8PAZA

Oxidized native pseudoazurin from a. faecalis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 8pazA00
2IWFA 2CBPA 1JZGA 2YXVA 3AZUA 4M3HA 4DP5X 2X87A 4UF7C 2AVFA 1AANA 3OM3B 3V9CA 4YSEA 5AZUA 3GDCA 1NIFA 4DP0X 2HXAA 1OV8A 1JOIA 3NJMA 1BYPA 4A68A 2DWTA 1AG0A 2VMJA 4E9SA 5E9NA 4G7RB 1NIBA 1NZRA 2J5WA 1V54B 3PCYA 4KOBA 1EHKB 2QT6A 2CJ3A 4L0PB 2AANA 3FU9A 2Q5BA 1ZIBA 1PZBA 3QQXA 5I5IA 2UXGA 2HX9A 5I6LA 4YSPA 3SBPA 4A67A 1BQ5A 4BWUA 4JHVA 2IDTA 1DZ0A 4DPCX 2UX6A 2UX7A 1A8ZA 3FYIB 1SFDA 1ZV2A 4G72B 4HZ1A 4HALA 3CVCA 2OV0A 3NJNA 3C75A 3FPXA 2EINB 4ZK8A 1JZIA 2PPEA 2AZAA 2LLNA 1E67A 1PF3A 2GC7C 4FAAB 1KV7A 2HZHA 5I6NA 2PCYA 1A4AA 1B3IA 4HCGA 3OMNB 7PCYA 2XX0A 2FQFA 1R1CA 4W1TA 3NSYA 4KO6A 2DV6A 1ASOA 4P5RA 1OCRB 1HAUA 1AOZA 2TSBA 2XV3A 1PLBA 4BK5C 3FYEB 4BWWA 1MG3C 3ABMB 5PAZA 2PPAA 4UANA 4BXVA 2DWSA 2A3TA 1NIEA 1NIAA 3PPSA 1E5ZA 1E65A 1SHWA 3V9EA 2Y1AA 4E9QA 2IDQA 4KNUA 3T6WA 4HIPA 3PLYA 5IY5B 3D12B 4WKXA 1X9RA 5LDUA 2EIMB 3T71A 2IWKA 1HAWA 3DTUB 3NJLA 3NJFA 1GS7A 1W6WA 3BQVA 4HHWA 1NPJA 1XB8A 2I85A 2QDVA 2XXGA 1AZCA 1GR7A 1JZFA 5TK2A 2XV2A 5F7BA 5B1JC 3U25A 3BVDB 2YARA 1PCSA 2BW5A 3SBQA 3T6ZA 3FSWA 5EHFA 3NJGA 4P5SA 2FTAA 2YXWA 3TBCA 4GXFA 5B1AB 3H4HA 3JT2A 1JZHA 3PXLA 4YSDA 1ILSA 2EIJB 3AY2A 2GSMB 2UXVA 4YSAA 1CUOA 3EF4A 2GC4C 3S3CB 4WTQA 4DP4X 4HCFA 2CCWA 3QPKA 1QNIA 1KCWA 2FQGA 1JZJA 4N8UA 3TASA 3S3DB 3TU6A 4GP5B 1F56A 1OCOB 4DP6X 1OCZB 1M9WA 1JVOA 1WA1X 2YAHA 1FWXA 5I6KA 3WIAA 5I6OA 2ZOOA 4AZUA 3AG1B 2MTAA 3QJQB 1GS8A 1L9RA 1KDJA 1NINA 1NDTA 4AKQA 1N70A 2HRGA 2J56A 1NICA 1ZDSA 2VW6A 1XB6A 2EILB 2HRHA 3X1FA 6PCYA 4HAKA 2YAMA 1JVLA 1SFHA 2OCCB 1CURA 2DYRB 3UAAA 3NJKA 2BP8B 1JXFA 1VLXA 4JHUA 2WO2B 2JFCA 1L9OA 1MZYA 2CALA 4YSQA 1OF0A 1ASQA 5FC9A 1TEFA 1J9SA 2XU9A 2IDSA 3ASOB 3NSCA 4A2EA 2CUAA 3OMIB 2XLLA 3FSVA 3X2QB 4M4RB 4GP4B 2B08A 2FQEA 4CSPA 1SF3A 2WSDA 2XYBA 2WO3B 2IH9A 2ZWNA 1J5DA 1AZRA 3HB3B 2VW7A 2N0MA 3EH5B 2H3XC 1IBYA 2NRDA 2IDFA 5I6MA 3WI9A 7PAZA 5TK4A 3UABA 4CSZA 3NJHA 1SHXA 1E5YA 2DY2A 2HX7A 2PP9A 2JXMA 3UAEA 4YVUA 3FS9A 3NSFA 4DPAX 4F2EA 5D4IA 4BWTA 4FA7B 1SNRA 3OD3A 2I7SA 5PCYA 1RZPA 2VM4A 3EH3B 3NP3A 4YSUA 2ZONA 4GP8B 2I7OA 1AZBA 2PPCA 4X4KA 2YAEA 5AFAA 3NP4A 4AX3A 4AI7A 4DPBX 3CG8A 5AKRA 1UATA 2PPFA 3NJJA 3ABGA 5B1JA 3L45A 1A4CA 1M57B 5B3SB 1PLAA 4A2FA 1ET7A 1AS6A 4A2DA 1ADWA 3JTBA 1RZQA 3TBBA 1IBZA 1OE3A 2XV0A 2P80D 1J5CA 2X88A 2FQDA 2GHZA 4YSOA 1JXDA 4E9XA 1NWOA 5D4JA 1BYOA 3X1NA 2PPDA 3N2JA 4A66A 1WA0X 4YSCA 3GXUB 1MZZA 4KO9A 2AFNA 1ZDQA 3IN2A 2PLTA 2BP0B 1ILUA 1PMYA 5I6PA 4YVNA 1J9RA 4YSRA 1TKWA 4KNSA 3NJIA 1KBWA 3N55A 1BXAA 4RH4A 3RYMA 1MDAA 3FSAA 4ENZA 1XB3A 3HEIB 5I26A 1PY0A 5B7FA 1KGYE 4YL4A 3WNJA 2JKWA 1DYZA 2BP8A 3WG7B 4DP1X 2OJ1A 5A7EA 3SBRA 1KYAA 3IE9A 4HHGA 2FT6A 1WAEA 4A2GA 4G70B 4G7QB 4N4YB 5B1BB 1OE2A 2TSAA 2Q9OA 3FQ1A 3CDZA 2MRYA 4BDVA 5D4HA 1BAWA 3DIVA 1GY2A 2FT8A 4Q8BA 2IH8A 3AG4B 1QHQA 4QKTA 2GB2A 2EIKB 2YAFA 1PZAA 1ZPUA 2GIMA 2BWIA 3X1BA 1ZIAA 1A65A 4DP2X 1KCBA 2VSMB 2IAAC 1J9QA 3AW5A 4TXVB 3S8FB 1KDIA 2BO0A 3OMAB 3QJTB 1BQRA 4KNTA 1BXVA 3AG3B 2BHFA 3NYKA 3CDZB 4BDVB 1OE1A 3UADA 1CC3A 2IWEA 2J55A 1SJMA 3CVDA 1L9QA 2UXFA 4QLWA 3OQRA 1AS7A 1NIDA 2PCFA 3X1EA 4G7SB 1PNDA 2W88A 1GW0A 4E9TA 3IN0A 4UAHA 3S8GB 1JZEA 2Y69B 1JERA 3ABLB 1HFUA 3ZDWA 2AZUA 1NWPA 1GS6X 1E30A 1T5KA 3ABKB 1AACA 1WS8A 1GY1A 4DP7X 2FT7A 1IC0A 3UGEA 4K9JA 2P80A 2FNWA 3T9WA 1FA4A 2H5UA 4NAJA 2GBAA 4DP9X 1BQKA 1WS7A 3QJUB 4NERA 2UXTA 3KW7A 3QJRB 1ASPA 3CZUB 3QJVB 3SQRA 3ZBMA 1N68A 4YSTA 2VW4A 1PAZA 4PAZA 2J57A 1X9UA 5ANHA 2VSKB 2FWLB 1AZUA 4KOCA 1AS8A 3H4FA 3H56A 1BXUA 1CYWA 1ETJA 2QPDB 3FU7A 3FSZA 1URIA 3FPYA 4AKOA 2XXFA 3ASNB 1BEXA 4E9WA 2RACA 3FQ2A 3GYRA 4E9VA 1PZCA 2H47C 2XVBA 3UACA 8PAZA 4F2FA 1OCCB 1AR1B 2R7EA 5B7EA 3WKPA 1A3ZA 1W8EA 3IBOA 3X1GA 3PAVA 2BP0A 4HCIA 1CYXA 2BWDA 4EF3A 9PCYA 1I53A 3MX0B 1EZLA 4Q89A 2VM3A 3FU7B 4PCYA 3EH4B 1J9TA 5I28A 4G71B 3WKQA 3ERXA 3ZIYA 5F7AA 2YAQA 1WA2X 1AQ8A 1SF5A 3MBWB 1V55B 2R7EB 3NSDA 5I5JA 3FT0A 4E9RA 4MFHA 4GY4A 4KO7A 2B3IA 3FQYA 4AKPA 1L9SA 1XMEB 2BZCA 4KO5A 1AG6A 1JXGA 1ET5A 1ET8A 2PP7A 2W8CA 1GYCA 1QLEB 1GSKA 3S3BB 4YSSA 3KW8A 1W6LA 1FFTB 4E9YA 2YAPA 3WNIA 2BW4A 1NTDA 1OOWA 3G5WA 2DYSB 4GYBA 1MG2C 4W9ZA 3DKHA 1KBVA 2IDUA 3QJSB 2PP8A 1SDDA 1V10A 4BXSV 1M56B 2YQBA 4A2HA 1YLBB 1IUZA 6PAZA 3PAZA 1AIZA 1AZNA 1TU2A 1TEGA 3ZX1A 2GI0A 4JKNA 4DP8X 1AAJA 2BZ7A 2FJSA 1RCYA 2XWZA 3CVBA 1L9TA 3FU8A 5I5MA 1RKRA 1PNCA 2ZXWB 1A4BA 1L9PA 1IKOP 1ID2A 1PLCA 2QDWA 3T6VA 3T6XA 5B1KA 3EHBB 2HLEB 3TA4D 2QPEB 2XX1A 3PAUA 1SDDB 3NT0A 2HX8A 2CAKA 5B7MA 2XUWA 3IEAA 1NPNA 2YAOA 4F7KA 3AG2B 4NB7A 2E86A 2VN3A
chains in the Genus database with same CATH superfamily
4DP5X 2DTMH 1JFHA 2IANA 4LBEB 1A0QL 4WEBL 4JO8A 1BVOA 2DL9A 4HG4K 1C5BL 3GDCA 4RGMB 5AZEL 3RWJA 3V4VL 4DP0X 4EKJA 1H9VA 2UY7A 1BYPA 2HMID 3VQMA 1YEJL 2VMJA 3SPIA 3G6JE 3IMWA 4ZFGH 4FNLH 5KBMA 4ANKA 3ES6A 2R69L 1A1NB 1FG2A 3H2QA 1DJIA 2VZ3A 3ATBA 1VADB 4AQOA 1XSJA 4ATWA 1WZ1H 3WN6A 5GISL 1KZQA 3GB7B 3HS0C 1OHQA 5JIHA 4PYHA 2AQ1A 4A67A 1BQ5A 4JHVA 2P8MA 2EDYA 2NX5E 1YVLA 5FYJL 4D9LH 4ZNEE 3RJQB 2O30A 2UX6A 3UP6A 3UAJC 3GSNA 1ZV2A 2WXNA 3FQXB 1BBJA 1BREA 1XEDA 4HK0A 2EINB 3OKOA 5BRZB 2OTUB 4X5PA 3HLAB 4LCWB 5EEWA 3ZZ1A 1NUNB 3MLWH 1MJUH 1HHGB 1UD2A 2NY5C 3TL5A 2HZHA 2X5PA 1VFOA 3NA9L 1I3UA 4AVHA 4U1JA 3WD5H 3P73B 4NRYB 5GQBA 2AGJL 2JKJA 1HL5A 3EBIA 4H1LG 3EJPA 4N0YH 4TOYH 1AHMA 4FNQA 1CL7L 2C9XA 4GXUM 4UT6H 1A7RH 2GTWA 4NKMB 1WT5C 4XPFH 4G1MA 3IFPA 3QRGL 3QE5A 1D9KA 3KCWA 1TTFA 3B4NA 5JHDE 5EN3A 4Z23A 5FO7B 1KLUA 5H2BB 4YUEL 4HPOL 4XAWL 4G8IA 4HLZH 2PYFA 4HCRH 5D7LA 1N64L 2A83B 3NGBB 3UMTA 4UV7L 1CWVA 3P2DA 3VRLE 5HVWA 3P4MA 1F11B 1I7UA 4LSQH 5KW9L 4HW6A 2LTQB 3ULVF 4FABH 3HI6H 3IGKA 2DDQL 3PGDA 5LLIC 3VM5A 5E2WH 5C0GB 1FVCB 1XF3B 4K7PH 4L4TD 4RAUB 5I66A 4W4OA 5ADPL 4CVXB 5C2BH 3K71A 4IRSD 5F7BA 3V6ZB 4KKPA 1O5PA 3SO3C 2K6YA 2Z8WC 1NCNA 1G5AA 2HJLA 1Q94A 1EMTL 2BDNL 1KCSL 3NN8B 4X6DB 3QZWB 1UOWA 4Z7UE 1KGJA 1KTDB 3AREA 3CZEA 3EW3B 2E3VA 3FAWA 3GT6A 4LLQB 3WXVH 4QHUB 1UT2A 4PLJC 1AXTL 3QQ9C 2WN3A 3ZYJA 3CGTA 1IZJA 2XQYG 1ILSA 4HC1L 1UM6H 2RB8A 2PABA 3HE6D 3M1BA 4KITB 2XN9A 4IKIA 3B7SA 2ZG1A 5KSBA 4MA3A 3CZLA 5J1SC 1N6QL 4NAMA 1J5IA 1NGYB 3PGCB 5AKSA 2BSTB 2V9RA 1T6BX 4UOQA 4S2SB 4DN3L 1XH3B 4B3EA 5EDSA 2ZD0A 5BOPA 2VM9A 2EC9U 4XXWC 4DZBA 1WBXA 2AK4B 2QGBA 5JPNC 4IIQC 5EOTA 2B5IC 4ZW5A 1NQBA 1TKWB 1NAKH 2LU3A 3D52A 4MNQA 1P5VB 3T04D 5I1JH 2R1YA 3SKNA 1GJUA 3FB7A 1SLWA 4MX7B 1S7VA 3MRJA 4LRIA 3TESA 1M7IB 1L6XA 4JK0D 4R3SA 2KERA 4OZIA 3QDJE 4U3SB 2CNYA 3H0TB 5DTFA 5HHOB 4FF9A 4ZPTB 4NZJA 3FTWA 5CIPH 5J5EA 2UWEF 1F8TL 4HQQL 4XWOD 5AUMB 2GEEA 1EUUA 2IOMA 3WIHA 1DUYB 2Z31B 2K0RA 3HS0A 3IB4A 4XVUC 1KJ3L 1J0ZA 1F3JA 3BP7A 1CXLA 1U95B 3RWDB 2G5BA 1JNNL 3RAJL 2O6EA 1L0QA 1M2VA 2Z9TA 5KSAD 3E3QC 1MFUA 2RR3A 4U1MA 4X2UA 3GLZA 4MQXC 5GS1A 3RRQA 4NO3A 4LHQB 5KZCD 2IF7A 1A14L 4PJFF 4GI9A 4EJ1C 1QYGH 3HB3B 3Q8AA 2VCOA 2F7RA 1MREH 2NY0C 4K73A 32C2A 2XOTA 3BIAX 3PWNA 3ZKXC 4X5WB 4C59B 2BVQB 3SJVE 1AQHA 1W72H 2CNZA 4JZOB 4WFFE 4YVUA 4TKWA 4HDIA 4ZQKB 4GMTH 5E94B 5JR1H 3DURB 2OSYA 5FYLD 5HYJA 4FA7B 3LN4A 3VJ6B 4HAGA 4N0UE 3DGGB 1K8IA 4R2GD 5PCYA 3WFZA 2AI0H 3ARSA 3CAFA 3I75A 3SE8L 1DO6A 4PCTA 5J7CC 1AGCB 2N7SA 5IFAH 2K4AA 5GS2H 1RZGB 4IK6A 3PABB 2YGQA 4DEUA 2DF3A 4LLWB 5BO1L 4DPBX 3U0PB 5AKRA 3L3DA 1KENH 4FFVD 3LPPA 4OFQA 1GOHA 4FFZL 1QTSA 2YA2A 5G5DB 2VXQA 3FZUC 2QVFB 4BV1A 1SXAA 1YEKL 4K2UL 3SE6A 4DK6A 5LBSA 5D5MB 3K7UA 2FEEI 5B3SB 1W16A 4HBQA 1KV3A 1KB5A 4JDVA 2XRAL 5FUZH 2Q8AL 4DOHB 5KTEH 3V5DB 2BRRH 3QCVL 2DEXX 2DWEA 4I0CC 4NBZB 4W9IC 1G6RH 2HFFB 2IPUG 1TXKA 1I7ZA 3RDTD 3IXAB 2XV0A 4JREB 1GKOA 2P80D 3C5ZD 5I8EA 3UTTE 2Y5EA 4P49A 5GS3A 3V0GA 1NWOA 1PCXA 4K5LA 3OHXA 4UI2A 1WA0X 5LB1A 2JCCB 3IJ9A 2EVFA 3TF7C 3AROA 4HJ0D 1Q9OB 2F18A 3BJLA 4L2YA 1Q9LA 4OF3A 4NP4H 4WUUD 2VITA 1TENA 1RVFL 4I85A 4OIFA 1F3DJ 3JV6A 4J4PD 4DQOL 1W0VA 3IGUA 1HZLA 4X4ZA 5EC1A 2FJFB 1U3YA 5E5MA 5KJRH 2V5MA 3IFNL 1C5CL 4ZRGA 3REVB 3TCLB 3AABA 4N5EC 2Y7QA 1QFWI 5TDPB 4RH4A 4KQ3L 1MDAA 4PRHE 4IIQA 5JPNA 4PJXB 1OM3H 4Y19D 2R0ZH 2GSIB 2WQVA 3CHQA 4IIZA 4RWYL 3P54A 1QRNB 3WJLA 3LS4L 1ZHKB 3HC4L 3TNNB 3CU7A 4OY9A 5DK0B 3UERA 2AS5M 1RP9A 2WCSA 3HNTL 1A22B 4W4NA 5ESVA 2FATL 4PTUA 5EOQL 3LIZH 3FU6A 2W60A 2OJ1A 1M42A 2N3JA 2GK0A 4JQVC 3WBDA 1OM9A 2HKHH 3KBPA 4ZYKB 4YXLH 3D09A 4G70B 5BXFA 2HTKC 4U05A 2IOOA 1A7QL 1PYWB 2XTLA 5B1BB 2JELL 2OMXB 3DOIA 1OE2A 4HYTB 4NRXA 4FLRA 1XWVA 3VO0A 2XTJB 3CIAA 1NLBH 1G0DA 2FSDA 4ODSH 4PP1D 5HPMA 1N18A 3RTLA 4QKTA 5LCVA 2GB2A 3U2SB 1FPTL 5TDOA 2AJXH 2XBTA 2WBJD 3DV6B 4XHQA 5DYFA 3TBSB 2CM6A 1DDTA 1FZOB 4NQVA 1BCIA 4AT6B 2X2IA 3IDJB 1L9NA 5C0IB 1J0KA 1U8JA 1MRDH 3WMSA 1JNHB 4YHMH 2RA1A 5D2LF 4NKOB 3TO4C 1RLBA 2ITCB 3BGMA 4X5XB 5E6UB 4MD4B 4YN3A 1TOXA 2CXKA 3N85L 4HMDA 5C0RL 1AS7A 4ELKB 4HWZA 1CE1L 4ZW7A 1M6OB 2P49B 4ODXA 4JHAL 4FERA 1P5UA 2D9CA 4TNGA 3L1GA 4M29A 3VACA 2W80C 1Q90A 1T5KA 3PQYB 5DMKB 4JO2L 4MQ7B 3LMJL 1X4ZA 1R34A 1I8KA 4OGAC 4URTB 3UFIA 4DETA 1H19A 1V3KA 3K8KA 2JLPA 3CFTA 4LEXL 4N0FA 4R7DB 5CSBA 2ORBH 4XVOA 1DP0A 3GPEA 3NIGB 4P05A 5DJZA 4NAJA 2BIHA 4FA8A 2FL5B 1BQKA 4MDJB 3UJIL 1CIDA 3G3LA 5KJ7E 4NPYA 3PHOA 3SKMB 4NC1E 3DPDA 3BO8B 5I18H 4O58L 1HI6A 4L8BA 5E8OB 4NNXB 4CNIB 3L4YA 5KYWB 3L2LA 4BUGA 1DBBH 5AOZA 2P7TB 5D7JB 2EYTA 5DRNA 4YDZA 2VZTA 3Q9QA 2FGWH 4ES8A 1JGUL 5EU7E 4TQEL 4PG9A 5H35A 4HJIA 4BK4A 2XVKA 3R18A 3W2DL 3FQTA 2XXFA 3HCVB 2OYPA 3KYKL 3MFFA 4L4JA 1WHOA 2XVLA 4ZFOB 1RU9H 2M1KA 3BFOA 2VJ8A 3CZNA 1W8EA 5B7EA 3U7AA 1YG9A 2GJPA 2Z1KA 1CXKA 4YGAB 1SN0A 3E8UH 5F1NB 3RWFB 5C3IA 3MDJA 1I9EA 4E0RA 1DVFA 2JQZA 4HVBA 4XI5D 1EO7A 4LEEA 4M5SA 4N9OB 2NY1B 4Y5VA 5DJDB 1WA2X 1X4YA 4LKXB 4QJ3B 3D2UB 2R7EB 1PFOA 1XAKA 1YMHB 1HXYA 2DJSA 1QSFA 3KVQA 4F7CA 5BS0E 4JJOA 3TYGL 2CHXA 2ZG2A 2Z7YA 4AKPA 3QEQE 1WH0A 1ZHLB 3H6JA 3UXFA 3B3BA 4LHUD 3QUHA 5CGBA 5EOCJ 4GNKB 1SVZA 3V4PH 3VW3L 1VKXB 4WFGD 3US9A 1KCRH 2WLIA 4OH2A 4UB0H 3VG9B 3EGDB 3KPRA 1KJMB 4W9GC 1O9WA 4E68A 2PWFA 2VXTL 3QNYB 2XZCH 2ENYA 1IAIM 3D3VD 3CFDA 1CGYA 3RX8A 2IDUA 4BUQA 1RZJH 1OK0A 2J25A 1J18A 3UH8A 4RQQB 1UXMA 1TEGA 2GI0A 3PL6C 2X89D 2EE2A 1YUKB 4JUSA 1IJNA 4P2OC 2X4QA 3UPCA 2L8AA 1SOQA 2B16A 3FO2B 1A4BA 1E5BA 2EEFA 4HPYH 4O2FB 3THML 3PJSA 4KMQA 1L9MA 4M5ZH 2XX1A 3P4NA 1NOFA 1IKFL 1WBYB 3DGCR 4K07A 4M8UA 1DEDA 3EOYG 3NZ8A 2DQCH 2ZOKA 4H8UA 4L3ED 1RJZB 2J8UE 2YUXA 3NZHH 3MBEB 1ZA6B 4HIIB 4FKEA 3EJZC 4G8EB 5AZUA 2VDMH 3VFPB 4U0RC 1QSEE 5L7XH 1EVTC 2YXFA 1QFUH 2EDBA 3K80A 3IAPA 1DN0B 3NZUA 5F8QC 5F7KC 1J10A 1LEIB 2H2PC 1QG3A 5JYMA 2VIRA 5E6YA 4M9PA 2OXGB 3M17A 4BZ1A 4TTDC 3Q8BA 3SBPA 5EU5A 4KVNH 5IB3B 1DZ0A 2EXYD 5HY9A 5D55A 1RPKA 3DUHA 2TAAA 3VDCA 3L16A 2ZKHH 5AW7B 4HZ1A 4MJ5A 1FN4A 2D73A 4HUVB 5I19H 1EXUA 4UTAH 4YHIB 4LF3A 2D7MA 4W9FC 2HCZX 1J5HA 5HI3D 4ZK8A 3FUJA 2PPEA 5HGGS 4MKTA 3VWJB 1XVSA 1Z5HA 1CFVH 2WOBA 2YHGA 1XGRA 5IROD 2GC7C 3U6RA 1ZS2A 3BSZH 3OMNB 3ZUNC 2XX0A 2Z34A 4BM7A 4UM8B 3WN5C 1PKOA 1I85C 2VMFA 2YWZA 3F05A 3ULUD 1JBJA 1JMZA 1KXQE 1OCRB 1AOZA 1ZLWH 1CVRA 2IPKA 1TMCB 2CIIA 3BHBB 5C09A 1K6QL 3WMQA 2IPTL 1I9IL 3IVKA 1U91B 5HI5C 4UANA 1E4KC 3MBWA 3CFUA 5LAXB 3O4LE 2YUZA 2A3TA 1IGML 3VFOA 4A2MA 1NIAA 2NXZC 3BAEH 3FO1B 1I8LC 1NBVL 1E65A 4K3JH 3NACL 5E4EC 4HU2A 2YUVA 3BAXA 2ESVE 4PJ8A 3RGHA 3D12B 3I9GH 4J3UA 1DANU 5JMRA 1G7JB 1NBYA 4MA7L 1RZFL 3BMVA 5CP3A 1BFSA 2FX7L 1T6VN 4QHKJ 3CUPA 3T0XA 3UZQB 4Y1AA 4RGOL 4G83A 5J1AB 4JHZA 2IWGA 4P3DA 5C0AD 1CG9B 5T1MB 3APNA 1KIRA 4PP2B 1QQDB 3A23A 5CJQL 1CFMA 5HGAB 4OF7A 5IV2A 2ZZUT 1BD2A 5HGBB 4WTXA 3QAZB 1I7RA 4ZX5A 1TUPA 2CKBA 1AGBA 3MLXH 4DEWA 5JHBA 4R5XA 2EDMA 4ZSOE 4UM9D 5DWPA 1URZA 3MUHL 2GSMB 5I75C 1GMEA 5IHWA 1LWJA 5BVJA 2G0KA 1MHEA 3UTSB 1KYOJ 2B4CL 2QV4A 4G8GB 2JJVA 1H8OA 1WWWX 3GSNL 1OAQL 5ICXB 2WTRB 1OEZW 1RP8A 5T33L 2ITFA 2MJWA 3EBGA 4NQXA 1QFPA 5CSZB 4LASH 3M86A 1C1EH 4NM4H 4OZHF 4LLMB 5GSVB 2OR7A 4GAJH 1YAIA 3NABH 5MI0B 1CGUA 4X6EA 3A47A 3HE7C 4AENB 3GMPB 3E0GA 1OIOA 1Q1JH 1G7MB 4Q6IB 3OMZA 1QP1A 4KK8C 3MRPB 3VXPA 3UGUA 2XIDA 2ZF8A 3A67H 1GS8A 3TA3B 5K59F 3EJUA 5TDNB 2Z0UA 5JPMC 4ZUTA 2RHEA 1B0GA 4DPRA 3BT2H 1BEYH 1R46A 4XN5A 4L0YA 2BINA 4PGCB 3X1FA 1CURA 2BCMA 4XHJC 4B97A 3SE4C 2F1BA 4Z76A 2WWKO 1BLNA 4NQUA 4DGWC 6TAAA 4OFIA 5DZOA 5DZPA 4C54A 5I1LB 1MHCA 5EF3A 3M07A 3GZPA 4XXDA 1WYJA 2GW5A 3TWYA 4QHMB 1JZ5A 5GRVK 3WY2A 4YSQA 4OGYH 1MCNA 1TQBC 4U1SA 4PJFE 3EADA 4LE8A 3MKGA 3X2QB 2VLLB 2O5YL 3NIDF 1D7CA 2HN7A 2JI2A 1ZEAL 2WO4A 3DRQB 1BLIA 1CDBA 3HNVL 4JFYA 2C8NA 2VDOH 2Y3AA 4G6AC 5BZWA 3Q7JA 4RA3A 1R9FA 1IM9B 2ZSWB 4L9LB 4JO3L 3DROB 4BGDA 3ARFD 4K8RH 4MAYB 1SYSA 3DA0A 3BPCB 4M8QA 3Q05A 4P9HL 4ESKA 3GGWA 1T0MB 1E5YA 1WZLA 1YPZB 2PP9A 4HUKB 4QHLA 1QZ1A 4HUUB 2E7LC 5HDQH 2CBMA 1QWUA 1I3GH 3GNML 2YPLB 2ZX8A 2F74A 1U4FA 3HZKB 3DUSA 5DJAB 4OI8A 1UCBH 1I8LA 2BY0A 1OSZA 2XKNA 4KUZH 2X4TB 4FJZA 2BP3A 4PJCB 3QZWG 5D1QA 1K3ZA 4NQED 4MZRA 3EBAA 1WVZA 1KTCA 1YQ2A 5DEGA 5DD3L 2G60L 3CFCL 1DBJL 3JZYA 2QSCH 3SN6N 2I9TB 2GG1A 4CC1A 4O02A 2J44A 3ZHFA 4B7IA 4OLYH 1O9VA 1QTYT 5C8JB 4JFQB 4DEPB 2B1HH 4DJMA 3QP3A 3ABGA 3LZPA 3PWJB 4BSVB 1BZ9B 3UTPD 5KYXB 1A4CA 4X42A 2BPBA 2ZIDA 4IRJB 1HHKB 4F7EB 2YD2A 3V7AG 2KYIA 3VX1A 1I4FA 2IAMA 3BAKA 4OTXL 2GJ6B 4MB5A 1E4HA 3HS8A 3P11L 2KH2B 1X5JA 1DEEB 4OCYL 4FLSA 1QSZA 4TPRH 4WI7A 1BYOA 2VXSH 4XNYL 2PPDA 3QARA 2WGNB 3WIHL 4EI5A 1OWWA 3FCUB 2EUXA 3G9VA 2A73B 3EFOB 4JRXE 4WV1B 1G7LA 1XIWD 4K9EL 1GZPA 2PW2B 3ILDA 1M7UA 1NAMH 2WKOA 3NCCB 3V4VB 4A7SA 1CFTA 3DMMB 1O6SA 3NEOA 4PIBA 1ZHBB 5IT2L 4LLUA 3AS1A 3LS5H 4XH2B 2ZCKH 4KNSA 4HFWB 4ZTOL 4J23A 1YY8A 1DFBH 2O72A 2CDEB 3DETC 3D07A 5CD5C 3P4OA 5IGXH 1WG3A 1DL7L 1P7QB 1PX4A 2XPZA 4ZMVA 2P45B 1OP4A 4PSPA 3K6SA 4B53A 4IBTA 2VABB 3U36A 3NBNA 3G6JA 2ROXA 1UH4A 4L1SA 3ZL4L 4FA6A 3LHPL 3IXTA 4UT9H 4AQ1A 4B0MB 4P5TB 4PYGA 1L3WA 3B2VL 3T1WA 2Q2EB 4FYRA 3KYOB 4HT1L 1QUNA 2H2SC 4P9ML 5D7KE 3GC3A 4X6DF 3VI3B 4XZUA 3FT2A 3SE4A 2EC9T 2EC8A 1AI1L 4KPHH 4QRTB 1S7XB 1U8CB 3RIKA 2WP3T 1EFQA 2I32A 3U4BH 2MRYA 5J06A 4KXBA 1GCYA 2QQLH 2QJDA 4LARL 4Q8BA 3DUUB 3QFJD 2XYCA 2RIKA 4X7SH 1J05A 2NY6C 4KQ4H 5D8JH 3UBFA 2J1KA 1CU4H 2FEDD 4F27A 4LIQL 3LRKA 4Y2OA 5K39B 3F6IA 3A24A 3QUGA 3EO0B 3WMPA 4RX4A 4HS6A 2EACA 2QPFA 5LBSL 1SJMA 2K7QA 4XBGA 4M3JA 1KB5L 5TF0A 3U46B 5HYSB 1YMME 3VFWB 4ODVL 1A6PA 1Y07A 2X1QA 2YLHA 1VB9A 3JWDC 3DLQR 4NN6B 4WGWB 4WK2B 4YDNA 4ALAH 1OTSD 4UNUA 5B39B 4HD9A 3FCBA 3QG6A 1WFIA 2Z91A 5JOFB 5JHDA 4AEHL 4GUPA 4QF1A 3TBWB 5KBDA 5GZOD 1BMZA 2AJSL 2ZOTA 4YDJB 2ADGA 3G5XA 1WS8A 1FZMA 5IQ9B 1ZTMA 2VDPL 3DOSB 3GF8A 3SIKA 1MLCA 4A7GA 2GAZA 3C5JA 2Z4QB 1WS7A 1RUPL 1YYCA 4GSXA 3QFDB 4PEEA 1MJJA 2PYEE 1U8NA 3WFCH 2VOTA 3R7RA 3ZZQA 2EVIA 5EZIH 4KK5D 1UASA 1A6VH 5MENE 3K0YA 4AE1A 5I8OH 5JXAL 3BPOC 3RVVC 2J57A 1X9UA 2ZG3A 4DSYA 4YFLF 3MX0A 4H7VA 4Z7UA 2Z3FA 2CK0L 3FU7A 4YHOH 4NUMA 1LWRA 3B9AA 4XPTL 4XMKH 5IMOB 3V8CA 4YHZH 3CC5A 2IO5A 5I9QB 4U7KA 1RJLA 3FQ2A 4M7KL 1AR1B 4FQJH 4JKMA 4M4PA 4OCSH 4P46A 5FUOH 2WQWA 3BZFA 3QS3A 1ZV9A 4HPHA 4HUCA 1YEWA 3GBNL 2X9YA 5JIQA 4HCIA 4TLTA 3MO1B 2VE6B 3QDGB 4DKDC 4QJ4B 4Z77A 1INQA 1T0PB 3WSQL 1GHFH 1EZLA 3CFEB 3H9SD 5LCVL 4PCYA 4HCRA 3VA2C 4QRRE 2Y7OA 4MMYB 3L5WB 4JPVL 3RNQB 4ZFZB 1UFGA 1M1XA 3NFSL 1IZKA 5F7AA 4GUOA 2ZKMX 2JI3A 3I84A 5J0BA 4HX1B 3O9WD 2CLVB 5HVHC 5SWZD 4PY8I 2YZ1A 4KO7A 4F8NA 3QEHB 1ZLSL 2CD0A 1UZ8B 3SPGA 2OM5A 2KLTA 3FCGA 4TUJB 2HPTA 5IK3A 1CLZH 2Q6WB 4DWHA 2Q7NA 1C7SA 3RJDA 1R5IB 3EJQA 5D5MF 4HOZA 2VLRE 1FFTB 3I3EA 3TZVC 1VGKA 3RWGA 1HZHL 1IEAB 3QI9C 3IDMB 1MWAL 1QO3A 1WQVT 3GSRB 2QSQA 2OMUB 2HKAA 5CZVH 5JDJA 4RFEB 4MGXA 4YGVB 5E6ID 4JFHD 1YEHH 2R1WB 3LXCA 5EOCH 4R4BA 4PWFA 4LSDA 4AJVA 3RX9A 2JCCF 1UWFA 4XGZA 3X3FL 2F8IA 4Y16B 1A9EB 2WQRA 2IADA 3C6LC 2WXHA 2CGRH 1QEWB 1L9TA 1VEMA 4Z7OF 1EJFA 3CLEL 4H88H 1KJVB 4MCMA 1AO7D 5F7EH 4TQHA 4NQSA 5D7IB 3DVGA 3IM1A 3T6VA 1HILB 5DGQA 3U7YH 2HLEB 1VACB 4RMTA 2ZUUA 2VRQA 4PJXF 3GSUA 4U1GB 5L4MA 2W59A 4PJ5B 1MQKH 5EU6E 5EO1A 3AG2B 3SJVA 4OSUH 5CAYB 2IWFA 2CPUA 2H9GB 2F68X 2FBRA 2XACC 3HG1B 4GG8B 4LCIH 1MIML 4E9LA 5CKAA 1MCOL 5DMGD 4G82A 1IE5A 4N0UA 5FXCH 1CK0L 1JOIA 4A68A 3P9MB 5CIPA 4K71C 4PJ9B 4E9SA 1J87A 3UOAB 4KKAD 5T3XH 3S0PA 3MRFB 2J5WA 3ZDXB 3GMMA 3UZEC 5E2VH 2WZAA 2GJZB 1E4XI 3B5TA 3OAZH 2AANA 3WHE0 3F12B 3FU9A 4G1EA 4OJCA 1U33A 4XMLL 4DF9A 3KYAA 2JJWA 4UIMA 4ORGB 4WFHE 3R8QA 4JFPB 1FYTE 4PD4K 3TFKD 2C9UA 4IBLT 4OJFL 1FNLA 4LB8A 3AJ7A 2SEBA 1TJHH 5ADOL 3FULA 5E0FA 4ZOCA 3N40F 1JZIA 3KGRA 3VXUE 3HAEG 4HXAL 4YBQD 3UTTA 4TVPH 3WNOA 2ZTBA 2P28B 1J5OL 1W72A 1RUMH 2B59A 4I4WA 5SWSE 4CVZA 1XHHA 4WI5A 3GMQB 1ASOA 4P5RA 4GG6E 2HG5A 3PFUA 5AWNL 1EFXA 3FB5B 1PZ5A 4LVHB 4DO4A 2AABL 3RPBA 1CDGA 1JV5A 1N0XH 4M1CD 5ERWB 2DH3A 2EIEA 3UTQB 1R19A 4PUBL 2PPAA 2J5LB 4BXVA 3AU1B 1CT8A 2CDFB 1DBAH 3ZE2B 1YECH 5EZLB 2DWSA 3IJYA 2FAUA 5AB2A 2VLJE 4GBXD 3NIGF 1JGLL 1IAOA 3LEXB 5DJ8B 3QIBC 4HJEA 2DEYX 3STZA 4Y2DB 2E4FA 3TT3L 2CZNA 4KNUA 4CKVX 4Z7VE 4NGHH 5IY5B 3RTQC 1I3RA 4LCYA 1OCWL 5MEPA 4OF6A 5GGUA 3CFBA 1JNLL 3VFMA 1PQZB 5GJTH 3NJLA 4K94H 4F3FA 1NDGA 4U4IA 5L8KB 5A2KH 4AEFA 1GR7A 3MRGA 3PJLA 5T3ZD 4LL9A 1G6RA 1IQDB 1JPST 2HRLA 3LKSA 2XDHA 3PP3H 3WELA 3TCTA 4UYQA 5D1XD 4TVPE 4MS8C 3GKZA 1E5UI 2FWOB 2EXSA 1S9VA 1TQTA 4GRLD 5T1LD 5B38A 2DKMA 1I31A 2VAAA 3K1KC 4UU9B 3SPJA 4WTZG 2YD1A 1I1CA 5FM5M 4BZ1L 3ZMEA 1Y0LA 4OZHE 3OV6A 4B5EA 4BKLA 3HZYA 4LVOB 2FJHB 5FM4A 2XZAL 1KCWA 1R3HB 4QRBA 2IH1A 5GSRA 3TASA 2F54E 2R4SL 4XP1L 2QKIB 3IDGB 4PJ7F 4APXA 2Y25A 2P8LA 4J3OG 3VWKC 1F3RB 3V4LA 1OCZB 1ZD6A 1M9WA 4N2FA 4NNYB 5K59E 3JYCA 3WXWH 3E2HC 3W0WB 4B96A 3MV9B 3ESNA 3N40P 1OPGH 2MPAH 3LIZA 1IGCH 5C3TA 1VCAA 3C2AL 3P77B 5I6OA 3BEWB 3OG4B 3IETB 1IE4A 2GCYA 4XNUH 1J0IA 1CXEA 4JPIA 1DQQB 4YEEA 4LLAA 4MD0A 2ZX9A 5LN4A 3HFMH 4Z3HA 1JWUB 4I3SL 4IOIB 2YAMA 4G8FB 5I1HL 3UZEA 2C26A 1XR8A 2A6IA 5EV7A 2PO6C 4F7TB 5EZPA 4G7VH 3HW7A 1HQRB 1I7TB 4MDIA 1G0XA 2VDRB 3B7YA 3SD5A 2YN5A 4F80A 5KAQG 3EXJA 1G87A 1R3JA 3D85A 43CAB 4XPHL 5E00A 1BX2B 5L8JB 4QWWD 2EDQA 1IGIL 3OF6D 4A2EA 5BQ7B 1JDAA 5KYYA 4P57B 3JV5A 4LQFH 1S7QA 1MFBH 3HG5A 2APVA 1GGYA 5DJ6A 3S35X 3TXAA 2AJYL 3S36H 4IKLA 3NDYE 4KKCC 1T04A 3QCUH 2W0FB 4BD4A 1CXFA 3BKJH 1YEEH 5I1CH 3ATFA 4ZW8A 4JZNB 2OL3A 1FORH 4F2MB 4XCYB 2CKBL 1N2RB 2QVTA 2WIIA 3F5WA 1UJ3A 2J1ZA 2WW8A 3L5XL 3FTYA 3U7WL 1FJ1A 3NJHA 1SHXA 1HYRC 2HX7A 1PIFA 4GKSB 4BEIA 4LCCB 3VTTA 4L9DA 4JMXA 3ULVC 2P46B 3WTYA 4EO5A 1HIMH 1RURH 1UB5B 3QEUB 5GS0D 1RZPA 2WVUA 4M6NL 3RFZB 5BS0A 3L3KA 3VDAA 3NP3A 4J5VA 4EQ3A 1PLGH 3QEQA 3MODH 4LKCB 3O6FD 4M62H 1RMFH 1N4XL 1NGWB 5BRZE 1XD1A 3QJFA 2HFGH 4OV6F 4Y88A 2NUTB 4Q9RH 4DTGH 4YPJA 4AI7A 4MQSB 1E4WH 4WUKL 3H85A 1JS4A 3L9YA 3QORC 5J6SA 2WUCH 4DUXA 2FBJH 3HE6B 3ARPA 1M3JA 1HU8A 4U6HA 1TT6A 4NENB 1IEBB 2EDDA 1WFUA 1GIGL 4L4VB 3AS0A 2E9JA 4Z7WE 3FQWA 6FABL 4AEIL 1ZE3H 2NNAA 1U8MB 5I1EL 1HN1A 4KZDH 1DANT 3C8KB 3T0EB 5HVGB 5HXMA 4I13B 1UVQB 4C83B 4H8QA 1ED3A 4FQ1H 1GYVA 4OU3A 2JLLA 1G7PB 1UM5L 4ODWA 3Q9PA 3K91A 4JX0A 1EQWA 1IAIL 3CXHK 2RFXA 4OI7A 1KT2A 5ACZB 1OK8A 3VWKA 5IFHL 3ALXA 2J8UA 1ROWA 1MVUB 2DI9A 4UZUA 5E8NB 1MCKA 1NGZB 1T0NA 3S3JA 5DHVH 1LEGA 1Y18B 5I26A 2NY7L 2UZYA 1QFOA 3V4PA 1VFBB 3HKFA 3O3BB 3T2PA 4K7PY 1ORSA 3D34A 1L4IA 4YL4A 4X6DE 3WNJA 1QSEA 5CUSL 4G9FE 4A7UA 1WIOA 1CICB 1U92B 4H0LC 1MY5A 1HQ4A 1DQJB 2J2ZA 3T0WA 2FT6A 5ABAA 1LYQA 2EH7L 3FHQA 3UJJH 5CNHA 2NZ1A 5JW4R 2O4EA 4G80B 2L3BA 4WDIB 1CBVH 4MXQD 2WNKA 1BBDH 4OLUH 1BAWA 4X6BB 1QBLL 4AVKA 4F8LA 3MRNA 5DVLA 5LXGL 2FT8A 4HBCH 4UQ3A 5KZCB 5EIIA 4M4RA 4ATTA 4IGBC 2FR4A 5ANMB 5CJBA 4U6YA 1Z9SB 4M7JL 4O02L 4IU2B 3T09A 4ORZC 1FVDB 3BRGC 2FBOJ 1LLAA 1X7QB 2X41A 3EDDA 4XPAH 3QJXA 3HNSL 3CDZB 1AQKH 3GSOA 3IS1X 2Y6SC 3ZYIA 2J55A 1L9QA 4U6VH 1J1OH 3DVIA 2QZ5A 4JRWA 4JO4L 3HHRB 5CEYA 1F58L 3WUWA 1GOGA 4GOSA 2R23B 2ZICA 2AQ3A 4DKTA 1KC5L 5LGHL 5CEXB 4I9WD 1TG8A 1JPGA 3FUIA 2Y24A 4U1KA 5HHOE 4WENB 1I1AB 1NFDB 4TLKA 4D9RD 4EQ2A 3ECWA 5CWSB 2WQXA 1MCIA 3WNMA 4I88A 3S5LA 3GRGA 4XN8A 5KVDH 4MNGE 12E8L 5DLML 3KLAA 4IBZA 2ESVA 4M6OH 4EDWH 5IQ7L 4KI5D 3RWJB 5CR1A 1SYVA 4YS4A 4V1DA 3HZVB 4RBPK 3HI5H 4L8SA 3Q1SL 4XBMA 5F1OB 1PL3A 1PKQE 4JM2C 3ES6B 5F7LB 4WJ5A 1Q0YL 1FG2B 1ACXA 2EECA 1KFAH 4UTAA 3S7GA 4NYLA 1HL8A 3FFDA 3RB5A 2GFBB 1CDYA 1YEFH 1E2WA 1CO1A 1BJ8A 3C5ZB 3QORA 3M45A 2AF2A 2CCVA 4FRWA 2VDKH 4N2IA 4YQXH 5LGKA 4WW1A 4OGXH 4HF5H 2X1OA 5TE6H 4TUUA 5C0BD 1XZ0A 2PWEA 3X3GL 1N3NA 1E27A 3QUZA 2WD0A 3GSNB 4ZSOA 3GPSA 1ZOXA 1BBJB 4WWKA 5KBLA 4HK0B 3OKOB 5E1QA 5AG8A 1SN5A 4NO0D 2NNCA 4NHUA 4YDLB 4XC3H 3OC5A 5HD8D 1OW0C 3SDDA 1YPZF 1HHIA 5EUKA 5F3BA 1VRSA 2NCMA 4FP8L 4U1JB 5IBLD 4FD0A 2YRPA 3QIUA 4JR9H 5KVDE 4QXWA 4ZXBC 3SGJC 4AIXA 4JFDD 3QQ3B 2WWKT 3ZIMA 4OJEH 4I8DA 2CJUL 2Z0BA 2ENQA 4PJCF 1WCQA 3LKOB 4OFPA 3FT0A 1D9KB 3BWAB 3L4VA 2DTML 4M1DH 1T1XA 1VGEH 5D5ME 1KLUB 4F1SA 4HISA 1FNAA 5D7LB 2OXHA 1ET8A 4NFBA 1N67A 3V0EA 3P4MB 1I7UB 3BEVA 1GSKA 3WJMB 4D0CA 1KCVH 4FNLL 4ZFGL 2VDNH 5IVZA 4KQ0A 3L9RA 5FA3A 4J8RA 2QGDA 1WZ1L 3MXVH 4ZO8A 2DQJL 5I66B 3MJWA 1NKOA 2WBJB 2V5TA 4APQA 1I9RH 3MRDB 4WO4B 1A3LH 3IK2A 1P2CA 4C55A 4Z7OE 1EBPA 3WJJA 1BOGA 1CFNB 2DQGH 2HJLB 4D9LL 2N4IA 2Y2WA 3DX1A 3OZLA 1HL9A 1HHJA 4IGBA 4PJFA 2MCPH 1AIZA 5IVXE 3IAQA 3AREB 3O8XA 5K1JA 2BZ7A 3G08B 3IDUA 3RX5A 3ULSB 3UO1H 4N86A 3FU8A 3MXWH 4QRPD 4JUTA 4PJXE 1ZT4A 1X7TA 1EJ8A 5FWQA 1QRNE 1EJOH 2BMKA 3M1BB 3MLWL 4IKNA 2XN9B 3QUYA 1OLLA 4Y4FD 1D2PA 3WD5L 4NLHA 3SD2A 2C34A 2QQKH 5D93B 4TOYL 4N0YL 5AB9A 3BW9A 3C75A 1PSKH 2X4UB 4NUPA 4P2YA 4UT6L 4KXZH 1A7RL 3GRBA 3P9LB 4XPFL 2VLKD 4DZBB 1WBXB 4MXVF 5DYOA 4TUKL 2PXYC 5B3JF 5BCAA 2ZXAA 4N2KA 1M6UA 3PV6B 2XTJE 2GVYA 3GMNB 4MNQB 4NQDB 2F7PA 3D0LA 3QWOB 3EHBD 3RUGB 3VI3F 3FFCE 4HCRL 2F19H 2R1YB 2VLME 1WISA 3FB7B 3LRLA 4LSQL 4D0BA 4GRMA 2V5YA 3TN0D 3MRJB 3AB0C 1OPOA 4FABL 3HI6L 2ZQKA 5E2WL 2H1LM 1PY9A 4K7PL 5A2LH 2A9AA 2DBJA 3CVHH 4OFYD 1KUMA 3ARGC 3MLPA 2P26A 4JFFB 5C2BL 3IDYB 2WYIA 1DDHB 3O45A 2ROYA 4KMLB 1F3JB 2AV1B 2QSTA 3BP7B 4Q58C 3Q5YA 5CZXD 2G5BB 4FXGC 5I1GH 3CNKA 3WXVL 3FRPA 5KVFH 2WTPA 3FCSA 3MNWB 1SJVA 5I6NA 4WWOA 1X5HA 3GHPA 4U1MB 1U30A 4D9QE 1J8KA 2YEVB 1UM6L 3MNMA 3BUQA 4NO3B 2WLHA 3G04A 1LO5A 4JRXA 3MNVA 1L0YA 2QV2A 4AIEA 1N12A 3WIFA 3GBEA 3NIGE 2NNXA 1MCQA 3KWTA 1F00I 3NRFA 4CMMB 5EWIH 4Y4KD 1YEIH 32C2B 3BN9D 3PWNB 3SE3C 2O5NA 4LHUB 2ZP0T 3QIWC 4R4ND 5TQ0H 4I2XB 2DJUA 2J6WA 4HDIB 2VQ1A 1DHKA 4MVBD 1WEJH 3V9EA 4H25A 1MRFH 5IMKB 4P07A 5HYJB 5IB5A 2IDQA 3QNFA 3LN4B 4BHUA 4OD3H 1N0LB 2XKUA 4EVNB 4FADA 3L9EA 1NAKL 1NL0H 1K8IB 3EYSL 2WKLA 2X1WL 5I1JL 3I75B 3ME0B 4W9CC 1MFAH 3J07A 1SRDA 2FH6A 1RAMA 5J8OA 1MHHA 1YNLH 2IQAA 2FVNA 2IWKA 3DTUB 4OW6A 1A4KA 2YA0A 1GS7A 3RHWK 2D31A 2VR8A 1XF4A 3KDPB 1D5IH 4X8GA 4DAGH 1KXTA 5AG9A 3VXTA 3HUJF 4KY1L 4YBLC 4DUVA 2Y1VA 1P4IH 5E7FA 1ERNA 4KRNA 2WUBH 3T3MB 4FNUA 4KROC 3QHFH 1N5AA 2YXWA 1DQVA 2WNXA 1JZHA 1U3HB 1KB5B 4JDVB 1KGUA 3VXSB 1JG9A 4KXAA 3AY2A 3DO3A 5F7UA 1NAMA 2UXVA 2IXQA 1UB6B 2GC4C 2BK8A 2KPWA 4XVJL 3BVVA 4PJ7E 4YIQA 4XO5A 4Q9CA 4WTQA 3KPQB 2PR4H 4HEPG 4DGYH 2OSWA 1I7ZB 5HGHB 1VIWA 3SDAD 5IHZA 4JRFA 4J2XA 3SCMD 4AJ0A 2R4RH 3OHXB 5E9DB 2CO3A 1MAMH 3B5HA 1SHMA 1QYGL 1YMMA 2VDPB 4OGZA 3QUMH 1MREL 1HVXA 4ABQA 3PWUA 2WYHA 1MI5D 1S9WB 3H3KA 3L5IA 2RTTA 1WICA 1UM4H 3NPZB 3VFNB 2OMTA 2WYZA 1FFNB 3MMEB 1A8JH 1W72L 4BRVA 4P4RA 3KLDA 4FNPA 1AXIB 4GMTL 2Y7QB 5JR1L 2PNDA 3V7MA 3O4OB 4JFOB 2RQEA 1MF2H 2AI0L 2VUKA 3CFKB 3SDXB 6PCYA 4OJDH 1NGPH 5ESVB 5IFAL 5IP4A 5DJYA 1ZT7A 4PTUB 1SDYA 3U1SL 3ZOAA 4XN7A 4O2EA 1UADC 1E90A 5D9SA 5MENA 3JTTB 4JZJB 2H45A 2G9HB 5M95B 1KENL 4GS7B 1ZLUK 3KWWB 4NRXB 3L7EA 5E5UB 2EKSA 5D7IF 3AMKA 5HPMB 5FUZL 5KTEL 3QYMA 2BRRL 5HJBA 3L5HA 1QHPA 4HFUH 2Z7UA 3VD0A 1G6RL 2IH9A 1YEDB 2DLFL 3ZO9A 4BBWA 1OP9A 1NM4A 2EDKA 4DHLA 1E9OB 3EH5B 2RALA 1LK2A 4JAMA 2LFEA 3BPNB 2RJMA 4IBYA 4CJ1A 5I6MA 4AGPA 2YSSA 4GH7B 3BGMB 4QRRA 3HA0A 4NP4L 3FB8A 1PZSA 1T1WA 1BM3H 4QCIA 3SE3A 2V7NA 3V52H 4ODXB 4D0DA 5KJRL 2I7SA 5C6TH 3QIWA 3ZDXF 3DOHA 5EZJB 1P5UB 3SPVB 3RWEA 1Z2KA 1INDL 4MA1B 2HJKB 2R2EA 2AKRA 4PJHB 1OM3L 5DK2B 1MWAB 3CBKB 4X50A 1I8KB 2M83A 3UAJD 1X44A 3ETTA 5FR3A 5CJXC 1U0QA 1ZVSA 4S11A 5DJZB 2X4SA 5I73B 3B2DC 2NY2C 2VLRA 3LIZL 2YPKB 4XBPA 3NJJA 4IHOA 5CEZH 2ZUQB 3EYFA 5D72H 3RIAF 1DCLA 3WTUA 1OAKH 4NPYB 5EO9B 3L45A 5HGDA 3VVWA 2HKHL 3MLRH 1MCHA 2Y1YA 1HI6B 1YSOA 1NCTA 3N1FC 5F44A 3NVQA 1H6UA 4HIHB 1DO5A 1ADWA 1EGJH 2EYTB 1NLBL 3RY4A 4ODSL 4FQXA 1B4RA 1XF2A 2CGZA 2V2WA 5H35B 3KAAA 2FQDA 4YDVA 1BP3B 2DQIH 1HCFX 2AJXL 4P3CH 2F0CA 3V0WH 1ITBB 4YO0A 5F70A 1JL8A 1A64A 5I16A 1E7UA 3ZE2F 1TTGA 1W8NA 1MRDL 3ZMRA 1MNNA 1NEUA 4YHML 3U9UB 5F8RC 1X5FA 3GIZH 3H9HB 4K8RD 2KQNA 3CZSA 5EU6A 3FDWA 4PLKC 1CZ8H 3O81A 3SGDH 4JL1A 3NAAH 2R27A 1TQWA 1R0AH 3RYMA 5BV7C 1XB3A 1HYSC 4Y5VB 2XI9A 1AKJA 1IGJA 3C8DA 4X9IA 1M3IA 1LVEA 3ILPB 4FMVA 4YOKA 4LFHD 2FUQA 1HXYB 5DC2A 1NCIA 5CEZE 3ZVVA 2GKIA 4PRID 3MUGA 4M02A 3WFDH 3E8VA 5L4IA 4XNZB 4L23A 1IL1A 1CTOA 2ORBL 3IE9A 2APFA 4U1NA 5I71C 4XNXH 5LQBH 4PLJD 3QQ9D 1DJHA 1K5WA 4QTIH 4CDGC 4NQQA 4G8GE 2TSAA 3KPRB 1FYTA 2D2CC 4QOKA 5I18L 3FB6A 4NJAH 2DTSA 4I48A 3CFDB 1XX9C 1DBBL 3TIDB 3QRBA 3VXUA 4MD5A 2FGWL 2AEWA 4J6RH 4TXVB 4WK0B 5FX3A 3UPRA 1FLRH 2AITA 3F7YB 5AW0B 1B0RA 5ID1B 3IJSA 3O11B 3PG2A 4JFVA 5SWSA 3NG5A 3QUXA 2X4QB 3TF4A 3QYNA 4GG6A 1AIFB 2A1WL 5AVUB 3WENA 4C47A 1WCBA 3E8UL 1J88A 1DJGA 3APDA 4JFUA 4I5BA 3P4NB 3LRGA 2C7UA 5GRUH 5KVEH 4MMXC 1CDHA 4YK4B 3MOQA 1YN6A 4OCWH 1U36A 4IS6A 4LL4A 1E8ZA 2G2RB 3STLB 2VLJA 4U2ZA 3CMOL 1LE5A 4HJTA 8CGTA 1JCKA 4PJGE 3UGEA 4K9JA 5CFHA 4XVUD 1FL5B 1T7WA 2Z7WA 3SQBA 4I18C 2V7HA 4ODUB 3RWCB 1MCWW 1D6EB 3QJUB 4NERA 1EHNA 4WO0A 1NM9A 3KPSE 5I2IB 1U8OA 3SQRA 3BSHA 3IYLW 1BPLB 2Q1EA 3P69A 4GQRA 3V4PL 1E8YA 2JJSA 1OSPH 4MYWB 4MQXD 2BXZA 2ZF9A 3KCPB 1Y1UA 3VCLB 4UB0L 2FCBA 2B1AH 5EU5B 4ONHB 3M88A 3BJ91 3BT0A 3D8MA 3OXSB 5HY9B 2XZCL 2BS8A 2MSPA 5DFVC 2NY0D 4RGNC 3FPYA 4MJ5B 1R17A 3ASNB 3GMRB 1EXUB 4GKNA 4LF3B 4ELMB 1RZJL 3GYRA 1RUAH 2Y4SA 4ONGH 5KVEE 1BVLB 4IYKA 4M7LT 4OZHA 3VH8B 3NGBC 4F57H 1SN2A 1XGRB 2BP0A 1OO2A 1T89C 2BWDA 3QQDA 4KGJA 3A4DA 4EF3A 5FLVA 4PJCE 2X05A 2LTQC 5DFTA 3U6RB 5JLZA 4L3CA 2F54A 4HPYL 5DD1H 5IG7B 2YRBA 1K2DB 3BUTA 5CCHE 1CD8A 4M5ZL 4EUPH 4XE5B 3SPCA 1DJXA 3IVKB 2YAQA 5GZNA 1UKQA 3MBWB 2DQCL 5I5JA 1G9NC 3PF2A 3N04A 1MFMA 3CE1A 3P0YH 1S7SA 3NZHL 2C9SA 1JWSA 3FZUD 2X40A 3INUH 2VDML 5E08H 1DJZA 1N59A 4PJ8B 1A6AA 1GYCA 2DYPB 5DI8A 5L7XL 4PRAA 4E5XB 1QFUL 2AMGA 4AIZA 5F7YC 5JMOC 2VR7A 5H94B 1OSEA 2A6KB 2VZ1A 5M7QA 2H0EA 5GPRA 1UD3A 1OOWA 3HJEA 3UDWA 3DVNA 1QR4A 4RFOH 3O6LH 1KYDA 1KIRB 2EDHA 4WAFA 5IV2B 3PNRB 2GY5A 4CN1A 2QR0B 1I7RB 1D7FA 1RK1A 2ZKHL 1AGBB 2Q76B 3JT0A 3TJPA 1AAJA 4AV5A 2ZSVA 1C16B 4UTAL 4M5YH 5I19L 1MXGA 4U0QB 2Q7AA 3BGAA 3HR5B 5JQIB 2DMKA 5IB4B 4N5ED 3DX2A 1CFVL 1QSFD 1RULH 4AEEA 4GQ9H 5BVJB 1MHEB 3UX9B 4JRYD 2DLHA 3UYPB 2AW2A 2HRPH 2XUWA 5I0VA 4GQPH 2WN2A 4JN2A 3FUDA 5EFIB 4AQ8C 4IMKC 5A2BA 1VADA 1K4DA 3IGLA 4NQXB 3B7RL 3VI3E 1I1YB 2Z31C 1NOLA 4Z3FA 2DQTH 1D5BA 1R5WA 5IMMA 1UURA 3BAEL 2UVEA 1G9MH 2HTKD 3VXPB 4K3JL 4FI7A 3B83A 4MASA 5E4IA 2KZWA 4ZBJA 3FQ4A 4N6RA 2JKRM 5FV1L 5L2KE 1WK0A 5MEOA 3SKUD 2IQ9H 3F58H 1OARH 1EHKB 5BRZA 1P1ZA 2OTUA 4ZUTB 3SO5A 3HLAA 1B0GB 3I9GL 2Q5BA 4XVTL 1NUFA 1BIHA 1HHGA 1UXWB 2LR4A 4LAJH 3IGFA 5H8DA 3HB3C 3RIAK 4F9PC 4Z76B 4WI6A 3B2UC 4RRPM 4AITA 1IB5A 4QD2E 2IALB 1SFDA 2ZJSH 3OLDA 3TO4D 1LWHA 1B4JL 3MRMA 4JY6A 1AHKA 4Z7WA 3F83A 4DN4H 3B3IA 2XT1B 2VXUH 4X4XA 3MLXL 1M71A 4GQQA 5FCUH 1EERB 3BAWA 3BH4A 4QRQA 3VGBA 5FO7A 4KU1A 3H54A 3MLTA 5I1IH 2X0WA 4JFYB 1NFDF 1HOCA 3LQAC 5BZWB 4ZO6A 4N0RA 5SWZB 3JUYA 4OGAD 4PW3A 5KUMA 4BWWA 2A74B 4RWHA 1MH5B 2DH2A 2GUOA 3KM1A 1SYSB 1KJ2H 2QFPA 5CO1A 5C0GA 4RAUA 1UWXK 4H8WC 2HJFA 4M8QB 1AVAA 2XWJB 4LASL 1C1EL 4NM4L 3GGWB 1GPOH 2VTFA 2Q8BH 1RUQL 2WV3A 4GAJL 2PTVA 3NABL 1SHWA 4C8XA 3GLDA 4YJZL 1N8ZA 2GBUA 2YC1A 1PG7H 1Q1JL 3C08L 3Q1EA 2F74B 5ECJE 4WI8A 3NN8A 2Q20A 4X6DA 2JQAA 5FFOA 2XKNB 3HUJE 4G9FA 3A67L 1KTDA 5F71A 2Y5TA 1HESA 1FLTX 1MN4A 2AQTA 4QHUA 5EO0B 4JREC 5E6IB 3U4KA 4PH8A 5T3XD 2NTFB 5DEGB 2R0LH 2XXGA 1BEYL 3BT2L 3KPLA 3NPSB 4KJWC 4O02B 3Q48A 5DJXA 4CA4A 3KVDD 1PCSA 5AOLA 3SBQA 4AYID 4E2OA 1NGYA 2BSTA 5F88A 4B9PA 3BMWA 1P6WA 3KWXA 1HXMA 5IB1B 1QFWH 5EEZA 4K15A 3JT2A 3EOBA 3ZXAC 4G5ZH 1XXDC 4NWUH 4OGYL 5EF1A 2FYYB 5T1DL 1ZGLM 2X53A 1P5VA 2Z93A 2ZPKH 3DRTB 1GAFH 1S5HA 4B5ZA 5EIVA 2VDOL 4EI5B 2YMXH 4NEHB 5F9JB 3EF7A 2H32H 2VR6A 5F9AC 3TU6A 4PMFA 4MX7A 4XPGH 1G7LB 3VXME 1GZPB 1E4JA 1M7IA 1OT2A 1KTRL 2XG4A 5DEJA 3NRQA 1CFTB 1NH6A 2A6JB 1U6AH 1O6SB 2W5PA 3H0TA 4U3SA 3BCFA 4Y1AD 4ZPTA 2E75C 3OR6A 3PUCA 1KELH 1WFTA 3LB6C 4LLUB 4RSVA 1FGVH 1JK8A 4LOEA 1XBDA 4LHJB 1MOEA 1DUYA 5HDQL 2XTJC 5HHQA 5JDSA 3HN3A 4MNGA 25C8H 1I3GL 3VM7A 1OB1A 1U95A 1J8HD 2D7TH 4WLCA 1UCBL 3ZE1F 2J56A 4KUZL 1Y1DA 3OXRA 2MNUA 2VO8A 4M9OA 4E36A 2BY2A 1XQ4A 2EDTA 1PKQA 2OCCB 3C2SA 3C9NB 3LQZB 4G9DA 5LDSA 2BCKB 4AQ1B 5C08E 4PJEF 5BMFH 2K4WA 2QSCL 1IBBA 2B77A 3PL6D 1QUNB 2Y9RT 2XA8H 4OLYL 4P2OD 1QR1A 3CN4A 1L0PA 2X4NA 3GWJA 2X6AA 4LCUA 1ASQA 3OAYK 1ZK5A 2VISB 2NX5B 5KN5B 3BWZA 4JPKH 2BVQA 3DTXB 2NNFA 1JGEA 1B9ZA 1IFRA 2FQEA 3HG1E 4ZQKA 5E94A 3A6BH 1OT4A 3MLVH 3B9EA 3VJ6A 4XMTA 1AZRA 4N8CH 5GHWH 2DI7A 3EJZD 4TPRL 1MVYA 4GBXB 4KTEH 3D4ZA 4PGZA 4QPEA 1EK3A 1GGBH 4XBGB 3ZDXE 1SUHA 1RZGA 2KZKA 4AL8H 1NAML 3CJJA 1BZ7B 1XCTB 4K23H 3RUGF 2H2PD 1SNRA 3B7UX 5G5DA 3CSBA 3LS5L 2ZCZA 5KANG 2ZCKL 3QG6B 1WJ3A 3D39E 1KN2H 5AVVB 1DFBL 5D7JC 3C87A 1QFHA 4GUPB 4QF1B 5JHDB 5D5MA 4AW4A 5IGXL 5KANI 2ADGB 3G5XB 1FZMB 1YC7A 2X6UA 1PAMA 3W9DB 4RMUA 2PPCA 1OGTA 1O6TA 2GAZB 5JW4M 3EXLA 2WQSA 4G7YH 2BSSA 3IXAA 2VH5H 5CMAB 4GRLB 5T1LB 3FNKA 2P5ED 3OB0K 2W65A 2AJUH 4PY8J 1U8NB 4Q14A 4Z9KB 4PGDB 1T7XA 1JCVA 3AQXA 4KPHL 2Z8RA 4BJLA 1XZWA 5EBMB 3U4BL 1HJCA 1OQXA 2NY1C 4P2QD 5JIKA 3I6LD 2FJFA 2QQLL 2N7AA 4POZC 2EIBA 4Z7UB 4L1BA 5GRVL 3REVA 4X7SL 5HI5D 5IVXA 4KQ4L 5D8JL 1FHNA 5E51A 3CC5B 4PJXA 3TOPA 3C5SB 3CU1A 2NXZD 1QRNA 5HI4C 3IMVA 1ZHKA 3FAXA 4P46B 5C0CD 5IEHA 3BZFB 2EEAA 2DWDB 5K33A 3OJDA 1WFOA 4TM9A 4Z77B 2FO8A 4RZCB 1INQB 4YSRA 1N7MH 3KPMA 3LKNB 1ANUA 3VG9C 2JE8A 1E9QB 4N5UA 1BZDA 4ZYKA 4ALAL 4ISVA 4FQLH 5AKVA 2QEJA 1NMCC 1OXYA 1QHOA 2P24A 1OL0A 4AGMA 3SGEI 1QA9B 1E3FA 3FFCA 2IIJA 5BNXD 4W9JC 3SQOH 4DP1X 5C7XL 5A7EA 4UNVA 3SBRA 2NZ9C 3DV6A 3HZ3A 5IK3B 2VDRH 3TBSA 3T3MF 1KSRA 4AT6A 3IU3A 1U58B 3IDJA 3QDJB 3FSOA 1Y6KR 2IJ0C 2DQHH 4HSAC 3WFCL 3NFPB 1DVUA 1JNHA 1TNNA 3IFLH 3RWGB 2KQMA 5EZIL 4GKZA 2ITCA 4K3GA 1A6VL 4OM1L 4X5XA 3BGFB 3QG7H 5I8OL 1QHQA 4ELKA 3VD2A 2N59A 4YHLH 1ZIAA 4R4BB 5FDWA 3MCYA 2BIPA 2G4GA 4WU5B 3MBEC 5AVYB 2VSMB 2EEBA 4R4FH 1J9QA 4YHOL 2J3SA 1U8LB 4XMKL 4YHZL 2BSEA 3HE7D 1Z66A 3HRZB 5DMKA 4PLOB 5CINH 4B9YA 3MNZB 5HDBE 4FQJL 4OCMC 4KK8D 3D69B 4OCSL 2EP6A 3DVGB 2YPVH 1G4RA 4R7DA 2OLDA 4KKLC 2JSFA 5IUCA 1GHFL 4MDJA 1X3DA 4UAHA 5D7SH 5D7EA 5IB2B 3S8GB 3GSUB 5EU3B 3SKMA 1TZHB 3SJVB 1IC5H 3BAYA 4NT6A 4XHJD 3X11B 1SXBA 4XP6L 3SDXF 4CNIA 3DX6B 3QHZH 1W0WA 2PCFB 3M1OA 4N0UB 4DKFH 3CVHA 3WS3B 3B8YA 1FA4A 5TQ2L 3SOTA 5CIPB 2AERT 5EUOB 3B9KA 4CDHA 3QH3A 3HCVA 4GFTB 2WYTA 3OKLA 5F6IB 1CLZL 2OQJB 5T5NG 4ABVA 4UQBA 2X6BA 3JQOB 2W9DH 1WD9A 4G1EB 4HH9B 4BFFA 3OB0H 4PAZA 4KKNA 4UIMB 4G6AD 2LE9A 4J2QA 1AZUA 4F2ME 1XBRA 2D3LA 1AHWB 3W1ZA 5CZVL 2MWCA 1YEHL 3PRZA 5EOCL 3O2VH 3BE1H 2SEBB 1QABA 3ZR6A 2LFGA 5DJDA 2H47C 1FE8H 1RJYB 4FTDA 4G6FD 4TNVK 3D2UA 1OGAD 4ZUUB 2R7EA 4PJ7A 1KY6A 4G8AC 1M05B 1VZGA 1YMHA 1LO0H 4L4TE 4N8VB 2CGRL 4H0IA 1CYXA 3VFVA 3FC8A 4E41D 9PCYA 4H88L 1F13A 5BQDA 3GZOA 3T8VA 1W72B 1FAIH 4CVZB 2ITDB 4I4WB 1ZHLA 5F7EL 3N6YA 5EEYA 1A5FH 5GGVY 1OAXH 2HG5B 2WXPA 3U7YL 1J9TA 1EFXB 1TYRA 1PZ5B 3HOGA 3QNZA 5FGBA 4NZRH 5D2NE 4P0DA 1VKXA 3HC0A 3APMA 4PJHF 4DH2A 1XSKA 4LESA 1MQKL 3CFJA 1IU1A 1CT8B 2VL4A 4OSUL 3U9WA 3MRQA 1KIPA 4ZAKC 2KLSA 5IQNA 4LCIL 4HULB 4PRHB 4PN6A 4OD2B 3VRIB 2BZCA 1IAOB 5I8CB 3QJHA 4ETYA 2W8CA 3L81A 4C56D 2DQEH 1KXVA 4GO9A 2DM3A 5KSVA 5T3XL 5GGUB 3CFBB 4DZ8A 3VFMB 5E2VL 4XPBH 4HOXA 5D1ZA 2ICCA 1TITA 2F15A 4Y4HC 4F3FB 1JYWA 3FO2A 3QQ4A 1LP9B 1CLVA 3O3AA 4JN1H 3CHRA 4O2FA 1CS6A 1NTDA 4XX1G 3ZGHA 3PHSA 2V2TB 1G6RB 2DQ6A 2QBWA 1DVYA 4NUJA 4M8VA 5MI0C 2E27H 3EUDA 1RJZA 5FW8A 4Q6IC 4NSKB 2A4ZA 1ZA6A 2WANA 5FYLH 4B60A 3D6GA 4YHKH 3V5HB 4G8EA 3TA3C 2WVVB 3DETD 3VFPA 5GIRA 4D3CH 4YDKH 3IRZA 4TVPL 1X7SA 3PAUA 5JNYA 1NEPA 3UEZA 1RUML 5FHBH 4LSRL 1DN0A 4JFZH 5GSRB 2IH1B 2FHBA 4K5OA 5E5LA 1A2YA 1ZLVH 1R47A 1N0XL 3HRPA 1NKRA 1XGTA 2OXGA 3CXFA 5KBKA 2H2SD 1YECL 1IBFA 4N28A 3PY9A 4XO9A 2DWTA 3OGOE 4EN3A 1OOAA 1YQVH 3MROB 1NZRA 4G6MH 2GCYB 4EZMA 2VWEC 4HUVA 2BOLA 4YHIA 1F4AA 4OCRH 4ES9A 3HPJA 4NGHL 3VFTA 1F1GA 1QASA 3QXDA 3U82B 2NY6D 3VWJA 2C1OA 4MD0B 3I2CH 4ZMWA 4BFNA 1H6FA 5C0BB 1P4UA 2UXGA 5H37H 1RZKC 5GJTL 3E1ZA 2B2XH 3BP5A 4K94L 43C9A 4L9LC 4LLYA 3HC3H 1XR8B 2A6IB 2BLFA 5DUBA 4MAYC 4LL1A 1EO5A 3MHZA 4Q9BA 3CPUA 5FYLE 4IOSD 3BHBA 3S6CA 2ZCLH 5ILTH 1U91A 1R3JB 2IGFH 3D85B 4QKXB 1T5XA 3M46A 4GUCA 5E00B 1EO8H 3CWGA 1RUKH 1U8IB 3EAKA 2VR3A 5KYYB 2ZUVA 4KK6C 3MYJA 3RDJA 1FL6A 4PV9B 1Q9WB 5A6IA 5F3HB 2DV6A 2I27N 2O93L 1NA8A 4C4KT 1T04B 5BO0D 4KKRA 3WEBA 2X9WA 3UROR 4ONFH 1P6AB 4HJ1A 3TH4T 2OTPA 3S37X 4AZ8B 2NZIA 1LDSA 3R0MA 3WLWC 3HIZA 1E40A 1UA7A 1UJ3B 3F5WB 4LQ1A 2OJZH 4KJQC 4IDLA 4U2YA 2ARJA 4DEPC 2RD0A 1FJ1B 4J3WA 5J1AA 4KVCH 3RLSA 1EJ6A 5GXBB 1CG9A 3WXWL 4PP2A 1CF1A 4TMPA 1QQDA 2MQGA 3T6WA 2YRLA 1OPGL 1SOXA 2MPAL 1IGCL 1JDDA 1EHAA 2FD6H 4G3YH 4IRJC 1QVOA 3T6QC 1KB9K 1H6EA 3CHXA 3PP4H 1J8SA 3RVVD 2WCPA 4O2CB 4LMQI 1NC2A 4M61B 5LDUA 1HH6B 4XNUL 3JVGA 3QEQB 2WXGA 3AM8A 4WUUE 1W6WA 3T1FB 5C9JA 1NPJA 2H41A 2R83A 3K6NA 3HFML 2YD4A 5B1JC 3LPWA 2E9IA 1MHPH 1MSPA 4WV1C 4G8GA 2GEQA 3TC9A 4GLRI 2AMUA 4ELMF 5ICXA 2QLYA 2WTRA 3DMMC 2ZWKA 4RIRA 4Y19E 3ZPDA 4BQ6A 5CSZA 4OZFG 3RHWF 2J8HA 4K5MA 4LLMA 3OKMB 4U6HB 2HFTA 4WJG3 4Y4FB 1IBHA 3IKCA 2Z35A 3ZTEA 4EXPX 1WRFA 5INDB 3EOAB 3GMPA 1SEQH 5CKGA 1G7MA 3MV8B 1MFBL 4Q6IA 4UBDC 3V55A 3NEXA 3V8OA 2J72A 3S36L 3CX2A 3DGDA 5F1KC 2MQ3A 2ZNXA 3TA3A 6CGTA 3QCUL 4JJHA 2X3AA 3RL1B 2ITEA 3BKJL 5I1CL 4P5TC 1AXSB 1ED3B 3CPLB 3GXIA 4ODWB 2X2UA 2W94A 4PGCA 1FORL 2E4TA 3HMWH 4KMTH 1J8RA 1RI8A 1W91A 3ZE1E 3MREB 1U8HA 2FO1A 1KN4H 2J8UB 3QJQB 5I1LA 3TZVD 3TN0B 2YD8A 3QI9D 1KDJA 1T0NB 1HIML 1RURL 2ZYHA 3E9UA 5F93C 4PJGA 1UWEL 4OQ1A 1LO4L 4PJEE 3V4PB 1F4XH 1ORSB 4PRNB 1CLCA 3U2JA 3FO9A 3GLAA 4WIQA 4YE4H 1HEJC 4DNLA 1PLGL 5F89B 2N1KA 3MODL 5BRPA 3H55A 5L6YH 1A3RH 2VLLA 4M62L 3RU8H 1RMFL 4F15B 2GQHA 3DRQA 3TWCH 1A1MA 2HFGL 3KPSA 4JY5H 5D96B 2J2ZB 4GSDH 3H3PH 3C6LD 3T8XB 4Q9RL 4P5MA 4Q97A 2F5BH 1E4WL 3D05A 1IM9A 3RILA 3FONA 1RJCA 1O7VA 2ZSWA 2A6DB 3DROA 4L9LA 2CMRH 5IBUB 4DQAA 5BW7A 3M8OH 4N1CA 3VB8A 1LEKB 2WUCL 1FIEA 1FAKT 3O2WH 3BPCA 4NN6C 2IDSA 4P2CG 4WI0B 4X6CE 3NSCA 3MRNB 2AP2A 3I50H 5EIIB 4M4RB 5J9PA 3FTZA 3OBAA 4HUUA 5KJ4A 2FR4B 3D4CA 3DPBB 2YPLA 1BJ1H 5LNEA 3KPNB 5C07D 5DJAA 4KZDL 1ZVNA 3R4DA 5A16A 4RFNB 5L2JB 3WTXA 2BERA 4NQDE 4PJCA 4GJTB 3GSOB 2P48B 4P23A 3VQ1C 3PS6A 4FQ1L 5CEYB 5JOEA 3JWNH 2I9TA 2R0WH 2VDMB 3T0BA 1T22A 1G9HA 5J13B 2QSVA 4OD1H 5I74B 4FKHA 4JFQA 3O4LB 4U1KB 2E74C 3PDDA 3PWJA 1BZ9A 4JVUA 5IM7A 4X9YA 3DARA 3BWUC 1INEH 2ATAA 3KLAB 2NQCA 1QFWM 1JPTH 2ESVB 5JIIA 5AFAA 3CHPA 2IH3B 5CCJA 4MZIA 1AR1C 4KZEH 1ZT1A 2AEPH 4L8SB 2C1PA 5DZ9A 1DEEA 3BQUC 4WJ5B 5TGBA 5B1JA 5FECA 1HHHB 2A73A 3FU5A 4WV1A 4WSKA 3UJJL 1DBMH 2WXRA 1TTRA 1CBVL 2LU4A 4HWBH 3V4VA 3GSQA 3FU3A 3G5ZA 1E6JH 3SCMB 4HBCL 3UBXG 2CRMA 2WXKA 4F5CA 1N3NB 3QUZB 2R69A 2X88A 4HFWA 4E9XA 1J5CA 3L1EA 4ZSOB 1SMAA 4I2XE 3JWNE 5HHMD 3UBXI 4WWKB 4EUPA 2KS0A 1P7QA 2E76C 3RWIB 1NMBL 2E9GA 4WFGE 3L4TA 4QRFA 4FMFA 3A21A 1ZDQA 1CDCA 4XPAL 4O51A 2VABA 4N2HA 2CGYA 3QIBD 5BZZA 3DNKA 2Y22A 4FE9A 5FGCB 5GGTH 1AQKL 1USQA 4DFHA 4WHTA 4JPWH 4U6VL 1J1OL 1OZTG 2LABA 3D3VE 3FN3A 4P5TA 3RTQD 5AOJA 4LPCA 3QIUB 5A2CA 3N55A 1PGRB 2ADJB 4PLNC 3VI3A 4X7TA 3OL2A 3QWQB 4MNHA 1KGYE 1S7XA 3TLRA 1RV6X 2XQYA 1N10A 1JZ7A 3EJYC 4B9CA 1ITCA 2K78A 1T1XB 5KVDL 2ENPA 4HA1A 4MS8D 3QBTB 4Y16C 4M6OL 4TVUA 4GW5B 3VNYA 5DCCA 3KEHA 4CBPA 4DIXA 3KBHE 4K3EH 4NPKA 3HI5L 5K39A 3BEVB 5F7FA 1WAEA 3LZLA 3RJOA 5IVZB 2EDJA 2QMKA 4L3EE 1QBMH 5DVPA 4XP5H 4YLCA 1KFAL 4AQAB 5FA3B 3ULUH 4J8RB 2IH8A 4U1GC 3SKJH 1YEFL 4APQB 3VFWA 1P2CB 3IF1B 4YQXL 2VDKL 5HDLA 1BOGB 4HF5L 4OGXL 2YA1A 4XC1H 5TE6L 5B39A 3VWKD 4NDMA 5JOFA 1HHJB 4PJFB 3NFNB 1F4HA 3KLQA 3TBWA 3NTCH 4YDJA 3PAYA 1ZY9A 4PJ9C 1DJYA 5IQ9A 3SYPA 1ZT4B 2WKOF 4OT1H 1S4IA 4XC3L 5EPMA 1YDPB 1E4XH 4QLWA 2ENJA 3KZ8A 2BMKB 4KVPA 2PCXA 3QUYB 1II4E 2W88A 2Z4QA 3LH8A 4FQ2H 2XWRA 5DEFA 4F1ZA 4PJAB 1N6UA 3F7VB 1MFVA 4YNYA 3TTYA 3VU2A 3ABLB 3BW9B 3WV0A 5IHHA 1OAZH 5IWLA 3CQFA 4PGBA 5B4MC 1GY1A 1U2YA 3JWOH 5DC4B 2PO6D 4YDIH 3KGTA 2R29H 4L5FH 2HLFC 4M1DL 4AYDC 3T9WA 2FWSA 1VGEL 3HUJA 4TNWK 2V3DA 3ULUE 2BNRD 3ZDZF 3HAEH 1CXHA 2GI7A 1AC6A 1A9VA 4MLSA 4D0BB 1HSAB 1HDMB 1KCVL 4DGIH 1IQWH 3SBWC 3ZO0A 4BIKA 4KKCD 4LVHC 5IQOA 5JUEH 3MO1A 3MI6A 3OWRA 3RPIB 1KPUB 3ARBB 1I9RL 2J5LC 2VJXA 2NMSA 1A3LL 1WBZB 3BUIA 2F1AA 3L5WA 3M6DA 1URIA 2VDOB 3O45B 4GO6B 4ZFZA 3RNQA 3S3PA 3TONA 2DQGL 4RMSA 2LU7A 2W9EH 4OFDA 1ZCRA 3IJ8A 5L9DL 4HX1A 1UEMA 2CLVA 1KJ2A 4Y2DC 3VXRD 3ULVD 3FRPB 5KOVC 3FCSB 3QEHA 5CN2A 3UO1L 3MXWL 5DURD 3OKDB 5C0EA 3U6XS 4PJHE 2H0PA 5CCKH 1UZ8A 1HNFA 3REWA 3HBQA 5C0AE 1EJOL 1YYLL 3G04B 1LO5B 4XOEA 4G71B 4V1DD 3VXMA 3WKQA 5E7BA 4EBQH 3RZCA 3WO3B 4L5FE 4OVVA 4JGNA 4GT0A 2QQKL 4PRIB 3ROLB 1IEAA 1BIIA 1H3PH 4N2NA 5I1AB 1PSKL 3GSRA 4YLQT 3VRLF 3FQYA 1WE5A 5DGRA 5IJCC 3LOWA 4A7GF 4RCAA 4YGVA 3STBA 2AJ3B 4PJDF 4KDTC 3QORD 2R1WA 4H25B 5DA4A 3H42H 4OM0H 5FK9B 4Q4EA 3D48R 3V0AC 3PHAA 2YFNA 3VD9A 4Y16A 2F19L 3PDOA 3VYNA 3OPZH 1UKSA 1MHHB 4LVOC 1CDUA 5C08A 3VI4E 4RMBA 5CSGA 1A4KB 4Q0XH 4HU8A 2V5SA 1UEYA 2D31B 3N06B 3GRWH 4LPYA 5D7IA 2BW4A 1HILA 1KXTB 4FQHA 4GYBA 4Z7UF 2QKIC 1Z3GH 3CVHL 3MN8A 4AYGA 5C97A 1NKGA 4GIPD 4OCXH 2B5IB 4J3OH 4A2HA 1QX1A 3S4SB 3CLWA 4PG2C 3T4AC 2VN6A 1BG9A 2X4RA 1E9PB 1I8IA 2H32A 3HG1A 2OZ4H 3FXIC 4GG8A 1MCBA 1V7NH 1ULVA 4KGLA 1NAMB 4FYTA 2IXQB 5CLXA 5I1GL 1QZNA 4KJYA 4YIQB 3ARTA 2BNQD 1T4KB 3P9MA 5CFAA 5DFAA 4PJ9A 4Y5YA 5IHZB 2O6PA 3U4EA 1JV2A 3UG4A 2OMBA 4O4YH 3VXOA 4M1GH 4ZMXA 3A6CH 2X87A 4ZPVB 3VFSA 5EWIL 4YSEA 1JZ4A 1WIUA 4HS3A 1YEIL 5IHUH 1J0JA 3UAFA 5JQHC 4ORGA 3EUUA 4PJIE 4DVBA 3D39A 5TQ0L 1JGIA 3Q43A 3RFRA 1AKPA 4P4RB 3UG3A 3W11C 1WEJL 3RGVA 1MRFL 1CDIA 3NIFE 4AYFB 3MRRB 4LPTA 4OD3L 1EANA 2NLJA 1NL0L 2ETWA 1A7NH 5F9OH 4IGBD 3ZTJG 3JTSA 2QQNH 1YNLL 4AH2A 4DTGL 2GY7B 1F6LL 2BZDA 3UGXA 5DJYB 1QTPA 3ALWA 3TH2T 2PYEB 4PMEA 1D5IL 4O2EB 2C4FU 4PB9L 4J28A 4NJ9H 4DAGL 5MENB 4HALA 3AY4C 4RA0C 2Y6SD 1P4IL 4C4BA 1O5DT 5GRZA 3UTQA 5I0DA 2WUBL 4LCCC 1JTOA 4EMZA 4WKZB 3MRIB 5DQ9A 1KCLA 3L7EB 3AU1A 3QHFL 4FI8A 3VGEA 5EZLA 4NQEE 1E67A 4MMZA 2XA3A 3LNFA 1F02I 2PCYA 3RFZC 3AWFA 2N01B 3DHPA 5DJ8A 1EXHA 2PR4L 1TZGH 2DIAA 4NKDA 4Y89A 4EDXB 3UTPE 3WL9B 3CLFH 4IQHA 3E7JA 1LK2B 1M53A 4JAMB 1COBA 2OW7A 1XCWA 1TZIA 1MAML 3MV7D 3PPSA 4QRRB 1K72A 2OW6A 2QGEA 3KNBB 3FB8B 3QUML 4JM2D 4YHPB 4QCIB 4R96B 5EUOF 1UM4L 1MIEH 2ZWYA 3MZGB 2V7NB 4D0DB 2HVJA 1LDPH 2IV8A 1I82A 2ZXBA 1UKTA 3RWEB 3OJ2C 2ILLA 1ZJBA 2EDNA 5FUCE 2AKRB 5C0JB 3H9YA 1FGNH 1NCAH 2GHWB 1B2YA 1KFGA 4MJID 1RHFA 5FKPB 5B38G 1MF2L 3T0EC 4NZFA 2QDVA 5EDXA 5C3LD 2DIBA 2EXWD 1HWGB 5CN3A 3IJHB 2JJTA 1NGPL 2WOYA 4X5RA 2X4SB 2ADFH 2VLRB 4XBPB 4JW3A 4IHOB 1EH9A 1GYWA 1HS6A 3EYFB 5LG6A 4R97B 4LSSH 4JRXD 4YC2B 1EAPB 2CLRA 4HSCX 1LMIA 2ALWA 2N1TE 2OMZA 4NCC1 3CX5J 4ZXBD 1BV8A 4FN0A 5DS1A 3EF4A 1D5XA 3J2PA 1WWBX 3H3BC 2CH8A 3FTXA 3BEWA 2V2WB 4UAOB 1T7VA 4YDVB 2CQVA 4FDWA 4ZDHA 4N8UA 1CICC 3SZ6A 2Z8SA 1F56A 3R4RA 4DUWA 4UILH 2HG0A 1JWUA 1JVOA 4G8FA 4PPTA 4V2CB 1JWMB 4ZMTA 2FZ3B 3QFJE 3QAQA 3WIAA 5EU6B 4FFWC 2NY4B 1AD0B 4F7TA 2D7QA 3MOAH 3R06B 1BM3L 3L2MA 1I7TA 1L9RA 4A39A 1NINA 3V52L 3DIFB 4EZKA 4HIEB 5DC9B 1IGJB 1AKJB 5C6TL 2XWBB 2CPCA 1S7WA 3MKKA 3RKDC 3WS6A 1UZ6E 4O9HH 43CAA 1BX2A 1Z0NA 1LP9F 4HAKA 1DVZA 3MUGB 3KYMA 1IL1B 2YRZA 4AIOA 2WJ5A 4U1NB 3CDFA 5CEZL 5F7HA 5KG9B 5D72L 4F2MA 2G3NA 1BVNP 1OAKL 3HMXH 3S3SA 1FYTB 4RMRA 3MLRL 3H7BA 3BRFA 1L5GA 3OMIB 1I1AC 5F0JB 3VXQB 1CD0A 4WWPA 2YPVA 1XFPA 3NMEA 3EBHA 3QEUA 4JQXC 4U6TA 4ZUVA 3VXUB 3MV11 3HC2A 4MD5B 4WEUD 5T1KD 4L4TA 4PCSA 4XNBA 2DQIL