The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
107
|
structure length |
107
|
Chain Sequence |
GSSGSSGARFTEGLRNEEAMEGATATLQCELSKAAPVEWRKGLEALRDGDKYSLRQDGAVCELQIHGLAMADNGVYSCVCGQERTSATLTVRALPARFIEDSGPSSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of the 15th Ig-like domain of human KIAA1556 protein
rcsb |
| molecule tags |
Contractile protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
KIAA1556 protein
|
| total genus |
13
|
| structure length |
107
|
| sequence length |
107
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2006-04-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07679 | I-set | Immunoglobulin I-set domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
