2FEDC

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
source organism Escherichia coli
total genus 36
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fedC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fedC01
5SV3A 1N64L 3NOIA 4MAUH 5C09D 3IXTA 4M7LL 1LNUA 3OHXB 1SYSA 1OAYL 3BKCL 4HIJA 1JPST 2LTQB 5IMMA 1LDPL 5TQ0H 3W5MA 3R0MA 4HDIA 2FECI 3EYUH 4LLVB 4OV5B 3ULVD 4WHYG 3TJEL 4M8QA 4QF1A 5AZEH 1WUNT 3LPFA 2GAZA 3MA7A 3DYMA 3QNYA 3GMRA 3PP4H 1L6ZA 5GJSL 2BMKB 2VLJE 5IW3A 2RCSL 3SDDA 5IROA 5EH1A 4HAFA 4PP2A 3QCTL 4L4TD 4NN6B 4RAUB 4DVRH 2VZSA 1GZPB 4LLUA 4PGCB 4XP6L 1GPOH 1S7QB 2BVPB 1YY9D 3NAAH 2DBJA 3LKPA 5FDYA 4AEIH 1S7WA 1T2JA 2BY0A 3ZKMD 2IQ9H 4Z7UE 1D9KA 2XICA 5HVGB 5CKGA 3ZKXC 4OIIL 3DROB 2VAAA 5F9DC 3E8UH 2VXTL 4MAYA 4X80L 1I1RA 3RIAK 5I18L 4LLQB 4AL8L 4E41A 5EWIL 4I5BA 4OLEA 3OBAA 4MCZA 3E6HB 1N5AB 1XCQA 5F1OB 5HHPA 5F6IB 3PDDA 3EGSA 1RQ5A 2R4SL 4P0DA 1NCBL 5F9WB 3AC0A 3SOBL 4I0PA 3NPSB 4L4VB 3PG2A 5EU4A 4POYA 5D7SH 4U6HB 4HWBA 1WZ1L 5CBAB 1LE9B 4MD5A 1RJYA 2FEDC 2O93L 4WGWB 1J0YA 2EYSB 2E7MA 4B41A 2WV3A 4MA7H 3MV7B 4JZNB 2O5YH 5HHVH 5KW9H 1QSED 3MRHA 1WBZA 5FXCH 2A9NH 2NY2D 2L4OA 3O2DH 3QHFH 1P7HL 2H8PA 3PJSA 3P40A 3RIFF 3ZHDA 1JWSA 1KYOJ 2VKXA 4LSUL 5FUOH 3HNSH 5C0CA 3HI1A 4NQSB 2IPTH 1OTUC 4WV1A 4G80A 4M61B 5IIEA 3O9WB 3MRIA 4PJ8C 2Q7YA 3QUKA 3CFDB 4ONFH 5FKAA 1K3IA 3TO4A 4HJJH 5DR5H 4JFDB 3TPUA 1MUJA 5GRWA 4XMKL 1WV7T 3AS0A 5GGVL 5TDNA 5DYOA 2F8OA 5EO1A 4EDWH 3FT3A 2BVOB 1UVQA 3ILPA 1FNFA 4XWGH 3DO7A 5TJWK 3LEXA 5DMKB 2XPGA 1FBIL 5LAXB 4R4NC 1F11B 4GOSA 3WFHB 1DE4B 4NN7C 2ED8A 4ZO7A 4BZ1L 4LSDA 4Q6IC 1A6TA 5CWSB 2OR9L 3OX8B 1RSFA 4DUXA 1PYWB 3RTQC 4OD1L 3IJHB 2VWEC 5D1ZC 4CJ1A 2W0FA 4LARH 1AQDA 3GMLB 4QXUL 2HVKB 4G6KH 2CKBL 4KJYB 5IW6A 3MJ9L 5CD5D 3KYOB 3D2UD 2EE9A 5D72L 3BP4B 3D87B 4GJTB 3X3FH 4ZS7L 1DQLL 4JVPA 1DN2A 3HE6D 1IT9L 4R7DB 1EEZB 4ZFZA 4XC1L 3N9GH 2XYCA 5D71H 3QUMH 2Z92B 1TQCB 2DWDA 3P0GB 2YC1A 2GTZB 4ZPTA 3ZTJG 2ZOLA 3HUJA 4JRYE 1IKNA 5SX5H 4OAWA 4K3GA 1KCRH 2A6KA 3G5YB 4KKBC 4WUUA 3T3PE 3D25A 4G8FA 4UU9B 4HWEH 5IESL 4XWOD 3RZCD 4R4FH 3RGVD 1EEYB 5DUBA 5J1SC 2H26B 5F6HI 3ARPA 3JWOH 4X4XB 1DJSA 1RUAL 2EC9T 2VDML 1CXIA 1AC0A 5DSCB 4J2XA 4JFOB 5JHDD 2X10A 4PJIA 4JFPA 1S9KC 2IADB 1IGMH 2AI0L 1WWCA 2B0SH 1RULL 1S78C 4OZHB 4ENEC 1N0LA 1PFCA 5DJDA 4JO3H 1F13A 3QXUA 2XWBB 2VIRA 1SY6L 5IB3B 4C56E 3MLRL 2H1PH 3QUZC 3ARFA 3L3IB 2VDNH 4FNLH 2MCG1 1T1YB 3FCTA 5C86A 4I3RH 2IH1A 4J4PD 1KLUA 4HQQL 5IV2B 5DJ6B 5LBSL 2F53A 1RURL 5HYQA 3GSOA 3FMGH 4U1KB 2J6EH 3JWOC 3KS0H 3QI9C 4PJ5E 5EOQL 3WYRA 4N0FB 4XPBL 4CVUA 3AGVA 2LU4A 1WBYA 2IC2A 3NIGE 2EKJA 1KPRB 3WFCL 2V7NA 2VOTA 5GRUH 1DL7L 3CPLB 1YYML 3V4VH 1YMMA 4L1HA 2CR6A 4X7SH 3SJVA 2E7LA 3PV6A 2JCCB 1LO4L 1LE5B 3KXFA 1F00I 3ZE0E 4Y8AA 2W65A 3QXTA 5MERA 3L1OL 4WWKD 4PJDE 3FQUB 4DFHA 4HXAL 1HH6B 1A6AB 2A0LC 2W59A 1BWMA 4M03A 4GKZA 4CADA 5BV7B 2IH3A 3W9DA 4ZFGL 1SBSL 4LIQH 3ARDC 4PJGE 4U1SA 1LP9A 5L8LB 3BKMH 2G75A 4N8VG 5D7IB 2I07B 3QUXC 2XWJA 2VRAA 5JQ6H 5C6TL 1NGPL 4MXVF 5TGBB 3O6FC 5E5MB 4PV8B 1J0ZA 4HH9A 2Q8BH 1VACB 3BW9B 5CJQH 3T65B 4J6RH 3TA3C 4PY8I 3WO4B 4UMGA 4CW1A 2ICEB 4WW2B 4E0RB 1P7QD 5JNYA 2X41A 4UTAH 1MH5B 2Y5EA 5FO9B 2VLJA 2GK0A 4KKCD 3U0TB 4N90D 3HLAB 4DGVH 3GKWL 3OXSA 4XP1H 4WY7L 3RVUC 1NMAH 5B39B 4YBLB 2DM7A 3QEQB 4Y19E 5JMOC 2F5BH 4CVZA 1UM5H 4NO3A 2PW2A 5I19H 1X5LA 3ZKQD 2P49B 3SE9L 4H88L 1KJ3H 1IEAA 4R2GC 1VERA 3OKKB 1KGCE 4JZJC 3REVB 4Z7UA 2G60L 3SCMB 1XAUA 3SDXB 3N85L 4KRPD 2WBJC 5SX5K 3TT1H 2CDGA 3LV3A 4I18C 3LKRB 1DBML 2LU7A 3QQ3B 4JPVH 3QPQD 4KTDH 3U30B 4ETYA 4WU7B 4ZPVB 1DTUA 1W0YT 4HT1L 5DJAB 4U1LA 5TE4L 2P7TA 1JP5A 1YQVL 4OGAC 2ZCHH 4JM2D 2X5PA 1OB1B 1FAKT 5TPWL 4YUEL 2JJTA 1K4DA 2QQLH 4LSQH 2KH2B 2DKMA 2XY1A 4N9GA 3PWNB 1CDJA 4PS4L 1CU4L 1QOKA 2Y5TB 3ARTA 1JNLL 2K9UA 2IFFH 3ZMRA 1CLZL 2QQKH 5B4MC 3DIFB 2UWEE 3ZL4L 5C2BL 4WHYH 1BLNB 1KIUA 4I3SL 4PRPB 3NCMA 4UT7H 1HWHB 5C0GB 4MQ7A 4PR5B 3MNZB 4RZCB 5DK2B 4K8RL 1OM3L 3JTSB 4V2BA 1ZT1A 3BQUC 5DD0L 5GS1A 4YHIB 4TYUA 4X6DB 4XMPL 3LQZB 12E8L 3HI6H 4P5TC 3UJJH 4RAUA 4JEGB 2EZ0C 3NIFE 1GZPA 4NQVA 4ONGL 1LEIB 3O3AB 5KOMC 4PBVC 4XPAL 3ZKNC 4EXPX 2Q86A 2N7BA 4Y1AB 1G7MA 1MHEB 4KHTL 3K2UL 5EOCJ 3V79C 2PXYD 5MI0C 3MOAL 2GITA 5EO0B 2Z91A 5DWUH 2QKIB 1A6WH 2ZKHL 5D5MB 2ZZUT 4CBPA 4QRUA 2X1XR 3NCCB 3HZKB 2DQHH 1YEFH 1OOAA 1U58B 3FQRB 4YX2H 4QHNB 1UXSA 5HD8C 4GKOA 4HS3B 3UJTH 4NC0B 4CNIA 1ZXQA 4ZXBB 1AQKL 3PWLA 3V8CA 4PJFF 5CBAA 5C7XL 1YN7B 1XGRB 1XZ0A 4ZD3L 3ZO0A 1XF4B 2EYSA 4H8WC 3OV6A 3WNOA 1WFOA 4K7PX 4RMVA 4Q0XL 5CGYC 1OGTB 3B8SA 4HEME 4KY1H 3S35H 3OG4B 4WEMB 1LO3H 3PL6C 2CIKB 2BK8A 1HIMH 2RJMA 1D5BA 1QFPA 2K1MA 2NY7H 4JRYA 2IJ0C 4LCUB 5GSVA 4M61A 4RWYH 3VFVB 3DETD 5TDOB 1KTLA 1MY5A 2D0FA 4HJGB 4WTZG 2JIXD 3O8XD 4ZUUB 4JFDA 1NC4B 3FFDB 4GMSL 4GAGL 1EJOH 3L5XH 1L0YA 2AVGA 4KK9D 3ROOB 1W8NA 4NCC2 2ARJB 4YQXL 2ESVD 1HILB 5J4MA 4Z7QF 4HWNA 5DMKA 4P46B 1MLBA 2XA3A 3MNVA 4WU5B 4U0RC 1F11A 5DURD 4NO2A 4TULL 3VI3F 2YOCA 1X4ZA 1FVEA 5CWSA 1ZHBA 3GMPB 4P4KC 5AYUL 1KB5A 4NKDA 4Z78B 2F5AH 3ULVL 2QADC 4PG2C 3T3ME 1H5BB 2HVKA 1MVUA 4ZNCD 4BH8B 2X4TA 3IRPX 1FO0A 1A5FL 1YEJH 2OTPA 2AK4D 2FSEB 3BP4A 5BXFB 4LNRA 4GRWB 2Y9RT 1EFXA 3EHBC 5D2NB 1UCBH 1U8JA 5I9QC 4M7KH 4GQPH 1CLYH 4OLWH 8FABA 1E6JL 3SDYH 4U1JA 1C7SA 5IBTH 4ZTOH 3ZTJH 2IFGA 3KPQB 2VH5L 3RVVD 4ERSL 4AIXA 3K80A 4PJDA 5DD6B 3U4BH 4KJWC 4TUOB 3QUYD 1GOGA 2R56L 4IRJD 4UU9A 5JXEC 5F7EH 1XIWA 3K74B 1KN4L 5JOEA 1J8HB 4S1QH 4JPIA 5HDQH 4U3XA 4WO4C 2E6PA 4IMLB 2L7UA 5GISL 3HMXH 1TNNA 3QG6B 4YHKL 5DSCA 1CFQA 1N6QH 5EZJB 5HY9B 5IB4B 5T1KD 1OAKH 2IADA 4M48L 3RX7A 2FRGP 5HGBB 4HFUL 1MFDH 2ZJSH 4JR9L 4J3UA 3LRSB 3TYGL 2VYRE 4M6OH 1A6UH 3R0NA 3ARBD 4M1CC 1CR9L 1VGKA 3MUGA 4LF3B 2X7LA 4XP4H 4IDJL 1S9WB 3QCVL 5T5NF 2DQCL 1T1YA 1E4XH 2WINB 3DGGA 4XNQB 5LGJB 4KK8C 4OCYH 5C0FB 5D1XC 5IV2A 1CL7I 1YNTB 1G1YA 4U1KA 1KTDB 5F71A 5ADPL 5K33A 2JB6B 5BJTB 4F15C 5FYJU 4DFIA 4G9FE 1T2XA 3FB5A 4Z7VB 3P4NB 1JGVH 3HB3D 2DTMH 4JN2A 4L3ED 4X7DC 4TVPH 3CPLA 4LHUG 4WJ5B 3BO8A 1FP5A 2XZQH 3MUJA 1OF2B 1DANT 4D0DB 3FB7B 3NA9H 2BC4B 4XZUB 3EOAA 2XQBH 4XGZB 2R0ZH 3DXAB 4UAOB 1FYHB 4G5ZL 1T83A 3CDCA 3PABB 1AHWA 1ERNA 1HINL 4UT6H 5HDBE 1JNNL 1T3FB 1EIBA 1HSBB 2WUCL 5F7DB 3T0ED 1QA9A 3BRFA 4RMQA 3TV3L 1B3JA 3UAJD 4JDVA 4B7IA 3AS3A 3N06B 5ANMB 2IGFH 4D3CL 3KHOA 5EU6D 3W0WB 4FXKB 5INDB 4WFFD 3UBXG 1H3VA 3MJ6A 2X4NB 1BQLH 3BKYL 4J3WA 4A6YH 1G7LB 2XA8H 3VFNB 3GSNH 4O2FB 3T65A 3ARGB 2UWEA 1WEJL 3CDYA 4NBZB 1JWMA 3FB6A 4FZEL 1U91A 4Y0GA 5ILTL 3WN5C 1V3JA 1ROWA 1NCWL 3FN9A 3NPZB 3QFJB 4MVBC 5I6XC 4N5ED 2F8VA 3QEQA 1T04A 1FFQA 4LPVA 3SDAC 2EICA 5EN2A 2VXSL 4PRNB 3KNBB 2X4QB 2LAGB 5DI8B 1I1FA 5A2FA 4QRRD 3MNWA 3U82B 5F7NC 2QSCH 3QXAA 3SE3A 3B9KC 3REVA 2DQJL 5I1DA 4XMLL 1IGCL 3KPLA 3SDXA 3WS3B 1OT1A 1Q72L 3MV9D 4DEPB 2B20A 5GZOD 1IKFL 3IDUA 3MRDA 4R9HA 2Q20A 3MUZ1 5TF1L 4XNYL 3QQ3A 1FSKC 4S10A 1X3DA 4MAUL 1XGPA 1JPFB 4UUJA 3DJ9A 3M8OL 3S4SA 3VDAA 2BVQB 4Z8FH 1LD9B 1ETZB 3QXDA 1MF2H 4BZYA 3VFSA 5CCKL 1H8NA 2HFGH 2E27L 1U3YA 3HAEG 1U2CA 3NH7L 4U3HA 4OQTH 4AEFA 5JW5B 2EXWC 3PP4L 1PEWA 2KKQA 3W9EA 2VZ1A 5KZCD 4XHJC 3STBA 3G6AB 5CD3B 2R2BA 3GMNB 4PRPA 4UIMB 5E6IB 1V3MA 1UXWB 2VXVL 4DVRL 5E00A 5I17A 1WQVT 4RZCA 3GM0A 4PJIF 5DK2A 5F7FA 1FL3B 2NXYC 4MJIB 3IETB 5T5NG 4WFGD 1NMCC 3NAAL 4AEIL 4EUPB 2ZUXA 3MCG1 4KMLB 1NCCH 1YEEH 4K3EH 3E8UL 3OR7A 4N8CH 4I1NB 4L8CB 3DX8A 1FLTX 2DIBA 4IRSC 2A77H 2BOCA 3BIKA 1KF9B 4XP9H 4U1MB 3SHSA 2IWGA 5HHME 3BZFA 5C07A 3ZYOA 1RIVH 2VLRE 3MUHL 3VW3L 2BSED 2IAMC 2NY3C 4X6BB 2Y6SC 2HVJA 1VFMA 4YDIH 1RY7B 4ESKA 2QKIA 4GG8A 2ZSVB 4LSPL 4R26H 5D5MA 2W0PA 4LRNH 1A14H 4QRQB 1AIFB 3L5WA 3KLSA 2JB5L 3VXNB 1BBJA 5A2KH 3LOWA 4LSVH 1MJUL 1QBAA 2EO1A 3C8DA 1B0WA 4LLMB 4MA7L 2O5XL 4JHWH 4MNGE 5LGHL 1AH1A 1YMHA 3U0PB 4WCYH 2BSRB 4ZXBA 3D1MC 3GB7B 2G9HA 1XGRA 6CGTA 3RWDA 4ZS6D 1A7QH 1EZVX 2FGWH 4P4RA 5C08D 4GG6A 4Y2DD 4HIIB 5LXGH 1D6VH 4OFYA 3MPCA 4G42B 3MV8B 5J13C 3QWOA 2H2SC 5KSBB 4FQ1H 2X9YA 3BSZL 1G7JA 1C5DB 1LP9F 4Z7WB 4PGBA 1PG7H 4M43L 4H1LG 5I1HL 1AGCB 1Z9SA 2H9GB 1HHHA 4JE4B 4JFQB 3O3DB 4JREB 4KWUA 4OLYL 4JO1L 4LCUA 7CGTA 1EMTL 2DI9A 2NYYD 4C55A 1O5DT 2DL9A 4HXBH 4CAGA 4YZFE 2EIEA 4HK0B 4PGDB 4XWGL 5I74C 2PO6A 3GJFB 3FFDA 3OZ9H 3CFCH 4U6YB 5C0BD 3WLWC 1D5XA 3ROOA 3NCYS 2ARJA 4PRAA 1H15A 5BVPH 1DUYB 3C9NB 3RX8A 1KBGH 3W11C 3CVIL 4P46A 4OLVH 4R0LB 2NY6B 1G0DA 3VCLA 1MCKA 4NZRH 1YEHL 1YYLH 5BCAA 5E2UH 2VQ1A 2H32A 5HJ3B 3OMZA 5CHNA 2F9BT 1CFTB 2OK0H 1MWAL 4R97B 1GGCH 2YK1H 2YPKB 3VH8B 1H5BA 3HG1B 3U7WL 4JG1L 1XF1A 3VWJA 4NRYA 4YXHL 3MGTB 4NKOA 5T3ZH 3S3JA 4BH8A 4J1UB 5DO2D 1FNSL 5D71L 2VLKB 4IHOB 3MJ7B 1X5AA 1A4JB 3IU3B 2VN7A 3MRRB 1KCRL 5KSAC 5E2JA 3K0WA 1RAMA 4UILL 4XVUD 4JPWH 5C0JB 4HWEL 1TMCB 3KWWB 1YPZB 1GC1C 1MY7A 1KG0A 4R4FL 4AM0B 1WISA 3VWKD 2N56A 1XCTA 5IMLB 2OI9B 3D9AL 2I9LB 2NTFA 3A0OA 3MLWL 1KLFA 3OWEA 4NRZA 4OM1H 4YNYB 4PJ9B 5DF0A 4IDLA 4EBQH 4KQ3H 3MOBL 4EVNB 1WTLA 3OGOE 1IAOB 1JGDB 3GSRB 2R8SL 3MRPB 4RWHA 2VMFA 5FV2A 4IMLA 2P5ED 4OCNC 4JY4A 3QDGE 4YAQA 3OKMB 5EZJA 3UTTB 2F19L 5IB4A 3S5LA 1L9MA 4LCWE 4FNLL 2ORBH 1ADQA 3DPBA 1RVFH 5MHSD 4I3RL 1EFQA 1C08A 3ARWA 3I02B 2X6MA 3S36H 3RHWF 3IRZA 3BP6B 4LF3A 1CD8A 5EFIB 3UTPE 3FMGL 1S9WA 1MJ8H 2GJJA 2J6EL 4KVCH 1VEOA 3TLRA 5FGSA 1IC4L 5F7LB 1FFNB 1OWWA 4M1GL 2NY0C 3MLZL 2FJGB 5C0FA 2A9ML 5C6PB 3O2WL 1HDMB 4KJPD 1FLRH 3MRMA 1KTDA 1WSST 2JB6A 3CMGA 3EYVA 1MRCL 4QHUB 4M7LT 3P4NA 5ESVB 3HC3H 3C08H 2C3VA 3WDJA 3BP7A 5AD0A 2J4WH 3GGWB 1MRFH 3UPRB 1PG7W 4YHNB 3MREB 4RMUA 1OF2A 4HZAA 4D0DA 3FB7A 1LMKA 4QXGH 2BC4A 1MOEA 2GJZA 4FZ8L 4XZUA 5IFJB 1ZLWK 4KUCF 1Q9OA 3BKML 2P42B 3GM8A 4G6FB 5GGSA 1ND0B 2D4FA 4JVWA 2Q8BL 1G7HB 1ZLVH 4LLYB 3QH3A 3VFGL 4J6RL 1G6RB 4J3XA 2UUDH 5BS0D 2KZWA 5SWSB 4NQCB 2DQEL 1DBAH 2CGRL 2RBLA 1GOHA 2GCYB 3DHMA 2X4NA 2XFXB 2AJUL 2C26A 3D69B 1R3LA 3C6LC 1OQXA 4XP1L 3ARGA 5T1LB 4L3CB 3MFFA 1K85A 3VXQB 1ZT4B 1FDLL 5M94B 4FQXC 4HG4K 5I19L 3K8KA 3MBEA 2QHLA 2WM0A 3NFSH 3DBXA 1KJ3L 3IDNA 3QFJA 1CLCA 3T04D 3WXVL 2IBGA 4Y4HC 1WBXB 2F15A 5T1DL 3O2VL 4PRNA 4ZDHB 4GXVL 1DQMH 2X4QA 4NT6A 1KEGL 1JPGB 4LP5A 5C0AB 3DHJA 3J7HA 2R0WL 5KANG 3SDCB 4JPVL 3M45A 1IM9B 43CAB 2VLRA 4Y4KB 3ARRA 3BN9D 4MCYA 1ZS8B 2PYFA 1WT5A 3IGAB 3B4NA 1KPUA 1BM3H 2WUBL 5CZVH 2K7PA 3MCKA 4P5KB 2CLZA 1S7VA 1Z9MA 3NIGF 2R29L 1BIIB 3GBML 4LSQL 3BOVA 1S5HA 4MMXC 1KXTB 4GMTH 2XACC 4PREB 3BFOA 4L8SC 1T0NB 4DUVA 4HS6B 3GEWB 1DBJL 2A6DB 1I3UA 1ETZA 1HHKA 4Y16A 4R96A 3GMMB 3FFCD 1B0GA 3HAEH 1FRGH 4BELD 2YMXL 4GLRI 5TH2A 5E2TH 4RGND 2LVCA 4YGAB 4WI9A 1UH4A 4OZFA 2OZ4H 4KV5E 4NDMA 4UIMA 2XTJE 5I1IL 3UTOA 5HPMA 3LIZL 4Z7NF 3FRUA 3S96B 1I1YA 5IQ9B 1P4BH 3IS1X 4DKAA 3TO2A 5F1NA 1B90A 2Q87A 1I7ZB 4JGJA 5SV4A 3GRWH 1ZGLB 5KAQF 3ULSB 2YN3A 3IFNL 3KPSE 3EFFB 2QTEA 3HZVB 1TZGL 3UC0H 3CH8A 3LS4L 4BSVA 4KZEL 1W72B 3SDDC 2PR4L 1GGTA 3P4MB 4NQTA 3KPOB 4U6VL 5IROC 1A6WL 2Q3AA 2B1HH 3CUPB 4U1GC 4X4MA 1JK8A 3UPCA 2F8XC 4CJ0A 4OZIE 2XRAL 5E03A 5KS9B 1I3GH 1CK0H 4M3KB 1A9BA 4HWBH 3UJTL 5IG7B 3PWVA 3NIDE 4NQED 1ZLVK 1CGVA 4ZUWB 1D9KC 3BIBX 2YXMA 2FIKB 1U3HA 1A4KA 2EYTA 4MAYC 3EO0B 4QWWD 1A7OH 2CKBA 4XI5D 3TZVD 3U0PA 1NAMH 4S1DC 4K07A 4FQ2H 4ODVL 3ZDZE 3C8KA 4G9DB 1OAZL 3HRZB 4UQ3B 2IMMA 3BPCB 3BKJL 1NLDH 5ID0A 2R69L 4I0PC 4G42A 3U6RB 5KSBA 4RWYL 5KTEL 4H1LH 5IB2B 1TCRB 2EC8A 5D7IF 5MEOB 4EN3D 5HYJB 1AGCA 4HPOL 5HI4D 2H9GA 1BMGA 1KNOB 4LHUD 4HWZB 4P2RD 1R3JB 4NSKA 4YBHA 1CI5A 1QFHA 1BWWA 3WNKA 3H3PH 1MLCB 5EC1B 2DM4A 1FAIL 1UB6A 4JO4H 2VDLH 2UWEF 1B0RB 4JY6B 5IB1A 3V0VA 4HK0A 4I8DA 2BVUA 1EJ6A 2F58L 3VFPB 2R0KL 2XWTB 3B2UD 3GJFA 5F3HB 3KJ6L 5CINH 3KAAA 3FL7A 4U6YA 3QDGA 1U3JA 4KI5E 4LKXA 4WV1C 1XH3B 5JW4N 4W81A 1IQWH 4LCWA 1UACH 3RUGB 1DUYA 4C54A 3T77A 3TO4C 4HUUB 2BNQB 5DRXA 3T8XB 2F5AL 1KTRL 3E2HC 5C09E 4KK5C 1SY6A 1WCBA 3HPJB 3K4AA 3WKML 1REIA 3TC9A 4BUGA 5F3BA 3SDXF 3UP1A 1I8IB 3I50H 4AENB 2W9DH 3S6CA 2OL3H 2OP4L 4OFKA 1X9QA 2IAND 3IVKA 1QFUL 1AGFB 3VH8A 5L7XH 1HEZB 1D6EA 1UCBL 2NY5L 3F7RA 4PJHB 4U1HB 5ALCL 3MGTA 4MQXC 4HMCA 4OM0H 1SEQH 3BVNB 1CDUA 5IBTL 4ZTOL 2UYLA 4JFXB 2VLKA 4PB9L 3VFRA 4L4TE 5HVHB 4KJQC 3IU3A 4K9EH 2ADGA 2Y1VA 3RL1B 5C1MB 1A7PH 3U4BL 1ACYH 4GW1B 4NYLA 2VZVA 3MMEB 5C0JA 3WLBB 3DTXA 3SGJA 3QO0B 4XHQA 4UB0H 1C7TA 1HXMB 4D0BB 35C8H 3M17B 1Y6KR 3PWJA 2R4RH 4YNYA 4ZFFB 2A73B 4PJBB 1RZJL 3MROA 2H41A 3LQAC 3JVGA 1FG2B 2IPKA 5K9KB 4FQLL 2ZJSL 3OQ3B 1MREH 1QRND 1IKNC 1PY4A 2VDPL 3P4OB 4M6OL 4BK5A 1FYTB 1IAKB 3EYSH 3PDOB 3FO1B 3OKMA 5HGHA 4N0UB 4XPGL 4U49A 1X6LA 2AXGA 5GS2D 3C5SB 4M5ZL 5FDWA 3T4YB 3D2UB 3BDYH 1NMBL 1P6AB 2W0KA 1KOAA 3O41B 4Z76B 1JJUA 5DJ0A 5EFIA 1F4XH 5FYLH 3D5OF 1F6AB 3WSQH 1QSEE 5DC0A 4N0YL 1I9IL 1R0AH 4MJ6B 3PDGA 2DTML 5D5MF 3O45B 1AXTH 3ARFC 4YDJB 3NA9L 3CXHK 3GKZA 3ZTNH 3WHXA 5JR1H 4QHUA 2VE6A 1MCBA 1QVOA 4NKIL 4NQXB 1A1MB 2R0ZL 1J05A 1TPXC 4QO1A 4EQ2A 1ED3B 4UT6L 2MHAA 3OJDB 1L7IL 1WC7B 2ICWB 1BJMA 2JKXA 4GG6F 3C2SA 3HHRB 1JYXA 1NSNH 1QNZH 2J8OA 1ND0A 2HTKD 2OBGA 2AQ2A 5B3JE 2IGFL 4DKEL 3ZKXB 5CUSH 1G7HA 3C5ZA 2E7LC 4LLYA 1QRKA 3I6KA 5BQ7B 5FGCB 1FV1B 1S9VB 3PHOB 4P3CL 1HN1A 4WFED 4P2QB 3FZUD 4HKJA 1TTFA 5HYSB 1RFDH 4ELME 4LLDA 4DAGL 4EEEA 1Y0LA 2E8ZA 3RDTD 1JFQH 4L29B 3D69A 2P4AB 3MRKA 1V5JA 1QSFD 4WUKH 4NUGH 4O2EB 5GQBA 5FO8A 3QJHA 4IOFD 2FWOA 2YPVH 1NEZB 1PX3A 5F7HA 1AGEB 3GHEL 1UENA 3AMLA 1D5IH 4EJ1C 2F54D 4MS8C 3T1WA 1N6VA 4LLWB 4LLAA 2ATKB 1JHTB 4PP1C 3S88L 3WD5L 2GTWB 1EHLL 1MAMH 4ZDHA 1A0QH 3KPSA 2ID5A 3NGBB 1JPGA 4FQIL 4ZUSB 3PHQA 2AV7B 3RTQD 1QHPA 4GRLB 5DQDH 2AJYH 2NY4C 3B6SA 3OKLB 4ORGA 4UV4H 1ZA3A 3C8HA 43CAA 3KYKH 4PLJC 1DQJA 4Y4KA 3S4SG 1XF5B 2X44D 3BHBA 1ZS8A 2O26U 4J8RA 3QCUL 3DX7A 1NDGB 4OCXL 4PJ8B 2XN9E 1AO7B 3TF7C 5JHDE 2X1WL 5KOVC 2P8LA 3VFOB 3A6BH 3WUWB 2DQUH 5JIIA 3SKNA 3WFBH 4XVTH 3QQ4B 2JCCE 2MFNA 4F37K 4HKBB 5IJVA 2FJFB 4OQTL 1IGTB 4HS6A 5SWZD 1S7SA 2CK0H 1IFHH 1U0QA 4WW1A 2A6DA 4LVOC 2D7OA 2YA2A 5B3NA 1NEUA 3DVGB 3D39D 2DD8H 5BRZD 5ESQA 4G43B 4Y2OA 4OLZL 5CIPA 2DIJA 1BVZA 4NN7B 3OKOB 2A6JB 2BZDA 1DUZA 1MCWM 4XX1E 3JWDC 2IPUG 1R24B 3NZHL 2LU3A 3TVMD 4O51B 5HDBF 3L7FA 3AROA 4OB5L 1CDIA 2R2EA 3C60C 4KMQA 1DDHA 1XT5A 1NDMB 4PRDB 4AMKH 3B2VH 3V5HB 5D7KD 3VRLE 4GAFB 4OBSA 3MO1B 1P2CA 1HOCA 1GIGH 3F7YB 4N8CL 2V5YA 2HJFB 4UIKH 5T5FH 3VXOB 3QNZA 2RGSA 4NJAH 4ENED 3U2SB 3ESUF 4R7NA 3W2DH 2AGJH 4M6MH 1BD2B 2WP3O 1CQYA 2W38A 3ULSA 1GGUA 5FYKD 2HT3C 1NBVH 2BDNL 5JIHA 5IQ7L 1W72A 4NWTH 3KR3H 1QLRA 4MMZC 4LCIH 5GS1C 5E9DB 2CR3A 5IOPB 4P2OA 1AD9B 4NN6C 4OFVA 3BH9A 1T4KB 4X98B 2FH8A 1D5ZA 5JOPD 5EOTA 3U0WH 5C0IA 1A3LH 5C09A 5BO1H 2MTPA 3R4DA 4WCYL 2W9EL 4Z7VF 1G0XA 3N0PB 1R5VB 2DQGL 3EKCA 5DXWA 5HTSA 5FK9B 5JPNB 5ACLA 3TBVA 4P9ML 1CXKA 2FGWL 5IFAH 4ZUTA 4DKDC 5EBWB 4QOKD 4PD4J 1D6VL 1YECL 1QLFB 2EKSB 3VFTB 3R1GH 4MD0A 4N90E 4EXKA 2ZP0T 2WSKA 2B8OT 5JW3H 3FO9A 2W1NA 3QUMB 1AY1H 2GI7A 4HGWB 3G6JE 4O9HL 2H2PC 3K4ZA 4L4TA 2NTSP 4WRLA 3T0XA 4X4YA 1RHHB 1T1WB 2ITDB 3PIQA 2W92A 3QDJD 1UWXH 2OSLB 4HXBL 1TCRA 5MEOA 5J11C 4HIEB 5I76A 1J0JA 2CLRA 3F7VA 4NC1E 1IZJA 3QI9B 1T1ZB 3GI8H 4FTVB 4MX7B 5CP7B 1MEXL 2AQ1A 3EJYC 4DWHA 1JN6B 3W39B 4LU5H 4M9PA 4DZ8A 3QA3A 4X6DE 1HYSD 5DTFB 3F58L 4OLVL 2XWTA 5F3HA 1OGAB 3KYMB 1KB5H 3MLSL 4NCC1 4NZRL 4RGMB 3I6GA 1YYLL 5E2UL 1HQRA 4L8DB 1DEDA 4NZDA 2ATPB 3V7AE 3L9RB 3OJVC 4HUUA 4Y1AE 2YD6A 2OK0L 3PQYD 1QKZH 1MCEA 1R3KB 5A3ID 2YK1L 5K9JL 1KFAL 5IEKB 2HRLA 3HPJA 4B7LA 3BGFC 5I8CA 3ARDB 4PB0L 1X5YA 1P5UA 2NXZB 3F5WB 4AENA 1I8IA 3QUXB 1BOGB 3G5XB 3O6FB 1UFUA 4NKQB 4FFZL 3C6SB 3MLVH 5EBMB 4JRXE 2E7CA 3TA3B 3VXRD 4QNPF 4Z77A 5DGQA 4HV8B 1FH5L 3BVNA 5EU3B 3SKJL 5CMAA 4FA8A 1MVFA 4OLXH 1T7ZA 5ICYA 2XG4A 3WDHA 4F9LA 3RL1A 5IWLA 4GW1A 4KI1A 1FZOB 5J89A 1IGIL 3WIHL 5I2IB 4FQHA 3L95B 1P4LA 2VABA 4R2GB 3FO2B 2CKNA 4ZFFA 4JZJB 4XRCB 2EXYC 5EOCL 4X6FA 1FG2A 5K9KA 4I18B 1I4FB 4HX1B 3LPGA 4ELMA 3MACH 2VR4A 4WHTA 1FYTA 3BXNA 3S36L 3V5DB 4N0UA 1XIWC 2DLFL 1MJ8L 2YHGA 4YZFF 4GW5B 4JFEB 4KDWA 1LO2H 1CD0A 3D2UA 3TCLB 1QPXA 4BFIA 3HPLB 3V6FA 4Z76A 5ETUB 2HFFB 4AZ8A 3DUUB 1F6AA 2CUMA 3HE6A 4NPYB 5AEAA 1O0VA 4S2SB 3SQBA 4KPHL 4G8GB 5E4EC 2JTDA 1FZKB 5MEPB 3VXSB 5D8JH 4R3SA 5MEQA 4XCCH 1VA9A 2D03H 2B7DT 3HC3L 2VDQL 2UVEA 3EJZC 2J4WL 4C83A 1ZTXH 3T08A 3H0TB 1UWXK 5M7QA 4OJFH 1CICD 4QXGL 3WNNA 3BUTA 3QFDB 1ZKAA 3RZCA 4NQXA 3RGVA 3BQUB 2YXFA 5CGTA 3NZ8B 1DEEB 2KPNA 3LMJL 4GRWE 1JZ6A 2P8MA 4KKAD 1ED3A 4P5TB 5JHDA 3BYYA 3OJDA 1KT2B 4RFEA 1IEBB 5FOJA 3Q5YA 2ESVE 2N4IA 3EDJA 1G9NL 3OXRA 5EDXA 1LWRA 4HZLB 3X12B 1G0YR 1X5KA 1CFNB 1KJMB 4U1NB 5KSBF 3PL6D 3VD3A 3ARBB 4DOHE 5IGXH 1FL6B 4Z7WF 3ES6A 1VFAB 3MV11 2Y07H 5MI0B 3VG0H 1S9VA 1S9YB 4QTHB 5HYSA 1J8HE 4OI8A 1T7VA 3RVTC 1T7YA 4UV7H 4PTTB 5C0DB 4J4PA 2WP3T 1AHWC 1ZGLP 3B5HA 1I8KB 4OT1H 4MDJB 1RZKH 3QPXL 5J6HB 3RZWA 5E8NA 5IVXE 4BSWA 4U7SA 5ICXB 4X5WB 3BZDA 3L7EB 2WIIA 1CBVH 5CILH 4MNQB 3B9DA 1T5XA 4N8PA 4JFZH 4AK1A 3WO4C 1A6VH 3Q3GB 2H3NB 4LLWA 5CBEA 2ATKA 2HKFL 4AIOA 4O2CB 1OY3B 5D6CA 1MFAL 3KLAA 1GSMA 4X0KB 3OTTA 3FRPG 1B4JH 3EYOB 4RAHA 4WWKA 4ZOBA 5CZVL 5GZNC 1I7UA 2AV7A 4LOUC 4QRPD 1MCCA 4GRLA 5FA3B 3RNQB 4C56D 3O4LB 5B38G 5KSUB 1T22A 1D5MB 5BZDB 1YNKL 3CU1A 3MRGA 1EHXA 4DTGH 1RZKC 1GH7A 1CS6A 5L2KB 2Z8SA 1PEZA 1S7TB 5EB9A 3TN0D 3SE3C 3FOMB 1KJ2H 4J12A 3FTGA 4CVXB 5HHNA 3QQ4A 1CT8A 1FRGL 4Y4FD 4PJ5D 1F8TH 2KL6A 5HYFA 1OHQA 5HI3D 4OZFG 1IGTA 1P7QA 2FO4B 3RWHB 4HUVB 5DRNB 4G43A 3O2DA 4U0RB 3VMPA 3INUH 1F58L 2E3VA 3G5ZA 4PG9A 5I15L 3OKOA 2A6JA 1JPSL 3G6JA 5F96H 1INEH 3K1KC 4P4KB 1DFBH 1IC5H 4HKZA 1EH9A 4O51A 1GJIA 1P4BL 1TVDA 3W0WE 3DOSA 3MRCA 3AUVA 3UO1L 3ZT6A 2QADB 3V5HA 3GRWL 3BZ4A 3ET9F 4CMHC 1DLHB 3TJHD 4F7CB 3TNNB 4ZNEE 4L3EE 3H7BA 3UC0L 5A2JH 1KIQB 5D7JD 5KBNC 4F58L 3U2SA 1OP3K 1CWVA 3BE1H 1RZIB 5EUKB 4QY8B 1OPGL 2BNRD 2R15A 5I9QB 1I3GL 3EZ8A 4K23H 1FIGL 2AEPH 1FL5B 2VJXA 3LH2H 1OT2A 3LN4A 4WI5A 4JM2A 4IS6B 3T0EE 4OLUH 3RIFK 3D85D 3ULUF 4YPGA 5BW7A 5GS3A 1I9JH 4OI7A 5F7KC 2AAVA 5EU6E 1K5NB 4WFFE 5F89A 2YD3A 4UOW1 1JHLH 4WO4B 4CMMB 2BVYA 1NBQA 5FK9A 4RX4D 4OCSH 3UBXI 2DTSA 5JPNA 3FT2B 5LWYH 2FIRT 3JV4B 4RFNB 3DECA 4OGZA 4JZOA 3FJTA 5T33H 5D1QD 1KGCD 4ODSH 5EBWA 5FEBA 4G6MH 5IMOA 4QYOA 3VFTA 4U05A 3BI9X 5TE7L 4DK3A 3QUMA 1MCPL 4HGWA 2WLYA 3OGCB 1EK3A 5I1KL 3V5KA 3Q5OA 2A38A 4MZ3A 1T1WA 2ITDA 3H3PL 4ZXBC 4ODBD 3JBG7 4QRRE 1F3JA 4JO4L 2VDLL 1KENL 4NQDB 3T0VA 4ZYKB 5T3XD 5D1XB 1Y6NR 5CP3A 1GAFH 2WAHA 1G7PB 3MV9E 3VXUB 5GIRB 4F15B 4XP5L 3EOBB 2HRPH 1UB5B 5DD5H 5F93C 3W39A 1K4CA 1IQWL 4V1DB 3G08B 4APQD 1DP0A 4TUJA 3BP5B 3H9SB 1KIRA 1LQSR 3DX6A 2EDXA 2AJSH 2BHYA 1P1ZB 2XXCB 2AV1B 5BZWB 4TNVK 5HI5C 2Y36H 3CCHB 3SDAD 2OL3L 3S98A 2PO6C 3WL9B 3UTQA 1T6WA 4I2XE 3FQXB 1WFTA 5L7XL 2EH8L 1B9ZA 3T2NL 1JZ2A 2QQNH 5FKPB 3IFLH 2J6EA 1OSPH 4W6XB 1XF3A 3M07A 5E8EA 3SE4A 3FT4A 3HNTL 3I75A 3RWEB 4P46C 4Z5RB 4K9EL 4OV6F 5H94B 3TA3A 3QXWA 1JWUA 2SEBB 3R8QA 1ACYL 3LDBC 1X5IA 3QP3A 4ZUVB 3WN5B 4YHLH 3PXJA 1H5BC 35C8L 4R8WH 4PRID 1WVZA 4M5YH 5FYKL 3VWJC 2JIXA 3O8XA 4OGYL 5I6XB 4ZQKA 4QLRA 4JN1H 1RJCA 1ZANL 1DLFL 4QXTA 1BQHA 3EDKA 3RFZC 1A9EA 1SM3L 4PRHD 3S34H 2ESVA 4JPKL 4N8VB 3CH1A 2ADFH 1AXSA 3L95A 2OTUB 1MREL 4FQJL 1JNHA 2DLIA 5CZXD 2OXGA 4W70A 1ZHKB 3WNLA 1A3RL 3B9KB 4ONHA 5CSZA 4A6YB 4XRCA 3C2AH 4RISL 1VADA 4WDIA 1UEMA 1I4FA 4IBLT 4AJ0A 3BDYL 5I66A 4ZTPH 1TZIB 3KPPB 4P57B 5IJKC 1FSKB 1F4XL 1UM6H 5DMJB 4NO0B 3WSQL 2EDTA 3ME0A 1G9MH 1VDGA 3LB6C 3X14A 5I1JH 3CFIC 4G6AC 2AK4A 3X13B 3WIIL 5IVXA 4YWGH 1LO0H 1OSZA 3AFLA 3U36A 4QHLA 3TIDB 4KI5F 3L3DB 3JXAA 4HCRL 1AXTL 3ARED 4NPYA 5HGDA 1AXIB 3S35X 1WAAA 3UJIH 1FZKA 3IDIA 1GGIH 1U8PA 1NFDB 1UH2A 1ONQA 5IW1A 4X5XB 5F9JB 4ZFOL 4D9LH 1UQSB 3KPRD 3H0TA 3ILQC 3V6ZA 3QUYA 5DHXB 4IRJA 3ULVF 4PLKC 3RVXD 3VRIB 2HTLD 3IFPA 1QNZL 3NZ8A 1NMCB 3GIVA 1ES0A 1A1NA 1RK0B 4HS8L 5C0BE 1N64H 4JAMA 2E7BA 5IKCB 3FQNB 4JLRB 4ELKA 5DHVB 4M7LH 5ISZD 5T1KA 4IRSB 3BKCH 5A16A 3MJ8B 1T7XA 5SX4H 1NANH 5MEND 4HZLA 4PV9B 5F9AC 1CFNA 4U1NA 1MJJB 3DV4B 3ECBA 3N1PC 1U6AH 2BFVL 2A83B 3CSGA 3ARBA 3DX9A 1FL6A 5GGRB 2IAMB 2M2DA 3LKSB 2CSPA 5GJSH 3T4AB 3RVWD 4XT1C 2RCSH 2CRYA 1JRHL 4Z0XA 2BSTB 4PTTA 4K7FA 3QCTH 1BVLB 1CFSB 4RNRB 2PF6A 1I8KA 2JJVA 3WIFB 4X7FC 4MDJA 4PGEB 1E27A 4XP6H 5IVZB 1TVBB 2J3SA 4ONOA 1MCQA 1OD7A 5ICXA 3IKKA 1N26A 4X5WA 3Q6GL 1MAML 3P9MA 1BFOA 1BPVA 1KJVB 4X6CE 4L3EA 2Z93A 1MQKL 3PNWA 4OIIH 1IAIL 1NUFA 2OMNA 2VXTH 1WFNA 4LPUA 3QIUD 1EO8H 3TH2T 4E5XB 2IQAB 3ARGC 4X80H 2HT4D 5I18H 4UV4L 2DBLH 2FX8L 2N7AA 5EWIH 5J13B 3MBEC 5FECA 3EYOA 5J0BA 1XGTA 2V7HA 4F2MA 2R4SH 1GGBL 2DQUL 2VLLB 4QHMA 2QBWA 3SOBH 1T66C 3WFBL 4XVTL 4K94C 1D5MA 2VERN 5FUCE 1TENA 5L2KA 4XH2B 1ZOXA 4LEOA 1S7TA 2DLTA 2CK0L 5EU6A 1M7IB 4TSCH 5BVJB 2BOBB 3NACL 5I74B 4CVXA 3TFKD 3KDMA 5MHSE 2H6PB 2R2HB 3RIAF 4OZFH 1WT5C 3DMMD 4YR6A 3CSPA 2CLVB 4HUVA 1UC6A 4NZUL 5L2JB 4LSUH 4QRSB 4GKSB 2AJ3B 4E42B 5K9OB 5DC4B 1GHFH 3EOYG 3JZ7A 3LN5B 4KTYA 5D7LB 1YN6B 4NQCE 4UIKL 1DN0B 3DUHA 4F33A 4YFEA 1U8OB 4NJAL 1M7XA 4QRRA 1JHKH 3W2DL 4Y16C 2J8UB 5JMRA 4U6XB 2AGJL 1VESA 1SYVB 4XMKH 2G2RA 5GGVH 1MCWW 2JJUA 5DEGA 1JCKA 1CXEA 2F74A 5IVNA 4PD4K 2PW1B 2P1YA 2GK2A 5KVEH 3MV9A 4HIHA 4YO0A 4NWTL 2YPLD 5J1TC 4KKLD 2N1KA 1RZIA 3BJLA 3EYFB 4PFEA 4BZ1H 5JDSB 5KSAB 1Q0YL 4H8WL 3DLQR 4H25B 1JV5A 3BPLC 2CIIA 4YE4H 5BO1L 3TM6A 1M6OB 4QXUH 5KVGL 2CKBH 2CDEA 1FNHA 3MJ9H 5BS0E 2Q76A 3LKQB 1IGJB 4I2XA 2QSQA 3BUYB 5D72H 4P9HL 2MQCA 1K5NA 1AKJB 1LK2B 4MNHB 3R1GL 4ZAKC 3OJMB 4RFOH 4CMMA 5A1AA 1IT9H 5TFSH 1AY1L 3LEYL 4GH7B 5SWQB 5DEFA 1K6QL 4XC1H 3TBYB 4J3TA 3ZDYE 5HHQA 1FPTL 2VZUA 4F7EA 3VI4E 3M1BA 2QJDA 1JRHI 5C3LD 3BEWB 4MDIB 2AXFB 4AG4L 5J1AB 1MNUH 1I1CA 1Q9WB 2QSTA 1U3HC 2Q7NA 1HSAB 3BJ91 1OAXL 3GI8L 3RBSA 1HYRC 2BVTA 2XV6B 2NY0B 2VDMH 1RUAH 2IEPA 4Y5YB 4OD2A 4PBXA 3UPAA 4PJ7E 4JJHA 4K7PY 2AI0H 2WK2A 1G7PA 4JJ5A 3RQ3A 2HAZA 5E2WL 3TYFA 5KANI 2FR4A 5IK3B 4WI4A 4N68A 3C5JB 1SY6H 3VRLF 4QHKJ 3MLRH 1FNLA 1I7RB 2WLZA 4Y5XA 4ISVA 3V52L 3VFUA 3QRFM 1BEYL 4K55A 1P1ZA 3CSBA 1YJDH 3BZEB 4HQQH 5F1IA 5IHBA 2ADJA 3CCHA 4GBXD 5TQ2L 1U95B 3NN8B 1JGLL 3RKPA 5HHOD 5LBSH 1RURH 3FFCE 4P5MB 1VFBA 5IVOA 3TWCH 2PYEB 5EOQH 5KS9E 5GXBB 3HS0B 5DMYA 4RGNE 4PJXE 5F72S 1FZMA 2D31B 5C08A 4Y2DA 1X5ZA 2R1WB 3AU1B 1K9TA 1MI5D 8CGTA 3IF1B 3U48A 2OR7A 1YYMH 2VR9A 1XF2B 2LAAA 2O5ZL 4EIGB 3EYQD 2VAJA 3RY6A 3G04A 4Z5RA 5LJYH 4H0HB 4LHUB 5DVOA 3C6LB 3QEHA 4W4OA 2SEBA 3FQTA 3L1OH 3IU4L 1OL0A 4FQXB 4ODWA 4RSVA 4ZUVA 1EPFA 5F88B 1O7SA 2PCPB 4HXAH 3RU8L 5GS0D 1T20A 4P23D 4M3JA 2MJWA 4KRMB 4ZFGH 1SBSH 1NCAL 1WZMA 4Y4HB 5C0BA 2GUOB 2BP3A 4NHUB 1DR9A 2HMID 5C6TH 1NGPH 3G6JF 2YBRB 3CFEB 5E8OB 4N8VA 1DVFD 1M4KA 4D0CB 5DQJB 5IHZB 1KIPB 3CFBB 1U93B 3CVHL 2HYMA 2BRQA 1JYNA 1RPQA 1ZHKA 1CVSC 5DT1L 3FHQA 4A6YA 4NQEE 3SGJC 3GSNA 3X11B 2R0LL 3T1FB 2D7MA 3L3JB 3B43A 3V0AC 3AS1A 3P2TA 2XT1B 4WY7H 2RFXB 4HF5L 5IHUL 1JGUL 3Q6FB 1OTTC 4XAKE 4D8PB 3HRPA 4NO0A 4L8SB 3JVGC 5D96C 1PKOA 1M71A 3SE9H 4G8EA 4ZSOB 4H88H 2X4RB 2KQNA 3X13A 3E3QC 5TDPA 4W6YB 5H2BB 3L3DA 2IBBA 2G60H 4X6CA 4MA3B 3N85H 3MODL 3O3EA 5EC2A 3D3VE 4D9RE 3RPIB 2EEDA 5T3XL 1DBMH 5AG8A 4L9LA 2NW2B 4P2RE 1UZ8A 2PN5A 3HR6A 4KROC 3VWKA 1PG7X 5DRZB 2Z8VC 3IDMA 2ED7A 3MR9A 1GGYA 1D9KD 5JO5A 4HT1H 3IXTB 4TSAL 1RIHH 5TE4H 1NFKA 1LNUB 1UZ6F 1YQ2A 4HAGA 3MRQB 1SYSB 3VRIA 4HIJB 4MAYD 5IMMB 5TPWH 4K3DL 5J6GB 4HDIB 2NZ9C 3CJJA 4NKMB 1DZBA 2P5EA 1H3WM 4JLRA 4QF1B 5IGXL 1RUQL 4PS4H 1CU4H 3GMRB 4KK6C 4XX1G 3HAEB 3OAYK 3SDDB 2R39A 2NY1C 4U1GB 1KCKA 1WZLA 4UV7L 3VJ6A 3ZL4H 5C2BH 4OQTA 4I3SH 3DV4A 3BH8A 3F6LA 1CDHA 4KTEL 5GGRA 2D7TL 1JZ7A 2DI8A 5E7BA 3F8UB 4BYHA 4K8RH 1W8OA 1QG3A 4LLUB 1A2YB 5F7MC 5KJRL 4LHJB 4YFLF 2EDYA 5DD0H 1RZ8A 2IANE 2VZTA 3BRGC 2BRRL 4XMPH 1CFSA 12E8H 3C5ZC 2VAAB 4POUB 3MA9L 5ACZA 5J3HC 4CDHA 3WUZA 4ONGH 3GSXB 4PGEA 1RUKH 4LKCA 4E41B 4XPAH 4X6EA 4KVNH 2D9CA 4I5BB 1KJVA 4KHTH 1B4JL 3K2UH 3MXWH 4WTXA 5F1SA 5HHPB 3MOAH 5CEYA 4XVSL 5J9PA 3EGSB 5E8PB 1JUFA 2YA1A 2XTJC 4I0PB 2EE3A 3GSUA 4KK5D 4YDKH 2YSSA 2VUYA 3PGCA 1RJYB 4FFWC 2HT2C 1CDYA 1AP2A 3IXAB 2CDFA 3CFKB 1CIDA 3U7YH 3AY4A 2HH0L 4OFIA 3PWUB 1AQKH 2CH8A 3DI3B 3MRHB 1WBZB 1QRNE 5LVEA 2JJSA 1EO5A 1AGBA 3C09C 1NAMB 4B0MM 4MGXA 4Q0XH 4JFFB 2OCFD 2BOBA 3WXWH 3MRBB 2C5DC 2JK5B 4Y4KC 5CJ5A 3I84A 4G80B 5IIEB 3IJSB 1BF8A 3ZYJA 3MRIB 2Q7YB 3QUKB 1CGXA 1L7TL 1DFBL 2NLJB 5DZLA 5FKAB 3H9ZA 3TO4B 4WIQA 5L2JA 3F62A 3S36X 3E2HB 4QRSA 1I75A 3TPUB 2AJ3A 1MUJB 4E42A 1X4YA 2PTUA 3BD4A 3LY6A 5DYOB 4OTXL 2C4XA 3KVQA 5D7LA 2CXKA 2AS5M 1CF8L 3B9VA 1U8OA 3DO7B 3PP3H 4HFWB 5DS8B 3V7MA 1U8KA 2XPGB 1J1XL 2J8UA 2C7UA 4GMSH 4GAGH 4U6XA 1VPOL 4WTZA 5C3TA 1A6TB 1B4RA 4YQXH 2J1KA 4Z7OF 4JQIL 5GHWL 4IOSD 5DFVD 2IALB 2W0FB 4X8JB 3V7AG 1G7QB 2VDRH 1AQDB 5E5RB 1AJ7L 5DFTA 5AUMA 3V6OE 4TULH 3EYFA 5IVXF 5KG9B 1H3TA 1HE7A 2Y25A 4ODHH 1KN2L 2YRLA 2J7LA 1EEQA 4H25A 5AYUH 3FONB 1WAAF 1KXVC 1PZ5B 1C16A 3R8BB 1IC1A 1JHLL 2MCPH 4PJCE 2JELH 3FFCA 4ZFZB 1A5FH 3AS2A 5ECJE 3ARFD 5C0NC 2X4PB 3D0LB 1WWBX 2DWDB 4KI5C 4NBXB 1I1AD 2YC1B 4PJXA 4ZPTB 5FGRA 3TVMB 2ZOLB 1GZQB 1XR9A 4JDZB 2BX5A 4P2OC 3HUJB 1NFIB 4HUWA 4OAWB 1H3UA 2A6KB 3SGKA 2D9QB 3NFNA 1QSFE 1TTUA 4WUUB 2AP2A 3D25B 2F53D 4G8FB 3TBYA 5JW4Q 2Z31D 3QQ9D 4H0IA 5DUBB 4ERSH 2K3TA 4MWFB 2QLVB 1YEKH 3VRJB 2F54E 1U92A 2HFEA 2EDFA 3OPZL 4PJIB 3ULVC 2R56H 4JFPB 1C8PA 4EI5D 3GK8L 2DQTL 4YC2C 3KGRA 4AH2A 1NGYA 1KN4H 3SJVD 5I71C 1IQDA 5CEZD 5DJDB 2HRPL 1VKXA 2YD2A 3QDAA 2VIRB 2VWEE 4YHKH 4Y5YA 3UTSB 3WIHA 1EZVY 3WEXA 4JM4L 3PE9A 4M48H 2P5WE 4IOIA 4M02A 5FCUL 1EAPA 2ZPKL 4XBEL 1WITA 4HFUH 2IH1B 5F7WC 4JR9H 1MHPL 2XI9A 3C5JA 3TYGH 1KLUB 4NQEA 1CR9H 4L5FL 3ZKMC 3HNVL 5EU5A 2GHWB 2DQCH 3PWPD 1WBYB 1HQ4A 5DJCB 4M8VA 1RJLA 5SWZE 3IFLL 4HH8A 3CIQA 3TZVA 1G6VK 2V7NB 2GJ6D 3NN8A 3R06A 5BRZE 1GC1L 2C4FT 3KJ4B 5ADPH 2PYEA 3QXVA 3DRTA 3E6FA 3NCYP 3HS0A 3PV6B 3KXFB 3K8LA 2D31A 3BPOB 5F6HJ 3WCYA 2NY4D 5IHLB 3DWTA 1TJHL 2FX9L 5MERB 3IF1A 3FKUS 1CE1L 2GSIA 3HKFA 3FN3A 5D7KE 3VFMA 4GKZB 4CADB 4EN3A 2IH3B 2ZG1A 4LHUA 1KXQE 1BQHG 4KFZC 4M5YL 1FNGA 4U1SB 2FYYB 1FGVL 4X7TB 4GKNA 2G75B 4G5ZH 1XGQA 2XWJB 2NY2C 1OCWL 3EJJX 4HH9B 1HINH 1EUUA 5FYKE 1BFVH 1JNNH 4URTB 1J86A 3TV3H 3MTRA 3MC0A 4FMKA 4NHUA 5JNYB 1HH9B 3C2AL 3CZJA 3O11B 1FIEA 2VLJB 3CFEA 5E8OA 1LEKA 3BKYH 4D0CA 3MRJB 3OXSB 4F7TA 4F9LC 5JOPE 3THML 1WEJH 3UBXA 5IWLC 1KB9J 3T2QA 1UM6L 4FZEH 4U0QB 4CVZB 2PW2B 5ILTH 1R3IL 3X11A 1G9ML 3T1FA 1RZFH 1NCWH 2IANA 2RFXA 2UY6A 4GAJL 3LPWA 2MOVA 1NBZB 5JZ7D 4Z7UB 1OGAE 4QOKE 2VXSH 3IDXL 4L8SA 1FN4B 2CDGB 5EG6C 4JFYA 3LV3B 3V6BR 1FJ1A 2ADIA 1BFTA 4LVOB 3BT2H 2VKWA 2I60L 4IMKA 4P99A 1FG9C 4XMLH 1IGCH 1Q72H 5CD5C 3CLEL 3QDJE 4U1LB 2P7TB 4YEFA 1MCOH 1IKFH 1JYWA 2Y4SA 3TT3L 5TF1H 3NCJH 4XNYH 5EPMA 3C60B 1K4DB 2VC2H 5DRZA 3HZMA 5DJXB 3HE6C 3GHBH 4N9GB 3SE8H 5EUOE 4MLSA 4P59L 1ZHNA 3M8OH 3MRQA 4WWID 1QFWL 5J6GA 4G7YL 5GSRB 5CCKH 1QRNA 2WWKO 4NKMA 2E27H 5BV7H 1U6AL 4F3FA 4MQ7B 4Y5VA 3NH7H 1PGRB 1ZT1B 4I48B 4UNTA 4XWOC 3HAEA 3RZCC 3RGVC 2A6IA 4FXLA 3PQYE 4L4VD 3VD7A 5GS1B 4Y7MA 5I1GL 4BZ2H 2V5MA 1XR8A 3TH4T 2VXVH 3DV6A 4NQVB 2OZ4A 1F4AA 3OKYA 1A2YA 2AK1H 3U79A 4KUCD 3MV7D 2OXHA 3J8F7 2Q86B 1FFRA 1G7MB 3N1MC 3VXRE 1X6NA 2GITB 1A47A 1EO8L 3GSXA 2Z91B 3GRWA 3OKEA 4U4BA 5KN5A 1WIPA 2DBLL 3QULA 4JFEE 4LGSB 2V2WA 5GS0L 2Y23A 3N1QC 4GW4A 4J4PC 4QRUB 3O9WD 5D2LE 2XTLA 4OZGE 3VW3H 4O02L 1PZUB 1UXSB 2VR5A 5E5UB 5E8PA 1T80A 3V6OA 4LSPH 4CNIB 5IBUB 4G8GE 3K7UA 3PWLB 3VXSE 2OTWA 3BWAA 3QR2A 5EU7C 2JB5H 1XZ0B 2APBA 3IT8D 3IXAA 5J11B 1MJUH 4TSCL 1HKFA 1EXUA 3CFKA 3TCXA 2O5XH 5LGHH 4PJCA 2VL5A 3FQWA 3PWUA 1ZT7A 2X70A 5EORH 3NGBC 4WWKC 1PKQE 4OCRL 3QWRD 3ZE1E 1NAMA 4GRLC 1D5BB 3RDTA 4JFFA 3REWA 5L8KB 4NRXA 3MRBA 4JRYB 3FO0H 2JK5A 5DK0B 1GHFL 1LO5A 1X7QA 1QSFA 2C1PA 5GSVB 3IJSA 3BSZH 1FHGA 4XCNB 1KTLB 2NLJA 4M43H 5I1HH 1ZWIA 1C12A 3QZWG 1JHKL 3GBNH 4OLYH 3TIEA 4BSJA 1CQKA 2F54A 4H1LA 4JO1H 1EMTH 4QKXB 3BGFB 4LQFH 5I75C 1YY8A 5KVEL 1RI8A 4HFWA 5DS8A 1Z5LA 4KKCC 1MLBB 1Z9OA 3MNVB 1FVCB 4NO2B 1LK3L 3GNML 4PTUB 1FVEB 3RL2A 2ITCA 1ZHBB 4KZDL 1KB5B 4YE4L 4NKDB 3CVIH 2NX5E 2IALA 2ARWA 4X8JA 1G7QA 3CK0L 3TN0B 2CRIA 5KG9A 4GXUN 1YEHH 5GRXG 1L6XA 1MVUB 25C8L 1SMAA 3JV6A 2X4TB 3A6CL 1FO0B 4NC1C 4X6CF 4KRPC 3FONA 1MWAH 5J56B 2DOCA 2DQIL 5SWZA 1PZ5A 4LNRB 1ORSA 1QFWI 1EFXB 1WLHA 5SX4I 1NANI 4RFOL 7FABH 2Z35A 3U7WH 4JG1H 1NFDF 1U8JB 2P43B 4YXHH 3D39A 5BRZA 4NNXA 5F70A 3QPQC 5TFSL 2OL3A 5LGKA 5IR1A 8FABB 5FYJL 2APFA 4U1JB 2XKNB 4F8TA 1FNSH 1BZ9B 5EZOH 2X4PA 3D0LA 1J11A 1EA9C 3TVMA 1TLKA 1GZQA 1PLGL 4JDZA 4JM2C 5JIKA 1NFIA 1T1XA 2Y06H 1MNUL 4PJDB 4UILH 4ODUA 1XIWB 5BW7C 4G6JL 3B83A 1E4KA 3HCVA 4JPIB 1VENA 3WNMA 4YLQT 4YBQD 4MWFA 5CP3H 4PRBA 3VRJA 1L0QA 3D9AH 5INCA 1GL4B 4MB5A 1CFQB 2XN9D 3MLWH 5LQBH 1CTNA 4JO2L 3MOBH 3L6FA 4WI3A 2PTTA 1MCLA 5E4EB 2R8SH 1K3ZA 4PY7A 4XPFL 4QRPE 3P0VL 4GLRH 1VGKB 1INDH 3MUGB 2F19H 2X7LB 3UTSA 3GSVA 1P84K 4GUPA 3DGGB 4UBDC 1YJDL 4Y19B 3NFPA 2FL5A 3HE7D 3GMOA 2GY5A 1JTPA 2YD4A 1UWEH 3TWCL 1Q94B 2DN7A 1IC4H 1NAKL 2FNBA 4X4ZA 3EOTL 1B88A 4UQ2B 5DJCA 4M1GH 3FB5B 5D1QB 3MLZH 5ACMA 1QBLL 3O6LL 4QOKA 4JN2B 2CJUH 2A9MH 1AC6A 3O2WH 3VGAC 3BO8B 3G9AB 5T1MA 4QT5A 3GJEA 5C8JA 4Q97A 4PJAE 4LOUD 1ZLUH 3EOAB 5FM4A 4RGMC 1MRCH 3UXFA 1NUNB 32C2A 1BJ1J 1QZ1A 4PJEE 4HMEA 3LQAL 3I6LE 2WWKT 2VDKL 3V2AR 5L8JB 1X5JA 4GRWH 1AHWB 3QRGL 2YWZA 4FZ8H 4RDQG 5DJYA 4ZFOA 5FF6B 3F6IA 1QA9B 1S7RB 2FYYA 3FOLA 4X7TA 2NXZC 3SCMD 1N3NA 4JDVB 3SE4C 2E6JA 5EUOA 2BNRE 2EDBA 4APQB 3VFGH 5JDJA 2UWEB 3ZDXF 2ZNXA 4BH7A 3HC4L 1JWMB 3FB6B 2DQEH 1LHZA 1U91B 2CGRH 1HH9A 3G6DL 5DK3A 2A1WL 3F12B 3H8NA 3O11A 1NGQL 5DA0B 4UINL 1UJTA 2AJUH 3MRJA 1CD9B 3O8XC 3PQYA 4KMTL 2J8UF 2VITA 1T04B 2LQRA 4MXQD 5EN2B 3VXUE 1FDLH 4KK9C 4MSWA 1U8NA 4RRPG 1I1FB 1KEML 3MNWB 3MLXL 4BFBD 3V8OA 3QXAB 3WXVH 4KAQL 4Y89A 5FA4A 1NBZA 5T1DH 5I1DB 4CU8A 3O2VH 3KPLB 4GXVH 3VXRA 1KC5L 1FN4A 1KEGH 3CNKA 1IRAY 3MRDB 2R0WH 4YK4C 5EULV 1QR4A 1R5WB 4QTIL 4CUCA 5CEZL 3X3GH 1XGPB 4UUJB 1RIHL 1UT9A 2WUBH 5T3XE 3S4SB 4CRPA 2DKUA 1J87A 2R29H 3QXDB 4PJXF 3C60A 3GBMH 3VFSB 3RX5A 5ID1A 3NTCL 4Y1AD 5DJ8B 1DBKL 2HJLB 5DJXA 3EO9L 4CMHB 4UNVA 1KULA 1KJ2B 3W9EB 1DBJH 3JUZA 4OD3L 3EFDH 4YHPA 3RVVC 5GSRA 2R2BB 2YMXH 4OKVB 3QUYC 5E00B 5I17B 4IRJC 4DN4L 4JRXD 4I48A 2YS4A 2ZNWA 4ZXBD 4HC1H 5CJ8A 1HKLL 1TVHA 3VXME 5I1IH 3MQIA 3OR7B 3DRQA 3DX8B 3LIZH 2BOCB 3BIKB 1RUKL 5DQ9B 2DQDH 2UZYB 5L88H 3CXDH 3BZFB 4KVNL 4LFHD 4UI2A 5C07B 1ZLUK 3ARBC 5D4QA 5E8DL 1AGDA 3MXWL 5AYQA 3IFNH 2R9HD 3GIZL 2YUZA 2HVJB 1TZGH 5EZLA 3LS4H 4KZEH 3MZGB 2PR4H 4GG8B 4U6VH 3B5TA 1CICA 4YDKL 1T2QH 3L5WB 5EIIB 1MIMH 4PRIE 2XRAH 1BBJB 3DVFA 1BOYA 1B2WL 5GGTL 1NC4D 3U7YL 4PRHE 2AW2A 1YMHB 4HBCL 1BAFL 4UT9L 1RZGB 3HB3C 3JWDL 2G9HB 1X5FA 1Q9KB 4X7CC 2CK2A 3HI5L 3RWDB 5E1AB 1JGEA 4EDXA 4P4RB 4GG6B 1ZSDA 4N1EA 3NABL 3WXWL 4AIZA 5DMIL 3QWOB 4Y88A 1CFVL 1G7JB 4ODVH 4N1HB 5FHBH 1OAZH 1RJZA 4PGBB 4ZOAA 1ZVSB 1HHIA 1OAUL 1Y6MR 4XXDA 5J57B 1F6LL 1HHHB 1IGYB 3BKJH 3QEUA 2R69H 1M05A 5DK0A 5C0EA 4DVBB 1F02I 5KTEH 3UAJC 1WWAX 4ODXA 1INQB 5E94A 4XCNA 2YUWA 4HPOH 2X40A 3BGMA 3IKCA 1E6OL 2PO6B 3KLHD 2FHFA 1Z3GL 1UYWH 3QIUB 4LPYA 1FAIH 1D5XB 3EDEA 2D0GA 3MRLB 4PRAB 1LEGA 1H15B 3VGBA 1K8DB 5KVMC 2F58H 3BESR 2R0KH 4EUPH 4LASL 3KPRE 2VDRL 1QACA 3KJ6H 3VCLB 4QRPA 1FVCA 4PTUA 1YEIH 4C56A 4Q9QL 4ODHL 3VD9A 2VQ1B 2H32B 3LDBB 1CG9A 1QO3B 1ZA6A 5CHNB 1FNAA 1J8HD 5E08H 3LB6D 5ISZE 3TN0A 4G6AD 1UJ3A 3AMKA 4XCEB 2MCPL 3VWJB 4NRYB 2JELL 1U8IA 3HZYA 3P73A 4NKOB 3WKMH 4FABL 5MENE 2P24A 4Y4FA 4PJ5A 2FO1A 3OAZH 4G9FB 2OP4H 4L3AA 3LZFL 5DUML 3UTZA 1QFUH 4KHXH 2NY5H 4XC3H 2NNAA 3IJYB 4FRWA 5ALCH 1NGWA 1T03L 2NW3B 2XZCL 2VLMD 2XKNA 5I16A 3W5NA 5D70H 1BZ9A 4PJAA 2AKRA 4PB9H 1KG0B 3BRDA 1XCTB 1YEKL 3IYLW 2NTFB 1F2QA 2J2ZA 4HJ0D 4NRZB 1NGZB 1LVEA 3ARSA 4MXVE 4PJGA 2J88H 4XTRD 2I9TA 5D7JA 2B4CH 4JY4B 3DARA 2HG5A 4YAQB 1I8MA 2ICWJ 3IAQA 4RFNC 3S5LB 2BNRA 4NP4L 5F7YC 3MFGB 1RZJH 3MLUL 2NY5C 2J5LC 1ORQA 3QDME 3HR5A 3KPMB 4FQLH 1MHCB 1QEWA 2VNCA 3RWFA 2VDPH 1C08B 3DXAD 4XAWL 4XPGH 1QBML 3P9WB 4Z18A 1EUTA 2FB4L 2QEJA 4N5UA 1YDPB 2MWCA 1DQTA 3D85A 1UGNA 3SY0A 4M5ZH 1NLBL 4Y19A 1NMBH 4XB8A 2V2XA 5DVMA 3W0WD 3MRMB 4RX4A 5ELIA 1Q94A 1KELL 1NGXA 2FH6A 3HMWL 3EYVB 3PGDA 4N0YH 1I9IH 4NUJA 4U2YA 1IL1A 2R23A 4UQ2A 5D1QA 1F90L 3ARGD 4TVSa 3MV01 4GXUM 3U46A 2C3VB 4UDUA 2DYPB 1HI6A 3BP7B 1P5VA 4LCYB 5AD0B 2E6QA 3CX5J 4Y5XC 1ZE3C 43C9A 1CIUA 5GJTL 4YFDB 4J7RA 1BP3B 1KB9K 2GJZB 2VXUH 4NKIH 2BNUA 3U1SL 1Q9OB 1T66D 5GGSB 1PQZB 3SKUD 2W0LA 1SEBB 3MXVL 1MPAH 4WI2A 4HHAA 4OF3A 3LQMA 1MCRA 3AM8A 1BFVL 1L7IH 3QH3B 1EHNA 4ZS6C 5FF6A 2APWA 4Y2DC 1S7RA 2R1XA 2YPLE 2VN4A 4DKEH 1RU9H 1ZVYA 1NL0L 3RY6C 3O4OB 4APQA 2RQ8A 1R3LB 4P3CH 4OCWH 5DUPH 5ICZB 4W4OC 4IIQB 1WIOA 1QSVA 3MFFB 4DAGH 4K7PL 5I73C 2NYYC 3F12A 4ZOEA 3MBEB 4NNYA 5EIVA 4GBXB 1TDQA 1X5GA 3DBXB 1RZFL 3IDNB 3LHPL 5DZNA 4XNMA 1QD0A 3OAZK 4LSTL 5HVWA 4L9DA 4NT6B 2X89D 3GHEH 2YR3A 4LHQB 4Q2ZA 4OZ4A 4FN0A 2NR6D 3BT2L 2IMNA 5HHMB 3IFOA 3BPNB 3S88H 3U9UB 2Q3ZA 1N8ZB 2VLRB 3WD5H 1EHLH 2BHZA 5E6ID 2EIZA 3QJFA 4MCYB 2PYFB 3I3BA 3IDYC 1KPUB 4FQIH 1MCOL 3MCKB 4MJID 2CLZB 4HUKB 1S7VB 3WFZA 3NCJL 4ODTL 1H8SA 1S5HB 2VC2L 5DHYB 5K59F 4Q7DA 2A74A 3MBXH 1R5WA 3GHBL 1OQOA 5ITBL 4PJFE 3SE8L 3QCUH 4OCXH 1JF1A 5I76B 5DO2C 5IEHB 2RB8A 4H26B 1HHKB 4Y16B 4R96B 4FQQB 1VCAA 1L0XA 5DJ8A 1B0GB 2HJLA 3QIBB 3HUJF 2FBOJ 5BV7L 3MRNA 5TH2B 4XVUC 5FYKU 1KJ2A 3SGEH 5DRWA 2CQVA 4L9LC 4OZFB 3VWKC 3QDHA 4OLZH 4NDMB 4BZ2L 5HYEA 4OKVA 4AT6B 1CCZA 5HPMB 1WICA 3VDBA 3NZHH 3FRUB 2AK1L 1I1YB 3BPLB 5HHOE 5FUCC 3VMOA 4OB5H 2DLGA 2AEIT 5FUZL 3TO2B 5F1NB 1A7RL 3AB0B 1ZMYA 4ETQA 5IFHL 3NCFB 3TBWA 2EC9U 1FFOB 3GSWA 1F3DJ 4FG6D 4G3YL 2DS4A 5GPRA 1MI5E 3AREA 1CZ8H 4BSVB 4F37F 5IB5B 5DQ9A 3D0VA 1P6FA 1OARL 3BYTA 1JK8B 3MV8D 4DKFL 4ZAKB 4LDEB 2DM3A 1XFPA 3VI3E 1KYOK 4OFPA 2BDNH 5IQ7H 1A9BB 1MFNA 4DZBA 4YHOL 3PWVB 4XBGB 5EIIA 1AR1D 3WJJA 5C92A 1M7DA 3K81A 4KJPC 1U3HB 1WGOA 1S3KL 1A4KB 4JFHD 2EYTB 4Z0BH 1F5WA 2CKBB 5CS7A 2P48B 2W9EH 4HKXB 1RZGA 5EORL 2DQGH 4M62H 5MENA 2OM5A 2MSPA 1Q9KA 3C8KB 4NHCL 3C87A 4P9MH 5E1AA 4BQBA 3KS0J 4DCQA 5ID0B 2NY6D 3QO1B 1YECH 3FO0L 2E5EA 5ABDE 4HK3N 1LILA 1I7TA 1ZVSA 4O9HH 5EUOF 1IAIM 1IGYA 4NSKB 1EGJL 3GBNL 3AY4C 5J12C 2RHEA 3HG1D 5HBBA 1UB6B 4X99A 2JJSC 4LQFL 5IB1B 2LABA 1INQA 1H3GA 1N4XL 2ZUTA 3V0VB 2HP4A 4WEBL 1ZLWH 2GYSA 2VLKD 5FIEA 1VGEL 1SJXA 3VDCA 1N6UA 4TQEL 4Z95L 2FX7L 3QIUA 3WO3B 5JTWA 3QDGB 3N1GC 4FHBD 1MEXH 4LKXB 5J7CC 3MRLA 4LCWB 1K8DA 3T77B 5DRXB 3F58H 4POZD 4WI7A 1WCBB 3S9DB 3MLSH 3SPVA 2BCKA 4Z7UF 4PJ9D 4E41E 1QO3A 5F3BB 3CSYB 1J1PL 1E4WL 3T2PA 5K9JH 1XGYL 3IVKB 1KFAH 4CL7A 4XCEA 7FABL 1D6EB 1RUML 2EDRA 5JLZB 4PB0H 3UTTD 3ZT7A 1CE6B 4JKMA 3BN9C 3DMMA 5EZOL 2UYLB 5C9JA 4G9FA 3VFRB 2YZ8A 3QISA 2V9RA 1NJ9A 2ADGB 4FFZH 2Y06L 3IJYA 4X8XA 5FYJE 4NYLB 4BFGA 2NW3A 3BN3B 4CN4A 1W0WA 1FH5H 2I26N 3VGFA 3PHSA 3DTXB 4YDVA 5EA0H 3SKJH 1J7VR 3RNKB 1BQSA 1T7WA 3OKNA 2V2TB 5IT2H 4PUBL 1NUGA 3PWJB 4XNXL 5LQBL 5IJKA 2ZCLL 1NGZA 5C0CE 1HHJA 5DMGD 3ULUD 5K9QG 3MROB 4LSRL 5D96B 4JHZA 1IGIH 2IPKB 3QAZC 3WIHH 5I8OL 3LS5L 4NJ9L 2YPLA 4O58L 5C2UB 5DD3L 3SGKC 1OTSD 5HGHB 1INDL 4FFVD 5TE6L 4KDVA 5EOCH 2AXGB 2VISA 3KPMA 5FDWB 1MHCA 4R6UA 3DYPA 4YEEA 4G6FD 3ZHLA 4KROB 5DJ0B 3CC5A 3IAGC 2DLFH 2AEQL 1JBJA 1UWEL 5IUSA 4RQQA 1YDPA 4NZTH 2EECA 2GIYA 4KQ4L 4WEUD 4MZ2A 5SWSD 4NQCD 2CJUL 4Y5YC 1PW3A 4NBYB 3MZTA 1YUHA 5DZOA 1BZ7A 4HIXH 3STZA 2BY3A 4KPHH 4NFDA 2WWMD 3O81A 3WHXB 2VE6B 1QVOB 1BX2B 2G5BA 3WKNA 4PPTA 5T1LD 2DI7A 2NY1B 2DYPA 1CDGA 1J05B 2VDQH 4LCYA 5HVFB 1AD0B 1F97A 4Q9RH 2W60A 1J9CT 2FD6L 2MHAB 2C1OA 4QWWC 4XI5C 2C3GA 3TZVC 5K93A 2CRZA 1BREA 1PQZA 2WNGA 1H9VA 1SEBA 3LMJH 4PJFA 3S37H 3ALPA 2ZOKB 3C5ZB 4UTBH 3I6KB 5C0AD 2ZSWA 4HKJB 1G9NH 4JQVA 3SDCD 2Z4QB 4XNZC 1IM9D 4LLDB 4Y4KD 1Y0LB 2EDHA 3RWJA 3T3PF 4HLZG 2DB8A 3GDBA 4EN3C 1IBGL 3MRKB 2EYRB 5HI4C 5ICZA 1A22B 4IIQA 4RGOH 3MCLL 2FBJH 4YJZL 2HJKB 3QNXA 2XTJB 5FO8B 3QJHB 2EEBA 2FWOB 3DUSA 5D6DA 3WNPA 3P9LA 4GBXA 5HHOA 1K2DB 5IP4A 1UM4L 5DD1H 2DICA 3HC0B 3O0RL 3QPXH 4LK4A 3Q5TA 5H35B 3L3KA 5AWNH 1W2KT 3KPSB 1F4WL 1G9NC 1MI5A 3PHQB 1DSFH 3C09B 2F53E 4DGYH 4XPTL 1Q1JL 1FORL 2HKFH 3B6SB 2VXQL 4ORGB 3SBWA 5J06A 1ZA3B 1MRDL 5H37G 3U9UA 1N8ZA 1MFAH 1DQJB 1GXEA 3BHBB 3X3GL 4J8RB 3DX7B 1NCNA 2PNDA 4TTDD 2P8LB 3FRPA 4P23A 1YMME 5E4IA 1JYVA 4NM4H 2AERT 2IBZY 3SJVE 3SKNB 5DHYA 5AAMA 1CDCA 5IBLD 1KTKE 5CEZE 2OYPA 1YNKH 3GMQA 5IJVB 5I8KL 5B38A 1S7SB 2DQFA 5IEHA 2Y7QB 4WW1B 4MNGA 4PJAF 4PGJA 3EFDL 2Q8AL 4IMKC 4H26A 1DVFA 4JRWA 4FQQA 5ESQB 3IB4A 5HGAA 5CIPB 1AE6H 3QHZL 3QIBA 3ZE0F 5GS2H 4XVJH 1DUZB 4PJDF 3JSSA 1LP9E 1P53A 4LDLB 1HK6A 4O5LH 1U8QA 3K46A 3L7FB 4U3CA 2R2EB 1DDHB 1H3PH 4HC1L 4U1IA 3RKDD 1CGWA 3PWPE 4PJGF 4M00A 4P2YA 1F58H 3QG7L 5I15H 2GKIA 4AT6A 1P2CB 1HOCB 1JPSH 1ZHLA 1BFSA 4Z9KB 1RK1A 5JORB 1TJIH 5KVDH 4R4BA 2GJ6E 3QNZB 2M26A 4BQ8A 2DQDL 4R7NB 4X9HA 4PLNC 2HKHL 3UO1H 3CXDL 5L88L 4N0CD 2BY2A 4P3DA 1IGFL 2G5RA 3MRFA 4A2MA 5IM7A 1FFOA 4Y5VC 4FXGB 1A21A 3QIWB 5I30L 1KLGA 4LQ1A 4TUKL 5IB5A 4K94L 2PKDA 1QLRB 4F58H 4MQSB 4U31A 1T2QL 3P30L 4P2OB 1OPGH 4ZAKA 2BXZA 1MIML 4R90L 3BH9B 4LDOB 2LV4A 1FIGH 1D5ZB 5FO7B 5HYJD 5EOTB 5C0IB 5C09B 1SJEA 2LE9A 2WW8A 4XBGA 5GRYA 4OIAA 3AAZA 1UA6L 1FNEA 5DJZA 3TBVB 3BEVA 3STLA 4YC2B 4ZUTB 1DQDL 5I71B 3LSOA 4XAKD 3MJ9A 3RWCA 4I9WD 4HKXA 4MD0B 1NBYA 1CGSL 5FHBL 3FO9B 3ZT5A 3MLYH 2BNQD 3ARQA 4L4TB 4X4YB 1DANU 2D7NA 3V6OC 3QO1A 1F4HA 4CDGC 3PIQB 5BOZG 4OF6A 5TE7H 3D3VD 4D9RD 3VG9C 2HTKC 1MCPH 5GGUA 4JHAL 5I1KH 2CLRB 3F7VB 4YDLC 3V4UL 1UYWL 3FZUC 2GW5A 2BERA 4GQ9L 1KENH 3MLTB 5JOFA 1KSRA 4JB9L 5F8QC 3UZQA 3QA3B 4DZ8B 2EE2A 3EO1A 3FHAA 2DMCA 1QYGL 2JJWA 2J8HA 2OJEA 3RDTC 5H8DA 5JQHC 1FE8L 3EZJB 4XP5H 5HXMA 3MSPA 4N9OB 3I6GB 1YEIL 1JPTL 1HQRB 4IOFC 5KSVA 4ALAL 3NIFF 5CKAA 1MFCH 5E08L 1FC2D 2P8PA 1A6ZA 2EDJA 5I8CB 1N7ML 3KPNA 5I1AB 2W07A 3MJGX 1QSEB 3CSYA 2NY2B 4K2UL 2VDOL 4KHXL 2EH8H 2FJHB 4XC3L 4LVEA 1FYTD 1C5CL 3T2NH 4K71B 4Z77B 5JLZA 3NMEA 4OKDA 2M8XA 4L4VE 1CE6A 3EIFA 4YHZH 3HNTH 1H0DA 5D70L 5DVLA 5CMAB 3K8MA 5FGBA 4V2CB 1QQDB 3SQOH 4RMWA 5ICYB 1YNLH 2IG2H 3MV7E 2AXHA 4ACPA 1YEGL 3EDFA 1FZJB 4EIZC 3RNKA 4TNVF 4FQHB 3WBDA 2V2TA 2J88L 5AZ2L 5FYKH 3KPTA 3L5JA 1P4LB 2VABB 3U4EB 2B4CL 4OGYH 1S5IL 1ZANH 1DLFH 3KYAA 5I8EA 1SM3H 1F3DH 4X6FB 3CDGA 4JPKH 2Q1EA 3TVMC 1X44A 3ZZ1A 4LSSL 4FQJH 4RAVA 2VQTA 4ELMB 3CX5K 4WHTB 3QEGH 3BXNB 2O61A 5E99L 2PUQT 4JFDE 1A3RH 3D6GA 4K9EC 4YHYB 1E4KC 5ESAB 5JHLH 4RISH 1Z9LA 1KCUH 3DNKA 4BFIB 3QHTC 3V6FB 5CLWA 2R1YB 1HHGA 3HE6B 1HXYA 4X9BA 2MPAL 4P2QD 4R3SB 5MEQB 4BQ9A 4W4NA 3WIIH 3S97C 1RMFL 1I1AA 1KPVB 4C83B 4HCRH 1Q9LA 4TN9A 1C1EH 5C0RL 4U2ZA 1JNJA 4HK3J 5F44A 2VXUL 2VUOA 2Z31A 3WS6A 1BX2A 3RZCB 2FATL 3T3MF 3RGVB 1AI1H 3GSQA 2ZUVA 4NO5B 3UEZA 1AD0A 5B8CA 1J0KA 1MPAL 2Z8WC 2P8MB 2XN9B 4MB4A 3UYRL 2FEDD 1PY9A 2YKLH 5JHDB 4RFEB 4C59B 4EI5A 1RV6X 5ADOH 2YUVA 3OXRB 3O6ML 3UX9B 4HS8H 3KJ4C 1E4JA 1RU9L 3QB7C 2Y72A 4TSBL 5MP6L 2ZOKA 2P44B 3ES6B 3LCYA 1MIEL 5FHAL 1U8LA 4GRLD 4OCWL 4Q6YA 3BPOC 4LGRB 5DUPL 1RHFA 5IF0A 2Z4QA 3LVEA 3TBSA 5GGRY 4HLZH 1OTUD 1FFPA 2BFVH 4PJ8D 3HE7B 1BBDL 1AO7D 3OAUL 2EYRA 2P45B 3UMTA 4Z7NE 4KC3B 1I8LA 3PWPA 3BISA 5E8NB 2HJKA 3DVNA 4OZHE 1JRHH 4BSWB 5D9SA 5LG1A 2WIIB 1VEPA 2GJ6A 5ENWB 1K2DA 1HYSC 5CGMA 5E2VL 1T5XB 1MAKA 5CBEB 3HC0A 2AABL 4R4ND 5D6CB 5H35A 1MHHA 3KLAB 3MYZA 3Q6GH 5FOBB 4O4YH 2YD8A 5JPMA 1MQKH 4MQTB 4WWKB 1KCSL 1IAIH 1I7UB 1CGUA 4YXLL 5A3IC 3D48R 5D1ZD 4N0RA 1FVDB 5H37H 1P4IL 4LRIA 3ULUL 1T22B 2FX8H 4PBWD 4OZIA 2P5WD 4F7MA 2OJZL 3MBXL 3Q1SH 3MRGB 1F4YL 2HLFC 2AJZB 3V4PH 3TP4A 3H9YA 2DLEA 1GGBH 3FTGB 5HHNB 1BD2D 1CT8B 5EBLB 5GGTA 1RUPL 4LBEA 3TH3T 4YXKL 4WI8A 5FCSH 2XOTA 1W0VB 1P7QB 5I75B 2Y7QA 1UCTA 4NWUL 5LCVH 4OSUL 3WFDL 5E9DD 3NACH 1J8KA 4HG4J 3G5ZB 4PG9B 3G6JB 1G6RL 4KKBD 3CMOL 4HKZB 5D7IE 4NZUH 3LRHA 1F3RB 1TNMA 5BOPA 4F80A 3MRCB 3OHXA 3S7GA 3BZ4B 5A2LH 1OAQL 1XEDA 4LLVA 4OV5A 1URLA 4X9IA 3H7BB 3I2CH 2B1AL 5JORA 1CZ8L 4KRPB 1S78D 4DQOL 2BMKA 2CMRH 5FM5O 3LEVL 4FXGA 3UYPA 3PXHA 2I5YL 2DWEB 3QEQE 3QIWA 3QUZD 4LEXL 2I24N 9CGTA 3FAXA 3U7AA 4HGKC 4CGTA 4LVHC 5L0QB 3LN4B 1QFWM 4JM2B 4PGCA 4UBDD 1S7QA 4KGJA 2BVPA 1UG9A 1Q0YH 4H8WH 5FO7A 4FFYL 4YPGB 4TOYH 4Z0BL 3DROA 3SDXE 3QI9D 4KRNA 4FTVD 1Z0MA 2DF3A 5F89B 2CRMA 5KVGH 1JF5A 4LLQA 4M62L 4G7VL 3OF6D 3LRGA 1MWAB 1NCDL 4C57C 4JZOB 5I1CL 4GFTB 3E6HA 1N5AA 1CICC 1OGAD 4P9HH 4QRTB 5IMOB 4JRXB 3FAWA 4QYOB 4F9PA 4L4VA 4KH2A 3LEYH 4U6HA 5JA8B 1CL7L 1K6QH 4KKAC 1FGNL 3V5KB 1LE9A 3RI5K 1CLOH 2A0LD 5BMFL 1FPTH 1F3JB