3QWRA

Crystal structure of il-23 in complex with an adnectin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
304
structure length
295
Chain Sequence
WELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQKKDRVFTDKTSATVICRKSISVRAQDRYYSSSWSEWASVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/cytokine
molecule keywords Interleukin-12 subunit beta
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 295
sequence length 304
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA03
3GJFH 5A2LH 4KHXL 1T3FB 5IHUL 4NFBA 5J06A 4GRWH 1UCBH 1GC1L 4MDIB 5KVMC 4S1DC 2PYFA 1WWBX 1GGTA 3P0GB 4ORGA 1T5WB 5D6DA 3BPNC 2X4PA 3QCTH 2BY0A 2P7TB 1E6OH 4PGDB 2E7BA 3DYPA 4IMLB 4YGVB 3SCMD 3ARGA 4OFVA 5D6CB 3B2VH 5C6PB 1AH1A 1UJ3B 5CSBA 1MCPL 1SY6H 4NKOA 3L1OH 3GIVB 1U93B 5F89A 4JRYE 4MVBD 1ONQB 4U7KA 2FSEB 4LLMA 5IFHH 5DHVA 5GGUB 1P2CA 4FXKB 3TBTB 1XGRB 1RZGA 1NUDA 3SGJA 3LHPH 3PWVB 2WZPD 4IMKA 4HMEA 2FZ3A 3U9PL 4J3UA 4CNIA 5E2WH 4ISVB 3I2CL 1S8DB 3HZKA 4DVRL 4PR5B 2BJML 5D5MB 3F58L 4BH7A 5FUZH 3RZCA 3KPQA 4TSCH 3GO1L 3DXAE 3VXMD 2B1AL 3OWEA 4KUCD 1NMBL 3QIBB 1T1WA 5HVFB 1J0YA 2AK4A 1MVFA 5C0CA 1MIML 5KSVB 4GG6B 2CDEB 3BD5A 1NFDE 1E0OB 2E6QA 3PG2A 3DUUB 4LCWD 1GZQA 4DVBA 3GHBH 4XNZC 2CXKA 4NSKA 3RGVB 3IDNA 4MJ6B 1WFOA 3CZJA 5EO9B 1QLFB 1V8HA 4JPVH 1QUNA 4P2QE 4S10A 3U7YL 3UPRB 3PDOB 4Z7WF 3O3EB 2X4UA 4MJIA 3U30B 2HLFD 3C2AH 3OHXB 3BGMA 1M7IB 4WU7B 5FGBC 4YHPB 4N0UB 1U8LB 5J13C 1BJ1H 1TZGL 3HI5L 4AT6B 4P9HH 2DYPA 4I0PC 5BRZB 3G9VA 1FYTD 4U2ZA 1VFAB 1A0QH 1JL8A 2IPTH 3FT2B 3FQNB 3DTXA 3CX5J 2EKJA 1EHAA 3UYPA 3VI4F 3FQWB 5EN2A 4LRNH 4PJ9C 3SE9L 1CBVL 2NYYC 4AMKL 3KPSE 4JREB 5JDJA 2GITA 2AJVH 2XWBA 2P45B 4S2SA 4U2YA 4KV5E 5LCVL 4HC1A 5HXMA 5IMLA 1CYGA 5T3ZL 3UJIH 1JPST 3HC4L 4IIQA 1SVZA 4C56E 2IFGA 1RUQH 2IQ9H 4RA0C 3WO4B 4F2MB 4NRXA 1EO7A 4PJAF 5ESAB 2X4QA 3MBEA 5AYUL 4OZGA 1FG9C 2DWDA 4FZ8L 5C9JA 2R2BA 1T0PB 3PDDA 4RGOL 3OJ2C 2XQBH 4ODBD 2B1HH 2DBLH 3O2DA 3WKML 4WY7L 4BK5A 2CDGB 2HN7B 2OTWA 5I1KL 1EUUA 1FL6A 4BUHA 1TCRB 3B3IA 3KYOB 4N0CD 3G5VA 3K2MC 4JFYA 1XGQB 4Y16D 4WI8A 1KGCE 1NANH 1RZIB 1FVEB 1MJUH 1NUNB 3JWDL 4G80B 3HR5B 1QBMH 4EQ3A 4XHJD 2DKSA 2D0HA 4QHLB 3G6AA 4V1DA 4W68A 3F5WB 1KT2A 2HKHL 2VIRA 1YY8B 4GAGH 4OCYH 4XMKL 5BO1L 4BQ6A 5DJ2A 3CZFA 4XPGH 2FCBA 1WEJL 3KXFB 1X44A 4OZIA 3BP5B 3GZKA 2R0LL 3WD5L 2XKSA 3NTCL 4JVPA 4LDOB 1N6QH 2DRUA 3MLVL 1S7QB 4WUKL 2DQCL 1EAJA 3T0AA 4HUXB 1WBXB 1HK6A 1FL5B 5E8EA 5HHOE 4GFTB 5K33A 5E6YA 5AUMA 2P5WA 2OP4L 1WFTA 4YBLB 2P24B 4IDJL 3S98A 4Q6IC 1MRCL 3B9KD 3RWCA 5HHNA 1CL7L 1K8DB 3HS0A 4Z78A 4PJXE 5GRUH 1FIEA 2VQUA 1CQYA 4XX1E 3ULVC 1ZVYA 1EEQA 4XXDA 1JHTB 3L7FB 4ZUVA 4EDXB 3QUXC 1JGUH 43CAB 5TQ0L 1ZWIA 2HMID 5IJVB 3L6FB 3FONA 3VXQB 5DJXB 2BC4B 3U6RB 4XP5L 4LLQA 3ZKXB 4EN3D 5ENWA 5DJZA 1TVHB 1AI1L 2DQEH 3D25A 2BCKB 1FC2D 3X14A 1U6AH 1OARH 4WV1C 1FJ1B 5GS0H 3C6SA 3GK8L 4ZTOH 5L7XL 5HVHC 3EZ8A 4PJBB 5FAAA 3IVKB 4N8PA 4OZIF 3D6GA 3QDGB 3MV7D 5F9JB 2A6IA 3O3BB 3WO3B 5F6HI 2LAAA 3QQ3B 3AREB 1QKZL 2P8PB 3FB7A 5EZJB 4R8WL 4NUGL 4Z7WE 2DM4A 4LPXA 3T8XA 5A2JH 3T0EB 4FQ2L 5CSGA 1NGYB 1W0YT 3Q6GH 3FMGH 3OKMB 4UILH 3MPCA 1VADA 5E6IC 5FKPA 4R4BB 3T77A 3WFEH 1KG0B 2NTFA 5FO8B 1LO4H 2YKLL 5DJ6A 2L0DA 4MWFB 1CLZL 3WFDL 3WYRA 1P7KA 4L8BB 1GCFA 5D1XA 4HIIA 1A14H 3PV7A 3REWA 4FFWD 4XCNA 5E2VL 4KFZC 3GJEB 35C8H 4XNQB 2AK4E 4DK3A 3L3OA 1T2XA 3ZKMD 4NHCL 4XWOD 1DQDL 1I3GL 5C0CE 5IJKC 2RAMA 4AENB 4EZMA 3UTQA 3L5JA 1U92A 25C8H 2BNRD 4PRDA 2A9NH 4HKBB 4JRXE 5DVKA 1WK0A 2FB4L 5KTEL 1I7RB 2DLFH 1BFTA 3GBNL 5J3HD 4YDJA 4LL9A 4NP4H 4LRIA 3QPXL 1N26A 4F33A 2DD8H 3GGWB 1UA6H 1EJ6A 4HS6A 3Q6FB 4IRJA 4MD0B 3TVMD 1UM6H 2R1YB 4MJIE 2PXYB 4P4KA 2X2YA 4Y8AA 4BQ9A 4QHUA 1MWAA 2RFXB 1L9MA 4J8RB 4ZDHA 5FK9A 4AM0A 1A6TB 5JTWA 5GQBA 4ODSL 1GYAA 2A9ML 1JPSH 3BKJL 3QQ9C 5HDBF 4KQ3H 3T65A 3X12B 4OAWA 3MV8D 3QNZB 1MCEA 1ZS8A 1UACL 5I8KH 1H3XA 4DGYL 1OAXL 1U91A 1JN6B 3L3GB 1SEBB 4HJJH 3QEUA 3VWJA 4NQSB 4K3JL 4O02L 1HSBB 1IEHA 4M5YL 5B22A 4DGIH 1ETZB 3D39B 3MQIA 4JCLA 5KSBA 2E8YA 3SQBA 4KC3B 3TWCH 1NDGA 4KRPC 2ED9A 5CJ5A 3CLEH 3C5ZB 4J3VA 4OZGE 1UWGL 5T3XL 4LSVL 4M1GH 4N0YH 3D3VB 4DUVA 2D0FA 1Y18A 4MNGA 3C9NA 3L5WA 1XH3A 3ULSB 3OKKA 3KPPA 2GI7A 1J05A 4PJDB 3L5XH 3VFTB 4X8XA 1IQDA 4ZS6D 4PTTA 1WC7B 1D6VH 1QFOA 2WP3O 3AM8C 3ARBC 2R56H 1UEYA 1NGWB 4JHWL 4NQXA 4RFOL 5DD3L 7FABL 3VXNA 3EO0A 1I3RB 1F3DH 3Q5TA 4G5ZH 2AEIT 1A1OA 2ITCA 1H5BC 1NC2A 3O6MH 1TZHB 1D9KD 5I8EA 3RAJL 2CKBH 4V1DE 5CZXD 1KTKE 1LK3L 3EOTL 4UB0L 1Q72L 4Y2DB 3V0WL 1H8SA 5EUOA 3CK0L 1IGYB 4P5TB 4OZIE 5DJ8A 1WCBA 1HXYB 1F5WA 2R29H 4KK8C 1T5XB 4PJIB 3BDXA 3SCMA 4CL7A 1BZ7A 3QZWB 2CRIA 3OKNA 1S3KH 4QRQB 1LO2L 3ILQC 3B6SA 1WT5C 1EEZA 5A43C 2P5WE 4YFLI 1C5BH 2XWTA 4OZHA 4A6YB 3WJLA 1PZUB 1NAMB 2Y5TA 1BQSA 3S37L 9CGTA 1Q0XH 3MRRB 1H3GA 5DEGB 2C3XA 2HJKA 4OTXH 2E8ZA 4KTEL 4KY1H 1HHHB 3NGBB 3RWGB 1R6VA 1E6JH 3ZMRA 2DMKA 1C1EH 2OCFD 1X5KA 3AAZB 3PQYB 4GSDH 3IXTA 2X4TB 3EJZC 4HXAL 2ZNWA 4OF0A 1CR9H 3GHEL 1FO0H 4KVCL 1P5UA 5IB5A 4Y19D 3CDGB 4BH8B 3GSQB 5SWZD 1XZ0A 1A7OH 2K7QA 2VQTA 3WEXB 4POYA 1Z3GL 1KTDB 1MCJA 1XR8B 4XPHL 4F7CB 5LWYH 1O7VA 1RPQA 3VXSD 4OUUB 1EEYA 3JBG7 2QLVB 4UDUB 5TFSH 4S1RH 3AROA 4OZHF 3TJHC 4B53A 4E0RA 4G8GA 1G7LA 3PIQA 1I3VA 1FAIH 2Y6SD 4DN4H 5IGXH 2IGFL 3EFFB 4LLWB 2R0WH 1D5BA 3UBXB 1FYTA 4D8PB 4WTWA 4K7PX 4JM2C 4Y5VC 3D0VB 4E5XB 4UV4H 1FH5L 5ILTL 2QQKL 1KB5B 3GNML 4G9FB 4Z95L 4X6DA 4H25B 1RZFH 3QHFL 3I75B 4KUCF 3HMWL 1YMMD 3T4AA 5EOQL 1A7QL 5DF0A 1CFBA 5J8OA 2IAMC 1UXWB 5HYSG 4KJWC 4PJ7B 3MLWL 1BIIA 4RAUA 2VZ1A 4BYHA 2YD7A 4U1SB 4OFYA 4F8TA 4OKDA 5FM5M 2NXZB 1BX2B 3VFVB 3KDMA 1NSNL 4P46C 1FNSH 2D9CA 4MCYA 4HEPG 1AKJA 1O7SA 4AYFA 4XP9L 4P49A 1PG7L 3TF7C 4XMPL 1CLYH 3KPTA 1J1PH 3C5SB 3PWJA 3UZVB 4IS6A 1RURL 3O6FC 1RIVL 4XCCH 1ZT7A 2EIZB 1BPVA 1N5YL 3KYKL 3CUPB 4JRWA 4LCUB 1YMHB 3L3DB 4IOIB 4UT7H 4Y16A 1XF4B 5GHWH 1HHKB 4GQ9H 1NMCB 2AI0H 2EYTB 1GGUA 4X6DF 1ZGLM 5E24E 4RBPK 5DJCB 5GSRA 2I27N 2GUOA 1RI8A 4NN5B 5IB2A 2KZ1B 4ZAKD 1EVTC 2Q1EA 1QR1A 4LAJH 1MAJA 5DFVD 2FYYB 1CL7I 3CDFA 4LHUG 2HVJB 4JY6A 3QUMA 2C3VB 4PUBH 4XCYB 5FA3B 4KROD 1JRHL 1PKOA 3RDTD 3ARXA 4PV8B 2A74B 5KSBE 1T6VN 5GS0D 1ZTXH 3LKOB 4PRPA 1K4CB 1H8OA 4B0MM 1NKRA 2J88H 5EC1B 4OLEA 3DV6A 3HLAA 5DHXB 2WWKT 3QDJB 5BV7C 2AGJH 3TV3H 1U58A 4Y4FB 1Q0YH 1ADQL 4NRYB 3HC0A 2YBRB 4MNGE 4OQTA 2LU4A 3MRCB 3BFOA 3B9KA 4PRBB 3MOAL 4RZCB 4XBEL 4WO4D 1S7RB 1IBGH 3F6LA 4MJ5B 4WWKB 5TE6H 5DEZA 4X7SH 2PO6B 2CK2A 4P23C 1T03H 3HAEB 4NZUL 2NQCA 3BH9A 1ZHLA 4KMTH 3I02B 3WLWC 4KGLA 4GW1A 2W65A 4EN3A 1NC4A 5GRVK 3CSBA 3OKOA 4Y5YC 3VFWB 4Q9RL 2JB6A 2HLAA 4ONGH 3VFGH 5INDB 4PJ8C 5IHZA 1NGPL 1HZHL 5F7FA 3L5HA 2H6PB 5EUOE 3UTTD 2QR0B 3DBXB 4GRLB 4LVNC 4M8QB 1AQKL 3L3KB 5E99H 4R2GD 5JW5B 2F5AH 1FE8L 2F53D 2FGWL 4LMQI 4PJEB 1P6AB 1R3JA 3FQUA 4LOUD 3DPBA 4UOW0 5ICXB 3QEQD 3UAJD 4OZHE 5AEAA 1YEDA 1H15B 3HNVH 1YNTB 2APFA 5FM8A 1AR1D 3IF1A 5F7DB 3VWKD 4K7PY 4ALAH 1DFBH 4EEEA 2YN3A 3P0VL 1DP0A 4XNYL 4K9EC 1AHWB 3INUH 4A6YL 5KW9H 5CJ8A 1HHIA 1CLOH 1NEZG 3PHOA 4PB0L 3PGDA 1FL3B 1JNLL 2YSSA 1AGBA 4JB9H 1IEAA 1X7QB 2QBWA 3VXME 2YHGA 5CJQH 4LU5L 1CIUA 4FQLL 3FN3A 3G6DL 2RGSA 2HRPH 2X4OB 5D7KD 3BEVB 4MXQC 3UJTH 1FGNH 4FZEH 2EIDA 1JFQL 3CSPA 4QWWD 1NCAH 5DR5L 4XNZB 4LCCC 1DDHA 1PQZB 1OP5K 5FM4A 1M4KA 3BQUA 2C26A 3FZUC 3FOLB 1OAQL 1EX0A 1KCVL 1AO7B 1ZE3C 1HI6A 1ZANL 3OGCA 5GRYA 2RIKA 4LCYB 3QBTB 1TITA 1ZLVH 1EIBA 4JLRA 4PJCA 4P4RA 1IC1A 3TVMA 3IJSB 5BVJB 5J13B 4I0PB 2XA3A 4G8GE 4NC2B 1TVBB 5I8OL 3FT4A 3G04A 5CGTA 4YO0B 4ETYA 5D6DC 1FYTE 5IK3B 1BQHG 3D87B 1HYSD 2RJMA 1G7QB 2R15A 3ARGC 3CMOH 1AXIB 4QXUL 4OZFB 4NKMA 1MQ8A 4X6DE 2AW2A 4L8DB 1UZ8B 3H3BC 3EFDL 3VFNB 2HT4C 3OKEA 4NKDA 1QFHA 3U0PA 1RU9L 1HQ4A 1ULVA 3BKMH 1MI5A 4X6BA 4HMDA 3K0WA 3SGJC 1KEML 5IFAL 4O51A 4QTIL 2ENYA 3RX5A 3K2UH 4IMKC 5HPMB 3WXVL 4HQQL 4NO0B 4HKJB 1CDBA 4J4PA 5EU5A 1LP9B 1II4E 1XIWB 2OXGA 1AGFA 3BJ91 3RZCC 2V7HB 3LCYA 4JO4L 4JDVB 1SHMA 2ITDB 2VUYA 3G9AB 4ONOA 5I74C 1RIUH 3MRLB 3DUSA 3P4OA 3ZT7A 1WZ1L 2PUQT 1NGQH 4NFCA 2B20A 5F7YC 1SY6A 4IHOA 5SWSD 4Y2OA 32C2A 4MDJB 1HOCA 3S34H 3PGFL 5GSVB 5ETUA 2BY1A 3PHQB 3CU7A 4KUZH 4OGXL 4DAGH 5TE4L 1SBBA 1EZVX 1DLHB 2M2DA 2BHUA 2L7JA 4G6KH 4G7YL 3GSUA 1G7MB 3P9LA 4EUPH 4IOFD 2W9EL 5FUOL 3GFUA 4KZEH 5JA8B 2HFEA 3FCTA 1D9KA 2VSCA 4ONFH 2FNBA 4LLDB 4OLVH 3RRQA 1DBAH 3RVWC 5IVXF 1GZPB 4ZPTA 4WTZG 3QEGH 3N1FC 2O5XH 5CIPA 1QRND 3BN3B 3M8OH 4GRWF 4PRPE 5EU4A 3OXSB 5B38G 1QSVA 4Q6IB 2ILLA 5IQ9A 5ACZA 2A73A 3TN0D 5C70A 3HE7D 1WSST 2ZOLA 4MGXA 1IC4H 3LS5H 1B0RA 2SEBB 1YJDC 4HMCA 5CMAB 3QI9B 3BZEA 3NFNA 5DI8A 5EA0H 1N2RB 1YN6B 1T2QL 5C86A 3CVHH 4IIQC 4TVSa 2YPLA 5BZDB 2P43B 1U95A 4JO1H 3BP4A 1V7NH 3D9AL 3MBEC 4NZDA 4PD4J 5GZNC 3Q1SL 4Y4HD 2CLRB 1XGPB 3EYSL 2BK8A 1DBKH 3I84A 1ACZA 1AGCA 5JW3L 4WV1B 4MAUH 5LGHH 3QG6A 3BP6B 5HVHB 4LIQL 3VW3L 1KXQE 2HKFL 3MJ9L 3HFML 5EU3A 4L3EB 3QDAA 3T0VA 3IDYC 3NCCB 4FQXB 2ZUQC 4HLZG 1WQVT 2AJZB 3OAUL 3NAAH 3ZZ1A 1YEJH 5EPMB 5T1MA 3GDBA 3ARQA 3ZSTA 1PYWB 2C7UA 2MPAH 3MV7E 2HVKB 5CINL 5EBLA 3ZL4H 5EIIA 3RPIA 3VXSA 4P59L 4UMGA 4PGEA 3CH8A 4FQQA 1S9YB 1KN4L 2XFXA 5CKGA 1DEEA 4X80H 4I0KA 4DUWA 2VXTL 2FO1A 1JI1A 1CICB 4YLQT 1XGUB 4KPHH 2CQVA 2YPVL 5ALCH 1GGBH 1BZQK 4OD3L 2RB8A 5DZOA 1YMMA 5E8OA 4UU9A 5FDWB 3H9SB 2YWYA 4HFWA 2DI8A 4YBQC 4OJFH 3OV6A 4ZUTA 2FL5A 2NXYD 4RMRA 1N59B 1HHJA 5B39G 3FN0H 3FO9B 4MQXC 2ZCHH 1OPGL 3CFBB 1N4XH 3TT3H 2VN4A 3SY0A 3MYZA 4LGPB 4HK3N 4KJYB 4NQED 2GFBB 5E1HB 5L6YL 4NCC1 2QKIB 4P2OD 1KFAL 4FOMA 4XP6H 3H8NA 4JZNB 4PJCE 3V8CA 5D72H 3P0YH 3THMH 2ZG3A 4U1NA 1EFXA 4LLVA 5E95B 3U48A 4RWHA 1EZVY 2F15A 1M7XA 3N0PB 2E9BA 3IGAA 3TA3D 3I3BA 5I1JH 3BHBA 1MF2H 4BSWB 4HBCL 2OYPA 1MHPL 2DQDL 4TYUA 2XI9A 4O5LL 1C5DA 1L0YA 1IM9D 2LABA 4APQD 1RZ7L 3SDCC 3SDYH 4RWYL 4Q0XH 3F7RA 4JFDD 5D8JL 5ITFB 1EO8H 4CBPA 5F7EL 1R24A 1IL1B 3FAWA 2VL5B 1SJEB 2AEPL 4FXGB 2GCYA 4J7RA 5D1XC 5J11C 4PG2A 3MLRL 4GRMB 4F9LA 4X4XB 1A9BB 43C9B 1IEBA 1KC5L 3GI8L 5FO9A 4C4KT 5I1GH 4HPYH 5I1DA 4OCXH 4X99B 4WUUD 1INQB 3O0RH 4FHBD 2N7AA 1GXEA 1KIRA 5D9SB 2XV6B 2DICA 4PJFA 5DRNA 3ARBB 4XPFH 2Z0BA 4TVPD 1P84K 4K3DL 2R23A 5KS9B 4U1KA 1IAIH 3ZTNL 1RUPH 3LV3B 5MEOB 4LEOB 4LVHC 4H5SA 4LRIC 4XNUH 4F15B 4G3YH 1RZKH 1T4KA 4IRJC 2AQ2A 3PABB 4P3DA 5D71H 4P4KC 3MREA 2IH3A 4FFVD 2XRAH 1RMFH 3MUHL 4CADB 3S97C 2ADJA 5E2UH 5GZOC 4N8CH 3UTTA 1R3IL 2A38A 3D18B 2FATH 3OTTA 1GIGL 4O00A 4JO3L 3BKCL 4LARH 2F53A 4AG4L 2AQ1A 3CLFL 2BVUA 1AE6H 4Z0XA 3VWJC 3MXVH 1S9XA 3F8UB 1D5MA 1D3CA 4F7PB 3AU1B 4XVJL 5BZWB 1L7IH 3GSRB 1J1XH 3B5GA 5FYJL 3VWKA 4PJFF 4NQDB 5FHAL 1Y0LA 3CFEA 2OI9C 3LRSB 2YPLE 5FXCH 3GRWL 3WFBH 1J0ZA 1T66D 3E2HB 3ULVL 4XNMB 5GS3A 1AC6A 3JUZA 3M17B 3PGCA 3ZTJG 1IGJA 4RISL 2DBJA 3H3PH 1DR9A 3W11C 1B2WL 2YD4A 5FGCB 4FG6C 5F7MC 1QBBA 4M4PA 4PRIB 5DJAB 4Y19E 4P2RB 1FLTX 2Q7YA 1JUFA 5LGJB 4LVOB 5T5NF 1HILA 2E7LA 5IOPB 1ZKAA 3A67L 4QRPB 2HYMA 2N1KA 5F88A 3VXSE 3QWRD 4KVNH 5DJ0A 4LNRA 3PF2A 5KVEH 3LKQA 2WIMA 2FR4A 3SDXA 1JPTH 4NWUH 4UIKH 1R3LA 1KCSL 4XC3L 5EOCL 1FNAA 3IDMA 5DRWB 4HUKB 3SCMC 1G6RH 4IOSD 1I1CA 1YNKL 4G8IA 4OIIH 4MVBC 1OHQA 4JQIH 1YDPB 3WJLC 4JN1H 1YMME 5HI3D 5DGRA 2OTUA 1V3MA 4FS0A 5CUSH 5DA4A 5CEZL 1QR4A 3GSNB 3DUHA 3BW9A 2CKBA 2GQHA 2VLKD 4JFFD 4X7CC 5CZVH 2H26A 4OV5B 4JFXA 1OM3L 2V5SA 4FTVD 2DQJH 1C5CH 5ID1A 1S7TB 4G8FA 4JFEB 4QTHB 5HHVL 3KJ6L 5BRZD 3RL2B 3X3FH 3KPRB 4OCRH 4Q6YA 2UV3A 3IDGA 4PB9L 4Z5RA 5DVOA 5SWSA 1U3JA 4YEEA 1I4FB 3RWIB 2CGRH 4Z7NE 4X4ZA 2XZQH 4G42B 4LPUA 1KPVA 2YA1A 1N5AA 5DHYB 3LSOA 3PV6A 4ZS7H 2MCPL 3IETA 1G9MC 2AKRA 2BSTB 5KSAB 4N0RA 5I1CL 1JGVH 4BA8A 2QQQA 3IU3A 3JV0A 1EHNA 1MAMH 4KTDL 2ORBH 3FTGB 2HLFC 1XF2B 2C9AA 5DJDA 2D3VA 2BSRB 4KAQL 1MRDL 1M71B 2P8MA 3M1BA 1E4XH 5DMIH 1H9VA 4X6EB 5C8JB 4JCMA 4M6MH 5IB1B 4F58H 3KPMA 3K4AA 2ADFL 1A3QA 1FO0A 1WBYB 4UTAH 1F6FB 4PJ5B 1KEGH 5ACMA 5HHPA 3MRGB 5BJTA 5C0FB 3GMOA 1Z6JT 4PY8J 1ZA3B 3DGGA 4Y4KB 3LEYH 1OAKL 5IB4B 4YXLH 3DOSA 1KB5H 4M5ZL 3MJ8B 3UP1A 1TQCC 3QPQD 5F1NB 4HS8H 4C56B 2ZKHH 1FIGH 3L3JA 3QEHB 1G1CA 1MCCA 2ATKA 2XA8L 3Q5YA 5ESQA 5DQ9A 4PJFE 2FD6H 1KIPB 4R7NA 5E0QA 3W2DH 1LE5B 1QSEA 1HH9A 1FCGA 1PFCA 2DWEB 3S88L 1RHHB 4XHQA 1ERNA 1U42A 4IJ3C 1DL7L 5TDPA 4RNRA 4AIZB 4LASL 3FO1A 3LD8C 3DX9A 4GKZB 4HWBH 5E56A 2NW2A 1IT9L 3KXFD 5CJOH 4HK3J 1JWMB 4EI6A 4UINL 4HS3A 3CD4A 5E1AA 5HY9A 3RZWA 1O0VA 3O9WD 1BZ9A 1NPUA 3UCRA 5CP7B 5E9DB 3V0VA 4JG1H 4X6CA 3RWEA 1K3ZA 5EC2B 2Y36L 3GIZL 3LMJH 3W39A 3UTTE 1XCQA 3VA2C 1TZIB 4Y16C 4ZUSA 5C2UB 3RVXD 4X5XB 3ECBB 2F53E 1Q9WA 5EOCJ 5GGSY 2XNAB 2VDNH 4XHJC 3GBML 5F8RC 4XMLH 3UPAA 3QEQE 3BRGC 2YR3A 3PDGA 4OFIA 1G7PA 1NEZB 2EKSB 1MUJA 2VWEE 3H7BA 5TH2A 3JWNC 3QUZB 4M62H 3TO2A 4XPTL 2BRRL 3BGFB 1YA5A 3UPCA 5J1AB 5HHOB 3IJYA 5EDXA 5E00A 5DRXA 3OB0H 2CR3A 4N0FB 4NUJA 5I6XB 2DIBA 4HWZB 1S7XA 4LSDA 1T20B 3B9KC 4K2UH 3IKCB 2O61B 4FQCH 4N1EA 1JGEA 3V4VH 1F4WH 5FYJU 4C55A 3UTSB 5IKCB 1JYXA 5D7IA 4X6CF 1J8HB 2EC8A 1KYOJ 1HEZA 5IUSA 1VDGA 4ZSOB 2FWOB 1JVKA 4FXLA 5HI5D 3T0ED 3CFDB 3L3HA 2HMIC 5A40E 4WNQB 3DYOA 1KN2L 2B8OT 1MCIA 5JNYA 2OL3L 5FB8B 2R69L 4L4VA 1FVDA 3SDDB 4EN3C 2PF6A 2BNQB 2CD0A 4P2OA 5SV4A 5IV2A 4AL8H 2DLEA 1F42A 2VZSA 5D2LF 4TNWF 3SDXE 5E94B 1ZEAL 2Y72A 1S7SB 2X4PB 1MHHA 3ZKSD 1IMHC 3CDYA 2O5YH 4CMHC 2EDQA 4Z7OF 2JJWA 2MHAB 2QHLA 4D0BA 3CFJB 3TA3A 4Z7WB 2Z8RA 1NGZB 5GRVL 2ATPA 5T33H 4LLMB 5JHLH 1NEUA 3BZ4A 1CXHA 3PP3K 3OKDB 4PRNA 1FBIL 2VKWA 1P7QA 1A5FH 1FZMA 3GSXB 4NNPL 4RRPA 2FZ3B 2BOBB 2P5ED 1J87A 1I7TB 5DQDH 2AJSH 4UBDD 2OJEB 4X7EC 5IG7A 4ZNEA 3JTTA 2OK0H 2PXYD 4OGYL 2AV1A 3BAEL 1YC8A 5F1SA 3SKOB 3GSNL 1JF1A 4FFWC 1N7MH 3QISA 3QNXB 1O5DT 3DURB 1BOGB 4PYHA 4EOWL 3HKFA 3MLTA 2EDNA 12E8L 4XWOC 1ND0B 3GSVB 4JRXB 3L7EB 4ZFOL 1GPOL 2K7PA 2YPKB 5SWSE 4GJTB 5D70L 3NIFF 4PJAB 1U8QB 2FX7H 4HUNB 2WSKA 2VDPL 4HV8A 3BQUC 5DRZA 1AY1H 3C09C 3SOBL 4YAQB 5C0EB 5J3HC 1J0HA 5JLZB 4H20H 1WZKA 4AEHH 3BGMB 3HNTL 3C6LD 3IFNH 2I07B 2I60H 3ALXA 3LEVH 1BHGA 3TVMC 3QHZH 2IBZX 4OM0H 4U7SA 3H7LA 1OLLA 1LD9B 4JFOB 3SDAD 4F37F 4MA3B 2VN7A 4JY5H 2ICCA 5J56B 2OR8A 3I6LE 3I9GL 4M1DL 3BDYL 1IZKA 2GSIB 4WDIA 3ARFA 3D2UD 4K07A 1A7NL 1LDPL 5BV7L 2RQ8A 1IM3B 4I18B 1JMZA 1X3DA 4WW2B 3O2WL 3WFHB 3T3ME 4EI5B 3HI1A 4BSVA 1FPTL 3WS3A 1ZHNA 3MFFA 5I19L 1EERB 1QSEE 3DWTA 3PXHA 1XAUA 3DSFH 3WDIA 1T3FA 4MDIA 1F4AA 5MI0C 4ODXB 2JIXB 3TFKC 2E9IA 3IKKA 4Y2DD 1EH9A 1T5WA 5DS8B 5D93C 2HFGH 4P5TD 2P7TA 2VXVH 2YD9A 4IMLA 4YGVA 3IDYB 5EZOH 5D6CA 5FGSA 4ZS6C 1LWRA 1UJ3A 3GIVA 2ZCKH 5IT2L 1S9KC 2DN7A 1BEYH 4X6CE 1ONQA 4JFZL 4GQPH 2FSEA 4NN6B 5GGUA 3WXWL 2RCSL 3NA4A 5J12C 1BAFH 1G6VK 4FXKA 5F9DC 4K3EL 3TBTA 1XGRA 5BOPA 4M6AA 5SX4I 3WNPA 5AWNH 4MXWL 2J5LB 3PWVA 3PL6B 1D9KC 3TBVB 4ISVA 1TTGA 2LQRA 5CZXC 3WHE0 1UZ6F 4PR5A 4C54A 5CP3A 3IFLH 2AEQL 3H9YA 3B2UD 2PNDA 3PQYD 1S7UB 5KZCB 4R4ND 1WVZA 4PRHB 1RJZB 5AUMB 1QO3B 4NOBA 2JELL 4L5FL 5KSVA 1WTGT 2ZOKB 2CDEA 3DUUA 4TNVK 4OLXL 2W9DL 3VJ6B 4JG0L 3O3DB 3O45B 1I8MB 1WZLA 3NPSC 3RGVA 4MJ6A 3TLRA 4EUPA 4YX2L 3LB6D 1QLFA 5EO9A 4Z6AT 4ZUVB 8FABA 1MLCB 2W38A 4JHAL 2VLKA 3O3EA 5D7IE 4YQXL 4P9HC 1YYLH 1M7IA 4WU7A 4BFIA 4LLQB 3WNKA 5GGTL 4NO2B 4YHPA 2J6EH 1MJJB 4N0UA 4S11A 5ENWB 5DJZB 1U8LA 3MGTB 4DW2H 4AT6A 2ZJSH 1MJ7L 4L29B 3FRUB 5BRZA 1RZJC 3AMLA 1VFAA 1IGTB 2FO4B 4NQEE 4ZTPL 4ELMB 3FFDB 2DM3A 1OL0A 4A2MA 3FT2A 3FQNA 1A6VH 4EXKA 2Y5EA 2KQMA 1YYMH 1NBYB 4DGVL 1LO5B 4YPGA 4G9FD 3FQWA 2P4AB 3QYCA 3NIFE 3P4LA 1CT8B 5GS1B 3QXWA 5CFHA 2UZIH 3HMXH 5I75C 5I1HL 5DT1L 3HRPA 3KJ4C 4JANB 4PP2A 4DJMA 5CLWA 1REIA 2PTTB 5IHUH 3GSOA 3P40A 1K8IB 2UY6A 1MCRA 2IBZY 4ENED 2WMPA 1MIEH 4I3GA 2C4FU 3ZO0A 3SDCB 4F2MA 4P9ML 2B2XH 5ESAA 3T77B 1QRKA 2NXZD 3QWQB 1MCPH 1F58L 1IQWL 1DTUA 1NUFA 4ZNEE 3VFUB 1JZ2A 1FG2B 2GY7B 4OSUH 2C4FT 2NCMA 4XPAL 5IFJB 1ZLWH 5L2JB 1GHFL 3N1GC 5B21A 1KENL 1P53A 2DQTH 2Z92B 2CDGA 4QO1A 4X8JB 1S5IL 1TCRA 3KYOA 4DVRH 4PRDB 2VDMH 1RVFH 1XGQA 2BP3A 3DIFB 1RZIA 2B5IB 3GO1H 2CO6B 4TVPE 1FVEA 3NCEB 3T2QA 2RR3A 3HPJB 4YK4B 4LVHB 5TDNB 3HR5A 4QHLA 3LN9A 1C7TA 2D7TL 4NIKB 4Z0BL 3BIAX 1EHXA 1HINL 5I73C 4WFGE 3KXFA 4XAKE 4YGAB 2CSPA 3BP5A 4JN2B 3BE1H 3EAKA 2APXA 2MWCA 3RWFB 1MNUL 4HUXA 1WBXA 3EYVB 3QDJD 5HTSA 5E2TL 5J9PB 1G9NC 1P1ZB 4D9LH 2P24A 4QRRB 3MZGB 3ZE0F 3VWJB 1RIHL 4ZFFB 2AEWA 3RJQB 4Z77B 1KELH 1U3HD 1K8DA 4WWKD 5EUKA 3HI5H 2IMNA 3PNWB 4OB5H 2VDLH 1CE1H 2EH8H 5DFVC 1JHTA 3L7FA 2MOVA 4EDXA 2ZZUT 4GUPA 3NACH 43CAA 1UZ6E 3FOMB 3X13B 4KROC 1YJDL 4UNUA 5IJVA 2KKQA 3L6FA 3VXQA 5DJXA 2BC4A 3AS0A 4HC1L 3U6RA 3WIIH 1S7VB 1CF8H 3BISA 2OJZL 1TVHA 5FYKH 2BCKA 4L3CB 4PG2C 1FJ1A 3O8XB 4R26H 4F9LC 2I26N 5T3ZH 3NCJH 1C08B 5I16B 3KLAB 3MJGX 4PJBA 1J05B 3LN5B 3IVKA 2W0FB 4HG4J 4L4TB 1X5JA 1RK0B 3QDGA 5AYUH 2EE3A 1IGML 3O3BA 4P2YA 4RX4A 2EYSB 3WN5C 4CW1B 3AREA 4NQXB 3O2DL 4YHLL 2P8PA 5EZJA 1QYGL 2BVPB 5D1QD 4RGOH 4L1DA 5C0ND 3EO0B 4M7LT 1NFIB 3T0EA 4ODVL 3UC0L 1NGYA 1TQBC 3QCUH 3U36B 5J1TC 3OKMA 4KHTH 3WKMH 5LXGH 5I8EB 3BRFA 4R4BA 5I1KH 1NKOA 1KG0A 3E8UH 5FO8A 4R6UA 5TQ2L 2VXUH 4MWFA 5C71A 1A2YB 4H0HB 2WM0A 5GRJH 2H32B 4L8BA 5IF0B 2L7UA 5K9JH 5HHXH 4XPBH 3GM0A 5TE7L 1LQSR 5T1DH 3SQOL 1OTSD 1OW0A 5EULV 3SCMB 5CJXA 1EHLH 1E4KA 3HR6A 3JWDH 4MAYD 3FRPA 3GJEA 5F1IB 4AEIH 2FLRT 3B6SB 3QIUD 2D7MA 4ZFZB 4XMKH 4AENA 4LEXH 4O58L 4JDTL 4LOUC 2HH0H 4WJ5B 1JMXA 4HKBA 2F8XC 4FMFA 5JHDB 4JY4B 1I7RA 1AO7D 1AR1C 3MLVH 3VWKC 4WUKH 2VWEC 3GGWA 5IQ7H 3Q6FA 4MD0A 5AD0B 2VLKE 4IDJH 1T04B 3D69A 5GGSB 5JMOC 1MRCH 2R1YA 1KACB 3VXMB 5BCAA 2PXYA 4N0UE 4KRMB 5GJTL 4J8RA 3U83A 1A6TA 2ED8A 5BRZE 1DCLA 4NBYB 3X12A 4PPTA 3M45A 3STLA 4UUJB 1UVQB 4LCWB 4M7ZC 5DFWH 3RI5K 3B9EA 4MQTB 1TNNA 5L88H 1JN6A 1GGIL 1SEBA 2NY4D 3L3GA 5JUEH 2DQIL 1HSBA 4AY0A 3IAGC 5DDHA 3ABZA 2E7LC 3E0GA 3GK8H 1CZ8H 1OSPL 4RQQB 3SKUD 2IPUK 2F19L 1TLKA 4KK6C 3I3EA 2V2TB 1D5BB 5DVNA 4UNTA 1XIWD 2VDRL 1MPAL 3SDAA 2C3HA 1CGXA 3NA9L 3JTSB 3S6CA 3D3VA 1PLGH 1PGRB 2X44D 4X6DB 4KGJA 3OR6B 3ULSA 2VZVA 4DKDC 3IS1X 3TO4D 1UFUA 3FQXA 4FQ2H 3RX7A 3MV9D 2ERJC 3D2UA 4G6JH 4HX1B 2WUCH 1IC5H 4QOKB 5JR1L 1WC7A 1NGWA 4JKPH 2P48B 4HDIB 1DZBA 1MAKA 4RAUB 4Q9QL 3FO0L 3RWJA 4NCC2 5ADPL 1KCUH 2EZ0D 1KIQB 1I3RA 1KJ2H 2ZUXA 4GXVL 2YUXA 4YR6B 4ORZC 3QA3B 3LZFL 4MA8L 1TZHA 4GAYB 4OLWH 3UJJH 3X17A 2D03H 3BMWA 4Q97A 3O2VL 1ZHBB 1RUMH 4Y2DA 1FFRA 3ZKQD 3TT1L 3PWJB 5E03A 1G6RA 3KXFE 1IGYA 4P5TA 5T5FH 4K7PH 1HXYA 1P4BL 2VERN 3ZDXF 1BD2B 4PJIA 2DMCA 2WUBH 3QZWA 3V2AR 4LLAA 5DQJA 4QRQA 3Q48A 3CGTA 3OZ9H 2ICWB 1Z9SA 4M6NH 4A6YA 1MH5A 4N8VB 2A77H 1NAMA 3HC3H 1XGYH 3QI9D 4Y8DC 2W60B 5GSRB 3NCBB 1SYVB 3MRRA 1QR1B 1JGLH 3N9GL 4IOFC 4ODSH 1MCOL 5CBEB 1R5VB 2VXQH 2A9MH 3VG9C 3BKJH 2YD8A 4ODHL 1QBAA 3SGKA 1JP5A 3NBNA 1ZHKB 3H9ZA 3ILPA 1ES0A 2FIKB 3RWGA 1T2JA 3MLXL 1Q9KB 5KVGL 1MCWM 4ZO8A 5FV2A 4QHNB 1OAXH 1ITBB 2YMXL 3HTLX 3PQYA 2AABL 5DYOA 4JFQB 2X4TA 5GGRB 1I9RL 5E08L 5FCUL 1JI2A 3P77B 4HFUL 4G6ML 4N5UA 1B88A 3V4UL 4M7LH 4C58B 1PD6A 4NKIH 3CDGA 4TSBL 1R3HB 3GSQA 4L3ED 3B9KB 3HA0A 4FQXD 4PJBE 3V4PL 4LPTA 1UT9A 4CN6A 4RCAA 1NL0L 3IFPB 1WFNA 1KTDA 2KBGA 1XR8A 1ZLSH 4F7CA 3QDGE 1PKQB 3MLZL 2XTJD 4OUUA 3WSQL 4LSVH 4YHNB 4AH2B 4UDUA 3S3SA 4TUKL 5F8QC 5GRZA 4GW1B 1DLFL 5D2NB 1BBDH 4NWTH 3T0EE 5DLMH 3EFFA 4LLWA 4H26A 2YS4A 3MR9B 3UBXA 4NZTH 4I3RH 5FM5O 3MLPA 3RU8H 1CICD 3DECA 4KU1A 2H8PB 2ZG1A 1S7WB 4KK9D 4E5XA 2CJUL 1KB5A 4G9FA 15C8L 5IW3A 4H25A 3MV7B 3EHBD 3I75A 2GEEA 3FAXA 3H9HB 2XZAH 1R3JB 3IDXL 3RAJH 2MKLC 2X7LB 1UXWA 1MFEL 4PJ7A 3LQMA 4UB0H 2QEJA 1OTTC 3UTPD 4HIXL 4U1SA 4R97B 3MLSH 1HDMB 3BJLA 3O4OC 4OCSL 1WITA 5DWUL 3RTQD 1BJ8A 1BX2A 3VFVA 1LEIA 3BIBX 4JQVA 5EZLB 4U3CA 3DMMD 3PGDB 2Q20A 3RVVD 1FRGL 3CX5K 1NQBA 2X1XR 4H1LB 4Q2ZA 2FH6A 2R2CA 1WCQA 2J4WH 5B3NA 1I8KB 3CUPA 1EDQA 2R1XB 2X1WL 1WJ3A 2JJUA 4LCUA 1CD0A 1YMHA 2BNRB 4NC1E 3VMPA 1HCFX 2BFVH 1XF4A 1HHKA 3G5YB 2EYTA 5DJCA 4KJQD 4TSAH 4K94L 3OGCB 4HXAH 3GMNB 2FYYA 4KXZI 2HVJA 2MSPA 4NQCB 4KVCH 5FA3A 2IFFL 4XCYA 5FYKD 4ZD3L 4P2OC 3NCYP 2A74A 4PV8A 5I18L 3LKOA 1K4CA 5T3ZD 5IBUG 2XG5A 2GTWB 5I71B 2GK0B 3RIAF 2R4RL 5EC1A 4E42B 3QDJA 3MV8B 3QIWD 4Y4FA 1OAUL 4NRYA 3D3VE 5I1AB 5I1LA 2HG5B 2YBRA 2KH2B 4NZRL 3TA3C 4NKMB 3MRCA 4PRBA 2OX5A 4RZCA 1MCKA 4G6AC 1S7RA 3GKZA 4MJ5A 4NKDB 4WWKA 3SBWA 1W0VB 2D9QB 4X6BB 4ESKA 2ZPKL 1FFQA 5IVXB 2PO6A 3ZDYF 1KLGB 1UYWH 2W07A 3MRKB 3HAEA 3LPWA 3GJFB 1S5HB 3BVNB 3VRJB 2ZP0T 3EYUL 4GRWB 3FT3B 3I02A 4RDQF 4OI7A 4K7FB 4JGJA 3HMWH 4X7FC 1U8KB 1X4ZA 4HZLB 3VFWA 1ORQA 1TENA 2X10A 4UTBL 3OAZH 1C7SA 1JGDB 5INDA 2DQFB 4EDWL 2H6PA 4Z18A 5IVNA 2QR0A 3DBXA 4GRLA 4S1SL 4M8QA 1T83A 3L3KA 2R9HD 5JW5A 1RAMA 3WE6A 2I5YL 4PJIE 2MFNA 1ZLUH 1MFAH 4PJEA 2CRZA 4AEFA 4ZOAA 2BVYA 5ICXA 4TNWK 2DQHH 1H15A 1YNTA 4CU7A 3PE9A 4OD1H 1L7TL 5F7DA 1UH4A 4YXKL 1I1AD 2YZ1A 4NQDD 4R7DB 3GB7B 2WBKA 1AHWA 1RURH 3OXRB 4FQPA 4I4WB 5LBSH 2EDFA 1TETL 4FFVC 1FL3A 1GAFL 4I48B 3MOBL 3HI6H 1X7QA 3QUML 3VGGA 3F6IA 5CGYD 3PQYE 4L9DA 5D7SH 5C7XL 1AQDB 3F62A 4MAYA 1U41A 2AJUL 3IT8D 2X4OA 3QIUA 3BEVA 1GRWA 3ET9F 2GW5A 5HHMB 1CU4H 3BZEB 4S1QL 4P2RD 1VPOH 1BQUA 4FRWA 3H42H 3FOLA 4OLZH 5JDSB 1AO7A 5C0AD 3RKDD 2ID5A 4CUCA 1ZGLP 1U95B 1FYHB 1KXVC 2OR9L 4QRPD 4M9PA 4LCYA 4PJEF 3SKJL 2XPGB 3IJSA 1T66C 5BVJA 1AJ7H 2Y9RT 4UAOB 4X7TB 1INDH 1TVBA 5F7UA 3SGDH 3JWOH 3D5OF 4YO0A 1JZ8A 4ZFGL 2FJFB 1P69B 5IR1A 5IK3A 4EQ2A 4JZJA 4Y19B 4MZ2A 4KZDL 1CS6A 5SWZB 3RNKB 2DLHA 1P4IH 2EH7H 1LHZA 1UJ3C 5AZEH 4OZFA 4U3XA 4HLZH 3CIQA 4G9FE 5T1MB 4L8DA 1UZ8A 2BRQA 2EE6A 4XAWL 4PLJD 4F37K 5GGVY 1K2DB 4Q9RH 1H3TA 2R4SL 4FQQB 2CIIA 3D85B 3P11H 4WRLA 3N85H 3GSWB 3RUGF 4N9GB 4TULL 3DI2B 5HPMA 2XFXB 4GW5B 4NO0A 4PJ7E 5MEPB 2F5BH 1NGPH 4HKJA 1JNHB 5C0RH 3GMQB 1LP9A 1HN1A 1AQKH 1XIWA 2V7HA 2FGWH 1MCSA 4JDVA 1KCRH 1AC0A 1MFBL 2ITDA 1HKLL 3MRLA 1MCWW 3V7MA 5FOBB 2VYRE 1WF5A 3TO4A 1NCBH 3IFOB 4MDJA 2ZCLL 5GSVA 5E8OB 2IADB 3PHQA 1VEPA 5DTFB 1MCBA 3ZDYE 3NFPA 1NCDH 2FL5B 5HI3C 4W6XB 1H8NA 1DLHA 4PB0H 1JNLH 1P6FA 3MA7B 4LHUD 1G7MA 3P30L 5DGQA 2XN9D 3U30C 4LPYA 2DQGH 4FQLH 3G6DH 1BVLB 2DJ4A 3QQ4B 2V17H 5I9QB 4BJLA 2DTMH 1GZPA 1UWEL 4WCYL 1JPFB 2NW3B 2PN5A 4LCIL 4YNYB 4U1NB 4XNXL 3MXWH 4K8RH 1KCVH 3OXSA 5JW4R 1ZANH 3K8MA 4NC0B 3WNMA 4BKLB 2ICWJ 3QDJE 2A6JB 1RUAH 1MREL 4JREC 5ADOL 2E7CA 4PLNC 2SEBA 5CMAA 3QI9A 5E4EB 2DQUH 4ZAKB 5EZIH 2HTKD 1N2RA 4NFDA 1YN6A 3NPZB 2BY3A 5BZDA 2J6EA 1HE7A 4LFHG 3WO4C 4KROB 3RDTB 4DKEL 4DN3L 5HD8D 2EXYD 4HJGB 5I1IL 4LIQE 1XGPA 5DC9B 1A6UH 3C8KB 4WFHD 3MCG1 3C87A 3BP6A 4BZ2H 3QWOB 5IBTH 3SO5A 1UCBL 2MQ0A 3DX8B 5E9DD 4L3EA 3P4NB 1QTYT 5ALBL 3DHMA 3QCTL 4FQXA 4WO4B 1E6OL 4KKBD 2AJZA 1ORSA 3QFDB 1BGXH 5EPMA 3V5HB 3WN5B 1QVOB 4YDIL 4QY8B 3B2VL 1PYWA 2APTA 2HVKA 1BP3B 1SY6L 4WEBH 3L1OL 3VCLB 3RVTC 4MNQB 3CVIH 1QHOA 4PJEE 3DGCR 3QAZC 5IFHL 1IGIH 1S9YA 3O81A 1LVEA 2HTLD 4KKAD 5C2BH 5F9OH 3LHPL 3SE4A 1CXEA 1J88A 3FN9A 5E2WL 3QUZD 4P3WA 5TE4H 4UT6H 1CICA 5CAYB 3V6BR 2H3NA 4OGAD 3O9WC 1Y6KR 4NYLB 5ICYB 4WI6A 4TSCL 4PP1C 1XGUA 1FV1B 5ICZB 5MEQB 2W9EH 5FUOH 4R2GB 2F53B 4QNPE 4ODTH 1VFOA 1DQQB 1QZ1A 3BI9X 1S9XB 5FDWA 3RVXC 4UOW1 3H9SA 3JSSA 3QEQB 4JJ5B 1N59A 1U8HB 1N0XH 3GHBL 3ZHKA 1J8HD 3I50H 3ES6B 3VWKB 3FO9A 5LAXB 3CFBA 3VE0B 1Z0MA 1AO7E 1Q8MA 4KJYA 2NZ9D 1YEFH 1OB1B 2GFBA 3W82A 5K9KA 3ZKXC 2JB5H 2QKIA 2BNQD 4JZNA 4HK0B 3TZVB 3OG6B 3ZTJH 1F11B 4P9HL 4KH2A 4N68A 4OGZA 1A0QL 2IPTL 2HRLA 3G08B 4M7ZB 4YDLB 3V6ZB 3SGEI 3WNOA 5F7LB 3D9AH 2CLVB 1U8IB 3QO1B 2Q7YB 4F8QA 1JUFB 4LRNL 3AREC 4BSWA 2CR6A 3EYSH 1KJVA 3BYYA 3ARPA 3P2TA 3T0EC 5HI5C 3MUGB 5DJ0B 3UJIL 3MJ9H 3X3GH 2FR4B 3HFMH 2AXHA 1I9JH 5ITFA 2B0SH 1CFVL 4AIOA 1IL1A 2NY0D 3EW3B 4X0KB 4Z76B 2VL5A 1SJEA 1QBLH 1LP9E 3HHRB 4FXGA 3UX9B 3MNWB 4X4XA 5ACLA 1A9BA 43C9A 1OW0C 4KKCD 5CJXC 3QIWA 4X99A 1MHEB 1MVUB 1INQA 1E4KC 2XQBL 4PJHF 4M48H 2B1HL 2DBLL 1KN4H 5D9SA 3BH8A 3T2NH 3LIZH 5DD6B 2RBLA 1RZ8B 1FZKB 5KS9A 1DJSA 1RZKC 3HZYA 2WBJD 1ZT4B 3LV3A 4KRLB 5MEOA 4Q74A 4LEOA 4QT5A 4OT1L 1MJUL 2R1WA 4UBDC 2D0GA 2A6DA 1QBML 2WANA 3PABA 2XY1A 2PXYC 1EXUB 2Q8BH 4GAGL 3KNBA 3MFGB 4RGNB 5DVLA 5I30H 5D1ZB 3H0TB 5DD5L 4XPGL 1AXSB 4CADA 4XVUD 1FNLA 5E5UB 2UWEA 4NC1C 4ZO7A 2DAVA 4YWGH 1N6QL 3D18A 1KPVB 5AG9A 2IQAB 3KYAA 1CN4A 3U0WH 4UOJA 1KFAH 1A7PH 1EJOH 4F7PA 3AU1A 1T7VA 4GKNB 3N1MC 4JE4B 5BZWA 3T3PF 3GSRA 3VG9B 2PR4H 5GRUL 4NQDA 5DJDB 4EI5D 3OSKA 4UT9L 4H0IA 5BMFH 5J89A 3LAFA 3LRSA 1JGUL 5KS9F 3KPMB 4WFFD 4HWEH 4XNMA 3SDAC 3VG0H 1DN0A 1QRNB 3BEWB 3M17A 5HHPB 3NCMA 1I85A 2YUWA 1J86A 2GTZB 2DQEL 4RMUA 3BO8B 5C3TA 3VRLF 1N64H 2V5TA 2NY1D 3TN0B 2Z35B 3HE7B 4ZODA 4PRIA 5DJAA 4RWYH 1QNZH 3MRBB 5D8JH 4L3EE 4P2RA 1JZ4A 2P8LB 5LGJA 2UWEF 3K81A 5TF0A 4CVXB 4R7NB 5KAQG 2AEPH 3RHWF 1BJ1J 3A6CH 3K46A 2W0PA 1Z2KA 4QRPA 1I7UB 2XTJE 3PL6D 2O5ZL 4FP8H 3WDHA 3EOAA 4Y4HB 3DVIA 3FO1B 2FJGB 3Q6GL 3FMGL 1QACA 4UILL 1LO3L 3ROOA 2OBGA 2DOCA 1I8IA 3WFEL 5E1AB 4Y2DC 1TJHH 1LO4L 1BZ9B 1NGXB 4FNLH 2EEDA 3QSKB 4P5TC 4PRHD 5DRWA 4XC1H 3ZTNH 2UYLB 1XGTB 4DEPB 2F54D 2XKNB 3K4ZA 3RA7H 5CEZE 1YDPA 1A3RH 4MQ7A 1KJ2A 1A64A 1BMGA 1F00I 3B9AA 1YEHL 3MRHB 5EO0A 5SV3A 3H9SE 5D2LB 4D9QD 25C8L 3WS6A 2A9NL 3GSNA 2Q3ZA 1G7PB 1MHCB 4OV5A 6FABH 2VISB 4OF7A 3SGKC 3UTPE 2WQ8A 3NGBC 4JO3H 4NP4L 5KVFH 1W72H 3NCFB 1S7TA 3LY6A 4JFEA 2DD8L 4QTHA 2DMBA 3B2UC 3IJYB 2HWZH 4K8RD 3U46B 3RL2A 3KPRA 3S96B 4R4NC 3S36L 4DK6A 3RWIA 2VR4A 1S7XB 4XVSH 1F8TH 4LAQH 3CFCL 4G42A 4RFNB 1JPSL 1ZSDB 4KQ3L 4PGCB 4X83A 5DHYA 3VDCA 2NXYB 3WIHH 5KSAA 2BSTA 3ULVH 1EAPB 4U1GC 3F65A 1CK0H 5I8KL 4LHUA 1J7VR 1A6AB 1WBZA 4RISH 2DLTA 1BVKB 4YZFF 3FTGA 2ZNXA 4PJGF 6CGTA 4HT1L 1XF2A 4NQEB 4E9LA 1TPXB 2W91A 4DGIL 2BSRA 4P2OB 3EYFB 1M71A 4Y5XB 4X6EA 5C8JA 4HPOH 5IB1A 5FYKE 3TWCL 3BOVA 3QCVL 1WBYA 4G8EB 4KI1A 4PJ5A 4LK4A 2F58H 4GW4B 3MRGA 4R96B 1AIFA 3CLEL 5C0FA 4X9IA 1ZA3A 4YJZL 4M1GL 4N0YL 3MNZB 3BPOB 3QUYD 4Y4KA 4NO5B 1BLNB 1GL4B 5IB4A 1FNEB 5DMGD 3MJ8A 5F1NA 5I17B 3L5XL 3QEHA 4G43A 1LK2B 3MACL 2Q87A 1WISA 1KCSH 4U6HB 1IM9B 1SVCP 4ENEC 1KIPA 1D6VL 2WINB 1CFNB 2R56L 1LE5A 4APQB 4JFDB 5KS9E 2DWEA 1RHHA 2NXZC 2VQ1B 4R3SB 3QJHB 3VI3F 4G5ZL 2QQLH 4P0DA 1YY9D 4AIZA 1YNKH 3RPKA 4GKZA 3O6ML 1IZJA 1JWMA 5SX4H 4LDEB 3RWHB 2CKBL 5GISL 3VRLE 5JW4Q 4WUUB 5B3JF 5CP7A 5C3LD 3MLTB 1AGEB 5E9DA 2A0LD 5ID0B 3R4DA 4I9WD 1W8NA 1NLBH 4QRRD 2UWEE 5EC2A 5E6ZA 1OM3H 5IW1B 4M61B 1TZIA 4Z7VB 4X5XA 1JZ6A 1NMCC 1S3KL 3ECBA 4I8DA 3KJ6H 4NN5C 4LSSL 3HG1B 3TH4T 2XNAA 4HGWB 3V52H 1J1OL 4U3HA 5B4MC 2HJFB 1Q0XL 2V5YA 3BZDA 3LRHA 2JK5B 5IEKB 4QHMB 4OCMC 4RFEA 4F3FB 4PD4K 4G7VL 1NEZA 1YECH 4NHUB 4OTXL 4OQ1A 4NQDE 4KY1L 3QUZA 5J1AA 1BM3L 1QLEL 1E6JL 4U1LB 2XKUA 1C1EL 4N0FA 2ARWA 4GSDL 4HWZA 2EEAA 4Y4FC 2P44B 2EXWC 1CR9L 1T20A 1FO0L 3BSZL 2EC9U 3IKCA 2YUZA 4L8CB 2NTSP 4KAQH 1MRDH 2O61A 5FF6B 3SBWC 3B43A 4WWKC 3WUZA 3KPOB 3UTSA 5IKCA 1A7OL 1BJMA 5ANMB 1KUMA 2PO6C 1J8HA 4P2RE 3T0DA 4ZSOA 3WS3B 2FWOA 1ZHNB 3CFDA 1IAKA 4WNQA 3PP4H 1OGAD 4S1DD 5FB8A 4QRPE 5TFSL 3SDDA 2BNQA 1MJ8H 5ISZD 2G2RB 3EZJB 4M43H 4S1RL 2NY5H 1I9IL 3OG4B 5F3BB 1FAIL 5E94A 2R0WL 1S7SA 3B8SA 3R1GH 2BVTA 3JVGA 4LSQL 3TNNB 2MHAA 4GRLC 2JJVA 3CFJA 1T83C 3N50A 4Z7WA 3S88H 2EDBA 1NGZA 2XZCH 5EU6D 5D4QA 4QXGH 4WHTB 5DD0H 3OKDA 3S36X 2I9TB 1KBGH 1IT9H 3S4SB 4YZFE 5C0NC 2O93L 4UINH 5JHDD 3O41B 3GSXA 2BOBA 3MBXH 2WP3T 1I7TA 1AHWC 2YXMA 2OJEA 2YN5A 5T1LD 1SEQH 1OAYH 1NDMB 2VH5H 4LKXB 1CTOA 4WWID 3SKOA 2AJYL 3O4LD 4MD4B 3MGOB 1TJIH 3QNXA 4JFEE 4Q9CA 3DURA 4D3CH 1BOGA 1QFWM 3KPRE 4U6TA 1A3LL 4MAYC 4NN7B 1CLYL 3OF6A 1J1PL 1CDYA 2VAAB 3QIUC 3S9DB 1ND0A 3GSVA 1NAKH 4JRXA 3L7EA 1F3DJ 2YPKA 5KG9A 3ALPA 4PJAA 4XCCL 4EUPB 1U8QA 3STBA 8FABB 3CMGA 3KR3H 4YAQA 5C0EA 4RBPH 5GS2D 5JLZA 5GHWL 3MJ7B 4JFFB 2VLKB 4GQ9L 2AI0L 3VI3E 4PRAB 4B7IA 4LSUL 4BFIB 2DLIA 3TJEH 2I07A 4FTVB 3BZFB 4WTZA 3DLQR 5CEXB 2VDKH 2XN9E 5DZLA 5LGKA 3MODH 1LD9A 4JFOA 1CGUA 5B3JE 4MA3A 4YXHH 2DTSA 5B38A 4ONHB 5LG1A 4JZJC 5CSZB 4Y89A 4YPGB 4PJ5E 2GSIA 1OCWL 2MTPA 5C0IB 5EIVA 1JZ7A 4EKXA 2AGJL 3GUTB 3LN4A 3UROR 3TV3L 1KN2H 4UNVA 5HBBA 4PP2B 1Q0YL 1QPXA 2NY4C 3CVHB 4QOKD 5LQBH 3BWAB 3GSOB 3MRMB 3KYMB 3NCYS 1J5OH 1MEXH 3QRGL 4BZ1L 2CO7B 1IM3A 1IBGL 1XT5A 5TE6L 4I18A 3LQZB 4WW2A 4CRPA 3WFHA 1DANU 4X7SL 5DURD 2QSCL 4EI5A 1T03L 1A7BA 4YHYB 1U8OB 4KKNA 1UM5H 3AY4A 2AQ3A 1XIWC 5JQ6H 4LP4A 5DJYB 5F3HA 1E4WH 5DC0A 4JPIB 1QFWI 4KMTL 4ODXA 1JHKH 1M1SA 2JIXA 5DUPH 5EB9A 3CNKA 4P5MB 5C09D 4NJ9H 1DANT 4WFHE 5DS8A 4YFEA 2QADB 3TO4C 4C59B 2PW2B 1BD2D 4I1NB 4O9HH 3VFGL 5E9DE 5F9WC 2VLMD 4PLOB 3TIEB 4YDVB 3I6KA 2VB5A 5HGAB 4PY7B 3CDCA 3VD4A 1MELA 2XACC 5E99L 2F5AL 4FQJH 5TPWH 3BAEH 4RIRB 2G75B 3QAZB 2EZ0C 5TF1H 4TOYH 5IW6A 2QSQA 4LLUB 1H3VA 4TVPL 3PL6A 3LVEA 3HNVL 3TBVA 4GBXB 3QT2A 4ALAL 5J6HB 1DFBL 3B9DA 1GPOH 3F7VB 4WW2F 5D70H 3INUL 4TRPL 5KW9L 2VDPH 2EDXA 3O9WB 1S7UA 2M26A 4LQ1A 4DTGH 3CXHJ 3SOBH 4PRHA 1DQLH 1RJZA 1QO3A 4JB9L 2ZOKA 3SJVB 3NIDF 5CCKH 3H3KA 4LBEB 5CJQL 1CDIA 2OSLB 4KK5D 5GJSH 3VJ6A 4ZMAT 5L2KB 5EUKB 3O3DA 3O45A 2HRPL 2ICES 1I8MA 3QI9C 3QUXD 1FGNL 4FZEL 1OP5H 1X4XA 1BWMA 1YPZF 1UM4H 1JK8B 3DX7B 2DL9A 4GUPB 3UTSE 1MLCA 2WBWB 4GKOA 2X42A 1AD0B 4P2CG 1J8HE 4F7MB 1PX4A 4ZSOE 3GMLB 4NO2A 3N06B 1MJJA 3MGTA 1JJUA 2NNAB 4L29A 3FRUA 2VO5A 4CJ1A 2FO4A 1IGTA 3PWUA 4ELMA 2ZSWB 3FFDA 1UADC 2BNQE 4RMWA 3LKPA 4ZQKA 3MC0A 3ARYA 5L9DH 1TNMA 1NBYA 3U4EB 3O2WH 1LO5A 1WICA 1X6LA 4WTXA 1CT8A 2XXMB 4FQXC 5GS1A 1UKSA 3CMOL 4JANA 1M05A 5TGBB 2PTTA 1F90H 3VGBA 2XTJC 1K8IA 3KS0H 2YK1H 5KVDH 5F7HA 4F7TA 1S9WB 2UVEA 3A6BL 3BKML 3SDCA 5EWIL 4I5BB 3SE4C 3K2UL 4OI9A 4MMZC 1CICC 3VI4E 1T89A 4KTYA 5HGGS 3QH3B 5F97E 3VFUA 2RCSH 2P1YA 1FG2A 4KK9C 3WXWH 5C92A 4P3CL 5IROA 4KKLD 4KQ4H 4OF3A 5IFJA 1BFVH 5JOFB 3SO3C 1RY7B 3EGSB 5L2JA 1L6ZA 1RIUL 2Z92A 4JDZA 1Q94B 1NBVH 4ELMF 1NGQL 3KPNB 4X8JA 1NBZB 4RAVB 5BS0B 1DQMH 3RY6A 4PREB 1B0WA 5E5MB 3DIFA 3EJYD 2AEQH 4KUZL 4ERSH 4PJAE 3HPJA 2P5EB 2QQNH 3ORJA 5TDNA 4K9EH 5JIKA 4NQCD 4G6KL 1I1FB 1D5IH 1H0DB 3D69B 3MCLH 5DZNA 5K9OB 1MQKL 2IH1B 3BIKB 4KZEL 2W9DH 3QQ9D 4ONFL 5D96B 4JN2A 3CSYB 5HVGB 3RVVC 1JNNH 4BZYA 3RWFA 4OCLC 3EYVA 1A22B 5GRWA 5IMKB 3QEGL 3STLB 2O5XL 5JMRA 4OKVB 5J9PA 3VFMB 3M8OL 1P1ZA 5C07B 4UQ3B 2IPKB 4QRRA 4NQVB 2PW1B 2LTQB 1RJLB 5ELIA 4ZFFA 3MOQA 1T21B 4Z77A 2Q7NA 4G9DB 3MRPB 1TTFA 1MJ7H 5EO1B 5DDHB 3WL9B 3ZYJA 3PNWA 4KJQC 3LS5L 4ZTPH 4LKCB 1K6QH 1PJ9A 1V7MH 2M8XA 4M3JA 3C6LB 3EJJX 4YC2B 1FVCB 3HCVB 3FOMA 3VXTB 3X13A 3CVHL 2F74B 4X4MA 4YFDB 5FHBL 3SDAB 1BQLH 1S7VA 4JO1L 3FFCD 5I1HH 1V7NL 4RGMB 4L3CA 1YQVL 2AXJA 4UI2A 2V2XA 4WFFE 5BW7A 3O8XA 2R8SH 1DBKL 1X5GA 4JM4H 3QIWC 1C08A 5I16A 3NIDE 3KLAA 2W0KA 4OF8A 4WEMB 3FQXB 3LN5A 2FRGP 4MAUL 5LGHL 2W0FA 3D2UB 4L4TA 1XR9B 1RK0A 2J8UF 1YZZA 4MNHB 2KDGA 3TCXA 2EYSA 4CW1A 3RWJB 2BVPA 3NAAL 1YEJL 4RRPG 1FNFA 5F6IB 5KOVC 2MPAL 3DVGB 1NFIA 3ZL4L 4F15C 1HHGB 3U36A 1BFOB 4YUEL 5JO5B 5L8JB 3W5MA 1ZLWK 2D7OA 3OL2A 2XYCA 4D0DB 1S5IH 5SX5H 2YD3A 1A2YA 2H32A 5IF0A 2Q3AA 3ZLQC 1G6RB 5HHQA 4X80L 3U4AA 2N7BA 1F97A 2GJ6D 3ILQD 4OFDA 4OV6F 3WHXB 4CN1A 1DE4B 2ZG2A 2H41A 1OT1A 1WIOA 5DQJB 2H2SD 4IM8A 4PRHE 5DK3A 5C6TH 3IRZA 5F1IA 2DS4A 2D7TH 1MOEA 1LEKB 5INCB 4KPHL 4ZFZA 3GBLA 3O11B 5HHMD 1MH5B 5ALCL 2AXFB 4WJ5A 5LVEA 2FJHB 1KYOK 5JHDA 1JHLH 4H0GA 4JY4A 3VD5A 2OQJB 4OJFL 1MFCH 2CUHA 5C0JB 4YHZH 1V3JA 4D9QE 3CPLB 3ILPB 3RQ3A 3FN0L 3EJZD 1ES0B 3TT3L 1N4XL 1DBMH 5AD0A 4CU6A 3E2HC 1T04A 2PETA 5GGSA 2LU7A 1P5VA 3VXMA 3MLYH 1Q9LB 2AXGB 5DYOB 1CD8A 3QDMD 3V5DA 1I85C 4KXZH 4XP6L 5CGYC 1X5FA 2X5PA 2YD5A 5D72L 4ELME 3P0YL 3THML 4UDTB 4UUJA 1UVQA 4I13B 3O3AB 4LCWA 2ARJB 2NLJB 1KPRB 4OLUH 3MJ6A 3E1F1 1Y6MR 1YJDH 3KWWB 3RY5A 3MO1B 1F2XK 4HC1H 2HT2D 4U1GB 5FA4B 4LVOC 5EG6C 2XICA 3JZ7A 4KDTA 4F80A 5I1JL 1MF2L 1X5HA 5H35B 3D85D 2PYEB 4S0TD 4RQQA 1YEKH 3MLUH 3S3JA 4EXPX 4JM2D 4O2EA 4ZPVB 4H26B 2V2TA 3J8F7 3SDYL 4Q0XL 1NLDH 2IG2L 5HDBE 1EO8L 2KPNA 1D5ZB 3JTSA 3K1DA 4NM4H 1DQJA 4HCRH 1VGKA 1MRFH 3OR6A 4R0LB 4KDVA 2XZZA 1EBPA 1B9ZA 1PX3A 1CD1B 2IAMD 3BUYB 1OWWA 3FJTA 4KJWD 4HPYL 4HX1A 4OCXL 2X9WA 3O0RL 4QOKA 2AS5M 4MXVF 4X5WB 3UO1H 4HDIA 4XPFL 2GAZA 1KIQA 3WS6C 2R0ZH 3ARDB 5B8CC 4M6OH 4YR6A 3QA3A 1IAIL 2GK2A 4GAYA 1LEIB 1RUPL 4XNUL 4HUWA 4G3YL 2GYSA 1RZKL 4U49A 2EDWA 2APWA 1ZHBA 1RJYB 4JR9H 4LSPL 1CCZA 5D71L 1ITCA 3WFCH 5C09A 5FEBA 2CUIA 4Q2ZB 4HIEB 1JF5A 2XRAL 4JVWA 1BD2A 4P2QD 1X6NA 2YD2A 2ADIB 2CDFB 2VXSH 5E2UL 5CD3B 4N8CL 2ICWA 3DO7B 2FATL 4LARL 4N8VA 4QRRE 5KSAC 3HE6B 2W60A 1Q1JH 1SYVA 1IGFH 2V9QA 1AE6L 5GJTH 3T4YA 3MXVL 4GS7B 4O2FB 4JPWH 3LRGA 1AFVH 5CBEA 1R5VA 4DQOH 5M94B 3V95A 3W0WB 5DD1H 1J0IA 1L7IL 1ZHKA 2FIKA 1DVFB 5CBAB 5I15H 1Q9KA 4QHNA 4X4ME 2Y23A 4JFQA 5GGRA 3P77A 2DQIH 4DZBB 1L0XA 1NCTA 1UQSB 1U8PB 5I1LB 1R3HA 3H3PL 4Y4KC 3TYGH 2AJXH 5FYLH 4P23D 1MCQA 3FB5B 1KPUB 1U3HB 3QQNA 2Y06H 4X4YB 2WWMD 3IFPA 4L4TE 3RWDB 2NY7H 2NX5B 4DKAA 2D7QA 2VDRH 2HTKC 4XBPB 1PKQA 3HB3C 4MNQD 2E6JA 3NA9H 3DSNA 3VD7A 4YHNA 4AH2A 1GJIA 3T0WA 4W4OA 5D2NA 4XCFL 4PG9B 3S37X 3MR9A 4KVNL 1ORQB 5GGVH 3RBGA 1BBJB 5HJ3B 4I0CC 2AV7B 5KVEL 4MB4A 4UIKL 2H8PA 1S7WA 4Q9QH 4U05A 5IESL 2EDHA 3MV7A 3TYFB 2OLDA 3WE6B 4KKBC 2BSED 4MQSB 3H9HA 4MA8H 4DWHA 3A0OA 1G6RL 1G7IB 5C0GB 5D1QB 1T0MB 2EDLA 1N0LA 2X7LA 4JQIL 1DUYB 4JN1L 1SM3L 2HTLC 5CUSL 1HDMA 1P4BH 1TVDA 5JHDE 1GGCH 3KLSA 1CGVA 4QF1B 4AZ8A 1NAML 2AAVA 1W0WA 1J0JA 1UB6B 4N1HB 5EZLA 1ACYH 5CZVL 1MWAH 4EVNB 3QUZC 3BGFC 4PIRF 3TZVD 4HIHB 2JCCB 4OGAC 5F21B 1D7FA 5CILH 2DQJL 4LPVA 1C5CL 4MXQD 4NO3A 5I6XC 4MAYB 4H1LA 4OCRL 4LSRH 3QIUB 3L95B 1YEEL 3FZUD 3RUGB 1I8KA 3RIFF 2R1XA 2X4SB 2CGRL 5CWSB 3ARUA 2BNRA 4LCWE 2XZQL 4HH9B 5KANG 2HP4A 3G5YA 2CUMA 1HWHB 1G7JB 4CMMB 3KLHD 5BVPH 4HUVB 1I9RH 4ZS7L 4MS8C 3MRDB 1A47A 4WI9A 5D7JB 1U0QA 3BMVA 3GMNA 4HFUH 2LE9A 1KB9J 1A6ZB 3R06B 3V4UH 4NQCA 2NZ9C 1MAML 3SDDC 4B41A 3NVQA 4ETQB 5LKNA 5J4MA 2IWGA 3V6OA 1E4XL 3ARGD 2GTWA 5DMIL 2GK0A 1VESA 5IR1B 2E27L 3S35L 4JZJB 2DDQH 4E42A 4F58L 5ECJE 3MV8A 3WSQH 4UTAL 2YA0A 3JVGC 1KEGL 2G60H 2HT4D 3SEPA 5I1AA 2HG5A 1KLFA 4U0RC 4UQ2B 5DSCB 4TUKH 2NY4B 4NM8H 1PG7X 4NJAH 4Q58C 4YXLL 1W0VA 1KB5L 1I1YB 2CIIB 3DX6B 4QOKE 5IVXA 4TN9A 3GKWH 1KLGA 2DI9A 1FIGL 2ZKHL 3MRKA 2H1PH 1RULH 3GJFA 1S5HA 3BVNA 3VRJA 2FD6L 1LEGB 4M93B 1EMTL 3W2DL 3FT3A 1CI5A 3MROA 5GIRB 1EGJH 2CK0H 2FEEL 4K7FA 4CAGA 1U8KA 2BVOA 1JWUB 4HZLA 4BFEA 5H8DA 5FGRA 4RGND 5D1ZD 1DBJH 3MNVB 1TCMA 4HWBL 1QEWB 5CJOL 3TO4B 1JGDA 1K5NB 5L8LB 2DQFA 3MV9B 5C09E 4HD9A 3MRFB 4TTGA 5F9WB 3NFPB 1BD2E 1GVIA 2K3TA 4JG1L 1LE9B 5BQ7B 1B0GB 4JFPB 3WDJA 2ZUYA 1JNJA 5C9KA 2WIIB 3NOIA 3SE8H 1INEH 2A6KB 3RVWD 4P5KB 4R7DA 3JV4B 4NOFA 4ZOCA 5HYJB 1JYNA 3EDKA 3FHAA 3GB7A 5ABDE 1SMOA 2VDNL 3L9RA 3AXLB 3OXRA 4XMLL 3ESUF 4I4WA 3NZ8B 1OP3H 4NNYB 4I48A 1PZ5B 2OZ4H 4M62L 5KANI 3OKLB 1FFOA 2X1QA 3WNLA 1AQDA 4HG4K 2EEBA 3HNSL 1R3KB 1LO0L 1A8JH 1FDLL 4HGKC 4NBZB 2IFFH 1G9MH 1F13A 3VFOB 2J12B 1J10A 4GLRI 4HXBH 4K2UL 4FQCL 3V4VL 4I18C 5JDSA 4WW2C 2R4RH 3SGEH 4EI5C 1PKQE 1FORH 2E6PA 2XPGA 3V6FA 3GEWB 3JWOC 3AY4C 2JJSA 5DA0B 4X7TA 4ZUUB 3QDMA 5D2NE 1X5AA 3L3IA 3IYLW 2ZUTA 2FIRT 2ZPKH 2FJFA 4AL8L 4Y19A 3EYQD 5SWZA 3RNKA 1ORSB 5A2IH 2O5YL 1KCLA 4HJ0C 3TNMB 4NN6C 1CE6A 2XTJB 3PP3H 1K2DA 2HFFB 1KNOB 2HJLA 3MYJB 3MUY1 3RKPA 5T33L 5GGQL 3D85A 1IFHH 4UTBH 4V2CB 1EO5A 3PUCA 3GSWA 4JEGB 1YEIH 2J5LC 4N9GA 4LNVA 3PL6C 4GW5A 5MEPA 2VE6B 4QXTA 1A5FL 1JNHA 3QUKB 4OZ4B 3GMQA 4HUMB 3TESA 3VXUB 1R5WB 5DQDL 5CZKA 1UB5B 2AJSL 1A4KB 2H3NB 2EDYA 2P5WD 1IAII 2KZWA 1DQTA 3HZMB 4AQOA 1JF6A 2K9UA 5FOBA 3SO3B 2OK0L 3QZWG 3IFOA 1L7TH 1N7ML 5JZ7D 1XF5B 3ARRA 1I7ZB 2IADA 5DTFA 4JZOA 1SBSL 1KJ3H 3S35X 3BKYH 1FFNB 2BNRE 1GAFH 3MA7A 5IVOA 2FX7L 3RTQB 3CU1A 4D0CB 1A7RH 3QQ4A 1BVLA 5K9KB 4PJHB 3DMMB 4C83A 4QLRA 2BHZA 3IFNL 4NQCE 2LU3A 3LEVL 3LKNB 1MLBB 1JPFA 3QHZL 1JRHI 2NW3A 1B4JH 4F9PA 4YNYA 1NCWH 4JM2F 4OM0L 5EOTB 3K7UA 1V05A 1CXKA 4ZOBA 3V6OE 1F4XH 2OR7A 5FYLD 2EECA 5KSUB 4OQTH 5ESVB 4J3WA 5IVZA 4BKLA 5GS1C 1KXTB 2A6JA 3MV8E 3DVNB 4FQ1L 4IRSB 3BXNB 1VB9A 3U9UB 1AD9B 4PGJA 2J3SA 1KJVB 1T1ZB 1A21A 4ZAKA 5MP6H 2DIJA 2CMRL 5HGDB 3IDUA 5FFLA 4ZFGH 3PWPB 4HKXB 5IVXE 5CJBA 1OT2A 1QG3A 4OLYH 2Q6WB 3RDTA 3UBXG 4HJGA 4E41D 3FQRB 4GRWE 4ODUB 3QXUA 2IBGA 1BIHA 3C8KA 3KHQA 3OJDB 4ACPA 1T89C 4XAWH 2XQYK 3G5XB 3QB7C 3FFCE 3QIWB 3QWOA 5IROC 3WCYA 5T1KB 4KWUA 3DX8A 1YNLL 1N6UA 3P4NA 4TULH 2HFGL 5DMGC 3BH8B 4WO4A 1ED3B 2VXVL 3QFDA 5EZOL 3RY6C 3V5HA 3WN5A 1QVOA 4L1HA 4QY8A 1Q9OB 2B5IC 3VCLA 2HT3C 3ETBF 4MNQA 3PWNB 2FX8H 4BFGA 1BEYL 4F57H 3HZYB 1MFBH 1HKLH 4IRJD 4FABH 1WFUA 3GMPB 4YK4C 4QT5B 3HG1D 3AGVA 2XT1B 2R1WB 1RQ5A 4M7JH 1OP9A 1GSMA 3LDBC 2A6DB 2ZCLH 1YY9C 3ZDZF 3LKRB 3FB8B 4ZOEA 3HUJB 1XEDA 3KNBB 4U6YA 1VFBB 3UYRL 4NYLA 5ICYA 3IFLL 2UWEB 4KJPC 3RNQB 4XRCB 4U4BA 1FV1A 4HUUB 1FFPB 2BNUA 1FNGB 2W1NA 5ICZA 4LDLB 5MEQA 1JE6A 2I9LA 1DQQA 2UZYB 5HDQH 4LVEA 3QEQA 1UWEH 4WCYH 3WNNA 2JKXA 4JJ5A 5HHME 1U8HA 3PXJA 5I76B 4LCIH 3ES6A 3KVQA 1I1AB 5LAXA 1RFDL 3VE0A 2R0KH 5CD5C 1U2HA 1OB1A 1DN0B 2KQNA 1MREH 1YYLL 1TJGH 4HK0A 3TZVA 2C4XA 1EEUA 5KJRH 2J6EL 5BW7C 1H3PH 1RSFA 3O8XC 5EORL 1F3JA 4FG6D 1F11A 4A2LA 2ZJSL 3QDME 2BVQB 4YHKH 5FECB 2XOTA 3G08A 3Q0HA 1VKXB 1A6VL 3V6ZA 1DBBH 1QFUH 5GRXG 1NCCL 1K4DB 1XCTB 2CLVA 1U8IA 3QO1A 5SWZE 2NPLX 4PLKD 3UBXI 4GMSH 2UZIL 3HAEG 3HMXL 1PSKH 1NC2D 5C0AB 2ICEB 3MUGA 4IBLT 3EO9H 3GMMB 3EOAB 1U9KA 1MIEL 5SWQB 5ALBH 3ROOB 2B2XL 3KYNB 4KMQA 1I8IB 2LFGA 5JORB 1B4RA 4X0KA 4Z76A 1AR2A 4YDIH 2OTPA 2VLJD 3MNWA 2FEEI 5A16B 3BT2H 4X98A 3V5KB 1MHEA 1MVUA 4HKZB 1IKFH 3NFSH 4I3SH 3VH8G 4OSUL 2V5MA 4PJGB 5HYSB 2UY7A 2MKWA 2DQTL 4PJXF 4MQ7B 4LPCA 1ZGLB 1KJ2B 5F6HJ 1HIMH 5DD6A 3OAYH 1PG7W 1RZ8A 5EO0B 1FZKA 2VDML 2Q8AH 1RVFL 1ZT4A 4UV7L 5B8CB 1F45A 1WUNT 1B6DA 2Z8VC 1UH2A 3FHQA 3BWUC 1EXUA 3LQAH 4J12A 5CIPH 4CVZB 3QXAB 5D1ZA 3H0TA 3S5LG 1AXSA 1TDQA 1ZV5A 1LDSA 1JTTA 5JXAL 3BE1L 4K94C 2Z9TA 3Q3GB 2VLRB 4ZNCD 3VRIB 1UWXK 3BX7C 1QP1A 3LS4H 2IQAA 4D9LL 5DMKB 4LHUB 5IM7B 4G8GD 4GKNA 4KDTC 1R0AH 3VXRD 4LFHD 1WBZB 1JV5B 1KELL 5EBWB 5JA9A 3V0AC 4OF5A 2XN9B 1HXMA 3ZDZE 5E8NB 3EYOB 4OB5L 4EBQL 2VDLL 1CE1L 2EH8L 5MERA 5A1AA 1KJMB 3NACL 1OAZL 4MSWB 1RZJH 3W9DB 1QRNA 3BEWA 3WIIL 1AIFB 3NZHH 2GTZA 1D5XB 1CF8L 4PGBB 4OM1H 4YBHA 4NGHH 5FYKL 1A02N 3BO8A 1JBJA 4G6FB 2QADD 4OZFG 4R26L 2R39A 3TN0A 4BELD 2Z35A 4PS4H 3NCJL 3HE7A 4L8SB 4LQFH 3F7QA 4DKFH 3MRBA 4G43B 4LF3A 1CFVH 2V5RA 4M9OA 1RJCA 2P8LA 4OFYD 4CVXA 5D7LB 2YC1B 2EIEA 4J3TA 3R0MA 3PHSA 3MMEB 2VABB 1I7UA 3TBYB 4HSQA 1AKJD 4MNQE 1B6UA 4RMTA 2BHYA 1WV7T 4IEFB 4Y4HA 1CFQA 2FJGA 4GBXD 3O6KH 4BFBD 3QCUL 3U2SB 4KHTL 4R90H 5LXGL 4HCRA 4ZYKB 3E8UL 4JO2H 1NGXA 2VXUL 5GRJL 4YE4H 1W8OA 5K9JL 5HHXL 3B4NA 4XPBL 2UYLA 5T1DL 4OT1H 1XGTA 2FX9H 3LPGA 4N0CC 1LNUB 4X9GA 4ZO6A 3SJVD 5JXED 5I1EH 1EHLL 2XKNA 5L2KD 1FAKT 4AEIL 5L0QC 1TIUA 3V7AE 3MRHA 4LEXL 5D2LA 5DD5H 2HH0L 2UUDK 3Q5OA 1I8LA 3QG7H 4RFEB 4PRPD 1MHCA 3HRZA 2VISA 1RK1B 4MX7A 4OZGF 4U31A 3HZVA 4Q7DA 2X89D 3U46A 5IQ7L 2Y07H 3GM8A 2EDRA 3JUYA 3C08L 5J0BA 2R2HB 3S96A 4HF5H 3OX8B 3TBWB 2C1OB 1G9NH 3CJJA 1FN4B 1MY5A 1OGTB 4UT9H 1ZSDA 4KK5C 4PGCA 5D7KE 4ZXBB 2VDQL 2G5RA 1EAPA 5HGBB 5L88L 1A6AA 3B5HA 3FQTB 1NC4D 5HI4D 5JUEL 4M02A 4K71B 1BVKA 1IAKB 4RMSA 3C60B 4NQEA 1CG9B 1DUZB 4W4OC 5D2NC 3EYFA 1CZ8L 4Y5XA 3AS2A 3HPLB 1BQHB 4U0QB 5IMOB 4G8EA 4H88H 4GW4A 4R96A 3MV01 4D94A 3MNZA 4U0RB 4J6RL 1PLGL 4JGUA 4NO5A 1BLNA 1QFWH 1FNEA 3MRIB 2O5ZH 3DNKA 5IB3B 5BS0D 5I17A 4G6JL 5C0BB 4QRTB 1LK2A 2WUCL 1LO3H 1IC5L 4U6HA 1IM9A 3P4MB 4XBGB 2WINA 1CFNA 3U1SH 3RX8A 4JKPL 1EFQA 4R97C 4APQA 3O3UN 4JFDA 2E3VA 4UZGA 1ZVSB 4FQIL 3VGHA 2VQ1A 4R3SA 1KCUL 3QJHA 3NH7H 4TUJA 1KJ2L 4E41A 4HLJA 3MRJB 4XH2B 2NY0B 1XF3B 4OLWL 3UJJL 2DJUA 3RWHA 2D03L 1CIDA 2VC2H 4Z8FH 4KKLC 4WUUA 1YEHH 3IDIB 4U1HB 4OD2A 4RGNE 1RUML 1AGEA 1ZT1B 5ID0A 3ZKMC 5ERWB 3BQUD 4JPKH 4XWGH 5C07D 5T5FL 4K7PL 5KG9B 1RUKL 5IW1A 4M61A 4OCWH 1M6OB 3B8YA 2WUBL 2YOCA 3EJYC 4Z7VA 1P4LB 5TDOA 3OZ9L 2WBJB 4M6NL 2V2WB 5F96H 3S36H 4M7KH 2A77L 3HG1A 4MA1C 4HGWA 3HC3L 1XGYL 2HJFA 3O6LL 4LPWA 3AB0B 2JK5A 5IEKA 4QHMA 4F3FA 1JGLL 3MA9H 3MCKA 4PY8I 4NHUA 3U4BH 5DVMA 3CFCH 4NCDA 2VXQL 2ADGA 4QCIB 2QJDA 2PKDA 3V6OC 1CLCA 5B38B 5I71C 5JPNB 4U1LA 4WI5A 5I8CB 4PBWD 1QRNE 2IF7A 5LJYH 2ESVB 3BD3A 1CGWA 1Y6NR 1UJTA 3LN4B 5IMMB 2A1WH 4HT1H 1MI5D 4M7LL 4WENB 4L8CA 3DV4B 4NKIL 4URTB 5FF6A 1B90A 1RV6X 2AERT 4YDKH 1CGSH 3KPOA 2FGZA 5ANMA 3IXAB 3CAFA 4J4PD 3QCVH 3T09A 1X5ZA 1ZLSL 3CC5B 5ITBL 4XVTH 5I2IB 4K55A 4L9LB 2H9GB 2NY5C 3V9FA 4Z7VF 2NY2B 2FDBP 3TFKD 1VFMA 5F3HB 3RIFK 5FYKU 2G2RA 5F3BA 1EV2E 3EDJA 1BBDL 4NWTL 1WAAA 2VZUA 5DLML 1KULA 1QSFD 1FGVL 3MACH 3WV0A 4NZTL 4I3RL 3VXPB 2NY1B 1N6VA 1YPZB 3RU8L 3OKYA 3TNNA 2IALB 1JWSA 1QQDB 4WI7A 5CGMA 1SJHA 3I6KB 3JXAA 3MRQA 4WHTA 5JQHC 3STZB 4D9RD 2I9TA 2XZAL 3S4SA 1NMAL 3ULUH 1NJ9B 5IW6B 4OFKA 3O41A 2VSDA 5GISH 1EGJA 3QWRA 1C12B 5DUBB 5CHNB 5KSBF 2L4OA 5D2LE 1IAOB 3MLSL 3REVB 5GXBB 1N3NA 2Z93B 1IC7H