1FL3A

Crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
AALLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTSVTVSAAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN
publication title Blue-fluorescent antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 208
sequence length 208
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3A01
2GYSA 4HWNA 1ZA3A 1T5WA 5E08L 1WEJH 4Q9CA 5A40E 4JG1L 2BVOB 1NC4B 4QT5B 4P5MA 3V0VA 5EC2B 2FSEA 2OM5A 4I2XE 4IRSC 5HI3C 1A7PH 2ARJA 3ARXA 2R69H 3QJFB 4JN2A 2BFVL 1FC2D 2DQHL 4Y1AE 4PD4J 2OL3B 4PJGF 3RVVD 2BMKA 5JDSA 3ULSA 1ZHNA 1A6WL 3VFPA 4HUXB 5I1IL 2YS4A 3WN5A 4L5FH 3WHE1 3S34H 5C09E 2W91A 3L3OB 1T2QH 3VGEA 1GGBH 3C6LA 1BD2A 1E27B 4LLDA 3T0XA 1IC1A 1IQDB 5HHOD 2H1PH 4M1CC 3WIIH 1PDKA 1GVIA 2OX5A 1EBAA 3V7AG 5ESQB 3KPSB 2NMSA 3S4SB 2ENYA 3RGVB 4LSPL 5D1QC 4PJEA 3GI8H 4ZAKA 5GRJH 3MNZB 3K8MA 4ALAH 4WUUB 3MLVL 2DOCA 4YWGL 1HSBB 3MLSH 5KS9F 4ZODA 4NZRH 3HZVA 1P2CA 3T2NH 1YC7A 5DMKA 3JXAA 4Z7VB 4XP6L 3QDGA 1EGJH 3WDIA 5IQ7L 5DMYA 5MENE 5I15H 2ZUWA 1QRKA 3GJFH 5CINH 1JGLL 2GITB 1IQWH 5D7IA 3ZKXB 2VXQL 4DZBB 5J06A 4Y1AD 4G6MH 1SEQH 3CSPA 3DVGB 4HIJB 4JZJA 2CKBA 4Y4FA 1OSZA 1FVCB 1Q38A 5C09D 3V6ZB 2VNCA 4FQJL 3GKWL 2F5BH 5DI8B 5LAXB 2H2PC 1KIRA 3MRPB 2FLBT 2VIRA 5JW5A 4ISVA 5FK9A 1RJYA 4RGMC 4E42A 2HFTA 3DUSA 2WZPD 3QP3A 4HS6A 4I18C 4IJ3B 1I3GL 5C0EB 3QIWB 4KI5C 4MA3A 1M4KA 4W4OA 3BRGC 5IK3B 1JGDB 4PJ8D 3HG1B 1IRAY 2NCMA 3GMMA 3U6RB 1TTUA 5F96H 1EFXD 3K80A 2N1KA 4LPWA 4E41E 5F8RC 4JPIB 3RA7L 1UB6A 5MEND 1OWWA 2FO1A 3SDCB 1Q9LA 1T0MB 1RK0A 4PGBB 4NUJA 1QO3A 4RZCA 1FAIH 3S37L 3GHBL 3UP1A 2IH3B 5IESH 3VRIB 4LSSL 1EMTL 3K4DA 5EZIH 5EIIB 1NGYA 2FL5B 2GSGA 2NY3B 3JV0A 4DKDC 2AK4A 4D9LH 3L9RB 4OJFL 2P42B 1U8JA 4FQQB 3MOQA 3VFUA 1IKNC 4F8TA 3RIAK 4OLWH 2BSRA 4L4TA 3OJMB 2EC9U 5EUKA 3ZYJA 5HYEA 2LQRA 3SKNA 3MRDB 3FRPG 1A7RH 2P8PB 4KDVA 4OGYH 4QHKI 3BHBB 3QDME 3A6BH 4NSKB 1FLRH 4JAMB 1HYRC 2A0LC 1RZKC 3QFDB 3TZVB 5I66B 4E41D 4XPTL 1LO0L 2OQJA 1TCRA 1FFNB 3PWJA 3TYGL 3UXFA 5GJSH 2AEQH 2YWZA 1CE6B 2EYTB 3DTXA 1P4LA 1YMHA 2DLTA 1NBYB 2FJHA 4JRXB 3RZCB 4GLRH 1IE5A 2O5ZL 2A83A 2Y5EA 4LVNB 4OIBA 5F6HI 3FB6B 3UDWC 1KUMA 4UILH 4Z76A 1MCHA 3L7EA 5DO2C 1RHFA 1YYMH 4GAJH 5C2BH 3MACL 3PL6A 1FCCA 3G5XA 3G6DH 3VD9A 2NW3B 3H9HB 3RU8H 2QSVA 5JHDB 3OJ2C 4HMEA 2NY4C 4FQ1L 5INCB 2IGFH 3NGBB 3AS3A 3QUZD 1HSAA 3LQAC 4EBQL 5BCAA 1LE9B 3C5JB 3UBXA 1A7QH 1A3QA 2BNRA 2NX5B 5L8JB 3RX7A 3OL2A 4Y16C 3VXMA 3KPRB 1Q1JH 2ERJC 5C9JA 3REWB 1AP2B 2QSQA 4RA3A 5DJZA 2PO6D 2CIIB 3GK8L 1W2KT 1CU4H 4OZIF 5HI4C 3I3BA 4JO1L 3TVMC 3ARGB 4GG6B 1K6QL 3BE1L 1JPTL 3U7YH 1ZKAA 3WNLA 2CLZA 5TE6L 5LXGL 2DQDL 1OTUD 2QSCH 3ZO0A 2DLFH 1AO7E 3QAZB 1QR1B 2OK0H 4P3WA 3S9DB 4KVCL 1UM4H 3TBSA 3FQUA 3L7FB 1NBZA 3G6JF 4U1SB 4S1DD 4OCMC 2R1XB 1MFAH 2YD3A 4PJBB 4Z7QE 1VGEL 4PJHF 1OP3K 2FEEI 1AQDB 2NTFB 5A16B 2R8SH 1XCTB 1O5DT 4PJ5B 3SCMD 4NRZA 4M61A 3EOBB 3BGAA 3D5OF 4PR5A 4HPOL 2Z93A 4YPGB 3UTZB 5JXAH 3CC5B 3ARBC 2IPUK 3HUJA 2BHUA 4Z8FL 3LQAH 3BESR 4OD1H 1SYSA 3RVXC 3ZE0F 4UBDD 4HWBA 1QFWI 1Q0XH 1KN2L 2GT9B 1X44A 1YPZA 3ARVA 5F1KC 3ZTJH 5A2JH 1V8HA 4OV5A 3PIQA 4JGUA 2I25N 3DI3B 4NQEE 4OD3L 3UTSA 4LBEA 1AO7D 1FNLA 3L6FA 1FV1B 1CT8B 3OXRB 1DEEB 3L3KA 5FYJH 4OZHB 5DHXB 4LSQH 5IIEB 5FOJA 4ODUA 3WL9B 1UXSB 1ZT1B 3ZE1E 3QCTH 3DRQA 1SJEA 3I6KA 1KV3A 1J05B 4NM8L 1B0GB 3SE9L 1LK3H 3B9AA 3S37X 2YZ1A 1JHLH 1J11A 1YMMA 5LGKA 2FIKB 1LE5A 2H9GB 1A7OH 4OF7A 3TV3L 3Q6GL 3SE3A 5FV2A 3QUMA 5E99L 1UJ3A 1HI6B 4Y19B 5FGSA 3VFTB 4PTTA 3SPVA 1K5NA 1KLFA 4JFQB 4NO5B 1JYWA 1ZHLA 4PRAB 4R2GD 3CFDB 2VC2H 1EEZB 3O4OB 2YD7A 1B3JA 4M5YH 4UINH 4P4KB 5E94B 2XWBA 4EXKA 2I9TB 4WDIB 4PY7B 4PG2C 1RIHH 2AXJA 2FWOB 4WHYG 1J7VR 4M3JA 3Q5YA 4YXKH 3ESVF 4RGNC 1ZHKA 1FNEA 1AGCA 2ITCA 4XPAL 3NIDF 2OXHA 1IAIL 1G6RL 1LVEA 1UM6H 3QHZL 5CLTA 3OAUL 4UQ3B 4XVUD 5IBUB 1QYGH 3FB5B 3MJ9L 4KC3B 5JUEH 1TJGH 4LVOC 1ZVYA 5KTEL 3KPSE 4MAUL 1XF2B 5CSZA 3K0WA 3H9SA 2I27N 4ERSL 4S2SB 3B9KC 4WUUE 3OXSB 2ARWA 1BJ1J 3LKNB 3EYVA 4P5TC 3F7YA 1TJIL 2Y23A 5E9DA 4Z7VE 3UTTA 3DURB 4HH9B 5E8OA 1MY5A 4F57L 5F9OL 3R1GH 4FQCH 4O51A 2A74A 3WFCL 1NC4D 3F65A 2ORBH 32C2B 3MNVA 4G9FD 5DHYB 3ZE2E 5CZXD 1YA5A 2VXUL 4Q9BA 1RUQH 1D5IH 5DD1H 4PLJD 1ADQL 2IC2A 3MLUL 1RPQA 5L8LB 3TT1H 3NACH 4JO2H 1NMCB 5D71L 3ROLB 1KBGH 1V3LA 4LLUA 2EKSB 2ED8A 2AABL 2IH1A 2G2RB 1AR1C 3KPSD 3UTQB 1RI8A 2VLLB 5L88L 5D4QA 3RGVD 4LSVL 1ZLVK 2GJZB 5FUZH 1RURL 2P5WA 3IU4H 1KIPA 2X4OB 1OTSC 5IHLB 4LLMB 1OLZA 5T3XE 3B4NA 4WUUD 5ITBL 3HLAB 3PWUA 4RAUA 1V3JA 2IMNA 3HG1E 3X17A 5I8EA 5JZ7C 1BJ8A 3AREC 4KJYA 4ZS6C 4JFPB 5HD8C 1IGFH 1KJ3H 1MCWM 1MI5D 1XEDA 1YNKL 3FB8A 1KB9J 2D31B 2PW1A 1FYTA 1LK2B 4ETQA 4HIHB 3ZT5A 3NPZB 1ZLSH 3OR6A 3ZMRA 4U1LB 3SDDB 5DD0H 1UWXK 4XRCA 3FRUA 3WJLC 4N0YH 5C92A 4MCZB 3QRGL 3BJ91 1ULVA 1FZOA 4OIIH 5IB3A 1E4KC 1BVZA 5DDHB 5JOFA 1BX2A 1Q0YH 2AJYH 3BQUA 3VFOB 3T77B 1FZKA 4NRYA 1KEML 4AG4L 1Z0MA 4QY8A 5JQHC 4G7VH 2AK1H 3CXHK 1R5VA 1MFDH 3SGJA 2XWJB 2EDRA 3QIWD 4K7PH 5T3XD 1H0DB 4PV9B 5ACMA 3HG1D 1N2RB 5I0DA 4YXHH 1VERA 1X5AA 3CVIL 2ZUVA 4KQ3L 1WIPA 1RUAH 5IQ9A 2GAZB 3X13A 2GY7B 1YEFL 2X70A 3SDCD 2VH5L 3NA9L 5DEZA 4CMMA 5ACZB 4JRXE 4MB5A 4Z7OF 5DZLA 4JFEA 5DJ2A 1INEL 3FZUC 3FN9A 4IEFB 1ZEAH 4JR9L 3QG6A 3W9EA 1AY1H 3AY4A 3GSNL 2F5AL 2QQKH 3ZDZE 4HGWA 4H20L 1HOCB 1Y0LB 1KELH 2AI0L 1FBIH 4NBYB 4LARH 3TIDA 5JR1L 5HSFA 5T5FH 3I75A 1PD6A 3M8OL 4KUCF 4NQXB 4XXCC 4EVNA 1U8KA 5JHDE 3WJJC 2R29H 1HHKB 1I7RA 1RIUL 2MQ0A 5EN2A 3IDYB 5JNYB 1SVZA 2QKIB 1JZ3A 3VJ6A 1C12A 3TZVD 1UZ8A 4HLJA 2NX5E 1EXUB 4D0BB 3MLRL 2VISA 3KPRE 4PLKD 3O6KH 1JNHB 4I48B 3L3GA 1L0XA 3BZEA 4JRXD 3LN5A 3RZCD 5B3NA 4GRMA 5CCKL 3BRDA 1DQDH 1QFOA 1OTTC 2QHRH 4N1CA 4GG6E 2OL3L 3SO3C 1AD0B 1OAUL 4G5ZH 4XBEH 1I3RB 5C0IB 3CFCL 4NQCA 4EUPA 4R4NC 1J8HB 1PAMA 2J7LA 1Z9LA 1D5BB 3LH2H 3QNZB 5T1MB 1KFAL 2YC1A 2DM7A 1DJSA 4TSAH 5KANI 1I1AC 1OAQL 2C7UA 3QZWG 1EX0A 5JHDD 5DLMH 3WMSA 4X4YB 2BVPB 4NPYA 1F4WL 2XI9A 2E7LC 1JNLL 3O2WH 4PJBE 5DJ8A 5INDA 5AUMA 1F6FB 4G6AC 3KJ6H 5BV7B 4EZMA 4NOFA 3KYMB 4PJ5E 1BIIB 2ICWI 2NX5D 3ILPA 2P44B 5GS2H 4U3CA 2APFA 2CMRH 4ORGB 3KPRD 4ZTOH 4W81A 4ZFOA 4TSBL 1QLRA 3WFBL 1HIML 1PW3A 2NZ9D 4AH2B 1KXQE 2MQCA 4FZ8H 4OLZL 3MNWA 4WW2F 1T4KA 3ARGD 5EA0L 1XIWA 1A9BA 1JWMA 3CNKA 5EO0A 1DQML 2XKSA 3QNXA 3QEUA 1LEGA 2FYYB 2WWMD 3BKML 3BIKA 3CXDL 4WY7H 5E2WH 4OZHE 1N59A 5HYSB 2R4SL 3WSQL 1KF9B 4ZNCD 5I19L 1A2YB 5CIPA 3V2AR 2AP2A 2DLHA 2E7HA 1ES0A 3HCVB 5T3XL 3IB4A 5DZNA 2FD6H 4LDLB 2ITDB 5T1LB 3MLWL 5E5UB 1WSST 4L9LB 4PJ5D 3MV9B 4PRBB 2D3VA 1H15A 3ZTNH 2W1NA 2ED7A 3GNMH 3RWEA 4Y19E 3TO2B 1PGRB 3NTCH 3GMOA 1MWAA 4UUJB 4JFDB 1KCRH 3RWJB 1S7RB 3SJVB 1JFQH 1UB5A 5HHXL 3E0GA 5JPMB 1JHKH 4X8XA 5ICYB 2NQCA 2AGJL 5FUOL 4IS6A 1KIUA 3SKJH 3WEXB 4K8RD 1YJDL 2HT4D 1NDMA 1T80A 1XGYL 2IBZX 5JHLL 3CVHA 4P59L 4U6HB 3U82B 2R0ZL 1QSEB 2PN5A 1QLFB 4F58H 4H1LB 3AU1A 4GRLB 1VADB 3VDAA 1T89A 1YY8B 1FH5H 5IEHB 1JWUA 3GSOA 1XF1A 4JB9H 3QWQB 4HFUL 4X4MA 4TVSa 1BQHB 4XPHL 1NCNA 1WBYA 3MJ8B 3VWKB 1S7WB 4Q2ZB 1W0VB 1AC6A 1ZMYA 5LBSL 4Y19D 2AVGA 4F7EB 4XGZA 3BZ4A 4JRWA 4Y4HA 4K3JL 2FO4A 3K2UH 5H35B 2X9YA 5ETUA 3GBNL 5E0QA 3RUGA 1HYSD 2X09A 2GIYA 1F3JB 3SQBA 4IIQC 4P4KD 2UYLA 5HVFB 1RZ7H 2Q6WA 3EDFA 3O2DA 1MIEH 4NKIL 1A0QL 4XMPH 4YIQA 3AVEA 1UH4A 2JCCA 2OMNA 1ONQA 3IF1A 5BW7C 2Q8BH 3B2UD 2KZ1B 4XPBH 4ZOAA 2CH8A 3IAQA 4LQFL 3T04D 4MXQD 5GSVA 3LN9A 5SX4I 1Z3GL 1TPXC 2AV7A 2B39A 3PDOB 1G0YR 5FDWB 1QFWH 2NR6C 4CGTA 1BQSA 2YUWA 4HT1L 4QHMB 2HLAA 5C8JB 12E8H 5J9PA 1P84K 3EFDH 1T5WB 1HHIA 3S5LA 1X4YA 3K3QA 3FAWA 3D6GA 1G9NC 2Y06L 3IDIB 1YQVL 4P5MB 3V0VB 3TPKA 2FSEB 2HJLA 4YK4C 2ARJB 1S7XB 1YNLH 2ZOKA 4JN2B 5CMAA 2XYCA 3W2DL 1CLZL 3LN4B 3IDGB 5EBWA 5KVFL 3ULSB 1ZHNB 3VFPB 3WN5B 1KENL 4MDIA 1ORQA 1QA9A 3STLB 3T2PA 1R3JB 2ATPA 3QI9A 3SGDI 4WHYH 4M48H 4X6EA 5FKPA 1HQ4B 4LLDB 1J9CT 1JF5A 2NY7H 2B2XH 1KTRL 2GTZA 4OFVA 4R96A 5GXBB 5DJ6A 2XQYK 1MVFA 3U4BL 4PJEB 4AEIL 5JW4N 4IM8A 3VFVA 4Z7QF 1IZJA 1LDSA 3MA7A 3WLWD 4N8CL 5J0BA 3HN3A 1T83C 3MUHL 2VABB 5DMKB 2QLVB 4EN3D 1K4CA 1IAOA 5FV1L 1G6VK 1MRCH 3QJHA 4U0RC 4EOWL 3EZ8A 3NCJL 4Q97A 4QRRB 5D7IB 3DMMA 1PYWA 1JV5B 3IS1X 4PY8I 2BK8A 4MDJB 3S3JA 3VXQA 4K8RL 3TWCL 4JZJB 5L6YL 3NZ8A 2V2TA 2DIAA 4BSWA 5M95B 1OB1A 5FGBA 3SBWC 3IDJA 2XRAL 5E4EC 3VRJA 5DQJA 3S35X 2VLMD 2C4FU 4OFDA 4GXUM 1J12A 1RJYB 2AJ3A 4G6FB 4LMQI 4U6VL 3F7QA 1KB5A 2AJZA 2QV2A 3DUSB 2OZ4L 3ZE1F 4HS6B 4Y4KD 2HLFD 5IFAH 4KK5C 1Y18A 4KHTH 4XVJL 4UV7L 2GW5A 3ZHKA 1OF2B 5KSAA 3RVUD 2HTLD 4QHLA 5CWSA 1WWWX 4LNRB 3QG7H 4GW1A 1U92A 4XXDA 4A6YH 4X5XA 1MNUL 4O4YH 3ZKSD 5B38G 3P9LA 4ZPVA 2OJZH 1MREL 2YK1H 3F6LA 3P0GB 2VLRB 3VA6A 4JDVB 5FYKU 4JANA 5KAQG 3CPLB 5MEQB 4OCYL 1VEOA 2PYEB 3V52H 4MJ5A 1MCRA 3KPLB 4DGIL 2ICCA 5C0GA 1VDGA 1A5FH 1J8HE 4LHQB 1UQSA 3BN9D 3GSQA 4L4TB 5H8DA 3MRCA 5EUKB 2V2XA 4FFZL 2ARJQ 1IGML 3CJJA 1KYOK 3BGFC 1VGKB 4Z7UF 3SKNB 5EBGA 1VSCA 1HCVA 4EKXA 2RAMA 1SM3L 3LQZA 2HWZH 1BJMA 5DJCA 3OAYK 2VDOL 1S9YA 4NBXB 2EH7L 4ODSH 4Z7VF 4YBHA 3OF6A 3T8XA 2FJHB 1V7NH 4WO4C 1ZWIA 4OSUL 1MOEA 1TZIA 1AJ7L 4I0KA 2VDQL 2ZCHL 4CAGA 2OR7A 1XGRB 4RGOL 1BEYL 3ZE2F 3D39A 4M6NL 4JFHD 2H32H 4G6KL 2DQEL 5EU6B 3RWCB 2X2YA 3ECBA 1J8HD 4M8QB 4OCXH 2X4QA 3S36H 4XCNA 1V7MH 3WD5L 4L8CA 4P49A 1JJUA 4YFLF 4BUGA 5JXEC 1S5IH 3QCVL 4QNPE 1NCDH 4YHMH 3QUYA 4NKMB 2QADB 3MV9E 5FO9A 3VFNB 1IGIH 2ZUYA 5C9JB 4LLWA 1JPSL 3LKRA 1U2HA 4JFDE 3Q1SH 3SJVE 1Z6JT 1JI2A 3I84A 4C54A 2FR4A 1MRDH 4FMKA 4H26A 1PY9A 4JM2B 4JQIL 3G04B 3TT3H 2AEPH 3LEXA 4ZDHB 2CLZB 5E5MA 5BZWA 6FABL 4OB5L 5MI0C 3HFML 1UYWL 2ZSVA 1CE1H 1HZHL 2IANA 4KKCC 3G5ZB 1QSEE 3BOVA 2EKJA 4PGEA 4QEGA 1OL0A 4PJAA 2DLIA 1NGQH 4X7DC 4N0RA 3CFEA 3TBSB 3UYOD 1NBZB 3BKJL 2MKLC 1BREA 2NY4B 5DD5L 1R24A 2Z4QA 1EAPB 2IG2L 1FZJA 4N8VA 4PG9B 3MV8B 3QWOA 1JK8B 3GB7A 2DF3A 5IB1A 3STZA 5T1LD 4APQB 4UU9A 3MV9D 4M61B 1P4IL 4AQOA 3JWNC 1J1PL 1CXKA 1GC1C 3MROA 2X4SB 5CJ5A 4JFDD 1JGUL 4JDZB 5DK2A 1F45A 3W0WA 2A73A 5H94B 4Z95H 1RZJL 3TVMB 2X05A 3RI5K 3UAJD 4YHOH 2BSTA 3L5WB 5TQ0L 4RQQB 5IGXH 1QSED 4Q9RH 3S96A 3ZDZF 5D1XA 5J6GA 3QIBD 3ZKMD 1MJ7H 1NUDA 3L3KB 2P43B 4LKXB 1PKQB 4JPKH 2W59A 4NN6C 2BY1A 1ZGLP 3RDTA 1XZ0A 5B8CA 4XP5H 1IKFL 1KPVA 5CILL 3TN0A 1SJEB 3K4AA 1XF3A 1EO8L 3MZGB 4GRWB 1ZHBA 4NQTA 1YMMB 1LE5B 4KKNA 3VWKD 3U0WH 2E9JA 3BUTA 3QUMB 4PP2A 3V6OE 4HAGA 1KULA 3SPVB 1K5NB 1DUYB 4WFEE 3MCLH 4GQ9H 1I8LC 4PJDB 4UI2A 2F54B 4FFVD 4DVRH 1ZHLB 3GSUB 4FZEL 3S8WA 5IB4B 5K59E 3P30H 4KKLD 4LKCA 3SGEI 3P11H 4LIQH 4TSCL 3RKDC 3KYKL 5LQBH 1FFQA 1JPST 2XWBB 2FX9L 2HKHL 2V5MA 2EYSA 4XHJC 3VFMA 4XT1C 4HUWA 4GG6F 2O61A 1U8OA 4F7PB 3N85H 4B41A 4BKLA 4BSJA 5A3ID 4JY5L 1TMCB 4ENED 2MHAB 5F1NB 4WHTB 4ZFZB 5SWZB 3ULVE 3B2VL 3UJJL 4GFTB 1KACB 2A9NL 5EOCH 1EHLL 1RUKH 4BSVA 5KW9L 2UWEA 2Z35A 3E6HB 4PJEE 5GS0C 4PJBF 1EGJA 2OXGA 4OLXL 2DJSA 3WUZA 4HBCH 1YN7B 3MRMA 3QCUH 5KG9B 5BV7L 1MAML 3EYVB 3TA3B 4YAQA 2PKDA 3WFEL 1XR8B 3CUPB 2H8PA 4NQDA 4HG4J 5GGTH 5TQ2L 4V1DB 4O51B 2EO9A 1RMFL 4ZO6A 4R3SA 5FXCH 5IW3A 4HWEL 4ODTL 5DT1H 3VXRB 4AEFA 4QRRE 5D7IE 4HZLB 2VDKH 4WWKC 4XWGH 1A4JA 4PRPB 3WCYA 1CN4A 1GJIA 4N0UA 3R8QA 3NN8A 4IRSA 2FGWH 5JDJA 4TUOB 3H7BB 3EO0B 4RISH 1J0ZA 5TDOA 4OIAA 3QEQB 1BZ9B 3MLXH 1RZIA 4ONFL 1MJUH 2WUBH 4MD5B 1DBBH 2CK0H 2X41A 5SV3A 5IVXB 4DGYH 1OARL 1A9EA 3T0EA 3ULVD 5FKAA 2LU7A 1E28B 3BP6A 3O3UN 3GKZA 1N6QH 3O9WB 4XCFL 3MXVH 2PUQT 2ZNXA 1NFIA 4HX1A 3RHWK 5ID1B 4BA8A 3B9KB 5LWYH 1Y6MR 4XNZC 2GI7A 4X4XA 5D1QA 4IMLA 4NGHH 4NJAH 4JVUA 3OBAA 2AW2A 4JKPL 1A7NL 2VR9A 5DK0B 3UPAA 1MPAH 2GK0B 1BOYA 2F9BT 3CFKA 1DLFL 1ACYL 4UOW1 1X3DA 3FT4A 4OKDA 5GS0H 3IDMA 5JA8B 4QRRD 2N4IA 4NO2A 1JGVH 4EI5C 1PG7H 3OR6B 5DSCA 5F7NC 2VLRE 4XBPA 4XRCB 5IWLA 1G7HA 3FRUB 3GFUA 3IFNL 4UIMA 5SX4H 2PYEE 4G80B 4RBPH 5DTFA 3RWHB 1FZOB 2YEZA 2C3GA 4QRSA 5IB3B 1ND0A 1OPGH 1DQQB 5EBLA 1UZ6F 3BKCL 1IL1B 3S97C 1KCLA 2VZUA 1FZKB 3PHSA 1H9VA 1GYAA 1G9MH 3LD8B 4L4TE 4G6FD 5HGBB 4QY8B 3A0OA 2G5RA 3AMLA 3OAZH 1C7TA 1MFEL 4YHKL 4OQTA 3RWGB 4LFHD 2J8OA 4I18A 5KSVA 1CLYL 2FATL 4DAGH 4HC1H 5ERWA 1T22A 5I1CL 3Q5TA 5DUBA 2OI9C 1U58A 1R3KA 1V3MA 4WEBH 2XN9B 4AMKL 4YGVB 2K9UA 5HJ3A 3FO1B 2ADIA 3O2VH 3SGDH 1NAMH 1MHPH 3VGDA 4GKSA 4XNXL 3IVKA 5IUSA 5DHVB 2VLRD 3AAZA 5IT2L 4MJIA 4PV8A 4LCUA 4QWWD 4IRZH 2JJUA 2ADJA 4NJ9H 2YHGA 2PYED 3NCCB 5IVNA 1KN4H 4RFOL 1WWCA 3UPCA 4I1NB 4R7DA 4F2MA 4PTUB 3TBWA 1R5IA 5EU6E 2DDQH 5IG7A 4K71C 4YXLL 1EEYA 4W6XB 3TIDB 5A2LH 4K3GA 4XP1L 3ZL4H 1RFDH 1T04B 4EVNB 2BJMH 1AGBA 1M7IA 4KI5D 5MEPA 4OZGF 4X9BA 3NIFE 5KVEL 1I7RB 3S88H 3HZKA 5BVPL 1PJ9A 1CGSL 1N3NA 1AGDA 1CDCA 1UZ8B 4J4PA 3CIQA 4R0LB 4X6DB 5E56A 4ELMA 4LCIL 1DBAH 5KVMC 1RVFL 5IBLC 3K74B 1OLLA 1YY9C 1XH3A 4LPUA 4ZNEA 4H0HB 1TDQA 2WP3O 1VHPA 5K33A 5E2UH 3BZEB 3LN5B 2NYYC 1E4WH 4WGVB 1NEZA 4M7LL 2NY6C 5FYKH 2BOCA 2VKXA 4HJ0D 4EUPB 3U0TA 3BDYH 5EU6D 1PX4A 4KTEH 5CEZH 1BWWA 4NO3A 3UDWA 3VCLA 2OYPA 3H42H 2E8ZA 2X4TB 3ULVL 1OSPH 2QQNL 3LEYL 1K8IB 1N0XL 4OKVA 3BP7B 4LLQB 4L3CB 2BRRH 3H7LA 4KDTC 1L0QA 2EYRA 4RCAA 2AJVH 1M6OA 3IXTA 5C0BA 1T21B 5D5MA 1KPRA 5DJ8B 5INDB 4NC2B 4M5ZH 3MV8E 1F4YL 3QFJD 2E9WA 1DFBH 2JK5A 3NAAH 4HXAH 1QNZH 2QADD 4U05A 1Q94A 3P4MB 2P24A 4MA1B 3UMTA 2ED9A 1CFSA 4ZFOB 1QLRB 4GOSA 5D1ZC 1XFPA 3MNWB 3QDHA 3WHXA 4L3EA 1F6AA 2CD0A 4JM2D 1S7VA 1A9BB 1JWMB 5EO0B 1L6ZA 3GM8A 2YD4A 2YPVH 2EDFA 5DO2D 1OAZH 4FFYH 5DMIH 2YMXL 2ZJSH 1GGIL 2IBBA 2X9WA 4H8WC 5HVWA 1EAJA 2E7BA 1PKQE 5CJQH 1K9TA 2NY4D 5KN5B 2JJVA 3CU7A 1KC5H 5CIPB 1R3IH 4MYWB 4N1HB 3RL1A 1AKJA 1ES0B 3MV8D 4NWTH 4FP8H 4GRWE 3KWWA 1YMME 4P2RB 2HVJA 1R5WA 2VWEC 4Y16D 4APQD 2Q86B 3EOTL 1C8PA 2RCSL 3O6LL 2PTTB 2CDFA 3S98A 4XNMA 3CLFH 4OFKA 1NJ9B 1I9JL 1MF2L 4PJDE 4Y5XB 2F54E 1UB5B 5JPNB 3GIVA 3OKNB 3QUKA 3Q3GB 5FDYA 3TVMD 4D0CB 3JWDC 4Y5VB 1FYHB 5DMGC 2XZCH 2R1WA 5DR5L 4O5LH 5HHNA 3O41B 1CFQB 1DBML 4AEHL 4OAWB 5I8CA 4HXBL 4M7LT 3SE4C 4E5XB 4PLOB 5D7LA 1XF4B 1NUNB 3SEPA 2BXYA 3GSOB 5SWZE 3OKEA 5I1EH 2X1WL 4ZQKA 3ARWA 5HY9A 1TZHA 1ZT4B 1NUGA 1YMMD 3SKUD 1XCQA 3WLBA 5D96C 2HH0L 5D7SH 4HQQH 4NNXA 3CSGA 4X6CA 4K07A 5ESAA 2XOTA 4PD4K 2XA3A 3LIZL 4K3DH 5EO9A 3BZ4B 4KROC 4Y4HB 3TNMB 3VMNA 2K7QA 4XPGL 2Z31B 2F54D 5BQ7B 2Z0BA 5ETUB 3EOYG 1YEEH 4V1DE 3UBXG 3T1FA 1E4XL 4MAYC 3VXRE 3IETB 1BFVL 4CADA 1JRHL 1U3HB 5CZKA 3MUJA 1C16A 4PRPE 3QIUA 1CXEA 1KCKA 4TTDD 4M62H 4PJIB 4PG2A 5BZDA 4HUVA 3QEQE 1M71A 4WCYL 1EJ6A 5DQDL 3QH3A 3IFOA 1S9XA 3JWDH 5IVXE 1YEJL 5SWZD 1R3HB 3KPOB 4I13B 5C9KA 5AYUL 4GW4A 2A38A 1N5YL 3QXWA 2DWEA 4IOSD 3IT8D 4QNPF 5K93A 3ZKND 2BFVH 4F37K 1I1CA 2DQHH 1BFOA 5E6IA 1ZT7A 5J9PB 4P9ML 1BBJA 2ATKB 3TA3D 4G8GB 4YDKL 3BH9A 5I1IH 3BEVB 3HAEG 4P5TA 5EC1A 4NRXA 4UDUB 4V1DD 3L95A 2KQNA 4K9EL 5J12B 5E8DH 4JO3L 3VXRD 3AXLA 2HJLB 1CGVA 5CMAB 2EDYA 3ZDXE 4PRPD 2W65B 1HWHB 4LSPH 4LSTL 2AJSH 1E6JH 2HG5A 4CW1A 4MDIB 4GKOA 3MLVH 3QEQD 2PXYB 1J0HA 4S1QL 1FVEB 1QSZA 3QI9B 3SDYH 3FMGL 1FG2A 4X6EB 5FKPB 5C2UB 2VLJB 4X7CC 4TULL 5IHZA 3F58H 1PY4A 4XP6H 4LVHC 1OGTA 2Z8SA 4R96B 3FQNB 5DJ6B 3BIBX 1SEBA 3O9WD 5AZ2H 1JGLH 1EDQA 2EZ0D 4HK0B 3SGEH 3EDKA 3B9KD 3FONA 3MX0A 3VH8B 2BDNL 4H88H 1LD9B 3HE6B 3N06B 3ULUE 2IBGA 2Z8VC 3PWNA 2DN7A 2YSSA 3DVFA 2VQ1A 4J23A 5AYQA 5C0DA 2XN9E 3PGDB 1TNNA 3AREA 4FQJH 3GKWH 5GRUL 1PYWB 1DQLL 2JB6A 3J7HA 3HC4L 3JV6A 1W72H 2W0FB 3VI4E 2A6JB 5F3HA 4B7LA 2QQQA 3VXQB 1K3IA 4D2NA 2X4PA 5IOPB 2LAGB 1DQJB 1IC4H 5SWQB 4YR6B 3NZ8B 3VFSB 5F72S 1I3GH 1DN0B 2APBA 3HMXA 2PW2A 5F9WC 5LGJA 1F6LL 3WJLA 1FL6B 1GAFL 3H3PL 3BSZL 2V5YA 5DQJB 4KZDL 2H6PB 3U0PB 1E4KA 1J1OH 3RA7H 1TJHL 2V7NB 3THMH 3BYTA 3RVVC 4XI5D 1KB5B 2YPLD 5DUML 4WTZA 2CPCA 5I17A 2EXWD 1Y18B 3MRBB 4XNUL 2WIIA 3VFGL 5CBAA 4XCYB 3S37H 3C5ZB 4QHLB 5F93C 1CFNB 1O7VA 4NC1E 4UT7H 3RL2A 4LSSH 4Y2OA 1KTDB 3MV11 2A9MH 3NA4A 2MKWA 2P8MB 2XN9D 1U92B 4GW1B 2K7PA 3DX9A 4X6DE 3VG9C 4ZPVB 5BS0A 5K59F 3MRQA 2SEBB 2DMKA 4ZYKA 2OTPA 3NZHL 1LO3H 2NY0C 2X89D 1SJXA 4P9HC 3WYRA 2IFFH 4X6FB 4IHOA 3C2SA 3BW9A 5E4EB 1FNAA 2WUCL 1CCZA 4GAFB 1JPFB 4POUB 1UQSB 2UY6A 4HK3J 4U1MA 1OM3L 3GSQB 3BD3A 1LO0H 3RBGA 4L8SA 3ULVF 2JJSC 1QP1A 1A6TB 3TYGH 5DRXA 2EEAA 2AJXL 3PHQB 5L8KB 2A6KA 4YFLI 4YJZL 5CS7A 4R4FL 2F53A 2O5YL 1CFVL 3QO0B 5C0CA 4NO0B 5D7KE 4PYHA 4BFIB 2VDLL 3WJJA 5GGSB 1TZGH 4JZOA 1K4DA 1KLGA 3U2SA 3TIEB 3PWPB 1LEKA 3P0YL 3U9PL 5DK3A 4AY0A 4AIOA 3BH8A 3KPMA 1FSKC 3HE7B 4PJ8C 4NHCL 3QPXL 3KS0H 4JY6A 5ADPL 4OGZA 2XA8L 1F97A 5I71B 4EDXB 3MUGA 3D39B 2IADA 1FC1A 4FQ1H 4Z7WA 2NY2B 2D7QA 1QFWM 3O6MH 1DL7L 3QO1B 1X5YA 1JMZA 1Z2KA 4PRDA 4EBQH 3VG0H 2VDRL 2DM4A 1UH2A 4F7MA 2X4QB 5T1KA 3IFLL 4F33A 1MCPL 5F8QC 1WFUA 1RJLA 4FN0A 4B7IA 1PZUB 1I1AA 3C5SA 2PCPB 1JF1A 5D7KD 1VFBB 4JO1H 4DKFL 5D70L 4P2RE 5E2VH 3OJDA 2Y07H 4M1DH 2VYRE 2DQGL 1F00I 4U1NA 3RWFA 4KK6C 1NGXB 5TE6H 2IAMA 5LXGH 4LLWB 5TPWL 4D3CL 3GO1L 4X7TB 5EZLB 3D48R 4EJ1C 3MOBH 3BPNB 3O3EB 1AXIB 4WFFD 5DVOA 3R8BB 1ZVSB 2DBLL 5FM5O 2BOBB 5BZWB 5IFJB 4OI7A 4AQ1B 4U6TA 2GUOB 3DGGA 1I8IA 4LK4A 4FNLL 1CQKA 1K8DA 1SBBA 3BKYL 5BMFL 1CLOL 1IC5H 1JMXA 5DVLA 1EO5A 1OGAA 5IHBA 4Z7NE 1FP5A 1K2DB 4S0SD 1CDYA 1NFDF 2Z4QB 1A6UL 2VITB 4HPOH 2LTQB 4LASL 2WMPA 3GSRA 5EU4B 3DHJA 1G7IA 3TBVA 4KI5F 2PF6A 2WLYA 5FB8B 1QFUL 1HINH 2CKBH 4H0IA 2HFFB 3GB7B 2HRPL 5IB1B 4XTRD 4P2RD 4K7FA 2C1OA 2HJFA 5GRXG 2CR6A 3VXSB 5I74C 3W9DA 2BNUB 3FO9A 3K1DA 2K1MA 3PGCB 3QUZC 1P6FA 43C9B 2MSPA 4QO1A 2JLLA 1DSFL 5EUOA 4PGCB 1WTLA 1C08A 2A73B 5C08A 3AMKA 1AR2A 4Z77B 3RNQB 5IFHL 2CRMA 2A6DA 1UA6H 1W8NA 3P0VL 4G42B 1L7IH 5DEFB 3FCTA 3TBYA 2P7TA 4F7TA 1GSMA 4AK1A 5E8EA 1D6VL 3I85A 1X7QA 4O2CB 4PRHB 4HFWB 2PO6C 5D1XB 5J6GB 3ES6B 3TV3H 3Q6GH 3F7PC 4GH7B 4PJIE 5I2IA 2ID5A 4CDHA 3BAEL 4DGVL 5E99H 1X5ZA 3RJDA 1JZ6A 3RDTB 4LGSB 5B8CB 5TGBA 3TN0B 1OTUC 1XF3B 1YECH 1ZAGA 3UZVB 4LAJH 3NIFF 1PEWA 2DQIH 5JOPE 3PWVA 4QRQB 2EIZB 5SX5K 3DX7A 4S1DC 6CGTA 1G84A 1ZS8A 4ZUVB 5LKNA 3C8DA 4Y4HD 5KVDL 4MNQA 4ZPTB 4G8GE 1UKTA 4WIQA 2Z31D 4HKXB 1ITBB 4XPAH 2Y1VA 1G6RH 1LO5A 3OAUH 3SCMC 5FOBB 4MJ6A 1MCOL 4HMCA 2PR4L 3MJ9H 5FO8B 4KTDL 4PJ9B 4HWUA 1FE8L 1U3HD 5KTEH 4JM2F 2D2OA 5C1MB 1EUTA 1D9KC 3HA0A 1XGPB 3JSSA 5L7XL 2NY1B 4W68A 3L3HA 4F7CA 1ZK9A 2VOTA 3R4DA 2I5YL 5EPMA 2VLJE 2W9EH 1TJIH 4WU7A 1RJZB 2EE2A 1NBVL 2CJUH 3VA2C 4F57H 5BW7A 1KB9K 5TJWK 2YWYA 3GJFB 3TH3T 5JOPD 1HKFA 2B1AL 2Z92B 3KR3L 3MRMB 3MYJA 3RBSA 5MHSE 3SQOL 3WE6A 3VXUB 3IRZA 2EE9A 2VXUH 4NQDB 1GGCL 1MLBB 1CL7L 4G8GD 3BPCA 3HMWH 3SDXA 3NFNA 1FZMA 3OR7A 1CZ8L 4R3SB 3ZDYE 5D71H 3FFCA 5D8JL 2AQ2A 2NXZB 3F5WA 1IT9L 4PUBL 1N5AA 1EPFA 3WNKA 1HXMA 1IFHH 1X5KA 4OZFG 4I0PB 4R2GC 5I30L 5TDOB 1P7HL 5GHWH 1G7QA 3UYRL 3VW3H 2PXYD 1KT2B 2ZKHL 5B39G 4G3YH 1MCKA 2XKNA 5E8NB 1A9EB 3CDGA 3T0EB 5DMJB 2VLJD 1KXVC 4DKEL 5D2LF 2FECL 3BWAA 3DV4A 1T1YA 4ODVL 2R0WL 1MJ8L 2Q76B 1S7UA 1YNKH 4I77L 5ENWB 3HI5L 3FQXB 4HX1B 1FO0L 3LCYA 5DRZB 4GW5A 4MXWH 4X4XB 1CR9L 4X8JA 4XVUC 4GRWF 2A6IA 5MHSD 3LRSB 3O6FC 4MCYB 3N50A 3OGCA 1T83A 4K7PX 3HE6D 3FFDA 4KRLB 3WIHL 3DUUA 3BXNB 4O2EB 4PRIB 1CBVL 4LDOB 4PJDF 1U8NA 4K2UH 5I9QC 4Q9QL 2YN5A 2V7HA 5I8OL 5F1IB 1YQ2A 4NO2B 2I26N 2WBJB 4Y5YB 5HHVL 4MD0A 5C0JA 4JHWL 4LOUD 3HAEH 4JZNA 4XBPB 4GKNA 1G7HB 1KEMH 4AG4H 4J1UB 1NMBH 4LVEA 3DI2B 1MH5A 1C5CH 3MV7A 1MRFH 3LRGA 2YEZB 4QRSB 4EI6A 5CLWA 3PP4H 2H26B 3PABB 3KDMA 4BQ6A 4TRPL 1FGNH 3CH1A 4P2OA 3EZJB 3PDGA 2HFEA 3CVIH 4GSDL 5CZXC 1ETZA 3SBWA 3UYPA 3VXNB 3H9YA 3T3PE 1YEFH 4PLJC 5DA4A 5I1GL 3GMPA 5MEOA 3MLTB 3NA9H 4XNZB 5D6CA 4EEEA 5GGVL 1U8PB 1WAAA 3D3VA 5L9DL 1UCTA 2K3TA 2VR4A 3QEGH 4HV8B 1NGPH 3DSFL 1A8JH 3P9MB 1INEH 4OLUL 3C5ZD 1AXSB 1OVZA 1R3KB 4JR9H 2YR3A 3RGVC 4K3EH 3GSNH 5HJ3B 3PWPE 1MLCB 3E8UH 35C8L 3RY6C 1R3LA 4GKSB 5T5NF 5IR1A 4L1DA 3AS0A 3BIAX 4N0CD 4PB9L 1P9MC 3JVGC 3D39E 2VN4A 3AS1A 4PJXA 1T1WA 4Y2DC 2ZCLH 3ZKXC 4FABL 5F7EL 5HDOA 2BVUA 2UVFA 4I3RL 2J8HA 4TUKL 2COQA 3O8XB 2IPTL 2RGSA 3OKOB 5IVXF 1NC2B 3VFRB 5EO1A 3MLRH 4UB0L 1YC8A 2G60H 4LP4A 1AGBB 2XG4A 4NQSA 5C6TL 4WU5B 2R2HB 2MCPH 1C1EL 1HHJA 3X14A 4ODHH 4P5KA 2VUOA 4J12A 5CCKH 4NO0D 3IU3A 3KPQA 1FIGH 2OL3H 5MERB 3P4NA 3NABL 1FFOA 1HEZB 2QR0B 1QRND 3PWPD 1KLUB 4IJ3C 1F90L 3QIWC 2X4RA 3B9VA 1BF2A 3HE7D 2VDMH 3JUZA 5F89A 4GAYA 3DXAB 1QTYT 2GQHA 2JJWA 4RA0C 4HUMB 5FA3B 3TJEL 4NM4H 4X4ZA 1JTPA 1FNSL 5IEKB 3D2UB 4TPRL 3UPRA 3MRFB 3BD5A 1INDH 3SDCC 2CDGA 1F4WH 2NY2D 3IJHB 2EDHA 5J89A 2APXA 1GZPB 4OLYH 5GZOD 4HULB 4JHAL 4JQXC 3HI1A 1S9WA 3BEWA 4P2QA 4BK4A 3CSYA 3BI9X 1B2WH 5D2NA 1MELA 1PZ5B 1U41A 1YJDC 3QZWA 4OKVB 1F58H 3HC3L 4MQ7A 4U1JA 3MBXH 1M6OB 2NY3C 3MRJB 5C0BB 3NFPA 3EYQD 4K94L 4I9WE 4O2FA 3LPWA 2JK5B 4NKDB 1KCSH 4X6BA 3P77A 3GRWL 5KJRH 2Q8AH 1A6AA 3VXSE 1DQMH 2VXTH 3QHFL 4L4VA 4WO4D 3BKMH 2JJTC 2ZNWA 1HNGA 4QTHA 3VI4F 3TZVC 3RQ3A 1G7JA 1XGTA 4JG0H 4HDIB 4DKAA 1CS6A 3QQ3A 2R4SH 3WSQH 5I19H 1S7VB 2ICWA 2GFBB 4PLKC 2NTSP 1BHGA 4V2BA 4YO0A 5JLZA 1D5ZB 5BVJA 3RZCC 4PRHE 3SGKA 1T1ZB 2YBRA 1VFAB 3FT3A 1F3DH 1IEHA 3UTPE 4XH2A 3MLPA 1LP9A 3O4LB 1U8HA 3S35H 4LVNC 2G9HA 4JPWL 1AGEA 3QDJB 4AT6A 4OGXH 5D72L 4MA8H 1JYXA 3KYOA 4I9WD 3QXUA 2AGJH 3D9AH 5FUOH 3ALXA 1IILE 4DJMA 3C60C 5IJVB 5EZJB 4R90L 3VXSD 1DDHA 4XNMB 1WK0A 4X6DF 1EERB 3HPJB 3NGBC 3MREB 1DUZA 3L3JA 5DJ0B 4YHNB 3MJ7B 3DETD 1P7KA 1KNOB 2R1WB 5C0AA 5EU5B 4GAGL 4PB0H 1MIML 4PRHD 3GUTB 5EORL 5CUSL 4HIXH 5ITFB 3MLZL 3PGFL 3MOAL 3PF2A 5LBSH 1VB9A 5F9AC 2ZUXA 4UDTB 1DBKH 2VL5A 3OKEB 5HDBE 4Z5RA 3QULA 3TN0D 1CXFA 1IGYA 4BELD 4X5WA 4QF1A 3D85D 3JWOH 2DQJH 2J6EL 3GBNH 3QAZC 2WWMC 3CH8A 1HH9A 3B5TA 4PYGA 1WV7T 3WKNA 3KXFA 3BT2L 5ESAB 3VXUE 4CDGC 4NHUA 5KBNC 4NYLB 1FRGH 5EO9B 5ESVA 4AIXA 4Z0XA 4X99B 4MSWB 4YH6A 4MNHA 4NQDE 3PJSA 1A64A 4U2YA 3I9GL 1BOGA 1I8LA 5EU7E 3M45A 1OCWH 2FB4L 3HZYA 3OHXA 4QRUA 4LCWB 4I3SL 3N1QC 4N9GA 3LKOB 4PJ9D 3I3EA 4DN3H 1TVHB 3QIUB 2BVQA 2ZUQB 5GRWA 2NY1D 3I2CH 4QRPA 4DK3A 4HUVB 2EEBA 3EKCA 4MQTB 4P2YA 1Y6KR 3QUXB 2B20A 3HRPA 4KPHL 4K8RC 2HT4C 1PQZA 3T0EE 2BSSB 1B0WA 2J8UB 5J1AA 4YX2H 2VZTA 4PJGA 3SKMB 3EDJA 1VEPA 1KIQA 2DWEB 3OX8B 3IGAB 4IOIA 4BUHA 4PGJA 5KVGL 2ESVA 1BFOB 4QHNA 5E6IB 1VESA 4JFZL 3VXUD 4XX1G 4PGZA 4LSDA 5DEGA 4XAWL 5KVFH 1JGEA 1DVFA 2AXGB 4J3VA 4NQDD 1Z9SA 4P57B 5DJYA 2M8XA 4J7RA 4PRIE 5J6HA 2DYPB 5EC1B 4NRXB 3RVTD 3L95B 5FGCB 2VSCA 1ORSA 5JQ6L 1BQHG 3AXLB 5I1JL 3U83A 4XHJD 3D69B 5KS9A 3K4ZA 5C0FA 5BXFB 1P6AB 5DXWA 4GUPB 3U4BH 5SV4A 4WWKA 4I0PD 1U8MB 2I60H 5HHQB 3O4OC 4UQ2A 1HYSC 1FG2B 4RMSA 5CBEA 4UNVA 5IHZB 1OY3B 4D9RE 4EOWH 1GHFL 4JLRA 5HGGS 5IW6B 5IMMA 4P3DA 4FQXA 4OBRA 1QQDA 5ALBL 4B53A 2VL4A 4RWHA 3HZMB 5I75B 5AEAA 1ZA6A 5IB2A 2MNUA 1NCWH 1NAMA 3DOSA 2V2WB 3DSNA 3TWCH 3O45B 2I9LA 1SY6A 2VQ1B 2GTWA 5I18H 4MXQC 2DIJA 4PRID 1NL0L 25C8L 1NAKL 1TLKA 3CK0L 4W70A 1A1NB 1KJ2A 2WBJD 2N56A 2QL1A 4GKZA 1U8LA 3OPZL 1HH6A 4EI5A 4XVSH 1YZZA 2W0LA 5I1DB 2ZSWB 1J88A 9CGTA 3EYFB 3BZFB 2VKWA 1CFTB 1NH6A 1IEBB 3KPTA 4FQHB 2FJFB 4AYFA 2E27L 4XVJH 4UV7H 4PJIF 1MEXH 4OZFH 1WBXA 1X5HA 1BM3H 1D6EA 4GXUN 1QOKA 4WI6A 4JFFB 1P53A 4D9RD 4ONOA 1TTFA 5KZCB 1MNUH 3QISA 1QKZL 1RSFA 4I5BB 4OF3A 5I17B 3CVHH 3OG4B 2QEJA 3P2TA 4RFNB 1BFTA 1NMCC 4HCRL 1P1ZA 1LO4H 4U6YB 1WEJL 4YHPA 2M26A 4OM1L 4LCCA 1ZGLA 4OCYH 4FTVA 3ET9F 1BBDL 4LEOB 4DEPB 5B38A 2L7JA 4JJ5B 4ZOEA 3WLWC 3SKOA 4H5SA 4ZNEE 3HR5A 1I8MA 4UMGA 1MHCA 3EUUA 3AC0A 1LQSR 3DXAE 3MRRA 4FFZH 1GGBL 1IGMH 5A2KH 2C3VA 3GM0A 4J3SA 5EZOH 3WIIL 3UX9B 2B4CH 1MFCH 3EO1B 1GXEA 3G9AB 1T20B 3TYFB 2DQTH 5JTWA 3GI8L 1G0XA 2VDOH 4U1MB 4KK9D 3SDDC 3O8XD 5GRJL 4L8SB 3IDNB 3U48A 1NC2D 3MLSL 4NZRL 2BY2A 1UM5H 3T2NL 4BQBA 2A6KB 4HUKB 2F53B 2DLGA 3O2DH 4M03A 5C0BE 1WIUA 5C0CB 5I15L 2ZCHH 5CINL 5GZND 1E0OB 4RGOH 1J1XH 5L2JA 4M6NH 3UC0H 5KSUA 3CMOH 4ZO8A 4ZXBB 1LEKB 4HIIA 1SEQL 3MO1A 3BH8B 3KPMB 3OB0K 1I8KB 5BOPA 2NY0B 1HCFX 2YPKB 4JY6B 3RVUC 2HTLC 3DXAD 4LGRB 2Z8WC 3WD5H 5HXMA 3PQYA 1OD7A 2CR3A 1T1XB 2UZYB 2IALB 3LKPB 2F5BL 3D2UD 1I9EA 4OCWL 2ZUSA 2Y36L 1RU9L 2CLRB 2ZG1A 3WDJA 4ONHA 3QCVH 4JREB 1RZJC 5E95B 5T1KB 4EIGB 5B3JE 3KLAA 2RHEA 3OKDA 4OZIA 4KUZH 1RJLB 2VAJA 3O4LE 4KVNH 4H25A 4PRNB 3QDJE 3EYSL 4KDTA 1JF1B 1GGTA 1KJVB 3BN9C 2AV1A 4JQIH 4MB3A 2ICEB 3OJDB 3VXPA 4NQUA 3RWFB 5FHBH 3G6JA 4OB5H 4P46A 2IAMB 1UYWH 2Q20A 1YY9D 2MCG1 1JZ5A 3WHE0 1JHTA 5IESL 5DA0B 3IDYC 3C08H 4PJHA 5EZIL 4DFIA 1E4XI 1BLNA 5GGRB 3VWJA 1FNGA 1F11A 1JRHI 2D0HA 2H3NB 3X12B 4NCDA 2IG2H 3T4YB 3BDXA 4HKBA 5KSBF 4C56B 2ZCKH 1UWGH 1K8DB 2KQMA 3E6FA 1A7RL 5I1KL 1P4IH 4OGYL 1FN4A 4KJWD 3O4LD 3T3PF 1MFNA 2IPUG 2EDJA 3D0VA 3IJYA 3IKKA 2HN7B 1JGUH 3QDJD 1YDPA 1G7IB 1MCEA 3TBVB 4YEEA 4PPTA 4AENA 2XTJB 3RWDA 2E8YA 3FOMA 2AEQL 3FT2A 3ARFC 4OF5A 1SYVA 3B9DA 4WHDA 4NCC2 2C1OB 4NDMA 4NNPH 1L7TH 8FABA 4CU7A 4L29A 5TQ0H 3FO9B 4WI8A 3SDAB 5D1ZD 1C08B 4HWZA 5F3BB 1BZQK 2X4UA 1XF5A 5BV7C 1WZMA 5J13B 5J1SC 2A6DB 5DVNA 1WLHA 3GSVA 1CTOA 4LCWE 1YYML 5CILH 1U95B 5C2BL 3I50H 5GGUB 1RJCA 3G6DL 1GGUA 3LSOA 4YFDB 3PHOA 5ISZA 1FJ1A 5I2IB 3HPLA 1M1SA 4MWFA 4BM7A 2IGFL 3MFFA 1NEZG 2YUZA 1AFVL 3LS5L 3REVA 1A7QL 2ZG3A 3BUYB 2R23A 3SE4A 3LDBB 3TEUA 4LU5L 4HG4K 1UVQB 2J8UE 2AJUH 4JJHA 3TO4B 1U8IA 1Q1JL 1SBSH 3KYKH 5CKGA 1G7LA 3PWVB 1IGTA 1B9ZA 5HI5C 4O58L 3DX7B 4HKJA 3GMRA 4WI3A 3DRTA 4L8BA 4OCRH 4M6MH 4GMSH 4MNQB 4KH2A 1KJMA 1NCCH 1JCKA 2J3SA 3SY0A 4CJ1A 3NVQA 1MJJB 3I6GA 5FGCE 1I7TA 4DW2L 2D4DA 4MNGA 2QSCL 4L9LC 3UJJH 4LCWD 3VXOB 5I73B 2FRGP 4B0MM 1EHLH 2RFXA 1CIUA 4OUOA 2P8LA 4OLXH 1QVOB 4NQVA 2C1PB 3UAJC 1MFAL 3HHRB 1DTUA 3JTSA 3QUXD 4NKOB 4WNQA 4DQOH 4DZ8A 1Z9MA 4YHLL 1MAMH 1T03L 5FYJU 5EPMB 3LEVH 5IBTL 1ZLUH 1S7TB 1S8DA 1DE4B 3V7AE 3WFEH 4Q58C 1QD0A 3D25B 5HGAB 4TYUA 1CGXA 5EH1A 2BVTA 2J88H 1RMFH 3ZKMC 3FO2B 4GRLC 4ODTH 4HWEH 4LHUA 1RZGB 5GGVY 3ARYA 4URTB 3MMEA 1JL8A 4OUUA 5MP6H 1YEIH 5E6ID 4OD1L 1YEDA 3BVNB 1W72A 3U30B 1P7QB 2L4OA 1H3PH 3U1SH 1Q0XL 3SDXB 1SMOA 4WEMB 1FZMB 2DYPD 3LS4L 1AHWB 1YEKL 3VWKC 2Q3ZA 3CDYA 2NW2A 3FFCB 1OARH 3B83A 3F5WB 2PTUA 2YRLA 3O0RL 2R2EA 4AEEA 3FQTA 5TDNB 1D9KB 5E5RB 4FFVC 1FDLH 3EYOA 2X4NB 1PKOA 1G7QB 1R6VA 3WFHB 1PEZA 4CVXA 3WIFA 4X5LA 1LEIA 3DROA 4OF6A 3GEWB 2XKNB 1LK3L 1A4KA 1JWSA 4JFFE 1DANT 1JHLL 3DV4B 1T1YB 1DLFH 1T7ZA 1U6AL 5TH2B 1A7OL 4KJPD 4U49A 4CU6A 2YD9A 1LNUA 3QXAA 3DBXB 3BWUC 5DJXB 4HJGB 2XV6B 3QNYA 4A6YB 3P4OA 3RHWF 1HXYA 4OGAD 1AD9A 2VC2L 3IFNH 5LGHL 2E5EA 1M7DA 4M5YL 2XPGB 3I02A 4UINL 1U8NB 1FL3A 5HHPA 4JQVC 1E6OH 1RIHL 3QWRA 1CG9B 3V6OC 1WCBA 3BP5A 4GBXB 4JZNB 2G75B 4WTWA 2M2DA 3GJEA 1HDMB 4O02H 3T0WA 1MH5B 2ZOLB 3MV7B 1MFEH 4BFEA 3U4EA 1IM9B 3MSPA 4H8WL 1CLYH 3IS0X 2FATH 3V6BR 3U9UB 5I1CH 5T5NG 3B5HA 4G43A 5HPOA 4P2OB 2D9QB 4JFFD 4WJ5A 3UJIH 3S3SA 5HDBF 5KZCD 2GSIA 3C8KB 3WN5C 4XNXH 1A47A 5F7FA 2F53E 3O6FB 3D0LA 4JY4A 4ODXA 5C0CE 1HNFA 4UT6H 3ULVC 1CK0L 2CK2A 5DFWH 2Q7YA 4LRIA 1BVKB 4YNYA 4I8DA 4RFOH 5HHOA 4BQ9A 2ORBL 4OFYD 4X9HA 3RTQB 4C57C 3GMLA 4X98A 4XCCL 1AH1A 2H32B 4WTXA 1KPUB 5DD1L 4HHAA 4DK6A 2OJEA 3RWIB 3N1GC 3TT1L 4HS3A 3NACL 4JO2L 5CFHA 3CX5J 3HS0B 5DRWA 1H3TA 1KBGL 2EE3A 4QXTA 1X4ZA 3V5KA 5KVEH 5BVPH 4LF3B 3C6SA 2D03H 3CFBA 1CGSH 4PJCF 2F15A 1F8TH 1JP5A 4N5EC 5EFIB 5HGHB 2CO7B 3IU4L 3VGAC 5DQ9B 3M1BB 4I2XA 5EO1B 3KJ4B 4JZJC 5CP3H 4Y1AA 1RVFH 5C7XH 2HRLA 2OTWB 4NQSB 1II4E 3HNTL 2JJSA 3X14B 4P5KB 3MXWL 3T4AA 1IM3A 4HS8H 1S5HB 1IGFL 1KJ3L 5C0CD 3ILQD 2VQUA 3O3DA 4PREB 4K3HA 4M7LH 4U1IA 1TNMA 4ZXBD 3V7MA 5DD0L 5SWSB 2H2SD 2UY7A 5CZVL 4HD9A 4BZYA 3WBDA 5JIPA 2NY0D 1QLEH 3LEYH 1JUFB 3TBTA 4PJ8A 1HKLH 1N0XH 5IB5A 1VEMA 4G8FA 1HQRB 3UPRB 1OAXH 3DV6A 2AJYL 1EFXA 3OZ9H 1KCVH 3EGSB 2VB5A 4NUGH 4Y2DB 5MENA 5LVEA 2MFNA 1F4YH 1J0IA 3O3BA 3HI1B 1S9WB 4C56E 5EWIH 4TUJA 3TPUB 3DX6A 4OT1L 1T3FB 1IBGH 3V6FB 4QWWC 1UADC 4WW2A 1D5MA 1I9IH 4NIKB 4U1JB 1RZ8A 4MB4A 1SHMA 3NFPB 3Q6FA 3OKMB 4FHBD 2XTJE 3MJ6A 1AE6H 4CN4A 4CUCA 1FORH 4YDJB 1UGNA 2AKRA 3P77B 5DVMA 5EIVA 1UKQA 5GGSY 4XAKE 5HYQA 4JCLA 1X5XA 2X10A 2IAMD 2BNQB 1DLHA 4WTZG 3QYCA 4J6RH 4MQSB 4JEGB 5HYJB 1S78D 1AY1L 1INQB 1AGFB 3WKMH 1RIVH 2QQKL 4HUUA 1G7JB 4NZTL 2HVKB 4R4BA 3RNKB 4X0KA 4RRPG 4JFXA 1FBIL 4DTGH 4E41A 1RUPH 4CVUA 5T5FL 2Q87A 4C56D 3CXHJ 2OP4H 3P4LA 4JFYB 3U4AA 2RCSH 1Q9WA 2VLKB 4EXPX 1U93A 4FMFA 5K9KA 5DYOB 3ARSA 1I9JH 4MLIA 3BRFA 4HJ0C 4PJFB 5K9JH 1XGUB 2XTJD 5TDPB 1NCUA 4MZ2A 1NCAH 1G6RA 5DR5H 1Q9OA 2VO5A 3ARZA 4KK6D 4XAKD 5C71A 3DX8A 2YD1A 1DBMH 4AEHH 4ODWB 4RDQF 3MJ9A 4BH8B 1CL7I 4MNQE 3SDAD 1FFPA 3M17B 4CNIB 2EDKA 4ZO9A 1P7KB 5ACLA 4XBEL 3DO3A 3QUZA 5H37G 3LHPL 2DS4A 2UZIL 4OQTH 2QADC 3CFJA 4OTXL 3AS2A 1QG3A 3IJSB 3LH2L 1BVLB 3MRIB 5I76A 4XNQA 4TSAL 4K9EC 3DO7A 5DLML 4KQ4L 2BSED 1HHHA 1ED3A 4WV1A 5EOQH 1OP3H 4ZTPH 2PO6A 3C09C 1L9NA 4G6JH 4JM2C 3LIZH 3MRLB 4XPGH 4AZ8A 5IV2B 1IGYB 5E8PA 4X5WB 2EDXA 1N6UA 3TO4D 4RNRB 2FZ3B 5E1AB 1ADQA 4ZTOL 3C60B 5J56B 1BFVH 1DN2A 4DVBA 4FZ8L 2DL9A 1MHHA 4X80L 2PYFA 4Z0XB 4G7YH 4RFEA 2YN3A 3QDMD 3AM8C 3PJSB 3SDXE 4FG6D 4WCYH 1BOGB 5DQDH 2LV4A 1M05B 4LCYB 2AQ1A 5I1LB 3EFFA 3VGGA 3FFCE 4APQC 4P9HL 1YEJH 1YEHL 3HC0A 3SCMA 2XACC 4WY7L 4C59B 5IMKA 3WXVH 1X6LA 1RZKH 1K3ZA 4ELKA 2UZXB 3RAJH 5ICZB 5HYIA 1MCIA 4GG8A 2MOVA 5B3JF 1NANI 2FD6L 4YUEL 3V8CA 4YDKH 3V5HB 2ZZUT 1HK6A 3MRGB 4UT9H 4N5UA 1S7SB 3NTCL 4I4WA 4IOIB 2YKLH 4ZUWB 1WC7B 2P1YA 1AO7A 3KLHD 4QHNB 2JTDA 3ZT7A 3X3GH 2BC4A 1I1YB 1DVFB 1P7QD 1U91A 3HAEA 3EDEA 4F37F 3EOAA 3MR9B 1WBZB 3FMGH 3FQWA 5F88A 3VXTA 4JM4L 3TH4T 3VMPA 4CL7A 4TULH 5KS9B 4LLVA 2V17H 2XQYG 2Z8RA 3HRZA 3EJZC 1D9KD 2BCKA 3L3DA 1FH5L 3B6SB 2FCBA 3UEZA 1WF5A 4X83A 3MV7E 1CDGA 2MJWA 4JB9L 3G08A 5F7HA 1RK1B 3KAAA 4MGXA 4GO6B 2GJJA 1Q9KA 2E6JA 1UXWA 4UIKL 1C7SA 4U6XA 3QQ4B 1BQLL 2GCYB 2CIKA 5BRZB 5IMMB 4G9DA 1A1OB 1VKXA 4TTDC 4U1HA 5JW4Q 2VZSA 5E03A 2UVEA 3HC4H 3GSNA 1CGUA 3P9WB 2EC9T 1HHGA 3F12B 1MQ8A 4J8RA 4M43L 5HHMB 5L2KB 3W11C 1CD9B 1MVUA 3VRLE 2Y7QA 4G8IA 2I9LB 1D5XA 2DWDB 4QYOA 5K9QI 3MRNB 3ALPA 4POYA 1GAFH 3H3PH 1MIEL 5C07B 3ZKNC 3C9NA 5I1AA 3V79C 1TQCB 1U8LB 1TJHH 4GBXD 3ARDB 3FL7A 1HH6B 3V4PL 1GL4B 3FTGB 5F7LB 3TA3C 3VD7A 4X9IA 2W38A 1I7UB 1IM9D 4XWOC 5C6PB 1ZLVH 4TQEH 1H8SA 5K9QG 2W07A 4UV4H 2BVOA 2G5BB 3QQNA 1NC4A 4QT5A 5EC2A 3L3IB 4NQED 4QHKJ 5GISL 3QJFA 1WVZA 4G9FA 2RJMA 2OL3A 2J8UF 12E8L 1CFBA 4HAFA 3EFDL 2WINA 3O6FD 1P1ZB 3NZHH 4HUXA 4CN1A 4AJ0A 4M1GL 1JTTA 4IRJB 4LCCB 3L3OA 1QUNA 4TNWF 5HYFA 1DQTA 1E27A 4MLSA 3CCHB 3O9WC 2EZ0C 5B38B 2BVEA 5H2BA 1D3CA 1UWXH 1YNLL 3GI9L 4BQCA 3RTQD 4TNVK 4Z7UA 3KPSA 3HR5B 5FA4B 5SWSE 2ZPKL 3RGVA 1I8MB 4M4RA 5F6HJ 3RY6A 1YUHA 3MNZA 4WUUA 1HSBA 4M48L 5I1HH 4KK8D 4R4FH 2GHWB 2NY7L 2B2XL 3FN3A 1P9MA 5C3LD 4Z7VA 1VFOA 1MI5A 2VDLH 2MTPA 2GITA 3EHBD 3BJLA 1VACB 5EBMB 4F9LA 3U9PH 1Q72H 4F8QA 1A14L 1P84J 3DVGA 3WXWH 1MRCL 4NHCH 1JNNL 1HE7A 3QPXH 2X40A 3DPBA 4F9PC 3WO3B 1FVCA 1ZE3C 2XA8H 5CHNA 1UFUA 3V6ZA 2CDEB 5D7JB 5DI8A 4XI5C 3KNBB 5KSUB 3LD8C 1RZFH 5LAXA 4LLYB 3KYNA 1J0JA 1TVDA 3MRPA 1PX3A 3NFSH 1DL7H 1PBYA 3CLEL 2EXWC 2BNQE 3MO1B 2VDRH 3QQ9D 4RAVB 5SWSD 3SGJC 2MPAH 4F3FB 3PWLA 2DICA 5C0EA 3IFLH 5HYJE 3QIWA 3TGXA 1MCPH 5JMOC 3ULUC 5IK3A 1JGDA 3PXJA 4YHZH 3HG1A 3VI3E 4NOBA 4DN4H 4Y2DD 4JPIA 4KHXH 2NY5C 3SDCA 3HR6A 3KLAB 5FF6A 2DQGH 4OZIB 5IFAL 4KHTL 2VLKE 2YA0A 5TPWH 3GO1H 1EHNA 2V6HA 2IH3A 4IDLA 3VRIA 1FAKT 3QG7L 4PJFE 4UTAL 4NNYA 2FL5A 5EIIA 43CAB 4A6YL 4ZD3L 4O4YL 2GJ6B 3L9RA 2YK1L 5FO7B 3V4VH 4MJ4A 4FQQA 2P49B 2IQAA 2OSLB 4LIQE 3X11B 2BNQD 3NPSB 1PFCA 1JHTB 4FNLH 2D7MA 5CKAA 3BKYH 5CD3A 2YXFA 1KEGH 3IXAB 3T3ME 5HYJD 3MRDA 1BLNB 1I4FB 3VWJB 4NC1C 2FNBA 3BHBA 4OFIA 4R0LC 4JAMA 4LASH 1FVDB 2YZ8A 4M7JH 5HGDB 1NLDL 3TZVA 4LDEB 1FQ9C 3BO8B 2YD6A 4XMLH 1QFUH 4HKBB 1FFNA 4PS4L 5AD0B 4H0GA 2EYTA 2CGRL 3Q5OA 1NBYA 3LKSB 4JRXA 3RZCA 1I9RL 2VLKD 2IPKB 2XFXA 3B8YA 1B6DA 4YC2C 5IMOA 2F8VA 2HWZL 1JPGA 2NY3D 2R1YB 4ODSL 4Y0GA 3HMXH 4LQ1A 3P0VH 4U1KB 3OWEA 2VDPH 4P48A 2WV3A 1D6VH 4M4PA 4L29B 1H5BB 2NW3A 4KV5F 2DD8L 3H9HA 5JHDA 4BQ8A 4RWYL 3BAEH 5INCA 2HT3C 1T0NB 4RX4D 4BK5A 3BYYA 3HI6L 3FB7A 3U46A 2O93L 4MA1C 3IFPA 4OCXL 2NX5A 3S36L 3SOBL 3LSOB 1V7ML 1XR9A 3KPRA 3REWA 1AP2A 2EECA 3HPLB 5IMLB 1RD6A 1WFOA 3MODH 3MFFB 3MCG1 2HKFH 2CIIA 4M7ZB 2IEPA 1KCUH 2YXMA 4C83B 1S5IL 4WW1B 4QXUH 3ARGA 4GG6A 2ZUUA 3ARFB 3FN0H 2KPNA 5JIKA 1MCOH 3ZSTA 4D94A 3C60D 1UKSA 3Q1SL 3GMRB 1QR1A 5IVZB 1MCQA 1BF8A 1T7YA 1SMAA 5L7XH 3V8OA 1G7PB 4X9FA 4M7KL 5EIQA 2R1XA 1AI1L 4L9DA 4XTRC 5AZEH 4R7NB 3CD4A 3RRQA 5FAAA 1AQDA 5FECA 5KS9E 4D9QE 4XZUB 3MTRA 4PJ5A 3GSWA 5KANG 1NGQL 4XVTH 5H37H 4Y5XC 3EOBA 4AIZB 2J4WL 2OR8A 4CJ0A 4YPGA 2J5LB 3SQOH 2AAVA 4DZ8B 4Y5VC 4LLAA 4QTIH 2HJKA 3OV6A 1S8DB 3I6LE 5BRZE 2GT9A 1I1FB 4RMTA 1FHGA 2DQFA 1BZ7A 1T89C 3FQRB 4X7SH 2C5DC 1F5WA 1IT9H 2Y6SC 3T65B 5HHME 5L2KE 3OXRA 2E6QA 4Z95L 4OCLC 1W72B 3WS3B 3QXDB 5IIEA 1A6ZA 1HN1A 5F9JB 3B9EA 4Z18A 1UXSA 1ZT1A 3RPIB 1KTLB 2NW2B 1B0GA 1G1CA 5C07E 4Q9RL 3L5HA 3PP3H 2R2EB 4PJ7B 5ALCL 2FIKA 2R0WH 1MJ7L 2H9GA 4D9QD 4OZFA 3KHQA 3ZT6A 3MGTB 4Y4HC 4TOYH 1PVHA 4JPKL 1FO0H 4Q6YA 4Y19A 2Z31C 1UWEL 3QHTC 4XP5L 3ROOB 5D93B 3WIFB 1LEIB 4N0FB 3DROB 5B39A 4MMXC 4ZFGL 2UV3A 3CFDA 3BD4A 3T09A 1U3HC 1A3RH 3WIHH 3I6LD 1CXLA 5K9OB 5ADOH 1T0PB 5BRZD 4P4KA 5E94A 2I9TA 3TLRA 4Q9QH 4PY7A 1JE6A 3L1OH 5I8OH 3R06B 2R15A 1HWGB 1LNUB 2FWOA 4GQ9L 1RHHB 3QNYB 4UAOB 3GHEL 1HXYB 1AD9B 5HHMD 5L2KD 2D7OA 1ROWA 1M7DB 3T1WA 1TITA 3PV7A 3P11L 4UQ3A 4LIQL 1EA9C 4XBGB 4GQPH 3FB5A 4LMQE 3KPNB 4P3CH 1T6WA 1TVBB 1NDGB 2ADGB 3N85L 5C07D 3BP5B 3LKQA 5TE7L 1R0AL 5DURB 5ECJE 1NANH 4OLVH 4R8WL 5FYKE 5EOTB 3FO0L 3GIZL 3ARDD 4S2SA 3DVIA 5CEZE 4FXLA 3OXSA 2DLEA 3LKNA 3LMJL 4WRLA 5GGVH 3U4EB 3CX2A 1RUKL 4HH9A 5J12C 3SE8H 4P23B 1EIBA 5F1SA 5F7YC 2DI8A 4HBCL 32C2A 4JKMA 3PP3K 1JYNA 5DHYA 3V5DA 4EDWL 3D18B 1YN6A 2PXYC 2HA1A 3QI9C 5GGTL 3U7WH 2LVCA 3W39A 4IRJD 5DT1L 3ROLA 5ICXB 4ZUSB 5D9SA 1XMWA 5F7DB 1M7XA 4K94C 1QSFB 3SDXF 4FABH 2FGWL 2VLLA 4ZFFA 3MBEB 4OZGA 1CD1A 4I3RH 1G0DA 2GJZA 4HHAB 4TUKH 2WWKT 2DJUA 5FYKD 2X4OA 2BVYA 3HE6C 2WUBL 5CEZD 1ZA3B 2B5IB 3HLAA 4EN3A 4DGYL 2B7DT 4WUKL 2DBJA 1C1EH 5FGRA 3C6SB 2KKQA 1WUNT 2DMBA 3MXVL 2IWGA 4LOUC 2D31A 1CGWA 4HGKC 1N4XH 2BMKB 5LWYL 4HIHA 5JDSB 1YNTA 3TP4A 4OZIE 4NC0B 4NJAL 1F90H 3H9ZA 4U1LA 4KTYA 4CBPA 3C6LB 5FGBC 1BD2B 3T4AB 1WIOA 4MCZA 4XC1L 2VMFA 3O3DB 2Z91A 4TPRH 5D7JD 2GJ6E 2OR9L 4ZAKB 5DUPH 1PG7L 1AQKH 3MCKA 3VFOA 3T77A 3HZVB 1P2CB 4Y4KA 2XWJA 3C5ZC 3QDGB 3TBTB 5IB5B 1OPGL 4PV9A 3HC3H 2NNAA 2EE6A 5BJTA 4K94H 5TF0A 2V9RA 1A3LH 1G9ML 1N6VA 1T2XA 4YBLB 3VGAB 1NMAL 3ZKQD 1MQKL 3DX6B 4N0CC 3SDDD 5FUCE 1BPVA 3GRWH 2CKBB 5ACZA 4WW2B 4Y4FB 3EYUL 1OSZB 3OAYH 4S10A 4HC1L 1G9NH 1KIRB 1JN6A 5JW5B 2D7TH 2VIRB 4EIZC 4ISVB 5FK9B 1Z5LA 4E42B 1SVCP 1ZTXL 4Z0BH 3O2VL 5EOCJ 1Y0LA 2AKRB 2GJ6D 3VRLF 3ZLQC 1UCBH 4OZ4A 3EBAA 4MA3B 2L0DA 5FCUL 4NQXA 4NJ9L 3ME0A 3GMMB 4XC3H 1CGYA 4HUUB 2VXVH 1UB6B 3WO4B 3QB7C 4R4BB 3VWJD 2WM0A 1Q9LB 2DDQL 4JE4B 4JFXB 5E00A 4JPWH 1RK0B 1X4XA 4KKAD 4NUJB 1Z9OA 4U2ZA 1EXUA 1QO3B 3WNMA 3ZL4L 4D0BA 4RZCB 3HE7C 1JNHA 4I48A 3NH7H 5I71C 3S88L 2HFGL 2HYMA 2WNGA 4R90H 1NGYB 2GSGB 1QBAA 5K9KB 2NY2C 4UOW0 4ZUTA 2AK4B 5GZOC 4NZUL 1U8JB 1KOAA 1AD0A 1LILA 3ALWA 3VFUB 3A67L 5ID0A 4KGJA 2BSRB 5C0IA 3RVWD 1J8HA 1QHOA 1TXKA 1D5BA 5T1MA 4ZS7L 4M00A 3EYQC 1FFPB 2P48B 5CUSH 2CKNA 1GZQA 4X4YA 3MLZH 1BQUA 2Y72A 3MOAH 4O9HL 2OQJB 5FYKL 1TCRB 1AC0A 1J0KA 4XPFH 3PWJB 4KTEL 5CEZL 3DTXB 3H42L 1P4LB 1YMHB 1OSPL 5E1HB 4XNQB 3BMVA 4JRYA 3BPNC 2Y4SA 2A83B 2LAAA 4WV1B 2AJVL 3BT2H 4AH2A 1UG9A 1ZOXA 5J8OA 1DFBL 1LDPL 4Z76B 3U36A 3ARQA 5DWUL 3L7EB 3NAAL 4HXAL 1QNZL 2BX5A 4DCQA 3PL6B 3G5XB 3ARFD 4I3SH 1X9QA 2FYYA 2LTQC 3LV3A 1LHZA 2PYFB 1HSAB 4RFEB 2XWTA 3UBXB 5ABDE 5HYSA 4P0DA 1A2YA 2BNRB 4GT7A 4KPHH 2KH2B 2DB8A 3VXMB 1CICA 4NP4L 4NN7B 1BGXH 4PLNC 2ZJSL 4PJ7E 4RIRA 3VI3F 2ITDA 5T1LA 1EHXA 4L9LA 3MV9A 1CDUA 5DJZB 5IMKB 2Q1EA 2B0SL 3TO2A 1ITCA 3DETC 4BZ1H 4JFDA 1LMKA 1G9EA 2E6PA 3C09B 2QSTA 4MA7L 4JFZH 5JPMA 2OCFD 2VAAA 3GBML 4NWTL 5GS1A 5ICYA 5DC9B 1TETL 3Q0HA 2C3WA 2C4FT 2AEWA 5D1XC 2F58H 5CD5D 4U6HA 4PJFF 4I4WB 1QSEA 3BP4A 5JQ6H 3CLFL 3FQUB 1QLFA 5HI5D 3QIBA 1GOFA 3C87A 1VADA 3RDTC 5B8CC 1A6PA 5B22A 3KLDA 4XB7A 5CEXA 1YY8A 3TN0C 3HAEB 4PY8J 5IEHA 2D0GA 2XZCL 3HNVH 4L4JA 1B4JL 5F88B 1BQHA 3T3MF 2WWKO 4NRZB 4PR5B 2B8OT 3MJ8A 2Z93B 1GHFH 1S7WA 4Q2ZA 1MAKA 3HB3D 3VWKA 3HRZB 4YDLB 3HUJB 5F7MC 4Y8DC 3SJVD 5FM5M 1SYSB 2FEDD 1ZVHA 5I1EL 2BRQA 2O5XL 1YPZB 5H35A 3JV4A 5AWNL 4MX7A 4OV5B 1BP3B 3PIQB 4PJ9C 1P69B 2CIKB 4G9DB 3UJTH 1VKXB 4U1HB 1NL0H 4LBEB 3UTSB 3L6FB 5D7SL 4HQQL 2LFGA 2NY1C 4GRLD 5J11B 1N0LA 3T2QA 3ZZ1A 2V5RA 2DTML 3OPZH 4ODUB 1A6VL 3DRQB 3I6KB 4WGWB 5GRVL 4C58B 4LRNH 5KOVC 4R6UA 2E27H 2VUYA 1QSFE 1UJ3B 2A1WH 3C9NB 4PTTB 5I1AB 3PDOA 4JQVA 5DURD 1GCFA 2HT2C 1GPOL 3MQIA 4QHMA 2CO6B 1QKZH 1J87A 4JN1H 5C8JA 5EU7C 3RVTC 3M07A 1WZ1H 5CP3A 4HCRH 2NXZC 4OM1H 4P23D 1B90A 1FNFA 3MJGX 1GC1H 3IDIA 5TF1L 5LJYH 1BBDH 2DIBA 1ZHKB 4I0PC 1S7XA 2UUDK 1FNEB 1AGCB 2ITCB 4G9FB 3RZWA 3TJHC 5DJAA 3LN4A 3IDGA 4DUVA 2WINB 1BD2E 3H0TA 1IEAA 5IHUH 1T7VA 4KRPB 3T0EC 5A2FA 3STLA 1R3JA 5E8DL 1RULH 1HQ4A 5CSZB 5H2BB 1PSKH 4DOHB 3H9SB 4KUCD 2EDTA 4Z7UB 4LHUG 1QSFD 2X1XR 2AJSL 1E6JL 3MBED 1YUHB 1OD9A 5J3HD 4WFED 3F7YB 3QXTA 5E9DB 4OD2A 4Q6IA 3SDYL 2VABA 3UTTB 3QDGE 5E8OB 4LSRL 4YEFA 2KDGA 2A74B 4FQ2H 3F58L 1MI5B 4YHYB 2FHBA 2WBJC 2HMIC 3MNVB 4Y5YC 5AZ2L 3N9GL 1DBJL 4QRRA 5IWLC 1JV5A 3CZFA 3DNKA 4XP4H 4MDJA 3KPPA 4H88L 2Y25A 5AAWA 1OOAA 2D7NA 4NKQB 4OBSA 4BYHA 2XZQH 3C6LD 1BD2D 1ZANH 3CFIC 4LLUB 4OZHF 1NSNH 5CHNB 3VD4A 1F02I 4NN5B 2IH1B 5E70A 1OAYH 3KYNB 4RMWA 1W72L 4OCWH 2P5WB 1KIPB 2Y36H 4ZAKD 1RU9H 5FHAL 2DI7A 4XMKH 5CAYB 4LSUH 3PWUB 1IC4L 3PWLB 3BGMA 2GEEA 4RAUB 4ONGH 5I8EB 4CKVX 4KJYB 2F19H 3QDGD 1CD0A 2R56H 2YA1A 3FB8B 4WI9A 1OF2A 2PW1B 1FYTB 5IKCA 4ETQB 3EYSH 1J1OL 2APVA 4LNRA 3THML 5C0RH 1WJ3A 4S0TD 3MC0A 4N5ED 3BZDA 2JB5H 5FF6B 4FRWA 4UTBH 2VLRA 4JDVA 4Y4FD 4Q7DA 3CPLA 5JOFB 1BX2B 5MEQA 2AK4E 2PYEA 4UT7L 3BQUB 4NNYB 5KOMC 2A9ML 3KPLA 5CSGA 4NRYB 4KK9C 3O8XC 4WHCA 2AEIT 2FGZA 2X1OA 2JELL 1MCNA 3GJFK 3DECA 1NFDA 1R5VB 2IQAB 2E9BA 1LO3L 15C8L 5CD3B 3DYMA 1VGKA 2IFFL 5GZNC 1A21A 1UT9A 5I1KH 4N68A 4J4PC 5KAQF 4FQIL 5IQ9B 3RPKA 3X13B 1QEWA 4OCSH 2X70B 4POZD 4U3HA 4B50A 3MA9H 4CMMB 4NT6A 1SY6H 4JFEB 5DJ2B 3WNNA 3BMWA 4QOKA 4R9HA 1PLGL 3JTTA 4S1SH 2VDNL 1JIBA 4JHBA 3QG6B 3W9EB 5E7BA 2XFXB 1KJ2H 5IMOB 4HGWB 1CYGA 1JPGB 1TZGL 1XGRA 2R0LH 3C2AL 5BO1H 3MYZA 1F4AA 2AK4D 1QBMH 5CJOL 1OT1A 3UO1L 4JDTL 3N1MC 3I75B 1IAKA 3ZYOA 4L4TD 5EU6A 3RWCA 3EO9L 4AL8H 1IKNA 3MUZ1 1U8KB 4M8QA 1I75A 2VJXA 2FBJL 5EN2B 1U8QA 2O26U 3VJ6B 1C12B 1J5OH 2BNRE 3O6ML 5LG1A 3FB7B 2WK2A 3QFJA 1AFVH 3LS5H 3VG0L 2VISB 3VXME 4I3GA 3U46B 4QKXB 5LCVL 3IFPB 4LU5H 3L3GB 4NKMA 1XR9B 3VFNA 3RX8A 2XG5A 4GRMB 3H3KA 4Q0XL 2EXYD 3S3PA 4U7KA 4O58H 1N7MH 2XZZA 3WNOA 4YC2B 4MJ2A 2KBGA 4F15C 4NQCB 4KXZI 1NKOA 3MLYH 5ANMA 4JM2A 2CUIA 2EDLA 5E2VL 4M1DL 2Y07L 3G04A 4ZDHA 4HJJH 3PL6D 2YC1B 4DW2H 2XNAA 3G5ZA 2QQLH 2C7UB 1JTOA 4KJWC 3MOBL 4NPYB 2WBWB 5AUMB 5HDQL 4QXGL 5J1TC 2FHFA 3G5VA 1EAPA 1VPOH 1EH9A 4J3TA 2BNRD 3STBA 1T7XA 3AM8A 3ILPB 4YHLH 1T03H 4PG9A 3MV8A 5IBTH 3DVNA 4XP9L 3VXMD 5FECB 1JK8A 1IC5L 2N7BA 3GSWB 4Y16A 3V95A 4APQA 3HUJE 2X4SA 2C9AA 1T4KB 2BZDA 4JDZA 1FPTH 1XIWB 1YPZE 2LVEA 2HJKB 1HINL 5H94A 2CKBL 3TVMA 3MZTA 3QNXB 4BZ2H 3V9FA 3QEUB 5GQBA 4XNYL 1LEGB 3UTSE 3LS4H 3L5WA 1YEKH 3BIKB 1IAII 3PDDA 2DQFB 4OI9A 4RQQA 1BZ7B 1N59B 3O0RH 2X5PA 1UEMA 2YUVA 1EEQA 4LKXA 1PKQA 3JBG7 5D2LA 5IJKC 1A6ZB 1UA6L 1L7IL 1OQOA 3W5NA 1NUFA 5C70A 3CZJA 1H15B 4HF5L 3RWEB 3GMOB 1MWAB 1U6AH 5ILTH 4OZFB 4KY1H 3SO5A 5F6IC 5F44A 1DUYA 3ARBA 3KS0J 1P4BH 4FQLH 4PJDA 2CUHA 4IS6B 2F54A 5B39B 3RKPA 1YECL 5C86A 3GSUA 1NDMB 1IC7L 1NGWA 5IB4A 5LGHH 3CVHB 3L5XL 5D6DC 2DQIL 3QIUC 2ZUQC 3AU1B 3UTSD 4G9FE 2EICA 4F7PA 1C5BL 3T0BA 3QUXC 3VD3A 4CMHB 1JWUB 1GGYA 4GXVH 2MHAA 5F1NA 3ABZA 4WHTA 2P45B 3CX5K 3TC9A 1WBYB 4ZFZA 5SWZA 1AIFA 1GIGH 4LEXL 4DOHE 2YD5A 3H9SE 1NCBH 4H8WH 7FABL 4Z7UE 2XIDA 3VDBA 1WCQA 3LKQB 1IGJA 3E6HA 4MD4A 3VGBA 2H41A 4XGZB 4M93B 5E6IC 1N64L 5A1AA 1A02N 3EJZD 2FO4B 5E9DE 1YN7A 3O11A 3UTTE 5KG9A 1FFRA 1MAJA 4E0RA 5L0QB 2R9HD 2W9EL 3TA3A 3RUGB 1XR8A 3CUPA 3V4UH 4ESKA 2CJUL 2EDEA 5TE4H 2UYLB 1MI5E 3WUWG 4V1DA 4C4KT 2Q6WB 3X3FL 1CK0H 1U3YA 4YQXH 3VXRA 3VGHA 2W0KA 4HZLA 5T33L 2BHYA 3LZFH 4YIQB 1NQBA 1U9KA 2CXGA 2XT1B 4OM0L 1J18A 4PRPA 4XCCH 3V5DB 2JCCB 5FYLH 4LPXA 1YN6B 1ONQB 3IF1B 2NPLX 3IDXH 4TUOA 3H7BA 3EO0A 2X9XA 3HMWL 4R97B 3W11D 3W39B 3QEQA 2DQUL 1BZ9A 4KRPD 4MD5A 5E08H 1MCWW 4KJPC 3K8KA 5IVXA 3ISWA 4JG1H 5GSVB 5D9SB 2RB8A 2AV7B 2P5WE 1E28A 3H9SD 1WT5C 2H45A 5I75C 3O9WA 3E2HB 2CQVA 1IFHL 4OZGB 2D7PA 1CD1B 4ZFFB 2HLAB 2BXZA 5ID1A 4OGAC 5GHWL 3B9KA 1MCLA 2HTKC 4OF0A 5T1DL 1A6WH 4PP1D 4U7MA 5E9DD 3VW3L 1HHIB 3FAXA 4PJ7F 3S5LB 3UTTD 4EN3B 4G3YL 5DK0A <