8PAZA

Oxidized native pseudoazurin from a. faecalis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 8pazA00
3TBBA 5F7BA 5B7MA 3TA4D 3AG2B 1J9RA 2QPEB 1OE3A 2N0MA 2BZCA 3PCYA 4A66A 2J57A 2FTAA 5B1JA 4DP4X 4JKNA 1TEGA 1ZIAA 2VW6A 3QJTB 1NIDA 2YAHA 3IBOA 1GS6X 2IDQA 4KO7A 1GR7A 1PY0A 1BQRA 4FAAB 2P80D 1BAWA 1SFDA 2HRHA 4KNUA 1PAZA 5I6MA 2PCFA 2MRYA 3FSAA 3FU7A 3FSZA 3JTBA 4DP7X 2GBAA 3H4FA 1FFTB 1KDIA 2CUAA 1V54B 1A65A 1RZPA 4AZUA 3EHBB 2YAQA 2I7SA 3AG1B 2PPAA 1JXDA 1DYZA 2MTAA 2UXVA 3N2JA 3ERXA 2LLNA 3T6ZA 3S8GB 2JFCA 1TU2A 1CURA 1PLAA 2BW4A 1CYWA 3DIVA 4YVNA 4BWUA 1KV7A 2AVFA 1JOIA 3S3BB 3TASA 2P80A 4DP1X 1AZNA 4UF7C 3SBQA 3GXUB 3MX0B 2BW5A 2XUWA 9PCYA 4K9JA 1V55B 2GHZA 1E5ZA 4HALA 4YSQA 1NIFA 2HX9A 1A3ZA 1ID2A 3X2QB 1OCCB 1SJMA 2FQEA 2PP9A 2VN3A 3FT0A 4YSSA 3S3CB 2J5WA 1NZRA 1ILUA 2GIMA 1NWOA 3NYKA 4HZ1A 2CALA 2WO2B 1T5KA 1YLBB 3S3DB 1IBYA 3FYEB 1FA4A 1BQ5A 1AIZA 2IDFA 3T71A 4P5RA 1WA1X 3WI9A 2UXFA 1I53A 1WA2X 4N4YB 5I6PA 3FU8A 1KDJA 1E65A 1F56A 1GS8A 4NB7A 2BP0B 1B3IA 2B3IA 1GY1A 1L9SA 1ADWA 3U25A 4DP5X 3T6XA 2FT6A 2PPEA 3ZBMA 1ET8A 2TSAA 1N70A 3QJQB 4BXSV 2IWEA 4E9XA 5I5IA 2UX6A 1WS7A 5I26A 3X1GA 4YSAA 3ABMB 2EIJB 3HB3B 5TK2A 4YSOA 1NPJA 2BP8B 3X1NA 2OJ1A 3OQRA 1MG3C 1NINA 3UAEA 1HAWA 3CVBA 4BXVA 3QJRB 1PLBA 1SHXA 5LDUA 2FT7A 4W1TA 2HRGA 2BO0A 3T9WA 1AG6A 1QHQA 3WIAA 1SDDB 2IDSA 3T6VA 1XMEB 1UATA 4WTQA 3V9CA 4BDVA 3HEIB 4L0PB 2PPCA 2XVBA 5I6NA 1URIA 1JZFA 1PZCA 3QJVB 5D4JA 5PCYA 1AOZA 3TU6A 1L9PA 1IBZA 2CAKA 2VSMB 1GW0A 1BXUA 3GYRA 2JXMA 1ILSA 2XXGA 4E9VA 1J5DA 2BHFA 2CJ3A 2EINB 3MBWB 4F2FA 3DTUB 3AZUA 4AKPA 2DV6A 2XLLA 1NIAA 2PLTA 4G7SB 4HCIA 4A2FA 4DP2X 1L9TA 1R1CA 1PNCA 2XU9A 2FNWA 1BYPA 1CYXA 3NJHA 2HX8A 5AKRA 3FSWA 2VMJA 4YSPA 2R7EA 4HCFA 2NRDA 1W6LA 4KOCA 1AZBA 7PCYA 2FWLB 4M4RB 3ABKB 3BQVA 1BXVA 3ZDWA 4G72B 6PCYA 3NP3A 2VW7A 4HHGA 1OV8A 2VM3A 2Y69B 4JHUA 1KBVA 2PP7A 2XV0A 3OMAB 1JZGA 1VLXA 3X1BA 2X87A 4YSDA 4FA7B 5AFAA 1W8EA 1ET5A 1XB6A 3NJFA 1KYAA 6PAZA 2JKWA 4UANA 4X4KA 3IN2A 3V9EA 1WA0X 2IWFA 5I28A 2YAMA 1A4AA 1ET7A 2PPDA 3EH5B 4E9SA 3ABGA 3CDZA 2OCCB 2VW4A 3BVDB 4F7KA 1AS8A 3QPKA 1KCWA 3T6WA 2PP8A 1JZIA 3QQXA 3AW5A 2H3XC 2ZXWB 1IKOP 3CZUB 4DP0X 3KW8A 2QDVA 3FU7B 1M57B 1A4CA 1SHWA 7PAZA 3DKHA 5I5JA 3JT2A 1CUOA 1GYCA 1OOWA 1AR1B 1WAEA 2FQDA 2DYRB 3QJUB 4DP8X 2FT8A 4A2DA 3FQ1A 4QKTA 2BWDA 3NP4A 2FJSA 1OCOB 4E9YA 3FSVA 2YQBA 3KW7A 1N68A 2QT6A 2FQFA 4A67A 1NIEA 2XV3A 4BWTA 2CBPA 2GI0A 3FQ2A 4YSUA 4W9ZA 1RCYA 5D4IA 1PZBA 2EIKB 2YARA 2WO3B 3NJMA 4KOBA 5B7FA 1AACA 1TKWA 2QDWA 4YSEA 3OM3B 1NDTA 4RH4A 2I85A 1BXAA 2DWSA 2YAPA 4AKQA 4ENZA 3QJSB 2BWIA 2VSKB 4KO5A 3UGEA 3NJIA 1V10A 4KNTA 1AS7A 2A3TA 5EHFA 2HX7A 1SFHA 3CG8A 2IDUA 2YAOA 5ANHA 3FPYA 1CC3A 1PCSA 3S8FB 1NPNA 2DWTA 2H5UA 2Q5BA 3ASOB 4Q8BA 1J5CA 1JZHA 1ZV2A 4GP5B 4CSZA 3AG4B 5A7EA 3NT0A 1PF3A 1A8ZA 2XV2A 4BWWA 3RYMA 2GB2A 3SBPA 2BZ7A 3NSYA 2B08A 1EZLA 4HAKA 2I7OA 3PAVA 4E9WA 3NJJA 1BYOA 3PAUA 4DPCX 3PXLA 2UXGA 2GC7C 4A68A 1JVLA 1IC0A 3NSDA 4NERA 3OD3A 1NICA 1ASPA 5B1AB 2YXVA 1AS6A 3EF4A 5I6OA 1L9OA 2QPDB 3D12B 4E9TA 4M3HA 1ZDSA 3EH4B 3C75A 4F2EA 1SNRA 2OV0A 1AZRA 1DZ0A 2W88A 1BEXA 4GP4B 1NWPA 2IH9A 4HCGA 3X1FA 5IY5B 2AANA 2Q9OA 3CVDA 4BDVB 1XB3A 3ZX1A 1M9WA 1M56B 3NJNA 3IE9A 3WNJA 1JXFA 1X9RA 2XYBA 3ZIYA 4YSCA 5I6LA 3UADA 5B7EA 1QNIA 2AFNA 1KBWA 1E30A 1GS7A 3AY2A 2DYSB 1IUZA 1XB8A 4G7QB 1OE1A 1E67A 1MZZA 4DPBX 3PAZA 3N55A 4BK5C 1A4BA 2XX1A 3FS9A 3SQRA 1KCBA 1J9QA 1KGYE 3PLYA 2IWKA 3AG3B 8PAZA 2HLEB 4AX3A 2BP0A 2XXFA 5B1BB 1E5YA 4GXFA 3GDCA 4PAZA 3OMNB 4HHWA 1L9QA 2PPFA 1PNDA 4KO6A 3UACA 1GSKA 4KO9A 3NJGA 1PZAA 3TBCA 1NTDA 2UX7A 1SF3A 1RKRA 2EILB 2IAAC 4A2GA 4YL4A 2XX0A 2R7EB 3FU9A 1AQ8A 1J9SA 2VM4A 2XWZA 2BP8A 3EH3B 4DP9X 4E9QA 3WG7B 2GSMB 1RZQA 4CSPA 3WNIA 2RACA 4G70B 3NSCA 1AAJA 5TK4A 4YSRA 1EHKB 2E86A 2UXTA 1AG0A 1J9TA 4G71B 2HZHA 3FPXA 1SDDA 4GP8B 4A2EA 3UAAA 3CVCA 3WKPA 1ASOA 1OCRB 2TSBA 3NJKA 1ETJA 4Q89A 3SBRA 4DPAX 1JZEA 1HFUA 3NJLA 2EIMB 1ASQA 4MFHA 3ASNB 1MDAA 1QLEB 3H56A 3CDZB 5AZUA 5B1JC 2CCWA 2AZAA 2YAEA 1ZIBA 4EF3A 1OE2A 5E9NA 3FYIB 1OCZB 1TEFA 4P5SA 5D4HA 5F7AA 4KNSA 1GY2A 1NIBA 2WSDA 4AI7A 4NAJA 4ZK8A 1PMYA 2HXAA 3WKQA 3G5WA 1HAUA 1FWXA 1WS8A 2FQGA 4GYBA 1OF0A 2AZUA 4TXVB 1JXGA 1JVOA 5B3SB 3IEAA 4YVUA 3L45A 1ZPUA 1AZCA 1SF5A 3IN0A 4UAHA 2IDTA 1W6WA 1MG2C 4A2HA 1AANA 2GC4C 3UABA 1JZJA 4HIPA 4PCYA 2W8CA 2Y1AA 5B1KA 1MZYA 4DP6X 2J56A 1BQKA 4QLWA 1AZUA 4G7RB 2H47C 3PPSA 4JHVA 2X88A 4GY4A 2IH8A 2J55A 4YSTA 4AKOA 2ZWNA 3NSFA 5I6KA 4WKXA 1X9UA 4E9RA 1L9RA 3ABLB 3OMIB 5PAZA 1JERA 3X1EA 3FQYA 2DY2A 3H4HA 5I5MA 2ZOOA 5FC9A 2PCYA 1ZDQA 2YXWA 1PLCA 2ZONA 2YAFA 4N8UA
chains in the Genus database with same CATH superfamily
2ADJB 2CHDA 4Z7OE 3T4AC 3JWDL 3AG2B 1J05B 3D69B 5J57B 5FLVA 2WQUA 4ONOA 1J1XH 4IHOA 3ROOB 1F58H 1N3NB 3KCWA 3TJHC 4Y19A 1B2WL 1QRNA 1EWHA 4Q6IC 1KJ3H 1OKEA 4UDUA 3KVDD 3PG2A 2A7BA 2PXYA 1FDLH 4BCZA 1YEFH 3S2AA 3JBG7 1AGFA 1HIMH 1V05A 2ZOLB 3HC2A 2VR7A 2BSEA 4PJEB 1F4XL 3L7EA 2NMSA 3DA0A 3FONB 4IRJC 2X4RA 4PGDA 4IU3A 3CVHH 5IGXH 4KPHH 4S1QH 1TQBC 4HJJH 3R7QA 1ZJAA 2YAQA 1RJLB 2N7BA 2WM0A 2WUBH 3QJFB 5CN2A 4AYBA 5EEZA 2EE0A 5K9KB 2X3AA 5AOLA 4Y5VB 5E6ZA 3IVKB 1RUPL 2NUTB 5ISZD 1MNNA 3CFEB 3NDYE 4M29A 4PJHE 2XA8L 4YX2L 1G0YR 2OX5A 3NQIA 4L8BB 1EEYA 3SBQA 1L5GA 2WK2A 4MNHA 1U3HC 1U33A 5SWZE 4CC1A 2GHZA 4LSTH 3TCTA 4CU7A 1H0DB 1H5BB 3VG9C 4XVJH 2YWZA 5HDQH 2Z31D 4Q7DA 1ITBB 2XTJE 2HPTA 4FQXC 4PJ7E 2VN3A 4KQ4H 5C6TH 4YSSA 2YD4A 1MCKA 4WFHD 3RWHA 4U6XA 1J8SA 3FYEB 2YRPA 3HG2A 4XVTL 5C08B 2IDFA 4LMQI 2FO1A 3ZGIA 2DKMA 1SUHA 1G43A 1JGEA 1UZGA 1E27A 2NX5B 4PB0H 5ADOL 5L88L 4F37F 4KAQH 1D5BB 4QYOB 1R3JA 5LNEA 2K8QA 1XR8B 3O81A 3NEEA 1MQKL 4H7VA 4JFPA 1B3IA 4YEEA 4A7QA 3V4UL 4OUUB 3WLWC 4PG2A 1X4YA 3QJQB 3VU1A 2WLLB 1KPRA 2PXYC 5D7LE 2OYPA 1AKJA 1Y07A 3EBIA 2IPKA 4QAWA 5TK2A 1L7IL 3UEQA 3LNEA 3MJGX 2V8MA 3K5RA 4QXUH 4ADGA 2Y23A 5H37A 6TAAA 3D7PA 1BBJB 2AQNA 2DQIL 2JSFA 4OZHF 3FFCB 1SBSH 2BJMH 2ITDA 1PTZA 1U8KA 2JV6A 3CVBA 5DEZA 4X99B 2E27H 3BWAA 5HHOE 4NRZA 1BVZA 2CJUL 3I84A 5FFGA 4PJFA 4QI3A 2I60H 2YWYA 3MKKA 5JOPE 1IQDB 5KANG 3T6VA 3FBQA 4L9DA 3GMMA 4H8WH 3C5SB 5FA4A 1UATA 2FYYA 4Z0XA 4Y4FD 5JPNB 1OY3B 4GSRA 5GJSL 4Y5YB 4KRPC 5J89A 4JJ5A 5DHXB 4JANA 3PE9A 1XGRB 4A7TA 1I8AA 5DQ9A 2WXFA 2BVOA 3CUPB 4XVUC 4NN5B 5E4EC 1VZGA 1SN5A 4P46D 4F2MB 1J10A 4IK7A 3QQDA 4GW5A 3CD4A 1WFMA 3V8OA 3DV4B 3RUGA 4MDJB 5MEPB 4L37B 3GIZH 3MBWB 4BHUI 2H3NB 2NY3B 1ADQH 1Q1JL 3F5WA 3CN2A 2V2TA 3VXRB 2APVA 5T1LA 2HT3D 4JDVA 4KKLC 2HT2D 4PRDA 1Y0LA 2WJ5A 3DGCR 5C9JB 3EOAA 5EZOH 3DBXB 3ARZA 1F00I 3DRTA 1X5ZA 3LZFL 3WJJA 1PNCA 2CDEB 4XO4A 1M6OB 4A6YH 2Z3FA 2FX8L 5L9DL 1ZHNA 3NJHA 4KXZI 1KN4L 1ZT4B 4FLRA 4ODXA 1MCDA 2WLZA 5DHVH 3OKEA 2COQA 1UQSB 5FYLL 3BYYA 1W6LA 5FO7B 2NZ9C 4PG2C 4PS3A 5D7IA 1RD6A 4KK8D 4CC0A 1T2JA 4LVEA 3ZVVA 4KTEH 1C7TA 1CWVA 3BXNB 5KJRL 3CDGA 4HX1A 2VO5A 4RGNC 3L3OA 3V55A 1Z5LA 3MGAA 3L9BA 4X7EC 5JIHA 2UZYB 3KYKH 1T7ZA 2X87A 4OLWL 4MMZC 2OJEB 4JHBA 1TVHB 3GRBA 3D07A 5E0QA 1MLCB 2O5NA 4NO2B 4OZIB 3LKPA 3T08A 3BO8B 1FN4B 3RKPA 1XMWA 4MKMA 4WUUD 2YS4A 4APQD 3FTZA 5I73B 3MLVH 3EYVA 2R9HD 3MV7A 2M26A 1CGYA 3PS6A 2W65A 4IBYA 3VTMA 1AS8A 5C2BL 4R8WL 5AAWC 2WQWA 3TV3L 3ZE1B 2PP8A 4MA1C 5IT2L 2O6PA 4D3CH 3K2IA 5EF2A 4UNIA 4KMTL 4OLUL 4HUVB 5HTSA 4LEEA 1T1ZB 2WBJA 4YHYC 4AQEB 3OG6B 2BFVL 4EIUA 4BFNA 4XZUB 5MEQB 2ZQKA 4JR9H 3GTTA 2K78A 2VLKA 1M53A 3TFKC 3M88A 3SKMA 1BVLA 3D39B 1O7DE 1ACYH 3FN3A 3LEVL 3P2TA 5CP7A 3QEQB 1K5WA 3W38A 3ZKQD 2R83A 3LX9A 1BD2D 3QQ4B 1DFBH 1Y6MR 2FJSA 3VMNA 3AY4A 2NY7L 1XXDC 5ICYB 3L3IB 4WWOA 1N68A 1G1KA 2FQFA 2JB6B 3F85A 1E40A 4QYAA 2G4EA 3WJJC 4Z0BH 3ZHKA 4BWTA 1B4JL 2ZUUA 3F62A 4G82A 1J8HB 2ZAGA 1VFAA 4OGQC 2YR3A 1IC1A 1MVFA 2UWEE 4W9KC 1QFWL 3O6ML 1G1OA 4I1RA 3EDDA 2P7TA 5JO5A 1P4IL 2PYFB 3JWNC 3KDMB 2QEJA 2VERA 4J28A 1G7HB 1HCZA 1M6UA 3HI5L 1V10A 4KJWD 4JGMA 4WO4A 1MI5A 3L3OC 1FYTA 2RMNA 3MTRA 4K5LA 1BQUA 1PCSA 1PG7W 3L9YA 4N85A 4H2CA 5DMGC 3W9EA 1YQVL 1FL6A 1X5KA 3H55A 2ZUTA 1S5IH 2XPYA 4S2SA 1NDGA 1RZKH 5I6XC 3N04A 3QDGA 1NCJA 4PS8A 1AHKA 1N19A 1SHSA 2IQAA 3DYPA 4F33A 4LCYA 4PJDA 3MJWA 4WO0A 2ATPB 4CW1B 1AI1H 4FFWC 3W0WD 5FB8A 1CDIA 2GB2A 3HPLA 3SBPA 2CR0A 4K71C 4LE8A 1L3WA 2B08A 4HAKA 5DRXA 1MCWW 4N6RA 5KS9A 3PAVA 1O6SA 3RX7A 1BYOA 2CKBL 1WAPA 4JGJA 1RURH 4I9WD 4HC1A 4B96A 2GFBB 3AU1A 1RUQL 35C8H 2WBJC 5BS0B 4XO9A 3LOWA 5EU6D 3K7UA 5CJBA 1VKXA 1K4CB 5C3IA 4NO3B 1YN6B 3FT1A 1RZ7H 2RH0A 3IT8D 3PDOB 4ICXA 4H8HA 3TO2A 3ULUD 3FQTB 2GBUA 3OXSA 4TPRL 3UTTA 1AQDA 5I5RA 4L1SA 4RMQA 1AZRA 5A3IC 2A9NH 2HFFB 4U1JB 3WDIA 2ZYSA 4FXTA 1Z9SB 3QB7C 3NCYS 3U6XS 3N85L 2HAZA 3HNVH 1FO0H 1OB0A 3P73A 4UYPA 3DIDA 1KJMB 3MRJB 4YSCA 3ZT7A 4P9HL 1MVUA 5KBKA 4TUKL 3DHUA 1YYCA 1ORQB 1SEBA 4LSPL 4KQ3H 4KI5F 4TNVK 1UD4A 1S7UB 5DRWB 2BY2A 5I1CH 2CO3A 1EEZA 3HS0C 3PWPD 2WHVA 4NPJA 2E7MA 1X5AA 1MHCB 3OGCA 3RU8L 2WQRA 3AG3B 2CIIA 2F8VA 1CGVA 4M7ZB 5T5NG 4GAJH 2X6AA 3KE0A 4WO4C 4NUQA 3VWJA 2BCMA 3FO9B 3LRHA 1CQKA 4GBXA 5I1DA 5KVFE 1KYDA 4D94A 5KWYC 5D1ZC 4YDKL 2BSCA 4ZMVA 3MCKB 2VN4A 4NZRH 1DSFL 2JTDA 1SJHB 2UX7A 5DVMA 1CLZL 1EZUA 5MENB 1PX3A 2EDRA 1AR2A 3EIFA 3T0VA 1KIQA 4JDEB 2C3VB 3D2UA 4FN0A 4AEHH 1NCGA 1TIUA 4IBZA 4IK6A 1OP3H 5A16A 2OL3H 3OC5A 1A6TA 2GG1A 3FO0H 4JDZB 4QLRA 4KVCL 4DKTA 4EN2A 2QZQA 2R4RH 2WCPA 1G6RA 3I9GH 2XWBB 4L4TA 5DVNA 4EQ3A 3U7WL 1KCRH 4ETYA 1KV3A 4QTHA 2PABA 2LFEA 1A6WH 3QFJE 1IM9A 3ARBD 4NM4L 5T3XH 4PJCE 3UO8B 1KJ2A 5K69A 3MLZL 1MIEL 2NY4C 3MZTA 4ZFOB 3M1BA 1HOEA 2X89D 2F08A 4PW9A 5IOPA 1YMHA 4AMXA 2HLAB 1ETJA 3B6SB 3QWOB 5D7HA 3UBHA 1AHWB 2H0JA 2W9EH 5E8DH 3V4VA 2GJ6D 4PRPB 1M05A 5BZDA 5JW4N 1NGWB 3QAQA 3H56A 4KJYA 4J3BA 4AYEC 4JZNA 4ABVA 4ZSOA 5AOZA 4Z7UB 4IM8A 4OJDH 5JIDA 4OZGE 2PR4L 1LLAA 5EEWA 2WSDA 4LU5H 1D9KC 2C1PB 3EGSA 3SB3A 2NT0A 5FF6A 2EIBA 2C4FT 2FZ3A 5CZXC 1WWBX 1PZSA 3G04A 1EX0A 1OF0A 3BHBA 4QWWC 1WCQA 4E5XA 4G7YH 3KLAA 5CSBA 4C56E 4QR7A 3L45A 1XF2B 4U1MA 1M2VB 3BH8B 1DVTA 3MJ7A 4GMTH 1AANA 4P9MH 2Y6TE 4PRBB 2CA3A 2XFXB 1KGWA 1W8OA 2CLZA 1H3TA 3SPGA 1MZYA 1JWMA 2FX9H 3NIDE 4GBXC 4NJAH 4HUXA 3V52H 3Q3GA 4PV1C 3BUDA 2HN7A 3MXVH 4PRHB 3QG7L 5TF0A 4FLOA 4GAYB 4NP9A 4J3OG 2O61A 4PBWD 4AKOA 2E76C 2ZWYA 2GQHA 4HWZB 1UXMA 2Y2TA 4M61A 3QDJA 4E36A 2JTYA 3BEWA 4K3JH 2A4ZA 5EC2A 2VXTH 4YDLB 3FQNA 4FG0A 5AVQB 2OMZB 1QSVA 4JPVL 2PCYA 3LKRA 4JRYE 1A1MA 4XC1L 4I0PA 2EKSB 1IEHA 2HPOA 4POYA 3RHWF 1UOKA 1OE3A 2CXGA 2X4PA 4PWHA 1A25A 2X4SB 5JHLH 2YQGA 2DQJL 4PS7A 5I1IL 2AV7A 1V7NL 5HYIA 2ZCLH 4GFXA 1I9JH 4E42A 1DQQB 4YQXH 4RETB 2V7NA 4KZEH 1C5BL 2FIRT 2VLMD 1JS4A 3FB5A 5JPMA 2X53A 1MIMH 2R2BB 4FQPA 1A22B 3BN9C 1MXGA 2DQFB 2WOBA 4JFXA 4ZO9A 5DK2B 2A6DB 1EERB 2NUPB 2JXMB 4P4KD 4UILH 3JTBA 1M7DB 4X5QA 4D9RD 3ILPB 1DVFA 2CUAA 3OXRA 3GF8A 4G1EB 3QNZB 4XPGH 1YA5A 2B4CL 1NCHA 3ARQA 3BPOB 4FQ2L 2XBTA 2AF2A 2NSXA 2WUCH 4YDVB 2UXVA 4P23B 4A6YA 4HWBH 5HI4C 4KJQC 5L8LB 1TU2A 5GRVL 5HPOA 4A2LA 1PLAA 2BW4A 5DHVA 5CCJA 1AJ7H 3F7LA 4UB0H 3ISYA 3S4SA 4Z7WF 1EGJH 5KW9H 3TZVD 1AO7B 2A99A 3VJ6A 4P49A 4JRXA 1XXFC 1MCWM 2GPZA 1VJSA 5DEFB 2AHIA 1NCOA 5FYKD 4XPAL 5DQJB 3X3GL 4OQTA 5AYTA 3N44F 2GIMA 4WJ5B 2VITB 3NYKA 2A9AA 2ITCA 2WO2B 3GSQB 4DQOL 1YLBB 2QMJA 1A6UH 4LLWB 4HU8A 3QNXB 1TQUA 4OV6F 4ZBJA 1TJXA 5AAMC 1BZ8A 3T4YB 3CN1A 1UJ3A 4G8GE 2ZG3A 4QRSB 3UOAB 4KXDA 5EDXA 5ILTL 1BX2B 4M6AA 4I0PC 1U93B 2FLMA 1KEMH 4L8SA 5KG9B 1MWAA 3JWOL 1PD0A 1G84A 2LAAA 1IGIL 2WP3O 3EOTH 4LCWA 5IB1B 1PBYA 4HH8A 3MRFA 2WQ8A 1OPGL 3N41B 1G7JA 4X8XA 2C8NA 3QWRA 3ZBMA 5IJDC 2IWEA 3VWKA 5JPMC 2WBWB 5JXED 1OANA 1FV1B 3P9LA 3ARED 1R4XA 3ZKXB 5JQ6L 3GWJA 2C7FA 1KMGA 1N6QL 3Q8CA 3I6LD 3ATDA 3Q43A 3OQRA 2HKHL 1KLUB 1NINA 4JG5A 4C4KT 3L4ZA 3KPNA 3LS5H 2A0LC 1DVFC 2D03L 2VXUH 2YEQA 3DDGA 2DJUA 3T4AB 3AXIA 5IM7B 3WY4A 2EXYD 4K2UL 3S5LG 5B4MC 4HU2A 1REIA 4B95C 4F9LC 3MBXL 5GRJL 4A7GF 4AJ0A 2DQHL 2LTQC 5GISH 1FZOA 4ZQTA 4RQQB 3DX9B 4GRLA 4CAGA 5DJAB 2BIMA 3EO1A 3MV9D 4NYLA 4Q6IB 2EXTA 4KNQA 3IMVA 3U4AA 2HFEA 4M5ZH 3FAXA 3O3EB 3VXUB 3T09A 2PCPB 1TZGH 3IXTB 4XCCL 3WHXA 1URIA 4G8FB 3O8XD 4DSYA 4A04A 5DWPA 5K9OA 1IAKA 3ECQA 4Z8FL 1TETH 4ZAKB 4IRJB 4LRNH 4L23A 1PJWA 5E1QA 2XN0A 4XB8A 4H20H 1Q94B 1TQBB 4JFDD 3GS0A 5CZVH 5CFHA 5IF0B 2O5XH 2I9TA 4DQAA 5FO2A 5FYJD 1S7TA 2ENQA 1WZLA 2GUOB 2D7MA 5D1XD 4JRWA 5HDRA 4X6CA 3WEXB 1KTBA 2YXMA 3O4LA 4NQEA 5KOVC 3RWJA 3GMPA 4ZYKB 1WAAE 1AR1D 2UZXA 1W8NA 1CL7I 1EAJA 3SPVA 1WDAA 2AI0L 1G9NL 4K9EL 4U3SA 2Q86A 4PVMA 1U3HB 5HI3C 2A73A 4JQXC 4A2FA 1GTNA 1R1CA 5DJ0A 5BZWA 4P5KA 2NY5L 1JPSH 1PCXA 3VG9B 3HNTH 2QSVA 3FSWA 5D1QA 2F54D 1QP1A 3WY3A 3SY6A 2FH6A 4JQIL 1KEGH 3FB7B 1I85A 3UROR 2XN9B 4JFEB 4Z76A 5C3LD 2EZ0C 3VWKC 5F7UA 1QOKA 1SEQH 4X83A 3ULUL 4KVNL 1DUZB 1PW3A 1Z3RA 2ZP0T 4YWGH 5F1IA 5GIRB 3S5LB 4DETA 3SN6N 3BSZL 1JF5A 3MCYA 3UIZA 3LQZA 3RIFF 1MRCL 1ZV9A 3PWJB 5I8CA 3TNNA 4ZODA 2DLTA 3DMMA 2ZIDA 3DK0A 4NQTA 5DMKA 4FQCH 4NGHH 1QLEL 1DLFH 1MNUH 3D3VA 3QUMA 2B1HH 4IHOB 4Q9CA 3MJ9H 3WIIL 4MZIA 1WZ1L 4GRLC 4Y19B 2ESVA 4LOFA 2A1WL 2ZXDA 1ZEAL 1MHEA 4UDUB 2F0CA 5EU4B 4UNVA 2O5ZH 5ABAA 2PXYB 5ESVA 4KKBC 2VR9A 3ZYOA 5C0RL 2NR6A 1AGFB 4M1CD 1RULH 3L7EB 3CTTA 1DTUA 4CJ0A 2X4RB 1P7QD 4PGDB 4IU3B 2VZ1A 4MMXA 4B0MB 1LXMA 2CUMA 4NQDA 4M8QA 5HHNA 3QJOA 1FFOB 3EF7A 3MOQA 2JQMA 3V7AG 4ZO8A 5I5JA 4KV5E 4NAQA 2SEBA 3IB4A 3GRWH 3IMSA 5H37G 4YHOL 1XV8A 4EDXA 3D0LA 2N56A 1RZKC 5AW9B 2DYPD 1JTOA 1W0WA 4U4BA 2QV4A 3GM8A 5CSZA 5TE4L 1LO0H 3CZNA 4Q4EA 5ISZE 2OX5B 5HVWA 1EEYB 4MNHB 1L5GB 3BT2L 7FABH 4KRPB 2Y6SD 1N18A 3GEFA 4GIOA 3PWNA 2CBPA 3P2DA 5GRZA 1B3JA 5F7LB 5LN8A 5D7EA 3NJMA 4RMBA 3HMXL 2P5WA 1VFBA 5JW5A 1AACA 1ZK5A 2XC8A 3CFUA 5D1QC 4RZKA 5E4EB 1NDTA 3HBGA 4OGYL 1I8LA 3LKQA 3SE8H 3V6OC 2EO1A 1MOEA 1YEEH 3A6OA 1I85C 2X28A 3DX4A 4JO8A 1F4YL 1KB9J 4BKTC 4B3VA 2ENJA 4R9HA 3RWHB 4U6XB 1B4TA 2R69A 1LYQA 3M86A 4K3DH 1RUAH 4WFHE 2Y36L 4Y2OA 3EJTA 1HYSD 1IGFL 4AOFA 1YMMD 3FPYA 1E9QA 1RLWA 2E75C 2WBXA 4PJIF 4TQEH 4XX1E 1JGEB 2D7OA 3D25B 5GGVH 5KSAA 1E27B 2Z7WA 2YD0A 3DMMC 3NA4A 1R3JB 1A14L 1LWJA 3IKCA 3BDYH 2JCCB 5FGCB 1OM9A 4JFPB 1MRFL 4S0SD 5BRZE 4JREC 4X7TA 5GGSY 3TEYA 5CGYC 1OD7A 1DVQA 1KPRB 3RYMA 4HUNB 3UDWA 2EO9A 1AKJB 2AK4D 2IPKB 2NXZC 1XSOA 5IFHL 4HIIA 3CNKA 2A77H 3GSOA 2BNUA 1T66C 3C60A 4NQSA 3QRLA 4FFTA 5F21B 3UG4A 4MMXC 2C9VA 3WUZA 1F6AA 1MW0A 2ITDB 1L9NA 1U8KB 2X6BA 1MQ8A 5TQ0H 3BWAB 1UGNA 4PRAA 4E9TA 2XKNA 4NRZB 5IBTH 3TOPA 4PJFB 1CJYA 4J3TA 2F2HA 4N1HB 2PUQT 3AACA 5KSBF 3LZQA 1DBAL 5TFSL 5C2UB 5FA4B 3GMMB 1MFAH 1CE1L 3SDAD 2FYYB 4Z0XB 3S0PA 1M56B 1NC2A 3NJNA 1JMZA 2X1XR 4LMQE 4BQ6A 1X9RA 4JJ5B 4OFKA 1UM6H 3MZGB 4JANB 4HWNA 1GGBH 2X2HA 5DQ9B 2FJHA 3EGXA 2BVOB 3F2LA 2X40A 3VCLA 1XB8A 2DRUA 1DJZA 3ESOA 5KVEH 2X4UA 3QQDB 4GW5B 4M8UA 5D71H 1J9QA 3HHSA 3OZ9L 3RUGB 1GMEA 3UP6A 3F5WB 1KIPA 4GH7B 5DVOA 2V2TB 5T1LB 4JDVB 2EDFA 3QIBD 4O02H 4LSQL 4WCYL 5IEKA 2FR4A 4JM4L 4PRDB 4X8CA 4TNWK 2DDQH 3WJMA 2G0LA 1UASA 2XIIA 3EOAB 4IMLA 1LM8V 1EAOA 1J0IA 3DRTB 2DKSA 4KO9A 5LCVA 4UZSA 3BGAA 4KXBA 3BVWA 1NTDA 1ZHNB 4ZW8A 1N2RA 1ZTXL 3R0NA 3SE3A 2JLPA 3T0ED 3VRLE 4ODXB 3BP4A 3OKEB 2XX0A 3B9KD 4TTDD 3B2VL 3BRFA 2PW2A 4G80A 1JHTA 2O4EA 5D7IB 5HDBF 3W2DH 1ODUA 2J72A 2WAHA 4HWBA 1I7TA 1MPAL 3UDWC 2G2PA 1PEZA 3CDGB 3PUCA 4HX1B 4H4NA 1RZFH 1KTDA 3FOLB 3I6GA 4DERA 3L3OB 1AG0A 3MACH 5IMOA 3RL1A 1Z5LB 3C60C 3RTLA 1BAFL 4LARL 3FPXA 4BELD 3LHPL 5IJKA 3P4MA 4QRFA 3VGFA 4F8LA 5GGRA 1E4WL 2WCGA 3MMEA 1Z9PA 1ASOA 2IADA 2JIXA 3EZ8A 5IVXE 3VGHA 5I6XB 1VEOA 3LKPB 4GLRH 3OKNA 2APFA 3TBWA 3QEUA 3EYVB 3MV7B 1TJGH 1C16A 1P6WA 4WUUE 2KPNA 4L4VA 5HDBB 5ALCL 3RI5K 5DZOA 4NZTL 1UEYA 1NIBA 4Q0XL 2P28B 1EO5A 4L8DA 4GAGH 1RERA 4KUCF 2WBJB 2J4WH 4HXBH 2XWRA 4IIQA 2J3SA 4EEEA 2VLKB 3EW3B 1AZCA 1GSMA 1MCPL 3U30C 4G8IA 3SKMB 1BVLB 3LB6C 2FX7H 5CP7B 2VLJA 1MG2C 3SIKA 4Q52A 5C1MB 4Y4HA 5JZ7D 4OSUH 3MV8A 1FHGA 4K15A 3NACH 4DP6X 3LKSA 3SJVE 1BD2E 4OVVA 1U8QA 1EUUA 4P2OC 5E8PA 2HSIA 4R7XA 4M4RA 4WK2B 3SE3C 4X9HA 4OF0A 4PD4J 1M71A 1VFAB 1R3IL 3JWDH 5I5MA 1OSPL 3A0OA 1HN1A 2MQ0A 1BFOA 3L5HA 4JEGB 1YDPA 4HS3B 5JO5B 2P7TB 5C08D 3D33A 4TUOB 3BD5A 1B2WH 1WQVT 2Q76A 3GUFA 5E6YA 5EBMA 4B6ZA 1SVCP 4B7LA 2HMIC 5DC2A 4ZUSA 1A4KA 4WO4B 1MI5B 3TEXA 4HVBA 1FYTB 4JW3A 4KK9D 3HUJF 5HGDB 3W9EB 1UKTA 2DIEA 3PFUA 4O2EA 4HWUA 5KVMC 1FL6B 2GJPA 3IBOA 3SCMA 1F4XH 3UO1L 4FLQA 5A2CA 4S2SB 1NDGB 3SYPA 3T3PF 2X0WA 2XCMC 2WWMD 2LU5A 3QDGB 3C8HA 3MRNA 1C9SA 5FYJL 4PGEA 1BQRA 2IQAB 1ED3A 2P80D 4F33B 4JB9L 4LCYB 4PJDB 4GQZA 2XPZA 2VOTA 1VPOL 5I6MA 3UZEA 5FPIA 5FB8B 2J8HA 3HPLB 5A2KH 2NY0C 4BZ2L 1KDIA 1RUPH 4OGAD 5DRXB 4N6RB 3GIVA 5KS9B 1O6SB 3W0WE 1QTSA 3AG1B 2XA8H 3AU1B 4XNMA 4YX2H 2QVKA 1DN0B 4I77H 2D3NA 3L95A 2NY4B 3S8GB 4I9WE 4IIQC 4TM9A 5D2NE 4K8RC 2TRHA 5D2LA 1VKXB 3KYOA 4FQHA 5EU6E 2V3EA 1AZNA 4PWEA 2UZIL 4DKFL 3GXUB 1TJMA 3UTTB 4NFDA 2FGWL 1AQDB 1SVBA 3RVXD 3WO3B 4PJAE 4DKDC 1HH6A 4YSQA 1NIFA 2WNKA 1KSRA 2E74C 3REVA 1A3ZA 2XZAL 4XNXL 4DW2L 2MEJB 2R0KL 3P73B 3B2UC 3WTXA 3ZDYB 4XVTH 5A2IH 4X4XA 5AW3B 1CLYH 2O6DA 5E8OA 2ZWSA 1MVUB 3R4DA 3IFPA 1N4XL 2DQEL 2IH1A 4KHXL 2WQVA 2Y1VA 4G83A 4N26A 2YUXA 5ADOH 5L88H 2G5BA 1SEBB 5LG1A 4WWID 1JK8A 2CZNA 1EEZB 1MQKH 3QARA 3BI9X 3V4UH 4UQ2A 3OGCB 4HJGA 3MOAL 2CIIB 2AJ3A 3VXRD 2XQBL 4I4WA 4LHUA 1T6BX 2ADFL 1CD8A 3F58L 1N10A 3OF6A 1TSHA 4E5XG 4OLEA 4OLZL 4OCLC 3VWJB 4D0BA 4GBXB 2ZJSL 5I1DB 1D5RA 3JUYA 1CLVA 1L7IH 1CIDA 4UTBA 2FT6A 3EJCA 2DQTL 2HTKD 4LCIL 2TSAA 4ZJ9A 3ZHDA 1IBBA 4LCCA 3QXTA 2DQIH 5DR5L 5C7XL 3D2UB 3TVMA 3FUEA 5IFJA 4L2YA 5A16B 4J27A 3SE9L 4ZW5A 5D7KD 5DLML 3A67L 1A6TB 1SJEA 2IV8A 5EO0A 2CJUH 3UZEC 4AH2A 3KBPA 2N1TE 3UAEA 4YGVA 1G6RB 1KIUA 1ERNA 3NVQA 2ZXGA 4L4TB 4UAOB 5GZOA 1X7TA 2Q10A 4QTHB 3NZSA 1BV8A 1PLBA 2ZX5A 2VMCA 1RUKL 1MN4A 2WNGA 3JVGC 1TTGA 1HWGB 1KJ2B 4ONFL 5T3ZE 5GJSH 3DX8A 2X70A 1E43A 1WFIA 3M1BB 2Q2EB 3VI3A 3NA9L 1ZLSL 5EG6C 1QBLL 5IOPB 4EI5C 1YMHB 4HZLA 3NCBB 1AHMA 5HVHC 4KTDL 3V4VB 4X6EB 1UG9A 3U0TA 3WFBL 1M05B 5BZDB 1Q90A 2BVQA 2VUYA 4MB3A 4KJYB 4F3FA 5LXGL 3JTSA 1ZE3H 1Y18A 1L9PA 4JZNB 1U8PA 2GJ6E 3FL7A 4Y1AA 4ZSOB 1GW0A 3QRBA 2VDOL 2WYHA 2ZXAA 3RPBA 5JOFA 1Q1JH 2XXGA 2I5YL 4U7KA 3EGSB 4KX9A 3LN9A 3WTYA 5FF6B 3PNRB 4R0LA 2FZ3B 1BM3L 2GTZA 3G04B 4QMEA 3BHBB 3V6FA 3LZFH 3HCVA 4E5XB 3KLAB 1HXMA 2FX8H 2XLLA 3D39D 5L9DH 1MFDL 4GRWB 4POZD 4G7SB 4U1MB 5CBAA 3DX0A 2JKJA 3MJ7B 5FYLH 2EDMA 3KXFA 3EYQC 3MDJA 3VYNA 4U05A 2CLZB 2BLFA 1JWMB 6FABL 5CN3A 4HUXB 5KJRH 1NFDA 3Q3GB 4HCFA 4OFVA 1CBVL 5JIKA 4XB7A 3E1ZA 3BAXA 3S4SG 1OGAA 2HN7B 1UXWA 7PCYA 3BE1L 1J8HD 2O61B 4XN7A 2VSDA 1PFOA 4G72B 4M61B 3NP3A 3QDJB 4OLWH 1YY8A 3RJQB 3BEWB 4NKOA 3TVMC 3DX2A 5EC2B 2F53A 3FQNB 2EVHA 2QVTA 2PP7A 5F8QC 1EJOL 3LKRB 1A1MB 1LHZA 3FQXA 4I0PB 4PJ5A 4YSDA 1PSKL 4BFKA 3FCBA 1HH9A 4I89A 5GZOC 2X4PB 5F7MC 3MVSA 1QKZL 3NZHL 5C2BH 2AV7B 2CBMA 4R8WH 3RVTD 3TV3H 2CR6A 5HJ3A 4FL4C 2A74A 2EEBA 5IT2H 5GZNA 4E42B 5KSVA 2R2EB 4KMTH 4OLUH 3ABGA 4QRPD 4EZLA 4IOIA 3DK2A 5KN5B 2MNWA 1Z66A 3F05A 1WGVA 2AAVA 3FB5B 5JPMB 1NCDL 3IDNA 5DD6A 3T8MA 4PSRA 2WXHA 2D4FA 2BFVH 2WMPA 2NY1C 1D2PA 2VLME 2P45B 2F74A 4JFXB 3QQXA 4MAYC 1JVKA 4PCKA 5CR8A 3RIKA 4DGVL 4Q9QL 2EXWD 2EQDA 2KLRA 5K33A 3GJFK 5ACLA 3O9WA 5TH2A 2HTLD 3LEVH 4LAJH 2DL9A 2EDJA 3LRKA 1DVFB 3OXRB 1USQA 1U91A 3U48A 3RPIA 5BS0D 4PSPA 3VDCA 4D9RE 3QIWA 1MELA 2NY7H 1GL4B 4RAUA 2Q7NA 4G11A 3QJUB 4JFVA 3TA3A 1S9WA 4WWKA 3RZWA 4YJZL 3ZU8A 3L2MA 3MLSL 1JNLL 3NRQA 3Q1EA 1B4JH 5DHVB 5FR3A 1U0QA 3S4SB 4IBTA 3L3DA 4HIJA 1IVTA 5E2UL 2WOYA 3VJ6B 4JRXB 5DK3A 3AC0A 1QFWH 3CMOL 3O6MH 1GZHC 3QZWA 3H9ZA 1HCVA 3IDYC 1U2CA 5GHWL 5B7FA 1P4IH 1YNKL 2LW3A 4QXVA 3HI5H 3OM3B 4HPOL 2VDPB 3LKNA 1Q72L 4RX4A 5FYKE 1VGEL 4G6FB 1G9MC 5HYFA 2ITCB 1CR9L 1T2QL 2VSKB 2BH0A 3UGEA 1YQVH 1R17A 2A3TA 1TF4A 3D1MC 3PY9A 1YJDC 1UJ3B 2YAOA 4ZW6A 3SDXA 3V6BR 1DQKA 1D5ZA 2O6CA 3QZBA 2VDQB 4F91B 5IJBC 4L8SB 5IQNA 3TIEA 5I18L 1J5CA 1MWAB 3HZVA 1BMWA 5IW6A 4LCWB 4LEOA 2AW2A 5GZNC 4MBOA 3MRFB 1SYSA 2CKBH 4XPTL 1G7JB 1RIUL 1TQWA 1F0LA 2ADGA 2QGBA 1RUQH 2H4EA 5HYSA 4ZO7A 3VWKB 3P9LB 3MLTA 1BQHA 1F8TL 5D7JA 3NJJA 4YXLL 4TL4A 4X8GA 3O9WC 4PVNA 1LK3L 1UXLA 2QGEA 4TPRH 2DM3A 1MCRA 3KPNB 8CGTA 3I6LE 4CUCA 2EDXA 3L2NA 3EF4A 2DWDA 3D9AL 4X6CF 5FK9A 4OIAA 3N85H 4R2GC 1HQRA 1FZOB 3TA3C 5E1IA 4WWKC 4GRLB 4NPYA 3EO1B 1ACCA 2XTSA 3QP3A 4NYLB 4P9HH 1YEHL 4NQCA 4TUKH 2AXHA 2HFEB 1QFPA 2QQLL 1A7QL 4CKVX 3MV9E 4LSPH 4XCNA 4APXB 3EFOA 3WHXB 5JA9A 5K9OB 1IAKB 1E30A 5D6CB 1JGLL 3RU8H 1QR4A 3DX7A 4WK0B 4YBQC 2YQ2A 3VQLA 5IP4A 2W0LA 1DANT 1MCJA 3A21A 3CSFA 3FS9A 2I9TB 1S7TB 4JPWL 3QJHA 5DK0A 4Q2ZB 2B8OT 3Q1SL 1YEJL 4N8VA 4YDKH 4JFDE 4X6CB 3O4LB 4NQEB 3RWJB 1NKRA 4TQ8A 3GMPB 5FYJE 1DSFH 4N22A 4AX3A 1CU4H 2JI3A 5D1XE 4Q4IA 2UZXB 1E5YA 1CLZH 1X5MA 5JIQA 1P0SE 3SPVB 4EXPX 2JKSA 4U3SB 2Q86B 4ECNA 2A73B 3BPNC 5DJ0B 3NJGA 3TBCA 2R4SL 4P5KB 3QIUD 5BZWB 3NIFF 4I1PA 3EADA 3KVPA 1EDYA 2CKNA 1CF8L 2IALA 3K3QA 1NBVL 4KVCH 4MQXC 3CFTA 1U58A 5D1QB 5I71C 3U7WH 4OFQA 1KXQE 1I1CA 2BP8A 2PTTA 3A47A 2F54E 4Z76B 2Y1ZA 3MLZH 1NA8A 4OKDA 1YO4A 4BUQA 1MIEH 1AAJA 4LQFL 3VXOA 5D7JC 4Y16C 5F1IB 2NXYB 4EN3A 1FH5L 3P1VA 2HJFA 3LQZB 1QX1A 5G4MA 4N28A 5I8CB 3WU1A 3TNNB 2X7LA 5L6YL 5F1KC 2WTRA 3DMMB 2FJGA 5DMKB 4OFDA 2TSBA 4KH9A 3NJKA 4Q89A 4N0UA 3D3VB 1F2XK 3BUYA 3QUMB 4OD3L 5CNHA 2LQRA 3X13A 4EZMA 1ZT1A 3MUZ1 1OSYA 4JREB 4KJPD 1ZVHA 4CN1A 3F65A 2ESVB 4JFFA 1MFCL 1J8KA 1MHEB 1O6TA 2F6AA 3VI4F 3ZL1A 3D85A 1S7RA 3IFNL 3JWDC 5ESVB 4AJYV 1GY2A 1U36A 1WFNA 2NXZB 1NH6A 4AI7A 2V9QA 4MAUL 1QAWA 2Y06L 5AVVB 4MMXB 2XWTA 3PNWA 4M8QB 4NQDB 5HHNB 3ZDXE 1P1VA 3H8NA 3IRCA 3J27A 2SEBB 2EDTA 5DUJA 2F15A 2YPLA 2A9CA 3VFTA 4LEXL 4EDXB 1W0WB 5DRZA 2J1ZA 2UUDK 4KK5D 5CSZB 4MS8D 5AG8A 1AO7D 1Q38A 1J11A 5AL0A 2WXPA 1H8OA 4CN6A 4MXQC 3PWNB 1VHPA 4JPVH 3NZ8A 4J4PD 4XC1H 5E4AA 4WHYG 3ZTDC 3ZDZE 4E9RA 1DZBA 1C5DA 1VFBB 2P5WB 2Z1PA 5JW5B 2DOCA 43C9A 3FQYA 1OP5H 2DY2A 2DM7A 2QVMA 3LKQB 2DQJH 3RVVD 5I1IH 3VGGA 1V7NH 2OA9A 3GXIA 3TBBA 4HJ1A 3U2SA 2FBRA 5KTEL 1Q0EA 3HLAA 4PY7A 1C5BH 3PCYA 4Y2OB 4EN3C 3RWIA 5T1KD 1E9QB 1I1AA 2FHFA 1G7LA 4CGTA 5KSAB 4KRLB 1U8IA 2VR4A 3IKCB 3WEAA 2C9UA 3CBRA 4MA8H 5BRPA 4G5AA 1GR7A 2GIYA 4M43L 1YNTA 1JFQL 3US9A 3IDUA 5JDSA 4X7TB 3GJFA 3TLRA 4P2YA 2B4CH 4FQ2H 3LZRA 3WE6A 1NJ9A 3FB8A 1R46A 1BQLL 4NN7C 2ALAA 2J8UB 4HIIB 2EC8A 3ARYA 3GSOB 4Z5RA 2BNUB 2V4LA 2AK4E 4JG1L 1RP8A 3C60B 4NQSB 4PCTA 1RZJL 1DYZA 4Z7IA 1NPUA 3D34A 1F6AB 5DGRA 2HLFC 3BFQG 4HK3N 2NNFA 5E70A 4MWFA 4UOW1 4PRAB 4XPAH 4HLZG 2XKNB 4KZ0A 3TJHD 3R1GL 4TVPD 5C0AA 2MOVA 1G9EA 4WKZA 3CK0L 4DQOH 1WUNT 1NC2B 1XR9A 4PIBA 1OP5K 3NAAL 4KROC 5AL8A 4IRJD 2F8XC 5ILTH 1WYJA 2G3NA 2FJHB 3EGXB 1F1GA 3VCLB 2WBKA 3JWOH 3A4AA 2XPGA 2R59A 1IGIH 1WA2X 2X4UB 4JRLA 4NCC1 3U30B 4A63A 2J1WA 1R33A 3DUSA 3UZVA 3HHSB 3OSVA 4B97A 3EO0A 4WSKA 1GS8A 1OPGH 4HS6A 5E9AA 1HHJA 5FKPA 1LO2L 1I1AC 1U3HD 5IEKB 2FR4B 2L7UA 5JQ6H 3WJMB 1O5DT 4PWKA 2G60L 1SMOA 1NKOA 4FNTA 4AM0A 5IJCC 2APSA 4IMLB 1N6QH 4S1DC 1ZE3C 1NM4A 1OAJA 4U0RC 4YFLI 1JXJA 2ZAHA 2E56A 4FQXD 4UIMA 5I26A 1N2RB 4DF9A 2HKHH 3ARGA 3CHXA 5F7NC 3BP4B 2E4TA 2EIJB 1UKQA 2D03H 4PJ8A 5GRVK 3BSGA 2DTML 5C6PB 3RNQA 4JFED 1DBBL 3T0EE 4K2UH 4ZX3A 1LVEA 2PW2B 1JHTB 4G80B 4N9GA 4AEIL 2MFNA 4OUOA 1RK0A 3MBXH 4G42A 4P8QA 5GRJH 3ZE2F 1I7TB 2DQHH 4RGMB 4WNSA 3D18A 3MJ6A 2WWKT 3IMWA 4YHKL 1KTDB 3QJRB 2Q1EA 3I6GB 2WLIA 5IMOB 3G5XB 1CFSA 2LVCA 3RL1B 3S2CA 3STZA 1W0VA 1FFQA 5JR1L 5CMAA 4XCCH 1MY5A 3P4MB 5GGRB 1NQBA 3MMEB 4Z8FH 2IADB 2JIXB 1OWWA 1MHPL 3U7YL 1T83A 3ZE0E 3RQ3A 3OKNB 1QRND 3WLWD 5I66A 4X4ZA 3TBWB 3QEUB 4NKIL 5BO0D 1FNFA 4CL7A 3O2VL 1C16B 1V5JA 5EPMA 4L4VB 2NY0B 2IOIA 2ZUYA 5EC1A 5I8OL 4Z3FA 3ZE2B 1NEPA 2CXKA 4BSJA 4CDGC 4L8DB 2AI0H 1G9NH 4K9EH 3QH3A 4LIQE 4Z7OF 2CO7A 3A23A 3I02A 2W5PA 4L0ZA 3L5XL 4IIQB 3PWUA 1D6VL 3V0VA 2NY5H 2DV6A 5TF1L 1ODAA 2ZUQB 3D06A 3SPIA 4G8IB 3OKDA 5HJGA 2VABA 2VLJB 4H0IA 3OB8A 2FEJA 4HCIA 4JQIH 3LPOA 4DP2X 4Y4HB 2VJ0A 2MJWA 4I7ZC 4LLVA 1QSFA 3DROA 3MV8B 4MA3A 1S6NA 2E3VA 2GTWA 4KRPD 2GY7B 1H15A 2R7EA 3C6LA 3LKSB 4IKJA 4KVNH 1UD8A 5FOJA 3ULUH 4AYGA 1U8QB 2PWEA 5E8PB 3BSZH 1I82A 4M4RB 2OR8A 4XVUD 1MRCH 1M71B 1EV2E 4ZFOL 4PJ8C 3RWGA 1JRHL 1QLEH 1CI3M 5EUOF 5DU7A 1N12A 2X10A 1BFOB 4K55A 4XGZA 1E5BA 1YDPB 1IBGL 3L16A 3WIIH 4FA7B 4JGNA 1R3HA 1WZ1H 5CUSL 3VW3L 2A1WH 2Q76B 3AUVA 1ZEAH 4KKLD 5EBMB 5KBNC 4ZUSB 1A4KB 1I4FA 1QMUA 4RFOL 3ARRA 4B9ZA 1CMOA 3O2WL 2IWFA 3S5YA 2P49B 4O2EB 1G7MB 2XQ0A 3SCMB 4LHUG 1P6AB 3H53A 4DIXA 1IT9L 4TLKA 4PUBL 5LBSA 1T83C 2WANA 1CDHA 3MRNB 5E5MA 2NZ9D 3NFSL 4RIRA 4PGEB 1RZGA 1RSFA 1ED3B 2R1WA 2DQCL 3NTCL 4FI7A 1AKJD 3CXDL 2V5SA 1TDQA 4R83A 4YHOH 4RGND 3UTPD 4KTYA 4DFHA 3CLEL 3GIVB 5EORL 3Q8FA 2X1QA 3DKHA 3DECA 3JT2A 1M7IB 4TQPA 4O58L 1I7RA 5TE4H 3RTQA 1KF9B 3CZFB 4S1SL 3ZPDA 4XNMB 2DI9A 2A4EA 4MDRA 4MXVF 3BT2H 4DEUA 1PZ2A 3L95B 1RPKA 5D2LB 3KYOB 5FEBA 3V0GA 4FQHB 3M1CA 3HMXH 1OHZA 5HVHB 2D9CA 4UMGA 1KT2A 4OGYH 4GSDL 2XQYK 3BPCA 1F4YH 1OT1A 5GRYA 1GCFA 3REVB 2FEDC 2NCMA 3ILEA 4JN2A 3V0WL 2JB5L 4X42A 3C6LC 3MA7A 4NWUL 1Q1PA 5I1AA 2Y36H 3NEOA 2P5ED 5A1AA 4X4XB 1JWUA 2GITA 1IGFH 3TC9A 5E8OB 4OBSA 2YUWA 2IH1B 2Z1KA 3HNSL 4RDBA 3KPOA 2G5BB 2QELA 3PGDA 5IW3A 1A14H 3TFKD 1TFHA 2DLIA 4ELMA 3KWWA 1JK8B 4OZHE 4PB9L 4R5TA 1MRFH 5ANME 5BMFL 4UQ2B 2Q5BA 5CILL 4HJGB 2YGOA 3ZTJG 4P9HC 2AJ3B 4FD0A 1YSOA 5T1LD 3CC5A 4N0FB 4I4WB 4LHUB 4U1GB 5F70A 3GTNA 2KUTA 3MI6A 3Q01A 4GINA 3HG5A 3SKNB 4D0BB 2VDML 3HBZA 3P3YA 3VXRE 5CD5C 4TLTA 5JYLA 1YUHA 4JO2L 4QOKD 3F00A 4QRAA 1ZPLA 3QC5X 4QUOA 5IFHH 1YYLL 2WYIA 5BW7C 5DHMC 3AABA 3OHXA 1F97A 2NNXA 4LCCB 1JTPA 1XL4A 5HHPA 2EUZA 3TVMB 4CVWA 5IFJB 4JVPA 3IXAA 3BAEL 3MXWL 1IKNA 4K7PY 1SJEB 1JVLA 5EO0B 1LO5A 4JY4A 4AH2B 2Z4TA 1RJYA 4HWEL 5LG6A 4PY8I 4YGVB 1DBAH 1KIUB 2N1KA 5D7KE 5TFSH 4ZTEA 3O6KH 2F8IA 2KHAA 2FH8A 4F8QA 1CE1H 3GHEL 2AXWA 4XAWL 2MTPA 5DMGD 4MNQA 4F2EA 4FL4B 3TF7C 4GIPD 3DX8B 2X70B 1E4HA 4K3EL 4P2RA 3DXAD 3APDA 1CGUA 2BS8A 4TNWF 3VI3B 5HVGB 1ACZA 1ZCRA 4HZLB 2WN2A 4KQ0A 4NJ9L 3U0TB 5JMRA 4GAFB 4FFWD 5ESAA 1WV7T 3PF2A 1NFDF 3JTSB 4Y1AB 1Y18B 2KDGA 4GG6F 1U8PB 3OZ9H 4TYUA 2QADB 3W9DA 3QGVA 3ZQ9A 5C9KA 5LNDA 3S3JA 1YEIL 5JOFB 4UQIM 3TYFA 4BUHA 4TTGA 3AS2A 1WT5A 2WBJD 1XGQA 1QPKA 4LSQH 4WCYH 5D1ZI 5B1CA 4JM4H 1S7WA 1WO2A 4R0LB 4U0QB 1ZLEA 2GTZB 2FEEL 2XN2A 4BE6A 2VLKD 1N59A 3HCVB 2NNRA 1OCWL 1Q0YH 5IBLC 2BP0A 1HXMB 3BWSA 3D09A 1ZTXH 5CBAB 3QPQC 5AW4B 3GLZA 3WTVA 3D6GA 4HHWA 3GSUA 2Q0ZX 5A3ID 4NBXB 1P53A 3D39E 3B83A 3KXFB 1PKOA 3B2VH 4QHKI 4J6RL 1A3RL 3IDYB 1MPAH 2BY3A 4KKCC 3MUHL 4G43A 4DKAA 5J56B 3FUNA 1AQ8A 2YD2A 1V3KA 1OGAB 4W9LC 1UXWB 3RI5F 1ZGLM 1NGYA 4X6DF 3OHXC 4OCRL 4OTXL 5INCA 1BAFH 3QZWG 4LARH 1YY8B 3LHPH 4NKOB 1J8HE 1E4WH 4YSRA 4TVPL 4YDZA 4MQ7A 1IKNC 2CWRA 3FQXB 5CFAA 4PJ5B 3THMH 4WO4D 5IBUG 1HH9B 1UYWL 3FW6A 1FYTD 2CG9X 3KLHC 2RBLA 1N26A 4XBPA 5D1ZD 1TTCA 5ALCH 5HJ3B 2A74B 4NZTH 2D73A 2Z0UA 4JCLA 4Q0XH 4UQ9A 5KSVB 1KCUL 1KJVA 4IOIB 2KQNA 3B3IA 3IDNB 1FYHB 1TEFA 4QRPE 2VRQA 5DHYA 2WMPB 4FJZA 2WQAA 2F74B 4WSJA 1DEEA 5IFAL 2HFTA 1NGXA 1PY9A 1AD9A 1MCPH 3SDYL 3O9WB 5H4ZA 5TH2B 2FQGA 1YEWA 4GYBA 1T5WA 3ZUNC 5HYSG 1FZMA 1AMXA 5E9DA 4YVUA 1BQHG 1X5JA 1U91B 1WT5C 3RPIB 1B9KA 1CGXA 4ZFZA 3QIWB 4RAUB 4R2GB 4NIYE 1KY6A 3VG0L 3UABA 2ITFA 3TA3B 1S9WB 4WWKB 4PCYA 1CE6A 2J20A 3SDXF 1S2EA 4FS0A 1KYOJ 4R84A 2YJLA 3UTTD 1CZ8L 5C0IA 3IS1X 1N0XL 3L3DB 1R3IH 2ZX9A 3QFDB 4HIJB 4UT9L 1VFMA 3UMNA 1WICA 1H6FA 1OSPH 2P5PA 1FG2A 1JNNL 3LZPA 3QZWB 1KGXA 1J1PL 3MC0A 1D9KD 4GS7C 4I2XA 4MASA 3LKNB 3U1SL 3I6SA 1FQ9C 1MCLA 5CZXD 1NKGA 4RA3A 3TH4T 1TZ8A 2YAFA 4QWWD 4WI3A 5IBUB 5FGBA 4R4NC 4BH8A 4WI9A 2KS0A 3UO1H 3P4NA 1S7VA 5H2BA 1A9EA 1LILA 2R23A 4PJ6A 5DJXA 3SDXB 1D5ZB 4JKNA 4QRRA 4XBGB 1X4XA 4N8VG 4TKWA 4JB9H 3BPNB 3TIEB 3V5DA 4GBXD 1VPOH 3HZVB 2YBRA 4M03A 1N8ZA 1VEPA 2B0SL 5IW6B 3GS7A 4BZ2H 2YEZA 5I71B 4LEOB 2VQ1A 2HRLA 4Y89A 1XBDA 3VXNA 1SFDA 3QW9A 1PAZA 4OIFA 2VR5A 3T1FA 5HYSB 1OQXA 2RD0A 3VGAC 3HC3L 3JWOC 3MLTB 1CDJA 4NSKA 1BQHB 2QQKL 2CU9A 3GPEA 5D7JB 1RZPA 4ADJA 4A37A 2Y5QA 4Y1SA 1X5HA 1FORH 2NDFA 4JQIA 4YIQA 4DKFH 2UZIH 3VFMA 5CLWA 4KI5E 4E41A 3WHE0 2FGWH 3OJ2C 1IM9D 4ADIA 2DWDB 4BFFA 3KS0H 5IK3A 2XZAH 4XNXH 5FK9B 4DW2H 3QUXA 2BW5A 2XQYA 2R0KH 2ED8A 4X5RA 1CI5A 3BSZA 1TR7A 1HQRB 1UCBL 1IC4L 2F8OA 4NPYB 4HF5L 2B1OA 3PPEA 4LT7A 2NW3A 3NABL 4C4KO 1N4XH 4NQCB 3BN9D 1KBPA 3L1GA 4KHXH 4OCWL 4UOZA 3FT0A 3M8OH 3AQXA 4XCNB 1BAGA 3X11A 5I24A 3EFOB 4KY2A 1ILUA 2BM3A 2D3VA 1P5UC 4HG4K 4NNXA 1U95A 1NAKL 2L8AA 3DOSA 3MOAH 3DX7B 2XQBH 3O2DA 2ADFH 3F58H 3UYOD 1K5NA 4OLZH 1HKFA 2ZJSH 4Y2NA 3ZMNA 2APTA 2VQTA 3O0RL 2QKSA 3QJHB 4KJQD 4N8VB 5DK0B 5HI4D 4C47A 5FGBC 2X9ZA 4NB7A 4LCIH 3OJMB 1R5IA 4QEGA 2A9BA 4WI5A 4L5FE 5DR5H 5C7XH 3DURA 4LBEA 4MSWA 2ICEC 5AVZB 5CKGA 5JIMA 1I75A 3SE9H 5DLMH 2XWJA 3A67H 1OLZA 3KG5A 1GYAA 3ABMB 1U58B 3IMUA 2AQ1A 1EZSA 1G6VK 1OVZA 2BP8B 1J18A 2PTTB 1IEBA 1RUKH 2Z34A 2J1XA 4WTXA 4J3VA 5IJVA 4ZRGA 1MJUL 4ONFH 5H4YA 3WSQL 1E8YA 1KY7A 1FJ1A 2AQRA 3BFOA 3VXOB 2EADA 1A8JH 1PS3A 3NA9H 4TUUA 1ZLSH 1QBLH 1Y6KR 4HMDA 4I0PD 4EN3B 4ZUUA 3T0XA 1PD1A 3US0A 1I9EA 2HJFB 3QNYA 2NTFA 4FOMA 4KTDH 4QKXB 2X7LB 3WFBH 3E3QE 4HD5A 2FJGB 1CGSH 4AUJA 5LXGH 3EJYC 4YHNA 1HHHA 1OAQL 3C5JA 3E1F1 1FNHA 4N0UB 3BUYB 2VDOH 1KXHA 3X13B 1H8SA 1ZT1B 1GZPA 1SM3L 3K1KC 2I5YH 4JFFB 5KAQG 2X38A 3D85B 3U9PL 4PVBA 2P44B 1BM3H 1S7RB 3GS4A 3IJSA 2W59A 3FU0A 5L4IA 1N6VA 3K8MA 4XOBA 1XH2A 3CZLA 2NYZA 1MFDH 2NNAA 3ZY7A 2C3XA 4M9PA 4YDNA 2CJ3A 5I19L 5L8JB 2A0LD 1DVFD 1H19A 5D7SL 5EN3A 4KKAC 1RZIA 2JELL 5B4MD 2XWTB 3PNWB 3OL2A 2YPVA 5DJ6A 4XR8C 4X80L 3TN0C 6FABH 3QUZA 1CBVH 2VJXA 1WITA 3ZYZA 4PQXA 3N43F 5A2FA 2YPLB 2JKNA 2CO4A 4N2OA 4O00A 1UD5A 3BE1H 4L9LC 3S37X 3VFTB 5JA8B 2M83A 3CHPA 1BHGA 5DRZB 4FE9A 2VMJA 3MRLA 4Q9BA 4JZOA 4KROB 2JH2A 2DAVA 1AO7E 3NZ8B 1EJOH 1CT8A 2ZUSA 2VW7A 4QRQA 2P46B 1C5DB 3FC8A 5AG9A 1PSKH 1OV8A 2VM3A 2Y69B 43C9B 1QKZH 3NZHH 5F0MB 2OS7A 2Y2WA 1G87A 2OULB 2PKDA 3A6BL 4FA6A 5IREA 5SX5H 2E5EA 3U2SB 1II4E 4F1ZA 3NJFA 3UCQA 3HLAB 4PY7B 3ZKNC 1R75A 4K7PL 3RWIB 1NCDH 3DSNB 1I1AB 4ICWA 2X44D 1G7LB 5HI3D 4LOEA 3JQOB 1UENA 5FYJU 4DGVH 3IMBA 4Q9QH 1U8IB 1PIFA 4RISL 4U0RB 5D5MA 3U0WL 4F7KA 4IEFA 4LCWD 4Z7WE 3BZEA 3FMGL 1J88A 5E23A 3H7LA 4XP1L 5DO2C 3BZFA 3JV6A 1YNTB 4XO5A 2EDOA 1JXKA 3QWRD 3NK3A 5JDSB 3GJFB 5AW0B 2EZ0D 3VWKD 3LXCA 4DK5A 4BRJA 1LNUA 3WE6B 3ZQWA 3MNVA 1NJ9B 4XMWA 5BRQA 3FB8B 3CBJB 3WELA 1OAXL 5GGTA 3U7AA 1T7WA 3C8DA 3IDIA 3MLSH 3OZKA 1JNLH 1HSBA 4Z5RB 2VZTA 4O51A 1CD0A 1SYVA 2BHUA 3B34A 1KXVA 3P3RA 3DGGB 5E2UH 3FNKA 2HT4C 3CMOH 1NAMA 4ETQB 3F7RA 2GAZA 3QUZC 4MWFB 1YNKH 5GHWH 4GRLD 3HRZB 4HPOH 5EF0A 3FZUC 1Q72H 5C07D 5FCSH 5C0AB 1JAEA 1O9WA 1VGEH 5D4IA 4WKZB 1U3YA 2EDEA 4KKBD 5TJWK 5D70L 1CR9H 1TJIH 1T2QH 3FO2A 5F7EL 2QDWA 1XR9B 1FNSL 2E6JA 3GUTA 2HVJA 3QDHA 2YGVA 4H0HB 4BFOA 4PPTA 3BKML 1HVXA 3KDPB 1IC5L 5SX5K 2G4GA 3GMQB 5I18H 4GUCA 4AG4L 2FK9A 2XPGB 2Z8VC 4QCIA 5JIPA 2P48B 3OKOA 1E7VA 4OI8A 1P7HL 1NPNA 2FBJL 1AMYA 3DUSB 3O4LD 3PJLA 3UZVB 3EO0B 3NCJL 2HWZL 1T1WA 1A6VL 3I75A 4XPTH 2BY1A 1U3ZA 1RIUH 4HS6B 1TG8A 3A24A 3CDCA 1HHJB 5FKPB 3C8KA 3D4GA 4CSZA 2JJSC 1ANUA 4AM0B 1F8TH 4YXLH 4RWHA 3MRDA 4FQJL 2AJYL 1OT2A 4HC1L 3QFGA 5D1QD 4UIMB 3HC0A 1LK3H 3TEUA 3ARGB 4FFVC 4P07A 2AXFA 1Q0XL 2XFGB 4PJ8B 3LIZA 5JQHC 3RNQB 5JNYA 3D9AH 1MF2L 1JJUA 2GC7C 4N9GB 4XN8A 1GJUA 1RK0B 4G42B 4K3GA 3OD3A 4IOSA 3E0GA 3D51A 4LLQA 4JFEE 1D2OA 1UCTA 4M7KL 2EKJA 5AOJA 1G7IA 3GO1L 3Q2VA 3D18B 3PGCA 1YEHH 4X98A 1DDHA 4G8EA 2WLIB 5T5FA 2QQLH 1CFSB 3STZB 1A7QH 3DMMD 1KXVC 1MCSA 3ELAT 1KLFA 2W88A 4CA4A 5CMAB 3C2AL 3FOMA 3D3VD 5L2KD 2FCBA 1JGLH 3MN8A 2X5PA 3AQDA 4LPWA 4B3EA 2ARJQ 5I66B 4PJHA 5C0DA 4F57L 5GJTL 5CGYD 5GS1A 4HA1A 1QRNE 1B90A 1XH0A 3DO4A 4NUJA 1IBHA 1N5AA 4JPWH 1T03L 2NXZD 2PYED 3Q1SH 1YEJH 5EPMB 1KJ3L 2AITA 4Y4KC 5EC1B 5HGGS 1T66D 1CICC 1HILA 5E99L 3SQRA 5J1SC 1WTLA 1ZJBA 3DO3A 1KGYE 1RP9A 2OM5A 3VA6A 1SQ2N 2ZKWA 3QH3B 2CO7B 3I02B 4LP4A 3BP6A 3MRIA 1HOCA 3K6DA 3PWUB 2R4SH 4YZFF 3V0VB 4F1SA 2APBA 3US1A 3T04D 4JKWA 1CF8H 2AKRA 4KPHL 1NBVH 4CKQA 4HJJL 3OKDB 4W6XB 3PHAA 2VMFA 2BDNL 1GSKA 4LLVB 1COBA 4P5TC 4EKJA 1IL1A 1QSFB 3DROB 3BP7A 4MA3B 1J87A 1MCCA 2GTWB 3C6LB 2R7EB 3TESA 1G6RL 4HIXH 4N1CA 1J9SA 4LQFH 4DT2A 2XWZA 1FH5H 4PWIA 3GXTA 2GSMB 5I74C 5JHAA 1KJ2L 4BZ1A 5L6YH 4AXWA 4C57C 2WQSA 4I88A 4JO3L 2AQPA 3RWGB 1JF6A 5D7LA 4NC1E 3N91A 4MS6A 4XB3A 4XAKD 3ARPA 2ZX8A 1Z2KA 3V95A 1O7SA 4XGZB 1R24A 4ISVA 3V4VL 4PRIA 4M5TA 1FFRA 1R3HB 1YYML 1MFCH 1I4FB 3IFNH 4HZAA 2X05A 5HHOA 3PUUA 1MDAA 4AGMA 2XY2A 3UX9B 2Q7YA 3KPMA 4XMVA 3I3BA 2YN5A 4MAUH 1RK1A 5D4HA 2Y06H 1G5AA 5E5MB 4P3DA 5D6DA 4RIRB 1RZGB 2B5IC 4HUWA 5GS1C 4AY0A 2IQ9L 2ED6A 1PMYA 2R1WB 2ATAA 2YD6A 3TH3T 2Z8RA 1S4IA 4Z3HA 4LEXH 4YFDB 2OMVA 4KGJA 3CWGA 1HJCA 5DC0A 2VZOA 3RNKA 3RTQB 1I7RB 1MCNA 3IN0A 3TWCL 4RGNE 5GRXG 3UTPE 1RI8A 5D55A 5DHDA 1JZJA 3IJEA 2W8CA 3AJ7A 4HSAC 4ZOAA 4PJIE 2JKLA 1BLNA 3WEOA 2ROYA 2VMEA 2W94A 3VXMA 1KT2B 1W91A 4Y5XA 3IDMB 4CC4A 3BPCB 3P54A 3QXWA 4LPUA 1NC2D 5E03A 3MUJA 3S34L 1L9RA 2DMKA 4JN2B 4K0OA 4PV9A 3HB3C 3MA7B 4XMTA 5KTEH 3ZT6A 2VE6A 1VEMA 5I1AB 4BD4A 1JWUB 2GITB 4G9DA 1PLCA 5CO1A 3TCLA 3FQRA 3E6HB 4LF3A 4CNIA 2WP3T 1ZAGA 4BZYA 5I16A 2P5EE 2W80C 1JMXA 2EDWA 1KFGA 2OSLA 1EEQA 1TVDA 3IPBA 3PGDB 3BIBX 4I9XA 1ZRUA 4ELMB 3LB6D 3KWWB 3HZYA 2FTAA 3HG1D 4BBWA 1U3NA 1UZ6F 4DP4X 3FFDA 4PY8J 4M43H 2ENPA 1JFQH 2X2UA 1IM3D 4R5VA 1MCQA 4N2GA 1IGYA 2HYMA 3CC5B 5DLLA 5MHSD 2IDQA 3LH9A 3WXVL 1XDTT 3L4WA 4P2OD 3V6ZA 1YUHB 3NCFB 1BQLH 2VXQL 4PGBA 1BAWA 4NZUL 3WNLA 1HINL 3WNOA 3OHXB 4R26L 4RA0C 3OG4B 3FSAA 4JG1H 4OFIA 1UA7A 4QOKE 1RZJH 4DP7X 1SOKA 5BVJA 1OAKL 1HS6A 1FFTB 4TVUA 5D6DC 5HHPB 1NDMB 3WHE1 2XZCL 2V5MA 1I8MA 1CXEA 4M1DL 3G6AA 1INEL 3B1UA 1LO5B 4JY4B 5L4FA 3GPSA 3R1GH 1RJYB 2ZYIA 2C5DC 2HMID 4NRYA 2JFCA 1C7SA 3PV6A 3RVWC 2Z7ZA 3JWNE 3CK0H 4AIZA 5IWLA 1QASA 4MNQB 1V55B 3NAAH 2VDPL 4OQTL 1XHHA 1E5ZA 4P2RB 4A39A 2JIXD 3ESPA 4F27A 3DJZA 4RNRA 2R0WH 2PP9A 3DXAE 3VD0A 4BUGA 4UQBA 4QHKJ 4Y5XC 3T2PA 4JFQA 4RDQG 4CC4C 5ESAB 2NY0D 4FKKA 2IBZX 2VDQL 1DLHA 3P77A 3Q5TA 1F42A 3W9DB 4YLCA 3T71A 5BOZG 5HDBE 1WA1X 1MWAL 3TYFB 5BCAA 1ONQA 3NIGB 1PKQE 4IRSA 1LO2H 1XGQB 4E2OA 3VO0A 1S7WB 2JKXA 2G60H 4K8RD 4HH9A 2YRZA 1N59B 3DRQA 1L3NA 5J06A 2BP0B 3DUUA 3UH8A 2VLJD 4TSAL 1L9SA 4HYTB 1OOAA 1L6ZA 3UAJC 2E9IA 3GSUB 1A1NA 2DTMH 4PJ9A 1DBBH 4FFZL 4YPJA 5IMMA 4AEIH 3ZZLA 1BMGA 1PIGA 4AE0A 2GY5A 3B2UD 5BNXD 1TYEB 4P2AA 1A9BA 4X4YA 1AXTH 4G43B 3SPHA 4XVOA 4GS7B 3OV6A 3O4OC 4YHKH 3SSGA 4FFYA 1JPST 1NGYB 3X1NA 5INCB 4HS8L 2XZQL 4OZFA 4BGLA 3QZPA 5CU5A 5JR1H 4B9JA 4X5XA 4N0CC 4XPFL 3PABB 4GQRA 3T6QC 1DJSA 4MQ7B 3TJPA 5BV7L 1MHPH 3U7YH 4MCZA 1J0ZA 2XHNA 3AUWB 4PBXA 5DS8A 4NKIH 2I24N 2TRYA 3OZLA 3QS3A 3O2VH 5IWLC 4XBPB 4BYHA 4NFBA 5I8OH 1T21A 1FYTE 1OEZW 4ODWA 2XDHA 1NLBL 4TN9A 1KJVB 1Z7JA 1AGEA 4PJEA 3B3IB 2ZOLA 3VGAB 2F5BH 5DHYB 3L5XH 5AVWB 1D6VH 1DEEB 1QSED 5TF1H 1NGXB 1AD9B 1WFUA 4NQUA 3LNGA 3HS9A 2EINB 4XC3L 1T5WB 5K93A 4F2FA 1FZMB 2H1PL 3L4XA 3K6FA 5E9DB 2E9WA 2R27A 4Y8DC 1RMFL 4IRSC 5KS9E 3DI3B 4XO8A 5ABDE 4ZFZB 4U2YA 1L9TA 4KK6C 1CE6B 4P99A 4EI5D 1CYXA 3WMQA 5AKRA 4N2DA 3HUJE 5C0IB 2J5LB 4WGVB 2WCSA 1GGCL 4UNTA 1E6OL 3CN4A 2XQYG 1AZBA 4U1HA 4UQDA 3HLKA 4PJ9C 1EVUA 1JRHH 2K9UA 3GSNA 4NNYB 3UTTE 1FG2B 3T3PE 1WRFA 4M62L 2RQ8A 4RAVA 4DZBA 5E56A 2LLGA 4ZMPA 4P0DA 4QGYA 1CG9A 3HI1A 4HHGA 1UWXH 1QFWM 5CUSH 4KRNA 4CSSA 4I2XB 1ZLWH 3LN5A 3VW3H 3K8KA 3ZDYE 3ZKMC 2MOGA 3QISA 4PN6A 5C09A 4RFOH 3QUML 5LGYA 2OXHA 5EEUA 3O2WH 5SWSB 1ET5A 4BH8B 4JQVA 5JQIB 3P4NB 4UANA 1UTDA 1S7VB 1IT9H 5HHMB 4AV4A 2R23B 1NC4A 3EYQD 4PUBH 3HC4L 5DJXB 3BISA 3O3BA 1HHGA 3U1PA 3NFSH 4LHUD 3BGMA 3OF6D 3QFJA 4KDWA 2ZXQA 1JPEA 4QRRB 3S36L 3ULUF 2DQCH 3QWQB 3NTCH 3F7KA 3V5DB 5EUKA 2YBRB 4OF7A 5B21A 1N8ZB 2KH2B 2RCSL 3CXDH 4MTMA 4AK1A 4ZXBA 3WNNA 2YEZB 2VQ1B 3AW5A 3CLEH 5EORH 3VXNB 5AB1A 4XCEB 1CD1A 4O58H 4R5XA 1I3RA 5KVGL 3KW8A 1ZTMA 4S1SH 5DJZA 3T1FB 3A22A 4GG8B 3TVMD 2YIHA 3H9HA 2DEWX 2VQ4A 4HUMB 2ED7A 2G2RA 4NSKB 4XMPL 4FQ1L 1M1SA 2XNAA 1T3FA 1FRGL 4OJAA 4OZGA 5HP5A 4YIQB 1IGTA 2K4WA 2WLJA 1T7VA 3VFMB 4E41B 5GZOD 1WBZA 4PLJC 4GSDH 4E0RA 2YRLA 4TULL 3N1FC 1LO4L 2L4OA 4XPHL 4IQHA 4Y5VC 5IK3B 2J44A 3V0WH 2B14A 2EH8L 2JB5H 3QUXB 4FTVA 1X7QA 4NWUH 5E2TL 2WLMA 1DVXA 4JO5A 1Q9LA 4YSUA 2XOTA 2XT1B 4W4NA 4JKLA 2NW3B 3HNSH 3UBFA 2NY1D 3V10A 4MAYD 1UWXK 2R69L 3M6DA 1R9FA 3X11B 4CU6A 2EXSA 4Y1AD 2V6HA 3L5JA 3DOHA 4W9IC 4UM8A 4NNXB 4PB9H 5HJBA 5CF3A 2W81C 4GIAA 5CILH 4YS4A 5BMFH 5IR1A 4UOJA 3DOSB 3GC3A 3LV3A 4MDIA 3N50A 2D9QB 4H8PA 1K5NB 4AGOA 4GQQA 2VDMH 1HE7A 4JO2H 1YY9C 3JT0A 1YYLH 4JO1L 4JQVC 1DQJA 2V3FA 5AVYB 5B38A 4PGJA 1P9MC 3FTYA 3KXFD 1T7YA 4H40A 2CDEA 4WTZA 4PJGF 4FADA 2Y5TA 3RY6A 4D0DA 3DURB 4LBEB 1WBYA 4MSWB 2FWSA 3BAEH 4CU8A 3MXWH 2XWJB 4GMTL 1NFKA 1HDMA 4HWEH 4ZXBC 2IJ0C 1FCGA 3EKCA 1M42A 4J3OH 1CFTA 5E6RB 3WV0A 3V52L 3GHEH 3AM8A 1IEBB 4XAWH 2DIJA 3NSDA 5IJVB 5LGKA 2OBGA 4DAGL 1RPQA 2F53D 4O9HL 4K3EH 1FJ1B 4M6NL 2DD8L 2AS5M 3D12B 4G2AA 3VB8A 1RSYA 2ZCKL 4ZUUB 4PJ5D 2M2DA 4LFHG 2NTFB 1F86A 2OV0A 2WXQA 3IPFA 4WEEA 4NJ9H 2BS9A 2ORBL 3Q8EA 3APFA 5T1MA 3BO8A 4YHNB 1XCQA 1HHHB 3C5JB 5GZND 5DVLA 1PLGL 4UM9A 4LLMA 1YEIH 1GZPB 2ZKHL 4QPEA 5JPNC 1C8PA 1ZXQA 4F8NA 3LH8A 5JUEL 1E4KA 3IJSB 3ATFA 1OE1A 4XE0A 1U8JA 4GLRI 2WD0A 3B37A 1OCWH 4A7UA 4DVRL 3O9WD 2G5RA 3DNKA 1AP2A 1OO2A 2NNAB 4NN5C 2YXFA 2FO4A 2YA0A 1TOXA 4NO0D 4AGQA 2YQ3A 5I17A 1RZIB 2P3YA 5F88A 2JJVA 3ALWA 5LCVL 4J6RH 1A3RH 3JV0A 3AGVA 3RKDC 5DJ6B 4GXFA 4R2GD 2NY3C 3FB6A 3TA3D 3QUZB 4N6QA 4WWKD 4G8GA 4KO6A 4RVBA 3SKUD 4QNPF 4HGWA 1L0YA 1U4EA 2JJUA 1RKRA 4OCRH 4OTXH 1EHNA 3BD4A 3MRLB 3DJSA 1CFQA 4QY8A 2H45A 4JZOB 3RY6C 1KB9K 1IJNA 4TVPH 1OQOA 2MQ3A 2IGFL 3KJ4B 4ZMQA 5FO8A 1T22A 3QS2A 5BVPL 4URTB 1CT8B 2RACA 4YBQD 4QRQB 4BFBD 3QHZL 1OALA 3TS8A 3JV4A 1UYWH 4XHQA 3EHBC 2DQDL 3G6JF 1F3DH 4ODHL 5AWNL 3UC0L 3IGKA 1G7HA 1M3IA 2ZX7A 1USZA 5CIPA 1GYUA 4NOBA 2I25N 3BH9A 4Z7AA 4AMWA 1KCUH 4HSQA 3TT3L 3DJRA 1YEDB 3B2MA 5LJYH 3PQYA 1LP9F 1XF5A 4UBDC 4QXGL 3OGOE 5BQDA 5IFAH 4ACPA 4WFGD 1CDUA 4MQXD 5D5MB 2YAEA 4IEFB 3BZEB 4EAEA 4P5SA 2ROXA 3BZFB 2MCPL 3JV6B 5AQ0A 4K8RL 1UACL 4DPRA 1EQWA 1RIVL 4XMXA 1LNUB 1GIGL 3MNVB 1E7UA 3L4TA 4Y16D 5D7JD 3VG0H 2CCVA 1BA9A 4U49A 4OFYA 2VLLA 4F8TA 4LAQL 3UTQA 3IDIB 2UY7A 4PP1C 1K8IA 5E7BA 1CZ8H 4O51B 1SYVB 1TTRA 1N0XH 2IXQA 4UT9H 3SY0A 2OJZL 4HIPA 1Z5HA 1F5WA 2RAMA 1A02N 1JNNH 3FQTA 3MFFA 3SO5A 5FUZL 1NAMB 3TBVA 1BECA 1F45A 2GAZB 2VXUL 5A6LA 1WAAA 2IH8A 1PL3A 5I0ZA 4NQCD 3U1SH 1RZJC 3ATEA 2C9AA 3HW7A 3IS0X 3Q6FA 4NAMA 3FO2B 5HGBA 5C07E 1SVZA 3LEXA 3FF8A 2KI6A 4B41A 3CSYA 3IWUA 5EZJA 4BE5A 3MCG1 2ZOOA 5H35A 1EAPA 3GUTB 1N64L 4X9BA 2HVJB 1ZDQA 1OK0A 4ZFFA 4EIGB 1AE6L 2EE2A 4W9GC 5B7MA 2QPEB 1TETL 4LVHC 4A66A 1LE5A 2J57A 5JIIA 4QCIB 2YD1A 3OKOB 3X3FL 2B0SH 3RB7A 2EE9A 4E9LA 3ZLQC 1JBJA 1NFAA 1C1EL 2VDRB 1T1WB 3I75B 1VA9A 2UY6A 3KLDA 4X6CE 3O4LE 4JJOA 4P2QD 1PY0A 2I9LA 3C8KB 3HC3H 3QWNA 4FKEA 4MXQD 1J5IA 2QQKH 4RSYA 4FG6C 3MRDB 3BQUA 5EB9A 4EIBA 4P3WA 3IGAA 4X7CC 5DZVA 3HC0B 2P42B 3H4FA 3VX1A 4ZMYA 1T4KA 2AXFB 4QXTA 3OR7B 5D1QE 1IGML 5JNYB 1OGTA 3H6JA 3V6OE 2V33A 3GZOA 4LLQB 5IQLA 3RWEB 1UCBH 1IC4H 2CGYA 4EN3D 4HF5H 4Y0GA 1S8DA 3ECVA 3NABH 1BWMA 4X98B 1DDHB 3I85A 4G8EB 3RAJL 2DM4A 4OCWH 3LN4A 1PY4A 4K9JA 2DQUL 4H8UA 5AOMA 1WCBA 3HE6A 5ID0A 1KLFB 3IU3A 3WY1A 3ETBJ 4ZFGL 2A83A 1T89A 1VGKB 3B6SA 3FOMB 3FRPA 1NAKH 1GXEA 4IBLT 5BO1L 4BJLA 5TDNA 1EJ6A 1ULVA 5DFVC 4JFFD 3CFNA 3D3VE 4PJHB 5C0DB 5L2KE 2B5IB 3S88L 4WHDA 3NIFE 5GS1B 3CZKA 3D85D 2CALA 4J12A 2X4NA 4NUJB 2CRZA 1N5AB 3O0RH 3G6DL 1SPDA 4LPYA 1OZUA 4AZ8A 5K59F 3PREA 5E8EA 2CHWA 3HPJA 1HILB 2PYEE 4IGBA 4ZMWA 5HPMA 3GSWA 2KLTA 3WO4B 1KZQA 2MCMA 5J3HC 3TBYA 2HLFD 4X5WA 3BP6B 3MRIB 4UTBL 1HOCB 4XMLL 4HUUA 2NYYC 4HIEA 5H37H 4M7ZC 1GY1A 2AKRB 2YPLD 3FJTA 1E9PA 3GBML 3U25A 3MLRL 4FHKA 5I8KL 3MRPA 5HYQA 2C9SA 4ANVA 1JZ8A 4PD4K 3CHRA 1OTTC 1IL1B 2YMXL 3CQFA 1MJUH 3GHBL 3BP7B 4Q6YA 1P6FA 3WSQH 1TTUA 3HB3B 1IARB 4KROD 2CGZA 5HYEA 3ZZQA 1NPJA 4I3GA 5AKVA 1EO8L 2QLYA 3BQUC 5BRZA 3VI4E 3FN9A 2OJ1A 2QLVB 5J13C 4LL9A 1JZ3A 2Q3AA 3T2NH 4PJXA 3V5KA 4KY1L 5D7LB 3KWVA 4GEJA 1OAQH 5T3XE 4PCSA 3VX0A 1R24B 2WYTA 4ISVB 3T2LA 2ZKXA 1YEEL 4PRIB 2WPGA 4XAKE 3KPSD 1SM3H 1I1AD 1IFHL 3KVQA 2OR9L 3U9PH 2A9DA 1JGVL 3R0MA 4S1DD 3HE6C 1JG9A 4UOQA 5E1AA 5HHOB 3IFOA 1AHWC 5EEYA 1MH5A 2VSMB 2WKOA