 1KXQA 1BBJA 2VO5A 3MJGX 5F7WC 4AQEA 2W91A 2MTAA 4B0MB 3KVPA 2J43A 4QTFA 4WZ9A 4AQ8C 3TO2B 4KKPA 3EYVB 1GGCH 3WL9B 1UM5H 3C6SA 4N26A 3THML 4IU2B 4HIXL 4Z5RB 4NKQB 3MV8B 2CXGA 2VN7A 1JGDA 4NO0D 3QBTB 1JHLH 5FYJH 4F7EA 4A2DA 2RQ8A 3X17A 4B9PA 3AB0B 1H8OA 1NBYB 3PGCA 4KI5E 3UG3A 1BMWA 2CR0A 5A2AA 3PREA 1LM8V 2D9QB 4HUVA 1SF3A 3S35H 4ZW5A 4A6YA 2H2PD 3IFNH 3A6BL 1Z3RA 2EQDA 2AFNA 5CFAA 4WW1A 3KJ6L 4QXVA 2Q76B 3M17B 4J6RH 4M1GL 4WUKH 4CMMB 5IFHL 4Z7NF 4NBXB 1UCBL 3QVAA 4NQCD 1U3YA 4K4KA 4XP9H 5C08E 1LWRA 2G0KA 2JFCA 3EJTA 3L1FA 5JMOC 3WXWH 3S37L 3BKYL 1TO5A 1I85A 1HCFX 1OB1A 3IN0A 3BEWA 4P2RE 1CF8H 5J6GA 2NUPA 2ISDA 2X4RA 2P26A 2DIBA 1S46A 4M61A 5ANMA 3Q1SH 3ECWA 1QEWB 3BAEL 3HZVA 3KYOA 1R5WB 2JK5A 2ESVE 5LG6A 1CWVA 1AIFB 1OGAD 4IEFB 5FKAB 3T8MA 5EO1A 3TL5A 1N4XL 2XNAB 1KJVA 2OMVA 1CLOL 4BA8A 5T1DL 2ZG1A 2HX7A 2CO2A 3K7UA 1AI1H 2HJLA 5HGBB 3TYFA 5E08L 4UBDD 2Z3FA 3N40F 2GK0A 5DLML 4ZG1A 5I71B 2NXYB 1HU8A 2VDLH 2P47B 2YA1A 3M1BA 4PJFF 2CBQA 3WNKA 2BERA 2ZOLB 4YX2L 1F4XL 1ADWA 4KI5F 3DMMA 1M7XA 1K8DA 4JDTL 1JK8B 5C86A 4RZCA 3DKHA 1YN6B 2JLPA 5BV7B 1G1CA 1YNLH 3OPUA 5TDNA 4ORGA 2YGOA 4XPFH 1NSNL 3LRLA 3CFTA 5FS5A 3D1MC 2OW6A 5AOZA 4DGIL 3KL3A 3EF7A 4M9PA 1YECH 2XG4B 4ZT1A 5DYFA 5E9DD 1G1OA 1MXGA 4E9SA 1XV8A 1CN4A 2Z35A 4HOMA 1N8OE 5TFSL 4MSWB 1QFWH 5IHZB 3LQAH 4JFZH 3W9EA 1J18A 2H7WA 3L4VA 1JXFA 1XD1A 4OJDH 4NNPH 4J2XA 4JREC 1GL4B 2IAMD 3VD3A 2W80C 3L95A 1S78C 1G7IB 4G6ML 1OAUH 4Y2DB 1FL3A 1P84K 2IADB 1XH3B 4BD4A 1BQUA 4NUPA 4OZIE 4HWNA 3E2HB 3FQUA 1GC1C 3RWFA 2VLLA 3STLA 3KDMB 1EXUB 1TETL 2H1LM 3GWJA 3BP7B 4TQEL 2W0KA 4Y9FA 5ITFB 4ENEC 4GMSL 1WS8A 4M48H 3SGJA 2JKWA 3Q44A 4EKXA 2Q3XA 1OGSA 1X44A 1SY6L 1T5WA 4F2ME 3FQRB 1WD9A 4MCYA 3P9WB 2B0SL