3QWRA

Crystal structure of il-23 in complex with an adnectin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
304
structure length
295
Chain Sequence
WELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQKKDRVFTDKTSATVICRKSISVRAQDRYYSSSWSEWASVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-12 subunit beta
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cytokine
total genus 54
structure length 295
sequence length 304
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrA03
2XFXB 3I9GH 4OB5H 4YH6A 5E8OA 4OCWH 3RKDC 4FQXA 5IQ9B 1AXSB 4P5TA 1C16B 2NXYB 2DQHL 5DZNA 4DQOL 3BDBA 4GBXA 5DMKB 5C0JB 2X2YA 3GRWL 3H9SB 4NM8H 3GBNL 2DQJL 2EC9T 3TWCL 1BM3L 3UBXA 5C71A 1KOAA 5FHBL 1Q9OB 5B4MC 1A9BB 4RFOH 2GW5A 2O5ZH 3HE6B 1BFSA 2OMNA 3MROA 4E5XB 3BT2H 3EOBB 5IBTL 4LARL 5I1CH 2VZVA 4XP1L 2Z8RA 4M6OL 3WFCL 2ILLA 1WC7B 3SGJC 2LAAA 3CCHA 1V8HA 2AGJH 4XXDB 4PRNA 2G5RA 5HHOB 1ZE3C 1S7TA 3F6IA 5ID0B 1ADQL 3WIIH 1A21A 2YC1A 1K8IB 4OI9A 1EJOL 4NDMB 5D8JH 4N9OB 2J7LA 4WY7H 2YN5A 4HUUB 4ZS6C 3RTQB 5C07B 1NGWB 4G6AD 3LSOA 1X4ZA 5T1DH 3RZCC 3ZE0E 1YNLH 4DCQB 3BGFB 3HC3H 4L8SC 4Q9QL 1FFRA 1WT5A 4JAMB 4ENED 4GAGH 4G8GE 1XCQA 1NMAH 2KL6A 1ND0B 5D7IB 4C59B 1CLOH 5AD0B 1M71B 2BRRL 3PV6A 3QRGL 4PJXA 5KSBB 4JO3L 1MLCB 4YGVA 3U2SB 1WT5C 2QEJA 2R39A 5A2LH 1YNTA 4AL8H 3BXNB 3P30L 1F4WL 5JA8B 3KPLB 2VKXA 1I1AC 4OM1L 3W9EB 1G84A 4MGXA 1RZIA 5JIPA 3QUMH 4UBDC 3UTSA 2ZCLH 4I5BA 1INEH 5HHPA 2FX9L 1HCFX 1X7QA 3FT4B 3WUWA 3S88L 4TTDD 2VISA 2AV7A 1UEMA 5FFLA 4R0LC 3RNKA 1CS6A 3LDBB 2XN9A 4JFFD 1XIWD 5CBEB 1C7TA 3BP6B 4JZJB 5H94A 1UZ8B 1ZGLA 2NY1B 3ABZA 5GRWA 1ZANL 1K5NB 4YHKH 4XHJC 5D2NC 4ZYKB 2NY3B 1NAMB 3TESA 2I26N 1LE9A 5IW1B 4J3OC 5JDSB 1NAMH 4L4VA 4TQEL 2BNQE 3PWJA 4PGCA 1CLZL 2MCPH 1NC4B 1RHHA 3EAKA 2JB5H 1DQQA 4GLRH 5GGVL 4KMQA 1YEFH 4P2QD 4BH8B 5JQ6H 4DAGH 4AMKH 5BMFH 1X3DA 2AXGB 1MRCH 3QFJD 4JY5L 3GHBL 3DMMA 3U4EB 5D7JC 5TF1H 4QRPD 4X6CA 4XP9H 2OZ4A 4NN5B 2J88H 2IF7A 4O9HL 3MRJA 5DS8A 5CD3B 3TC9A 3LB6D 3CMOH 4N8CH 3V79C 2J8OA 4K3EH 1HYRC 1A3RL 3OR6A 3S35L 3TN0B 5T3ZL 3KJ4B 4XH2B 1E6JH 1HK6A 4UIKH 3AGVA 1DE4A 3CSBA 3DVGA 5HGHB 1ED3B 3IT8D 1MFBH 5AZ2L 5I0ZA 4JRXB 2BNRB 2GJ6B 4ZOEA 4LCWE 2IJ0C 1Q9WB 3ROOA 3BKCL 4K7FB 2V2TB 1YQ2A 2C7UA 1IC5H 4RA3A 2VE6B 3OJVC 1CDYA 2W0KA 2YN3A 2C3VB 4K3GA 1A6AB 1HH6B 2GT9A 2D7OA 2JK5B 4WO4B 5E5MB 3UTPE 4PP2A 4IOFD 4ZFZB 2I27N 1OAKL 4MQ7B 1A8JH 1BJ1H 3FQUB 1AGEA 2JELL 4BQ9A 5DI8A 5FK9A 2V7HA 5JXAL 2WBJD 2F53E 1MF2H 5J89A 4YC2B 1DL7L 3BH9A 2R1YB 2OTUA 3FQRB 4FNLH 4NO3A 2E6PA 1FBIL 1QBLH 4H25A 1JHTB 1DN0A 4X7EC 1SVCP 3EGSB 3UTOA 4JG0H 3NA9H 1H3XA 2ADIB 3MV11 2HG5A 3CFIC 2R29L 1UVQB 4PJBE 3EYQD 3VFGL 5DO2C 2MMXA 4CMMB 1GHFL 4QYOB 1T1WA 2BHUA 3T4AA 3CVHH 4M7JH 4BH7A 4UU9B 1OSPH 3QXVA 3DECA 4HIXL 3TYFB 3RQ3A 5T3ZD 2PYEA 4DWHA 3CX5J 4M1CD 3T0EB 5EU3B 1JF5A 4OZGF 4LLQA 5DMIL 5TE4L 2W92A 4DFIA 2CLRB 3SY0B 3T8XA 2J2ZA 4IRSC 4C83B 5I1DB 3A6CH 4MA8L 4ZUTB 1W0WA 5HHMB 4UT6L 2UYLA 4ZFFA 3PWLB 3MA9L 1QA9A 1FYTD 5KSVB 3HG1D 1JGEB 4GRLA 1UA6H 3N9GH 1RZFH 3Q5OA 5ESVB 1F02I 1KELH 3QUYC 5MHSD 5EA0L 3W81A 5C08D 3L5JA 3T1WA 3BP7A 3GIVB 2F15A 4F7CB 1RULL 1PKQA 2BVPA 5TDPA 3NCMA 4CBPA 3AXLB 3MV7B 1WJ3A 2ICEB 2WP3O 3ARDA 5EG6C 1FV1A 5ESAB 2HVKA 3HNSH 4KTEL 3CXHJ 4U31A 4PJAF 4YWGH 4XAWL 3MRDA 3D25A 1D6VL 5DJXB 1WIUA 5IGXL 2WV3A 4OCRL 3ARDC 1GOGA 1TLKA 2ATPA 1CFVL 1DDHB 1I3RB 3GHEH 4XCCL 1TMCB 5C1MB 1HSBB 3U4BH 2IG2H 3OSKA 3KVQA 4OLUH 4N8VG 2EDKA 3WFDH 5I1IH 4G8IA 3MLTA 3QB7C 4ONHB 3OKOB 1T66D 1IJ9A 2OCFD 1L0QA 3W39A 4G6FD 4PIRF 1X4XA 2BDNH 4I0CC 2A6KA 2XWBA 3OGOE 1EIBA 4G9FA 1DLFH 2FEDD 1FIEA 3TCLB 5TQ2H 3BZ4B 4ONFH 4EXKA 3P9MA 3NMEA 5EU7E 3OKYA 1S7XB 2VXSL 3FN0H 4B7LA 4XAKE 3NH7H 2DMKA 1QNZL 3K4DA 4XNXL 4L9LC 4RGOL 3LRSA 5IVZA 4Q9RH 5T1LB 5ID1A 4X98B 4Z7VA 4I48A 4PRBB 3OKNB 4QXTA 3QHFL 2VH5L 4RWHA 4DKFL 4ODTH 4HJGB 5E5RB 3JV5A 3NTCL 1IGTB 1RZ8A 1YEJH 4IIQC 1HIML 4XPFL 3SGKA 4Z7OF 1J05A 2FB4L 5SWZD 1B88A 5ICXB 3MXWH 4NFCA 5JW4M 1NC2B 1QFUL 2H6PB 4HWUA 1T1XA 2OBGA 3GB7B 1NUGA 1LE5B 1T0NB 1JK8A 3DETD 1PVHA 1PW3A 4M9OA 4E9LA 4L3CB 1OP5K 3QZWA 1FZKA 5IR1B 3QUKB 1DVFA 1XF3B 3UX9B 4Y16A 5B38A 1G0XA 5IFAH 5D5MB 3SDXF 1IAIL 4HS8H 4P3DB 3UZEA 1UH3A 2QSVA 4IRJB 3VXNB 4MD4A 5MEOB 4NUGH 4DN4L 3LV3B 3UDWA 5DURD 4KQ4H 1KBGL 5KSAD 2OLDA 1DZBA 8CGTA 4LASL 4Y5VB 4OZHF 2UUDH 4WI2A 3MRIB 3IDJB 2R4RL 2BVTA 1CFSA 2HT4D 4S1RH 4YBQD 1JZ4A 1AKJD 1G9NC 3AAZA 3P4OA 3ULVF 1I8KB 3HR5A 2GYSA 3CFDA 5A16B 1G6RB 3D69A 3QIUA 5IJKC 2NXZC 5ACMA 4P4KD 2YD2A 2AJVL 4PJCF 1OTSD 4H1LB 3W11C 3WLBA 5K33A 2VDQL 4DFHA 3IFNH 4H1LH 1NGPH 4UI2A 5F7HA 1XT5A 4WFGE 5F7WC 4YPJA 4M93B 3ZKXC 4KGLA 4U1MB 3WKNA 1YPZA 4OKVB 1MHEB 2DF3A 2YKLH 4KK9D 1KLGB 1BQUA 3RPIB 2XQBH 3R1GL 4TNVF 5A43C 2ZUQC 2CXKA 3DHMA 1TDQA 4QRRB 4Y5YA 2Y07L 1XMWA 4MA3A 4JFEE 4MZ3A 4GKZB 2LVCA 2X4TA 4L4TE 1FL5B 5SX4H 4JHZA 1ITCA 1XZ0A 3MCKA 4K94L 4KRLB 3LZFL 4XPAH 4QOKA 1IGCH 4DZ8B 1BQHB 4Z7WA 4LIQH 1A4KB 2DQTL 2Z92A 1DUZA 5JMRA 4OF6A 1CFQA 3ULUC 3MRMB 2NR6D 4OFIA 3FMGH 4MWFA 4FTVB 5E24E 1CFBA 4TSBH 5ISZD 1T20A 2VMFA 3O11B 3RL2A 5F1SA 1KB5B 2DQUL 2X7LB 1OGAE 4EDWL 3IXTB 3THML 5EZOL 2IAMA 1F11A 4U7MA 5IB5A 1JN6B 4ODSL 3P11H 1HKLH 3N85H 1S7VB 3HI6H 1NGZA 2VL5A 2R2HB 3QAZB 3GM8A 4GUPB 4JJHA 3VWKB 4OQ1A 3RWHB 3UEZA 3RA7L 3QCVH 4NQDE 4PJ7B 5HI5D 1N59B 4PG2A 4H5SA 5IESL 2BZDA 3MCLL 4TVPH 2WUBH 1L0XA 1QFHA 3EDFA 1YC8A 5FKPA 2Q3ZA 1MPAH 2VLKD 4YAQA 1A6UL 1CL7I 2CKBB 2D2OA 3RWEA 1LD9B 2P43B 3VFRA 3RIAF 4CN1A 5MERA 4ZFOA 2A6IB 2MPAH 1LO4H 4OQTL 2UY7A 2FCBA 2OSLB 3QUZA 3F6LA 4JM2C 3TA3A 1RI8A 4G7YL 2EXYC 2R23A 3HFMH 2J8UA 3IXAA 3PGCB 1N8ZB 3TPUA 2Z91A 4TNWF 3SEPA 4OT1L 2XKSA 4P3CL 5J4MA 3DUSB 2ICES 4P0DA 4TYUA 4WHYG 1ZHBA 2DMCA 4HKBB 3MZGB 4WW2C 4HHAB 5EOCH 4PGJA 2VITA 4NHUA 2WIIA 1D5BA 2V9RA 3ESUF 2QQNH 1PAMA 4Z7QE 3HKFA 3GSNL 2QHRH 4HJJL 3PHSA 1E4WH 1AC0A 4MXVF 3IVKB 5D1QC 2Q8AL 1IM9B 2H1PH 4AEIH 4OGAC 4QRSB 1CXLA 1NFDB 4PTTB 2ID5A 3L3HA 3O6FD 2NXYC 2NZ9C 1L7IH 5E4IA 4G8GA 4ZTOH 3L3DA 1YN7A 2G75B 1RZJH 2HH0H 1I4FA 5I1EH 3LN5A 3VXPB 2Z31A 3MLWL 4FQHB 1SJXA 1TNMA 1AGCA 1DR9A 5J56B 2GQHA 1LEGB 1V3LA 4PRNB 1S7TB 4NQCB 2P8PB 4PP1D 1L9MA 4Y89A 4LSSH 4RWYH 4BFEA 2BJML 2PW2A 1NANI 5L8LB 3QNZA 1CICD 2VABA 2NY6B 1A7PH 4O2CA 1FSKB 4Q9BA 2Y6SC 3G08A 3L3IB 4LVEA 3X12B 4U1NB 5K9KA 3CLFL 1FN4B 3C8KB 5DHYA 3SOBL 1G9EA 3N0PB 4HX1B 3QEHA 3NAAL 3MLRH 4WCYH 3HS0A 2XPGA 2XTJD 3DX9A 4HH9B 4CL7A 1YYMH 3UJTL 4H20H 4G42B 3C08L 4MVBD 3PP3K 3L7FA 1R5WA 3RTQC 5SV4A 3BGMA 3AUVA 2BNQA 1T89C 1R3IL 5CINL 3VGAB 3SN6N 4F8QA 5FUZH 1WWWX 5TQ0L 1RUML 5DEZA 5ETUA 4NSKA 4LU5L 4Q9CA 4KZEH 3BGFC 5I8CA 5IB3A 4YEFA 4PG9B 3BYYA 4J4PA 1EH9A 2F58H 1S7QB 5JMOC 1YECH 4HKZA 4HT1L 4RIRB 5MEND 3PGFL 1TPXC 4Z5RB 1ZTXH 4JPKH 4U1GB 1X7QB 3UTZA 4ZUVA 1EXUA 1J8HD 5EBWA 1BVLB 3V95A 3WO4B 1MIML 1A7QH 1CE1H 1P5VA 5EC1B 3KHQA 4EXPX 3CFJA 3CZFB 2VN4A 2QADC 4PGBA 2EYTB 4M61B 3TT1H 5JW4N 1VFMA 4NNXA 3LPWA 1WZMA 1I8LA 3HNTL 3MMEB 4YDJB 3G5XB 2DQFA 5HDLA 5T1KB 1XGRB 2DBLH 4O5LL 2LABA 4OF3A 4GXVL 3A6BH 5J3HC 3BN9D 4LPUA 3SCMB 1Z3GH 3LKQA 3KLAB 5F88A 1FP5A 5F70A 2X10A 3LDBC 1DQQB 4LCWA 1I8LC 1HXYA 4KDTC 5LCVH 1MJUH 1KN4L 4JZJC 3O4LD 2NY1C 5EBLA 4PLNC 4JHAL 4HK3N 3PHQA 4RAHA 1N6VA 1NAKL 1CDIA 1FE8H 2NNAA 4ZUUA 3BP4B 4Z18A 3PIQB 1FL6A 3MRHA 2CUIA 3MRJB 3QEQB 2XZZA 3MRNB 3M8OL 5E8EA 1F4XL 2F53A 3O8XB 5LWYH 2BHZA 1CXHA 4LLWB 5BV7L 2Q87A 4RX4D 3RU8L 4FP8L 5EPMA 3ZLQC 5CSGA 1OAXL 1MOEA 2ZG2A 2Q7YA 3U83A 4OIBA 1WBZA 3LS5L 4KROB 1QFOA 2B5IB 3VXQB 2HKFL 3R8QA 2BVUA 4LRIA 3SPVB 5F7DA 2Z4QB 3DVGB 3OAYK 5DUPH 1FAIH 3X11A 4NN5C 2QTEA 3D6GA 3RP1A 3PXJA 4PJBA 1S78C 2IMMA 2X1WL 5IB1A 4N0RA 3SQOH 5JOPE 4OSUL 2D31A 1GC1H 1I9IH 4XXCC 3HRPA 3C60B 3TN0C 2D7MA 4NQXA 1N7MH 3KJ4C 5BZDB 4KK8C 1FVCA 4AEHL 3UZVB 2B2XL 5I66B 3U36B 1YN6A 4Q2ZA 3L3JB 4HQQL 4MD5A 2JJWA 4OLWH 3CPLA 3V5DB 1FJ1A 3QUXD 1I1CA 4PRHB 4F3FB 2X4PB 5BVPH 2OJZH 3ARGA 4H25B 1INQA 1ZXQA 1U6AH 1HKFA 1DN0B 4Y4KC 3MRBB 1RJLB 4XNQB 2OR7A 3D85D 1DFBL 3VD9A 1QSVA 2I5YH 1HXMA 2M8XA 3BO8B 2QJDA 2YA0A 3H8NA 4HWEL 3STZB 1HN1A 1ZLVH 4CJ0A 4J7RA 1NEZB 1UJTA 3DV6B 3FRPA 5HY9B 4YC2C 3QI9D 4WWKB 2ZSVA 3T4AB 1MHPH 5DJCA 1HHHB 2NY5H 4Z0XA 5INDA 2R0WH 2BY3A 1Z6JT 5EFIB 3CVHA 3GK8L 4Z0BL 2FWOB 5FYJH 5GGUB 1MEXH 1JNHA 3RZWA 4ZPVA 4K8RL 2IBGA 5I1JH 2DQGH 1A6VH 2V7NB 2AJYH 3TV3H 3IDMB 1VPOH 4XTRC 3H7BB 1QFWI 3SDCD 1CT8B 3WEXB 5FM8A 1S7WB 3HNVH 4POZC 2YMXL 1K8DA 4XRCA 3JSSA 4KI5D 3T0EC 3TVMD 5F7EH 1KCUH 4UNVA 1QPXA 4HS6B 5ICZB 4HAGA 5T5FL 3SDDB 1VESA 5CD5C 1F3RB 2E8ZA 3BUYB 2VXQH 5IMLA 4W4OC 4HIIA 4LLUA 2OR9L 2FH8A 3OX8A 4PLKD 3U0PA 1RAMA 5CEZL 5I2IA 1OTTC 4F7MA 4YO0A 4Y1AE 1I7ZA 4UQ2B 4HKJB 3RY4A 3T04D 4CDHA 1NCBL 1YMHA 2B1AH 5FYJE 4OZIE 2ATPB 2MCG1 1RUPH 1F8TH 5AYUH 3IJHA 4LNVA 2HTKC 4PY8J 4H0GA 4OCLC 4JY6B 5KSUB 2YPKB 4K8RD 3NIFE 2ZG3A 3OGCB 2HN7A 4XBEL 1JNLL 2NW2B 5ACZA 1F90L 1BJMA 4OCXL 2I60H 1OWWA 3J8F7 4LOUD 3F12A 1ZLUH 2W1NA 1G7JB 3PQYE 5IWLA 3ROLA 1AI1L 3CDGA 3KWWA 5GSRB 2DQCL 3BEWB 2AK4E 5TDNA 1AXIB 1S8DA 2N56A 3MV01 4MAUL 5L8JB 3P4LA 4U6VH 2PO6B 1CR9H 4GQ9H 5IEHB 3IAGC 1KXTB 4DGIL 1OCWL 5CEZD 3WJJC 4NNPH 1I8IA 4XVTH 1QBMH 4APQA 1MJ8L 1EHLH 5DD3L 1YEIH 3VDCA 3IAPA 3WFHB 1JVKA 2FX7L 5A3ID 4XMPL 1WBXA 2QQQA 3FL7A 4MB3A 4Y16B 1BGXL 2EC8A 2YRZA 4M7LT 3O3BA 3IDGB 3FT3A 3FAWA 3HMXA 1IQWH 5KS9A 4ERSH 2E7BA 1U95B 5BS0E 2M1KA 1YUHA 3K4ZA 3RDTD 3ILQD 4AT6A 1ORQA 3DUUB 1KLUA 3GSXB 3QHZH 4QHLB 3E8UL 3KPNA 5AYQA 1OT2A 2NLJB 3DYOA 5GGQL 4NO2A 3UCRA 2XG5A 3AAZB 1D5MA 4NC0B 3RPKA 4GG6B 5MEQB 1H3WM 1IFHH 1TXKA 4IRJC 5GS0H 1ZHKA 4NQTA 1I3UA 4PTUA 2DQDH 2Z35B 3QFDB 5T1MB 1QP1A 4FQ1H 3OV6A 2B1HL 4RFEA 4Y5VC 1CIUA 3MRRB 4LSUL 4YPGA 4U1KB 1RVFH 3LKRB 4AH2A 3GSWA 4MNQB 4JB9L 2OI9B 5IM7B 4F7EB 2DI9A 2RFXA 3P9LA 4CN6A 1WZ1L 1AHWB 3DVFA 4NKIH 5F9OH 6FABH 2FIKB 3DVIA 4S1DC 25C8H 3TCXA 1ZT4B 1JHKL 3AMKA 4NQDA 1U3ZA 1XZ0B 2RGSA 3D2UA 2VJXA 4QOKB 1P4LB 4R4NC 4OJFH 3MR9A 2Y5TA 3QXUA 4QNPF 3CU1A 3CXDL 4X6DF 4F57H 2PF6A 2Z92B 3BP5A 3FZUC 3RKDD 3HA0A 3VXRE 4J1UB 1LEKB 1N26A 1WZLA 3ALPA 3O41A 3R4DA 3FB5B 4OZGE 4ZO6A 4OCNC 3L3KA 1DBJH 1F6AB 4K3HA 2UZIL 5E2WH 4PRIE 4FQXD 1HOCB 1KSRA 3MUHL 5B4MD 1RJYA 3NN8A 4M6NL 4PV9B 3E2HB 3TGXA 1NGZB 3ARSA 4JM4H 2EKJA 3OTTA 2VERN 1U3JA 1J1OH 2FL5A 2W65B 1UM5L 3GSVB 4MJ6B 3MJ9L 3X3FH 3K2UH 1KCVH 4OFYA 5ERWA 3I75B 4P48A 3U7YH 5E7FA 1JWMB 1KPUA 2DLTA 4YAQB 4KHTL 3RWEB 1T1ZA 1F3DJ 3RWFB 3DI2B 1P53A 2X70A 4LRNH 1NFKA 1FAKT 2IADA 1N5YH 1X6LA 3TNMB 3QAZC 5ANMB 3F7PC 1I7UA 1U3HA 1BZQK 3VWKC 1VFOA 4QLRA 5DRNA 3TA3B 5DK2A 2BVQA 1Q1JL 1V3JA 3REWB 4J3UA 3MFFA 2BFVH 4HWBH 3MJ8B 4TOYH 5TPWL 3PL6C 2Z91B 2NX5E 4WDIA 3HCVB 3X3GL 1AR1C 4M7KL 3GI8H 3UJIH 1ZHBB 1F13A 1S9VA 4KY1L 4RAVA 5IQ7L 5J11B 2AJSH 5KW9L 4NHUB 3SDXB 3TP4A 5KVMC 5DMGC 1KTRL 3UTTD 1D5BB 1EFXA 1OAZL 3GJFA 3UC0L 1DANT 1TTUA 1F4YL 3VH8G 4M8QA 1IQDA 4GMTL 4RRPG 1EO5A 1C8PA 1JBJA 3C5ZA 3AM8A 3L1OL 1ACYL 4C56E 1CLYL 1UXSA 1FCGA 3ARFA 4Z7OE 4MNHB 4UBDD 4LLYB 35C8H 3L3DB 2OZ4L 2VQTA 1MCOL 2DIAA 4P59L 2GTZB 5EB9A 3Q6GH 4BA8A 3AM8C 3G9AB 3QQ3B 3W2DL 5IEKB 4JFQA 1AGCB 5IT2H 2XG4A 3BIKA 1AGFA 4NQVB 3UTSD 4I2XE 5ENWA 4JLRA 5A1AA 4FXGB 2UUDK 4WGWB 2VTFA 4XHJD 1VFAA 4IDJH 1RZJC 3IKCB 3QNZB 15C8H 3NPSB 2D4FA 2GI7A 1OVZA 4O2CB 3V6FA 1CN4A 4PB0H 1HHIB 5ITBL 2K1MA 4P23C 4HGWB 4NRYB 4JO2L 2PETA 3FCTB 3P4NA 4FXKA 1QFWL 1XH3A 2KKQA 1T6WA 1JGVL 2EE9A 4OZHE 2G9HA 1T03L 3GBMH 1YEHH 4Z76A 4L4VD 4NGHH 4NKOA 2HTLD 1AO7E 1DQLL 4PYHA 3QEUB 2BSRB 4JKPH 2NY6C 4KI1A 1FNSH 5FM5O 3ULVE 3QSKB 2KBGA 2CLVB 1FSKC 1H3PH 1M7IB 4PGEB 5C0CB 3MBEA 3WO3B 4GW1A 2YHGA 4PJCE 3QBTB 4HK3J 5I8CB 5E8NA 2E7HA 4P5MB 3QYCA 5GRUH 1BBDL 4MQXC 3BPNB 3H0TA 1N0XL 4NC1E 4EI5A 2EDOA 4PY7B 2CGRH 3QR2A 3LQZA 2ORBH 4JR9H 4K3DL 5KTEL 2NY2B 1XAUA 3VGAC 2Y9RT 1EO7A 4LSPL 1I1YA 4XC3H 5F1KC 5F97E 4NJAH 3G5YA 1BMGA 4HBCL 2ZJSL 5D70H 4NCC2 3VGBA 3N06B 3SKOA 3KLSA 2DQFB 1ES0A 4LEOB 4KQ3H 4XWGL 3G5VA 4OD3L 4U1GC 3B3IA 3MA7B 1CFNA 1W72L 4UTBH 3K74B 3LKQB 4WIQA 3FT2A 3V5HB 1KENH 4YE4H 2ERJC 4XGZB 4OLVH 4I4WA 1JV5A 1IKFH 5DRXA 1IM3B 2IH1B 3SJVD 4N0FA 3BX7C 5ALBL 2FJGA 3RWJB 1R3LA 1G7HA 4X4XB 3EO0B 1EUTA 5LGJA 3VD7A 1ROWA 1WAAA 2FR4B 3SCMC 1JPTH 3ME0A 1QR4A 3B2VH 2ZP0T 3QDJD 5DO2D 3BVNB 2JJTC 4KMTL 5IVXE 1R3KA 1BVZA 5I17B 2ATKA 4ZAKB 3JTSB 1YEKL 2WANA 5K9OA 3VWJB 1T22A 4PV8B 1Z5LA 1F4HA 4I0PB 2ZUTA 4UILL 4OZ4A 5CJ8A 3ZTNL 5DJ0B 3VGFA 5HYSG 4FFYH 3Q1SL 3T1FA 5KG9A 3WIHA 2PYED 2LQRA 2FHBA 1TZIA 3ET9F 2VDLH 3MGOB 3O8XC 5HGAA 3QUYD 1F6LL 2YSSA 1HSAA 2AXHA 5JW4Q 4HFUL 2I25N 4N1HB 1MWAH 2W0FA 5EBMB 4KROC 2B5IC 4I9WD 1JZ8A 1ZHLB 1G7PB 4JQIH 4B7IA 2AEWA 1IAMA 5DJZB 2DYPD 1SM3H 1GC1C 4LPWA 4GLRI 1CK0L 3PWUB 3QDHA 12E8H 5TGBB 3HE7A 1UYWH 3ARGB 3C60C 3UJJL 3ARDD 3BKJH 1DQMH 4K23H 4G5ZL 3O6KH 1CBVL 4L8DB 3SE3A 1Q8MA 5E8DH 5EZJA 1Y0LA 2IALB 3KR3H 4QWWC 2ITCB 3GSUB 3RWCB 4NO5B 4M02A 4X4ZA 1Z0MA 4N8VA 4Z0XB 1QHOA 2R1WA 5T3XL 4WU5A 3G6JF 4EBQL 1ZA6B 4AQ1B 1HILA 1IEAA 3UO1L 4QRQB 1BZ7A 1BOGB 2FRGP 1SBSH 1YEEH 5GS2H 1LDSA 4OZIA 1IC7L 3RAJH 4L3AA 4M5ZL 1G9NL 3EYVA 5DEFB 5J6HA 3S6CA 1VSCA 2E9BA 1R5VA 3RVWC 4JGUA 2F54A 2R8SL 2IANA 4HUXB 5D96C 1ZT1B 4WWKC 2YS4A 1J0YA 3IDNA 5GIRA 1QSEA 2HJFB 3KPMB 4GAJL 3S4SG 3TBSA 1P84K 4PGZA 2VL4A 3D3VD 1IGJB 4F7PA 4KKAC 1MCWW 3T4YB 3ZT6A 2X1PA 4QT5A 3FRUB 5E9DB 3RGHA 4X9FA 1Q0XL 3PNWA 1J0KA 3IDXL 3PQYA 4MA7H 2K9UA 4JFFE 4OLYH 2GCYA 4S1SL 4OUUA 1P7QA 1FC2D 2DTML 1WITA 4X80H 2FBJH 3V4PL 1UM4H 2DLEA 3FB7B 3X14B 2ITDB 5E2JA 1XR9B 2K7QA 5FA3A 2NYYD 1UZ6F 3FOMA 4QEGA 5E1AA 1NEUA 1FNEB 3QXWA 5T3XD 2D03L 5HJ3B 3DBXB 3KS0H 1E28A 1JHLL 1IKNA 1RK0B 2F5AL 3ULUL 5E00A 1FHGA 4KXZH 1U93A 1T1YB 4ZTPL 4FQQB 3T0BA 2RCSL 1I1FB 2QQKL 3EOAB 1RZKH 5IG7A 3IJSB 1T80A 3CH1A 4QF1A 4D0DA 2UY6A 4UINL 5EU6B 4QRPE 5ACZB 1BFVL 5D9SA 5L7XL 2AJ3A 3MRCA 4WEBH 1IKNC 4YHYB 1TZHB 1J0JA 5FHAH 1JIBA 1A02N 4M48H 2JIXA 2NXZD 4IM8A 5BS0A 1TJGL 2J4WH 4GKOA 4J6RH 1K4DA 2HFFA 4GKNB 3KWWB 4QTIH 1QBAA 1KV3A 1QLEL 4DTGH 1P9MA 2HFTA 1XEDA 1MAML 5F7FA 5I1GL 4HIEB 4R8WH 2OL3H 5F3HA 4ONGH 3DARA 4HS3A 1MREL 3HAEB 5TE6L 2MHAA 3AY4C 1T5WB 4HKXA 4WHTB 5EIIA 1BIIB 4MS8D 4X9HA 5FGCB 1WGOA 2EDFA 1S3KH 3MV8B 4BFIB 3T65B 3PWVA 1A3QA 2A0LC 3MLPA 4LSQL 2PO6C 2C4FT 1FZOB 1MFAH 5IP4A 5EIVA 3O3BB 3DGGA 2ICWB 4YXKL 5FOJA 3QIWB 4KFZC 4ZFOL 1TQCB 4N1EA 3ULUD 3A67H 3INUL 4YNYB 1A1MB 5DQDH 3CSYB 3ZDZF 2PCPA 3BMWA 3AS2A 1DBBH 4JFEB 3B9VA 4CVXA 3VFSA 4L4TB 5HGGS 4KRPB 4YDLB 1RMFH 5E8PA 1MHCB 5I30L 3MLSH 4XNUH 1U0QA 1U8PA 3FQWB 3OXRA 3I9GL 3QG6B 4OB5L 4QY8B 1S7UB 4OCWL 4CRPA 2I9TB 1INDL 5CZKA 4BZ2H 5I16B 5T3ZE 1FNGB 3FOLB 4ELKA 5BW7A 5DRZB 1LWRA 1OAYH 4OZGA 4JQXC 5GGTH 3WKMH 4YPGB 1OGAB 4NM8L 2P5ED 2IQAB 3BPCA 3FJTA 2VZUA 5DFVC 3CUPB 4M7LH 4KUCD 5GS0C 1ERNA 3O0RH 5K93A 3VFUA 5JUEH 4RFOL 5C0NC 2O5ZL 2HA1A 3HG1E 2V5SA 1B4JH 5MHSE 3BT2L 5CP7B 4JM2D 1T5XB 3ZL4H 2EXYD 2VSCA 4XBGB 5CZXD 5I1CL 1I9JH 4WU7B 5DD0H 4NQDB 4UDTA 3VXMD 5CMAB 2OI9C 4PRPD 5GZOC 5IK3B 4MDJA 2Y5TB 3MR9B 2W07A 2AGJL 3TO2B 4PJAA 5DD6B 3WIIL 1IT9L 1YEDA 3P3YA 5ELIA 1I7TB 2GK0A 4TUKH 4JRWA 3VRIB 5D8JL 3G6DH 3O2VH 1RUKH 3VMOA 4WY7L 2W60A 4Z77B 5IFHH 5D1QD 3PP4H 4LSTH 5JLZB 3U82B 4OGAD 1K4CB 3EHBC 5EDXA 4R3SA 3LN4B 3KYNA 1RJYB 3NN8B 3NIGE 5F3BA 4HPYH 2YD8A 3V5KA 5T1DL 1L9NA 3CFBB 1YNLL 1F42A 2NXYD 2NZ9D 3SE9H 3HC3L 3BKMH 1I75A 2ZOLB 2BOCA 4GAGL 1PDKA 4JJ5B 1YY8B 1NMAL 2UVEA 1CLOL 5J9PB 1Y6KR 5JO5B 4S0TD 1TVHA 2VDOL 3MUGA 1KPUB 2VQ1B 43C9A 3OKDB 1B6UA 2E8YA 3Q48A 4AJ0A 4ODXA 2D0GA 3E2HC 2A77H 4G8GD 4AL8L 5E6IA 5LVEA 3Q0HA 1RUQL 4NZUH 3T2PA 1U8HB 1MCIA 4PJHF 1U8NA 3QUML 1LILA 5SX4I 2ZCLL 3LPGA 4ODWB 1INEL 5SWZE 4XZUB 1I7RA 1PD6A 1WCBA 3KYKH 5E6IC 5DRWB 2E9IA 5CIPB 3VRLE 1DQJA 5HHOD 1WIPA 1EV2E 4NQEA 3KG5A 2IPUG 1QUNA 1JWSB 2DICA 5IV2B 4I2XA 1QKZH 5DHXB 4D0CA 5H35A 5EU5B 3HZVB 4YHKL 1VA9A 1BF8A 4N0CC 2FLBT 5DMJB 3RTQD 1NAML 3QH3B 5FGBA 3RVTC 5HTSA 5IMOB 2YZ8A 2MCPL 2FJFB 4MJ5B 1JL8A 5F93C 5IFJB 5FXCH 4KKCC 2BHYA 3IETA 5M94B 5GGRA 5FF6B 5J11C 3LEXA 5JIIA 1YEFL 2XIDA 5JQ6L 4OZHA 4FHBD 4DAGL 3ZDXE 4AMKL 5BMFL 1U8JA 3NACH 3MBXH 1MRCL 5K59E 2AKRA 2WWKT 5FGBC 5I71B 1AO7A 3FO2B 1IGIL 1B2WH 1F2XK 1HQRA 1A0QH 5TF1L 5FO7B 4XP9L 1IGMH 4KVNH 4PJ5B 2J88L 3V9FA 4EIZC 4J4PD 4MNGE 3L5XL 1AY1H 4LLVB 5FYKH 3CMOL 3UPAA 4PJCA 4GOSA 2QADD 1NLBL 5HHQA 5IUSA 3HPJA 1D6EA 4K3EL 2P4AB 1Q9KB 1LGVA 1VFAB 4LKXA 4RFNC 2VR9A 1E6JL 4XVUC 1FL3B 1X44A 1A9EB 4UIKL 3TIEB 3V6FB 5J3HD 2VSDA 3HLAB 4LCIH 1IAOA 2A6JA 5FYLH 1BJ1J 5BVJA 3E6HA 1MFBL 5F6IB 4FXKB 4MX7B 4Y8AA 4O4YH 4FFWC 4MAYB 4JEGB 4Y4FA 1IC5L 1U8LA 1IEHA 5JXEA 3B2UC 3KPRD 3TNNA 2P5WA 1PEZA 1O5DT 3CVIH 3NPSC 3VXOA 4JRYB 5FDWA 2XNAA 1FZJB 4RMVA 1LEIA 3EW3B 5JW5B 1Z0NA 5DC0A 4NIKB 2Q20A 5JXEC 1MF2L 1V7NH 4FNLL 3VXUE 5HPOA 5ISZE 1GCFA 1QBLL 3NIDF 8FABA 3KPSD 3U9UA 2F19H 1GH7A 1LO5A 4PJ9B 1HI6A 1P69B 4P57A 4JG0L 2F53D 3HB3C 3NA9L 3EJJX 1NGQH 1C5DA 1S78D 1WTLA 3CVHL 4GRWF 4M7JL 4R96A 1OSPL 4X4YA 5IVXA 3P4MB 4WV1A 1HDMA 1VKXB 1CI5A 3BPNC 4HUVB 3DXAA 4X5XA 4KK8D 5ESQA 2IGFH 5C3TA 4QNPE 4XI5D 2YD6A 2VLKE 3GI9L 4NP4H 4LSRH 5BZWA 1MCPH 2NY2C 2I07A 4JRXD 2NQCA 3A6CL 3BWAA 3F7VB 4GKSB 4BZ1H 1KIUA 4ZFGH 4QRTA 2JJSC 1FYHB 3SDYH 1UA6L 2W9LA 1RZFL 3N9GL 4YIQA 1KELL 3MQIA 1EEZA 1SY6A 1GXEA 5E2TH 4Y4KD 2NTFA 3EO9H 5IKCA 3QNXB 2HMIC 1MVUA 3R06A 3QQ9C 4HPOH 5L2JA 1FG9C 4G8FB 4LHUG 3RL1A 4D8PB 4X9BA 1S5IH 2AQ1A 3WHXA 4RNRA 3HNSL 4W68A 4U49A 4ORZC 4P46B 4XB7A 1M6OA 1FG2B 4YWGL 2JB6B 2ATKB 4LLMB 3FB6A 3RGVB 4M43H 2HYMA 1KJVA 1LO2H 2XACC 3QDMD 1I8MA 4YHNA 4DVRH 5DWUH 4HUKB 2G2RA 4JDVA 2NY0B 3GHEL 1WWBX 3MC0A 3ARQA 5KG9B 2EH7H 2OXHA 2IG2L 4IOIA 3U4BL 4OLUL 4XTRD 4X5WA 4O58H 3WFDL 5AUMB 5LXGH 4ELMF 5ILTH 2YSSB 1IAKB 4ZAKC 1BFTA 3S36H 2BDNL 5CP3A 3VWJC 3EFFB 1U2HA 2HJLA 2R1XB 4I0PC 1DLFL 1D9KB 1MWAA 5TQ2L 2V6HA 4G8EB 4ONFL 5B21A 5CD5D 2Q76A 3FN0L 3EDKA 1JYWA 3NH7L 1OSZB 1EPFA 3VG9C 5HHMD 2YXMA 4Q9RL 5BRZB 3TBYB 3B5HA 3WFEH 1OTTD 5CEYA 3DRTA 2I9LB 4ODTL 3DUHA 1X5HA 4FQCH 3UAJC 1YEJL 3EOYG 2XXCB 3IAQA 1ZS8A 4WI8A 1KJ2B 1CWVA 5FV1L 1KJ2H 3LAFA 4UUJA 3QJFA 3MV7D 3MXWL 1QRNB 2X05A 5IIEB 5CJXA 4KJPD 3GFUA 5BXFB 5CCKH 3L95A 3GO1H 2KQNA 1KIQA 2A83B 4JFFA 1XIWA 2BSSA 5E2UL 2XTJE 5C0BA 2KZ1B 5E4EC 1DBMH 4KV5E 4PJIF 5D72L 2LTQB 4JFZL 4Y1AB 5CJXC 1IEAB 5TE7H 1U9KA 4LAQH 1UB6A 1MAJA 2FYYA 3AREB 1ORSB 3SE8H 4TNVK 5IFAL 4N1CA 2FSEB 1KUMA 5HYJB 1R6VA 4RGMB 3CH8A 3IFPA 2YWYA 4NUGL 1PLGH 5L9DH 1PSKH 1LO3H 1A7OH 3MRQB 3MNZA 3DROB 9CGTA 4XVJH 3ZHKA 2V9QA 4LVOB 3QISA 4EZMA 5MENE 4FZEH 2VLJE 4AM0B 4F7PB 4L9DA 4QRPA 3GSOA 1T83C 5GSVA 2ZKHH 4PJGF 4BSVB 1J8HE 4XX1E 5DK0B 2Z9TA 3BHBB 3WLWC 4R2GC 1T0MB 4YLQT 3JWOL 4O2FA 4PJEB 3WIFA 5I18H 3KLHD 3DIFA 3HTLX 4XPGH 2AK4B 3MODL 3IFNL 1NGPL 2EYSB 3O45B 5E94B 3PWNB 1GGBL 4APQD 4Z78A 3MRKB 3FOMB 5EU7C 2ARJQ 5CHNA 3FFCE 1MCCA 2VLRB 2YKLL 1XF4A 1D7FA 2XQBL 1JZ2A 3VJ6A 3O4LE 3BZEA 3ZTJH 2QV2A 4U1LA 1CVSC 2ENSA 4K3JH 4PJFF 3DV4B 1WLHA 2GSGA 2VZ1A 5EU4B 5IBLC 3RIAK 1O0VA 3D5OF 4XPAL 2R56H 1IGCL 3VXSE 3MNWA 4LIQL 1UH2A 4KJYA 4IRJD 1AIFA 5HSFA 2XZCL 4X6BB 2BMKB 3GBLA 3WBDA 3FMGL 3PABA 4PJDE 4TNWK 4TSBL 3NCCB 3ESVF 4G9DA 4S1QH 5GPRA 2DDQH 4I0KA 4DZBA 1N64H 1U42A 4AYFA 3WDJA 2D0HA 2OL3A 1ONQA 4Q58C 4U6HB 4HEPG 4YHYC 4PYGA 1HKLL 3PV7A 3N85L 3PJSA 3HI6L 3M1BB 1KTDB 2AV1A 4LP4A 3FQXB 1F3JB 3AS1A 3FQTB 3JWDH 4HKXB 1QEWB 3IF1B 1B0GA 1BLNA 5F89A 2HAZA 1U41A 2HJKB 1WSST 3QCVL 2X5PA 4P5KA 3OJDA 2YWZA 3QNYB 1LDPH 4TVPL 2WUBL 4R4ND 1MPAL 3QJHB 1T7VA 3GUTB 4M7ZC 3FZUD 1LNUA 5LAXB 1F2QA 4JPIA 4LCCB 2MPAL 4QRRD 1LO4L 3V6OE 3PDDA 43CAA 1OHQA 2H26A 3CDYA 4CVXB 3VFSB 4XCNA 4JM2F 3C9NA 3H9HA 4PJ8B 3HFML 4LKCA 4CW1A 2VDKH 4LL9A 5EUKB 3G6JB 2ZCKH 3KXFA 3QIWC 1TQCC 1XGPA 3U9PH 2MFNA 1JPGA 4FQPA 3VXRB 3S3SA 2WAHA 4FTVD 4I3GA 4NPYA 5GGSB 4WW2F 5GHWH 1UM6H 5L0QB 2Q8BH 1FCCA 2QKIA 3BKYH 2QHRL 3DO7B 3BPCB 5GGTA 3VFOB 2GFBA 4PRIB 2OS7A 2H1PL 4J3TA 1V3MA 1D5ZA 3TBTA 5F9JB 3D0LA 1KJ3L 5EORH 2X4OB 2YR3A 5L6YH 4YFLI 3DX7B 3U7WH 3VWKD 1J10A 1B3JA 3BIAX 2VLLB 2D7TH 1L7IL 3L5WB 2LU7A 5FOBB 4D94A 4KI5E 4TVPD 3NFNA 1WICA 1AQDB 4ZTOL 3BEVA 4FZ8H 4IMLB 4GJTB 1RZJL 4A6YB 2HH0L 3PL6D 4NT6A 4ORGA 5I1EL 1S7SA 2ARWA 1CVRA 3VG0H 1AR1D 3DTXA 1ODAA 1TFHA 5DEGB 4HZLB 3Q5TA 4DUWA 4Z95H 4R4BB 4HGMA 5D1XA 3BWUC 4M1DL 3I6LE 4LSSL 1H5BB 4P2OA 4KKLD 4OV6F 1NLDL 3MV9B 4RWYL 2DM7A 5EO0A 3DX6A 3ARBB 4X7CC 5C0FA 1C08B 5E70A 4QHNA 4QRUB 1D5IH 1FORH 1A7PL 2W60B 3QXAB 3EO1B 3MO1A 1PX3A 1P84J 5SWZA 2L7UA 3D0VB 2WNGA 4PD4K 1VADA 2NX5B 5C3LD 1QFPA 2ZOKB 1FZMA 4L1HA 3VH8A 5KZCB 4RRPA 5B8CA 3MLRL 4WCYL 1TQBB 5DQ9A 1CL7H 1YYML 4MDIB 4H20L 3ALXA 3C5ZD 3QULB 5J13B 1IM9D 1CGUA 2AJXH 1KN2L 4Y2DA 2EE6A 5FUZL 3LPFA 3RWIA 4OZFG 2MJWA 4KZEL 2WBWB 2X40A 4HW6A 4C56B 1XGTB 4EI6A 2F58L 4PPTA 1T3FB 5AEAA 2VZ3A 1LK2A 3E3QE 4XB8A 3LEVL 1AKJA 1I7RB 3IGAA 4P23D 5FUCE 3ZT7A 1ZTXL 4JPKL 4QGTA 5FKAA 1CLCA 1DQJB 3DRQA 2VDNH 4NQCD 5CEZE 4LAJH 4MNGA 5FECA 5DJAB 5KSBF 1CE1L 1L7TH 2Z0BA 4PRAB 3F58H 1A4JA 1G7QA 4P4KA 3KPOB 1NGYA 5H37G 1UB5A 1BVKB 3TT1L 1H8SA 4U0QB 5IJVA 2V5MA 1ETZB 3TIDB 4HIJA 2DBLL 4JREB 4UDUB 3B9KB 4YHLH 3I50H 3VGHA 1NFIA 3A6BL 1L4IA 3TYGH 3O2DH 1JP5A 4J3WA 3ULSB 1Z3GL 4KZDH 3OB0K 1OGTA 3IU3A 4K7PY 3VA6A 3V2AR 5LCVL 3LEXB 5F21B 2XQYG 3L5IA 1IVLA 5FO8A 3WE6B 2FGWL 3MBED 5DSCB 1EBPA 4OF0A 3QWOB 2C1OA 2JJVA 4NYLA 3W0WD 3L3OA 4JFXA 4IHOB 4RGND 5LWYL 4G43B 3G9VA 4UOJA 3VXUA 5HHQB 5HVHC 1D6EB 4ZXBA 5CUSH 3RWGB 1H15A 4NBYB 1A6ZB 3FO0L 3MOBH 3HZYA 3WIHL 5DUPL 2H2PC 1SEBB 1U8QA 3LKNA 2BVOB 3TZVB 4L5FH 5C70A 3E6HB 1KPRB 3RUGF 2GIYA 3BW9B 3GMMB 1HEZA 2APXA 3SQOL 1HQ4B 3IB4A 4JZOA 1GC1L 1I9IL 4PRDB 2EDNA 4F33A 1N7ML 3KYAA 2CK2A 1OLLA 1N3NB 4GH7B 5TDOA 3SBWA 2HLAB 4X6DA 1JWUA 2Y23A 4IDLA 5DA4A 3DOSA 3P0VH 5F6IC 4OLWL 4BUGA 5C0DB 2GAZB 1EO8H 5DF0A 1AD0B 2EO1A 4MAYC 3T77A 3RRQA 3UPRA 5BVPL 2OJZL 4RQQA 1HNFA 1U6AL 1GSMA 3F7YA 1E0OB 1T21B 4P57B 5I76B 3S34H 3BQUA 1DQDL 2I5YL 5GJTH 4JGJA 1CE6B 3NCFB 5HYSA 1TCRB 2QLVB 3O8XD 1J11A 5AG9A 3HMWH 3U46B 4EDXA 1MHPL 2NY5L 2R0WL 3MJ7A 4NNYA 2FJHA 2CDEA 4PJ9C 5FYJL 1S9XB 1MEXL 1NCCH 4H26B 1AGDB 5DYOA 4ZS7H 5I1JL 2DQGL 4PJHB 1A6VL 2AJYL 4LDOB 3BWAB 2P24A 3TV3L 2VNCA 1VPOL 3VFWA 4N9GA 2FO4A 1XF2B 3O6FA 2K7PA 4FOMA 1KJMB 3HNVL 1EEZB 1JRHH 2UVFA 1A2YA 3C60D 3K7UA 2WP3T 1YY9C 5K9QI 2GK2A 5F7EL 1KCUL 5I8EA 4M9PA 5C9JB 3TFKC 4CU8A 3MRFA 5I1AB 4QWWD 1KCRH 3HE7D 1B0RA 3S96B 1NUNB 2VXQL 4RNRB 3UROR 1AE6H 1U8KB 3I3EA 4LMQI 1SYVA 3UTTE 4UZGA 3F5WA 5I74C 2D9CA 1KJVB 2B1AL 4X7DC 4IS6A 4LHJB 7FABH 1KIPB 1RUPL 2G2RB 1F8TL 1P4BH 4KRMB 5AYUL 5FYJU 1GYAA 2CDFA 4S2SA 2B4CH 3FO9A 5CEXA 1JNJA 5EWIH 4P46C 1T6VN 5A2JH 3WHE1 2P49B 4MHHI 2DQHH 4GG8B 5FYJD 3GSNA 1MUJA 1N5AB 3RGVC 5D6DA 4Z7UE 2N1KA 2F54D 1J0IA 2IAND 3TWCH 4KKAD 3S4SA 1PJ9A 2I60L 1K85A 2NY0C 1ZVSA 1QSED 1FPTH 4P2CG 2AW2A 3UTSE 4FXLA 4GW5B 1DP0A 4G3YH 5EUOE 3EYOB 1E4KA 3DRTB 4HUMB 4Z8FH 5JHLH 2Z93B 5D2NE 2ZUUA 1DQTA 4N0UB 1I3GH 1H9VA 4M6OH 4U6VL 1UKSA 1D9KC 5MENA 3PQYD 2VLJA 3WSQL 5IHZB 3FKUS 3QJFB 4R6UA 1CR9L 2Y7QB 1P7QD 4GQ9L 3IDIA 1HH9B 4NNPL 4A2LA 4XVTL 1QBML 1KIQB 2XA3A 2H8PA 3CC5A 1SJHA 3CD4A 2WQRA 1EJOH 4JFFB 3LKPB 4JFPA 4RISH 5F9AC 5D2LB 1YEIL 4CMHB 1EHLL 4OAWA 1MCRA 4HJ0C 5DQJA 2Z8WC 4LF3A 1FFQA 3K8LA 3BRDA 2W38A 1ZSDA 4E41E 3KYOB 1DJSA 3EJZD 4HG4K 1HHGB 5CWSA 3EUUA 3FFCA 4ERSL 1FO0H 2AJZB 1MCKA 1U8OB 4B0MM 4KK5C 4X6CE 4P2QB 3O4LA 1MFDH 2LTQC 1IC4H 3QHZL 4R7DB 1P7KB 3QFJB 1W0YT 3AREC 1HE7A 1PZ5A 4GRWB 1W2KT 1NCAH 3VXSA 4GRWH 4JO3H 4F9PA 2ZUXA 1FFOA 5D5MF 5GS0L 5JDJA 4RGMC 4JANB 2DQDL 3JTTB 4WFED 5JORA 5CZVH 3U0TA 4FQ1L 1P5UA 1GZPA 2DLGA 4NRZB 5GS3A 3WL9B 3PWPB 4LVOC 1NDGB 1OB1B 1QBBA 4LDLB 2A0LD 4EOWH 2Y1VA 3MNVA 4FFVD 4NUJB 1RVFL 3H7LA 2IH3A 1WBYA 1OP9A 1RJZA 2X4NB 2GSIA 4D9LH 1SHMA 4JZNA 5BO1H 3NFPA 4U1SA 1XF4B 1RIUH 4NKIL 5F9OL 3ARWA 25C8L 2P7TB 3SJVE 5E08H 3ILPB 4JY4B 1IZJA 3QIBB 4MD0B 4AIXA 1OY3B 4HSQA 4TQEH 3MNWB 3TBVB 5JHDA 4OJFL 2MQ0A 3GIZH 1AIFB 3QDJE 4F57L 4JDZA 3T0WA 3HUJB 4I18A 3X13A 3CSPA 2EKSA 1EUUA 2IPKA 3W9DA 2WBJB 3QUXA 3BFOA 3PABB 4OFDA 3TJHC 1G9MC 3HPLB 1MCSA 1FC1A 3IU4H 1S9YB 5F1NA 3VA2C 3WMSA 5KAQG 4FQIH 1DBJL 4DW2L 2V2WB 3RIFF 3DWTA 4DZBB 5DFVD 3WDIA 1GIGL 2WLZA 5E2WL 1NGXA 1PY4A 1ONQB 1M7XA 1S9WA 2V5RA 3VFVA 5GS0D 2P1YA 4ZODA 3VFTB 3TO4B 4I77H 1ZA3B 1NDMB 1QQDA 2WSKA 3PXHA 1P2CB 1OL0A 5C0ND 4JM4L 2AV1B 1MH5A 2DM4A 3KPPB 1BWMA 4P2RD 3GGWB 1Z9SA 3K2UL 3UZQA 3C5SA 3OJDB 1BD2E 4YR6A 4P49A 1SJVA 5GZOD 3BPLC 3U7YL 5JOFB 4Y4HB 4PREA 2PUQT 3JWDC 5J06A 5AZEH 4LRNL 3MRPB 1UWGH 1FYTB 1X5FA 3HG1B 4HK0A 1J7VR 5D7LA 1ZT7A 4KXZI 3CGTA 5C08B 4CU6A 3L6FB 3OR7B 4UMGA 1MQKH 1I9EA 2BFVL 4PJ7F 4HWBL 1A1OA 1RSFA 4TOYL 1PG7H 3EHBD 3OKKA 2HWZH 3FB8A 2EDWA 1LP9E 2VZSA 3GI8L 4R7NA 1DL7H 1CG9A 4LCCC 5H2BA 4NPYB 5HGDB 3FTGB 2XYCA 2UWEB 1XGUA 3UYRH 5F72S 3LKOA 4HMCA 4QXUL 4YK4B 4PJ8C 5TH2A 3O9WA 4BZYA 1SJEA 2OJEB 3TLRA 5JNYA 3RHWF 5HYQB 3OKEB 2IFGA 3V4UL 1X5IA 4PR5A 2HKHH 4CNIA 3PHOB 2P8LB 3O9WC 5TFSH 35C8L 3C6LB 4G6FB 4MCZA 5L0QC 5HPMB 3VFNB 3DPBA 1M7DA 3D3VE 5E6ID 3Q6GL 3WNOA 1S7SB 1M1SA 2VIRA 5IT2L 1WWAX 4MA8H 5J6GB 3EBAA 3P73B 2ICWI 3I6KA 4PJIE 5J8OA 1NFDF 3VRJB 4IDJL 4Q6YA 5C0FB 4N0CD 15C8L 2BSTA 4NQED 1E6OH 4PB0L 2BCKB 4GXUM 2H2SC 4QGYA 5HI4C 2YD3A 1YDPA 4HBQA 2IMNA 5T3XE 2LU4A 3SE4A 5D1ZB 1IC1A 4YEEA 4HFWA 2X4QB 1H5BC 2BC4A 4HDIA 4YDKH 3GBML 3ZE1F 4NGHL 4E0RA 5EN2B 3ARBC 3V0VA 2CIIA 2EYRB 4JKPL 2IBBA 1FNSL 4PJGE 2V2XB 2DI7A 1H3PL 2YEZB 1L0YA 4KK6C 2O5YH 5B39B 5D7SL 3MUZ1 3LN9A 2GTWA 3TH4T 3U7AA 3G5ZB 1TTGA 5DHVA 5GS1B 1AO7D 5KVFL 5DURB 2BOBA 5IF0A 1KXQE 4P9HH 1TQBC 1XGQB 5GRUL 5KSAB 1A6PA 3QXDB 5IOPA 1RUAH 3ZKSD 1KEGH 4HWZA 4KDVA 4XVUD 2FLRT 5ADOH 5J13C 2CGRL 2ORBL 3PDOA 4JR9L 4XNXH 3O3DB 4Q0XH 1YNKH 3BZFB 3JUZA 2VKWA 4XC3L 2YBRB 2BX5A 3G04B 4FFWD 4NJAL 2VH5H 2VWEC 1JMXA 2OQJA 4HEME 3B2UD 4F9LA 4UAOB 4ZUWA 3VDAA 5D70L 2WINA 3QWRD 4HULB 4OTXH 1A6TB 4HIJB 3NA4A 4KQ3L 2A9NL 3BAEH 1QFUH 4Y4FD 1T04A 2D3VA 1VFBB 4UTBL 5JXED 3ULUE 1KENL 2HRPL 3GMRB 4YE4L 2P5WD 3O2DA 1OGTB 1R5IA 3IU3B 4H1LG 1CDBA 4QHMA 4OLVL 2M2DA 1IKFL 1YMMB 2HVJA 6CGTA 4J3VA 5KN5B 4Z7WE 3WN5A 3RKPA 3DURA 2CUHA 4TN9A 4JREC 3DSFH 3B9KC 4KPHL 3HB3D 3EIFA 5C0CD 2XZAH 2BK8A 1IGYA 4JVPA 4OF7A 1JPTL 4IMKC 1KCKA 2OXGA 1G1CA 4TUOB 2DWEA 4KDWA 1ZVYA 1Q9LA 2IBZY 4OD2B 3QO1B 4X8JB 4GRMB 5ISZB 1GGYA 5DJ2A 1BQHG 2PYFB 1G7MA 2R2BA 4RCAA 2IBZX 2P5EE 2VDMH 1R3JA 5E2VL 2EH8H 4RZCA 2NY2D 5C8JA 1QACA 5CLTA 1JGLH 1WFTA 5F9WB 3SGDH 5DUBA 4GS7B 3DXAD 4AENA 3S36X 2P8MB 1VHPA 1R3HA 3L9RA 2XV6B 4V1DA 2VDQH 1MWAL 3RVVC 1IBGH 2BRQA 3VXME 2DOCA 4WTXA 4NC1C 3SGJA 3Q6FA 1AD9B 4PRPE 4JQIL 2VLKB 4PFEA 3GMLA 3TZVC 4JO4L 1NBZA 4KRNA 4LHUA 4F7TB 4MJID 5IBUB 3P9WB 1VEMA 4KWUA 2EDXA 1SM3L 3O3UN 3ZDYE 5IMKA 4U0RB 3T77B 2J8UE 4L1DA 12E8L 1JZ6A 1UYWL 1W0VB 3WJLC 3UPRB 3BKJL 4TSCH 4UV4L 4K23L 3O6KL 5F96H 3AU1B 1YJDH 4JDTH 1UKQA 3KR3L 2IPUK 3N1FC 5HYSB 3HI1A 3HC0A 5I6XB 5C0IA 3RZCA 1IILE 4L8SA 1NBYA 1SYSB 1KG0A 2LE9A 5D6CA 2VDPH 3UTTA 2DQUH 5EOTA 1X5YA 3EFDH 2KZWA 1E4JA 3H9SE 4YDVB 3U79A 3VGDA 5C92A 3RBSA 1EAPA 5DJYB 1SBSL 1YEEL 4ODUB 5DTFB 4X99B 5DYOB 2NMSA 3RAJL 4H8WC 1PKOA 1U58A 3C5JB 1UXWB 4PD4J 4ZSOB 1U3YA 2M26A 2X89A 4J8RA 4B50A 3VFWB 1I1AA 5MI0B 1IL1A 3MJ9A 1R0AH 2PXYC 3UAJD 3RA7H 1FFPB 4XBPA 5MEPB 4Z7UA 5HGBA 4JG1L 5DJ8A 2JE8A 3HZKA 3VFPA 5HHOE 5SWQB 1RK1A 4ISVA 5KANI 3FAXA 4R0LA 2BVEA 4U6YA 4MA7L 4ZQKB 3KS0J 4OLYL 3CJJA 5EUOA 3CFEA 3G6AA 4X80L 4JFYB 1DEEB 3REVB 5SWSA 1UM4L 5D93C 4ZDHA 1U92A 2A74B 5D2NA 3PDGA 1CICB 5EZLA 4HC1H 3IFOA 4JO1H 4MSWB 1ZK9A 4Y5XB 2JCCE 1O7VA 4QHUA 5C0BD 3S3JA 3VFMA 3FONA 4ODVH 5C0GB 3P0GB 1KT2B 3B6SB 4J12A 4HF5H 2XTJB 3GSNB 5IHBA 2AXFA 5GS2D 5D7IE 1RZKL 1PEWA 3IS1X 5D7JA 4E41A 2Q8AH 4WEBL 2B4CC 2XRAH 4OKDA 4R2GD 5FHAL 3OXSA 1ZHNA 4M48L 4MA1B 5EOQH 4TUJA 2J4WL 2O26U 3TBWB 4J6RL 5HDBF 4D0BB 4PGDB 4QTIL 4F2MA 4DTGL 4BKLB 4JFDA 4U1IB 3RUGB 4R8WL 2R0KH 2OL3L 1GGTA 4LBEA 1LK3H 3VD5A 4DVBA 2JLLA 5E9DD 3MLWH 1MJJB 4ONGL 1DUYB 3FFDB 4WNQA 1J8HB 1URLA 1A14H 3CC5B 5GRZA 1BQSA 2DQIH 2ADJA 4GXUN 4OAWB 5BQ7B 1H0DB 1S3KL 5BJTB 3KPRE 2R4SL 3RX7A 4HIHA 5IBLD 4Q6IB 5C7XH 5KVEL 1MFAL 4EN3B 4L8BB 4XNMA 4NWUH 3RWDA 1GZQB 2X9XA 4WI9A 4NQSB 3W5NA 1TJHH 3NFSL 3A67L 4YFLF 5DQDL 4CMHC 4JHBA 5EO1A 5EO9B 4EQ3A 4LCYA 2EIZA 3SJVA 1F97A 3KPSE 2FDBP 1DBBL 1FFNA 4FQLL 3ARVA 2PTTA 4OBSA 3IRPX 5CINH 3MLSL 4QHKI 5GGSY 3QO0A 4XNUL 2YA2A 3QDJA 4Y7MA 1DLHB 4X0KB 1KTLA 2E7MA 1RZGB 2YA1A 2YD4A 3ES6A 2FZ3B 4BZ2L 3D39A 4U1JA 3TEUA 4PJDB 4WJ5B 4UQ3A 2GITB 1KXVC 1OAYL 2GUOA 5GGTL 3WKML 5JR1H 3W82A 1BJ8A 5DDHB 3STLA 3GSQA 4X6EB 3L7EA 1UEYA 4M7LL 4IRSA 4JZNB 2YPLB 32C2B 4JRXE 2GJ6E 1U8IA 3O0RL 1UJ3B 2H32B 5L2KA 4GG6F 5JUEL 2BY0A 2PW1A 4NKDA 2H32H 1B4JL 2RHEA 2X4SB 3QUYA 2GJZA 3MV8D 3ZL4L 1IARB 4YUEH 1QSFB 4OGYH 5DVKA 1S7RA 2YD1A 3MGAA 1NKRA 4YQXH 3QDGA 1BD2A 3ZO0A 1W72A 4X7TB 2DLHA 3QIWD 3VXTB 2FEEL 4LLDA 4DGVH 4RDQF 2PKDA 3X13B 1YPZF 3BYTA 2EDYA 2DYPA 5IW6A 3HRZB 2XWTA 2F5BH 1CDJA 3GSRB 3QIBC 3G6DL 3O2VL 1RUKL 1S5HA 3KXFD 5I1LB 4U1HA 3QDME 4JFHD 2IFFL 5IFHL 2R2EA 5EC2B 4DOHE 3PP4L 4MXQC 3D85B 1MHHA 3KPQB 1W8NA 4LSTL 4WUUB 1MFEL 5IVNA 3BRFA 1LP9A 4ELMA 1CD1A 4HPYL 5BV7B 2WBJC 4H0IA 3SDAB 3SE9L 3QI9B 3BKML 1KIRA 3MUJA 3IDUA 4CVZB 2DWDA 1PBYA 3LS5H 2Y5EA 2R9HD 4YR6B 1EEYB 4W81A 3V0WH 2CLZA 1MCDA 3ETBF 4OF8A 1NEZG 3TO4C 3GJEB 4L9LA 5HHME 1QR1A 3EYSH 2A77L 1NBQA 3MREB 2NW3B 4WRLA 3QG7L 5FA4B 3SDCB 3Q3GA 3CX2A 4NZUL 1ZT7B 5I15H 1EMTH 4IIQA 3MRLA 4YXHH 4M1CC 3TVMB 1M05B 3MLZL 4GW4A 4AEHH 3D3VA 2VAAB 1AJ7H 3KYKL 3MV7E 1J0ZA 5D1XD 3O3AA 4LQFH 1IEBA 4Y4HC 3RNQB 5DJ6A 3VE0B 4P2OD 1J12A 5LG1A 4CVUA 4PJIA 1QKZL 5C0RH 2X1XR 1HHKA 5DJDA 2SEBB 3D18A 4O2EB 2ZNWA 3QA3A 3LKOB 1TZGH 2QQLH 1U91B 4G6JH 2VOTA 4AK1A 2F8VA 1TENA 4XP4H 4XC1H 3I6GB 1NPUA 2EE2A 4HMDA 4PR5B 1T2JA 2Q86A 1RZ7H 1VACB 4OZFA 5IB2A 3O6MH 1BP3B 1I85C 2YRLA 5C0EA 4Y2DD 4C58B 4YK4C 1B2WL 3F65A 4PJGA 1FVDA 1A0QL 4F8TA 3B9DA 1IGML 4KVNL 4EUPB 4NHCH 1J1PH 4YHPB 2A73A 4LQ1A 1AY1L 5IJKA 1NJ9B 5FYKL 5DD1L 3I6KB 2IQ9H 3B4NA 1F58H 1QVOB 1T4KA 1T66C 3ZE0F 3KDMA 4XCYB 3B43A 1TVBB 3C6LC 4F37F 1CXKA 2OX5A 2EDLA 2CO7B 4HV8B 5ITFB 1OTUD 1QLFB 3IYLW 1G6RH 1JPFA 4LCIL 3WDHA 2XZQH 5FYLL 3GMPA 1C12A 1FH5H 4I13B 4ZUSA 4O4YL 5INCB 2BC4B 4NJ9H 4GAYB 3K80A 2DRUA 2XTLA 1X5GA 4ONOA 2ESVB 3EKCA 1X6NA 2IPTL 5KS9E 3CVIL 4ODHH 2RJMA 1WFUA 5D5ME 3JV6B 4YHIB 2AJUH 5HI3D 4NKMA 2VXTL 1OT1A 3ZKQD 4NO0D 1PYWA 5IROC 3O3EA 3FQNA 1XR8B 5I8OH 1V7NL 5D1ZC 5C09B 3RDTB 2DD8H 3ZHLA 2BNUB 1KGCD 4DGYL 2MTPA 4J3XA 3HN3A 2VLME 2F19L 2AP2A 1FVEB 3OHXB 2H2PD 4YXLH 3ZSSA 2CDGB 1TCMA 4PJ5D 2H3NA 1NGQL 5FYKD 3VXUD 4ZXBD 1ACZA 5CJOH 5GS1C 1SBBA 3AB0B 1UQSA 4P9HC 1AI1H 2Y36H 1KB5H 5KSAC 4WUKL 5ICYA 1MI5A 2QR0A 3GMNB 4JFOA 1QLRA 2P5EA 3EYFA 5FYLD 5SX5H 2DQEH 3MRGB 1NUFA 4NP4L 4LSRL 1VGKA 1MCPL 3O6LH 1OPGH 3MYJA 3O2WH 4NRXA 4BZ1L 2LU3A 1J18A 4MAYD 4QRRE 2CXGA 3RVUC 2NY7H 4JM2A 5E2TL 5CSZA 4UAOC 3DURB 3EO9L 4WTZG 4XMPH 1V3KA 4LIQE 3P0YH 4RDQG 3VXMA 2CKBH 4HPOL 1BGXH 5IB4A 1L6XA 3B5TA 4PRPA 4LPVA 1NCNA 1N4XH 1BAFH 2H9GB 1S5IL 3M17B 1WK0A 2CR6A 4KK9C 3WS3A 4WW2A 2X4RB 4FTVE 1YYLH 4F58H 5J1AB 4P4RB 5HHXH 1VEOA 1D5XA 3BQUD 4M5YL 3JV4A 3WFZA 2OTWA 4M43L 1JTOA 4PJ9D 5AWNH 2R2BB 1LO2L 3L5HA 2WUCH 1G7LA 4BSWA 5D1QA 5E8OB 4DVRL 5DWUL 4FQXB 4P5TB 2EH7L 4XCEA 4GBXB 5IQ9A 4O58L 1AXSA 1C16A 5ILTL 1DN2A 2MQCA 3CLEH 3K81A 1YY9D 4TVPE 5DMKA 4DK3A 3UBXB 1CXFA 3S36L 2EZ0C 5C0JA 3H9SA 4G6MH 3TFKD 2DIBA 2WK2A 3DI3B 1A1NA 1Q9OA 1A9BA 3MROB 1VEPA 3GKZA 4N8PA 3VI3F 1EERB 3LS4L 4GS7C 1JI1A 3WFEL 4PJBF 5IMKB 4E5XA 3NZHH 3EOBA 3QT2A 4LEXH 4FQCL 5FB8A 2HFGH 3CCHB 4JHWH 4ZD3H 1KJ2L 1WC7A 2YC1B 5AG8A 3HE6C 4XXDA 4LCUA 5CCKL 5HHOA 5ID0A 3GO1L 3HC0B 5IHLB 1K8IA 1NBYB 1KG0B 4NDMA 3O4OB 2DIJA 1DBML 5EOTB 2BSED 1YJDC 3LSOB 5TE7L 1T0PB 1ZMYA 3OKMA 4LAQL 3SE8L 4HUUA 3RTQA 5C07A 2NY0D 4UB0H 1QOKA 1T89A 2FNBA 2PNDA 2JCCA 2DL2A 5GISH 4M6NH 1E4XI 5I6XC 3ZYJA 5L9DL 5F7UA 1PLGL 1XCQB 4DCQA 4YHOL 5A2IH 1LO3L 1A7OL 2XQYK 4JAMA 1KC5H 4XVJL 3PV6B 4XPHL 1MCNA 4PJXB 4W70A 5D7IA 4YGVB 4FZEL 5AD0A 1M71A 1YNTB 5DD5H 3BI9X 5DJ8B 2ZKHL 5KSBA 1MLCA 3U2SA 1RZIB 4NQCE 2XA8H 3BXNA 1JFQH 5BRZD 5I73B 3CXHK 3KPLA 3UTSB 3OL2A 3TT3H 3W9EA 3QUMA 4I5BB 5I18L 5MI0C 2VLJD 5HHPB 3NGBB 1F00I 3V52H 4HJ0D 3EYUH 4XPGL 1EEUA 1XF5A 3WUWB 2DKMA 5I1HH 1J87A 1IAIM 2VAJA 2VISB 2AV7B 1QRND 3RNKB 4EQ2A 3OAUH 2XN9B 4HC1A 5H94B 1ZGLB 1F3DH 4DN3H 2RBLA 5CBEA 4KDTA 5IQ7H 3BP6A 4JZJA 1T7XA 4H88H 1LE9B 1UZ8A 2JF1A 4L4VB 1K5NA 4K3JL 3PWJB 4PGCB 1MRDH 3KPRA 4ZYKA 3ARYA 5GGVY 3OQ3B 1CICC 1NAMA 3FFCD 1RHHB 2BY1A 5IW1A 5JDSA 2R56L 4Y5XC 3W0WE 4M4PA 5K9QG 1NC4A 4NC2B 4D9QE 4ZO9A 1YQVH 4RGNE 3ECBA 3DMMB 2NY3C 4BH8A 4S0SD 2AXGA 4X6CB 4F2MB 1JRHI 3VXSD 5B3JE 3KPSA 1AQKH 5LGHH 4S1QL 3C2AH 2DDQL 4XVSL 5DS8B 3U4EA 1N64L 4LBEB 3VU2A 1MCBA 4WI3A 4OI8A 5CD3A 5DT1H 3OR6B 5F6HI 1MIEH 4JGMA 4XXCA 1DE4B 2ADJB 1A6WH 3TN0A 4XH2A 4R97B 1LDPL 3QCUH 3ROOB 3S97C 1ED3A 4MHHG 4U6XA 3V4VL 2C7UB 4XNMB 2KH2B 2XKNA 4JRXA 2BNRA 1RURH 1UWXH 2GJ6A 5DA0B 4PLOB 1Q9WA 5IW3A 4BQBA 5CSBA 2GT9B 4K7FA 2V2TA 3K46A 3TJHD 4PP2B 4HLZH 2R69H 5EO1B 2VE6A 3WNMA 2EIZB 1WAAE 5JHDD 2C3VA 2PR4L 4Y4KA 1A6AA 1HH6A 1MLBA 1PG7X 4WO4A 5E5MA 4Q6IC 1AGEB 2W91A 4XWOC 5DI8B 5FK9B 2V7HB 2EXWC 1FLTX 2VDKL 4ZFZA 1PZUB 2PTTB 3WXWH 3BH9B 3QEQE 4MQ7A 2ZCKL 4NO3B 2EIEA 2OTUB 4XMKH 4EN3C 3FQUA 4KAQH 3QDJB 3U9PL 2R1YA 1NMBH 3DSNA 3FQRA 3ES6B 4WO4C 2E7LC 5GHWL 1UM6L 1JHTA 2DTSA 4UQ3B 2HG5B 4FABH 3BKYL 3EGSA 3RVXC 3GSQB 1NKOA 3QDMA 2X41A 2R0ZH 3L7EB 2ADIA 1T1WB 4BH7B 1D3CA 3C6SA 1UVQA 5LJYH 3OB8A 2PYEB 4CMMA 5EORL 3EDDA 4QYOA 1RIHH 4UU9A 3TYFA 3QUYB 1UADC 1OARH 3U7WL 5I0DA 2D7TL 2ZWLT 4LLQB 3T0EA 5EU3A 3T8XB 3BN3B 4FZ8L 1W0WB 1OW0C 2UYLB 4ZFFB 4Z6AT 1QA9B 2CLRA 5D7LD 3SY0A 4GRLB 5I1DA 4ZUTA 1K9TA 1UJ3C 3ORJA 3BP7B 4W4OA 4Z95L 4Q74A 5KSVA 1JGEA 5ESVA 1PKQB 2BVPB 5TDPB 3OZ9H 2DM3A 3EDEA 4ZNEA 3GIVA 1FIGH 2ZPKH 1S5HB 3ARDB 4BJLA 4F7CA 1D5IL 4PJ8D 1FORL 1FV1B 1NSNL 2HVKB 4C55A 3TJEH 3MV7A 3I6LD 4JVWA 1A7NH 3MRDB 3D25B 5KOVC 5ESAA 2AEPL 4OM0H 1BF2A 4QXGH 5C0AD 1SMAA 3T2OA 1CZ8L 3O9WD 3V6OC 5DR5L 1JNNH 5ACLA 1MCHA 3LMJH 1CL7L 1TNNA 3GNMH 3CK0H 4UNTA 2F54E 2IANE 3K2MC 1QRKA 1I3RA 1DDHA 2IWGA 3Q1SH 4G8IB 2AJXL 3MLTB 4D9RD 1HSBA 4KTYA 4DUVA 1QSEE 1BFOA 2APTA 3W39B 5BV7C 4KHXH 2A6KB 1GPOL 4FMFA 2XWBB 4ONHA 2NPLX 2NCMA 3OKOA 3QI9C 3SDAC 4G9FB 3Q3GB 2DN7A 3P9MB 3RY6C 4IIQB 3BE1H 4WI7A 2ARJA 3TCLA 4AQOA 3BZ4A 3LRSB 4M6MH 4OFKA 5IVZB 5HI4D 5ID1B 4Z7VB 1BOYA 4I48B 4Z7QF 1IEBB 1S7XA 3NABH 4QXTB 2VDNL 4XPTH 3WJJA 3OKLA 5T1LA 1RZ8B 1L7TL 4PRBA 3OKNA 3F58L 1ZLWH 5JA9A 3SDCC 3QPXL 1J05B 3MV9D 4HJGA 5DMYA 1BX2A 1IGTA 2DLIA 4C54A 3TVMC 1T1XB 3JUYA 4YHLL 4KK6D 1LO0L 3I50L 4LPXA 5ICXA 4I3SH 1NC2A 2H6PA 1JK8B 4Y19D 3TYGL 3O2DL 1RQ5A 3GB7A 3LH2H 1AXTH 3QZWB 1LE5A 1FZKB 1T0NA 2KPNA 4OFPA 1DVFB 4K55A 4L3CA 4NFBA 5H8DA 1Z2KA 5B38B 3WHE0 5IR1A 1FNAA 3UO1H 3QUKA 3T0DA 3LHPH 1T2XA 2XOTA 4MD4B 4M1GH 5D5MA 4P3DA 1WTGT 2CMRH 4IRJA 3VXNA 5MEOA 2CO6B 3V6BR 2R8SH 2VUOA 1AH1A 1PFCA 3LV3A 4FMKA 3S37H 1CFSB 4WFEE 3KDMB 2Z8SA 3P4OB 4Y5VA 4C4KO 4KJWC 5CUSL 3MRIA 3HR5B 3IDJA 5SV3A 1TVDA 3CFDB 3MOBL 3NCBB 3MLVH 3D69B 5KOMC 3QIUB 2VO5A 4JPVH 4NWTL 4NFDA 3MXVH 2XWJA 1I8KA 1VFUA 4LOUC 2L0DA 5F44A 1Q0XH 4L5FL 4X7SH 1G6RA 1VCAA 3WLBB 4HXBH 2ZUQB 2E7CA 5ALCL 3QQ4A 5KJRH 1FNHA 3LIZH 4H1LA 3V4PH 1VGEH 1Y6MR 1YPZB 4U1MA 3HAEG 2HP4A 5JZ7D 1E27A 4OKVA 4Y5YB 1MHEA 4MA3B 3P0VL 1OM3H 4KKBC 1KLGA 2X4TB 3FQNB 1EO8L 2DMBA 3MCKB 4QRRA 4M93C 4GKZA 5F8RC 2RCSH 1FL5A 4Z7WB 4X83A 4UINH 1DUZB 4IEFB 1CFQB 4DZ8A 1BQHA 4GG6E 4O02H 2JKXA 5GJTL 4MWFB 1JGUH 3BD5A 1A4KA 2GY7B 1X5LA 1T20B 3MTRA 3E1F1 3RL2B 2QL1A 3MRMA 3HMWL 4K07A 4FTVA 4NZDA 3RDTC 5CJBA 2ED7A 4OV5A 2IAMB 1F11B 3O11A 4P2RE 3RVVD 5IB5B 2X7LA 1P6AB 4JFOB 1NCCL 2VL5B 2ZUVA 1JN6A 4ZS7L 5GJSH 1NCWH 1S7VA 4V1DD 5T33H 5CGYC 2E27H 2R2HA 4H5SB 4GUPA 5E99H 3VWKA 5FKPB 1JRHL 2Y06H 3RWHA 3E6FA 4PJ7A 1N59A 3JWNC 4LHUD 4PJAE 1B4RA 4LSQH 3RFZC 1VDGA 3VFRB 2FGZA 3PL6A 2X4UA 5MERB 4ZFOB 2CKBA 1CGWA 1KCRL 1LD9A 4W6XB 3QUZB 2DJSA 1HZHH 1AE6L 2A6IA 2R23B 4GO6B 5EBGA 4XCFL 3MCG1 2OSLA 4ZS6D 2VDRH 4CDGC 2J8UB 3IXAB 3TPUB 4ZOBA 1RHFA 4FFZH 3ELAT 2NTSP 4I1NB 1AP2A 3RZCD 2GKIA 4BSWB 1N8ZA 2RR3A 3IS0X 5I75B 3DX8A 2VITB 1P4BL 4MXWH 3OJ2C 3DUSA 5I19H 3RI5F 2WIIB 5DGQA 2B4CL 4HKBA 1INDH 5EWIL 4HHAA 3VW3H 3U4AA 2PXYD 2A1WH 3GZKA 4A2MA 1N0LA 4XPBL 5I1KH 3ZE2F 4YZFF 5B22A 1NCUA 2X89D 1X5AA 4UNUA 3IVKA 1I1AD 1IM9A 4FQXC 1A1NB 3L3HB 3T0VA 4P5TC 4QRSA 3QCTL 1YA5A 3RJQB 1NFDA 1FPTL 4PTTA 4GBXC 2CD0A 4G8GB 3KYMA 4YDIH 5ANME 4G3YL 1YN7B 2PTUA 4Z8FL 4Q97A 1I4FB 2HRLA 3LN5B 5JHLL 5FB8B 2O5XH 2Z31B 2G75A 1OAUH 4NQEE 1I3GL 1UG9A 3VXPA 4P23A 3P77A 4FQHA 2QSCH 3NCYS 1IAII 3T08A 1LEGA 2HT3C 4LCUB 2EECA 1KEMH 4NQCA 1OF2A 5SWSD 2PW2B 1IT9H 2P8PA 4HCRH 2VABB 1CDUA 4RISL 3SDXE 4YJZL 3DNKA 1I9RL 4R4FH 3G08B 4EIGB 2X6MA 5K9KB 3OKMB 5DHYB 3L3IA 3QEHB 3X12A 4U1NA 2JCCB 5F7NC 1FN4A 2BXZA 3C8KA 3HS0B 2XPGB 3DX9B 3PUCA 1A5FH 4HX1A 2ADGA 1FO0L 3BDXA 1AGBA 3SGDI 2J12B 4XP5H 1FNFA 5D7JD 2DBJA 3WV0A 3O4OC 3WNNA 4HH9A 4E41D 5KBNC 3L7FB 1R5WB 1MFDL 1IC4L 3BGMB 2BNQB 4G42A 2VC2H 3CIQA 4L3ED 2P48B 4EJ1C 5ETUB 1TPXB 2VDOH 4NSKB 1NCAL 4LGSB 5IB3B 5JIHA 3W0WA 4U05A 5LBSH 4OZIF 2APBA 2YUWA 4R90H 3RIFK 2V9TA 4JFDD 1CYGA 4HKZB 1RUQH 3QUMB 3QPQC 4JN1H 2QADB 4WI6A 2ED8A 4PG9A 5CZVL 3B8SA 1S7QA 2UZXB 3T3PF 1XF5B 3UTZB 4ZUVB 1EXUB 4RIRA 2EEBA 5EBWB 4EOWL 4FRWA 2J5LB 4X8XA 2D0FA 5HVGB 4Z5RA 3NIFF 4D9LL 4TULH 3CFJB 4PGBB 1BVLA 4DEPB 1JF1A 5EC1A 5BO1L 5I73C 2P5WE 4NNXB 3I02A 1RIUL 2DLFL 5HD8C 4RBPH 3CZFA 3NGBC 3U0WH 2EYTA 4M61A 4PJEF 5E08L 4YDJA 3MMEA 3KPRB 2B20A 3G5XA 5SX5K 5T1KA 1XGRA 3WO4C 1U2CA 5F88B 5C0CE 4LCWB 4JPWH 3SCMA 1HXYB 3GIZL 3KLAA 4LMQE 5EBLB 2JJTA 3PHQB 1ZGLP 3ECBB 1PY9A 2NNAB 5I8KH 4LVHB 4EKXA 4ZUUB 4K7PH 3DYMA 1FL6B 2HTLC 3MRHB 4PB9H 3KPSB 3IU4L 4U3CA 1OWRM 5KANG 1IGIH 4FQIL 3M45A 4XP6H 1UACH 1UWEH 3BP4A 4FQ2H 3PIQA 4MCYA 5E8EB 2F53B 4YBHA 3QEQA 3D39D 4I77L 3MRNA 3L5XH 5EPMB 2Q7YB 3DXAE 1WBZB 3H3BC 3O8XA 3MOAH 3DMMC 4LLWA 4ALAL 1NLBH 3RHWK 5F7DB 3PWPD 4IRSD 3X11B 5EIQA 3VXQA 2AQ3A 5L2KD 3SPVA 4PJBB 2Z4QA 1CD0A 3EZJB 3MLUH 5IB1B 4Y2OA 4U6XB 2D31B 1T2QH 2XKNB 3CDCA 4MJIE 3CFKA 2FATH 5AZEL 2KUTA 3MSPA 4NQXB 3UYPA 4YX2H 1UWGL 4KVCL 3QDGD 1BD2D 1V5JA 1II4E 1FVCB 2XI9A 5CFHA 3QIBD 3VCLA 1JCKA 3C60A 4POUB 4YHZH 1YN6B 5KVDH 3BJ91 4Y4KB 4X7FC 1MLBB 5BZDA 4Q2ZB 4R97C 4BK4A 1MQKL 1T7ZA 4MD5B 1B90A 4MXQD 3CPLB 5I66A 3U36A 3B9EA 1PG7L 1FJ1B 2HWZL 1C5BH 3L3JA 1XFPA 3CNKA 3CDFA 4MXVE 5CJQH 3V5DA 1INQB 4PRHA 4F3FA 3ARUA 2X4PA 1QO3A 3FN3A 4UOW0 3WXVL 3OBAA 1HXMB 3UYRL 2FH6A 3MRBA 4UTAL 1RJLA 3NCEB 4XNQA 1IGFH 3QDMB 1DBAH 1KACB 3BO8A 4DOHB 3VI3E 2ZSVB 3TO4D 3STZA 5DJCB 5INDB 2OK0L 3C6SB 1NEZA 3CVHB 3DV6A 5HY9A 4WWKA 1HHHA 2HKHL 2FHCA 1JNHB 5EFIA 4ZPVB 3OF6A 4M4RA 3HC4H 5TFSL 3EJYC 4NOBA 4FQJH 2FWOA 5GGUA 3GI9H 4Y4HD 3N1GC 5FCUH 2V7NA 1ZGLM 3JBG7 3IDMA 1K8DB 4XRCB 3H7BA 1QZ1A 1CT8A 3WEXA 1X5ZA 3BH8A 3GKWH 1S7WA 1SEQL 5HVFB 3MZTA 5GXBB 3H42H 2W9DL 2BERA 4HS6A 5ICZA 1FGNH 1E6OL 3SDDA 2P44B 3ZZ1A 4HIIB 1KF9B 4LLUB 5IMLB 3BESR 3OX8B 3U0PB 4GRLC 5I2IB 5C0BE 4F7MB 3BUYA 4YO0B 1I7ZB 1FRGH 1YMHB 4YDKL 3SDDC 4AY0A 4UQ2A 4HKJA 4W6YB 1TETH 2OM5A 4AEEA 2VN7A 3IJHB 5F7MC 3LY6A 2O5YL 3UMTA 5CAYB 1BFOB 2CUMA 4O51A 2GEEA 2HN7B 4P9HL 2YK1L 4JY6A 3C6LD 5KSUA 2YPKA 1RUAL 1JPST 4G80A 1KEGL 4M3JA 3F12B 2ARJB 3OGCA 3ZT5A 2NW2A 2C3XA 5ADOL 3T2NH 4FN0A 5E9DE 1QFWM 3ROLB 1G7JA 3CDGB 3W11D 4Q0XL 1YNKL 3OKLB 5TDNB 3AY4A 2ZCHL 1S8DB 2XT1B 3MYZA 2CSPA 5GSRA 3BEWA 1UFUA 1BX2B 3T0AA 5C9KA 2ZSWA 1J5OH 1C5CH 4IOSD 4TPRL 4OTXL 1I8IB 1FDLH 2PO6A 4APQB 1KCSH 3BAEL 3HAEH 5IEHA 1AR2A 3NCYP 4BFBD 1MCFA 1KB9K 1JJUA 4BELD 5DC9B 5D1ZD 1Y18A 1WBXB 3SGKC 5E2UH 3WFHA 3LOWA 4KUZH 1BQLH 5D72H 1AFVH 4JFZH 5DUMH 4URTB 2DKSA 7CGTA 1QSZA 4RA0C 3FT3B 5EU6E 5FAAA 1EDQA 5KS9B 3DSFL 2NYYC 2XZAL 1YUHB 3HMXH 3IDGA 1UWXK 4OCSL 4AT6B 3ZTJG 1ORQB 1U95A 1KLUB 1A64A 3KPNB 2WW8A 4HUNB 2ZNXA 4NM4H 1DVFC 4NO2B 3DUUA 4Y16C 1MFCH 2YPVH 3ARTA 3GSXA 1D5MB 4X9GA 4QHLA 4JQXA 2NLJA 5IHUH 2B7DT 1CDCA 2VDML 4OCYH 2MOVA 1ZHKB 4I3RH 3UDWC 2EH8L 4PTUB 4GG6A 2XWJB 5MEQA 1JGLL 1V7MH 2N7AA 1NBVH 4DUXA 1DBKH 1MI5D 4RFEB 3JWOH 2Z35A 3QFDA 4N5EC 5FGCE 5T1MA 3RVUD 5LKNA 3DJ9A 4AH2B 4DKEH 3GSWB 3QQ4B 3MV8E 1ZLVK 3C8HA 4P2RA 4UT7H 3MRRA 2IEPA 3MODH 1YEGH 1IBGL 3IFLH 4U1KA 2X1QA 3P9LB 2RFXB 3LKRA 4M62H 1GGBH 4MNQA 3MFGB 4WTZA 3QIUC 5IM7A 4F7EA 1E27B 1MQ8A 3HI5H 3BSZH 1AHWA 2EDHA 2FIKA 1KNOA 4P9MH 1YMMD 3D2UB 4MS8C 4XMLH 1ZT4A 3KXFE 4TSCL 2I24N 4JFHE 5F96L 2W0LA 3TPKA 3BP5B 1YJDL 1AHWC 1UCBH 4JDTL 1P4LA 4U3HA 4Y5YC 1NL0H 2XZCH 5JW3H 3O41B 1CU4H 1B6DA 4OLXH 4J1UA 1LEKA 3L3KB 3RJDA 4OV5B 2F8OA 4WHCA 3FB5A 2EZ0D 2VDPL 2V5TA 4NQUA 3EFDL 1F6AA 2O61A 1CTNA 1HOCA 3MLXH 2FL5B 1TTFA