1FL3A

Crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
AALLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTSVTVSAAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blue-fluorescent antibodies.
pubmed doi rcsb
molecule keywords BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN
molecule tags Immune system
total genus 35
structure length 208
sequence length 208
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3A01
2JCCA 1MRDL 2YEZB 4U6VL 2VDQH 4WTWA 2P4AB 2W59A 4NZJA 5I19L 2NW3B 3S96A 3B3IA 3H0TA 2EKSA 1JVKA 4JO1H 1YEHL 4LQFH 1NUFA 3MRQA 4ZFZA 4XXDA 3V52H 1MAKA 3B4NA 3LKNB 2R1XA 2X09A 4P59L 1YYLL 2YBRA 4JY4B 2R0KH 1S7TB 4MQXD 1F6LL 1V7ML 5SWQB 5JZ7D 1AD0A 5KOVC 3L6FA 3T0EA 4UILH 2UV3A 4PGEB 2HTKD 2NY7H 3NN8A 5CD5D 2P7TB 4IMLA 3AFLA 1I8MB 4HXBH 1ZGLP 1WZMA 2XG4A 1J1OL 2BSTB 3O11B 1QRNA 3IAPA 4A6YH 1MCNA 4WVRA 3Q2CA 1Y6NR 4NFCA 4GG8A 4NJAH 5HJ3B 4Q74A 3O45A 3OKNB 3FB8B 5BW7C 4MA3A 3K8LA 3MC0A 5DJYA 1RZIA 4JHWL 5F7FA 2GJ6D 4N0RA 2XQBH 4G9FB 2R0LH 4P5TD 3HNVH 1LE5B 4H26A 1CGVA 1DANT 5DMKB 1KTDA 2CLRB 2AJ3A 3PWUB 3PL6B 4MX7B 2NPLX 5EULV 2VDOL 3GIZH 1U95B 4S1QL 3O0RH 2RB8A 3WKML 3S35H 1EBPA 3GMLA 3P11L 4HWBL 4I5BA 4B7LA 3BESR 5F21B 2X4OA 4NGHL 4GRLA 4F15C 3ALPA 5KANI 4LHUG 4TUJA 3PWLA 2IC2A 5HGBA 4OBRA 4NQED 2H8PB 2A73A 1FQ9C 4MQXC 5JZ7C 2FEEL 2PXYA 3JSSA 3F7VA 4PJGE 2HTKC 5CD5C 1Z2KA 2DWDB 1XGYH 5EUKA 4AG4L 1PLGH 1VFMA 2P5WE 3QNXA 1U8IB 4X5XA 5FAAA 5JW4M 4G8GB 4MA7H 1J10A 2BC4A 3NCEB 3UC0H 3GSOB 4O9HL 4OUUA 2EO1A 3I6GA 4QHMB 1W72H 5D93B 5DK3A 1A9BA 3JBG7 4KAQL 2AK4A 5EU4B 5F1IB 2X41A 1K8IA 5CZVL 1UWXH 3LDBB 5JA8B 1VFOA 4P5TC 5C6WH 1S78D 4HT1H 3WHE0 2A9NH 4FQIH 3ROOA 3D9AL 3JUYA 2F54B 2FIKB 4OF3A 2FH6A 5D7LA 4AL8H 4PP1D 1E4XL 2JK5A 1AE6L 4JM4L 4WI5A 1YEJL 2YXFA 1FIGH 4YHIA 5HPMA 3QXDA 3P4MA 1MH5A 1A6AA 4Y8DC 2C1PB 2IMNA 1F3DH 4J23A 4DCQA 3L1OL 3O2WL 5B38B 3BAEL 1D5XA 3GMPB 5K9JL 1WBYB 1QR1B 3HG1D 2VWEC 5HI3D 1B4JL 1WTGT 4NP4H 4TQEH 2BVTA 1A9EA 3GSWA 4Y19D 4Q9CA 1BBJB 4EJ1C 3WUWA 4M1GH 2X70A 3PGDB 3WFCH 5L2JB 3U4BH 3EFFB 3MMEA 5LBSL 1P4IL 1NFIB 3MFGB 3QUKB 1MRFH 3O41B 4KZEH 1UH4A 3ULVE 4P23D 3M8OH 4JY5L 3QNYA 1RD6A 3P77A 2NTSP 1N5AB 1CL7H 3QEUA 4NKDB 1IBGL 4G6ML 3GNML 5IMOB 4HGKC 4JKLA 1V3KA 1S78C 4QGTA 2C1OB 3DIFA 4RAHA 4ENEC 2VLKD 3HCVA 3R0NA 4PP1C 5FYJD 3R1GL 3QA3B 3QUZD 4YGVA 1S7VB 3FQXA 5HYJD 2WNGA 5D1ZB 43C9B 2L0DA 2X4NB 1T5WB 5E8DL 4C56D 1ZSDA 4QKXB 4BELD 5C0BB 4X6BA 1LVEA 4DVBA 3OB8A 3UX9B 2FX8H 5KTEL 4FZEL 5IEKA 3FQUA 3TPUA 4UUJB 3JV4A 2QV2A 4C59B 5HI3C 5MEOA 3ROLB 5HYSB 3O9WB 1YMHB 5HGHA 4WGWB 2WK2A 5F1NB 2XWJA 3BOVA 4M93C 2XTJB 4K7FA 3LKOA 4JKPH 4ETQA 5DUMH 4P23C 4JDVA 4Z77A 3K2UL 4O2EA 3NAAH 1U3HB 5DK0B 1Q1JL 2X1QA 3B5GA 5J6HA 3W81A 1P7QB 4O51B 3V8OA 2P5ED 1FDLH 4PTUB 5ERWB 2O5YL 3SDXE 1GHFH 4KTYA 4X7CC 4RFEB 2BNUB 3NCFB 4UBDD 3QUZC 5F7YC 4LVOC 5EO1A 4ODUB 25C8L 1OW0A 4JPIA 1INDH 1U8JB 4LLAA 5ID1B 5EA0H 3W82A 2VXUL 2V5SA 3BP7A 3NFNB 1R5WB 3ES6B 2DQDH 3CAFA 1EIBA 4JPWL 1CBVL 5E8EA 3ZYJA 5JOEA 4IJ3B 5C0EA 4M48L 2BNQD 2CDEA 3BPLC 1QSFA 1U92B 4KKNA 5JPNA 3QDGB 4PS4L 2OK0L 4K3JL 3D25A 3FO1A 2LE9A 5C71A 5E5MA 1LEIB 3G5VB 1CGUA 4PRAB 1NCNA 1NFDA 2WINB 4NKMA 2F5AH 4Q9RL 2QSTA 3AM8A 5BV7H 3QEHA 1VADA 3KPPB 1EPFA 1RZ8A 5B39A 4ZPVA 1JGVH 1KIPA 2C5DC 4KDTA 3CZFA 1HN1A 4LRIC 5T33L 1HSAB 2X1XR 5DEFB 2WIMA 4XZUB 5GS3A 2NY4D 5C92A 5F96L 5D96C 5FK9A 1ORSA 4OKVB 1FE8L 1WBXB 1YN6A 3WUWG 2X10A 5D1XA 5FEBA 1Q0XH 4UDUB 4OTXH 3OAUL 1KJ2H 4QHLA 1T0PB 2E7CA 3MLZL 3IFLL 4O02H 4S0TD 5TE7H 1UXWA 3MNWB 4MCYA 3UAJD 5GSRB 4FQ1H 2DM2A 1JL8A 4A6YA 3LB6D 3HZVA 1A6VH 4UT9H 2DIBA 5TFSL 2G5BA 3MRGA 2HJKB 3SGEH 2R4SH 4G8EB 5JIIA 1Q9OB 1QTYT 3WYRA 3D0VB 3JV5A 5CHNB 1NGXB 1TJIH 3GSNL 2YD1A 5IB1B 3ZKXB 1YEKL 4KKBD 5ESQB 3WS6A 4Q97A 1YJDL 4D2NA 3MO1A 5C0FA 3EO1B 3RNQB 1NL0H 1FFNB 4JRYA 5FKPA 4J12A 1QSED 3TVMD 1TNNA 3HNSL 2OP4H 1VKXB 4F7TB 3LS4H 5DDHB 5FM4A 3L7EA 2NY4C 2B20A 1TZGH 2VNCA 3ELAT 5CBAA 1OOAA 4LEXH 4KMTH 2YUXA 5AZ2L 2MPAL 2VQUA 1Z0NA 3UYOD 1JZ4A 3FQNB 1UEMA 1QSFE 1BEYL 3RIAK 3U2SB 4U1LA 3HMWH 3NZ8A 3UTZA 1AKJB 4HKJA 3UAJC 2YUWA 3VWKC 5DS8A 1CN4A 2NY1B 5EOQH 3VMOA 3G6DH 3LB6C 2DD8L 4G80B 4XNUH 2JF1A 4JGUA 1W72A 5HSFA 1URLA 1VHPA 3WXVL 3MYJA 1Z3GL 4BFGA 1FZMB 4KKBC 4RRPA 3DO7B 3EYUL 5T5NG 4EI5B 1WFOA 2D31B 3UO1H 4PJAE 4UI2A 3OKEB 2ZUXA 1P1ZB 1MJ8L 2OX5A 3TVMC 3RRQA 1RZ7H 1QLFB 2NZ9D 1HILA 3MV9B 2Z35A 1X5JA 4XAKD 3IXAA 5KVFL 1U6AH 1A1OA 2XKNB 2VLRA 5TDNA 2EH7H 3OKLB 4DVRL 8FABB 1KC5L 4LSUL 3ZDXF 1EVUA 5GRZA 4W6WB 5IMKA 3AU1A 3IF1A 3VRIB 3VFOB 3MA9L 2VDRH 4KUZL 1QFWL 2FATH 3RX5A 1XGQA 2XKUA 5F3HB 4TUOB 1BJ1J 1RI8A 2HFFA 2DF3A 5F3BB 3CVHB 5B39G 4AT6A 5DWUH 2YHGA 4OLYH 1E4KC 4ZS6D 5GPRA 1WEJH 1IARB 3M07A 1A02N 3GSXA 3HPLA 4ZUUA 1G9MC 4P2RA 5EC2B 2B0SH 2VABA 5EZLA 1AY1H 2FCBA 4OIIL 4MCZA 5ITFA 3TESA 5D8JH 4RMUA 2FYYA 4NWUL 3S4SB 4ZOEA 3QAZC 4P2QA 1G7MB 1KEML 2NZ9C 4J3OC 5C0CD 4PRID 3CVIH 4NBYB 2EDHA 1H3WM 3HUJA 2RFXA 3JTTB 5FYJH 4D0BA 1DQLL 4HX1A 4HH9B 2N56A 5JO5A 2CJUL 2QBWA 4OLWL 4L5FL 1S9WB 1HSBB 3HC4H 2Q8AH 5E08L 2F15A 3QDJA 1OGAB 3D18B 2J8UB 4LLVA 1A3RH 3SEPA 1JZ5A 5M94B 3MODH 3TEUA 4HIXL 1K9TA 2BVYA 2XFXB 1EHAA 1L7TH 1I1FB 5ECJE 4EBQH 3ARRA 4Y4HA 2CGRH 4ZS6C 4K94H 2LU7A 3FT2B 2DDQH 4QTIH 3O4OB 2R1YB 3B8YA 5E6ID 1AGBA 1UH3A 2ZSWA 3ARBB 3THML 2QQKH 5T1DL 3GMMA 4V2CB 3T77B 2YPLB 3ARQA 4NQTA 4AIOA 5ACZB 4ZUSB 3X14B 2IANB 3B2VH 3LV3B 4JM2C 2IPKB 3DGCR 4CKVX 2NY6D 1I3UA 4Q6YA 3ARYA 1X44A 2EDQA 5HYQB 3NCJH 3BI9X 3H3BC 1H5BB 4PJBA 1EEYB 1IT9L 5E24E 3EYFA 3BRGC 5CMAB 5SWZB 1WICA 3BZ4A 5D9SB 4MNQE 4NBXB 5MERA 4BQBA 2GK0A 5F7WC 2DQTL 1R3LB 4RRPG 3WL9A 3D85D 1AI1L 5DMJB 2FRGP 3DX6A 2XA8L 3RX7A 8CGTA 2CMRH 1G6RL 1RZJC 3VXQA 1D7FA 3R0MA 4QHNA 5IESH 5IMMB 5E6IC 1S5IL 5J1TC 2AV1B 4NSKA 4UAOB 4Y7MA 5BJTB 1F97A 3ULSA 1UWGL 4WHTB 4L3CB 5LGHH 1UM5L 2NY6C 3NPSC 4M5YH 1S7RA 4HMDA 3Q6GH 1CF8H 1UJ3B 3KYKH 3E3QE 4Z7NF 1A3LH 3G04A 1KIQB 1KJ2A 4I0CC 3W39B 1TQCB 1AGCB 1YEIH 4H0IA 4POUB 1HHKA 3BXNB 3QPQD 3MRIA 5ACLA 5DQ9A 1D9KB 3S35X 3DO3A 1GGBL 5HDOA 1KTKE 5F71A 3ZHLA 3AMLA 2ATPA 3GI8L 3S98A 1AJ7H 1NCTA 1DBJH 1F6AA 3FQRB 4M00A 4MWFB 3P30H 3TNNA 5HHOB 5H35B 1MFBL 3O4LB 3TIDA 3FB7B 5J89A 3N9GH 5DD3H 4RGMC 3LRSA 1FORL 5DHYB 5I75B 4HPOH 3BKYL 4AEIH 4DQOL 5J8OA 3LPWA 3OZ9L 2EDXA 1Q94A 5I1DB 1XF3B 1JHKH 1MCEA 2EDDA 2F74A 2H6PB 3IYLW 4ZSOB 2X4UB 2UYLA 4PJXB 5IVXB 4OZGF 1NMCC 1FNSL 3SJVA 3X13A 2GAZB 1JPSL 1FL5A 3WLWD 2CKBB 4HDIA 3SE9H 2J1KA 3MLRH 1T1ZB 4XCEB 1MFEL 2VSDA 3VFGL 3QPQC 1IJ9A 1ES0B 4PJ7F 3QG6B 4NQCA 5CEYA 4Y5VA 3DX9A 1M4KA 2GTZA 3DURB 3OJMB 3CGTA 3TO4B 4LRNH 2CKNA 4BZ1L 3CFCL 2WSKA 4GAJH 4S10A 4OQTL 4IRSD 4XT1C 3D39A 4X6DB 2EDFA 1EBAA 4L4TB 3G5YA 4HS6A 4UT7L 4YBHA 3TZVB 1GH7A 4PTTB 4XCCH 4RQQA 4UU9B 2VXVH 3RWGA 3UTTD 1MCDA 5FO7A 3RVUD 2J12B 3BZFB 3QIWB 3VFVB 4FQQA 1A22B 3CFEA 4MNGE 1ETZB 4PY7B 3K4AA 1EFQA 3WLWC 2FBJH 4L8CB 1JMZA 3O2VH 4JO4L 4OZ4A 5D70L 3WFZA 3H2WA 3CFBA 3UROR 2EE9A 3DGGB 1MLBA 1IGCH 2JIXA 4JR9L 3VA2C 4FTVA 4FQJL 1KACB 4R7DB 5C07D 3QDMD 1JF5A 3RWCA 1MJJA 4ZG1A 5BRZD 4ZTPL 5JQ6L 1XGRA 4NO5B 3RVVD 1CDIA 1ND0A 2AVGA 4IRSC 3UCRA 4OGYL 1NDGB 4BSWB 4GBXD 5GS1B 1PD6A 1P9MC 3LOWA 5LQBH 3GBML 2FJHB 1F00I 4WUUD 5KSAA 2WP3T 5IWLA 3S7GA 3HRPA 5DSCA 1J12A 5TF1H 3RVUC 5LXGL 3HZKA 2HG5A 2Q7YB 5JTWA 1JRHI 3U30B 2EH8L 5GZOC 1RZFH 3BT2H 1NLBH 1SBSH 3KPSD 3MLSH 1REIA 1EO7A 1FFQA 1RPQA 3ARGD 4U7MA 4WJ5B 1XEDA 4E41D 1MAJA 3G5ZA 4HHAB 3VXUB 1OAXH 5KS9E 4I18A 4J8RA 4X6EB 4LNRB 1R0AL 4PJDB 4XPAL 4U6YB 3OKDA 4MXQD 4Y2DD 4MJ4A 1FYTE 4PBXA 3V5DA 4GBXC 1MCHA 4YDJB 2W9DL 1NGPL 1Z9SA 5IQ9A 1MJUH 2B5IC 4RMWA 2YC1B 3WFHA 2APFA 2GKIA 5DJCB 4PREA 1DBKL 4P49A 1QP1A 3BDYH 2AJSL 5DGRA 4H8WH 3MNZA 3U7WH 1DN0A 4N0UA 4J6RH 4YHLH 3C6LD 1A6TB 1K3ZA 3VD9A 5CJ5A 4P3CL 2EKJA 3DTXA 5TJWK 3HR5A 1BIIB 2Y7QA 4KRLB 3VFWB 3ARGC 2X44D 4MJ5A 4QHUB 5C09A 2PTTB 2Q76B 3HZMB 1ZGLA 3RL1A 4NHUA 7FABH 3HB3D 2WQ8A 1F45A 4LPVA 4P5TB 1NGQL 4G8FA 5EDXA 5DK2B 1KCRL 5CAYB 4XC1L 3P3YA 4S1RL 4LLMA 4MXQC 3BN9D 1G9NC 4Y2DC 4DEPC 1SMOA 5C0DB 1K4CB 4FABH 3QJFB 4DW2H 4P46A 1HKFA 1CDCA 4AIXA 4DZ8A 4Y5YC 2BSRB 3BQUA 1NBYB 5BS0D 1P2CB 5IBUB 1TDQA 1LK3H 1OSPL 5F1OB 1XF5B 4WHCA 5ISZA 5D7SL 4OQ1A 2FB4L 1IKNA 4NM8H 4YFLF 3SGKA 3L3DA 2YPVL 2OYPA 1G0XA 2DQJH 3NABL 1JNNL 3QXAB 4JFDE 1CQKA 4JB9H 1D5IH 5C0RH 1ZA3A 3C6LC 1BOGA 4YC2C 3CFDA 1U8NB 1INQB 1C16A 2YZ8A 5GGSA 4HZAA 3QUMB 1BFOB 3BEVB 1G7LA 1IGJA 1YEDB 4PUBL 1IZJA 5K33A 4ONFL 2JKXA 2YEZA 3HB3C 2BFVH 3CXHJ 3BW9A 1V3MA 3BN9C 4C58B 3W11D 4KU1A 5FUZL 3LKNA 3LKPA 4LPUA 1OM3H 5FIEA 2DQFA 1VEOA 2AK1H 1S7TA 3AGVA 2ICWB 4LVNB 2OLDA 4GRMB 1EAJA 4F9LA 3ARFD 5BOZG 4N1CA 4GSDL 5J11C 3AS3A 3V79C 3OX8A 5CGMA 3W0WB 3O11A 2BSTA 2G9HB 4S2SB 3L3IB 4ZMAT 5EIQA 3D3VD 5HJ3A 3HG1B 3WO4C 3OKNA 1RUQH 2X89D 3TYGL 3FB8A 3OGCA 2KH2B 5A3IC 1JFQH 1GXEA 2VQTA 1YQVL 3V0AC 4LPTA 4G9FA 1LE5A 3CSYB 5HXMA 5DD6B 4R0LC 2CLRA 4I3SH 1N6QL 5FA3B 1CICA 2OMNA 3PWUA 4PJ5E 3PL6A 1I9RH 3DVIA 4XBPB 4DKDC 4HIHA 3TJHD 2R9HD 3QJHB 5IW3A 5E9DA 5EU7C 4X0KB 2FZ3B 3B9DA 4X7TB 43CAB 4HQQH 4PRDB 2VLKB 5AZEH 1B0WA 3QUZB 4NKOB 2QSCL 2H8PA 4LVOB 4ZFGH 5HYJB 1MCLA 1DE4A 5MEND 5I18H 4XMPL 3TA3C 5IW6A 5I8OH 3ARFC 1MHHA 1SQ2N 3RGVD 1R6VA 2DWDA 1YJDC 4HSQA 3ZHDA 1FP5A 1P84K 3OPZL 1AO7E 4IOIB 5IGXH 3FRPA 5IEHB 2DMKA 3SDCD 4G8GA 5EIVA 1EH9A 4M43H 3P4OB 1IC1A 2ED7A 3MJ8B 4MAUH 2PYED 4WO4D 5F1IA 3A6CL 2D3VA 4OZHB 4GG6F 1FHGA 4JFZL 1JI1A 4PB9H 3KYOA 3BPLB 2YR3A 1GZPB 1Q0YH 3Q1SL 4HIIB 4EXPX 1RVFH 5JORA 3A6BL 5F9WC 1JWSB 3C8HA 4YUEL 4N90D 1SMAA 5CGTA 3F62A 3H9ZA 3NFSH 2R9HC 3CLFL 2E3VA 2P5EB 2QHRH 7CGTA 1JNLL 1EV2E 2C1PA 2VXSH 5I30H 4DAGL 5B38A 2DN7A 3ZKSD 3M1BA 2AXJA 5FUCC 3GMPA 5EBMB 5D96B 5IHUH 3RGVC 4PJHF 1I3GH 1BBJA 5GGSY 3IFOB 3DYMA 4XNMB 3EFFA 4M5ZL 3PHQB 4JQVC 3QUKA 1HDMB 3E8UH 1DBML 2AJVL 1LILA 4LBEA 2HTLC 2AEWA 3CVHH 5JW5B 3QUXA 5IKCA 4WO4C 1N5AA 4FXKB 1ORQB 1JYVA 2RAMA 3NZHL 5DI8B 3F7RA 5IMOA 1WISA 1MEXL 2OM5A 2HMID 1CLZL 2C1OA 5LAXB 4LHQB 1N26A 3WS3B 2VOTA 2CIIB 4KZDH 1Z0MA 5I76A 1JGDA 3UZQA 3FHQA 3CMOH 3QA3A 3DNKA 3FRUB 2VE6B 1I1CA 4M9PA 2I5YL 1QFOA 5IW1B 4JFFD 3R06A 4PR5A 3WNNA 2BZDA 1YNLL 3KPQB 4N8VA 5DLML 1N4XL 3WSQH 5BXFB 1IAOA 2IGFL 4PG9B 4UUJA 1RZKH 2BNRE 3ULUL 4LKCB 4BFIB 2E27H 3ROLA 5HYSA 2DTMH 1JYXA 1YMHA 3L9RA 4WU7B 5F7EL 1MCOL 2VYRE 4J4PA 1PW3A 5D5MF 5F1NA 3QRGL 2IPTH 3LMJL 4Y2OA 1NCBL 2F54E 3BMWA 3TT1L 4Q9QL 3CXDL 3VWKB 1U3HA 4U1KB 5DK0A 5L0QC 1ZLWK 2FH8A 2JB5H 5L2KE 1P7QA 1FFRA 1P84J 1SM3H 4MA8H 1YY9D 4O51A 4E9LA 4H5SB 2HMIC 4PTUA 5DVOA 5ERWA 2J6EL 4N68A 2BNUA 3BP6B 3EYVB 2FECL 3L3OB 1PKQB 3MV8E 1LWRA 5CILL 3MRCA 5T1LD 4MGXA 4ODUA 3RAJH 5GGRA 4DGYH 3DROB 1JYNA 1U8JA 4Z7VF 1UB6B 4YO0B 1AXTH 5ID1A 1NMBH 4YIQB 4QXUH 1QSEB 3FRPG 3FQTB 5JW3L 1QO3B 3BWUC 4ELMA 5FF6B 3RY4A 1HZHL 2I07A 1WTLA 5I1JH 4PGBA 3SO3C 5FYLE 4CU6A 1GOFA 1MPAH 4PGCB 2H3NA 5DJ6B 4YDIH 1DL7L 4D0CB 1U92A 3S6CA 4K9EH 2DQIH 3QDGA 2E5EA 4JLRB 4Z7WA 2R0WL 4M02A 4O2FB 5CLWA 5HHMD 3FO0L 5J57B 4Z76A 3G5VA 1LEIA 1MAMH 3X3FL 1F58H 4PRAA 3SQOL 4F80A 2WINA 1WUNT 4YQXH 3WDJA 3V6ZB 4TSCL 3VGHA 1FSKC 1YY9C 4QRRE 2F58L 4GAGH 4UT6H 1MCWW 3ARTA 3KPPA 4NC1C 3V4VL 4XNXL 5C0BE 3NGBC 4XTRD 5D2LF 5DJDA 5B38G 1D3CA 2Y06H 2WUCL 1IKFH 2PNDA 4IEFB 4WWKD 2B8OT 3RX8A 1V7NH 2ENSA 4DN4L 3FFCD 3VJ6A 4OKVA 1WBXA 4CMHC 5FDWA 5T3ZE 1Y18B 4D9QD 4UDUA 4IDJH 1ZGLM 3NBNA 2AS5M 2WUBH 4GMTH 1WT5C 2XRAH 1DBBL 4MJ6A 2HYMA 5F7LB 5DTFB 4IHOB 3MNWA 1ZLUH 3BYTA 5GSRA 1CL7I 2UY6A 1GOGA 4HGMA 1B4RA 2C9AA 2HJKA 1T3FB 2EEBA 2BERA 3CU1A 4G8EA 3LZFH 4LDEB 1OWRM 1ZAGA 3IDUA 4QRPE 4KI5F 4AENB 3L3JB 1NGXA 5DQJB 5EO9B 4YXLL 4HFUH 4RDQF 5IB1A 5ESQA 4NYLA 3LH2H 2R1WB 4N8VG 4WV1A 3S37X 4OM0L 2W07A 3VFPB 3OKOB 1RULL 4XTRC 3RNQA 2JJSC 4Y4FB 1FFNA 3D1MC 4OV6F 3EW3B 1VKXA 1BIHA 4F7TA 1MHPH 5DDHA 4WWKC 3U7YL 4OGZA 3FONB 5HYSG 3UYPA 1DQML 4Y5XB 4ODSH 3QWOB 5FGCE 3IETB 3G5XB 1J8HB 4JM2B 3U2SA 4JFXB 5C0CB 3BN3B 1A7QH 3KPRB 4MMXC 1KXTB 3RVWD 1CTNA 2P8PB 5JXAL 4G80A 3D0LB 4CNIB 3ULUF 4RGNB 1HIMH 4AIZB 5KVGH 3GK8L 1MQKH 5FCSH 5GGRY 1FFPB 2YMXL 4N8CH 3RQ3A 3NCBB 4NDMA 1FZMA 1RUPL 2BXYA 3BKCL 3W9DB 3DETD 3DO7A 1AC6A 1RIHL 3CK0L 3MGOB 1IGFL 3OKEA 1P1ZA 3LIZH 3G6JB 1HNGA 3GKWH 3VRLF 1QLFA 2IFFL 5K9KA 3REWB 2BY1A 4WI6A 4UIMB 1X3DA 4JZOB 2JJVA 5GGVH 1ADQA 5JXEA 3WNKA 2XKNA 1PG7L 4R7NB 4D3CL 3RPIB 4XCFH 1PVHA 3W2DH 2X4PB 2ZCHH 4AEEA 4O2CB 8FABA 2NY6B 4M7JL 1W0YT 5HDBF 3NPSB 1T22B 3KDMA 3INUH 1GYAA 3TC9A 4QF1B 3VFOA 3VRIA 3HAEB 3MXWH 4OD3L 4WUKL 4N0CD 3VE0B 2BSED 2IADA 4HKXB 4JFOA 4LIQH 3FFDA 3RVWC 1FNEA 4TUOA 4X7DC 1RFDH 4YNYB 4LPCA 5F3BA 1QHOA 3CVHA 2V2XB 5D72H 3T0DA 1WIPA 2GFBB 3OQ3B 4PJIE 3KJ6L 4V2BA 2OJZH 4FZ8L 5HYEA 2OZ4L 2Y5TB 1F4XL 3DETC 3TF7C 5F1KC 3D85B 5TQ0H 1VPOH 5I9QC 3U4EB 4RGMB 3ZE1F 1OAUH 3RA7L 4PJFA 3S4SA 1RJZB 1TETH 5FUOL 2EDRA 3QEQA 1RU9H 4UZGA 3ZTJH 3U0PB 1V3JA 5JQHC 4NT6B 2ADIB 2F53B 2Z93B 4G5ZH 5EU6D 2X9YA 4YHZH 1IRAY 1EJ6A 5KOMC 2XPGB 5GIRB 3SDDD 3CFIC 1NMCB 1H3PH 3TIEA 5HDQH 1S9WA 4KTDL 1QR4A 1HSBA 3SGEI 3VMPA 4PJCE 1L6ZA 3PHOB 5MHSD 4OCRL 3D18A 3QWRD 2WANA 3ZE2F 1KIRB 2OJEB 1U42A 2VISB 3KLSA 4B53A 2Q86B 1IGIL 2XFXA 3DSFL 4DKFL 4LARL 1LO4H 5EIIA 3VD5A 1GGTA 3FT2A 3STLB 3MV9E 1JF1B 5DFTA 5FA4A 3F6IA 3UBXB 4R3SA 5CUSL 4QY8A 3ARBA 4RAUB 2A6JA 3T77A 2YPLA 3O8XD 2DQCH 3PWVB 3BGFC 3PWPD 4F7MB 5I8EB 3X14A 2JE8A 2IPKA 2J5LC 3SN6N 1FGVL 1BD2D 3JVGA 4TVPE 4OLVL 5HYQA 3IXTA 2ZPKL 4X4XB 1UZ8A 1II4E 3SDDC 5L6YL 1PEWA 1A8JH 3P0YH 1KN2L 5DUPL 4YX2H 1MLCA 5DGQA 5CMAA 5SWZA 5F8QC 3FHAA 2XZAL 5D9SA 1L9MA 5DZLA 3PWJB 5EZIL 4KC3B 3KR3L 1A5FH 3QCVH 1OAQL 2LVCA 2YZ1A 1R3LA 4XPTL 2Q3AA 3QHZL 5IROA 4S1SL 4CDGC 4X7FC 1IVLA 3FB6B 5FGRA 2V7NB 3WKNA 5EBLB 5J6GB 1T1XB 5BZDB 1TZHB 5IMMA 2ARJQ 1FNAA 2CIKB 4IRSB 5BJTA 3SDYH 4WHTA 4NRZB 4L3CA 1A6ZB 4GRWB 3NIGF 4LCCA 5E2WH 3MRKB 5DEZA 1OGAE 3MCLH 4JG1H 5HI4D 1HWGB 2J8UE 3J8F7 4I9WD 3V6OC 2QQNL 1UXSB 3RP1A 3UTTB 1UM6L 1L6XA 4XVJH 4ONGH 1MY5A 2EIDA 2F8VA 3PP3H 3W39A 4Z9KB 2YA0A 4Y16D 3QUMH 4UV4H 5MP6H 3K80A 2UUDK 5JA9A 4QXWA 4JRXE 1D9KA 4OKDA 1X6NA 1ACYL 5D7IB 4R90H 4ETYA 3NH7L 2V9QA 3TN0D 3FQRA 3ZDYE 2EDKA 4MWFA 2B4CH 3L5JA 1T20B 1IQDA 5HHOA 5H35A 4OBSA 2YPLE 1KPRA 2HAZA 3O4LA 3VG0L 3FB7A 1KTLA 5C3LD 5C2UB 3KS0H 3GMOB 2LVEA 4YHKH 3IKKA 2IANE 4JQIL 3S4SG 2BRRL 3QDMB 3WN5B 5DHYA 5I8KH 4XVSL 1DLFL 1G1YA 2OR9L 3D48R 5AWNH 2FIRT 1NAMH 1KGCE 1A7NL 2OSLB 4NM4H 2IALB 5I1DA 1FVDB 3LPGA 5ID0A 4KDVA 4HWZB 4WTZA 3RUGF 1YYMH 1OAYL 3DUHA 2VMFA 3ALWA 2X4UA 4GFTB 4ZSOA 1X5YA 3VH8G 4HGWB 4PJXA 5IVXA 2AXHA 1S3KH 2DBJA 3EOBB 4LCYB 5HI4C 4MNQD 2CKBA 2AI0L 5JHDE 1T1ZA 1XR8A 5DURB 1VSCA 1OAZL 3VXRA 1MCSA 1ES0A 3QG6A 5L8JB 3PGFL 5E2VH 5HY9B 4EN3D 3DURA 1NGWB 3TO4A 2DRUA 3LN4A 4XPGL 2NY0B 3BUYA 5A2KH 3S97C 3RY6C 2WWMD 3OXSB 1J0JA 1I7UB 3ARGB 2P49B 3FB5B 4S0SD 5HTSA 1MCFA 5FYLL 4E41B 3OKKB 3MBXL 4L3EA 4XP1L 5IF0A 3EKCA 3P9WB 3UTPE 3VW3H 5TPWL 1S9KC 4L4TA 4XP6H 3DECA 2BOBB 2MCPH 1E27B 4JHBA 2XN9B 1A1MB 3TZVA 1YEEH 2VDNL 4Y2DB 4MA1C 4DEPB 2W91A 1UCTA 5B4MD 4UU9A 1A0QH 1X5XA 5C86A 3BZFA 2HLAA 3QIWA 3VFVA 2EDJA 2KDGA 1MVUB 1ETZA 4PJEB 1XFPA 4PY7A 3K2MC 4R97B 2DQUL 3LEVH 2VDML 2V5TA 1YEFH 4L8CA 5FYKH 2YPKB 4AK1A 4IBLT 2DI9A 4GMSL 1CCZA 4RWYH 5SWSB 4WDIB 3DGGA 4HUUA 3SGJA 1CXHA 4Z7UE 3WLBA 1MI5D 3C6LB 5T1KA 4YC2B 4EN3C 1Z9LA 1QA9B 2F5BL 4R7DA 2VZTA 4WIQA 3PV7A 4KI5D 1QBMH 3IU3A 2WWMC 3K8KA 1NANH 3B2UD 4FP8H 3KLAA 1I4FA 4FN0A 4NO5A 3GGWB 5D1QD 2G60H 5TE6L 3U48A 4Z7QF 4FQHA 1NDGA 4BSWA 5GS1A 5IQ7L 1CR9H 1MJ7H 3BGAA 4FQLH 4U3CA 5IVZB 2FJHA 1MNUH 2CK2A 5F9OL 1XF2B 2F19L 3O3AA 4ORGB 5B4MC 2EECA 4J7RA 3E3QC 4LQ1A 1DUYB 2R4RL 4RNRB 1WAAF 4TNVK 3VXMB 4D94A 2Q7YA 2EYRB 3S36X 5F7DB 3REVB 1FAKT 3LQAH 5J11B 1XH3A 1W2KT 4FXGB 4NCDA 4V1DE 3P9MB 5CJ8A 1CIUA 2AW2A 3QI9B 1XCTA 3KJ4C 3H9SE 4K8RD 3WO4B 1IC5L 1SJVA 3AROA 5L7XH 3H7LA 3RZCD 3ULUD 4X6DE 4HPYL 4HHAA 1GIGH 2FL5B 3PQYE 4QTHB 2ADFL 5D6DC 4KI5C 4M1DL 4X6EA 3KXFE 4LNRA 4PJDA 3B2UC 4U6YA 1T6VN 4CVZA 1AGEA 3AMKA 5D1QC 4WTZG 5FKAA 3S34L 4OFYA 5FM5O 2GW5A 1J1PH 5KW9H 1RHHA 4YDJA 1KT2B 4XNQB 5CINH 2J8HA 4YWGH 4WW2C 2YC1A 1J86A 1RURL 3HMXH 4ZNEE 5DJCA 4FRWA 4GKNA 4M3JA 1R3HB 5DVNA 3F65A 3TO2B 5IFHL 1MRCH 4OCNC 1JPGA 3TA3B 4DGIL 2IQ9H 4P9MH 1I7ZB 2I26N 3GSNB 4PBVC 4O5LL 3I2CL 1A6TA 3DX7B 1MSPA 4GKOA 1S7SA 2O61B 4U1SA 3GBNL 2H26B 4PV8B 4LPWA 5HVGB 1BIIA 5DRWB 1BZ7B 3D3VB 4LSDA 1QUNA 4K8RC 3VFWA 3K4DA 4QHUA 4XC3L 2B1AL 2ESVB 2Q76A 5JIPA 1G7HB 3HZMA 3RZCC 4KTEL 3ULUC 4YXKL 4M7LT 1A6WL 1X5IA 2DQHH 3O3BB 1LP9A 4PGDA 1AD9A 3BPCB 5DK2A 5IUSA 3E6FB 4UDTB 4C83A 1K4CA 5E8NA 3FMGL 1SEQL 3WCYA 1CLOL 3T4YB 1MQ8A 5GGVY 4R26L 5J1AA 1P2CA 5CSGA 1XF5A 2NLJB 4FQ2L 2JLLA 4P2YA 2FR4B 4R4BB 1F8TL 4PJ8A 4OI8A 3CDFA 4XNYL 4PGZA 3QXAA 4X6CB 4WI3A 3OKMB 3RGVB 3VXUE 2DKSA 4H20L 4JFYB 1U8NA 3AY4C 3QUMA 4D0DA 1E6OL 3BIKB 1BFOA 1YPZA 1C5BH 3L5XL 1YZZA 3BEVA 2GT9B 4K23H 5C08D 3KVQA 3WIIH 1YEDA 3FT4A 1JYWA 1MIML 4C4KO 2KL6A 2PYEB 4DN3H 1HINL 2I60H 4JZJC 4ODTH 1DQQB 4HCRH 2JCCF 2VLMD 1T4KB 5FGBC 1DVFA 1XZ0B 4TULH 4Z7OE 4UTAH 4Z8FH 2I9TB 1KFAL 1RIUH 2Q8BH 3ZMRA 1UGNA 2R23A 1NAMA 4OSUH 5CEZD 3ZDZE 5DJ8B 2ICWA 1AR2A 3SCMD 1BVKB 1NLDL 1QFUL 1XF4B 3W0WA 4LU5L 4S2SA 5DO2D 1WZ1L 3RWEB 4MZ2A 2HKFH 2YN5A 3MV7D 3C2AL 3WFEH 3BSZL 3MRDA 2GJ6E 1I9JH 1NCCL 5DJ2A 3U7AA 4DK3A 5EBGA 4TVPL 1JV5A 4TNVF 3T09A 3VFTB 3DARA 5KSBA 3CSYA 5DD6A 1C7TA 2OR8A 4JPVH 1LK2B 1N6UA 2GCYB 3CLEL 5FA3A 4M62L 1N5YH 1I75A 1HKLL 5BQ7A 4XBPA 5I1KH 5L0QB 4WY7H 3QJHA 3ULVF 2NZIA 3MUGB 4N1EA 5I0DA 4X0KA 2FZ3A 2E9BA 2A9MH 4X7TA 1UWEH 1XGUA 43CAA 3X17A 3SDAD 1F4HA 5DFWH 4ZYKB 1FL3A 4NQEE 2ED9A 4HEME 5F93C 4NKOA 1A7BA 1IEBB 3EJZD 3EOAB 2VWEE 4R8WH 4OLXL 4NNXB 4MD4B 3SCMC 3QPXL 5EOCL 5ESVB 4XVTH 4IOIA 2VDPL 3CSBA 4LMQI 5ALCL 5IEHA 2YA1A 4WFHD 2HKHH 2ZOLB 5DO2C 4Y0GA 2B1HL 4U2ZA 3UZVB 1EEZB 4OCMC 3P4OA 4XPHH 3MJ8A 2UWEE 2W65B 3SO3B 5ITBH 2AJYH 4OZHA 2P43B 4AYFA 4AM0A 2JELL 4Y1AD 4WI8A 2VDQL 3RFZC 1GZPA 4TSBH 3UMTA 4UB0H 4HIIA 3ZT7A 4LQFL 1JWSA 1U8OB 1QPPA 3WDHA 3V52L 2KQMA 4BQ9A 3CCHB 2Y25A 1FSKB 5CSBA 5IBUG 3T3PF 1FRGH 1VGKB 5ACMA 1YMMD 3GMRB 3T8XB 3QIBD 3SDAC 4DFIA 3NGBB 5JR1H 2J2ZA 4UILL 2NY7L 5AD0B 3JTSB 3C9NB 4WFGD 5DR5H 4G6AD 2HVJB 1DTUA 4L8SA 2HP4A 4HUXA 3EJZC 3HG1E 3HTLX 3MOBH 5EBMA 5BV7C 4A6YL 4JFED 4Y19E 2GIYA 4NJAL 2JJTC 4CMHB 3OHXB 3HAEH 3HE7D 4QGYA 4XNMA 4M6OH 1J1XL 4X9IA 4OZIA 4HJGB 1RUKH 1G6RB 1WWAX 6FABL 5GRXG 1HDMA 2XQBL 3T2NH 2R0LL 2VAAA 3HNVL 4Z0XB 5EBWB 3SQBA 1ORQA 5IB5B 4PRNB 3GIZL 2CO7B 3O0RL 3G6AB 1NBVH 1ZVYA 5LAXA 1KJVA 4KMLB 2VLKE 3V7AE 1XR9B 2X1WL 5HHMB 5FYJE 2CIIA 4X7EC 5A1AA 1RJYB 4GLRI 3FRUA 1BLNA 1JWMB 1I8LC 3ECBA 5HGDA 2VE6A 5HYJE 2H1PH 5MEPA 3TGXA 1AP2B 2KPNA 3WNLA 4B5EA 5J0BA 4C56E 1S9YB 2EDTA 2XI9A 4DKAA 1QFWM 1ZA6B 3QIBC 3VXSD 2D7OA 4BSJA 1XGYL 5E1HB 1PLGL 5DHVB 4GS7C 3IJHB 4M61B 3VXPB 4PG9A 4WWKB 1U8KA 1WWWX 2CR3A 4TUKH 4U0RC 4U6VH 5AYUH 3FFCB 4BFIA 4MA7L 4YHNA 3HMXA 3UC0L 3HE7C 4U2YA 3JXAA 1JGUH 2Z9TA 1W72L 1UWXK 5DRNB 2VZOA 4P59H 4YK4B 4QCIB 5F89B 1PX4A 1UYWH 1J5OH 3JWOH 1QSVA 1YDPB 1M71B 4HT1L 3VWKA 4FQIL 2UVFA 4CU7A 2DL2A 4U1KA 2VL5B 3RDTD 5EOCJ 3DHMA 4LCIH 2P5EE 1YC8A 1J1OH 2NXZD 4H5SA 1K8DB 3U6RB 3SDXB 1LO3L 4CN1A 2QJDA 3ZYIA 3GRWH 3VWJD 3EYVA 2IMMA 4P57B 1PKQA 1AC0A 3DYPA 3GSQB 3GZKA 3NIDF 1NKRA 4JHWH 3DROA 4W68A 1T0NA 4IMKC 3NIFE 1UB6A 4YO0A 4CW1B 2CK0L 4NP4L 4TQEL 4QOKA 2YD2A 4YIQA 5EFIB 2XXMB 3FQTA 3I3EA 4M1GL 5ANMA 2GSGB 5T5NF 3U4BL 3FCTA 1QO3A 2VDOH 4G9DA 2EZ0D 2VLJD 1OCWL 3P11H 4NZRH 3MBEC 1MRFL 4I2XA 2XNAA 4NGHH 4KZEL 2BNQE 5DJ6A 4UOW0 4D0CA 1CL7L 3T0WA 3H9HA 5DRZB 4JLRA 5DC4B 3IS0X 5FM8A 2CSPA 4HJJH 1ODAA 1DQDH 5IHZA 3RDTC 1IAMA 3DXAD 5E4IA 4AG4H 3V6ZA 4D8PA 4DGVL 1NFDF 2NXZC 3V2AR 4YGAB 4KV5F 5JW4N 1UT9A 3QFDB 4GW5B 4JVPA 5F9JB 4LVHC 3VWJC 4O9HH 5TH2B 4HCRA 1A21A 5DF0A 3E6HB 1HCVA 1IC4H 1X6LA 2FX8L 4HC1L 4RGOH 1QKZH 2J7LA 1OB1B 1Q9LA 1LDPH 3VFNB 1WWBX 1Y18A 12E8H 1P6FA 3FTGB 1JPFB 3OJVC 4NNYB 1HYSD 1E4XH 5DJZA 2EZ0C 4LHUD 1YEJH 4JZNB 4QWWC 4IHOA 1LO2H 1DEEA 4JKPL 3WHXB 4WU5B 5DUML 4JANB 4X80H 3NAAL 1NCAL 4KKLD 2ITCB 2HT3D 3MXVH 1A4KB 2NX5D 4NOBA 4JHZA 3O2WH 4GXUM 1CGSL 4JN1H 1T3FA 2Z31D 2BP3A 5EWIL 2GTWB 3HC3L 3LS5L 4YDLC 3EYOA 4AENA 3L3JA 3FQWB 4JFQB 3V8CA 5DQJA 1JTOA 5EO9A 2IAMD 2R1WA 5DEGB 5IB3B 3G08B 1F5WA 1FPTL 5I1EH 1QSEE 1MFAH 4Y4FA 2RCSL 1N8ZB 4EUPH 4X6FB 2W1NA 5EA0L 4WRLA 3JUZA 3CDYA 5B22A 1AHWB 4UOW1 1RUAL 2DQDL 2PKDA 4M8QB 2HJFB 2PW1A 1NC4B 3ARDD 4P2OD 4Y5XA 1JP5A 4HS3B 3B8SA 4QNPF 3G5XA 1J8HA 4JM2A 5EU3B 1LE9B 1HYSC 1I1AD 3R1GH 4JFXA 2Z8RA 3IJYB 4J1UB 1B3JA 5DMGD 5EB9A 2IG2H 5M7QA 3MLXL 3KPRA 1P4BH 3C08H 3WIFA 1JZ7A 2BVEA 4LCUB 3WNMA 1JZ6A 2ZG1A 4BA8A 1I9EA 2HT3C 2P8PA 1SVZA 2F5AL 3D0LA 5KTEH 4CNIA 2Z31C 1JHTA 3ORJA 4U1MB 1FGNH 3WFDH 2LU4A 2N1KA 1JGVL 5JOPD 4GG6B 1CIDA 1ZTXH 2IAMC 5D6CB 1CE1H 3W9DA 3PIQB 4HUWB 4X7SL 4EI6A 2WMPA 1DBAL 4MD0B 3NACH 3MRFB 3G6JA 1Q0XL 4OTXL 4XAKE 3REWA 3MLVH 5J3HD 1KJ2L 4UIMA 1HHIA 1HXYB 4JZOA 2W9EH 4JJ5A 4MD5A 4MDIB 3IDMB 3ARDC 4O02L 1YNKH 4P2OC 2FX7H 4R7NA 3PWPB 1RZGB 4JDZB 2O5YH 1RK0B 5TE7L 3RPIA 3T0ED 3AS0A 2X4PA 4O2CA 3C09B 1I1AC 5AEAA 5FXCH 1T22A 5DMGC 3C6SB 1A6VL 4QF1A 4UT9L 1GC1H 2VDKH 3HAEA 4LLDB 5C2BH 25C8H 1QRND 5IFAH 1ED3B 3VE0A 2R29H 4U4BA 3G9AB 3SGDH 1QLRB 4TPRL 5HHPB 3RWDB 1BVLB 2VKXA 4H25B 2V2TB 3OGOE 2V2XA 4PRHA 4BZYA 4U1NB 5DC0A 3RBGA 2WBJB 1FC2D 2GFBA 3CC5B 2XZCL 1EGJL 5F9DC 4NQDA 1TTUA 2X5PA 2G5RA 2D9QB 3H7BB 2OP4L 2Y5TA 4KGLA 3D2UB 5IR1A 3LS4L 3Q5OA 3PXHA 1FH5L 2ORBH 4PS4H 3U4EA 4X4ZA 2OK0H 1U8QB 4K3JH 4KMTL 4LEXL 5B8CC 1M05B 3MNVB 1RJZA 1AXSB 2UZIL 2Z0BA 4GRLD 3LD8B 5C0CE 1A2YB 5A2JH 3HMWL 5J3HC 4PRIE 5E5RB 4Q9RH 1MCCA 3U0PA 1CXIA 2AERT 3QSKB 2AGJL 4NT6A 2ADIA 2F53A 3T0EC 4ZODA 2G2RB 1Q9KB 5GIRA 2PXYD 1RSFA 3WDIA 1D5BB 5EOQL 3OKYA 3G6DL 4W6YB 3HUJF 4OFKA 4NUJA 5GQBA 3PHOA 4P5KB 3R4DA 4NN5C 2ZCKL 1V05A 3A67H 2OJEA 5ALBH 5D5MB 2VISA 2Q86A 4KRPD 5E03A 2A38A 2AK4D 3OAUH 4PLKD 4ZFFA 4PRPA 1JWUA 1PYWA 1S7UB 4ZD3H 3AVEA 4K3DL 1KELL 1BQHB 2CO6B 3U46B 3B5TA 4U3XA 5GGQH 3V6FA 4IOSD 1WF5A 1SYVB 4LPYA 5D71H 3UBXA 5D7LD 4RAUA 4U1GB 5C0AA 4KVCH 1BOYA 2VAJA 4G8IA 3GRWA 5LWYH 5TFSH 3PWVA 4F7MA 5I8EA 2X9WA 1U6AL 4Z0BH 4GRLC 5FV2A 1PEZA 1U91B 4HLZH 2BJMH 1JPTL 2Y23A 1W0VB 3MGTB 4G6JH 2EC8A 4KJPD 1BAFH 3EZ8A 4X4XA 1YEKH 2FEDD 1QLEL 4MQ7A 2PXYC 4K3EL 1I7RB 5GS0H 1OT2A 2V7HB 2HRPH 2FATL 2L7UA 4U6TA 1EXUA 4PJBF 3HNSH 1LO0L 5I6XC 5C7XH 4MNQB 5LGJB 1BHGA 4OLYL 3DMMC 3HKFA 4KRPC 5T3XH 4N9GB 3BGMB 4PLKC 1P4LB 1PDKA 1B2WL 4EN3B 2P47B 2B0SL 3TBTA 2V7NA 1NEZB 2EICA 5F6HI 4GO6B 5D8JL 3F7YB 5J6GA 4ZDHB 1T1XA 5BZDA 1TZHA 2DD8H 3QUYA 1NJ9A 1HHJB 2HH0H 3FL7A 4IRSA 4K71C 9CGTA 5JMRA 4WCYH 2R2BB 1EHXA 1T6WA 4M6AA 1QPXA 3CVIL 3DX8B 5D2LB 2D7MA 3DV4B 5FYJL 3MRKA 4LP5A 3HAEG 4KQ3H 4KJPC 1DQJA 2FEDC 3TLRA 1UXSA 4X5LA 2Q8AL 4G7YH 1JTPA 5EOTA 2FLBT 5I1HH 2AABH 1A3RL 1MJ8H 3MODL 2P45B 3MRMB 5D7IA 3CNKA 4NQSB 4XNZB 4EBQL 2E7MA 4EEEA 4URTB 5J9PB 4K94L 1SEBB 5JPMB 3KJ4B 1DLHB 2NNAA 3SOBH 2QSQA 1E28B 4DVRH 4QTIL 4LSUH 1MI5B 3MOAH 2QQKL 2X4SA 5J13B 3WN5A 3WD5H 4KUZH 1WITA 4RMQA 2OSLA 3TBVA 2W0PA 4LDLB 3ILPB 4G42B 2IALA 5D1QB 5F72S 4HWZA 5IIEB 1MELA 3U1SH 4HGWA 1VFAB 4MDJB 3IU4H 5D7KD 1SYSA 4LCYA 1T0MB 5IB2B 4WW2B 4YFDB 5BVPL 1XMWA 5DJAA 4OIIH 3EIFA 1PZ5B 3L3GB 5GGTL 1L0YA 2AEPH 1EUTA 1OTUD 3P73B 5HY9A 4JFHD 2YS4A 2GITB 2IH1B 4UMGA 4X98B 3OSKA 2CMRL 3UBXG 5I1CH 3FB5A 4KK6D 3MROA 2GJZB 5I8CA 2A77L 4OLWH 4OAWB 3LQZA 4ODVH 4P2CG 2BOBA 1FZKB 1UCBL 1Z6JT 2XN9A 1A1MA 4HZLB 1U0QA 2X4TB 3UTTE 4ZUVB 4M5YL 3RZWA 2DBLL 5CBEB 3Q6GL 1CF8L 3QRFM 4X8JB 1OW0C 4JN2A 1A3LL 3MLUH 4MNGB 5FO9B 5D1XD 5DJXB 3MREB 2Y72A 1JN6B 3DUSB 1FZJA 2R2EA 3DVNA 1M7DB 3LKRA 3P4LA 2YPKA 3C5ZB 4ZXBB 5SWSA 1AJ7L 1DBJL 4WDIA 5FFLA 3C6LA 1OTUC 5C07E 3QDME 3D69A 1PFCA 1QA9A 2EYSB 3N9GL 5DD3L 3RUGA 5BRZE 5ILTH 5JIHA 4G6FB 4U6XB 1V5JA 3QQ4B 1X5KA 2D7PA 4LHJB 4AEIL 4KK6C 4LF3B 5ADPH 5FYKU 1T66D 4XB8A 4JY6B 3WIHH 4QEGA 3SKJH 4M7KH 3AM8C 3AB0C 1U93A 1L4IA 4JZJB 1JHKL 5TGBB 1U3ZA 1BFVL 4WUUE 4J3SA 5DD0L 4JE4B 2Y1VA 5IVZA 3SBWA 1XF2A 2ATKB 4KDTC 4ORGA 4R6UA 2DQTH 3MRHB 1NAKL 1DUYA 3MLTA 3VXMA 5C8JB 3P4NB 1K85A 4P9HH 2NYYD 1AI1H 2ZUSA 4MJID 1P7HL 2Y36H 4F57H 3MLRL 1G6RH 5D1XC 3QBTB 5F7DA 4Q7DA 5F7HA 3ULVH 3V0WL 1S5IH 3KPSE 4FXGA 3VRJA 2XQYG 1S9VB 3P9MA 4FMFA 1CFVH 3QI9A 1NCWH 4BJLA 4JREC 4LRNL 2WV3A 4E41E 3UYRH 1UM5H 3QG7L 2FL5A 5KS9B 4NQXB 3EOYG 4ZAKA 5J1SC 1BREA 4FQXC 2ICWI 2NCMA 5C08B 3MLYH 1T66C 4I0KA 1AGFB 4N0YH 4EUPG 3F12B 1IAIH 3ZLQC 2VXVL 1GGBH 4XNQA 1TIUA 1UB5A 4PJEE 4ZFOL 3QQ3B 1MUJB 3GI8H 4R2GD 3A0OA 4X5WB 5I1GL 3U4AA 1MFBH 2NYYC 4BH8B 1N7MH 3O6KH 1FFOB 3QO1B 3TO2A 1YN7A 3WBDA 3ZDXE 5CP7A 4M4RA 1K6QH 3O2VL 5GJSH 3TA3A 3ESUF 3BKYH 1I7ZA 2HN7B 2VLRD 3TV3H 3V5HB 1ZT4A 5L9DL 3DX7A 4WFED 3SCMB 1D6EB 1SVCP 1IGCL 2O61A 2MFNA 1MY7A 1A1NA 5C0GA 2Z4QB 4PV8A 1BZ7A 3D3VA 3ET9F 1H0DB 4L4VE 2PYFB 3UZEA 2ESVA 5TDPB 1C7SA 1FNSH 1N3NA 3MSPA 3O3BA 4G6KH 1KYOK 3IJSB 1UADC 3BPCA 1MFEH 3MRPB 5LQBL 2B2XL 2V17H 4P4RB 4UDTA 1KOAA 3JZ7A 4LLWB 4MAYB 1R24B 1TMCB 1TZIB 3T4YA 5BS0E 4P2RD 5TF1L 4R2GC 2KZWA 2NLJA 2ZZUT 2FR4A 2EXWD 3DWTA 5E95B 1RZFL 4WFFD 3PXJA 4X6CA 1OSZB 2LV4A 3OKMA 4OLZH 1M6OB 1NUGA 4UT7H 3RKPA 1T04B 1HI6A 5IM7A 4RMSA 3KXFD 2R8SH 1OAXL 3BIKA 4OZFB 1L0XA 1NANI 3QDJD 5JLZB 2GT9A 4H88H 4YHPB 1OD9A 5E94B 5DYOB 4ACPA 3PDGA 2QLVB 3O6LL 2XG5A 1DQQA 4Y4HD 3MRLB 4XMKH 1T4KA 5D70H 5KVMC 4HUVB 1XZ0A 3SPVA 1TPXC 1F4YH 4G43A 3MA7B 4JR9H 1MJUL 4OFDA 1A6UH 3B83A 4NC2B 5F6IC 1UQSB 3P2TA 5IJVB 1FAIH 3BDYL 4H8WL 5GRVK 3U7WL 2OQJB 2EXWC 4Q2ZB 4OT1L 5C1MB 5GRVL 1XF4A 4M1CD 4J6RL 3VG9C 2C3XA 2DLGA 5E70A 4GS7B 3RIFK 3O6FA 4OGYH 1CK0H 4ZO9A 2BCKA 2L4OA 3WUZA 3RWEA 1MFCH 4JFEB 4YPJA 1KCVH 4KKAD 1RMFL 3GBMH 5L8LB 3HE7B 3WE6B 4CJ0A 1GPOL 4GAYB 1T1WB 2X05A 4I3RH 5LXGH 2XYCA 1M7XA 4NUGH 3VXTA 1KLFA 1F4WH 4O58H 3TBSB 3FAWA 4FABL 4DW2L 1EFXB 3MUGA 1X5ZA 4Y4HC 2DOCA 1FNHA 3MRBB 1G0YR 1LK3L 4NO3B 4XP4H 5LJYH 4ZYKA 2NTFB 3LN9A 4MB3A 3N0PB 3H42H 4HLZG 5MENE 4MZ3A 1IEBA 1TNMA 3EOAA 4NM8L 5BO1H 4PJGA 3KLDA 3WXWL 5AAWA 2MTPA 3VXSB 1KYOJ 4XPAH 4MD4A 2PO6D 4OGAC 1D5IL 4Z7NE 5C0RL 2P5WA 4M1CC 1AO7B 4R4ND 2Q20A 2VDLH 2W9LA 2ZOLA 5GGUB 1UZ6F 4BM7A 1EEZA 5EORH 2A1WH 4KKAC 4UQ3B 2DJUA 2PYEE 3MBEB 3D6GA 2W65A 1NGZA 3JWDH 4AQOA 4YDKH 2HFGL 1F42A 3UJIH 1KBGL 4IIQA 4HMCA 3TH2T 2BFVL 4L4JA 4KHXH 3CSGA 2NW2A 4H0HB 2AJSH 4XBGB 1IFHH 3RI5K 4N90E 1HH6B 1CTOA 3GJFB 1U8OA 3RDTB 3LEYH 1ZMYA 2ARJA 1GGYA 1MFNA 5A40E 5CKAA 2E9IA 3QHFH 2NXZB 5ELIA 3WIHA 1VGKA 1L9NA 3FO9A 2C7UB 3T8XA 3N85H 5CWSB 4HG4K 3JTSA 2EDYA 2UZXB 4LVHB 4WGVB 3VWJB 3MJ7B 4JJHA 5E2TL 1JPST 4OZGE 1BM3H 4G7VH 4MHHG 4PRBA 2VN4A 4LCWD 2V6HA 3BRFA 4KI1A 2PO6C 3OHXA 1KCRH 4XC1H 1RUQL 5ADOH 1CG9B 1KLUB 4OF8A 4R4NC 1KSRA 2G75B 4HJGA 3SJVD 1HEZA 3GMQB 3BDXA 1G6RA 1HQRB 5C9JB 1U8LB 3FO2A 1AQKL 4PJ7E 2VLJB 1T2JA 1T7ZA 3BD3A 1IL1B 4XP9H 5H8DA 4I3SL 1CD8A 5AYQA 5EBWA 1OAKL 4LAQH 5IB5A 4PRNA 4NQCD 32C2B 3G6AA 1NFKA 1KNOB 3E2HB 1XR9A 2A6IA 3O3DB 4HQQL 1BBDH 4YDLB 1JWMA 4JFFE 2YUZA 4MSWB 5AZEL 3NCCB 3CUPB 1AP2A 5KN5B 1CFNB 1ZV5A 3QCTH 2DQGH 3X12B 4FOMA 3KPNB 3PE9A 4ZFGL 1S9YA 3D39D 2EDOA 1ZA6A 3LKQA 3L95A 4JAMA 3KYNA 2JJSA 1ZT1B 1FNGA 1QOKA 3HI5H 5DHVA 3IJHA 4ZUWB 3VXPA 3NFPB 5IGXL 4W6XB 2BNRB 3FFCA 4Y4KA 4TRPL 4NN7C 3QB7C 3MRNB 2XXCB 4IDLA 1CGXA 3BPOB 4LLYA 4ERSL 4FNLH 3QULA 1IAKB 1J0HA 4HIEB 4MAUL 1CFQB 1IQWH 5F89A 4L8DB 3MRJB 1YDPA 3ZL4L 1Q0YL 5IJKA 5HHXL 1QBLL 1RVFL 1IM3B 2PN5A 4OV5A 1B0RA 5L2KB 1I7TB 2BVPB 2NX5B 3P9LB 2JIXD 4QO1A 4Y5VC 3NFSL 4NC1E 3LSOB 1K8DA 4FTVD 3RIFF 3U6RA 3SDXA 2Z31B 3Q5TA 2QHRL 4HAFA 5SX5H 1AQDA 3MV8B 1LQSR 2VXSL 4Q58C 2YKLH 5DT1L 5I30L 3GSQA 3BEWA 3P0VH 4YPGB 3ILQD 1MCPL 4CW1A 4MMZC 2YWYA 2E8ZA 5IHUL 5BVJB 3HC0B 1N6QH 1I3GL 5E4EB 1GGUA 2FWOB 5K9OB 1YUHA 6CGTA 2QQQA 3WJLA 3E8UL 4ZOAA 3H6JA 4P2OB 2P42B 1SY6H 4ELMF 4OQTA 5I66B 2HFEB 1FO0H 4F7CA 3BZEA 3RTQA 3BHBB 4HG4J 1IEAA 3B9AA 1AFVH 5HHME 3EDEA 1OLLA 1X7QB 1I9IH 5LCVH 2NMSA 3IAGC 4KZDL 4Z7WF 3VCLB 3CMOL 1VACB 2BDNH 2QADD 4QRRB 3EDJA 5KVEH 4IS6B 3VD4A 1JUFB 2YD6A 4ELKB 2CDFA 3QFDA 4GW5A 4HK0B 5F9JA 1MFDH 3WSQL 2ZUQC 5DD5H 5TH2A 3GFUA 4WTXA 3BPNC 5HHVL 3E6HA 2M2DA 1KEGL 3A6CH 3FFCE 3HPJB 3ILQC 3GSRB 4JFZH 2BVOB 1LEGB 1DR9A 3WHE1 4TNWK 4D9QE 1OB1A 3VFNA 1ZHNB 5B8CB 4LASH 3FTGA 3Q1SH 5K93A 3S96B 1Q9WA 3TCLA 4APQA 5C6PB 2EKSB 3RI5F 1G9NL 4NNYA 4ZFZB 3MRQB 5EG6C 4KUCF 4XXDB 5IWLC 4NNPL 3SE3A 2FHBA 4CAGA 4JZNA 3QZWB 1KJMB 1DN2A 2HWZH 3WHXA 4OCSL 4JANA 1JNLH 5F44A 5ICXB 2ITCA 4DAGH 1BZ9B 2FHFA 1SM3L 3J7HA 4NN5B 4N9OB 2GTWA 4QRPB 1FG9C 2J8OA 3Q48A 4PLOB 2FNBA 4JFQA 5GSVB 3MGAA 5C09D 2QADC 4MA3B 2IH3A 2IF7A 4PJ9B 4DTGH 5DEGA 3G08A 4DGYL 4I18C 4E0RB 1LEKA 2AJVH 5I0ZA 1AXTL 1QFHA 4H26B 1NMBL 4X6FA 4OFPA 1TFHA 1CD1B 3PP4H 1ZEAH 5FM5M 4QRUA 3O3EB 2R2CA 1ZWIB 1AHWA 1Z5LB 4K94C 4P46D 1MEXH 4JKMA 1NC4A 3GMLB 3R8BB 5FGCB 4BSVB 3BQUD 5EU3A 1LE9A 1MPAL 5ISZD 4E5XB 2P8LB 4TUJB 3IJYA 4J1UA 4KDWA 4EQ2A 1HOCB 4K9EL 3L3HB 1R5IB 2A73B 4TTGA 2JJWA 2K3TA 2QQLH 3CH1A 2OBGA 1MAML 4LCUA 5DLMH 1VB9A 5EUKB 5I6XB 2XY1A 3UBXI 4CVWA 1JMXA 3HRZA 3QNXB 4UBDC 4GAGL 4UT6L 1BQLL 3CFJB 4U1MA 3SKUD 1L7IH 4X5XB 2K7PA 3QO0A 2FSEB 3DMMB 4U1IB 5F7EH 2Y06L 4GQ9L 4KRPB 1IKFL 3PIQA 4HUWA 3QRGH 1T80A 1I8KA 3GSVB 3V5KB 4Q6IB 3TJEH 4PJAA 4MD0A 3MRFA 1XT5A 5I71C 5D7LB 1JGLH 2WUBL 4P46C 2XRAL 4K71B 2CDGA 4MDIA 1BVZA 2HT4D 3IDMA 1ZLWH 1ZLUK 1RZGA 4YHIB 3BQUC 1VDGA 4I4WB 3QHTC 1PBYA 3QXDB 1MH5B 3OBAA 3VGFA 2AXFB 4MQSB 2H2SD 4HBCL 4W81A 3C6SA 3DBXA 4XRCB 5CILH 5IBLD 4LLDA 3SGKC 1WCBB 1GCFA 2FEEI 3GHBL 1ED3A 3I6LD 4Z95H 4LSSH 3I9GL 1QLRA 3LZFL 5I1AA 5HHPA 3RWDA 3GSWB 1BVLA 5I15H 1RJCA 1KTRL 1VFUA 3I3DA 4HFUL 5FB8A 3MMEB 3LH2L 4M7ZC 4G9FD 2WBJA 2JJUA 4PJIB 3N1GC 1CICD 3H7BA 3PL6D 3D2UA 3P77B 1DL7H 1MHPL 4N8PA 4U05A 5FGSA 1U8QA 3BIAX 4U0QB 5E9DD 3U82B 3FO0H 4U33A 1M05A 3MNVA 4ODSL 1GAFH 3SQOH 4RX4A 1E4XI 1IILE 2CR6A 4PJFF 1YA5A 5EU6E 4Y89A 1NEUA 4NQVA 2HT4C 1A7QL 3PJSB 1UM4H 4XNXH 4FHBD 2XWBB 3BRDA 4M6MH 1NSNH 2H2SC 3O81A 4RFOH 4RFNC 5MHSE 5IBLC 4PJCB 4X6BB 4DVBB 1G7QA 1HHGA 4P5KA 2WLZA 5IEKB 1FYHB 4QLRA 3JV4B 4TNWF 4GG6E 4G8GD 2NY2D 1MQKL 2J8UF 2MKWA 1JE6A 5HGHB 4N8CL 2OTPA 1CVSC 1LD9A 1DBBH 2ADJA 1S7UA 4MS8D 2VZ1A 1BQHA 2VERN 3U46A 4XI5D 2ZOKB 4ETQB 2FBOJ 1CICC 4JDVB 1SYVA 3LIZL 3W5NA 3PL6C 3GSUA 3GKWL 1BJMA 3PWPE 4LDOB 1KXQE 5J6HB 5GGVL 3HE6B 1BD2E 2FJGA 1U91A 4XCFL 2YD5A 3W2DL 2M1KA 2ZCHL 1W0VA 2C4FT 3V6OE 3IAQA 3MGTA 4PJHE 3ZYOA 1JIBA 3INUL 3ARZA 5EO1B 1TCMA 2W0FB 5KAQF 2WM0A 3MXWL 3VFRB 1I7RA 4JPIB 3OAZH 4LIQL 4QRQB 2V7HA 2AV7B 5CP3H 1RFDL 3U7YH 3L7FB 4HULB 2EDWA 4U7SA 1SY6A 4MNQA 5KJRH 3ZTNH 1TCRB 1EO8H 1FO0A 1X5FA 4YZFF 5D72L 2NY2C 4KXZH 5E8EB 5D93C 3QUXD 3BGMA 3GIVB 1J18A 4A2LA 4GKSB 3CPLB 1RUML 3BO8B 1VPOL 4YHOH 5TQ0L 4MS8C 3C60B 1NEZA 4KPHL 3F7YA 3FO1B 4XI5C 1OGTB 4ZDHA 2Z8VC 4ODXB 4LPXA 1GJIA 1TETL 3BE1L 5GS2H 2QR0B 1HHJA 5JXAH 1CS6A 1WZKA 2R2BA 3NTCH 2A6KA 5J4MA 3DV4A 2PR4H 3M17B 3WJJA 4YHZL 3H8NA 4I9WE 2YMXH 1BJ8A 5HDQL 5M95B 3SGDI 5CJOH 5D5ME 4TVSa 4D9LH 2YOCA 5EUOB 2OTUB 4UTBH 1OP5H 4OZFH 5D1XB 4JRXB 3MACL 3MRMA 4J4PD 2IFFH 4NCC1 1HHHB 5CJXA 1IM9B 3KPLB 5JNYA 1JZ2A 1FBIH 1PZUB 5FECB 1E6JL 1LO4L 2X1OA 5KVDH 2XTJD 5J9PA 1WWCA 3GJEB 1SEBA 4JREB 5JPMA 1DLHA 3QUXC 2R56H 2MKLC 3ABZA 3C8KB 4FMKA 3OB0H 3KYAA 2COQA 2DQCL 3RWFB 4NKIH 1F90H 2I24N 3MRGB 4RIRB 4FQXB 2O93L 3RHWK 4G42A 4LSPH 1H8NA 4CDHA 2MSPA 5IIEA 1XGPB 2C4XA 4HXAH 1VFAA 2D7QA 2AEQH 3MO1B 3KJ6H 2APVA 4A2MA 4PJXF 5IVXF 1T0MA 5FKPB 5IB2A 3TP4A 3P0YL 4WW2A 2OZ4H 5T5FH 4IRJB 2DYPA 1KG0A 5JHDB 4MJIB 4NWTH 3B9KD 3LHPL 3RA7H 1PZ5A 3L3GA 3QCVL 1A5FL 1ZANH 4J4PC 4QXTB 4BK5A 1EDQA 4U1LB 4H8WC 3NZ8B 5CEXB 2XTJC 2GITA 1BQHG 2I27N 2IH1A 2LAGB 3QDGD 4X98A 4CU8A 4HKJB 4OD2B 4Z6AT 3EYSH 4P4KA 3H9YA 4JKKA 4J2XA 5D2LE 1NGYA 4P3DB 2P1YA 2X4RB 1HQ4A 3SDYL 1KXVC 1FZKA 4YJZL 4HZLA 2RBLA 3HNTH 5E2UL 1IGIH 5E2WL 1T7VA 4ZUVA 2N7BA 3DSFH 3MCLL 4LARH 5CBEA 1VERA 2YK1L 5E8OA 4LOUD 2ZNXA 35C8H 4X8JA 3RU8H 2NY5H 2YA2A 3PP3K 1X5LA 3IT8D 4Q9BA 4G3YH 5IK3A 3H3KA 4MNGA 4XVJL 4W4OA 5FO9A 4KUCD 3MREA 5GRJH 1WC7B 2V2WB 4UV4L 1JN6A 5MP6L 2Q7NA 4HUKB 1HILB 2VUYA 4R90L 2BMKB 3C5ZA 3B9KC 4ZXBA 2VR5A 4IJ3C 4GW1A 1MI5E 2VH5L 2VLRB 5B3JE 4Z7UB 5TDNB 2PUQT 3GB7A 4K7PH 5GHWL 1DFBH 2ZCLH 1RV6X 4KI5E 2EYSA 1B6DA 1OVZA 3GJFH 4OLVH 2E7HA 2DQEH 4YHKL 4U6XA 3QQ4A 1D5MA 5I8KL 5L6YH 1R3IL 1NCUA 3IDNB 4JY6A 1NAML 4N1HB 2DM4A 4ODHL 5I16B 5TGBA 5CJQH 1YYML 2AQ1A 1PAMA 4L1HA 1VA9A 3DLQR 3U9PL 3KR3H 2A0LD 4MHHI 1OAQH 2FD6H 1F6FB 3GSXB 3QNZB 5I74C 5C8JA 3P4NA 4ZUUB 1U3JA 3QHZH 1RK1A 4LOUC 2APXA 5E7BA 2WWKO 2FO1A 4DZBA 4L9LC 2DMCA 1T89C 4HW6A 1NBQA 1QRKA 1QYGH 3V95A 3F5WB 3U0TB 4V1DB 4MQTB 1S9VA 3VG9B 2A2QT 3H9SB 4I8DA 1OQXA 3BIBX 3HUJB 3ULUE 2RFXB 4DOHB 4HX1B 4LSRH 3PQYB 4CADB 5KS9A 4K3HA 1KPVB 4NQXA 5JO5B 1UKTA 3KXFB 1HK6A 2DKUA 3VW3L 1UM6H 4XP6L 5IT2H 5C08A 2MCPL 1B9ZA 2C26A 4M4PA 1AGFA 1FYTA 1YEEL 4PJDF 3S37H 4D9RD 3F12A 3PWNB 3N50A 1A0QL 3QIUB 4WV1C 3VRLE 1FV1A 5AUMA 4Y4HB 1MUJA 3NH7H 4I0PB 2A0LC 3F58H 3RWHB 4NC0B 2DLTA 3S5LB 4BH8A 4OCWL 3IDXH 2ITDA 1AGBB 3QO1A 1YEFL 4U1JA 4JQIH 5HDBE 5JXED 1VFBA 4XVSH 2HN7A 3V5HA 1YNTB 1D6EA 1A7NH 3RHWF 1CDHA 2ICCA 2EC9T 2Z4QA 5IBTH 1OAYH 1N0XL 4PLJD 5CP3A 1H0DA 2PYFA 5DZNA 5IMLB 1QD0A 4FP8L 3EYFB 1TJHL 2G60L 2Q3ZA 2A6DB 2GY7B 2AI0H 3SY0B 1XIWA 1CR9L 1MJ7L 5GRYA 5MERB 3KHQA 3MRPA 3KNBB 5BCAA 1LP9F 4P4RA 3VXOB 1PG7W 5DQDL 4C57C 1JZ3A 3OG4B 1RAMA 3ZE1E 2GK0B 4LLWA 4MAYA 1R24A 2FGZA 1J0IA 2IQAB 4LSTH 3N1QC 3RY5A 4CMMB 4WENB 2OTWB 4XPGH 1I85A 3JV6B 1F2QA 2ERJC 1B0GB 2BVUA 4QHNB 5FYLH 2RJMA 3QEQD 4XP1H 3BKJL 1ITCA 3FN0L 1M7IB 4HK3J 2DJSA 4JFDA 5JXEC 1OSZA 5TPWH 3CX2A 1MWAL 3ARUA 4LL9A 4E42B 1DANU 1M6OA 3ULSB 2FDBP 2JJTA 3AXLA 2PO6B 2W0KA 3RBSA 1INEH 5JW4R 2VDNH 5IHBA 3ZE2E 1NKOA 1S7RB 1TLKA 4EQ3A 4OZFA 3RVVC 1H3UA 4PLJC 5C08E 5JLZA 3WNOA 2BK8A 4YHPA 4RBPH 3G04B 5DYOA 5E94A 3UTSD 1KJ2B 1FCCA 3IDIB 1YPZF 2E9WA 3BISA 4RA0C 3TH3T 1ZVSB 1ROWA 4F15B 2EIZA 2VLME 5KW9L 1ERNA 4UQ2B 3MX0A 2Z91B 3MRLA 1FJ1A 4JQXC 2GEEA 4HUVA 2DKMA 5KG9B 1F6AB 4ZTOH 5T3ZH 3MA7A 5MI0C 3OV6A 4YWGL 5CEZE 1UQSA 3LAFA 3KG5A 3ARBD 3HMXL 3S88L 2F5BH 3EAKA 3UDWA 5IJVA 3QP3A 1TXKA 1MRCL 2V9TA 3VI3F 2OQJA 4Q2ZA 4P9ML 1OP3H 5TE6H 3MV7E 4H1LB 1OARL 2F74B 4L4VD 4HUMB 4LCWB 4NN7B 1N6VA 2OZ4A 4ODWA 2UYLB 2GJ6B 5HPOA 2VITA 5F9OH 1O5DT 2F19H 2XOTA 4DUVA 4JFPB 5EN2B 2ED8A 2R4RH 3CFKB 5DD1L 4GAYA 5SWZD 4QRTA 4AQ1B 5F97E 3DYOA 2HLFD 4HDIB 2ICEB 2PW2B 4PJ5A 2C3WA 4X9BA 5KSBF 1IAII 1SJHB 5DA0B 4UINH 1CDUA 4NQCB 3TWCL 1EFXA 3EGSA 2GTZB 5D7JA 5DMIH 4DJMA 5C0IA 2FLRT 4NO3A 4NQEB 2NTFA 2LU3A 4KH2A 1IC5H 2L7JA 4KY1H 3ARBC 3NIGE 1NDMA 4HPYH 1IGYB 2KKQA 4R4FH 5DRXA 3D39B 5JHLH 2N7AA 1U36A 4QRSA 4HS6B 4NO0A 1P6AB 1AO7A 4WFHE 3JVGC 1CLYL 1K2DB 1NH6A 1CU4H 1NUNB 4RQQB 4UQ3A 5FO7B 3MBEA 1C5BL 2UWEB 3CMGA 1OWWA 4K23L 4Y1AE 3WIIL 4JO3L 2NW3A 3TYFB 4WI9A 2XZQL 4DN3L 2I60L 2DLFH 4JRWA 4OCXL 1GSMA 1W8OA 1H3VA 4ODTL 4OZHF 2HLFC 4HCRL 5IFHH 4GLRH 4JY4A 1HH6A 1KCKA 4DGIH 4OZ4B 3GJFA 4K9EC 3CFBB 5SWQA 4Z8FL 5HHOD 4EOWH 4X4ME 1RIUL 5IROC 1OPGH 4PGEA 4MB5A 5H2BB 1YMME 2P7TA 5JMOC 3K81A 1T1YB 1I8MA 4OSUL 5C70A 2C7UA 3BFOA 4AEHH 5CWSA 2X40A 4WFGE 1QQDB 3MJ7A 1U2CA 4QXGH 4KTEH 1A47A 2EDBA 3BPNB 4JFEE 1A6WH 1ND0B 2LABA 4Y19B 2O5ZL 4XPBL 2CPCA 2HA1A 3EHBD 1CG9A 1G6VK 4M93B 4LCCC 3WFEL 1GOHA 3FMGH 3VDBA 3GMQA 1I9JL 1J0YA 1J7VR 4OZFG 5DMKA 2FHCA 5FO8B 1HQRA 5C9JA 3HFMH 4P23B 4M6NH 1IL1A 3VI4F 4OZIF 4MX7A 5DSCB 4GT7A 1U95A 4JPVL 1TQCC 4KQ4H 2HG5B 3VXRD 4FQ2H 1N5YL 4PG2A 5I1KL 1T21B 32C2A 4WY7L 3W11C 3OAYH 3D87B 1G7JB 3O3DA 3TO4D 1DQTA 1GGIL 2A9ML 1UWEL 1LDSA 5LKNA 3AAZB 4MSWA 3CUPA 5EZOH 1Q72H 1KCUL 1CFNA 3X12A 1C5CH 4YE4L 3VDAA 4C56B 4OFVA 3KPNA 4L3ED 3VXSE 1E6OH 1UACH 4GH7B 4L4TD 5I75C 1ZT1A 1U8IA 4C4KT 2V5RA 4P48A 3WEXB 1MIMH 3TZVD 3OKDB 4XX1E 4ZUWA 5IHLB 3NFPA 1HINH 1NBZB 3GSOA 4QHMA 2BNRA 3MRNA 3V5DB 5EU4A 3EHBC 3QIWD 2IBZY 1BQSA 1IAKA 4HIEA 4OLUL 1CFQA 5E6YA 5ITBL 3T2PA 2F54A 2FIKA 4EKXA 3MRJA 3VGEA 4JPKH 4TSBL 5E8PB 3TJHC 3EOTL 3V9FA 5BZWB 1MHEB 5L2KA 1KUMA 1NLDH 1I7TA 2BVPA 1ONQB 2NX5A 3P9LA 3UTOA 5T1KD 1ADQH 3TO4C 3X3GH 1EHLL 1FRGL 2Y7QB 4F7EB 2MNUA 1A7RH 3MV8A 1B88A 1Q8MA 1WBYA 4UV7H 5C09B 1QR1A 5DR5L 4YPGA 1ZGLB 3DRTB 4NHUB 5TQ2H 4TVPH 3MOBL 3PGDA 4X9FA 5L2JA 2YXMA 1WAAE 5BVJA 3HC0A 3SDCC 1NFIA 4M62H 3TZVC 4LLMB 2VLJE 3O41A 5K9OA 1RUKL 3C87A 1CXLA 2VN7A 1MCQA 2X42A 4NKDA 3T2NL 3QIWC 3OR6B 1EJOL 1NUDA 2AJUH 2BNQB 5I66A 3BQUB 3GM8A 1CGYA 4OCYH 2FJFB 1E4WH 4K7PY 3B43A 3PABB 1DDHB 1HNFA 5E99H 1VGEL 5I1LB 4XWGL 1X7QA 1NBVL 3L3DB 3DXAE 4TOYH 1S7VA 2OXGA 3NOIA 5D1ZA 1ZE3C 43C9A 3VCLA 3IGAB 3K4ZA 3QPXH 3LQMA 1BX2B 3SGJC 2X4NA 4YDVB 1VACA 5EOCH 4QRRA 1T5WA 2H1PL 1BOGB 1G7PB 3T3MF 5ALCH 1JUFA 5DC9B 4IRZH 5C0BA 5GGSB 4AY0A 3DVGB 1WK0A 3MCKB 2VIRB 3B9EA 4K8RL 4HF5H 4X9HA 1QZ1A 2NY4B 1FVCB 1G7LB 1IGJB 3GSRA 2BVOA 1LEGA 4OFYD 3O9WA 4TUKL 4IOFD 5GS1C 5AYUL 1ZHNA 5B8CA 4HKBB 2IBZX 3BW9B 2CH8A 2IBBA 1JGUL 4CJ1A 3MQIA 3LKPB 4YHMH 2DS4A 2Q1EA 3S36H 3L3KB 1UYWL 3QZWA 1J5OL 3JWOL 2DQFB 1KJMA 3BMVA 4JEGB 4HD9A 2E6JA 1M1SA 3EZJB 2NX5E 3OMZA 5ICXA 3U30C 3OL2A 2ZKHH 1BZ9A 4LCIL 4RFNB 3OX8B 4RFEA 5E5UB 4QRPA 1XF1A 1I1RA 3K0WA 4ORZC 2X1PA 3B5HA 5GSVA 3GRWL 3OGCB 2BHYA 1J1XH 2AJXH 2BHUA 4PJ9A 6FABH 4E0RA 1MCIA 3TVMB 3NFNA 1R5WA 3ES6A 1CD1A 4AJ0A 1TJGL 2JB6B 1CICB 3O3EA 1ZWIA 1Z5LA 4IOFC 4HIHB 1ZS8B 3Q3GB 2Y5EA 4NZRL 5E9DB 1BPVA 4BSVA 4YBLC 2C4FU 3I6KB 5F88B 3OJDB 4K7PX 4E5XA 2P8LA 4JM2F 1HOCA 4X8XA 3L3HA 1P53A 1R5IA 1I8IB 2Y07H 4PJ8D 2K7QA 1DE4B 4HJJL 3ISWA 5KSVB 4Z5RB 1DQDL 5IW6B 1MHHB 4GOSA 3V4UH 1NC2D 4ZFOB 2UY7A 2VC2L 3CFJA 1CFTB 1HSAA 5JOPE 5DEFA 2FSEA 4XZUA 3DMMA 2NY2B 2FO4B 4U1IA 2JCCE 5FCUH 1IC4L 4RGOL 1TITA 3GSVA 1UA6H 3V5KA 4Q6IA 4MXVF 3KYOB 3QAZB 1QKZL 1LDPL 4BYHA 4JO2H 12E8L 1ZK9A 3MV11 3TNMB 2EYTB 4ENED 1DVFD 1F13A 5JORB 4DUXA 3G6JF 2HJLB 1I3RB 4XMLH 3T0EE 1MCJA 1PQZB 1BFSA 1LO3H 4I4WA 1LO2L 2MWCA 4OJFL 2KBGA 2XQYK 2AXFA 4AH2B 4X80L 4NZUL 1IC7L 1QRNE 4XRCA 2XIDA 3MXVL 1H3GA 1Q9OA 3KGRA 3W0WD 1WCBA 2APBA 3D0VA 4PJ8C 5CEZL 3M1BB 4WEMB 5CHNA 4JN1L 4GUPB 2CK0H 4N5UA 5TF0A 4LSVL 5IFJB 3K1KC 3RKDD 3EO1A 4X9GA 1XCQB 1OCWH 4PJIA 1FLRH 5I1EL 1MFAL 2RGSA 4LBEB 3QUXB 1ZLVH 4C55A 5IKCB 2CKBH 3FQNA 4OB5L 3UP1A 2B4CC 1KIUA 3LEXB 3PV6B 4XBEL 4AMKH 1D6VL 1AKJA 1DVFC 3O3UN 5I76B 1ULVA 1JGDB 4PRIB 3QZWG 2XZZA 4DGVH 2IG2L 3PJSA 1DSFL 1TVHB 3R06B 1P4BL 3C08L 4BKLB 4LVNC 4PR5B 2XWBA 3KWWB 4OIBA 4N8VB 4PJCA 1IAOB 5F70A 5E00B 4HC1H 4HLJA 5BV7L 1C12B 3WFDL 1FGNL 1IMHC 3V4PL 1XGTB 3GI9L 2AK4E 3K8MA 4EI5A 2XTLA 3RKDC 1ZTXL 3L9RB 3NA4A 5FYKD 2D31A 5FHBH 5ICZB 4NZTH 1CE1L 3RL2B 3O2DH 3ZE0F 4FFYH 1R3KB 3MV9A 2AP2A 5E6IB 2YRPA 2ZOKA 3I50L 3NACL 4LNVA 3PG2A 5D7LE 2FGWH 3T3PE 2YN3A 4XCYB 1CT8B 1NCAH 2VUOA 5GJTL 1RHFA 3MLVL 4GXUN 1CGSH 1KPUB 2MJWA 3OKLA 3HE6A 2W9EL 2YWZA 5EWIH 4BZ2H 4CUCA 1KB5L 1YNKL 2FX7L 3HC3H 3LS5H 2O5XL 4I77H 5K59F 2OL3L 1S8DB 1T7YA 2XA3A 3SE4C 4ONHB 3MRCB 2W0FA 1GC1L 2VDKL 5C2BL 2LAAA 5F3HA 5GGRB 1FPTH 5IFAL 3MUJA 3VFRA 2R29L 2E7LC 5L88H 2RCSH 3MLWH 2W38A 4QRQA 2AV7A 4NIKB 5BOPA 3L7FA 4U6HB 1A7OH 1TCRA 1RUAH 2EE3A 4NPYB 1D5ZB 3CH8A 4ELMB 4YXHH 3B9KB 3DPBA 1BGXL 2I07B 2XWTB 3MV01 3NA9L 4GW4B 4JKWA 5EC2A 4PGBB 3GBLA 4NHCH 3GIVA 1BFTA 1H9VA 2H3NB 3DI2B 4GKSA 3CPLA 3BO8A 3U9UB 1YEGL 1G7MA 3C60A 3MLXH 3U83A 5CLTA 2ORBL 4Z7WB 4GKZB 1OGTA 4BUHA 4Z76B 1T7WA 4ODXA 2QR0A 3CD4A 5IOPB 3JTTA 2D7NA 4RISH 4HH9A 5GRUH 1C1EH 4NJ9H 5BMFL 3T0VA 4LFHG 3M17A 2FECI 4HK3N 3BH9B 1OGAA 4KHTL 4N0CC 5DJDB 2J8UA 4GRWF 4L8SC 5I74B 4X7SH 2EXYD 5E1AB 4JDTL 3S3SA 4NRYB 2H41A 3A67L 3VJ6B 5EUOA 1DBAH 2OTUA 1I1FA 5FDWB 1HXMB 5ALBL 2HRLA 4JRXA 4L9LB 3T1FB 1HHHA 1IM9A 3KPLA 3QT2A 5FECA 5I1IL 1JTTA 4MJ6B 4F9PA 5D7IF 4F3FB 3GJEA 2R1YA 4ZD3L 3LQAC 3B9VA 3VWKD 4OF6A 5GGQL 3C8KA 5D71L 5ACZA 4ZUSA 4O4YH 2IANA 3LV3A 4KVNL 4KVCL 4ZQKB 1H3XA 4LGRB 3RWFA 5LWYL 4RIRA 3HI6L 3NIDE 2DWEB 3QYCA 4WI2A 4FQXA 4TPRH 2GUOB 4Z0BL 4S11A 1TENA 3Q6FB 5CJBA 2BJML 1H5BA 5TDOB 1EEYA 5CCKL 1XGPA 4G6JL 3GHEH 3RVTD 1BAFL 4XAWL 3BH8B 3QWQB 4NYLB 5D7KE 4WV1B 1F3JB 4Z18A 2XZCH 4K07A 1EGJH 4H1LH 5GS0L 4QOKD 2HRPL 4IRJA 2EXYC 1FH5H 3E0GA 5JHDA 5C7XL 1PY4A 4MJIA 4GXVL 3ZZ1A 4LGPB 2EC9U 2UZIH 2YSSB 4QXTA 3K3QA 5INCB 4JFHE 5T3XL 3B6SB 5CEXA 5L8KB 2HVKB 2AGJH 2W60B 3QXVA 4FXLA 1NFDE 3QFJD 2AV1A 4OD2A 2EO9A 3O8XC 4KV5E 15C8H 1R5VB 3U0WL 1ZOXA 4P3DA 2HH0L 2VR9A 1JHLL 2X4RA 2ZCKH 4WCYL 5FHAH 4RMTA 4NBZB 1UJ3A 2I9LB 4HS8H 2VLLB 1KIQA 4HMEA 4KQ3L 3EO0B 1AGCA 1DUZB 4NDMB 3RVTC 5EUOE 3BXNA 4XH2B 1HWHB 4G7YL 1FN4B 5I1HL 4K3DH 1KELH 4F8TA 4WW1B 1WC7A 2V2WA 2ERJB 2AABL 4PYHA 3OF6A 2MQCA 3C2SA 5F7UA 4PJEF 2GJJA 5K9KB 2R69H 5EC1B 4KXZI 2BMKA 4ALAH 5EU5B 3SE8H 4Z7UA 3SOBL 1MOEA 5C07B 1JPTH