3TFKC

42f3-p4b10/h2-ld
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
201
structure length
201
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC01
4LP4A 4KUZH 4NP4L 4XNZB 1N0XL 3MGAA 4WFEE 3WIFB 4NCDA 4JRXE 3GSQB 1BJMA 4BSJA 4HIHA 1N4XH 2AK1H 2IAMA 1NBZB 1FL5B 1Q72H 3QAZC 2VLRB 3OGCA 4DGIL 4H8WH 4P48A 4X80H 1WZ1H 4PBVC 3GSRA 2CXKA 5T1DL 3RWHA 1DEDA 3DPBA 4PJ8D 3AM8A 4XPTL 2NY6C 1AO7E 4HIIB 4WUUD 3HUJB 4G80B 1RVFL 4PJ9B 3MA7B 1QR1B 2GY7B 2D7TH 2H45A 5IVXE 3UDWA 3IDYC 1OM3H 1SYVB 3UPAA 4OZGF 2OS7A 4Z7OF 4JGUA 4MJIA 4DFIA 1QLFB 4U31A 1N4XL 5FF6A 5KOMC 5ANME 5JOPD 2FR4B 2YXMA 2C4FU 4K7PH 1L7IH 1HILA 4WO4D 5JIIA 3BRDA 3MMEB 3R06A 4WI8A 1FYTB 4WCYL 4H8WL 4X80L 1D5MB 1WZ1L 5DRXA 4G43A 1LO2L 4PGCB 3RA7L 2GK0B 2X4QA 2V2WB 2WUCH 3JWNC 1QSFE 4EI5A 3D48R 3GI9H 5DXWA 3P3YA 2ADGA 5C0JA 3AY4A 4RFNC 3ZHDA 5SWZB 4Y19B 1YC7A 3ZLQC 4LNRB 2ZCHH 3CSBA 3DARA 1KIPB 4LPCA 2RBLA 4WV1A 3TF7C 2GQHA 5AZ2L 1ZMYA 1OLZA 15C8L 1L7IL 4M8VA 4PJHB 1ULVA 1N6VA 4ZAKC 4U6XB 2G5RA 5EBGA 1BX2B 1L0QA 5CJOH 2Y06H 1RJZB 2DQHH 4Q6IA 1CICB 1MJUH 2WUBH 5DRNA 1AC6A 4HEME 4KJPD 2ZCHL 25C8H 1G7MA 1MHPL 3DV4A 4IRJA 5KS9B 5I8EB 3S4SG 2KL6A 4JFQB 2VDNL 1RULL 4P2OC 5E56A 1OTSD 2X9WA 4PY7B 1VFMA 2XYCA 2ZOKA 3V95A 2EC9T 3KYOA 5I8OH 1O7SA 1YY8B 5F72S 4ZO6A 5IB1A 5HGHA 1EHLH 3GBLA 4S2SB 5CGYD 4N0YL 1J88A 3DI2B 1X5JA 1IAIH 5I1CH 3KPSE 4D8PA 1R3JA 2Y5TB 4M9PA 5CJOL 3HI6H 4OUUB 2V7NA 1G1CA 1GZQA 1A7QH 1X5HA 4HKBB 1TTGA 3ARGB 1OSZB 2WUBL 1JNHA 5GS0D 1X6LA 3LEXB 1V7NL 5F1OB 3GB7A 4HAFA 3TYFB 2Y1VA 3TCLA 5F9WB 3KLHC 3E6FB 4L8SC 4C83B 5T1KA 4QRQA 3D9AH 2IFGA 4NNPL 2JELL 5CINH 4ZPVB 1MUJB 2AEPH 2GCYA 1JWSB 2BSTA 5TPWH 1B6DA 2FLBT 2BHUA 2UUDH 3O3UN 1IGFH 4LBEB 5INCA 4JVWA 5GGRY 5DC4B 5DQJB 1NSNH 2R56H 3C6SB 4O00A 3SGDI 4EJ1C 2FJHB 5I74C 3S4SA 3GSXB 3BXNA 3VFTB 2A73A 5C0EB 5CINL 2VDKL 3STZB 2BCKB 2IALA 3P40A 2O5YH 4P5TA 4QXUL 1ZLUH 4GO6B 1OAYL 4WEUD 5HHMD 4A6YA 5F7EL 1EEYB 3OB8A 5TPWL 1A21A 3MV9A 3E8UH 3JUZA 4Q9CA 2HLAB 3GUTA 2VLLA 2ITCA 1FL3B 4ISVB 2QQKH 5GHWH 3WEXA 3MRJA 3ILQD 1K8DB 3NFSL 4QTHA 4JPVH 5C07D 1BECA 4U1IA 2R56L 3VMNA 1RUPH 5GGSB 1G9MC 3RVTD 3IXTB 4I0PD 4NNYB 3AM8C 2O5ZH 1MFBH 2WANA 1GC1H 1FDLH 4LSPH 4XVJL 5DR5H 4QOKA 4M5YH 3PGFL 3QQ4A 3SDXA 1FZOA 2O5YL 5CEYB 4RNRA 2RFXB 1AE6H 3UPCA 4J6RH 3E8UL 1UENA 5ALBL 1U3ZA 4L8BA 1FSKC 4M6OH 3ZKND 3CLEH 5C0IB 3H9SD 4PJDA 1V3JA 5IK3A 4KAQL 5IQ7L 1T89A 2DD8L 1I3RB 1KPUA 2EE2A 1G7IB 1X5YA 3QIBC 1MFBL 1S8DB 5DQ9A 3QWQB 1QPXA 1ZSDA 5DR5L 5F1KC 4M5YL 1H15A 4MD4A 2NNAB 1CTNA 3AY4C 4ZFFB 5KOVC 3BDYH 3DX9B 4IRSB 4JFFB 1SEQL 3RRQA 3T77A 4LLAA 3KHOA 3UTOA 3FMGH 3T4YB 2BVPA 5J11B 1NGQL 4JQXA 4WV1C 3L3KB 2FCBA 1DZBA 4M6OL 1NCCL 4Y4KB 5D96B 4TOYL 4NRXB 4PTTA 3U30C 5HPOA 4XWGH 4CVXA 3PXHA 3K1KC 1JHKH 5L6YL 1J10A 3H3PL 1UKQA 2VLJE 2DI8A 2J4WL 3GSOB 5D7LD 1OSPH 5D7JD 1J18A 4KMQA 1FNLA 3IDGB 4L3ED 4LCWD 4JRXB 5E99H 5FB8A 2QSQA 1E6JH 3BDYL 1KTRL 3HG1D 1II4E 1JPTL 5F3BB 1LO3H 3E6HB 1CGYA 5T1LD 1G0YR 1PQZA 4Y0GA 1UZ6E 3D18B 1BBJB 3ZTJH 1Q9LA 4Q97A 3H9SB 4WGWB 4XWGL 3SBWA 5JNYB 2XRAL 3NFPB 1AO7B 1OL0A 1CFSA 1J0YA 3O2VH 3DRQB 3X17A 5A16A 4ZUSA 2C1PA 4QT5A 4Z7UA 5IVXB 3BKYL 3PP4L 3GMLB 5JDSB 1EHAA 1NJ9A 4P5KB 3G6DH 4LL9A 1JPSL 5E99L 1SVCP 1G9MH 1U8OB 5ANMB 4PR5A 3TYGH 1ZHKA 5IQ9B 3Q3GB 2P5ED 4RAVA 5TE4H 1XF1A 4OLUH 4HG4K 1U93B 3MV9E 4XCEB 4R0LC 5IJVB 3OR6A 4OUOA 4HAGA 3SPVB 1U8KA 4MAYB 5E5RB 2IMNA 5IMMB 3O2VL 1I75A 1QSFB 2AJVH 3SO5A 3EDEA 3C60B 2DM4A 5HD8C 2FL5A 5DGRA 1W8OA 5FHAH 1J0HA 1K5NB 5ESQA 3H42H 1CE6A 4JVUA 1KELH 1SYSA 4QOKE 2D31B 3BH9A 1YDPA 3SDXE 3AC0A 3TYGL 2NY0D 5IFJB 5TE6L 3QFJA 2FD6H 1EVUA 4NJAL 3PDGA 5EFIA 1J12A 2G60H 3N1QC 5KSAC 3QUMA 2EKSB 3O0RL 5GS1A 3VJ6B 4XPGH 3IETA 2R2BB 4W6XB 5KVFH 3BUTA 3MNVB 4P5TC 5DJZA 3PWPA 3S37H 4B7IA 1A1OB 4PJCE 4Z8FL 1RZ7H 3KPLB 1FORH 3FQWA 2WWMD 2XA3A 5DFVC 3ARSA 1I1YB 4BSWA 5EOCH 4PLJC 4XBGB 2FD6L 4M48L 4FTVD 5DJAA 1YJDL 5FO9B 3KPSB 3O3BB 1U8IA 4PJFA 1ZK9A 2YUZA 3Q1SH 3T2NH 1FV1B 1T0NA 2FYYB 3D0LB 1EERB 5CHNA 3C5ZA 4YDIH 3CCHA 4LAJH 2ENYA 5BW7A 3HKFA 1CGTA 1A7NL 4KKBC 1F4XH 3H7LA 3L3GA 5CUSH 1H3UA 4Q58C 1LILA 4YAQB 4EIGB 3ABZA 3FQUA 5E2JA 2B39A 5C08D 2NY5C 2IAMB 2E7CA 4DAGH 1KIQA 5DK3A 2EDRA 1T89C 1J05B 3OAZK 5SWSB 5IGXL 4HMDA 2F53D 3TBSA 2PTUA 5HYQB 1T1WB 1DLFL 2VISA 5DEGB 1J0IA 3GSRB 5DVMA 3RU8L 1DBMH 3SKNA 4FA8A 3T2NL 1VDGA 1SJHB 3RWJB 3PGCB 1FAKT 4YDKH 1Z6JT 1F3RB 4KDTC 4Z7UE 4Z7VF 4G6JH 4HUMB 4H0IA 2XKNA 3MJ7A 5CUSL 3DIFA 3CH8A 4JQXC 2NZIA 2P8MB 5E2UH 4LVHB 4PYGA 4Z7WE 3ZDXE 5DMYA 2EICA 5FF6B 3FONA 3LHPH 5FKAB 3HMXA 1BIHA 3I02A 2X7LB 4I0CC 4O51B 4IM8A 3CU7A 3R06B 5D72L 3D2UA 4MDJB 3IDNA 4OGAD 4QRPE 2EDLA 4G43B 1OTUC 3KXFD 5ICXA 2WBKA 1JZ6A 1SY6A 2X4QB 3NAAH 4IJ3C 4EI5B 1I9JH 5D93C 1DQQB 3D69A 3VXUE 5C0JB 3B6SA 1OGAE 3ILPA 2DKUA 3VCLB 2DI7A 1GGIH 2IBZY 1H3XA 1L7TL 1AGFB 4ZFOA 4A6YH 4HJGB 2CIKA 1NLBH 1RV6X 2CQVA 1FRGH 3VGHA 3QFJE 2PN5A 2WINA 3FT2B 1WBZB 1EEQA 1BJ8A 3V6OA 3O3EB 1PX4A 3O4LD 4F58H 4BZYA 1WAAA 3BP7A 5FDWB 3UCRA 4Q6IB 3PWPE 3NABH 5KTEH 3WL9B 1FO0L 5F7LB 1EHXA 2EDKA 1GGIL 4MJ4A 2KQNA 1G7MB 3DV4B 4IRJB 2YSSA 3WO4C 4FN0A 5IR1B 1F3DJ 4P2QA 3MRQA 3KPTA 1ETZA 5SX4H 5F6IB 1NFDA 4L4VD 1MREH 1FRGL 3O9WA 4JZJC 1FQ9C 3KYOB 5IB1B 3OKNA 3BT2L 4HIXL 5HGHB 2NY5H 4HWUA 3O2DA 4GSDL 4ZS6D 4BZ1H 1LNUA 2D0HA 2V9RA 4R4BA 4WEBH 4D8PB 4PJFE 4EBQH 5FO8A 4L29A 2ZUQB 1QLRA 3U7WH 1A7BA 4R6UA 4H20H 4U1GB 4KK5C 1C16A 2WQRA 2VLJB 1D6VH 2R8SH 3V5DA 1JTOA 3ZKMD 4ODVL 1A4KA 3SOBH 4K3HA 4XNXL 3I6KA 3QP3A 3SO3C 4S0SD 1R5VA 3AS1A 3T2QA 1MOEA 2DJ4A 1KG0B 2BSTB 3PIQB 4NT6B 3EO9L 2D0FA 35C8H 3NCYP 4POUB 3RAJL 1DQDH 3HR5A 5LCVH 3VFUA 1Z9LA 3NTCH 4Q9BA 1GH7A 1YEDA 4GQ9H 3UTSD 4O2EA 5FDYA 1XF3B 3QFDA 5INCB 5EU6A 3OB0H 3VFWA 1IMHC 3S4SB 3TO4C 3ZHLA 2O5XL 4D0BA 2R8SL 3BXNB 1V3LA 2A73B 1FO0B 3C5ZC 1FVDB 3ESVF 5BW7C 6FABL 4OZIF 1HKFA 4L9LA 2WMPA 5I6XB 1SBSL 2DQJH 3MV9B 4O2FA 1QRKA 4P4RB 1KULA 1WICA 2B0SL 5D6DC 1DQDL 2VUOA 1X5GA 2ITCB 3KYKH 1DDHB 5JUEH 3TNMA 1LO5A 4JY4B 2R0LH 3IGAB 1QNZL 1UB6A 4YWGH 4X6EA 3SE3A 4I4WA 5JXAL 1VA9A 1NAKL 1OP5H 1F13A 3D85D 3JTSA 4R96A 2DBLL 4MNGE 3QG7H 3S5LB 5E6IA 5HVHB 2IANA 4XP9H 4K9EC 3SDXB 1U91B 3WMSA 1MLBA 3M8OL 4RISH 1PGRB 3CDGA 5GRUH 4X7TA 3AB0B 1NFKA 1WAAE 1T83C 4YR6A 5JUEL 1AIFB 4YHLH 4HD9A 3RTQD 3PQYD 1A6TB 3HC3H 2IPUK 1RUMH 3MRPB 4U1JA 4E9LA 3RZCD 4YO0A 3MLZH 1KPUB 4R2GB 5T5FH 2CO6B 4LSUH 4WHTB 4PJCB 3S7GA 1ZSDB 1H15B 2VZ1A 4XP9L 2KUTA 3QUMH 5EORH 4OGXL 5C0CE 3OX8A 4EVNA 4H1LB 3IKCB 3R8BB 5GRJL 5K33A 3T77B 4RISL 1UADC 3CXDH 1MF2L 3OJ2C 1IGYA 5GRUL 2BVPB 1OOAA 4DTGH 4GFTB 3O3AA 3TLRA 4PTTB 4NC0B 3S35H 3I84A 4JG0H 4QXGH 3HC3L 1FE8L 1RUML 3RPIA 1UVQA 3V6OC 4CBPA 1OD9A 5T5FL 4LSUL 1TJIH 1JYWA 1E0OB 1GOGA 3MBXH 4XXDA 1A1NB 4ZFZA 1OB1A 3SDCA 4IBLT 4JHWH 3G9VA 1Z0MA 1RIVH 4LCCA 1AI1L 1NC2D 3B2UC 2VDQL 3IDUA 5EU7E 2PUQT 3OZ9H 1DBBL 3ORJA 1YEKH 3M1BA 4KVCL 4FQ2L 4QXGL 3O9WC 1U95B 3I2CH 2AI0H 4QXWA 4DKEL 1CFSB 1MAML 5A16B 2BNUB 1I8KB 4ZUSB 1M4KA 2C1PB 2WQ8A 4NQDA 5EU6E 3DRTA 4Z7UB 3UXFA 4NWTL 5DD3H 1I85A 5FV1L 3ARDD 5ABDE 5DK2B 4MNQB 3C9NB 3RIAF 4PRAA 4TN9A 1EA9C 5FYJL 3I75A 1NEZA 3UEZA 4OLWH 5DVOA 4Z7WB 4YQXH 1RIVL 1PBYA 2AV7A 3GHEH 1R3HB 3LH2L 1ZHKB 2K9UA 4V1DA 1Q0XL 4RAVB 4K9EH 5J1SC 3JV4A 4F8QA 4QRPB 3OZ9L 3QUXD 4NQSB 5HTSA 5HDOA 4XVSL 1YEKL 1U8KB 4OFPA 2NYYC 1MY5A 3D39A 1BQUA 3QRGH 3SGJA 5GRVK 5ETUA 3HMXH 4LLMB 1WISA 3VXUB 1UJ3C 1OGAB 3DXAD 5HHQA 3DI3B 1TVBB 1ZWIA 3SDDA 1SYSB 3BH9B 2IANE 3U36A 3O81A 3UC0L 3O8XA 1SY6H 1YDPB 5CAYB 5I17A 5MEND 2NY1C 3QISA 3CPLA 3CK0H 2EH7H 3QFJB 4OJFH 1NCWH 3CUPB 4UT9H 5EFIB 5T3ZE 3QIUD 4YHPA 1T1ZA 4XVTH 4KV5E 3PP3H 4HCRA 5DT1L 3MC0A 1GGTA 2R0WH 4JFZH 3VWJC 5K59F 4Z95H 3QUMB 2XA8L 5GS1B 3KJ4B 1OF2A 5M95B 4CNIB 3IETB 3LRHA 4M1GL 5DJZB 5E9DD 3HN3A 1K4DA 4TTDC 2YZ8A 1EBAA 3B9AA 4X99A 1T5XB 1ZLVK 5GSVB 1XZ0A 3T0AA 1VEMA 1HOCA 4HS3B 4KKCD 1DEEA 3CK0L 5A40E 3TCXA 3MLYL 2X4TA 1S3KL 1NCWL 5ACMA 3FB5A 2HKHL 1HZHH 1XIWB 2OR9L 4JG1H 4DKAA 4QWWC 4ZYKA 1X5IA 4PJXF 4ZUTB 1E4XH 1U8IB 4Z95L 4PJFB 4LCYA 5JIKA 4GAJH 5FOBB 4EN3C 1JWUA 3OAUL 1T0NB 5D5MA 5INDB 3MRFA 5C0BE 3GI8H 3O4OC 3BQUC 5CHNB 2XI9A 3MREA 1A7RH 2VH5L 2J8HA 2FEDD 3JWDL 3O2DH 3VXMD 5SV3A 3L3GB 1KYOJ 3NZHH 5C70A 1HXYA 3G5VA 4D9RD 4KY1H 4EDWH 1WFOA 3MBED 3HMWH 1KIQB 2VLKA 3EHBC 3QIUB 3TBSB 1HZHL 3GMOA 4XX1G 3VXQB 1S7WA 3ZZ1A 4NN7B 3SKNB 4NKOB 5SX4I 3SJVA 4WUKH 3ULUE 4MB5A 4OZFG 2DQDH 3T8XA 4PREA 5B4MC 3O6FD 2DS4A 3O2DL 2J6EL 3DIFB 5JW3H 3GIVA 3RBSA 4KY1L 3BP5A 4WWKA 4KQ4H 1OVZA 1AKJD 1XF4A 4V1DE 3HRZA 1NAML 3CXHJ 1VSCA 4G8IB 5FA4A 1TQBB 5AAMA 3D2UB 4YNYB 3HAEA 1MPAH 5ICXB 5CSBA 4JO2H 4RFOL 4XZUB 3D39E 2EH8L 1DVFD 2W9DL 1M71A 2UY7A 1DL7H 3D69B 3LEVL 3G04B 4PPTA 5KG9B 4LCCC 1A6WL 4N5ED 3B6SB 2IJ0C 1BF2A 4HGMA 4CGTA 4K8RC 3WS3A 2BNRA 4Y5XC 3MRKA 3AREB 4KQ4L 4RAUB 3SE9L 2CIKB 2MJWA 1A1MB 1DQLH 4MNGB 4HDIA 3ULVE 1F3JA 3QDJE 5ILTL 4NQED 3VRIB 4UQ2A 4LLDA 5TJWK 1HK6A 3K46A 2UZYB 3BGFC 3GFUA 3GSWA 5FUCC 1P84J 3BP7B 2B4CC 2QTEA 4WRLA 3BPOC 5DF0A 4GKNB 5IV2A 3C2SA 3CX5K 2OJEA 4RBPK 4OF7A 1FZJA 3MRQB 1KN4L 5T3ZH 1I7UB 1NH6A 4XP5L 3LZFL 1P6FA 5JHDD 2MCG1 1QR4A 5C0CB 5EZIL 3B3IA 3X3FH 1WT5C 4JRYA 1CE1L 2E7HA 4LSDA 3SDDC 1K6QH 4UIMA 5D5ME 2B1HH 2F5BL 1QLRB 1S9WB 3BAEL 3VI4F 1NAMB 4YDJA 1FCCA 5D71H 4XPAH 4MLSA 4Y4FD 1MCJA 4LP5A 2ZCLH 4HT1L 1PEZA 5IW3A 1WFNA 1UC6A 4NHUA 1KB5A 5HGDB 1WTGT 2VLKE 3QI9A 4DVBB 4YPGA 2FIKB 1BD2D 1VFBA 2Z31D 2QLVB 2WNGA 1S7XA 2QKIA 5EUKA 4RAHA 1R5VB 4FOMA 2MSPA 1NFIA 2AQ3A 5I8KH 3BEWA 4ODHL 1K6QL 4KROC 5FGCE 1FNGA 4M8QA 2B1HL 5IMKA 3BUYA 3TN0C 2X4OA 2YS4A 3HR5B 3VFUB 2PNDA 3QNZA 4PJGF 5DMGD 1A3QA 5FYKL 3C5JA 1W8NA 2JJSC 2C26A 3CFDA 2CD0A 5DUBA 3RHWK 4RGND 4QRRD 1MCPH 4NZUH 3VFWB 1GGBH 3P30H 4A2LA 1C5BL 4X83A 4UOW1 4C54A 3ARUA 5EH1A 5FYKD 4QNPE 3ULUH 3D3VD 4J1UB 4I48A 4K23H 4L9LB 4HK0B 2VITB 4O2FB 1CDYA 3LDBB 4YBLC 1P4IH 5SV4A 4X6FB 4JN2A 2HTKD 4I18C 4Y16D 1M05B 1WIPA 3EYSH 4GRLA 4ZXBA 2ZSWA 1LK2A 4W68A 3QDAA 2VWEC 4BFIA 1WZMA 4R8WL 2B4CH 2BNRE 4K2UL 4X6EB 1S5IL 4HLZG 4WENB 2HKFH 3JTSB 4R96B 7FABL 2GSIA 3BH8A 2WAHA 5E6IB 4PS4L 5C09A 1YYML 2IANB 4MX7A 2Q8AL 1J1OL 1MLBB 1A2YA 1BFOA 3VXSA 4H25B 3CDGB 4JFHD 4WWKC 3L9RB 4YDLC 1IJ9A 4O4YL 3UJIL 4WFGD 1CD9B 3AS3A 2QADB 5MEOA 4U1JB 2XICA 2R39A 4D3CL 1QBML 3ULVH 1F4WH 1H9VA 5CZKA 32C2A 4IOIA 2Q8BH 4HCRH 4WI6A 5DVLA 1A14H 4OCXL 4P23D 4OTXH 3OX8B 3Q5TA 4IMLB 5H37G 3LKOB 2V5YA 4XBEL 1IGYB 3WSQL 4JRYE 1EO8L 4J7RA 1BQLL 5ESVA 5F3HA 2PTVA 3SKOA 3F65A 2UWEA 2ILLA 3LQAL 1FHGA 4CKVX 2WP3O 2OMNA 1ROWA 2CXGA 5C0BB 3C8KB 1FIEA 2NR6D 4LDLB 3ZYOA 3ULVL 4FQJL 5EA0L 4U0RC 4AIXA 5IW1A 1FNAA 3ARBA 1J8KA 2AGJL 3L5JA 4XXDB 4XCNA 1F58L 4EDXA 1KCUL 5E24E 4HCRL 1OB1B 3SDCB 2QR0A 3SE4A 3R1GH 4GBXC 1X7QA 3RWGA 2DQFA 4N0UE 1NMAH 2IBGA 3GRWA 3QO1B 4JEGB 1TJHH 2VC2L 5I75B 1IKFH 2YUWA 1PSKL 4PGEA 3QT2A 3LB6C 4PJDF 1WIUA 1RZ8A 1HDMA 3F12A 4KRMB 3TT3L 3DRTB 4GS7B 1UFUA 4D0DB 3G6AB 4CN6A 4XAWH 4EUPG 1ZLWK 3WUWB 4XB8A 4MLIA 3UBXG 1QSVA 2IPUG 3JSSA 1R5WA 3I75B 1NEZB 5DHYA 5FGBC 1MFCH 2GTZB 3LKRB 3R1GL 3VXTA 5J8OA 3LS5L 5CFHA 4V1DB 4KTEL 3KDMA 2LAAA 4LLQA 3JV4B 4F7MA 2A1WL 3HFMH 1NUGA 43C9A 3O6MH 1RUKH 1CG9A 2ADIA 3NZ8B 5D2NA 3VGAB 1I8MB 3QI9C 4IRZH 3D39B 3S3PA 1FNSH 5F89B 2R2HA 1JTPA 1FIGH 1HYSC 3UP1A 5I1GL 5F9OH 2NY3C 2I25N 2Z4QA 2XWTB 1U2CA 2B1AH 5F6HI 5I2IB 4XAWL 1D5IL 3HAEH 3D1MC 1ZWIB 4HWZB 3IAQA 5C09E 3O8XB 5C0DA 3TZVA 3HZVB 5I17B 1VADB 2EXWD 3CPLB 5GGVL 1UZ8A 1MQKL 3QDJB 4K3JH 4YHPB 1T1ZB 1RUKL 3O6ML 4NO2A 2H2SC 5JZ7C 3EOBA 1NGYB 2F19H 2YBRA 4IRZL 5I1HL 4FQIL 3U6RA 1OF2B 1CCZA 4PUBL 1DUZA 3MXWH 1IT9L 4YIQA 5HI4C 2B1AL 4OIBA 2I9LA 3B2VL 1T03H 1MEXL 3SCMA 4EUPA 5EBWB 4FG6D 4PP1D 1MCNA 3TIDA 3UBXA 1XZ0B 1HOCB 2LVCA 1DEEB 4FHBD 3QIWA 1F4YH 3ZE1E 2X4TB 3V7AE 3TO2B 3HE6B 1YN7B 2UWEE 1T21B 4ZYKB 1ZANH 2H9GB 2B2XH 3B5GA 4LCYB 1H3VA 2BFVH 1JWUB 5GGRA 5C71A 1JGUL 5ITBL 5DURD 4P2RA 5AG9A 1IGIH 3DVGB 4HLJA 3MREB 4KMTL 3EJZC 3MLSH 1LK3H 2NY6D 3G5VB 3EW3B 1WITA 1V3MA 3DVNB 4M43L 1B4JH 4P4KA 4GMTH 2JB6B 2VLKB 1F4YL 5B22A 4LSTL 1IC5L 1S7WB 1U2HA 4X7SL 4R90L 5FGCB 1KB5H 4Y2DC 2EC9U 1FBIL 4Z76A 3U7YL 1JGVL 3REWA 1RU9L 1LK3L 3L3DA 3B9KC 4MQ7A 3NGBB 3H9YA 5D7IA 5CP7A 1KTDA 5DD6A 3GIVB 4Y5VC 1CVSC 4W4OC 4YHOH 3X14B 4GMTL 3OAZH 1NC4A 2VZTA 1XF4B 1EXUA 2HN7A 4DKDC 1DQJA 1W0WA 3WNKA 1NUNB 2XY1A 1TZIA 3HAEB 3RUGF 5D2NE 4LPXA 3H6JA 4UILH 4AJ0A 4LFHD 1INEH 5IW6A 4ZAKD 4NHCL 1DJSA 2MPAH 3PG2A 1QBLH 4M62L 3C6LA 2A6JA 1YEFH 3LD8C 1DR9A 4PP2B 1FZKA 4U2YA 2BNRB 4J8RB 4BQBA 1KJ3L 2AABH 1B0GB 3LN5A 5F6HJ 2YD9A 3EYVB 3FHQA 3I3DA 3WN5C 2VO5A 1F3JB 4LMQI 1NMBH 2W65B 2VMFA 2OTWA 4AL8H 5JR1H 3ZMRA 3IDJA 4JKKA 4LLDB 4P2OD 5JMOC 1X9QA 3BJLA 5FYLL 4BZ2H 3N85L 1INEL 1IBGH 4UTBH 5CBAB 1OWRM 4J3WA 1U3HA 3IFLL 3EO1B 3UTZA 1QBLL 5GS3A 2VQTA 4PBWD 1EUTA 2CLVA 2IPKA 1AGCB 2OZ4L 2ARJQ 1R3IL 4OD3H 2RAMA 4HMEA 2OJEB 1HHHA 1UB5A 1FZJB 1PDKA 1S7TA 5BRZE 1W2KT 4MSWB 1VACA 4JM2A 5FYLD 1RD6A 3OG4B 4GRWE 4AL8L 3B3IB 1U8NA 3KLHD 1WEJH 3SDAB 3OXRA 1HNFA 4JRYB 5FKPB 1AQKH 4KKLC 2R9HC 3VD7A 1IBGL 1UGNA 4UT7H 3TZVC 2LV4A 4P2RE 3EFDH 3D87B 5MEQB 4WI9A 5D1ZC 1Q9OA 4LCUA 3S36X 2JCCF 3CFCH 2BY2A 4G9FE 4NHUB 4XMLL 1VCAA 3T0EA 3VW3H 4PJ5A 1FLRH 5MHSE 2CJUH 4LKCA 1WBXA 4C56A 1UH3A 1I9IH 1S7VB 1VFBB 3L3HA 4UAOC 1S7XB 2E9JA 4N0UB 1WEJL 1F45A 5F1NA 1NFIB 3BEWB 1AQKL 1YEIL 1FNGB 1I9RH 5IMKB 3BUYB 3EFDL 3QNZB 2A77H 3C5JB 1T6VN 2MHAA 1OAQH 5H94A 3S96A 3CFDB 4MNHB 1BLNA 4P46A 5D7IE 3RBGA 5E08H 3GRWH 3FL7A 1NFDF 4M1CC 4X6DF 3VW3L 2W92A 1TCRA 5AWNL 4JKMA 3DROA 2WP3T 3W0WA 3HLAB 1WK0A 1I9IL 1QSEE 3KNBA 5GGSY 3AS2A 1EVTC 3MCLL 1UWEH 4I48B 2XG4A 1I1AC 1XCQA 1T5WB 1I1RA 1I9RL 3DJ9A 5D1QA 4CMMA 3QQ3A 4JN2B 5CGMA 4PG9B 4HJJL 5I9QB 3A6OA 2VJXA 1OAQL 2R2CA 1Q0YH 4GRLB 4ZXBB 1IAKB 1LK2B 3SDYH 4MJID 1M1SA 4BFIB 5AZEH 5TDPB 3IU4L 2CUHA 5HDQL 1IAMA 3GDBA 4JFEA 1A6AA 4P9HC 5IMOA 1ZVYA 5B8CB 4MX7B 1TVHB 2XT1B 3WDJA 4HS6B 2OTUA 2QHRL 5C92A 4X5WB 1A2YB 1OP3K 3C5SB 3QIBD 1JPFA 4OLZL 4G8GA 4Z7NF 3ARZA 4PRNA 3RKPA 4IOFC 5EUOF 4JREB 2PETA 4LQ1A 5L2KD 4UV7H 4D9LH 3ARPA 3Q6FA 3VRLF 3OR7A 3FO2A 2MCPL 1HH6A 5AZEL 1XH3A 4R4FL 4YHKH 1UCBH 4JANA 5IJKA 3L3IB 4X6CA 4NO0A 2AKRA 1P9MA 3MYJB 4KHXH 1MLCA 3BIAX 3EO0A 3MX0A 1RZGA 1MJJA 2BX5A 1RY7B 4MA1C 5ESVB 5F3HB 5F7YC 5EOQH 3QWRA 2N7BA 2I07A 4QF1A 2UWEB 1WBYA 3W82A 4D9LL 3R8QA 4X0KB 2GTWA 3CDCA 3UJJH 3MLWL 2DQUH 2JJTA 2X1QA 4NKIL 3F58H 1UCBL 4G6ML 1VPOL 3U0WH 1ZAGA 3ARBB 4EOWH 3T0EE 3MYZA 3MLXL 4EDXB 4GRWH 3TBWA 5I1EH 1YMHA 4HWEH 3AS0A 4WFHD 4C56E 4B41A 3B8SA 3WFDH 3H0TA 2QR0B 2HRPH 1X7QB 3EDFA 3RWGB 4MA3A 3REVA 5IMLA 4LASL 1T0PB 4HULB 1UWGH 4YHIB 2DLFH 3VRJA 5HHVH 5L8KB 4JM2C 4NSKA 3LSOB 5HYEA 2DQUL 3F12B 4LSSH 3TBTB 5LKNA 3G5XB 4OFIA 3FB6B 1GZPA 3T0DA 3IFOA 5T1KD 5D2LF 2C3GA 1N59A 3IDIA 2OSLA 1R5WB 1CGSL 3VXTB 2DAVA 4QHKJ 4P9HH 4MCZA 5D8JL 3VWKB 1FG2B 5HD8D 2F8VA 3KDMB 5CLTA 3PNWA 4LLQB 4XCYA 5JA9A 4OCLC 4AENA 3HI5H 2VKXA 3UYOD 1PKQE 2ADIB 2DLFL 5BZDB 2HFFA 1CD1A 5D2NB 4HKZB 4N8PA 2Y72A 2OMBA 2QJDA 1ACYH 2GK2A 3QXUA 3KPOB 1YC8A 3MGOB 5SX5H 4JHAL 4HC1L 3TIEA 4JFEE 5KSAD 1R3KA 4U1HA 1MIEH 2NXZB 3QRFM 1WWBX 5C0DB 5IROA 3U4BH 4PRPD 4H5SA 1MNUL 3I3EA 1J11A 2J5LC 3TVMB 4P46C 2FJFB 4G8GE 4OF8A 4LSQH 5CEZE 1M7DB 4X4YB 2R2EA 5DFVD 3QCVH 3MLVH 4NO2B 4Q9QH 1BAFL 3EOBB 1IM3A 5JW4R 3U6RB 4JRWA 4PLJD 4KC3B 4K94H 1DUZB 2BY1A 3BP4B 4PJEF 5C86A 1ZT1A 2V5TA 4YIQB 3SE8H 4LKXA 1I8LA 3NH7H 4GQPH 4YEFA 1SEBA 5B38G 4GKZA 1AGDA 4XP1H 3SCMB 1MIEL 1X4ZA 4PJ7F 3TIDB 1ZGLM 1PG7X 3GMRA 3RNQB 3GNML 4XBPA 5BRZB 3QIWB 1T22A 4ZUVA 4WGVB 3GJFK 4KKBD 4LU5H 3RJDA 3WD5H 3QCVL 3DX8B 4XC3H 4GRWB 2PR4H 2P5WD 4RMUA 3FO9A 1D6EA 3ME0A 2VDPL 2DTML 2X1XR 3VD5A 4K94L 5GGRB 1VERA 5E8OA 3SE8L 1BWMA 1XAUA 1ZHLA 2DL9A 3P9LA 2HWZH 4U1KA 3P77A 1GJIA 1N5AA 3T4AB 4XP1L 2R0ZH 4HMCA 3VXPA 4G9FB 3HRPA 4P4KB 4XRCB 3RWCB 2DLIA 2BDNH 3P73A 1AFVH 3VDBA 2ESVD 3V4UH 3HZYA 5F70A 2X10A 5LAXA 4YBQC 1P9MC 1TQCC 1MFEL 5C9KA 1KJVB 1UXSA 4PV9A 2RCSH 4Z76B 1F90H 1TENA 3PL6A 3WFBH 1Q9WA 4O2CB 5HHPA 3A6CH 3REWB 1ODAA 3ZYJA 4TUJA 1OTUD 5HY9B 4OIIL 4Y88A 4XCFL 1CXEA 2PF6A 2R0ZL 5DC9B 3A67H 5D7IB 4WW1A 1KTDB 5DD6B 3T65A 3WNPA 3L3JA 4HV8A 1KNOB 4LVNB 1NC4B 3EOAA 5CMAA 1ZT4A 1QSEB 3QJFB 2O93L 1VFAA 1TZIB 3G6JA 5I8CA 3P2TA 2J12B 2RCSL 4B0MM 1HKLL 1DCLA 2IH1A 5IW6B 4HPYH 3FN0H 3CFEB 2CMRL 1BIIB 4OLXH 4QHLA 4BK5A 4XPHL 1PFCA 1WV7T 1K85A 3C6LB 1U58A 2CKBL 3DUUA 3QNYB 4G7YH 2PO6B 3A67L 1NMCB 1RURL 2X4NA 4JO1L 1BFSA 3W9EA 3BPCB 1P69B 1HEZA 3LN5B 3LKQA 3JV5A 1XGRA 1IEHA 4MZ2A 1NCAL 4IIQA 5ID0B 3Q0HA 3IFPB 4HPYL 1X5XA 1ZGLB 2ZG2A 1U3HB 3IDXH 3L7FA 4GLRH 4XCCH 3OHXB 2FATL 2CLVB 3VG9B 2IPKB 3TV3L 4TNVF 1T04B 5ADOL 3C2AH 1HI6A 3F6IA 4DEPB 1HHHB 2ZUUA 3ALPA 4X8XA 1F11A 2YPVH 1VACB 4M5ZH 4NZTH 2GJZB 5EO1A 4KQ3H 1KCVH 5T5NG 4HPOH 4KK5D 2P44B 1OT2A 5GZNC 3ZDZF 4DCQB 1KLUA 1WZLA 3I6GB 2XQYK 1DP0A 1UXWA 2F8XC 1W0YT 1ZLSH 3AROA 4DKFH 4Z7QE 5F93C 3NMEA 3QULA 1XF2B 5DSCA 4KPHL 3T3PF 4RBPH 1J7VR 4RGOH 2YPVL 2I60H 5CEZL 3T0EB 4LKCB 4NZTL 1WBXB 4MJ2A 5FK9B 4C56B 4KQ3L 4BA8A 3SQOL 4LEXL 5HGBA 1I8LC 4NN6B 3CVIL 2BJML 2YPKB 5CSGA 5JOEA 2FB4L 2X42A 5F1NB 1KGCD 4WY7L 3TO4D 2UV3A 3PGDA 4FMFA 2VQ1A 4YC2B 4DN4H 2X1OA 1A4JA 1ZLSL 1T7WA 2CK2A 3C5ZD 3PWUA 2FWOB 5H94B 3SQBA 3L95B 4Y4HA 1MHCB 5HGGS 4YLQT 3BKCH 2X09A 2I60L 5J9PA 5DJXA 1LEIA 3PUCA 3LV3A 1P2CB 5B39B 1CXFA 3W2DL 1TCRB 2ZUTA 1IAOA 1NGZB 4K71C 3TPUB 1FC2D 4KRNA 1OPGL 3UBXI 3KNBB 3WFEL 1MJ8L 4PRDA 4J3TA 3BSZH 1I7RB 1KEMH 4JY6B 4LVOB 5TE7L 4UNUA 2JTDA 2L0DA 2SEBB 4DN4L 2E9IA 5D1QB 4CMMB 1PKQB 3T0XA 5IOPA 5ISZD 1AHWC 4U7MA 1MWAL 4HK3J 2DQTH 5IWLA 4JFEB 3K74B 2BVOB 1A6AB 3NIGE 1GGYA 4RWYH 4PIRF 4PB9H 4UDTA 2EXYC 3THMH 1YPZA 3UTTA 4MXWH 2XQBH 1C5CL 4ALAH 4FZ8H 3EYFB 1BOGA 3BSZL 2YWYA 1KEML 4W6WB 2H32H 4M7ZB 2FIRT 5F88A 1CLYH 1F2QA 2AXFA 4P3WA 3QZWG 1NUFA 3BKMH 4PRNB 5DA0B 1SJEB 1ADQA 1FAIL 2YD1A 3LIZH 5KVEH 1FJ1B 4APQB 3MCKB 3Q6FB 3SGKA 1B3JA 3OR7B 4AIZA 2DQTL 5DEFA 1IGML 5HYSA 2IC2A 1CFNB 3FQNB 1BM3L 2W9LA 3IDMA 4JANB 4XP4H 4PJIA 4PB9L 3OKEB 3GMNA 3FT3B 4NO0B 1QYGL 1GAFL 5J7CC 1S9YA 1MLCB 3BEVA 3EDKA 2VZ3A 3TGXA 1RZGB 1KPRA 5IM7A 3BW9A 4MA8L 5CKAA 2CUMA 1RUAL 3FT4A 4KGLA 2WK2A 4KRPC 2I07B 4LPTA 1FL6A 1GGUA 4HQQH 3RNKB 1WBYB 5DUPL 1QZ1A 1KJ2A 4J12A 5I73C 5KVEL 2GTWB 2HT3C 1BEYH 1I1FA 3B2UD 1VGEH 4R26L 5KJRH 3MXVL 2B5IB 3H9HA 4JKPL 4NCC1 4P2QD 4O5LH 5M94B 4IIQC 1V05A 2C1OB 1KB9J 5C6TH 2YA2A 3TBWB 1CF8H 3O9WD 4QCIA 2JKXA 1MWAB 4V2BA 1CGWA 3VI3E 4Y1AE 4PV8A 5FA3B 3I9GH 4PGJA 3FQTB 3NIDE 2DM2A 5E8PB 4HQQL 1H3PH 2D7QA 4UUJB 3GMMA 5F7WC 2WWKT 3QZWA 4YFDB 4F33A 4WDIA 3VGDA 4K7FA 1RZKH 1VGEL 4Z78A 2VAAA 4ZMAT 4PFEA 1QRND 4L4TD 1I3UA 1OCWL 2PTTB 4ONHB 3IFOB 2Y7QB 1N59B 3G5ZA 4X5XB 2NYYD 1CF8L 4G6AC 4Q9RH 3G08B 4M6AA 2HT2C 4JDZB 1DQTA 1RFDH 2X4RA 4MCZB 4Y89A 2AK4D 4HXAH 1O0VA 1TPXC 3BRGC 3TBYA 4CW1B 5C2UB 1U8QB 3PNWB 4XCYB 4AENB 1FPTH 2R1WA 3IRPX 1CD1B 3GEWB 5ERWB 3MV11 2HJFA 2NY1D 3U2SA 2IPTH 3ROLA 5HPMA 9CGTA 1MCLA 5K9OA 1MI5E 2H32B 5MEPA 3TT1H 2BNQA 2VRAA 3VWJD 1QO3B 4MJ5A 3GSUB 4TSAL 4Q9RL 3VGEA 4OLVH 1CXKA 2M8XA 3QCUL 1G6VK 1RFDL 5EZOH 1RJLA 4RX4A 2VDRH 4H5SB 4RQQA 4AEIH 4LLUA 4Y4HC 2DOCA 4TTDD 4I0KA 2AXGA 1QKZH 3F62A 1ZLUK 3QUZA 1UQSB 2DQEL 2R2EB 4JR9H 3HNTL 1JPGB 5D7SH 2IPTL 1IM3B 5IUSA 1Q8MA 4NQXA 1QRNB 4N1HB 4HFWA 4LKXB 1CGXA 1CDJA 3TT1L 4PLOB 4QWWD 4GKZB 1AGDB 4F7EB 3KPQA 3UMTA 4EN3D 2I24N 2ZUVA 2PXYA 4LPUA 5EZOL 3BQUD 2WBJB 2YD5A 1IILE 2OP4H 3LEYL 1T22B 2XTJE 4LLYB 2I27N 3BPLB 2CLRB 2FEEI 3L5XH 5IWLC 1JP5A 4JR9L 5FGSA 5KN5A 3AXLB 1EHNA 3DYOA 5D7SL 1ZXQA 3QHTC 4Y2OA 3ZYIA 1WC7A 4K3DL 1T20A 3ECBA 5CCKL 3EHBD 1VHPA 5E8OB 4FQXA 4NO5A 1JNLH 2GI7A 1FLTX 2E7LA 4TUOA 3P77B 5CZVH 1QEWA 3STLA 4PRHA 1KN2L 1H5BC 4M3KB 4NBYB 5EWIL 1NLDH 2DQGH 3V0VA 4QXTA 1L9NA 4N1EA 5DLMH 3MRRB 1M7IA 1NCNA 3L1OH 2OP4L 4UT6H 5B4MD 3C08H 3UYPA 5DEZA 5IKCB 4OCYH 3O41A 5C9JA 3O11A 3L5XL 4TVSa 4L5FL 4HKXB 4JDVB 4JFPA 2PYEA 3HZYB 4JE4B 3QG6B 4U1SA 3QA3B 1BVKA 2O61B 2D7MA 3MR9B 1UXSB 2A83A 3PL6B 1JNLL 4K8RL 4CMHB 5CZVL 5AD0B 2ITDB 1JZ8A 4HUWA 4F15C 4JM4H 2ICCA 4WW1B 1INQA 2X4PA 4OKDA 3T65B 3L3JB 1UM4H 4IS6A 3WLWC 3EOAB 1UACH 1P7QA 2QEJA 4TVPL 2GITA 1ZT4B 2J2ZA 3MOAH 4PJAE 4K8RD 5J57B 1DLHB 1E4KC 2V17L 3QDMA 2DYPA 1X5KA 2COQA 4LHUG 1VFAB 4JLRA 2NY2B 4P2YA 5IBTH 3QYCA 4GW4A 4B50A 3PHOA 4NUGH 1KOAA 3OGOE 1YQVH 3MV7D 3QHZH 3JV0A 3U83A 4NQDD 1BJ1J 3ARFA 4RCAA 4TVPD 5BVJA 2BNQE 4HF5H 1CYGA 5HDLA 3DUUB 2VE6B 3GSVA 4PJBE 1UT9A 1YEHH 2C3HA 2X4NB 3QEGL 4PGBA 2GFBB 4S1SL 4ZQKB 1N3NB 3DYMA 3TC9A 3OXSB 1Q94A 1EFXD 12E8L 1EO7A 3LKQB 4DUWA 4JFYA 2WW8A 1AP2A 4G42A 5GJSH 2JIXA 4ACPA 4KI5E 3WDHA 1CLCA 3QHZL 1F6AB 5J1TC 1YN6B 4P99A 3L7FB 3MACL 2NY4B 4LSVL 1KLGA 3PABA 5CKGA 2X89A 3EZJB 3WE6B 3GMPA 2VNCA 2F5AL 2R69H 3OAYK 5FOJA 3S98A 3SDDD 2Y36H 4G6KH 3ULSB 1GHFH 3DX7A 3WNOA 5BZWB 3LOWA 4AQOA 2R23B 5F96H 2Z91B 4PY8I 3U1SH 2FO4B 3BD3A 3E1F1 1ADQH 4YHZH 5ALCH 2NXYC 2R4RL 4HUKB 3RP1A 4LHUA 4AY0A 5CEXA 5T1MA 1KLUB 1JGEA 1UXWB 3GM0A 3GJFA 3LPFA 3RX7A 3ZTNH 5JLZA 4PRHE 2XPGA 1AXSA 3QULB 4KROD 4OCSL 5DHVA 3MRCA 2OQJA 4N0FA 2YXFA 4BQ8A 2HFTA 3TN0D 3VXRD 1LO4H 1K4CA 4U4BA 3CH1A 2PW2B 3U1SL 5C8JA 3HE7C 5ENWB 1KJ2H 2XZZA 5HGBB 4YHZL 5EO0B 3J8F7 4P3DB 1F4HA 2PYFB 4Y1AB 5F9JB 1E27B 2J7LA 3PJSA 1H0DB 2BRRH 2NTFA 1ACZA 2PXYC 3BHBB 5I1KH 3TA3A 4N0CC 1CDCA 1KV3A 3U0PA 1QTYT 2W1NA 3L5HA 3QUYB 4LLWB 3PWUB 3DLQR 2IQ9L 1JYNA 3BDXA 2HJKA 4IMKA 4UBDC 1V7ML 1RQ5A 5J9PB 5DJXB 1LO4L 2RR3A 3LV3B 2VDML 4YPJA 4KRLB 3ZO0A 4FQXC 3OKOA 4Z0BL 1N7MH 3QDME 3TNNB 2V2XA 4PRDB 3QDGE 1IGTA 2NY7H 3HTLX 4ZO8A 1DBJH 4POZC 4NFBA 3SJVD 3ARYA 4EEEA 1XGQB 1F8TL 3RDTB 5EIIA 4JKWA 2ORBL 1D5ZB 2XQYG 1MI5B 1NL0L 1JNNH 4GW5B 1S7RA 4WWKD 4O02L 3GSQA 4JPKH 3MNZB 4M1DH 5DD1H 1BQHB 1N7ML 4B53A 1NBZA 1FL5A 4ZNEA 1DBKL 2HYMA 1BOGB 2J8UE 3STBA 1RIUH 3P0YL 1QUNA 5E8DH 1C8PA 3SN6N 1UH2A 5DJ8B 2AXFB 4P3CH 2QQLH 5LGJA 4Z6AT 3L5WB 4HIIA 4G6FD 3QEQA 2EE3A 5TF0A 1UKTA 1QR1A 2C9AA 5HYSB 1MVUB 3NPSC 3AU1B 1RZJL 3B4NA 4JPKL 5E1AA 5LJYH 2DDQH 1JTTA 2AEQH 4MB4A 4MXQC 2FR4A 3ARFC 4WI3A 5JTWA 2VZSA 3BEVB 1OP3H 1RIUL 1FYTA 2XTJB 1D5MA 5IM7B 3BW9B 2EKJA 1E4WH 2GK0A 3U46A 2V2WA 3P0VH 1I4FB 4GBXD 1KJ2B 4LLVB 1HQ4B 3MLUH 1I1FB 5B21A 1EK3A 1JRHH 5DHXB 3KPRD 4Y19A 4OQTL 5F7UA 2A74B 4LNRA 5KSBA 3LB6D 2DDQL 1KC5H 4Y8AA 5BS0D 4YE4L 1G9NL 3PWNA 1J8HE 3BPNC 2YD6A 2YKLH 3OPZH 3L5IA 5DQDL 4PV8B 1E4WL 3HNVH 5TFSL 1BX2A 1MCQA 3O3DA 4F7PA 3P0VL 5C0NC 3IB4A 4OAWA 1RJZA 2X4SA 4WDIB 4K7FB 3VD4A 4Z78B 4EIZC 3ZE2E 2VAAB 4X6CF 1G0DA 2JE8A 5JOFB 3DBXA 5CD3B 5KS9A 3QI9D 3G5ZB 2FX8H 2YKLL 1YYLH 3NPZB 3OPZL 1GPOH 4WO4A 4J23A 1HYSD 1EZVY 1TNNA 2VR9A 2NY3D 4I8DA 4S2SA 3TBYB 5A43C 4PJAB 4M7LH 1MCOH 1JIBA 2Y5TA 3WJJA 3OMZA 3BZEB 4OBSA 3S36H 3ARWA 4MMXC 1N2RA 3ROLB 4HKBA 4LEOB 1JYVA 4KHTL 4XC1L 5K9OB 1BZQK 5HVFB 3LEXA 1BVLA 3DMMC 2APXA 3OTTA 4HUVB 3TYFA 4ONFL 1CL7L 2BNQB 3NCJH 4KJQC 5JZ7D 4M93B 4TUKL 2ERJB 4PJBB 4MJ5B 2FX8L 3QXDB 4S1QH 3E6FA 4FS0A 3HA0A 4FP8H 3T08A 4HIJB 4O9HL 1TJGH 4ZNEE 1NCDL 1QACA 4WEMB 5D1XD 5HI4D 1BGXL 1XFPA 3RVWC 3D6GA 4RQQB 4KTDL 3VFGH 4K3EL 1UM5H 4ZPVA 4NFDA 1NEUA 1QFWI 5FHBL 3QUZB 3DGCR 1S7QB 1TETL 3FKUS 1JWSA 1P6AB 5I1DB 2OL3H 1DN2A 3QEQE 1TDQA 2XV6B 5MI0B 4NQXB 4HFWB 1BZ7B 4W81A 4LBEA 4NO3B 3NCJL 2VDLL 4HUUA 4PG2C 3EOYG 3MUY1 3KPQB 4D0CB 2FJHA 1BBDH 3RGVB 4FP8L 4MXVE 3DTXA 2Q7YB 3GSXA 4FRWA 1YEEH 4HUNB 4I77L 3VFGL 5C0EA 3EJYC 1JF5A 3MROA 3VXSD 3QXWA 4E41E 3STZA 2BCKA 5HGAA 2GUOA 1ZHNB 4XNZC 3BWUC 1MSPA 1HHGA 2E8ZA 3PWVA 4U6VH 1AJ7L 2JJWA 2OL3L 5IHUH 3UTPD 1J1XH 4TULL 5E95B 2EYSB 1RHHB 3ECBB 3ESUF 2IFFH 3RWDB 4NO5B 3VFRB 4OB5H 2AJUL 5I66B 3H2WA 4WTXA 4YHNA 4TUOB 4ZD3H 4XI5C 4TNWK 5KSBE 5CJXA 3STLB 2HH0L 4PRHB 2F54D 5GGSA 4Z0XB 4E5XB 1KXTB 3IXTA 1G7PB 2UZXB 4OM1L 4Y2DD 5D1XB 4LSRH 1RIHH 4PJ9C 1YEGL 3GJFH 3MRLB 4JFDD 4ZFGH 3B9KD 2O26U 3O41B 5C9JB 1ONQB 4KXZH 2RFXA 3OKKB 4WUUE 4JFPB 2X5PA 4JVPA 1YA5A 4X7CC 3W11C 5C2BL 2ED8A 2WM0A 4ONGH 2RB8A 5C0IA 2CGRL 3S3SA 5J0BA 4ZD3L 5ADPH 1I3RA 2E27H 3FFCD 1G7IA 5JOPE 4OLYH 4U7SA 1S8DA 3UYRL 2XZCL 4KTYA 1MRCL 8FABB 1JGLL 3E3QC 5KZCB 4RRPG 1ORQB 2NNAA 4NGHL 4LDOB 2EDEA 4ZFFA 1CLZL 2GITB 3DX9A 4CADA 3QDMB 2DYPB 4JLRB 2UVFA 2HFGH 2CDEA 3QDGB 4GW4B 2KBGA 4GKSB 5KSUA 3O2WL 3WKML 4NM4H 1B88A 1DQMH 3HC4L 3QXAB 4QGTA 3FO0L 3ES6A 5BVJB 5HYFA 4P9MH 4HZLB 2E27L 4I0PA 3GSVB 4R9HA 2OL3B 2UVEA 3GSOA 4PGBB 1D9KB 4BH7B 3IDGA 5D6CA 4JRXA 2V5SA 2ZKHH 3BE1H 1RUQH 4OCWH 1Q94B 5K9JL 1CICC 5D7KD 4JFYB 5DZOA 4TQEL 5C0RL 1IGCH 2JIXB 2J8UB 1EJOH 1MVFA 3D18A 1KPVA 5ID1A 3H9SA 3FQRB 4FQLL 5J13B 3N9GH 1AO7A 4L8DB 2XN9D 3F7VB 5IT2L 2LTQB 3DRQA 1KLGB 3PABB 2XKSA 1EEUA 5JDSA 4KKLD 2R9HD 4XPBH 4WW2A 1ZT7B 1MRDL 3TZVD 4P5KA 1PLGH 4ELMF 4L3CA 2EE9A 3ARGC 3OJVC 1FP5A 5A2LH 3EAKA 3G6JF 3LKSB 4H8WC 2IG2H 5D1ZD 5IQ9A 4XTRC 3W39B 1IGCL 4X98A 5DYOB 2K3TA 4P5MA 1JN6A 1U93A 1TLKA 2YEZA 4LHUB 2ICWI 3NIFF 2BMKB 4I13B 1HHJB 5F9WC 3WNMA 1PZ5B 1IRAY 1JF1B 1JGEB 5IJVA 2W07A 3SPVA 2VAJA 4MAYA 2APWA 1CR9L 3FRPG 1QBBA 2F74B 2H2PC 2OI9B 1Z9MA 2NZ9C 3NA9H 2VSCA 5JQ6H 1IEAB 5JLZB 1G7QB 5IHLB 5D7LA 5D7JA 1AXSB 4L3EA 3P0GB 1T1YA 4XPBL 1XMWA 1PLGL 3CAFA 1K4CB 2YRLA 1NGWA 2D31A 3CH1B 1JCKA 3HG1A 5AYUH 4ZS7L 5C8JB 4U0QB 1J8HB 2IG2L 1P4BL 5T1LA 5LWYH 1HSAA 3PJSB 2NTFB 3BKJL 3K2UH 3QQ9C 3P9MA 1IL1A 1JVKA 4P2RD 4F9PA 3TA3B 3VJ6A 1PG7H 5CGYC 5BVPH 2R2BA 3NA9L 3MNVA 2A9NH 5GSRA 3WJLA 1I1AD 2C3VB 1A1OA 4NP4H 2PKDA 4K07A 3L3OB 1N0XH 5KVGL 5C7XL 1T2JA 1NBYA 3BYYA 5FFLA 1I1YA 4CN4A 1HHIA 3LPWA 5HHME 2P5EA 2W0LA 4CDGC 4UV4H 1WUNT 2CDGB 2CSPA 2V2XB 3BIKA 4XBGA 3VMOA 5CJXC 1QBAA 3FRUB 3ALWA 4DGIH 1DN0A 1U8JB 5T1DH 1LP9F 1PG7L 2W0FA 5EIIB 1BWWA 1FV1A 3D0LA 1RVFH 1RAMA 1A7PL 3V6FA 5FO7B 2VXSL 4MAUL 5HYJD 1S7RB 3CU1A 5TGBA 4F7CB 3GSNA 2HT4C 4IOFD 4YAQA 1TZHA 5FM8A 2AJYL 3FQXB 4UV4L 4RA0C 1J05A 4JPIB 5SWSA 4ZTPL 4I2XA 4WCYH 4NNXA 5HYQA 1T1WA 3RX5A 3WFCL 1LO2H 5DEGA 2YZ1A 4RMTA 3H9SE 4A2MA 3RA7H 5LGJB 1E6OH 5E1HB 2YPLD 3QEQB 1SJHA 3RWJA 3PGCA 1BJ1H 4IRSC 4OF6A 3VDCA 4OZHF 4EQ3A 4XH2A 5J11C 5C6WH 2P8MA 1EZVX 5E1AB 4LRNL 5IB3A 4Y4KC 5D96C 3RY6A 5HHOD 5T5NF 5FKAA 2AJSH 4FTVA 5AZ2H 2X7LA 15C8H 4O51A 4XP6L 2ZOLA 4MDJA 4E41B 4Q2ZB 5DD5H 1A0QH 3NOIA 4ZO7A 5HDBE 1ED3A 3ZKXB 5CILH 3U46B 1E6OL 4PRID 5BOZG 3UTQB 1DQQA 3CSYA 4KWUA 3C09B 5D7LE 4NQVA 4L3EE 4LCWE 5EG6C 3VCLA 5LXGL 4UTAL 1MHPH 1YPZF 2QHLA 5KSBB 1AGFA 5C08A 1N6QH 4Z77B 3HG1E 3PWNB 2EDQA 4HJGA 2VDNH 1RULH 2AJSL 2MKWA 2F53A 1VENA 2ARJB 5GS0H 5ICZB 3GBMH 4JHZA 5DD5L 3OF6A 1A0QL 3FT2A 1WBZA 2YC1A 4PJ8B 4N0YH 5CILL 4M9OA 2DIAA 1KT2A 4R97B 3O3DB 5HSFA 4WUUB 4F7PB 4L8CB 4WJ5A 3O3EA 2GKIA 4OAWB 2X4SB 5FDWA 1MFAL 1BFTA 2AEIT 3WL9A 5E2VL 1V7NH 4PJIF 1IEBA 4HGKC 4ORGA 1GC1C 4PJ5D 3DBXB 3TH3T 2UZIL 1N6QL 5IR1A 3BD4A 3HHRB 4MAYC 2P5EE 1ZHBB 3VFNB 4WO4B 3WIIH 4OQ1A 5GS0L 3GBML 2A0LC 4NNPH 3C60C 4LHQB 2JK5A 4BM7A 5DJ6B 3KXFA 2JELH 4XNMA 1AD9B 1MCRA 4MHHI 4NDMA 3UZVB 5H35B 1QVOB 1N2RB 4YHMH 2Q3ZA 1ES0A 5GRWA 3RJQB 1BVLB 2Y07L 3EYQC 4KXZI 4RMWA 3W0WD 2VLJA 4F9PC 2L7UA 3HB3C 3S5LG 3WIIL 3KPMB 5SWSE 4M02A 4NUJB 4U33A 4OV5B 3WJLC 1LEGB 4I2XE 2VDKH 4QXUH 2YK1H 4MA7L 1EGJL 1OAYH 3O4LA 1KG0A 5F7EH 4NQCD 4NT6A 3PIQA 3V0WL 4YHML 1OAXH 4QRUB 3MO1B 2V9QA 1S78C 1XF3A 3NFSH 4HUUB 4UINL 4M7LT 1JZ7A 3DTXB 3R0NA 2BVQB 4FTVE 4XVJH 2BRQA 1FO0A 3MROB 3PGFH 4H1LG 1FVDA 2WIIB 5HGAB 4G8GD 2GUOB 5FCUL 4ZG1A 2YK1L 4OV6F 5LGHL 1UYWH 1HHGB 2RHEA 3KPPB 3T0VA 3PWVB 5GGQL 3RGHA 1BREA 4P4RA 2G5BA 4PLNC 1OAXL 1GGCL 5ALBH 2VZOA 1S9VA 2J8OA 2IAMC 3Q2CA 1DDHA 3HPJB 3GJEB 3OKLB 2LQRA 5IQ7H 4OZGA 4KAQH 4YHNB 4JY4A 5IFHL 1QFOA 3QCTL 2DD8H 3IGAA 4X6BB 5C08E 4YBQD 4JO3H 2A38A 1AY1L 4AG4H 2F53E 4YXLL 1CXIA 3S5LA 5BO1H 1AXTH 1EX0A 3VA6A 3UDWC 1U91A 5E0QA 1NBVL 3QWRD 1SEQH 1XGYL 1UYWL 2M2DA 2FECL 4LVHC 4N90D 3D25B 1NGQH 3RY6C 1A5FL 2IQAB 3N06B 1AIFA 1NCCH 3UTSA 4TOYH 4WFFE 1CDBA 1A6TA 3V4VL 5L6YH 1Z0NA 3MRPA 5KVDL 3H3PH 4JO3L 4LIQE 4AG4L 4WHTA 4PJCA 2BVYA 2J4WH 5A2IH 1P1ZA 5GS2D 5FUOH 2VSDA 4EI5C 1NCTA 5BO1L 2Y6SC 3M07A 1AXTL 3BN9C 3KXFE 4KK8C 3KS0J 4L9DA 5HHMB 4H1LA 3IKCA 5JO5B 4CADB 4W6YB 1JPTH 2CDEB 1F6LL 3ARTA 3RIFF 5KSUB 3N1GC 4M7KH 3LQMA 2Y25A 3SGEH 4YHYB 2BSSB 4MS8C 4U1LA 1L0YA 1J0KA 2XRAH 5C07B 3ES6B 2NX5D 4I0PB 3D85A 4Y7MA 3BKYH 3PP4H 4NYLA 3EGSB 5FUOL 5EIVA 1A1NA 5D6CB 43CAB 2VL4A 1JPSH 4Q6IC 3RI5K 3QXVA 5GRYA 1AGBB 3FAWA 3MUGA 3IJSA 3ZE0E 3O4LE 4IRJC 5BOPA 1YEJH 1Q38A 5GIRA 3MTRA 4M7KL 3RTQA 5F6IC 2R29L 1KPVB 3PQYA 3VXOB 4LCIL 3GSNH 5ID1B 2G9HB 2FX9L 4WI4A 1U95A 1OQXA 5EC1B 1CBVL 2BNUA 2GT9A 1I8KA 5GZND 2FHCA 4AEHL 1Y18A 3WDIA 1S9XB 4OD1L 2DF3A 5JW5B 2P7TB 4L1HA 4OBRA 4WW2B 4MNQA 3C9NA 5DK2A 4DOHB 4KZDL 4JPWH 2E6PA 2ZUQC 4L3CB 4Z7WA 1R3HA 1JZ5A 5J3HC 4NJ9L 4X98B 5TE6H 4P5MB 4U1GC 1JN6B 1LHZA 2YEZB 1YEJL 1YMMD 4NJAH 4QRPA 2DWDA 4NQSA 3CDYA 2KZWA 3ARVA 3GSNL 3RIAK 1PX3A 3O0RH 3EYOA 1EAJA 4OZGE 4Z7OE 5E8EA 3OAYH 4LLMA 1F00I 3VXUA 1OGAA 5D7LB 5D7JB 1Y6KR 3W5MA 2V7HA 4L3EB 4LCWB 1T1YB 1RHFA 3QO0A 5E2WH 4Z8FH 4JPWL 4S0TD 1TVBA 2ZCKL 1NGWB 2X44D 3HG1B 3AUVA 4GG6A 3K0WA 1D5BB 1NC2A 1FC1A 1LO0L 1I3GH 1FFRA 4Q6YA 3CC5B 2YR3A 4M48H 5T1LB 3CUPA 1HSAB 1YJDH 4HIEB 4NZRL 2Q7NA 5KW9H 3P9MB 2ZNXA 4U2ZA 3UTSE 1IL1B 5D70L 2X1WL 5A1AA 4GAFB 4CNIA 3QHFL 1AD0B 3FOMA 3ZT6A 4JJHA 5GSRB 1DTUA 5I6XC 4XNYL 5E2WL 1A7NH 2HP4A 2K7QA 1J5OL 2F58L 1T5XA 1NBYB 4OD2A 5GSVA 5TH2B 1HHIB 2RGSA 4HS3A 2P5EB 1DFBH 1I3GL 3BIKB 5IGXH 5C0AD 3QUXA 1XGTA 5SWQA 2HFEB 1XIWA 2EEBA 5KW9L 1DN0B 1DLFH 2V6HA 4ZUTA 4YXHL 3TFKC 4FZEH 1S7UA 2EXYD 3PDOB 3RU8H 3HZMA 5HVHC 5FOBA 2W0FB 4Z5RA 4QTIL 1EAPB 5INDA 1SQ2N 3V6FB 5ICYB 3S9DB 4RIRB 4YX2L 1T3FB 3T3MF 3AB0C 5TGBB 3GSNB 2EDDA 4FXKA 4X9GA 2NY0B 1CK0L 1TZHB 5E6ZA 5DD0L 3NFNB 1KCLA 1TXKA 1DFBL 2V9TA 3HPLB 3QIUA 1F42A 5D72H 4R2GC 5B3NA 4I2XB 4NNXB 2H8PA 2D7NA 4FZEL 3PQYE 3VXQA 1RZFH 4LIQL 4NKOA 5E9DA 2EZ0C 2FBJL 4OGYL 4DGYL 2I9TA 4KRPD 4XH2B 3S6CA 4MNQE 1IAII 1KTLA 2YRPA 4OT1H 4I9WD 3PWLB 1L7TH 4JQIL 5IB3B 3HZKA 2HT3D 1ZEAL 4FTVB 4AMKH 1LE5A 1VB9A 4G8IA 3E2HB 2ZOLB 2QQQA 5EBLA 4UMGA 4YNYA 4OGZA 5TF1H 1ED3B 1IM9D 1JFQL 2CIIB 1RZFL 2IWGA 4XZUA 5E03A 4LGSB 5ACZB 4IHOA 5EBMA 4LAQL 3CSYB 3G04A 5KG9A 3VXMA 4NQVB 1FO0H 1QA9B 3LCYA 4OT1L 3X3GH 3V79C 5C08B 4M4PA 3AREA 4RAUA 4GG6E 3SBWC 3U0TB 4AMKL 1A1MA 4MNGA 2F53B 4WI5A 1G9EA 5MP6L 1GOHA 4P2CG 4V2CB 4HIXH 3BT2H 3ZL4H 5TF1L 4I1NB 4GSDH 2YC1B 1VEOA 2IGFL 1KT2B 3VRIA 3HUJF 4G6AD 4AM0A 3IYLW 4WJ5B 2HT2D 4ORZC 1QHOA 2DKMA 2ZJSL 4CVZB 4KK9C 3M45A 1NANH 1KFAH 1IEBB 4ORGB 4GKNA 3X3GL 4ZSOE 3NVQA 4QEGA 4AIOA 4OM0H 1AKJA 1R5IA 1KACB 1I7UA 3I6LD 3ZSSA 2APVA 2NW3A 4ODVH 1RK1B 2JK5B 1IM9B 3ZL4L 3KXFB 2J6EA 5C0CA 4XNXH 4XNMB 2YMXL 5IEHB 4NDMB 1K8IB 5CJ8A 5FYJE 3NBNA 1YUHA 2FJGB 4I3SL 3EO9H 5K93A 3JVGA 5I71B 3DXAE 1S9WA 3KR3H 3K81A 1NAMA 2AVGA 3RAJH 4Y4HD 4HH9A 1ES0B 1KFAL 3MJ9L 5J4MA 4WVRA 4H1LH 4F57L 4RGMB 2NTSP 4OM0L 5MENE 1UWXK 4WU5B 1FFNA 4WNQA 5GS1C 3KJ4C 1KYOK 5HGDA 4PJHF 4N8CL 2O5XH 4YXKL 4DVBA 1WIOA 5E2TL 5BXFA 2FIKA 1ND0A 3V9FA 4AT6B 2G2RA 4PD4J 4RDQF 6FABH 3GKZA 3SKMA 4WU7B 2XZAH 5L8LB 4WHYG 3O4LB 4S1DC 5LQBL 1SBSH 5AUMA 1CU4H 1OWWA 5E9DE 3KR3L 3RWIA 2B0SH 3P4NA 4OZ4A 4U3CA 3DECA 2N56A 5KS9F 1AGEB 4YZFF 1XIWC 4R7NA 1QNZH 3UTTD 4L4VB 4QY8B 4YK4B 5JXAH 5JHDA 1NAKH 1MFDL 2DBLH 2HTLC 3O6KL 1A6UL 3CXHK 2XZAL 3M8OH 1FVCB 1TITA 4J1UA 5DFWH 1YNKH 4HK0A 2VITA 1A3RH 1CU4L 1P7HL 2G5BB 3GKWL 2Z35B 5HJ3A 1S9VB 4X6FA 5FV2A 2DL2A 3VXME 4KK6C 5I1AB 5T3XL 1CD8A 1M05A 4OZGB 5CBEA 1HWGB 3S34L 4RMQA 4D9RE 4ERSH 2VLMD 2P4AB 4NN7C 1R3LB 4GXVL 2VXQL 5EULV 1BD2A 1H3TA 2DLEA 1KIRB 2Z31A 2RIKA 2VABB 4OGXH 5CZXC 2BXYA 5T3XD 5GRJH 5C0GA 2DMCA 1YNKL 1MF2H 4H25A 1A3RL 2P42B 1ZVSB 2W60A 5DJYA 4XGZB 4YUEL 2X2YA 3MV8D 3WLWD 3L9RA 5EZJA 2H26A 1G0XA 3UTSB 4UDUA 1TQBC 1P84K 1URLA 1FE8H 5CJBA 4JN1L 4ERSL 4NQTA 4FFYL 2YD7A 3WUWG 3WS6A 3LKNB 1P1ZB 1NEZG 4AH2B 3AVEA 1N8ZA 2APFA 1A6VL 4UIKH 1U8LA 4IMLA 3LKOA 2GSGA 4M7JH 1FZMA 3KWWB 4S1RL 1AI1H 4F9LC 2XKUA 2VDQH 3AREC 1XGPB 1DBBH 4CDHA 4Y16A 4U1LB 4JQVA 4KVCH 4FQ2H 1HH9A 4ZO9A 4DKEH 1MAMH 2E5EA 3JWDC 3C8KA 5C0BA 3X11A 1LQSR 5GGUB 3D85B 4NWTH 4NYLB 3T04D 4HWBL 4UIKL 3BO8B 5I30L 5FYJH 4XAKD 3S3JA 4OI9A 4M7JL 3MUGB 3IJSB 3LH2H 1Q0XH 2PCPA 3QO1A 5GGTH 4EZMA 4POYA 4BFBD 5GIRB 2YD8A 5EZLB 3RTQB 3JWOL 3PQYB 4XVSH 5DO2C 1FVEA 2AXJA 3RZCB 3KJ6L 4N5UA 2NXYD 1TCMA 2GT9B 1Y18B 1G7HA 3CJJA 5SX5K 4D0DA 4GRMB 3G6AA 3HNSL 3F7PC 5JHDE 1GVIA 3WUWA 4RX4D 5J12B 1CS6A 2GTZA 3LKRA 3N50A 3UC0H 3A0OA 3EUUA 4WWID 5GGTL 2AQ2A 4Y5YB 3EJJX 4BUHA 5IBLC 2DWDB 3NZ8A 3CDFA 1I8MA 1W0VB 5DT1H 3HE7D 3WXWL 4Z7VE 3IS0X 2XA8H 3EYOB 5F89A 4D94A 4M1GH 5E8EB 1VFUA 2D7OA 4FNLL 1D3CA 2XWTA 2V7HB 4E0RA 5LBSH 5I2IA 1LDSA 2R1XB 3QO0B 5EU7C 1BD2E 4N0CD 3PF2A 4HWZA 4JHBA 4WTZA 2ZUXA 1I7TA 3MA9L 4GG6B 3HZVA 4QHMB 4OZIA 1VADA 1NC2B 3FJTA 4UBDD 3MLYH 4H26B 5DJ2B 1S3KH 3QDJA 3NCCB 2FHFA 2HKHH 4JCLA 2OR9H 5GPRA 1B90A 1NGYA 4FQXD 4CVUA 2G75B 3KLAB 3RL2B 1GIGL 4B7LA 5IVXF 3OAUH 3FOMB 4RGNE 4QRRE 1S7SA 4U7KA 5C0FA 3UPRA 3ARDB 4POZD 1REIA 4L9LC 5LBSL 4LOUC 3QPXL 2VH5H 4XWOC 3JWDH 1QFPA 3LDBC 1PY9A 2H6PA 5EBWA 4ZSOB 4OD2B 3RFZC 1PYWA 2MQCA 5FYKE 3G5YA 2C5DC 2HRLA 5F7FA 2PYED 1U8HA 2EIZB 3TO2A 3QUXB 3HAEG 1B2WL 4TSCH 3HE6A 1XGTB 1YN7A 5SWQB 3BGAA 3SE3C 1T21A 2H9GA 1MCCA 1S7UB 2CUIA 3GZKA 3HZMB 5E6IC 4EI6B 4JGMA 4Z5RB 1OLLA 1IQWH 3S97C 3VFPB 2IBZX 5IHZA 3DXAB 4GMSL 1DBAL 3FCTA 3DVGA 3BVNB 3VFMA 2J6EH 1VESA 4D9QD 1P7QD 1KEGL 1A9EB 5MENB 4FXKB 3WIHL 1M7XA 3DVNA 2BVUA 4HFUH 1C1EL 4NKDB 1I7ZB 4RMSA 1QP1A 4JFHE 2JB6A 5IF0A 4JFXA 3U9UB 1NAMH 2QADC 5F7KC 4TSCL 2GJ6D 1HINH 4NQUA 1MHHA 1K3IA 2H8PB 2ATPA 4MXQD 4RFOH 1A9BB 4WFGE 3ARFD 4G8EB 5DRZB 2EH8H 2W9DH 1IQWL 1NDMB 3E0GA 1K9TA 5E9DB 1BZ9A 4UI2A 3MRDA 4F9LA 3LEVH 1A6WH 3KPNB 4F37F 5EOCJ 2I9TB 1KTLB 1AH1A 4NRZB 5TDOB 1IGJA 1TNMA 1G6RA 3U82B 1DE4B 3HZKB 4HFUL 3X14A 3L7EA 3SE9H 4JQVC 1LE5B 4RSVA 1MFNA 2MQ3A 2OBGA 1NCUA 5EBLB 1HINL 3W81A 5DJ0A 5HHNA 4MJ6B 1N26A 3P4OB 5ILTH 5LGKA 4LFHG 1WWAX 3SDCC 2EDYA 4FQ1H 4NZDA 4IHOB 5EBMB 3BOVA 3QB7C 2X89D 2X1PA 5JW4N 5CD5C 4N8VB 3VXMB 2ADFL 2GHWB 2DQIL 1E28B 5I75C 5C0ND 4PP2A 4J8RA 3MBEB 3OJDB 1B0GA 3KYNA 4OZIE 2WLZA 1KN4H 3EYVA 3SGDH 3ULUC 4XP5H 3AAZB 3LZFH 3IKKA 1CZ8H 5FECB 3IJHA 4GS7C 2W65A 5JIPA 5E4EB 1I85C 3HS0A 5EZIH 4AM0B 3VFOA 2OR7A 4FQ1L 1CE1H 5ACLA 1BF8A 1F5WA 2F5BH 5CBAA 3BAEH 3O6FB 3EO1A 4H88L 5DDHA 1BFVL 5I1JL 1C12B 1AGCA 1MAJA 4HT1H 4PB0H 4UB0L 5FM4A 4CL7A 3MOBH 3VGAC 1AKJB 1V3KA 3RWFA 4WHYH 3SKJL 1R5IB 4TPRH 2P8LA 1SM3L 2ZWLT 4MSWA 3SGJC 1CZ8L 2P47B 5M7QA 2NW3B 3DMMD 1OGTA 5A2KH 1Z9SA 1C7TA 4KJQD 2IMMA 5IVZB 1DVFB 3SDAA 5FKPA 1WQVT 2XWJA 1YUHB 3QEHB 4ODHH 4BSVB 1HXMA 5L9DL 3O8XC 5J6GA 3RVWD 1GOFA 4HH9B 3VH8G 1GL4B 4U1NB 4N1CA 5FYKH 3ULVC 2I5YL 5MEQA 4NN5B 4PB0L 2HLFC 3K7UA 3BMWA 3MOBL 2OLDA 5I1LA 4HEPG 1FFNB 4WNQB 4UQ3A 4TPRL 1NPUA 3I3BA 1X5FA 1C5BH 4CAGA 5BXFB 1ND0B 5CJQL 1S7VA 4NQEB 2G2RB 5L0QB 2AJXL 1NBQA 1T7XA 4N0UA 3SKMB 3S88L 4P2OA 4PJXA 1G84A 5AUMB 3RWIB 5IB2A 3P4NB 4OZ4B 1PJ9A 3EJYD 4W70A 3RL1B 5DJDB 4MNHA 3HE6C 1MCFA 4HHAB 1C7SA 4MD0A 4I3RH 4R8WH 4R7NB 4K2UH 1S5IH 5JHDB 3MGTB 2OK0L 4WI7A 3HLAA 7FABH 1QHPA 2VLRD 1HN1A 1B4RA 4PS4H 5BV7H 1YYMH 4GKOA 4XI5D 3INUH 1J1OH 2Q8AH 4L8SA 4CU7A 4LPVA 5JORB 5DGQA 2OZ4A 3V7AG 2XZQL 4P57A 1T5WA 4PJ9D 1DANT 4FFVC 5HJ3B 4ODTH 4CU6A 4PG9A 4Y4FB 2IEPA 4Z7VB 3VXNB 4O4YH 3UJIH 1MELA 3VH8A 4OKVB 5CBEB 1IAKA 4KZEH 4ODSL 4I3RL 3W11D 1YECL 5TDPA 2BSRB 4D3CH 1QBMH 1BD2B 1G7JA 2Z31B 2VIRB 5I76B 1GCFA 5B8CA 1FYTD 5BV7L 2AS5M 1TVHA 4H0HB 3D5OF 3INUL 4HS6A 2YD2A 4OCXH 1JHTB 4X5WA 5C0GB 1OAUL 4FG6C 1UJTA 3MRIA 3NGBC 3C5SA 4PBXA 4PP1C 4XBEH 3WSQH 1UZ6F 1EO8H 1BQLH 2W60B 5DJYB 3B8YA 4ODTL 5EZJB 5GRZA 2H26B 2VN4A 4HUXA 5SWZD 1N64L 3LQAH 4UDUB 4Y19D 5IB4A 3OV6A 3FO1B 4KZEL 3F7YB 2M26A 4G7VH 2D9QB 4QRRB 4RGNB 5DJCA 5I16A 1NGPL 2GW5A 4HGWB 4FQJH 5EA0H 2AGJH 2BY3A 2OXHA 4R3SA 1F58H 3L3IA 1N8ZB 1KCUH 2XFXB 3K1DA 3MYJA 1K2DB 2HVKB 2DQCL 3O6LL 3D3VB 4JDTL 4HXBL 1U8LB 2GSGB 1FZMB 4DN3H 3KYAA 3QJHA 1OQOA 5K59E 2CRMA 4QKXB 2VC2H 5JA8B 4KUZL 5DTFA 1PSKH 1LE9A 4Y16B 1CICD 3NCBB 4X0KA 1HH9B 1FN4B 5I15H 4G7VL 2AK1L 3X11B 1FFOB 1Q72L 5JW4Q 3TT3H 3RVVC 2HG5B 1F3DH 3SDXF 1AXIB 1IARB 4HBQA 1CDUA 1CFQA 3QIBA 3LS5H 4DN3L 2H41A 4PJXE 1XR9B 4KTEH 1AC0A 2PCPB 2D7TL 4YHIA 2A1WH 1OM3L 3ARGD 2CR6A 5L2KA 2B20A 1MCWW 5BV7B 2L7JA 1FG9C 5I15L 4XTRD 1FVEB 3LSOA 1FGVH 3TBTA 3RWEB 3G5XA 4PLKC 5E8NB 4PJCF 2IH3B 5I1GH 1G7HB 3PV7A 3FB6A 3SDAC 4K7PL 1T6WA 3RX8A 5FYLE 3QEUA 5ESAB 1D5IH 1JMXA 1E4XI 5JIHA 2H2PD 3BWAB 4P23B 2NZ9D 4ZOCA 3VWKA 2WUCL 1FG2A 3VGFA 5GGVH 4Y8DC 3GI9L 3DHJA 2FRGP 1MQKH 3IXAB 1R6VA 5BZDA 4HKZA 3FZUC 4TTGA 1JJUA 4PJGA 4XVUC 5I1HH 4FQIH 1G6RH 1U8MA 3KPOA 1FGVL 4PUBH 2LABA 1IT9H 5IB5B 3BN3B 3FAXA 3MGOA 1CN4A 4E0RB 1IAIM 3QQ9D 2AXHA 3B2VH 2OCFD 2P45B 1P7KB 2EC8A 2VTFA 1MEXH 1I7TB 2ENSA 4OZIB 1AQDA 4R4NC 4J3XA 2YD3A 2Y06L 3TVMA 2DQHL 2LU7A 3WNNA 2FJFA 5JHLH 1M7DA 4X4YA 4M00A 1MJUL 2FSEB 3CLFH 4C57C 4NKMA 4TSBH 25C8L 1G6RL 3LRSB 4Z7UF 1XGUA 3BP4A 1JGUH 5ITBH 1S7SB 4R0LA 5DI8A 5C0FB 3KAAA 3UPRB 2E7MA 5AG8A 4C59B 2LVEA 4KMTH 5I8OL 1EHLL 3ZDXF 4Z7WF 2H6PB 2GEEA 1IAIL 5I1CL 1EO5A 1PYWB 5I9QC 2UYLA 3G5YB 4M43H 3HI6L 2X05A 3X12B 5BRZA 3RNQA 1L9MA 4GRLC 4ZXBC 1A7QL 5K9QG 1U8HB 1JHLH 5JHLL 3JXAA 3CLFL 3DX8A 1TTFA 2D7PA 2HT4D 1OARH 4TSBL 4LSTH 1IC5H 4X7SH 2APTA 4R90H 5CS7A 4MJIE 4UOW0 4BQ9A 5B8CC 5IHZB 2BOCB 1FBIH 1D7FA 3U7YH 1JGVH 4R7DA 5KSAA 1IQDA 3D9AL 3FCTB 4MWFB 3K8MA 4JCMA 4DUXA 1RU9H 3VFMB 2ZUYA 3T4AA 4EXPX 4TNWF 2AEPL 4PRPA 4G9FA 4JREC 4IRSD 4JFFD 4DFHA 3DSFH 3DETC 4XRCA 3RWCA 4GAYA 1I8IA 5IF0B 4JFXB 1JHLL 3PXJA 4U1MB 1A22B 1HNGA 1AR1C 4HC1A 1KJMB 1MHHB 1OARL 3VI4E 4Y4KD 1IGFL 5L2KE 4B5EA 2ATPB 1U9KA 3QWOB 1MIMH 1NSNL 5CP3H 1KJVA 2WIMA 1BZ9B 3MRDB 2ZNWA 4O2CA 5DK0A 4NHCH 1EEZB 3LN4B 4M62H 5HY9A 2E9BA 5C1MB 4WFED 1JYXA 4JRXD 1IGJB 1G6RB 2NLJB 3DSFL 1KJ3H 2FBOJ 3L7EB 1KNOA 4L3AA 3L6FB 5A2JH 4N9OB 2D0GA 1QSEA 3QJFA 4ETQA 4QHUA 2QQKL 2Z8VC 2P5WA 4G3YH 1BOYA 5DJ0B 5GHWL 4PJFF 4NPYA 5HHNB 3ARBC 3QAZB 1MIML 4JPVL 4PJGE 3GMQB 5DZNA 1AO7D 4U6YA 5F7HA 5DURB 1RUPL 3SE4C 5FYLH 3AFLA 1KIUA 3N85H 1H3WM 2O5ZL 3CFEA 1H8NA 1BIIA 1GC1L 1FDLL 3MUJA 4LSPL 3IFLH 1AR2A 3ET9F 1IZJA 2NY6B 4WFHE 3QNYA 2OZ4H 1RJCA 2PO6A 1R3IH 4KDTA 3BPCA 1AE6L 3IDYB 3KYNB 4J6RL 5F9DC 5CIPA 3IJHB 3Q5OA 2ESVA 4G3YL 3B9VA 1ZOXA 3CLEL 1SJVA 1HCVA 3CNKA 3HS0B 4MAYD 3VFOB 5ID0A 2EYTA 1QOKA 1QSFD 4KJYA 1VGKA 3GGWB 2DLGA 1U41A 2A0LD 3IFPA 5EU5B 3C60D 3VWKC 1ZGLA 2E7BA 4LARH 3UO1H 5DDHB 3OHXA 1T04A 3QNXA 5D2NC 5B39G 2A6IB 3RWFB 4RFNB 1CT8B 3FMGL 4XMLH 2P8LB 3P4MA 2GJZA 3EYQD 5L2JB 2VR4A 1INDH 1OGTB 1T1XB 1UKSA 5CSZB 1JHKL 4DCQA 3HB3D 1F2XK 4TNVK 2XWJB 3I6GA 1YEIH 1HXMB 2NXZC 4ZAKB 5J6GB 3G9AB 1OSPL 3PWJA 3TVMC 4LARL 2QSCH 3K80A 3UO1L 1MCHA 4F7TA 1E6JL 1XF2A 3RVUC 2LFGA 5I1LB 4PRPE 1A02N 5E4IA 4UQ3B 3CFBB 1LO3L 5J56B 5AWNH 3F8UB 3CVHA 5FK9A 5L7XH 2EDXA 3FOLA 3MZTA 1INDL 4NZJA 1S78D 2CKBA 3MCLH 2YPKA 3KPSD 4P2OB 4PJXB 4BQ6A 3SCMC 1WAAF 4JZJA 3D0VA 2JJUA 4ZUUB 2APBA 5IB2B 1JUFA 1HQRA 3QIWC 2QSCL 4HJJH 3G6DL 2FWOA 1Z2KA 1G9ML 3L95A 2AQ1A 2FGWH 1MHCA 1UWXH 4MD0B 4FQHA 3IU4H 5HDQH 4FMKA 2IAMD 2VXVH 4OLUL 5TE4L 1P2CA 2P8PB 5B39A 5SWSD 1KTKE 2BXZA 1NGZA 3TPUA 5L7XL 2P5WE 4L8SB 4MB3A 2QHRH 1I7RA 4PJDE 4JY6A 2AJVL 4P57B 1ZS8B 4OLZH 2SEBA 1ZTXH 1PKQA 5EO9A 4P4KC 2BHZA 5FHAL 4F3FB 1CXHA 3H42L 1KELL 2ARWA 3MUZ1 2Z92B 3VH8B 2FGWL 2CDFA 4X9IA 3KYMB 4L1DA 2MCPH 4R4FH 1D5XA 1F4AA 2VXVL 2BVOA 2G60L 4QRTA 1G7JB 3ZHKA 5F1IA 1MHEB 1Q9KB 1RMFH 2ESVE 4N68A 3EYFA 1A6ZA 5I74B 3RUGA 3TO4A 4XPGL 1NKRA 2GAZA 3MRIB 5KVFL 3MOQA 2P46B 2VN7A 1ZTXL 4XB7A 3S37L 4EI5D 3RVXC 2Y6SD 4LVNC 3BN9D 4KUCF 1RZ7L 1QSZA 1FORL 4KK8D 4HUXB 1SJEA 5IB4B 1W72A 4ELKA 1FJ1A 4APQA 3MCKA 3ZKQD 4HIHB 5EOCL 5DJCB 5IIEA 3MLWH 5D6DA 5I16B 4NKIH 5LVEA 4G6MH 1CFNA 1VPOH 3MSPA 3FQNA 3MLXH 3OGCB 3OKEA 4MS8D 4R3SB 3UAJC 3FT3A 3OSKA 1RMFL 2V2TA 1OHQA 3OF6D 3OKMA 3DO7A 4NCC2 3RWHB 3C6LC 3Q1SL 1A8JH 4GXUM 3QJHB 2PO6C 4LASH 1NMCC 2WLYA 3P4LA 4UNVA 3U4EA 3H9ZA 4YDIL 5ISZA 5DTFB 3RNKA 4K94C 4FABH 4FXLA 1LE9B 3EIFA 1F4XL 4WFFD 2Z93A 5DMJB 5TDNA 2JF1A 4MJIB 4J3UA 2J88H 4IRJD 4OFYA 1T83A 3QUKA 4DAGL 1FSKB 1HILB 2C1OA 5F97E 5DRXB 1FH5H 3BZ4A 4X4XA 3OWEA 1CGSH 1U3HC 3MRBA 4OI8A 1DSFH 1MWAA 1DBML 1CFQB 3QIBB 5D8JH 3VG9C 5FA3A 3FQTA 4YDKL 4KV5F 5E8PA 4DEPC 2ADGB 3QBTB 4G6JL 4FABL 4UUJA 4KU1A 5L2KB 4M03A 5E2UL 1P4LA 3LRGA 4KVNH 1CFBA 2J88L 4OCNC 4WV1B 5J3HD 3LHPL 4YBHA 2VLJD 2JCCA 2PTTA 4ONHA 3JBG7 4JHAH