3QWRA

Crystal structure of il-23 in complex with an adnectin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
304
structure length
295
Chain Sequence
WELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQKKDRVFTDKTSATVICRKSISVRAQDRYYSSSWSEWASVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cytokine
molecule keywords Interleukin-12 subunit beta
total genus 54
structure length 295
sequence length 304
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA03
1B4JL 4HFUL 4DVBB 4CRPA 3SCMC 3T3PF 3F5WA 4GKSA 5FAAA 1JPGA 4GG8B 4A6YA 2NY4B 1MI5A 5FA3A 2KQMA 2B39A 3FT3A 3PQYD 1E27A 2PR4H 4XPAH 4L8SB 2R2HA 1ADQH 5BO1H 3KYMB 3MV7D 2IEPA 1BOGA 3NFSH 3F6IA 3GRWA 2IADA 3L95A 1TJHL 5J1TC 2UZYB 3ARDD 4FQXB 3N9GL 3ZKXB 1NAML 3MUY1 2Y5EA 4IHOA 4PJ5E 3LSOA 2AV1A 4YE4H 3WIFB 2WBJB 3TF7C 3NTCL 1H8OA 3S97C 2B7DT 3O6KH 4NQCB 1MI5B 4NQCA 2BX5A 1AGDA 4PY7A 3T0EB 5T3XE 3WJLC 1II4E 3QG6A 3IDIB 4UU9B 1CICA 1P1ZB 1ND0B 2DWEA 2ICEA 4B53A 1OTSD 4NQSB 1OB1B 4X80H 3VWJC 5EOCJ 1TTUA 4A6YH 3GSNH 1O5DT 1G9NH 2EXYC 2P8MB 1P4IH 3IFPA 3HE6A 1A7OL 1MNUL 1RSFA 2MFNA 1MCBA 2CXKA 1EDQA 1QNZL 5I16B 3B3IB 2FX9H 2QR0A 2WINA 5EU6B 4LLVB 4F7PB 4X6CB 3G5XA 4EI5D 3MGTA 4K3GA 3C09C 4FFVD 4U1NB 3GSXB 4JFZL 2DQFB 1CGSL 8FABA 5DRNA 1G7IB 1MHHB 1XGYH 3BT2H 4HKJA 1HEZA 1JWMB 4Y4HD 5KS9A 4LEOB 1BGXL 2YXMA 1V3MA 2ARJB 3CJJA 1HN1A 3LQAH 1J88A 2ZCLH 3BHBB 3UPAA 3HNSL 1AC0A 1EBAA 2Y06L 3REVA 1NFDA 4NKOB 5D7JC 5AAMA 4GKZA 4FQIL 1WC7A 3B6SA 3V0WH 1J8HE 3QEQB 4EJ1C 3NVQA 4NQTA 5EO9A 1ZA3A 5E8DH 1PZ5A 5C0JB 4I0PA 3K2UL 4RNRB 4MQ7A 4Y1AE 3CVIH 5GSRA 4P0DA 4XRCA 1MWAL 1OGAB 4H20L 3RAJH 2PW2A 4NC2B 5DQ9A 1QBBA 5D93B 1LO3L 4M6OL 4RMTA 4X9FA 1T5WB 3O45A 3BKMH 3MRPA 4NP4H 5ELIA 5CZXD 4TYUA 3ZE2E 3JTTB 3NIFE 1AIFB 3B2VH 3GSWB 1A2YA 4JDZB 4NNPH 4MJ5B 4P4KD 1D5XB 1AGCB 1NFDE 1FZJB 4Y4HC 1ED3A 2YC1A 5HHME 4X7TA 3AS0A 2VDMH 2XZAH 3O4OC 2O26U 5H35A 1OAZH 3HR6A 1WISA 1JRHH 5D70H 2VL5B 1U93A 1P4BH 1A6VL 2OTWB 1UVQB 3C9NA 4G9DB 1ZVSA 2CO7B 2AJ3A 5I8CA 5M94B 3V0VA 3AY4C 2CXGA 3P30H 4IOIB 5L8KB 1CDIA 4EN3D 5KW9H 1BJ1H 3O41A 1N6UA 5T3ZH 5ADOH 3BO8B 1HHKA 3GK8L 3L3JB 1KXTB 1I85C 1DP0A 1KJ2L 4LIQL 1L7TL 3O9WA 2BJMH 4JE4B 4XMPL 4JFPA 5FDWA 1KPUB 3T0BA 4JFOB 1LK2B 4MNQD 4KK8C 2EO9A 4K7FB 2HRPL 4KDWA 1X6NA 2YHGA 4FABL 1X5KA 1OCWH 2AP2A 3WFHA 4NNXB 4MNGB 3L7FB 3CZJA 4HUNB 5I19L 1PKOA 2FBJH 2F53D 5HHOA 2NY5L 3WFCH 3WJJC 4M1DL 1K4CB 5KTEL 4XVTH 1GRWA 2FL5B 2AJUH 4XPTH 2VC2H 4OF6A 1MH5A 1KB5H 3DX6B 4OZFG 2BY0A 3PUCA 3O2DA 4G9FE 1RJZA 4L4TB 1A1NB 4HW6A 3QUXD 4IS6A 2BP3A 2ZUWA 3LEYL 1ES0B 3T0XA 3MZTA 1G6RH 1KCRH 1BQSA 4IRSD 3D25B 1YC8A 4LLAA 1XGQA 1OW0C 3BN9D 3MZGB 5F7WC 3OGCB 3QUMH 1FGVL 1NCBL 5D2LB 5CJ5A 4XCCH 3O4LA 2IF7A 2XPGA 3SGKC 1P69B 4PJXB 3CUPB 4RMSA 2CLRB 4HFUH 3MRHA 3WXVL 1C7SA 1IEAB 5JPNB 3EYOB 2ENSA 5GPRA 3JXAA 4PJ9D 3CLFH 3C6SB 1AI1H 4XNUH 2EIZB 3MA7B 5DDHB 4JVWA 4QRRE 5FK9B 3ISWA 1B4RA 4LQ1A 2IAND 4HG4K 4JREB 2EDWA 3RTQB 2CJUL 3MRMB 3NCMA 5HHVL 1YC7A 3GJFA 2GITB 3OKKB 2FWOA 4N9OB 4PJEE 3MACH 2F19L 3MPCA 3S36H 3SE8L 1UQSA 3ZHLA 5CEZL 1QO3A 3UYPA 5KSBB 4PP2B 5FUCE 4GAGL 5CEZD 2X42A 3D18B 1U8QA 3JWOL 1I1YA 2ZZUT 4FG6C 4FQ2L 1KB9J 1HQRA 1NBYB 2EYTA 2Z31B 4AIZB 4GMSH 3WHXA 4P2QD 4M5YL 2VQTA 5C08E 1VHPA 2ARJQ 4PJAA 4JFQB 3QJFB 4AG4L 2OBGA 2Y07L 5F21B 5DEZA 2UYLB 2CKBA 4TVSa 5M95B 3WHE0 4HK3N 4RGMB 4C58B 2YD6A 2I25N 5C0BE 4WUUB 5DMIL 1NBVH 3BDXA 3V6ZB 3QDMB 1HZHL 1LP9E 3ARSA 4X7FC 3QO0A 5GGRY 5LG1A 1S9YB 4D9RD 1KNOB 3LEXB 3RDTC 1D7FA 3P77A 5C0AE 1ODAA 2Q86B 4LOUC 1QTYT 1EHLL 1Y0LA 1KIPB 1DQDL 1T1XB 4CGTA 5I1AA 3JV6A 4FRWA 3RIAK 4KROC 5ALCH 4X7CC 2RBLA 4U1SB 5DSCA 1U92A 2VLJD 3CMGA 5KBNC 2FD6L 4ZPTA 4JM2B 1V3KA 5IVXA 5I1IH 1RK0A 1L9NA 3FT4B 5JOFA 4L3EA 1MUJB 4YO0A 4HWNA 4DK6A 3RY6A 2HVJB 4KPHH 4HMEA 5DZNA 2Z91A 3TBWA 4P2RA 1A3LL 3QDJA 1NFIA 4LVOB 3SDXF 4X8XA 5DRZB 2WANA 4CN4A 3OG4B 2E9JA 3MXWL 2H26A 2C1PA 4JO4H 3QDAA 3V5HA 2LTQC 4N0UA 5T3XD 3UYRH 4JZOB 2MCPL 1RI8A 4PJFA 3ZDZE 1X7QB 1I1FA 4MAYC 4M93C 5I1LA 1Q1JL 1CG9B 4BH7B 1RUAH 5GS2D 5EU7E 4XX1E 4MXVF 5IFAH 3SOBH 4F9LC 4L8BA 2NY3B 4PRHE 5H2BA 1F90H 3CVHH 5IMMB 5KSAD 2DQDH 2ZSWB 1NUFA 1W0VA 1N6QL 3RNQB 1OAQL 4D8PB 1ZHKB 1HXYA 1ZA6A 4Y1AB 4I3RH 2D7TH 1I8KB 4O2EA 5DYOB 3C60C 1G84A 1TVBB 4NYLA 4GRLB 4HZLB 1X5AA 4M8QA 5F7DA 4JFQA 4PJIA 1S7TB 2P8PB 2APVA 1EZVY 1PY4A 4O2CB 2MKWA 4S1QL 3OJ2C 2AJYL 2CPCA 5D72H 1NLBL 1N2RA 3FCTB 3HR5B 3RGVC 3MROB 4DAGH 5EN2A 1W72B 2Q7YA 1NEUA 2XG4A 3LEVH 5LXGH 3G6JB 2X44D 2JJUA 2VXSL 1IBGH 5FYJE 3RTQA 5EOTB 2ZCHL 5DQDL 3VFVB 3O9WD 5CIPB 1KBGL 1DL7L 4U1HA 1RK1A 4Y16C 3WIHH 2VXUL 3V6ZA 4J3XA 4QOKD 3QFJE 4Y4FC 4RFNC 2V5MA 3UDWA 1JP5A 1EEZB 1ADQA 5AEAA 3Q1SL 4NNYA 3VCLA 1IEAA 4WUKL 3E0GA 3WL9B 2ZUSA 1OM3L 2D2OA 1TVDA 4UZGA 4HD9A 4NGHH 1WEJL 4S11A 5KTEH 3T3PE 1FORH 2FJHA 4GKOA 5DJYB 3T0DA 1A7PH 1BWMA 4MDIA 3MLRH 2VDRL 5JQ6H 1F6AA 3QIWD 3BRGC 2CIIA 2DKSA 3HAEB 1J86A 3GMQB 2GW5A 1UENA 4NKMA 2ATPB 2FX8L 5ILTH 1DQJA 3I75A 3OAUL 5FV2A 2IAMA 1VADB 3K81A 4H0IA 1ZV5A 4QTHB 4TQEL 4V1DE 4FQQB 3QUML 4GSDH 5L8LB 3TO2A 1F4HA 1CK0H 1U8PA 2BRRL 1F97A 4NO0D 3H9SD 2YRLA 5EIIB 3SDDA 3TLRA 1Q9OB 4TVPD 2BXZA 5GJSL 1X5ZA 2UVEA 1F3RB 4RIRB 3DECA 3IFLH 4APQD 4GRWH 4TVPL 2DN7A 5FCSH 1A6AA 2EKSA 4KJQC 4X7SL 4NDMB 4OGYL 5J7CC 3OKMA 5FB8A 4M03A 2UVFA 1FZMB 2EO1A 2Z8VC 2V7NA 3F58H 3CC5A 3SGEI 1CD1B 1EFQA 3CIQA 4L4VD 1KXQE 4ODSL 4OIBA 3QI9B 3KXFE 2Q76B 4LSRL 4TUJB 2AJ3B 5I8CB 2RQ8A 2XA8H 3QWRA 3VWKC 4TULH 1AD9B 2PTTA 4MZ2A 1HSBB 4H1LG 3C9NB 5KOMC 1T6VN 2VLKA 5T3XH 3VFNB 4YXLH 3KXFB 4JFFE 2EEAA 4UTAH 3M17B 3RWGB 1T03H 4HUUB 5JXED 1CDBA 5CSZB 1JGVL 4KVCL 3QQ3B 1X5IA 4NN6C 2JJSA 1TTFA 2ZOLB 1AD0A 3T0EE 3U0PB 4D94A 5ESVA 3QFDA 1SBBA 4RQQA 3FOMA 1P4BL 2E6PA 3LHPL 5F1IA 1XGUB 4H5SB 1S78D 3KJ6H 1J1OH 3P30L 4Y5VB 3O4OB 4X99B 3RWJA 3MLZH 5T3ZL 4P4RA 3E8UL 1X4YA 1YECL 3O3AA 4HX1A 3OAYK 4LNRB 1QLRB 3U9UA 1IAIH 2I60L 4C4KO 1R6VA 3O6LH 5HHNA 1F45A 5EO9B 2I9TB 1W72L 2DMCA 3QRGH 4KHTL 1CZ8L 1WC7B 5C0AB 3MGAA 5BZWB 1XZ0B 5GS2H 2DTML 3IKKA 2W9DL 1B90A 5DA4A 4TSAL 3FQUB 3CFKB 3N85H 3D39B 3U46A 1IJ9A 3BHBA 1JNNL 4N8VG 3SDCD 4LSPL 4U1KB 1EMTL 3KPLB 2OYPA 3UJJL 3MRPB 1YEDB 4HIIA 4ERSH 2MPAH 3KGRA 2ZJSH 5ICZA 4D3CH 2QR0B 2WINB 1T1ZB 5GSRB 1RD6A 4K2UH 4RNRA 3GJEB 5IW1A 3VXNB 4F7CB 1F42A 3MLWH 2VKXA 3PWUB 4PJ9A 2BVPA 2PETA 3B6SB 3BIBX 3DUHA 1CFBA 4PIRF 2HLFD 4OZHB 1L9MA 1NSNH 1QPPA 4BUHA 1D5ZA 1J05B 4LPWA 3V95A 1IGIL 2EH8H 1NMAL 4G6FD 5C86A 2ICEB 3HG1D 1C5BL 5IOPA 1S9WA 1KTRL 5FKAB 1MLBB 5DFTA 5D7JA 1HEZB 5EBWB 2BHUA 2AK4B 4AEHH 4WHYG 3RPIA 2NY4C 2KZWA 2X4RB 5AYUL 4KKNA 3FL7A 2N7AA 4O9HL 2AV1B 3P4LA 4IHOB 2A74B 4OJFL 5E9DE 1YPZF 3HI1B 5IMKA 4FQXA 1LWRA 2X9XA 1F4AA 1D6VH 4G9FB 2GJ6D 5I16A 1V7NL 2VWEE 2UZXB 2YD9A 1EJ6A 3OBAA 3MGOA 4LCCA 1LE5B 4QHKI 3PGCA 4L5FH 5C0IB 3GBMH 3G6JF 4LCCB 1DL7H 3RTQD 1LE5A 4Z7OF 3GSVA 5CEZH 5GGRB 4XNMB 3BKYH 1OB1A 4FFYH 3Q1SH 3DUUB 3DVNA 4H1LB 3ZDXF 4JPIB 4MA8L 4PJXE 3QH3A 1QACA 2FSEA 3KDMB 3IJSA 2SEBA 2A9ML 3QRFM 1UCBL 5D7JB 3IDJB 4IOSD 4PJ9C 2DLHA 4NJAH 4KRNA 1OGTA 5DMIH 3ZYJA 4R0LC 3ULUE 3WJLA 3THML 2EDQA 1DZBA 1C08B 3HNVL 3W82A 4EBQH 5C09D 3UJIH 5IVNA 3IDMA 4HC1A 4I48A 3TYGL 5J13B 4MXQD 1VEMA 4Y4KA 5FGCE 4HLZG 5FYLD 1N0XL 3EDJA 1HXMB 2FO4B 4M43L 4K3DL 1BF8A 4KKAC 1AQDA 5SWQB 1H8NA 4FXGA 5MEOB 3FT3B 4MXVE 1LO5B 1QEWB 1QBML 4HGWA 1UM4H 4JKLA 2OK0L 2IJ0C 4IMKC 2YPKB 4KHXH 1OPGH 3TA3A 4Y5YC 5F97E 1I9RL 1DDHA 4ZO7A 1MCJA 3I2CL 1R0AH 3TN0D 5J3HD 43CAB 3CVIL 5ACLA 2OXHA 1DN0A 1CF8L 3ARFD 5D2LE 2C1OA 4LQFH 1EJOL 2HFGL 3KPLA 5TQ2H 3QQ9D 4XPBL 2YS4A 3MV11 3C6LB 1XR9B 3M1BA 2ERJB 3P2TA 4OLWH 3D39A 1R5IB 3FQUA 2WIIB 4XPGH 1FAKT 1LEKB 4JO4L 4ZSOA 5EO0B 3HCVB 3QP3A 5D9SB 5EU6E 4LOUD 4WI7A 4NWTL 1JRHL 4LLQA 3WE6B 4HT1H 1K5NB 4S1SH 1YJDH 2XA8L 5T5NG 4P59H 3QUXC 1UADC 4WFHE 4WCYH 2W07A 5E6ZA 2IGFH 2DD8L 1SJHB 4L29A 1ZS8B 3GK8H 4EQ2A 1CXIA 4PJIF 25C8L 4LFHD 1CDYA 4BSVB 2CDEA 1IQWH 1FL6A 3EBAA 3FQRB 2JJTA 3OPZH 4HQQL 1OAXH 3IDYB 3ARPA 1FE8L 5I6XB 1QRNA 1W0YT 2XA3A 5KG9B 5E8OA 4AL8L 2R9HC 2PO6D 3QCTL 1S3KL 3FRUA 1CDUA 3QJHB 2OX5A 3ZTNH 3HG1E 5GS0H 4UT7L 3C09B 2PCPB 5CWSA 4FZ8L 3N1FC 1JPFB 1HSBA 1K8DA 5LGJB 4TNWK 5LXGL 2IBZX 1AD9A 2PTTB 3RHWF 1AP2B 4WEMB 1H3WM 2D4FA 3OTTA 1K8IA 5JW4N 1MCFA 4URTB 2QQKL 3QDHA 3I50H 4H0HB 3C5ZA 1KIQA 5EB9A 4LF3B 1Z9SA 5CSGA 3SGDI 5HPMA 1NAKL 3QI9A 1A9EA 4K94H 4W4OA 4X6FB 4UDUA 3PHOB 4AIXA 5I76A 4UNTA 1CD1A 1NGZB 4PGZA 4N68A 3MBED 2NZ9D 4XVUD 3C5JB 4UOW0 1MEXL 1TIUA 4K3EH 4ZTOH 3CNKA 3ALWA 4E41A 3D3VE 1G9NC 2D9QB 3BGMA 5A40E 4I3SH 5F1NA 4U1JA 1RV6X 4WHDA 3V7AG 1YUHB 2C7UA 4OQTH 1Z9OA 4HFWB 5C6TL 1D9KB 3TBTA 1F4YH 1UGNA 2FEEL 1HQ4B 5T5NF 3MR9A 3QZWG 5JMRA 3FQTA 3L3GA 1SM3H 4N1CA 1VENA 4ZDHA 5MERA 4EUPH 3R1GL 4CNIA 4DTGH 3OAUH 2ATPA 3T8XB 5I74C 1S7WA 1L0QA 4Z7NE 1U8OA 4GT7A 3S36X 3MV7A 3R0NA 3GUTA 3D48R 4WWKA 2QEJA 4PRNA 1RZJH 4WJ5B 2MHAB 2DM3A 3BPNC 4JFHD 1I1AA 1U8HA 3DVIA 1MWAH 5FIEA 4HV8B 3EDEA 2ESVE 1FV1A 1AKJA 3HG1A 1NH6A 3P9LB 3O2WH 4HG4J 3V4UH 1X3DA 4YUEL 5F9DC 1SBSL 4L9LC 5D7SL 3T0ED 1YEEL 4NQCD 3IFNL 4UI2A 4N8VA 2X5PA 2CGRH 4WO4A 5FOBB 3MV8E 3C8KA 3DWTA 4S1RL 2EE2A 3R06B 2H6PA 4H0GA 1EXUB 3J8F7 3SKNA 4HKZA 1U91A 4OUUB 3N50A 3NIGE 2RFXA 3VD5A 3CFCH 1C1EL 4I0PC 5IIEA 3KPNA 5FA4A 3TVMD 5ICYB 4UIKH 5HI3D 5T3XL 5ADOL 4U1MB 2R4SL 4HIHA 3FN3A 2IALA 4K71B 3TNMA 3E2HC 1W8NA 1WFNA 2EE3A 5TE6L 2I9LB 2AJVH 4KJQD 5HYJA 1CLOL 5EBGA 2IQAB 1EEQA 4BUGA 1Q0XL 4NYLB 4KQ4L 5J1AA 4YFDB 3TBVB 5E08H 4UIMA 4I18C 1H3VA 4YHLH 4LSQH 4P2OC 1KG0B 1DANT 4NT6A 5FYKL 1OLZA 2GQHA 1JNLL 4MA3B 1A3LH 2FBJL 1P6FA 4DGYH 3LS4L 1MAMH 2XNAB 1DLHB 4F9LA 4FXKB 3NGBB 5FEBA 1T04B 1GC1C 2WP3O 1MVFA 5F3BB 1FRGH 4IRJA 2VAAB 2FEDD 3K8KA 5TH2B 5DMKA 1UB5A 3GJFK 4KHXL 1UB5B 5DMKB 1I3RB 3BKCH 4IRJB 2PTVA 5DJZA 5F3BA 1NCCL 3V6OC 1AXSB 3PWPD 2C1PB 3OF6D 4BH8B 1DEEB 4K8RC 4ZFGH 4HK0B 4LCWE 4R2GC 3NAAL 2EIEA 3PQYA 5T5FL 4XPBH 5DRZA 5IB5B 3TIDA 5CMAA 3TC9A 3HI6H 2H8PA 1I4FB 2J5LB 3TZVC 5D6CB 3IDGA 3RVWC 2A9NH 4XPGL 2R8SH 5CILL 5HYQB 1DFBH 1QHPA 3DRTA 1FDLH 4LCWB 1HILA 1U8KA 1UT9A 2DTSA 1S7RB 5I8OH 4XVSL 3GDBA 1NGWB 4ZPTB 1EX0A 2VDKL 2E8YA 2NY0B 6FABH 5EO1A 5D7JD 3QXWA 2QADD 3RZCC 3S7GA 4WFEE 3Q6FB 3NFPB 3SEPA 1QSFD 3KPOA 4AENA 3FFCA 5E8PA 4X9BA 4TOYH 1PEZA 5BVJB 5A2JH 4JQXA 3PP3H 2AEPH 5I1KH 5IGXL 3QXUA 3CSYB 3HTLX 1JZ4A 3U82B 4XNXH 4IEFB 4ZUVA 5DK2B 3DV6A 4M00A 3O2DL 1P6AB 5CD5C 2R2EB 3RZCA 2HT4D 4KTDH 3AS1A 4MJIA 4WI2A 1KGCE 4PJEB 5L6YL 1QR1B 5GGSY 1OP5K 4BA8A 1AE6L 1KCSL 1N8ZA 1CGXA 5DK3A 1LO2L 3NIFF 2IH1A 12E8H 4OGZA 5IROC 1Q0YL 1CS6A 2V2WB 5C0GB 5JW5B 5CAYB 4YDJB 5E5RB 4PP2A 2PF6A 4OV6F 1QO3B 5C08A 2VOTA 4TPRL 1UQSB 4RAHA 3VI3F 5HYSA 1IGFH 1BIHA 2GJZA 1FORL 1XIWA 3MOAL 4HIEA 1INDH 2ZKHL 4PRHD 3GJFB 2D7PA 2WWKT 1G7PB 1TJGH 1OQXA 2XTJC 4OCWH 1Z5LB 3VA2C 1TITA 2VNCA 4X8JB 5A3IC 4P5TB 1YPZA 5FK9A 5EUOB 4XC3L 5E99H 3SE4C 5ILTL 4PV9A 1ZSDB 5FKPB 4N1EA 1X5HA 4WHYH 3D85D 4RFOL 3P40A 3FN0L 3QDME 2I5YL 5DD6A 3MFGB 3G04A 1XGYL 3TT1H 5IBUG 2Y7QB 3MLTA 1FFQA 1VKXA 1DUZB 5MEND 2KDGA 4OLZL 2XTLA 5GISH 3ZKSD 1YEIL 1QRNE 3C60B 4NM8H 1I7RB 2B5IB 2XZCL 2G9HB 2XFXB 1QFPA 4MAUH 3QEHB 3F12A 2E8ZA 3UTQB 4QXTA 4L4JA 4POYA 4PJDA 3GFUA 3D39D 2Q8BH 5DEFA 4CMMB 3SQBA 3BAEL 5GS1C 5C0AD 4PG9B 1H5BB 4FFVC 2WZPD 1AJ7H 3JWOH 3BKML 1QSEE 4PJXF 2ED8A 1RFDL 5SX5H 2ZG3A 3CVHL 2PUQT 5C3TA 3VFRB 4G7YL 4OI9A 4OTXL 3L7FA 3CX5K 5D2NC 3DO3A 3K8LA 3KPQA 4HH8A 4W6XB 3EYFA 5EIQA 1ONQB 3SKJL 5GRUL 3GHBH 4LCUB 4F8QA 3FQRA 5JMOC 1R5VB 3AU1A 1H8SA 4NWTH 2ERJC 4YEFA 5CEZE 1RZKC 1ZHBB 5E7BA 1JN6A 3SDYH 3DSFH 3S4SG 5B22A 3ZDYE 5IEKB 1VERA 4KQ3H 3RNKB 4I18B 2GTWA 5GGSB 1MFCL 4TSBH 4P2QA 1JFQL 2COQA 1C5DA 2R4SH 4Z0XB 5B38B 5E2UL 4WFFE 3RWDA 4OAWB 3HC4L 1XCTB 2RGSA 3PL6B 4JQIH 1YN7A 2CLVA 4HWBH 3TYFB 4GRMA 1CDCA 1I8IA 1RZGB 2CR3A 3C5SA 5EA0H 3OKOA 3VXSA 4GW1B 2HFEA 2AGJL 3VGEA 4KU1A 1AY1H 3CCHB 1UWEH 1KCVH 3MBEA 2NR6D 3L1OL 3DRQA 1G6VK 1YEKH 1ZLWK 2R1WB 1JNLH 2C1OB 5D2NE 1CDJA 4E41D 2DS4A 3MV9E 4YHOH 7CGTA 3BSZL 3EAKA 4POZC 3GMRA 4ZTPH 3UYRL 2ICWB 4RGOH 3TA3B 4ELMB 5KVGH 4MQ7B 1DE4A 4OI7A 4HGWB 2AERT 2VO5A 1LO5A 5AZ2L 3SOBL 4UV7L 1C5CL 2EDFA 4EDXA 1A1OA 4OLUL 5EIVA 3EO0A 2B0SL 3S3JA 3SBWA 1RURH 3QUZD 5J89A 2ZUUA 3GMPB 4FMKA 1N3NA 3KPTA 4BK5A 4F7MA 3VI3E 1B0RA 5KS9F 3OKEB 2PYFA 3V8CA 1P7QB 3EYUL 3QIWB 4AK1A 4LEOA 1GGIH 4CU8A 4JGMA 3VXRE 3PWLA 1HHGB 5DFVD 3CFEA 2P47B 1R24B 4N0UE 4ZG1A 3U7YH 1SQ2N 3DBXA 5EU4B 5EU6A 3S4SA 3R1GH 4ZO8A 5C0BB 3OB0K 3PGDA 1KEGL 5FUOH 3U7WH 1QFWL 4E41E 4ZUUA 4BKLB 2AW2A 3ULVF 2UUDH 5L7XH 1QA9A 5DQDH 4QNPF 1V7NH 3BVNA 4XVUC 3IFOA 3G5YA 3CDGB 4Y2DB 1TVHA 4OZFA 3WIHA 4PLNC 4MB3A 1SYSA 3LPGA 4G9FA 2AXFB 5CLWA 3HI1A 2FLRT 3PGDB 2IC2A 3HMWL 1RUMH 3S4SB 1AH1A 4XTRD 5DGRA 5EU4A 2ORBH 1L0XA 1IARB 5C0CB 4G6JH 4FQHA 1U3HC 1AGFA 2AI0L 4GAYA 1JJUA 5SWZE 5A2LH 4HHAB 1NANI 4WFFD 1IM3B 2K7QA 4ETYA 1DBJH 4DKFH 2ATKA 4HUXB 1RZ8A 2HKHL 1D5BB 5DD5L 1L7IL 1S7UB 1P7QA 2G60H 4L1DA 4POUB 3MRKB 4YK4C 1A7PL 5F89A 2JCCA 4NJAL 3H7BA 5JQ6L 2EZ0C 4PUBL 4F9PA 2R15A 1EAPB 4XGZB 5GS1A 3D2UA 3FZUC 2OI9C 4C83B 4Y1AD 4FQ1H 5ALCL 4EDXB 1UJ3C 1YDPB 4PGEA 3EOAB 4NFBA 5EUOE 3B9KD 2D7NA 4HBCH 4P9ML 1VFAB 2JELH 1RZFL 3DX7B 4R97C 5DHVH 1DANU 2Z92B 5ACZA 2HLAA 4OLZH 1FL3B 3D3VB 3ORJA 4M6OH 4RA0C 1I7UB 1GVIA 1BBDL 1SY6H 3MRIB 4QHMB 3EJYC 1B0GB 3MRFA 1AXTL 1NEZA 1R3IH 1Z0NA 2H41A 5DZLA 3DXAB 3QIBA 3ELAT 5F7YC 4ZNEA 3QUYB 3IS1X 4R0LA 5BS0D 1PKQB 5HYSG 5JW3H 2VH5L 3KYOB 5JDSA 3BE1H 1MFDL 2BK8A 4JFFA 4ODSH 5FFLA 2WAHA 4OAWA 3U30B 4L3EE 1MRFH 1T4KB 2RJMA 1HYSD 3AS3A 2I9TA 3BKCL 5HHNB 4DZBB 4ZAKC 3BPOB 4LNRA 3D85B 4JM2D 5I8EB 1JMZA 5C07B 1X5LA 1GHFL 3HB3D 4QRUB 2JJWA 3B5TA 1XT5A 3T2QA 4U4BA 3FHQA 3MO1B 5ISZD 3VA6A 4QHLA 4PJGB 4QHNA 2A9NL 1NMBH 1RZJC 3PP4H 4OD2B 1UJ3A 1TZGH 5F6HI 2CRMA 4JG1H 2NTFA 3OPZL 1MJUH 4NQXA 3RWEB 3MXVL 2DI7A 1U95B 2OI9B 2VSCA 4WV1A 1FGNL 4PJ5D 4KTEL 5DD1L 3MLZL 4JB9L 4MAYD 4KQ3L 1KJVB 2A83A 5E8EA 5GS0D 4JDVA 3QEUA 1CR9L 4NWUH 5INDB 4UDTA 3PQYE 3MLUL 4LGSB 3RGVD 2OSLB 2GCYB 3UP1A 3QPQC 3IETA 4MD0A 2XV6B 4F2MB 1KGCD 3C87A 2AKRA 5F3HA 5EA0L 1U8MB 3GSOB 3NMEA 4LLUB 4TSAH 4XP9L 1HH9A 2Q20A 1ZANL 2IANB 4YHMH 1I7RA 1NGXA 1EMTH 2JJTC 1LEGA 3T0EC 2RAMA 3JV5A 2YD7A 4LBEA 4MQSB 4P3CH 5EIIA 1BZ9A 3BIKA 4YX2L 4ERSL 4M62L 3GBNL 4WFED 2VUOA 3QUMA 4I0CC 3ROOB 4Z7QF 4LLWB 5KVGL 3BFOA 3TH4T 1MRDH 4FQQA 3S98A 3VGBA 1KLFA 2DYPA 1SYVA 1PFCA 1IC5H 1T0MB 3Q3GB 1S9VA 4HBQA 1GZPB 5FGBC 5GRYA 1F4WH 4KFZC 3ARGB 1IC7L 1M7DB 2DIJA 2PNDA 5LWYL 1Z5LA 4GUPB 2PYEB 1QYGH 3KR3H 2OJZL 3FT2A 1RZIA 2F5BL 3FB8B 4HULB 1YA5A 2IBZY 2AABH 1M7XA 5KVMC 2W1NA 3FN0H 2NW3B 3QUXB 2HLAB 3VRJA 3V7MA 3ARZA 1N59B 4HGKC 1CXHA 3HZVA 1Q9LB 2VLLB 3KPRA 4AEEA 2NMSA 3QIUC 4S2SB 1J5OH 5ANME 3GMLB 4PD4J 1I75A 1E28B 1ORQA 4MJ6B 3FFDA 4MAYB 2P48B 3MCKB 4YUEH 3UBXG 4GBXC 4TNVK 5HHOE 2IMNA 2YSSA 4O51A 1T3FA 5D71H 2A1WH 5DC0A 4C83A 5ANMB 3VXMB 4OZIB 2E9BA 3W2DL 5EZLA 4G6KL 5KN5A 5EFIB 5HVHB 1BZ7A 4L4TE 1HHIA 1LP9B 4PRAA 3G5ZA 4M9PA 5EZIH 2IQ9H 3CDCA 1I3GH 4GG6E 1HZHH 2Z8RA 4KJPC 4G8FA 2VXQL 5CP3H 2UWEB 3HI5L 1HHJA 5CKAA 3J7HA 1IGTA 2OCFD 1ZVYA 3G6JA 4GBXA 3RX7A 5IMLA 4J23A 2Q7YB 1K4DB 3QWRD 1KT2B 4Y19E 4PJDF 5EWIH 4WU5A 5DLML 3SO5A 4XCNB 1KJ3H 1AFVL 2YD8A 5TF1H 1Y18B 3BKJH 1CICD 1UWXK 2Z4QA 1NGWA 1H15A 5JXEA 4EN3B 3MNWB 3T77B 4PGCA 1AO7E 3OKNA 1EZVX 2GJ6A 3GHBL 1EUUA 1MHEB 1QR4A 4HZLA 3VXOA 1NBZB 4C56B 3D69A 4P3DA 4HS8H 1XGPA 1UH4A 3BVNB 3Q2CA 5C0CE 4DOHB 2E7BA 5FM5M 4WO4C 2LU4A 4YWGL 3L3DA 4JY5L 3L9RA 1Q38A 3UZEA 3V0AC 1PSKH 1UKQA 4BH8A 2JIXB 1MRCL 3MYJB 4IOFD 4QF1B 4NUGL 3U2SB 4ENEC 5GRVL 1T5XB 2EXYD 5DJAA 4K71C 5E2UH 1R24A 1PX3A 4P9MH 1KB5L 2Z93B 4U05A 3FONA 4X7EC 4NN6B 3HC4H 1ETZA 1JHKL 4ETQA 1RUQL 1ZXQA 4JLRA 1DLHA 3KWWB 2J7LA 1RUAL 3MLPA 1XF4B 2FZ3A 3B9KB 4MA3A 4JFHE 2C4XA 1LQSR 2AXJA 2R0KH 4X4XA 3ARFA 3EDDA 3QDJB 1UXWB 3I3BA 3GMPA 4UIMB 4Q0XL 3VI4E 5C0DA 2EYRA 1BECA 1HI6A 3VG0H 4YO0B 3A6OA 3DVGA 1SJEB 1D9KD 3X12B 4J8RB 3BMWA 4O58L 5SWZD 5SWSB 1MFDH 4MNHA 4MCYA 4GXVH 4RMQA 1OL0A 5FUZH 3ZDYF 5LBSL 3M8OL 3ARYA 4GRLC 4L9LB 4M61A 1U92B 4NCC1 4N0CC 3V4VL 3VG9C 32C2B 4S1QH 3QWOB 3TV3H 4ENED 2XTJD 5J11C 1P5VA 2CO6B 3EO1A 2V2XA 1JZ2A 3REWB 5IT2H 5SX5K 4GLRI 3MBEB 1TZHB 3T2NL 2DOCA 2DBLH 5K9KB 3L5WA 1H3TA 1YEJL 1XH3A 3EFFB 3VDAA 5IQ7L 1NMBL 1Y6NR 1RU9L 1KBGH 2P42B 3IVKA 1I8IB 1RZGA 1RZJL 2X09A 4CMHB 1GSMA 3I6GB 4JG1L 1XCTA 1T1YB 4M7LH 3LD8B 2ZWLT 3NFNB 5D8JL 1JHTA 4UV4L 5IVZA 4UNVA 2B8OT 4PJHA 1QUNA 1SBSH 1N64L 4PGBA 4WVRA 5CD3B 5CHNA 3VFTA 1RIUH 2GTWB 3BD4A 1SHMA 5GHWL 5FYJL 3GI8L 2NXZB 1XCQB 4LVEA 3U79A 3C8HA 4DVRL 4WEBH 4PGDA 4OZFH 1CFNB 3ALXA 2R0ZH 1DQLL 3L6FB 2JCCF 4OLXH 2D31A 3LH2L 1FCCA 1FYHB 4ODXB 4BZ2H 3KPRE 1S7WB 2W0FB 5CFHA 1FNAA 4HPYH 1R3HB 4LFHG 3UTTA 4IRZH 2VWEC 1A5FH 3NGBC 4NHCL 1T2JA 1SEBA 3L3GB 3X3FH 2DICA 2YPLB 1A7NH 1HQ4A 2I07A 1LDPH 2HWZL 4ONHA 4R4ND 5DZOA 2AXGB 5B8CB 2CRZA 3IU3B 4ORZC 4TRPL 4M5ZH 2OZ4H 5JUEL 3TA3D 4XTRC 5F1NB 3UDWC 2D7QA 1CE1L 1U9KA 2FJGA 5EOQH 4E41B 4ZUSA 1XGTB 3GIVA 2NY2B 5D4QA 4EI6B 4JANA 4DTGL 5HGDB 2HT2D 5ETUA 4EI6A 4NQDA 1U8LA 5F9WB 1CD9B 2OL3B 3OXRA 3CSBA 2R29H 4PRDA 2YD2A 3QNYB 3QR2A 1NCUA 2YD5A 4FFWC 1RJLA 4KV5E 2AXGA 3MBEC 3N1GC 5B8CA 5BJTB 2Y7QA 3MLTB 3BPCB 3O3BB 2Y72A 3MREA 3P11L 1U36A 4WI3A 4MS8C 1IT9L 4NZTL 2X4QA 4Y5YB 1MQKH 3KHOA 1GGBL 1FLRH 4UTAL 5JHDD 1AXIB 1P84J 3WFHB 4RWHA 5EUOA 3H3PH 2XY2A 4S1DC 1J1PL 4O02L 4OM1H 2FHCA 4OZ4B 3HC3L 2X05A 5E03A 3UTSA 3TT3H 4L3CA 3ET9F 2A77H 1KXVC 5DR5H 3M07A 1ZS8A 4LSUL 3MYZA 4XCYA 3MRBA 3JSSA 4ODWB 3CFCL 3ARBC 1TFHA 2KL6A 4G8GB 3ZE0E 1HHKB 5TDNB 2HFTA 4YDLB 5F9JB 1ZWIA 5CJXA 3ZYIA 5C6PB 1RVFH 4OT1H 4TNWF 5HSFA 1A7QL 5IFHH 3KLSA 1NAMB 4PJBE 5F8QC 4ZO9A 1F00I 3EYVB 1OY3B 4H8WH 4ZXBC 1FO0H 1ZLSL 2JK5A 4JM2C 4D9QE 3HHRB 4KXZI 4HQQH 1JF1B 4RGNC 1BP3B 3EJYD 4ZNEE 4YZFF 4DKEH 1XH3B 4HS8L 5CZKA 2H32H 3TO4A 4N90E 5E2WH 1UB6A 4PJBF 35C8H 3CSYA 3OAZH 3KPSB 2W92A 2AGJH 2YRPA 4X4YA 1FGNH 4F15B 3Q6GL 4HJJH 1EFXA 2P8LA 5FO7A 4X6DB 4FZ8H 5FF6A 3TVMA 4I9WD 3QPXL 1LO2H 3DHJA 4JPKH 5F8RC 3O3EB 4H88L 3S8WA 1ZTXH 3MJGX 2VLJA 4FZEH 4Q9BA 5EO1B 2RIKA 3TPUB 3KYKL 1J0JA 1IGMH 1T89A 3MLUH 2W0LA 1BVKA 4MXWH 3L5HA 1NCCH 1Z9MA 3X12A 4FXGB 1HILB 4R4FH 3TVMC 2J8UF 3QIUB 2N56A 4JFDA 3S34H 4P46D 1EERB 4I48B 4Q6IB 5BOPA 2VDPH 1CT8B 4NKOA 5T5FH 1S7XA 3MA9H 4Z7WB 4NRYB 3HUJE 4L8DB 5ALBH 1NGYB 2E9IA 2NLJB 1ITBB 1A6PA 4KUZL 5CILH 1PD6A 3V4PH 4GH7B 3HE6C 5GGVY 5IQ9A 2BRRH 3ILPA 3TN0A 3V6FB 1MHPH 3N0PB 1RIHH 3F8UB 2OTUA 4XVSH 3QA3A 4U1NA 3NH7L 3W11C 3Q5OA 3MOBL 4M7LT 3QDJE 3S35L 3TBSB 3RFZC 1PLGH 1A6ZA 4L9DA 3B43A 4EXPX 5EZJB 5E9DB 2YKLL 3MV9A 1J0YA 3B3IA 4NBZB 2VQ1A 2VAJA 2W9EH 4Q9RH 4OCMC 1Q9KA 1C7TA 2BOBB 3PGCB 3T2NH 1JWUB 1XF3B 1FIGH 5AUMB 3BEWA 1MREL 3B9KC 3DYMA 2R0WL 1YNTA 3ULUC 1FSKC 4HXBL 4M7ZB 1F6FB 1WIOA 4LLMA 3OKNB 2KPNA 3RKPA 1QD0A 3ES6A 5TQ0H 2BNQA 5L9DL 4YE4L 4JJ5A 1D6EB 4ZS6C 3RJQB 4HIHB 5F93C 1AE6H 5JHLH 4U1GB 2ITDB 4Z7UB 4GW4B 1KTLA 3H9ZA 1T03L 5I30L 1DVFB 1QFUL 3GMNA 3UTSE 4ZD3H 4LIQE 5HVFB 4HEPG 3QHTC 2RFXB 5IB2A 2Q3ZA 4X80L 1U91B 4OUUA 4YZFE 1L7IH 3MOAH 4IJ3B 2RR3A 4LCWD 3L95B 5EFIA 2HTKD 4LSSL 1WWWX 2V5RA 1JI2A 5KZCD 5FO8B 1GGCL 5EWIL 3P9WB 4CAGA 2NY6C 2FX9L 4OIIH 5JA9A 5JORB 3F5WB 4GKSB 1FYTB 1A7NL 3JTSB 4HBCL 3WS3B 1YN6A 2AJVL 1A9BB 3BDYL 3LN5B 1F13A 5I1HL 5SX4H 3QUXA 2NW3A 1HKLL 1UXSA 1XIWD 2XY1A 4NM8L 3VH8B 3FQXA 3U36B 4YHLL 2V5YA 2GSIB 3UPRA 4QRSB 3MNVB 4ELKA 2V17L 5E2VL 1KIRA 4NQDE 1KLGB 2QQLH 5CGYD 4HF5L 1KFAL 5K9OA 3MRCA 1T0MA 1CBVL 1SYVB 2ZNWA 4OV5A 3DIFA 1AR1D 2P5WB 4M1GH 5D2NB 4NQDD 3H9SB 3DTXA 1UM5L 1E4XH 3FO2B 5BVPH 1BZ9B 3BIKB 2FYYA 5E2TH 3WDJA 3C2AL 3LKPB 4M3KB 4BZ1L 1XGRA 4KAQH 4LCYA 5I1JH 1IMHC 1FL5A 1PDKA 3NAAH 3UTTE 4PP1C 1MY5A 1V8HA 1NSNL 3ZSSA 3LRSB 3IAQA 3FB7B 2R8SL 4B5EA 1I8LC 4K23L 1T21A 4NO5A 1MCWW 1NUNB 4R2GD 1WT5C 3PP4L 2I27N 3QCUL 1OP3K 4HS6A 5E70A 1OAZL 3WFEH 2A0LC 1YMMB 5DR5L 3I84A 4I2XE 1KENL 2AEIT 4AEHL 4MD5B 2FECI 3UTOA 4Z76A 2YEZB 3MV01 2FIRT 1HNFA 4WRLA 1PG7H 1WWCA 3GRWH 4JB9H 4TOYL 2XWJB 1CWVA 4U49A 4NM4L 1U95A 3RY4A 3V5KB 3RWHB 3MUJA 4QOKB 2EEDA 3FAXA 4K7PX 1HHHB 1TJHH 4M6AA 4HIJA 3LDBB 3PABB 3AAZA 5IB1B 1CLZL 3ZE2F 4M4RA 1WCBB 3B9DA 5KSUA 3WJJA 4LLDA 3MJ8B 4CW1A 1MAKA 4QOKE 5C2BL 3IJYB 2XTJB 5IHUH 3BD5A 1T2QL 1N4XH 4OKVA 1A6AB 2EKSB 4M7ZC 1D9KC 2M26A 1ZAGA 3HE7C 5EU7C 5IF0A 3HPJB 3HS0B 4LCCC 2DQUH 5DJXA 1UCBH 4WW2C 3DMMC 2J4WH 1CFVH 1TZIA 1DBJL 2RHEA 3GMOB 1IL1A 4ORGA 1A0QH 3MRDB 2ED9A 4OLXL 2OJEB 1NMCB 3QDJD 1PKQA 1DQJB 4N0YH 3CH1A 2FHFA 4QRSA 1R5IA 5KSAB 3VXSE 3MLSL 1EGJH 1IC7H 5A43C 2GSIA 1VPOH 3FQXB 3MA9L 3U36A 3QUZA 3X3FL 2NY3D 4EUPB 3QXAB 5HHPA 3SPVA 4GJTB 1MFEH 4A2MA 3QZWA 5JUEH 3HFMH 4UQ2A 1NDMB 1BGXH 3DX7A 4WHTB 4HUWA 5C0NC 3NH7H 4ACPA 4U2YA 4LQFL 4Z95L 3EOAA 3B2UC 4JDTL 4MAUL 1YDPA 4NNYB 1SY6A 5SWSE 5JNYA 4C57C 1WLHA 1T1WB 3ARBB 4E9LA 3TA3C 4XGZA 4PR5A 3V0WL 3X13B 4G42A 4DGIL 4B41A 5I1EL 4I9WE 3UX9B 2K9UA 4KK6D 5AD0A 3FB6A 4HCRL 3G6AA 5D93C 1AJ7L 1IM3A 3QG7L 4DEPC 2HTLD 4O4YL 3DX8A 3A0OA 2WV3A 15C8L 2FSEB 1IT9H 3EOTL 3KDMA 4NZTH 4JVUA 3CDFA 3CDYA 3QAZB 4RDQF 3WCYA 1DBKL 5IBUB 2CDFA 3GGWB 5JIIA 3BEVB 3BKJL 5FYKU 2EDTA 1S7TA 3PDDA 5AZEL 4HC1L 1I1AC 2B4CL 5E2JA 4N8PA 3GSVB 2F8OA 3HC3H 1I8KA 1JWUA 4PJGE 5C0IA 2VXTH 4NFCA 3HAEH 1X5YA 3WFZA 3IXTA 1ZT7A 4OCLC 1P53A 1HK6A 1YYLL 5EZJA 2ZPKH 4U1LA 4YWGH 1NFKA 1PQZA 1DEDA 3K3QA 2N4IA 3DOSA 3P73B 1A14H 1R3KB 5FGBA 3RI5F 2HJKA 5DEGA 2DKUA 3I85A 1A7QH 3BD3A 5IFHL 4LKXB 2APXA 5GZNC 2JELL 2GSGA 4QRPA 4EVNA 5D5ME 3KLAA 4LRIA 3U4EA 3TN0B 3V6FA 1NCDH 4NWUL 3GMMB 5LJYH 2BHZA 3H9YA 4V1DB 4QXUL 5IOPB 1YQVL 2PYED 1RUQH 4GRWB 1NCWL 1HKLH 5J6GA 3SGKA 1CT8A 4NOBA 1U3HD 5L88L 3SDCA 1F4XH 1JTTA 2GKIA 4PJ9B 2HVJA 4R90H 1S7SA 5K9QI 4RX4A 5C09B 3VGGA 5IESL 4MD4B 2IANE 5BXFB 5I66B 3NABH 3FQWB 4MSWB 2J8UA 1LEIA 1CBVH 4BM7A 2AJUL 1DE4B 1Q9WB 2AV7A 2BCKB 3QDGE 4R7NB 3UJTH 3NA4A 2VUYA 3CH8A 5ICZB 1WIUA 3P9MB 5IKCA 3E6HA 2HH0L 2XQBH 1U58B 3O8XB 3S5LB 4OCXH 4U6XA 3JWDH 1CCZA 4HUMB 2Q86A 4G5ZH 4XBEH 3MJ9A 1T83A 2VITB 1KNOA 4Z6AT 2F74A 1NFDF 1A02N 3LZFH 1XF2B 2CIKA 2ICCA 4YGAB 5E94B 3KR3L 4GQ9L 3GB7A 4LMQE 5DA0B 3RGVB 2BDNL 3QIBD 5HGAA 5BS0A 1OARL 4D0CB 1TQCB 4LSTH 4HIXL 3T0VA 4OF3A 5E6IC 4P46C 3ARFC 3MUZ1 1P5UA 2Y9RT 3FFCE 2A6KA 1OP3H 2EDYA 1TJIH 4G9FD 4U6HA 3PV6B 4QYOA 4LP4A 4PJ5B 1EIBA 2Y36L 4DFHA 2BNRB 4FXLA 3H7LA 3PV7A 1HDMA 4PLJC 5BMFL 1J18A 4YDVA 3N06B 4KKBC 3I3DA 3EGSB 4CVXA 3T3ME 5GSVA 3MRBB 1XMWA 4TNVF 5DO2D 4H5SA 1IM9A 3GSNB 2DDQH 4J12A 4MVBD 2VXSH 5DMJB 3AU1B 3QNZB 3DYOA 4K8RH 3QFDB 4RQQB 4KMLB 2ZOLA 4KMQA 3KPQB 4WGWB 5F7NC 5BCAA 5TFSH 4CMHC 1I8MA 4XP9H 3S9DB 4H26A 5ESAA 4XC3H 3M17A 3HE6D 4YHML 1DUYA 4RMUA 4MS8D 3QEGL 4BQBA 2VLRE 5I30H 1H5BA 1CU4H 1S5IL 2JKXA 1IZJA 3IS0X 5EBLB 2Q76A 1UZ8B 1CLOH 2NXZC 2VYRE 4X6DE 2OZ4L 2XTJE 2PO6C 1IGCH 5DJ0B 4PS4H 2B5IC 2HRLA 1XGQB 4FQPA 4R96B 1LO0L 2L7UA 3FTGA 3STLB 4JY5H 2IG2H 3ARBD 4XP4H 3OKMB 3EHBC 5HHMD 1RJZB 1XGTA 1AO7A 2AABL 5K59E 4N0FA 5DUBB 5T1MB 1NPUA 1DUZA 1JGEA 3GSQA 2Q8AL 3RDTB 3AB0B 4F37F 2EH7L 5C07E 3PJSA 2DLGA 2I07B 4PREB 3HFML 5I73B 2KQNA 2BY3A 2XZQH 1PZUB 3OKDA 2NX5E 5GJSH 4XZUB 3CPLB 4EDWH 4PRPD 3KYAA 3FQNB 3I75B 1MCHA 2VH5H 5FM8A 4LHUA 3ZO0A 4JFFD 1VGKB 5CJQL 1T20A 4O58H 2YPLE 1KCUL 2XRAH 4TSCH 5JOPD 2CDGB 5DJ0A 4W81A 2BHYA 5C0CD 5MI0B 4EI5B 3ZSTA 3UBXA 2OR7A 1G6RA 4NO3A 3QG7H 4BZ1H 3KXFD 2IH1B 4ODVH 2BSTA 2MTPA 1FLTX 4JRXD 3VGAB 4X98A 1TQBB 2VL5A 4LIQH 3U9PH 2EDKA 1G9EA 4MQTB 1L6XA 4D0CA 4ZPVA 4HC1H 3HMXH 2HMIC 2EE9A 4Z78A 3GB7B 5D7LE 3LS5L 2CIKB 2RCSH 4IRSC 3V6OE 5JW4R 4BFIB 4KY1L 4UOW1 3VRIA 5I71C 5E8PB 1IE5A 5DD1H 3K7UA 4U6XB 4K3HA 5LAXA 3NFPA 3RGHA 3RVVD 1JPSH 2FATL 2QKIB 2UV3A 3G6DL 4APQB 1LNUA 4CVXB 2WBJD 3UAJC 5KAQF 2MOVA 4DGVH 1IAIL 1Q9WA 1IBGL 2BNRA 4DVRH 2ADJB 3NPSC 1NCDL 5F88A 3ARDB 1SJEA 4R2GB 1GIGL 5F7UA 1HI6B 5C0DB 2DYPD 1BJ1J 3BGAA 4Y1AA 1ZHKA 3OL2A 4BQCA 1P4LA 3RPKA 4N5UA 4F37K 5ADPL 4FNLH 3PQYB 5DHYA 5BQ7A 3SJVB 1G6RL 1DEEA 1JL8A 3VGHA 3KWWA 1FNGA 4I1NB 5I75C 2M2DA 5DJZB 3VFMB 2IFFL 1X7QA 4WV1C 2ZG2A 4WY7L 1MVUA 4JZOA 1ITCA 2XACC 3BP6A 5SWZA 2FRGP 3PP3K 4F7PA 3E6FA 4NHUA 3MCG1 3PWPA 4WU7B 4PRBB 4AMKH 3O3UN 1MJ8L 3OF6A 4TUOB 3WXVH 3QFJD 5KS9E 4ZQKB 1IFHL 3LCYA 5L2JB 3MNZA 1ZT7B 5CJOL 2R2BA 3IXTB 3QCVH 3MLSH 1OD9A 1AGEA 3PXHA 3S35X 2FEDC 1BQHG 2A6IB 1K85A 4P5KA 1EVUA 2B2XL 3NCJH 4Z8FL 4UBDC 2Q8BL 2NXYD 4C56A 1NBZA 1UA6L 3ZLQC 4JFYB 1BAFL 3AMLA 4OQ1A 2XN9E 3JVGC 5D1XA 2DWDA 3BRFA 2VZ1A 1FO0B 1H15B 1PVHA 4UU9A 3KAAA 1CQYA 3H0TA 4XCNA 4U1MA 2NY7H 3WFDL 2X7LA 2P1YA 2FH6A 3ZMRA 3F65A 4U1IB 5D71L 5K33A 3A67L 1NANH 1R3KA 4OF0A 5CCKH 1E4XI 3WIFA 1SVCP 1PQZB 5D1QB 4DOHE 1DBAL 3OR7A 4JRYA 2ZCKL 3ROLB 3ZT7A 4GRLD 1P4IL 5FECB 3RVUD 1IRAY 2F15A 1MJ7L 4HCRH 1J1XL 1NEZG 2VSDA 1UWGH 4O4YH 3EKCA 1DVFD 2DI9A 2D03H 2HVKB 1FCGA 1INEL 1J0HA 3KJ4C 4GG6B 4X9IA 3WHXB 1DBKH 4XC1L 5E00B 5C9JB 2B1AH 1J12A 3SDAC 4OIIL 1T80A 1M7IB 5ISZE 5DMGD 1G7MA 2XICA 3ECBA 4G43A 4JQIL 3UZQA 1S5IH 4Q97A 1BFVH 1U6AH 3SPVB 3QXAA 3D0VA 1A3RL 2QQNH 3GKWH 5HHPB 3ZYZA 1G7LA 2OP4H 4KJYB 1BREA 2IWGA 2XKSA 3RVTC 2A6DA 4YBQC 4HWEL 1A64A 4JVPA 3L5XL 3KPPA 1IGJA 3ZHDA 1IC4H 1KOAA 3BUYA 4OLVH 3UTPD 5C0FB 5MENB 4J4PD 4H88H 3F7VA 1T1WA 3ARBA 1KFAH 4RAUB 4LLWA 2X4OA 2YR3A 3MJ6A 4WFGD 4XNZB 3ROOA 4XPTL 3NZ8B 4M1GL 1FPTH 1UFUA 2C7UB 3ZE0F 4QKXB 4U1JB 2FBOJ 4U6YA 4LAJH 5C0EA 5DTFA 1ZOXA 3IXAA 5MEQA 4P5TD 1LK3L 4F7EB 1CF8H 1AGBA 4P5MA 2XI9A 3E1F1 2R56L 3MX0A 5GXBB 4JREC 5IW3A 1FLRL 1S9XB 3A6BL 2AKRB 4NIKB 5E24E 2Z0BA 1NGZA 4PRPA 5KSAA 1WBXB 4PB0L 3PDGA 1F3JA 4YJZL 1NCBH 4X7DC 4K23H 5BRZD 4R4BB 1HSAA 1A9EB 2V2TA 3RVTD 1TZGL 3MMEA 1MCDA 3SDAA 4CKVX 3L7EB 2XWJA 5I1DA 2NX5D 5IUSA 4YIQA 3TNNB 5GIRB 3V4VH 4ORGB 1FFNA 3NCFB 1S7QB 2LV4A 4AM0B 3JWDL 3BWAA 4L8CB 3QUKA 2YKLH 5IW6A 1PG7L 4MLIA 3SO3C 1YJDC 2P44B 4WCYL 2HJLB 3PWNB 4HS3A 3VFPA 3BZDA 4OIAA 5HHQB 2H3NA 5CIPH 1FO0L 1BD2A 1EAJA 1FAIH 5DWUL 2PW1B 2FJFA 3LN9A 4HIXH 1NDGA 2P5WE 1FBIL 4RFEB 3FO0L 2H32A 3L3HA 4HIJB 1FZOA 2FX7L 4GAGH 1HHHA 3MRNA 5EUKA 1WFTA 4HPOH 3RWHA 3T4AA 5FYJH 3K8MA 2X4TB 5HYJD 5HJ3A 1ZVSB 1OSZA 5DJ8A 2EDXA 2X89A 4RFEA 1C12B 2O5XH 3O6ML 4F57H 1U93B 1WQVT 1NJ9A 4PLJD 5CBEB 1OTTD 5HGHB 3AY4A 4JFEE 1H3XA 3GBML 2PW1A 4JY6B 5GRVK 2R4RH 5K59F 3VXQA 3E3QC 2W59A 1NEZB 1B0GA 5D5MB 1KULA 2H3NB 1T66D 4IRSB 4K9EL 1D5XA 1IKNC 4KKCC 1GGCH 2WQ8A 4RISH 5IW6B 4MMXC 2H2SD 4ZAKA 1QOKA 5FYLH 1U8NA 4ZXBD 3U0WH 4JCMA 1AGBB 4P5MB 2Z35A 3ARDC 2EDJA 4B7IA 1CGSH 4QRRA 1FL5B 1N0LA 1T7YA 1OAUH 2DIAA 1E4KA 4JO2H 4NQEA 1FYTA 4XNYH 4OI8A 4RSVA 5I1IL 1QBLH 3NCBB 3HE7A 2YPKA 4XXCC 1I1RA 5C0JA 1ZT1A 5DO2C 1MSPA 2E3VA 1PLGL 3HNVH 4RA3A 5JXEC 4AMKL 4JFED 1IGYB 4WEUD 4HDIA 1VFUA 4TVPH 3CXDL 3C5ZC 4MNQE 5KVEL 3MRCB 4BSJA 4M43H 4POZD 3VFGL 3MV9D 4PLKC 1F58L 5JW3L 5FM5O 3VWKB 3PXJA 2CK0H 1FIGL 2A6DB 2W91A 1KF9B 1QBMH 3K2UH 4U6YB 3GSRA 1OPGL 4HXBH 3GMNB 2DQJL 1P9MC 3VH8A 4FA8A 5E0QA 1BHGA 2DQEH 1G7LB 4G7VH 5HD8C 2JF1A 3NZ8A 1OLLA 3LN5A 4FQHB 4JKWA 2ZP0T 4QGTA 4UT9H 4YFEA 2F54D 4LLVA 4BZYA 2P5EE 5C0FA 5IBTL 3GI9H 3BUYB 4GG6A 1IGJB 5EDXA 3KS0H 5EBMA 1N6QH 2BSRB 4AG4H 2EDNA 4NRZB 5GGRA 1BIIA 1FNFA 2EXWD 2PXYB 2X4NA 5D1ZA 2NW2B 2CQVA 3MRLB 1LO4L 3GJFH 4HH9B 4HK3J 2LABA 2E6JA 5B39G 5JXAL 1FG2A 1RHHB 2VR5A 2YN5A 4G6AD 1L0YA 5IB2B 3MUGB 4P4KB 5ID0B 4S1SL 3TZVA 1ND0A 3QHFL 1ROWA 3IDIA 3SDXA 1ZHNB 4OSUL 1PG7W 3RPIB 5F72S 1SVZA 3HMXA 4NM4H 2HFFB 2NNAA 3NA9L 4P2OA 1TQBC 3ILPB 5HD8D 1ZLUK 5B8CC 4RMVA 3H0TB 5SV3A 4LARL 3I3EA 4OF7A 1NC4B 1YNKL 4HMDA 3VXUB 4BFGA 3ULVH 3QRGL 1IQWL 4PTTB 2DWDB 1NGYA 1QSED 4ONFH 1Y6MR 3LMJH 4GAJH 3RWIB 2IADB 1CGVA 5AUMA 5DK0B 3IF1A 1CL7L 2E9WA 1GC1L 3OG6B 3KPMA 2G5BB 2X7LB 5DD0H 2D3VA 5E9DA 3UJJH 5IG7A 1IGML 4PJAF 1RQ5A 5GRJL 1MVUB 1TENA 2VLRB 5HYFA 5D1XB 3O3EA 3RVVC 1K9TA 4R4FL 3HNTH 3MLRL 2DB8A 3BISA 5MEPA 1RMFH 5JZ7D 4IDLA 2AQ1A 5MENE 5DJ6B 3B8YA 2DQIH 4R9HA 4YHIA 1TCRB 5ALBL 1AGEB 3CFKA 3U48A 1YMHB 1QSEB 3MNZB 2VZTA 1KPVA 5BZWA 1JF1A 2XYCA 5D7KD 2IPKA 4ZFZB 3PL6A 3N9GH 4OFYA 2WM0A 3RWFA 1O7VA 4E5XA 5F7EH 5LGKA 1CLCA 3TM6A 1GZQB 1ZWIB 5M7QA 4ZUWB 1QLRA 3U9UB 3H9HB 4DCQB 2NTSP 3MFFB 1SM3L 1UKSA 1MQ8A 5IB4A 2BMKB 2YD4A 1MI5D 2QKIA 3WXWL 4O9HH 3CU7A 2G2RA 4Y89A 3VRIB 2AEPL 2LU3A 1N5AA 4DGIH 1J8KA 1RJYA 1UB6B 3CFJA 3BH9B 4FQXD 3V8OA 3ZKMC 3S36L 5HI4C 4M7JH 5MHSD 4EI5C 1BFOB 5D6DC 4ZPVB 4HUUA 5IHUL 3FO0H 1VFMA 2JK5B 5DLMH 1I7ZB 4HKXB 1UEMA 5DQJA 3EYVA 4PY8J 1KUMA 1JF6A 2N7BA 2APBA 4YXLL 3TN0C 12E8L 4LMQI 4MA1B 4Q74A 2NR6C 4JN1H 1G6RB 4BFIA 5CP7A 4KVCH 3JZ7A 3IKCB 5AZEH 2BNUA 4CMMA 1QSFE 1PG7X 4XCYB 3BQUC 4P23A 4PJ8C 2VXTL 3P0YL 4P2RE 2V7NB 2NYYD 5DUML 3RP1A 3I6LD 1P9MA 2VABB 1VESA 2VLME 4XMLH 1IZKA 1MF2L 4JFEB 1FZMA 4C59B 5JR1L 2ITCB 1MRCH 1A1MB 3HZYB 4XP6H 3BN3B 1RULL 5FHAH 3SKMA 1I7TA 3OKLA 5L0QC 1MCKA 4ZYKB 4LRNH 3BQUA 4P23C 3QPQD 3SDDB 3UCRA 2OL3H 2X10A 3PWVB 4LDOB 2NY6B 4JHWL 4F58H 4ODTL 2QQNL 3GKWL 3HRZA 2YBRA 2EC9U 3I2CH 5I1GL 2OQJA 1BJMA 3GEWB 1SEBB 1NGQL 3PWPE 5EORH 5E08L 1KIUA 2WK2A 2V17H 2F8VA 3CXDH 1M05A 1BWWA 1AR2A 5EPMB 3FTGB 4XZUA 3STLA 4CDHA 2D31B 2EDHA 4R96A 3O81A 1VGEL 1CFNA 1UM5H 4PGDB 2VDML 1N6VA 3UC0H 2KZ1B 3PWVA 5E56A 4ZUSB 4YDKH 3SKOB 3WNPA 5JQHC 5JW5A 5DURB 1JGEB 2YUVA 3BWUC 4PJHB 2CKNA 4ZFGL 4YNYB 2P7TA 3WN5B 4AJ0A 2WWMD 3TBYA 4PJEA 1EEZA 2GIYA 4YHYC 3VD9A 2UWEE 2X1WL 1MLCB 1OTUD 4X5XB 5CJBA 3D0LB 2G75B 4LSTL 1R3HA 1NMAH 3ARQA 2BC4B 1C5BH 5I8OL 1PW3A 5JXAH 2UZIH 5E2WL 3G9AB 3U6RA 1M71B 4G8EA 3ALPA 3FO9A 4LPVA 5J57B 3DSFL 4EKXA 3QWOA 32C2A 3VXTA 2AK4D 3KYNA 2BMKA 1RUPL 4PV8B 4CU7A 5F9AC 2FATH 2XWBA 1HINH 3SGJC 4WW1A 3SY0A 3G6DH 3T0WA 1MFCH 2MMXA 4LGPB 3OZ9L 2QBWA 3K80A 4ZUWA 4QYOB 4J8RA 1DQLH 4KHTH 4XNQB 1CLZH 1IAII 2NXYC 5IWLC 2XWTA 3WIIH 3T0AA 2W0KA 2QV2A 1N5AB 3U83A 2D0FA 2IPKB 5BW7A 1UXWA 1R3LA 4NJ9L 4WUUE 5ISZB 1KJMB 3WS6C 1N26A 1GAFH 3F6LA 2VDPL 2X1QA 1TCRA 4LU5H 5IB4B 3O6FB 5C07D 2BRQA 3GHEL 2A0LD 5CP3A 2LTQB 2V2XB 2WNGA 1W8OA 5GZOC 3S5LA 5LQBL 1TETH 1U58A 3O8XA 4X0KB 5IKCB 3BSZH 5TH2A 3B5GA 4XCCL 2EIDA 1VEPA 1RIHL 4M61B 3LQAL 3X17A 4ZFZA 1MHCB 2XNAA 2HH0H 4JHBA 5GGUB 1F8TH 1CFQA 5BS0B 1DR9A 3CLEH 3QUYD 2J8UB 5HGAB 1LEIB 5FYKE 2W60B 5JO5B 1B2WH 4KMTL 4JPWH 1I3UA 3IDXH 3LV3A 1WWAX 1A4KA 4I0KA 1REIA 4JM4L 1G9ML 3TPKA 1Q72H 3TWCL 3D3VD 4L3EB 2ZUVA 4PGCB 4L8SC 4DZ8B 5H37H 5FUCC 4YDLC 3SO3B 5IG7B 3F7YB 2VRAA 2HFFA 1I9EA 2NNAB 3IFLL 4MSWA 3HPLA 4EVNB 4AY0A 4KK5D 2PXYC 4WI6A 1WZKA 4M7KH 5H94A 4WHCA 4RGMC 3TZVB 1KEGH 2I24N 4U1LB 3U30C 4Z18A 3IAPA 2CK0L 1QFOA 3W9EA 3L5IA 5KN5B 5D1QD 5ANMA 4YAQB 4Y4KC 4CU6A 2DRUA 2M1KA 4HJGB 2PXYA 1XGPB 4NZUL 5AAWA 4N8VB 5GGQH 3VXOB 2WQRA 4HT1L 4MJ6A 1OAKH 1ORQB 4XB8A 2V6HA 5K93A 1RFDH 3GGWA 4BQ6A 1HQRB 5L2KA 3P9LA 1INEH 2Z4QB 5L0QB 2APWA 2JLLA 1MOEA 1U3YA 3DYPA 1Y18A 3GO1L 1BZQK 4HV8A 4F9PC 2VZ3A 2BJML 2LVEA 4H8WL 2MHAA 3E3QE 3NN8A 4LASL 3BP7A 4X6BB 2HKHH 4GOSA 5A2FA 3PIQA 1HHJB 3PWJB 4M6NH 3EYSH 1A3RH 5TE7H 5D1ZB 2X4NB 4G8FB 4NFDA 4J2XA 1OAXL 4JZJA 3T8XA 3G5ZB 1PJ9A 4K9EC 3MJ7A 4KY1H 5EZOH 4G80A 2R23A 4EOWL 5DI8B 4KKBD 3P3YA 3HZKB 1EEUA 3UTZA 1KCLA 4FQ1L 2XT1B 2K7PA 4PRID 1DQMH 3DVFA 1KN2H 1HYRC 4RAVB 1KPRA 3O6LL 4BELD 3KYKH 4N9GB 3MRJA 3CUPA 4PJXA 2P5EA 4WHTA 5DHXB 1J0KA 1ORSB 3B4NA 2WIMA 4PBXA 1UEYA 3ARWA 4QRRB 3BW9B 2EC9T 4KAQL 4YR6A 3RUGF 3N85L 2PYEE 3INUL 5TGBA 5C7XH 1Z0MA 4MZ3A 4PR5B 3GSOA 2DQDL 3QUZB 5D7IA 5F3HB 1BBDH 1FSKB 3MLVH 4HDIB 4R4NC 4PJFF 4OLWL 1LVEA 4UDUB 5JHDE 1CLYL 5INDA 5B39B 3QEUB 1MHPL 4PJCB 5B38G 1SMOA 1DFBL 1A7RL 4JDVB 2VN7A 4LHQB 1K8IB 4UQ2B 2ZUQC 1JPFA 2Z35B 5INCA 1TZIB 3OGOE 2AJXL 1P2CB 4G5ZL 3SDDD 4WV1B 4EUPA 4WDIB 1D5MA 3GKZA 1WBZA 3BP5B 4XNUL 5AG9A 5HHXL 1LEGB 1T66C 4KKCD 4GQ9H 4NNXA 5GGTA 4W4OC 1NGXB 3CK0H 5K9JL 2A73B 1G0YR 3U9PL 4HAFA 4E42B 2FIKA 2LVCA 4YGVA 3HMXL 5MP6L 4YGVB 5DWUH 3MO1A 4LVHB 3EDKA 2HYMA 2IAMC 2ENYA 4MD0B 5GS3A 4ZUTB 5LGHL 3QSKB 1SJHA 1FNHA 1MJUL 3GNMH 3SE3A 3L3JA 4FQCH 1C16B 1WBZB 3V5KA 5DJXB 1D5MB 4UT7H 5E6ID 1C16A 5JIPA 1VACB 3FHAA 1QFUH 3U7WL 4OGAD 4XPFL 4PJAE 1JZ6A 1MFAH 3H3KA 2QSCL 4DUVA 4JFFB 5I1DB 5L7XL 4Z0BH 2WBKA 5I0ZA 4X9GA 1V3JA 1YMMA 4OZIF 4HS6B 1HSAB 3PABA 4GFTB 3DXAA 1F3JB 2DI8A 4PRPB 1MJ7H 5HHQA 4QOKA 3C6LA 2W0PA 3UROR 4I3GA 1RJCA 4FFYL 5LCVL 5J8OA 1ZT4A 4FTVD 1VFOA 1FL3A 1A4JA 1DN0B 5IHLB 3DNKA 4YR6B 5EOCH 3BWAB 1CGTA 2Z92A 3GHEH 4AM0A 5ACZB 3P4OA 3NPZB 2A9MH 4O2FB 4PY8I 4TQEH 1IAIM 4RGND 2Z9TA 2IAMD 4MD5A 3RU8L 3ULSA 3ZT5A 1OGAA 3AROA 3WMSA 4OCYH 1RZKH 3DARA 4EIGB 4WY7H 3WYRA 2F58L 1RZ7L 4DZBA 4IJ3C 3QQ4A 5MEOA 5ID1B 4RAUA 4LVNB 3JV4B 1T21B 1HXMA 2FO4A 2R1YA 3ME0A 4JFDD 1JNHB 2B20A 2IG2L 5K9OB 3HZKA 4DKDC 4LCIH 3L5XH 5DI8A 3SKUD 3REVB 5JDJA 4N0CD 2QQLL 4XWGH 3IDXL 3VMPA 1G7HB 3C08L 4Z8FH 1X5JA 3BZFA 2F5BH 4FQLL 5C0EB 3LRGA 1OGTB 1CFTB 1G9MC 4WI8A 4YHYB 3PIQB 3OKYA 4OZGB 2YUWA 1JGUL 3NN8B 1SEQL 4KI5E 2AEWA 5CBAB 3F7VB 5GQBA 3DVNB 4H1LA 1CXLA 4KK8D 5C9JA 1A8JH 2VDLL 5JORA 1INQA 4UT9L 1YEEH 4JO3L 2AXFA 4ELKB 1SYSB 4Q58C 2DAVA 3VWJB 3A6BH 3BGFB 2GI7A 2NYYC 1P7KB 3BH8A 1UXSB 5C3LD 2FDBP 2D4DA 1CIUA 3C8DA 3R8QA 1MRFL 2IQ9L 3ECBB 3H7BB 4G43B 4NQSA 2JCCB 4UOJA 2VXQH 3OSKA 5A2IH 5HYEA 1A22B 4ODVL 1S7UA 2W65A 2X4RA 1D5BA 4KGJA 1A6TA 1PY9A 5T1KB 3HPLB 4GS7C 2DLIA 3PL6C 1EUTA 4JKPL 5FO8A 3WSQH 1MLBA 2PTUA 2AK1L 4DN3H 3RX8A 1JFQH 4Y2OA 1HOCB 3LKQA 2MQCA 1BFVL 4DZ8A 4ZO6A 1B0RB 2H1PL 3LRHA 3QBTB 1WZLA 3UTTD 1QKZH 5FCUL 1FBIH 3IFOB 3QXDB 3QQ9C 2BVPB 4LSQL 5HDQH 1AHWA 2R2HB 1QA9B 3VI4F 2O5YL 1AY1L 2HKFL 3T65B 4KTEH 2W60A 4L4VE 3LS4H 2EDEA 4GG8A 3Q0HA 1MHCA 4NGHL 3GM8A 1A6ZB 2F54B 3HC0A 4MA1C 4X83A 3E6FB 4NHUB 5BV7H 3FN9A 4HLZH 4KDTA 4OGXL 5F7FA 2ADFL 1IGFL 1AHWC 4B50A 3ARRA 1EVTC 1K2DA 2R1WA 4BQ9A 5IQ9B 4TVPE 3QIWA 2X2YA 3HN3A 3BUTA 2A6IA 1C5CH 2C26A 4L4TD 4M8VA 5C7XL 1ZK9A 2R0KL 4LU5L 5D2LF 3RTQC 4Z7WA 3MV9B 1HKFA 1S7XB 1VCAA 3QI9C 2BNRE 4Q6IA 3U4BH 4V1DD 4LLYB 3PWPB 4GMTH 1CTOA 3EO0B 1FDLL 3OXSB 3BP6B 2I5YH 4JN2B 3QA3B 1C5DB 1BVKB 2F53B 5FUZL 3TCLB 2WBJC 3UAJD 3SY0B 1QFHA 3RIAF 1YEIH 4Z95H 4PJ8D 1IC1A 1YQ2A 4APQA 2NZIA 5HGGS 3DO7A 4ZXBB 5FF6B 3NCJL 2V7HB 4YHNB 2OJZH 3UTSD 1U8JB 2DDQL 3WNKA 5DJCB 4XH2A 2EZ0D 1G7QA 3WO3B 4GKNA 4GRWE 1JRHI 2JTDA 3VMNA 4K7PH 2VLMD 2X4PA 4JG0L 4YXHL 2H9GA 1YEGH 3BKYL 1LNUB 3O8XC 4JRXA 5LAXB 4PBWD 3FO9B 3QDGB 4IIQB 1QLEH 1OSPL 4Z7VA 4X4YB 4EZMA 3U1SH 1UZ6E 1BFSA 4Z78B 4Z0BL 2W9LA 4KWUA 3RQ3A 4A6YL 1FIEA 1NUGA 3SBWC 4RZCB 1TCMA 4A2LA 4EBQL 3QEHA 2JE8A 5DUMH 1ONQA 4K9EH 4NDMA 5MHSE 3A6CL 3W0WE 3TESA 3C60A 3NACH 1MCRA 1A14L 4NQUA 3VXPB 4PB9L 5CGTA 3OX8A 3VW3H 5TDNA 3UBXB 2X4QB 2OQJB 1GOHA 4EI5A 5C92A 4OB5H 4Z7WE 3QNXB 4U6VL 3TP4A 1U8PB 1MI5E 3DSNA 3TO2B 3SE9H 3QEQD 3ULVL 1J8HA 3WLWD 3BQUB 4R8WL 4HWBL 4L3CB 1OF2A 1CDHA 4J1UA 3MRGA 3VXUE 1ZSDA 3LKOA 1FG9C 4WNQB 5GISL 3SKMB 4Z7OE 2XZQL 4PRDB 3HE7D 2BVOA 2XZCH 4HJ0C 5FYKH 2GTZA 2X1XR 2GTZB 5EZOL 1UWXH 3VXRA 5F96H 2VABA 1SY6L 3RVUC 5T1DL 4J4PA 2XKNA 4FFZL 2Q6WB 4MWFB 3F12B 4ONOA 5IFJA 3QULB 2R9HD 2YD3A 3F62A 3QNXA 4PREA 3TO4C 2DQJH 3BE1L 3AM8C 3OJDB 4QO1A 4NO0A 4PG2C 2OR8A 3UC0L 2O61B 4LKCB 2X6MA 4KK9C 4HLJA 1XFPA 4TTDC 3SDAD 1KCKA 1I1CA 4YDKL 4ZYKA 5CZVL 1ZMYA 3GZKA 5CGMA 3CXHK 2O61A 5IHZB 1LK3H 2EYSB 1LO3H 4KROD 1G7JA 3V5DB 1AO7B 4JHAH 5DD6B 5HDBF 2APFA 3VCLB 3QULA 4B0MM 1WTLA 4G7YH 2XKNB 2Q6WA 1W0WA 1A6UL 4K94C 2VLJE 5I9QC 1MCIA 4PG2A 1WJ3A 4JQVA 1LO4H 3X11A 3JWNC 3VFVA 4FOMA 3WNMA 5AG8A 5CP7B 4BFEA 2G2RB 3OJMB 4AENB 3L6FA 4AL8H 2AJZB 1L6ZA 1TQCC 2QLVB 3L5JA 5ERWB 5BMFH 3ABZA 3RKDC 1XR8A 4O2CA 3VFTB 3QIWC 4WTWA 4JHZA 2PO6B 4Z5RA 5I9QB 1W2KT 3LY6A 1BM3H 3WSQL 1E4WL 1LILA 3BZ4A 3BH9A 3RVXC 3I50L 2R69L 3W9DB 4GKNB 1QR1A 1TVBA 5J11B 1A6WH 1U8JA 2IPUG 3S88L 4ODXA 5E4EB 5C2UB 1KPVB 4NBXB 1M4KA 5HGBB 1EV2E 5GGTH 5D8JH 4GQPH 4FNLL 1RUML 1YY9C 4KRLB 5IK3A 1EEYB 4WTZA 2F74B 2HKFH 4YDVB 3TCXA 5I0DA 3H9HA 4HJJL 4Z7VB 4JGJA 4JM2F 4CJ1A 2E6QA 2IBGA 2X4UA 5KANG 1CTNA 3MLXH 3TGXA 3WFCL 4E5XB 5I8KL 3OWEA 4OM0H 2A6KB 1EO5A 4LHJB 1T04A 1TETL 4ZTPL 5B3NA 2H9GB 4M62H 1MCSA 4LLYA 4MB4A 1KACB 5I2IA 2X4PB 4UAOB 3FB5A 4U0QB 5FGSA 4PS4L 4BZ2L 4MNHB 1UKTA 4OCWL 1WFOA 4JZNA 2DJSA 4YHKH 3G6JE 4P2RB 3MCLL 2VITA 3EO1B 1B2WL 3ULUH 2B2XH 3ARFB 3RWIA 1UM4L 4OCRH 3WO4C 4OLEA 4I0PD 1Q8MA 1HCVA 4Y4FD 3WKNA 7FABL 2KH2B 3ESVF 1JHLH 4MCYB 3T1FB 1NBQA 5FOJA 5HVHC 2CUIA 1JV5B 4WENB 1NGQH 1JGLL 1AHWB 1B6UA 3KPRD 1YMME 4I2XA 3QXDA 1CD0A 4FXKA 1S9YA 1J0ZA 4KRPB 4UILH 5T1LB 2J6EL 4PTTA 5KJRL 2BY2A 1KTDB 2F53E 3P4NB 5E5MA 5FYJU 2NX5A 1EGJA 4P48A 5DJDB 4PGJA 1K2DB 3SQOL 2Y5TA 5A3ID 3CFBA 3MRRA 3TEUA 1YJDL 1H9VA 4HEME 3IB4A 1VEOA 5IMOB 1F3DH 2DD8H 1DBBH 1MAJA 1AFVH 5DUPH 2DQGH 4JN1L 1QSFA 1K4DA 4PRNB 4XXCA 1IGTB 4GBXB 4ZD3L 4JPVH 4NUJB 4R3SB 1PBYA 4OD3H 4F33B 3FB6B 2D0HA 1UYWH 4X4MA 2CH8A 5EBMB 1HHIB 1LP9A 4PRAB 1BZ7B 5HBBA 5HY9B 3T77A 3AREC 5EZLB 4EN3A 2CDFB 1MCWM 3MODL 3WLBB 4RMWA 3SDDC 2YK1H 4NSKA 1PSKL 2QSVA 5JPNA 3MRHB 1ZT1B 3NA9H 4HFWA 1A6TB 4C56E 1WZMA 3K1KC 3MJ9H 4QGYA 4F58L 3HG1B 3QZWB 5AD0B 4G6FB 4EN3C 5D2LA 3WIIL 5JPMB 5I1GH 5ECJE 1X4ZA 4FABH 4OQTA 4ZAKB 1KCVL 4K7PY 3QIUD 4NZDA 3BH8B 5JIHA 1P7KA 3AVEA 1IGYA 5ID1A 1ZANH 4QRTB 3VFUA 5BRZE 1A1NA 4E0RB 1Z3GL 2BVEA 3CH1B 2BVYA 2DIBA 3MLVL 3W5NA 5E2VH 4JY6A 2FGWL 3HE7B 2JCCE 5HGHA 4KC3B 1BPVA 4RGOL 2UWEF 3BQUD 2IFFH 1JF5A 2CUMA 2FL5A 2AK4E 3GMOA 1I8LA 6FABL 4OZGA 1F8TL 2B0SH 3T4AB 1NLDL 1CGWA 1F4WL 3QCVL 3NCEB 4IRSA 4PJ8A 5IF0B 5IWLA 2FB4H 4R6UA 3D1MC 2B1HH 4OKVB 5HHMB 1U3JA 3CXHJ 1HH9B 3ARGA 3U0TB 4FP8L 5BO1L 2CDEB 5CBEA 3Q3GA 4BSVA 2OJEA 5GRWA 3QHZH 1RY7B 4UT6H 5IB1A 3IDNB 4UB0L 2BVQB 4L4VA 3PHOA 5I76B 4YFLI 3QCUH 4KZEH 1I1AD 3CVHA 3I6KB 1QBAA 3WFEL 1AKJD 2NY7L 4LBEB 3WXWH 3RZWA 1LE9A 4G9DA 5CWSB 1XAUA 1ZT4B 4LLUA 3L7EA 1NDGB 1O0VA 2OR9L 4XCEA 2A73A 5KG9A 2WUBL 5EZIL 5IVOA 1AGCA 4JG0H 3BP5A 1S9XA 4MJID 4ODUA 4XP1H 1FNLA 4L8CA 1GPOL 4LPTA 5INCB 4IRZL 2OXGA 4GMSL 3K4AA 4Z76B 5C71A 4OCSH 3FRPA 5GIRA 1MFNA 1XGRB 4LCYB 4PJDE 4YIQB 3TNNA 1VACA 2DQUL 3LKPA 2DM4A 4YX2H 3X3GL 2G60L 3TT1L 4NZRH 1U6AL 3VFWB 1LDPL 4YXKH 4RDQG 4R4BA 4ZOBA 2ICWI 1JIBA 4L4VB 3IDYC 4CADA 2UY6A 3FMGL 4NO5B 1MRDL 5D2NA 4J3WA 5I71B 2VDRH 4PJGA 2GY7B 3KYOA 3MBXH 4S1DD 1YEHL 4NN7C 4ZFOA 2XN9D 3MNVA 4OLVL 3QIBB 3AXLA 4DGYL 3MRFB 4ALAL 3B9AA 4GW5A 3TWCH 1JYXA 1I7UA 2P5EB 1NCNA 2GAZB 3D85A 3IDJA 5D6DA 4JHWH 3O8XD 3VD7A 4G7VL 1I9JH 5J13C 1TPXB 3H9SA 1WAAF 2P5WA 3DUUA 1DDHB 5EORL 5JDSB 3QUYA 4R0LB 3KPPB 2XZZA 2VDLH 4MQXD 4E0RA 3WDIA 4C4KT 3UPRB 1AQDB 2DF3A 3B2VL 3IFPB 4MA7H 5ITFB 1WVZA 5D7IB 1V05A 3H6JA 5IJKC 1U3HB 5TGBB 4U7MA 4XP5H 1N5YL 1G0DA 1I3GL 3SJVE 3OR7B 1G7MB 1I85A 1YN6B 5CZVH 3QUYC 3SDYL 4CVWA 3ARXA 4FS0A 4U1IA 2ATKB 3PHQA 4LSRH 1ZLUH 1IAKA 4N9GA 2HVKA 4YHZH 5EBWA 4X6EA 3RA7H 4HJGA 2V9TA 4WW2F 4KK9D 4YPGB 1U3ZA 4W4NA 3UTZB 1FFPB 2DBLL 5CINH 5F6IB 2YMXL 1LMKA 3BN9C 4G80B 3MJ7B 2O93L 4XMPH 4RBPK 5MP6H 4OZHA 5JLZB 1NCAH 5F89B 2MSPA 3BEWB 3WD5H 1NCTA 4CVZA 4R3SA 3PWUA 4IMKA 1E27B 1UWEL 1BX2A 2NY2C 3EFDH 4DN4L 1T6WA 4ZUUB 2AJYH 5L2JA 3GJEA 5IMKB 3EOBA 4NRXA 4X4ME 4ISVA 1AGFB 4GAYB 4HWZB 4WU7A 1WAAE 1RUKH 4KH2A 2A2QT 4EQ3A 4JJ5B 1BM3L 1A47A 5BS0E 5SWZB 1E6OL 4HIIB 1XF1A 4Q2ZA 3PWLB 5BV7L 4JKMA 4QT5A 4YBLC 5DJDA 4C55A 4CBPA 3LH2H 5GGVL 5KVDH 5E5MB 1A4KB 3P4NA 3LV3B 2NLJA 2BNQE 5TDPA 2X4SB 5DHYB 1QSVA 3RVXD 4RISL 3S34L 2VISB 4TUOA 4PRBA 3QIUA 4JFDB 1V5JA 1UZ6F 3MV8D 3QXTA 4ZSOE 1T22A 2FR4B 5H94B 3H2WA 3DMMB 2DL9A 4IDJL 2NY1D 3VFMA 2VB5A 2ADJA 4PRPE 3S96A 3VD4A 4YBQD 1MCNA 4ELMA 3TPUA 2FEEI 2ESVD 3SJVA 2IFGA 1XGUA 4KMTH 1HE7A 4JZJC 2FX8H 2BERA 1NC2D 2HAZA 1Y6KR 5L8JB 1ADQL 2FB4L 4LHUD 1IQDB 4HWUA 1T7XA 4C56D 5F6IC 3PG2A 3WO4B 4G6ML 4FQLH 5HI3C 3G08A 5JO5A 2J8HA 1HWGB 2CRIA 3BIAX 1GJIA 2CLZA 3TJHC 4UT6L 4YC2C 2XWBB 3KXFA 2VDOH 3WLWC 1FNSL 2VLJB 4M7LL 3HA0A 4Q6IC 3RWDB 4JR9H 2WSKA 4JDTH 2HG5B 4NZJA 4F3FB 5F7MC 1BVLA 1Z2KA 2E7CA 4DW2L 5GHWH 3HZMB 4G8IB 5A16A 1MFAL 2VIRB 5IK3B 2DJ4A 3RWJB 1OSPH 4RCAA 4Y5VA 3SKJH 5HGBA 2MQ3A 4X5XA 3BZEA 1MLCA 2C3VB 3B83A 1ZLVH 1DQTA 2CUHA 1KJMA 3V9FA 3NOIA 5ISZA 3SCMD 1KELL 1F2QA 4ONGH 1BEYL 1NBVL 1H5BC 1MCPL 3RL2A 1LGVA 2DQHL 3W9DA 2P7TB 4YNYA 3BZ4B 3M45A 1R3JA 3QHFH 2BSTB 3CPLA 1KJ3L 4P2CG 3ARTA 3VFRA 3OKDB 4G8GA 3JUZA 4ODWA 5ERWA 1MWAA 2VLKB 1L7TH 2HWZH 3BPCA 1CU4L 3CZFA 3HUJA 4C54A 4KGLA 3NIDF 4OCYL 1T20B 1ZHLB 1J10A 3OB0H 3OQ3B 1M71A 4QTHA 4XB7A 5DUBA 1YMMD 2EDDA 5DRXB 3W39A 3GSUB 5CGYC 3OXRB 1EA9C 4EOWH 3T4YB 3EOYG 3DPBA 4KPHL 1MIMH 4PJDB 2CIIB 4M1CD 4QXTB 3TYGH 3MODH 4WI9A 1IKFL 5BV7B 4MDIB 3RWCB 3QPXH 5HI5C 3N1PC 5HYJE 3V5DA 4OCNC 1KYOJ 3HB3C 4PG9A 4RIRA 4W70A 4WFHD 1UZ8A 3SHSA 2MJWA 5DRWB 3IAGC 1VKXB 4N0FB 1OAYH 1A1MA 3VJ6B 2ITCA 4Y19A 5IFJB 4JFEA 4MCZB 1H3PL 2P5WD 1IVLA 1MCOL 2HT4C 4MWFA 5L88H 4O5LH 4NNPL 2E7HA 3NCYS 3U7AA 4P23B 3H3PL 2KKQA 1CLYH 2P49B 3BP4A 2BNUB