3TFKC

42f3-p4b10/h2-ld
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
201
structure length
201
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H2-Ld SBM2
total genus 34
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC01
4IOFD 4XP4L 4P46A 4JO1H 5JW5B 2EXYC 3L5IA 4AZ8A 1B6DA 1F4YL 4ENED 3Q48A 1I1YA 2DRUA 1NFIB 4JGJA 4TSAL 4I0PD 1D6VL 1QBBA 2C1OB 2HJFB 1MREH 2PXYD 3LKOA 4M9OA 2WINB 5SX5K 5AYUH 1FL6A 2WNGA 1UM6H 1H3VA 4MD5A 4WW2F 1CZ8H 2OI9B 1X5ZA 1BVLB 3BE1L 2PYFB 3GKZA 3T8XA 1V7NL 4N8CL 1DCLA 1ZMYA 2VDNL 2YPVL 3SOBH 5KG9B 5HHMD 3OXRA 3QNYA 2KQMA 1DP0A 4POYA 2YEZB 1N8ZB 4CMHB 3D48R 2E7LA 5IIEA 5JPMB 1JGVL 1CE1L 2VLRE 3EOBA 3ZE1E 4YXHH 2EDJA 1P2CA 3DSFH 3BJ91 4QXUL 3EFFB 4JFFA 2FIKB 3NBNA 2DDQH 2OR7A 4GG6F 5HGHA 4NT6B 3VGBA 1T0MA 4OTXL 4RBPK 3BFOA 4HGKC 5D1XC 2E9BA 3O6MH 4UAOB 1LO2L 4XXDB 4WNQA 4U1GB 2ZNXA 1UGNA 3MLTA 5FUCE 3DRQA 5D1ZB 5J1AB 2B0SL 5ID0A 4JFZH 4N9OB 4DW2L 4PJGA 5C0ND 3OXSB 1NSNL 1LE9B 1HH6B 3QWRD 4Z0XB 2VDOL 5BMFL 3P9LB 4G43B 3GSXA 2F53A 2LV4A 5F7NC 3LY6A 1NC4B 2VC2H 3AB0C 1K9TA 2IH1A 3BP7B 4MDJA 4UILL 2HVJB 2VQ1B 3LD8C 1DJSA 3H42H 4IJ3C 3CCHB 3B9KD 4KHXL 3VA2C 1TZHA 4K3DL 1Z3GH 4MNGE 3WNMA 4WHYG 4Z95H 5HGGS 3BGAA 2OQJB 4OCMC 1FRGL 1O7SA 1J0HA 2YSSA 4PJBF 5GGUA 2BVOA 3ARFB 2G9HB 3B9EA 1VFBB 5FEBA 1VEPA 4U1HB 4NN7C 4NHUB 1U8LB 1WIOA 3TO2A 3HLAB 3KYKH 1UKQA 4P2OB 4YFDB 4JAMB 1FGNH 1AKJB 3RGHA 2W38A 1JGLH 2FX9H 4MZ3A 1BF8A 1FNFA 2C7UA 4PGEA 2FHFA 4NOFA 5C6TL 4W6YB 1VEOA 3NCJH 4HC1H 4S1SL 2J7LA 2GIYA 3OF6D 4RQQB 3ZDXE 3CDCA 1A6WL 5CEZL 5I73C 5DI8A 3WLWD 3ZZ1A 2QQQA 3BDYH 1EVUA 1XEDA 3AAZA 4Y19A 3P0YH 5LCVL 1IBGH 3X13A 1HIML 2Q7YA 2Y06L 4F7MB 4LCUA 3AREC 1JRHI 4WFEE 3P11H 3G6AB 2OTUB 3H2WA 4LKXA 5JZ7D 3HG1D 2E9IA 2HRLA 5CINL 4LNRA 2D4DA 4Y19B 5ACMA 2HKHL 4PRAA 1SEQH 3GB7B 3CXDH 2A2QT 1QHOA 4P2CG 4YXLH 3E3QC 1OP3K 3VCLB 4Y1AD 5GJTL 2OBGA 3DNKA 4I0PC 1LNUA 2DWDB 3JWDH 1ADQH 4PP1D 4LFHG 4CW1B 3V6OA 3HUJA 2R0LL 4JG0H 3O0RL 2ZCHL 3KPNB 3L6FA 3RNKA 3MA9H 5C70A 1HN1A 4IDJH 4JDVA 4GG6A 2R8SH 3C8KA 2DMCA 5DGQA 1CDGA 1A14L 4HH8A 2BSTB 4HULB 1A9EA 5JOPE 4X6BA 2IPTL 4OF0A 2C3VA 4X5XB 4FS0A 2R2BB 2MQ0A 3FQNA 3F12A 2Z31C 1N0LA 5I75C 3T3PE 5H94A 4PJDE 1ZV5A 5K9QG 4F7TA 3HNSH 4LPWA 3MR9A 3RUGB 1NANI 2HAZA 4OFKA 3K8KA 4Q6IA 2XZZA 3OB0K 1V3LA 1HILB 4WI5A 2DN7A 4WWKD 3LS5L 3TA3A 5T3XE 2BOBB 4JQVC 4ALAH 3VGGA 5EIIB 8CGTA 5K9OB 5GS2H 1L0QA 4Z77A 5ANME 3MO1A 1MHCA 4X6FB 2F5AL 1RZGA 3SQOL 2P5EE 5DRWA 4X5XA 3QIBA 1RIVL 4HBCH 5T3ZL 3WDIA 3C5JA 1YY9C 1KEGL 5DFVC 4FABL 3WHXA 4E42A 3FKUS 2J88L 2AK4B 2EEAA 5E8PA 3FONA 1B0RB 3BQUD 4HIHB 4Z5RA 5HDBE 2YK1H 2EH7H 1B90A 5AZ2H 7CGTA 3L5WB 5IVNA 1JPTH 2R56H 2E9WA 5SWZE 2ADJB 3QDGB 1FNEB 4QCIB 4GAGL 3MRKB 3SDYH 1ZLSL 4ZUSB 3D69B 1UM5H 3I3EA 1EO8H 3KPMA 4DGYL 2MCPH 1MIEH 1H8SA 1QLRB 4UOJA 3SJVE 1EFXB 3S8WA 1SMAA 1AC6A 3WCYA 5E8PB 2OK0L 4NZDA 4PJAF 4Y5XC 3VXTA 4NFCA 1KPVA 4OQTL 1I3GH 4M02A 3UPCA 1CGVA 4TOYH 3DXAA 1R6VA 2E6QA 1U92B 3QDJB 5SWZD 1AD0A 3RUGE 2ERJB 2DLIA 5TF1L 2P42B 4LDLB 4WHTB 5H37H 4DVRL 5JLZA 3SGJA 2Y6SD 3NFSH 3GIVB 3CVHH 2DQIL 4KI5C 4M8QB 1DN0B 1UYWL 3DXAB 1GC1H 1JTTA 3O8XD 5HI3C 1L0YA 3T2PA 4D9QD 3MRMB 5F7DB 4WTZA 1JIBA 5J9PA 1FC2D 1IGML 3EDEA 1Z9SA 2OL3H 1BD2E 1CXHA 1U8MB 5T3XD 2YC1B 4H5SA 1NCDH 4W81A 4QY8B 3QIBD 1FE8L 1HZHH 1GVIA 2FIRT 4NO2A 3QUXC 4FQ1H 3LHPL 2D7OA 2NXZC 3QCUL 5I1LB 2X89D 3VFMA 3V6FB 4K7PX 4UNVA 2FBJL 3G08B 1H3UA 1OAQL 2VN7A 5D7KD 1D6VH 1NGWA 4HS8H 5GGSA 5GRYA 4WUUE 4I4WB 1NGZB 1VKXA 1A7PL 3RY6A 1FG2B 1NKRA 3RBGA 4KZEL 4I5BB 5JIPA 3BE1H 4MDIB 3WHE0 4M61A 1IZKA 1IC4H 4NQSA 2HYMA 2F8OA 1S9YB 1HHJA 1GJIA 1JI2A 3MPCA 4TSCH 2EXYD 3WD5L 3GJFA 1BP3B 4I0KA 2J5LB 3LEXB 1IARB 4RWYH 5C86A 1G7PB 2GEEA 2K1MA 5B4MC 3GMPB 5IB1B 2EIEA 2Q8BL 1CD1A 3F6LA 4P5TC 1QQDA 1JGVH 4HKXA 4PLKC 2G5BA 4QXUH 1BBDL 3PDOB 4WUUB 2DDQL 2HKFL 3OR6A 4JRXE 3VWJC 2HMID 3T1FB 4TRPH 4YO0A 3AS3A 1KJ2H 5I1JL 1KCUL 5BXFB 1N4XH 5H35A 3MLVL 1N2RB 3DX7A 4AEIH 3EGSA 1YEKL 1G7QA 2BXYA 5IEHA 1QNZH 1KN4L 4G6KL 1IE5A 2AKRA 1NDGA 1OSPL 5CJBA 5CD5C 5BMFH 1C12A 1G1CA 5DC9B 1J0YA 2RCSH 2H3NB 3QXUA 3GEWB 1MHEB 3VFVA 1Q1JL 1RIUL 1KB5A 3PNWB 4NCC1 4CN6A 4NNPL 5C0JB 2DWDA 2EEBA 2NY3D 1JPFB 1WBYA 1QFUL 2A6IA 4RSVA 5JDSA 3CLEL 3OF6A 1IEBA 2X2YA 3H42L 4QRRE 5TPWL 4U1LA 1AI1H 2XIDA 5JHDB 4K3DH 1RULL 2X40A 4Z95L 3OKYA 4NHCH 3ORJA 2IH3B 3I2CL 3S7GA 1FRGH 5I71B 4GQPH 4NQXA 4X5WB 1S7QA 2UYLB 2X42A 3VD9A 3BW9B 1PKOA 3WS3B 4HX1A 4F7CB 3FB7B 4Y4HD 1DLHA 5ISZA 2FLBT 5I6XC 5MP6H 3QI9D 4Z8FH 2ZSVA 5IB3A 3RL1B 2NY2B 4F7EA 5F70A 5MHSD 5ERWB 5IEHB 3V2AR 2M8XA 4MCZB 4PFEA 4S1SH 4F7CA 5F6HI 2ZUYA 2MPAL 5IEKA 3Q6FA 3TP4A 3TV3H 3NFNA 1R0AH 5HGBB 1ZLUH 12E8L 2CK2A 3AFLA 1HQRB 5FGBA 1BREA 1HI6B 4YE4H 2VXSL 3V0AC 4JRYA 2BSSB 4ONOA 3QDJD 5CINH 1CTNA 4GS7B 3O41B 4JFEB 4Q58C 1TPXB 5DSCA 1MF2H 2XWBA 5D1XA 4QHMB 3L7EA 2J8OA 4LMQI 1NFDE 5BO1L 3VXSD 3CC5A 1J5OL 3JWDL 1OL0A 3BD4A 4FQ2L 4P4RB 4GO6B 5CWSB 2R4SH 5I18L 3FT2A 3VG0H 1R3IL 1JZ7A 5EU5B 5BV7B 5CZVH 5ACLA 4P99A 3MA9L 3QIUA 4IDJL 4S1DD 2FX8H 1A8JH 5J12C 3QUXB 4LLWB 4H88H 1CDUA 1JK8A 4PY8J 5DRXA 1G7IA 1YECL 3LRSA 3JXAA 5EZJA 1MCRA 4M6NH 4ZFFA 4LDOB 3UAJD 4I48A 5ISZD 1JPGA 4NZUL 1X5YA 4V1DD 1NMBL 2FCBA 4FQQB 4R97C 4UNTA 4U6VH 5JR1H 3BN9D 4ONHA 4J3UA 3QUZD 3MLWH 1OB1B 1P7QB 2Y6SC 3NVQA 3J8F7 4PIRF 4V1DE 4MVBC 5ITBH 3QUYC 1NGPL 1V3KA 3U6RA 4HBCL 4HWNA 5ESVA 2WLZA 3CU7A 4YHKL 5C07B 4ZD3L 2KKQA 3PUCA 5DDHB 5EOTA 5GGTL 1UB5A 4G6ML 5D8JL 3I6KB 3QZWA 1TJHH 4M6OH 4BZ2H 3WIFB 4EUPB 3HAEB 2ORBL 4I3GA 3OQ3B 4MXWH 2EH7L 4Y8DC 5AAMA 3GSQB 3QEUB 5ID1A 1IAII 1JPTL 2R56L 3MACH 4WIQA 1NC2D 4DTGH 1ND0B 3BYYA 5DYOA 4O02H 4Z7VF 3THML 5JIKA 43C9B 2VRAA 1H3GA 2HN7B 3O45A 4OFIA 5BV7L 4G7YH 1ZT4A 2BNRE 4QXGH 4ZO7A 4ODSL 2K7PA 1U3ZA 1XIWB 2OMBA 1EO8L 7FABH 4PGZA 2IANA 2VDMH 4X98A 4O9HL 2NLJB 3QT2A 1W0VA 2D03L 3U1SH 3UZVB 1CVSC 2IAMC 3QUYA 1N6QH 2CUIA 1EEZA 3G6JE 1MHCB 4N0UB 2QHRL 1MH5B 4Y0GA 3V4UL 2F8VA 1UWEH 3HNTH 4B50A 5SWSA 4PJXB 3TIDA 5IVZB 1RUKH 4BFBD 3GIVA 4PRHD 4OLWH 4WI9A 2PXYC 4PY7B 1KTLA 3K2UL 2F19H 3P4NB 2D7PA 5CS7A 1GC1L 4U2ZA 1NH6A 5F88B 4OZGA 2F54D 1EHLH 4LSUL 1MRFL 4XHJC 5KN5A 1BQHA 5JPNA 4XP6H 4WI4A 1U8KA 5JDSB 4JB9L 4QGTA 3K7UA 1F6LL 4U6YB 1FV1A 2X70B 4KK5C 1UJ3C 5D96B 2XN9E 4RA0C 1DQJB 3HB3C 1T20B 3ES6B 5FOBB 1CLCA 3F8UB 3TVMA 3R0MA 2QQKL 1RZFL 5HHXL 5D2NC 4YFLF 3C5ZC 4OQTA 4ZTPH 1QBAA 5GGUB 1AR1C 3WIIL 5HHMB 1U93B 1QVOB 3O4LD 4Y4KB 4DKEL 2A6DA 4XPHH 5C9JB 2GJ6D 5ESAA 4PJIE 4LSSL 3ZYZA 4IHOB 4JDZA 3CH1A 4NSKB 2OP4L 2V9QA 4CVWA 5DJ2B 5FB8A 1H0DB 3EOYG 1CFSA 1RIHL 5F72S 1OSZA 3SKJL 5I75B 2VLJA 3W39A 3CVIH 1XGRB 4IM8A 4MA1B 4BFGA 3MJ7A 5T1MB 5KVDH 1GC1C 5C3TA 4AIOA 2WLYA 2IMNA 1XAUA 1JRHH 1GL4B 3BT2L 4F58H 4Z7OF 3SDDD 4PTTA 1FFOB 2CRYA 3VFGH 1KCSL 1FC1A 2P8PA 2A6JA 2ITCB 2DQJL 4F7MA 4D0BB 3B8SA 1OGTA 2NY4B 5FM4A 1ZLVK 1FNLA 2IGFH 3WNLA 1CFNB 1KJ2L 4JQIH 1BEYL 3SKOA 1H3TA 3D85A 4HCRL 1JNHB 5I17A 1LQSR 3MLVH 4YEFA 3UX9B 4B41A 2UVEA 2YD5A 3SDAB 4UTAH 3DIFA 1F3DJ 4GBXB 4S0TD 2A74B 4OKVA 4TUKL 3BPLB 1A4KB 3BSZL 4Z7WE 4QRPB 2BVUA 3IFPB 4FQCH 4BH7A 1JF5A 3VWJD 5D1XB 3IDUA 4M7ZC 1FVCA 4N5EC 3P77B 4U6XB 4M7KL 1HXMB 3CMGA 3TBSA 2X05A 4OCRL 4FQPA 3BHBB 4LSTL 1QP1A 2OTPA 1RZJC 2J2ZA 2Y07L 4UDUB 2BNRB 5IJKA 2UZIL 1FNHA 3BOVA 2VERN 3MV7A 4LCCB 1U8QB 4DOHE 2P49B 1N59B 4LSQH 4ONGH 5L2JB 2MJWA 1D5MB 4QWWD 4Z0XA 5T1DL 1U3YA 4K8RC 3OAYH 4OB5H 2Z93A 1YYML 1RMFL 2ZP0T 4U6HB 3L95A 3QWRA 4PJHB 3QXAA 1ZE3C 5CZXD 3PWPE 4L29A 4YXKL 5DMIH 1AC0A 2FO1A 3BPNC 3UTSD 3GUTB 1QKZL 3MRGB 1RFDH 1IMHC 3QFJE 1KGCE 4ZUVA 3C60B 2OZ4H 4P2OD 2BVOB 4YHNA 1XIWC 5T5NG 3QQ4A 3QULB 2ICEA 4OZHB 3HCVB 1L6XA 4X7SL 4FZEL 1CXIA 2NY0C 4NNYB 2BSRA 5J89A 4G6JH 1XF3B 4MJ4A 4WHDA 3JV4B 4YAQB 1SY6L 4H20L 1K5NA 1NCCH 1PDKA 5ID1B 1DVFD 3S37X 3ZE1F 3GIZL 5C0JA 4LHUG 1QG3A 1JMZA 3ARTA 5ENWA 4PGJA 3QQNA 3JVGC 5AYQA 4JRWA 2OR9L 3U2SA 4MCYA 4UT9L 1J1OL 5HXMA 1J5OH 4FQ2H 43CAB 3S36X 5FA4A 4LCWD 1PLGH 4K3HA 1JYVA 1P5VA 2H1PL 1DLFH 2BMKB 3T0ED 3PL6D 2WIIA 2CSPA 4K3JH 3MNZB 4FFVD 3VFWA 1YECH 1AO7A 5GGRY 4TVPH 4YDLB 1M7DA 2F54E 4HGWB 1IM9D 5ELIA 4JFEE 4NZUH 4WDIB 1T22B 1OGAE 3MRCA 4Y5VA 4MJIB 2A0LC 4F33B 1RPQA 1UCBL 1MFCL 2GTWB 3HMXH 4PJXF 3N50A 3ULVE 2RAMA 1OARL 1FL5A 1F45A 2C3HA 4E5XA 4MNQA 5C8JB 3SGDH 3CPLB 3SEPA 2NX5D 3MLWL 4I3RL 5E2WL 3S4SB 2IANE 2OTWA 4O58L 1N0XH 2Z0BA 5HHOB 4R4BB 2F53D 2DQDL 4D2NA 3CLFH 3Q1SH 4JKMA 3S35X 4I13B 1NGPH 1CTOA 2GQHA 3FFDB 1OM3H 2P5EB 4JFPB 2VLJE 1FV1B 4HLZG 2J1KA 1BF2A 1BBJB 4HIJA 1S9KC 4KQ3L 5GGTH 3IDXH 5GGVY 5B38G 4ZOCA 2HJLA 4OSUH 3GSQA 4OAWB 3I9GH 2FD6H 3ARFD 1VGKB 4W4OC 4BZ2L 1FQ9C 2AEQL 3QJHA 5KS9B 3IRPX 1BWMA 5E9DB 5DR5L 1CD8A 4Y1AA 2FX7H 2IADB 4QYOB 2F53E 4JY4B 3RU8H 2P24B 4X4YB 5HHOA 3BVNA 4WW1A 5CD5D 3OV6A 2QSTA 2C1PB 3BPLC 3MGOA 1TJGH 4XWOD 2AJYL 1BQSA 2FRGP 1YUHA 6FABL 3TT1H 3I50L 1ACZA 3QIBC 3D3VA 5C3LD 3LD8B 4IJ3B 3VD3A 4RGMC 4NQVA 3CDGA 3BZEB 2UZYB 4MXQD 1JGEB 4D0BA 4C59B 5HVWA 4O2CA 2XQYK 5EULV 3TBYB 5IV2A 3T0BA 3O2VH 1T1YA 3HNTL 5I19L 5I1IL 1RV6X 2XRAH 2VKWA 2BNQE 5BW7C 3T1FA 2FJFA 1NGXB 1P4IH 5IOPB 3QHZL 3SO3C 4WWID 4MA3A 4GXUM 2DBLL 2Z31A 3HC4L 1ONQA 2G9HA 3R0NA 4P2QD 4G9FD 3STLB 4KFZC 1WCBB 1A6UL 3TO4D 1B4JL 5KS9A 2DI7A 1T80A 1FGVH 5EUOE 1UB5B 4WEMB 3BPNB 1AXSA 4NN5B 5D7IA 3QAZC 2HLAB 3O2DL 5B3JF 1NBYA 3NIGF 3KYNA 5LXGH 3U79A 4XZUA 1X9QA 3QPQD 3IAPA 1D9KB 1OAYL 1YEJH 2F5BL 1NGXA 5AUMA 5IQ7L 4KRPB 1UC6A 2EDTA 5CLTA 5A2JH 1K3ZA 4LLYB 2KQNA 3NTCL 5D7LA 3ZKNC 5J13B 4MAYA 1XR9B 2FEEI 4O2CB 4ODHH 4G42A 4G7VL 3ZDZF 5BQ7B 3QFJD 4HIEA 3RP1A 4ZOEA 5GQBA 1D5ZB 3PL6C 2NW3B 3WE6B 3O11A 4H1LA 2X5PA 4CU8A 1YEGH 2L7JA 2HFGH 3BPOB 1ZT7A 1HSAB 4YR6B 2AVGA 5I0DA 1NAKH 3F7RA 4MAUL 4ZXBA 3LEXA 3LKQA 3GUTA 1VHPA 2HFFB 5DMYA 2GAZA 2HFEA 2X9XA 3P4NA 3WL9B 4KU1A 2GJZB 1QACA 1X4YA 2PO6A 3GMLB 3KPRE 1W0WB 4G9FA 4MAYB 1CK0L 3VFGL 1KCSH 3S5LA 1ORQB 5ESQA 3TBWA 2FEEL 3FFCE 4PJ5A 3MRFB 4GMSL 4KJPC 4OV5B 1X6NA 1MVFA 3EO0A 4JQIL 4KPHH 4U31A 3MXWL 5EUKB 2KH2B 4RX4D 2ZUUA 3C60D 5C0DB 2MKWA 1SYSA 4MCYB 4X6CE 4CVUA 4MZ2A 4U1HA 4LRIC 5ALBL 1RK0B 2CGRH 3VWJB 1HOCA 4NRZB 2NW2A 4LK4A 2YPKB 5FHAL 2AJXH 4G9DB 2DJUA 2OLDA 4LKCB 4RRPA 5J57B 1Z2KA 3OKEB 1X5JA 3EYOA 4ZPTB 1XGRA 3PWLA 2EYRA 3MV8D 1A1NB 1T2XA 1FFNB 4I18B 4PV9A 1YJDL 1D3CA 5TDOA 2E27H 4UTBH 2Z91A 4QRQB 1RJZB 5F7HA 1FIGH 3HNVH 5T1DH 4U6HA 4JLRA 4BK5A 1RMFH 1PEZA 5DJYB 3RZWA 1DFBH 1H8OA 4NKMB 4YPGB 5ERWA 1DQML 1V8HA 4AK1A 4X7TA 3G5VB 3FO0H 3LQAC 3C6LD 5DMIL 2C26A 2BY3A 1GGBL 5E8OA 2VLJD 4S1QH 1VFUA 3OJMB 1CGTA 3BGFB 3D18A 4JZJA 1F11B 2LFGA 4WW2A 2DWEB 4GQ9L 4MNQD 4TVPD 2ADFL 5C0FB 1KGCD 1N64L 4LLWA 1FCCA 3GSNH 2GFBB 2B1HL 4P9MH 4S1RL 4JANB 1T5XA 4RGNC 2Y1VA 4L8SC 4QRSA 1KXQE 2FNBA 5C07A 1KJ2A 2VDPL 3P77A 1XCQB 4APQC 2OS7A 4OJFH 4DN4L 4NQEA 1KIQA 4Z7NF 3IFLL 1KNOA 3WLBB 3N9GL 5CBAB 1PVHA 1P7HL 3U46B 4HXBL 4Q9QH 5GSRB 2OM5A 3QDMB 3L7EB 4YHIA 4NKMA 4YPGA 3LEYL 3WKML 2ZG3A 1A64A 3QG7L 4FQXC 4JE4B 1KULA 1KG0A 3ZDZE 1ORSB 3BZ4A 5FKPB 2GFBA 4ODVH 3BKYL 1A6PA 4X98B 3F7PC 5J0BA 3VCLA 1XGUB 2EXWD 4FXGA 4RISH 4QGYA 2XWTB 4HGWA 3EJYD 4NZTH 2APTA 1U9KA 5D1QD 5INDB 3PWUA 4P49A 5SWQA 4UIKL 2NY3C 4PJ7A 4YHMH 3K2MC 5HD8D 1YEDB 1EPFA 1C8PA 2B2XL 1AFVH 3RWEB 2NY2D 2J6EA 3MODL 5BS0D 3VDCA 3T0EB 1CU4H 2E7MA 3C8KB 3QFDA 1UCBH 1MFCH 1XCTB 1KG0B 4Q2ZB 3U83A 3BEVB 3KLDA 3BESR 1R5IA 4AL8H 2AABL 3IT8D 3HUJB 4NQDE 3C6SA 4KRLB 5E2WH 4YDIH 4JM2F 5C08E 1LEGA 3KHQA 3NZ8B 2WP3T 1N0XL 2R2EA 4J7RA 2FGWL 4WUUD 4QYOA 2APFA 5ALCH 2ATPA 3TBVA 3TGXA 4NN6B 1NMAH 1OM3L 2VAAA 1WWBX 4LP5A 2HJLB 4RNRB 4M6MH 1TETL 1VGEL 1VADB 1A0QH 4TYUA 1YEIH 3IB4A 1K85A 1FO0B 3W11D 1LE5A 5KVMC 1HKLH 3RDTD 3GNMH 2HWZH 3KPSE 5I9QB 5IQ9B 4NIKB 3VD7A 3MC0A 1FAIL 3E8UL 5EWIH 5I74B 3FB5A 5D5ME 1T03H 2FX7L 2D7TH 1J18A 1UWXK 3WO4B 1H9VA 1X44A 1F4XH 2OSLA 5GGVL 4CMMA 4J3OC 1U95B 4XXDA 4FN0A 1KLGA 5H35B 5BXFA 2Y25A 5SWSB 2PW1A 2Q6WA 5EO1B 4JQVA 3MCLH 5HHOE 4APQB 1OAUL 4JZNA 3NZ8A 5DMKB 5DYOB 5SV3A 3ROLA 4OFDA 4BA8A 3DUUA 1U6AL 3H7BB 1BFOA 1U3HB 4JFFE 1HEZA 1NBVH 3H3KA 2Q20A 3TPUA 1FVDB 1OGAB 1IGCH 4MXQC 5DD6B 8FABB 4P3DB 1P4LA 5A2LH 3RA7L 3O9WD 4QHKI 1RZ7H 5IMOA 2W65B 3VXSB 3ZTNH 4M61B 4U33A 1JYWA 4P2QE 3PWNA 1KTKE 1SYVB 1G7LA 5C0AA 4PJDB 4CVXB 3V52L 4H26A 3S35L 3AB0B 1RZIB 5DLML 5GIRA 5EZIH 1UJTA 3ILQC 3UTZA 1ED3B 4D0CA 4UINL 4XCCL 3FQXA 3SKUD 2VWEE 1B88A 4JKPH 4ZXBB 1OAXH 1T0MB 1YMME 1OCWL 2NY4D 3NTCH 4OM1L 5EIIA 1HQRA 3C08H 4PLOB 2M2DA 3QCVH 2NXYC 3TF7C 2FR4A 3DBXB 4HMDA 3NOIA 4XX1G 5KSVA 2XN9A 5FF6B 3SQBA 5C07E 1XT5A 4Y4HC 5GSVA 3H0TB 3HUJE 3U7YH 1U8LA 3MLPA 5KG9A 2UVFA 3S34H 3OB8A 1WEJH 2IPUK 4Y5YB 4FQXB 2AXGA 2LE9A 1FP5A 3MLUL 5C0FA 1HINH 4OCSL 3G6JF 3ZTJH 3D6GA 3FT2B 3TA3D 1KB5B 5DURB 1CK0H 1RK0A 3FB8B 4KJYB 5KVEH 4UI2A 4GBXC 3SE3C 3O6KH 4KY1L 5B3NA 3H8NA 4F9LC 3B4NA 3IGAA 1DLHB 4ZG1A 2HT4C 2GTZA 1BAFL 4HDIA 4UQ3A 1NBYB 1TENA 4G9FE 5FO7B 1K4CB 2R23B 4UBDC 5B8CB 5I1AB 3JUZA 1C7SA 1GHFH 2R0KL 1YEEH 4H25B 1OP3H 4LNVA 4XPBL 1RJYA 3LMJH 1BGXH 1HSBB 5ICYA 1I8LA 1RJZA 1RVFH 2W59A 2OL3A 2YN3A 1RUPH 1K4CA 3HR5A 2HT3C 1TVBA 1A1NA 1WAAE 5I71C 5I8OL 5TE4H 4X80L 4NQDA 3SDAA 3ILQD 5DJ8B 3ULVD 1U3HC 4M1GL 5DVOA 3F7QA 4C57C 4BSVB 1MHPH 3UJJH 2AW2A 5DJYA 2I60L 5E6ID 1D6EA 3K81A 5HSFA 4X6FA 5MEOA 1OGAD 1UT9A 2RBLA 4XNQA 3SGDI 3C5SA 1KIPA 2AJSL 2PR4L 3DOSA 3FRPA 5FV2A 4KTYA 3TVMD 3AREA 1OP9A 3OTTA 2QLVB 3PP3H 4Y19D 2QL1A 4HJ0D 4NQTA 3UTSA 4LPUA 1A7RL 1CLOL 4NJAL 4KC3B 1B0WA 4S2SB 1FH5L 4HZLB 4H25A 4XMLH 4UT6L 1EMTH 4R4FH 4I5BA 4M5YL 5L6YH 2B8OT 1FVEA 4DGIL 1NGQL 4XBEL 1A6VH 3MCKB 3MRPA 3L3OA 2WW8A 1A3LH 3PWPA 4TQEH 4NC1E 5A3IC 5A2IH 1PX4A 4EI5C 2ZCLL 5CJOL 4X6EA 5HI3D 5JORA 5JW4N 3WLBA 2A9ML 1Q9OA 3L6FB 2VL5A 4JZJC 5K9JH 5JO5A 3NIFE 1NAMH 5KSAD 4PRPA 4KTEL 3FZUD 4PJGF 1T2QH 2OJZL 3UYRH 4NOBA 4XC1L 1EX0A 2FYYA 3QIUD 3CPLA 1SVZA 4PJ9D 5F9OH 1JBJA 3WKMH 1NFKA 2ZCKL 3GGWA 4I3SL 5KN5B 4V2BA 4F8TA 1M71A 2W9DH 4PJFE 2ESVA 3QEQD 4L4TE 3ESUF 3DX6B 2EDEA 1T83A 3VXNB 2Q86B 1KXTB 1CFBA 1WICA 5INCA 1BOGA 1ETZB 4JFYA 3TJHD 5EBMB 5JNYA 5FO8B 3KPRB 4M1DH 4YEEA 2NXZB 2D2OA 1KYOJ 4M6AA 3OXRB 5GHWL 1EFQA 5FDYA 1DEEA 2DQFA 5BS0B 4OZIA 3BO8A 1TIUA 4HIHA 4N0FB 1MUJA 3WUWG 5E7BA 5EOQH 2XKSA 4XX1E 3OR7B 1TXKA 3SCMA 1MRCH 4K7FA 1KN2L 3ARWA 2GHWB 5EU6B 4P23D 5E08H 3ES6A 5L7XH 1MEXL 5IFAH 5E2UH 4JHBA 1FFRA 3MJ6A 4LEOB 1NUDA 3VXRA 3QCTL 4RFOL 2VDRH 4J12A 4ZS6C 3IDNA 3UCRA 4U4BA 2PTTA 3LB6D 5LVEA 1RZGB 1J8HD 4J3WA 1CGXA 1MWAH 3RWGA 3IKCB 3Q6GL 3N85L 1ZHLB 4JRXA 3QSKB 1UXSB 3GSWB 2CXGA 4LBEA 3ZHLA 1SQ2N 4YBHA 3CIQA 3RY6C 4OF8A 1M7IA 5DK2A 4BM7A 1A0QL 1FDLH 3CXHJ 3L9RA 3SKNB 1L7IH 1F8TH 1PGRB 2D3VA 3GNML 5EC2B 1R5WB 3O4OC 4Y16B 4XNXH 5GGSY 2PF6A 2B4CL 3DX8B 3S5LG 4K94C 2VITB 2H32B 4PD4J 5E9DA 4WCYH 3GO1L 3G6DH 5I0ZA 5I8KH 3GHEL 2BVPB 1PQZB 5BCAA 4XAWL 5HYSG 2KPNA 5F89A 1GZPB 2V2TB 2H8PB 4FA8A 4G8IB 3W11C 1JHLH 5DWUL 3HI6H 4HIJB 4ZAKB 5I74C 5CUSH 4GRWB 1EO5A 5MEQA 4MNHB 1T1XA 1UXWA 1OAUH 3BEVA 3FQWA 4XWGL 3T0AA 4ELKB 5DD5L 4PP2A 3CFIC 1WC7B 5E95B 3KPTA 3DJ9A 4TPRH 1QFWL 1HXYB 2GITA 3HFML 5DD6A 3A67H 2J3SA 4UB0L 4IHOA 4O5LL 1HHHA 5DVLA 3SN6N 1CGWA 1Q9LA 1QRND 3ZSTA 4MS8C 1OP5K 1WZMA 4JO4H 3HRPA 5L0QC 4LCUB 4KMQA 5KW9L 2HJKB 1FZKB 4JN1L 1AP2A 2DF3A 3NH7H 4UT7L 2BNQA 4UV4L 5TDPA 4X7DC 1PQZA 3RRQA 3REVB 4H8WL 4XP5L 5F1IB 3S3JA 2XZCL 3A6CL 4OT1L 1YMHB 3UJIL 4O51A 4ZAKA 5C1MB 3TJEH 4YHLH 4X6DF 4R3SA 2EDXA 4FQJL 1LK3L 5D1QA 4ZSOA 4XCYB 5FAAA 4OM1H 1WZ1H 4Q9CA 1IRAY 3F58L 4L4VA 2VZSA 3EYFA 4KRNA 3C2SA 4RMSA 1F02I 2Z8WC 2XNAB 1PG7X 3RWDA 4JY6B 4OZGB 2H45A 3ECBB 1F6AB 3NMEA 1J1PH 3K80A 2DI9A 1OHQA 4LLUA 4XMPH 4X99B 5FOJA 1XF3A 4JREC 3S34L 3EKCA 4GSDH 3IVKB 2A6KB 1FHGA 4L8CB 1MCFA 4KROD 4HDIB 1A9BA 2EDNA 2GY7B 4MJIE 4BKLA 3HPJA 2BSTA 2NZIA 4TVPE 4QT5A 2OI9C 3WUWB 2XQYG 4U1MA 4X6EB 1A22B 5D2LE 4IMKA 3H9SE 4CUCA 2YD9A 4KJQD 4PJFA 5ESQB 5H37G 2DBJA 2BC4A 4NO5B 1P4BL 2HTLD 3B5TA 1UZ6F 4M7JH 3V0WH 2E6PA 3UDWC 4PR5B 4O2FA 4GS7C 3VFNB 3GSRB 2OTUA 2HFEB 1G6VK 3D39E 1CBVL 4XAKE 4JFXB 3HRZB 4K71C 1N5AA 5IUSA 1FFOA 4CMHC 2BOBA 1CF8L 3QUYD 3P9MA 5TE7L 3TPKA 1A5FH 2V5SA 1HOCB 2ZNWA 5E2TL 3PG2A 1HH9B 3AY4C 3I3BA 3WN5A 5E8DH 4NKQB 1LE9A 1SJHB 2QKIA 5EN2A 2AJVL 2VZOA 3HRZA 5D7SH 1UA6L 4NKDB 5TE4L 3PHOA 1B2WL 5FM8A 3VFPA 3DGGA 4D3CH 5C6WH 3N1FC 3C09B 1KFAH 3D39D 5E7FA 5IFHH 1WFUA 2VYRE 1NC2A 4ODWB 2YD3A 1O7VA 5EU5A 3MXVL 3PP4H 4HAGA 2PW2A 1ACYL 2BX5A 4ZQKB 3HLAA 1HHIA 1IC5L 3LN9A 3SE9L 2YD4A 3L5XH 4BQCA 3DV4A 3SDXA 1A3RL 3SPVA 3VWKC 2BNRA 2LU7A 3GJEB 3S6CA 4ZUSA 3N1PC 3DURA 4L8DB 4EBQL 4KZDL 2WBJC 1SEBA 1F3DH 4I9WD 1UXSA 4NJAH 3S3SA 1QR1A 2EO9A 4HS3A 4WWKA 4KXZI 5CSZB 3KJ6L 2WAHA 3RVWC 2YD2A 3GMOA 1IGJA 4R4FL 4GW4A 4WW2C 3ARUA 1AJ7L 2XPGB 4F3FA 3EDKA 2ICWA 1XF5B 2H6PB 2YD6A 3RTQB 1T5WA 4PJGE 5E8NA 3UBXI 2DKUA 1F6FB 1I1CA 2OCFD 3CUPA 3OAUH 3PXHA 1OTTD 3RZCB 4ZFGL 3DRTA 2WWKO 5JHLL 3PGCA 5D5MB 1A02N 1I7RA 1T0NB 3QDAA 2YD8A 3QNXA 2FH8A 2IQAB 1NAML 3V5KA 2WMPA 2V9RA 5C0RL 4EXKA 4KTEH 2XWBB 5GISL 1AH1A 3LKPA 5ADOH 1T2QL 3F65A 4PTTB 5KSUB 2JB5L 1REIA 1A7QH 1DUYB 1FJ1A 1RJLB 2WQRA 4XP9L 4ZOBA 2OSLB 3LEVH 1WCQA 3MV9A 2BNUB 5I1GH 2AJZB 1IEAA 2HFTA 2QR0B 3VGDA 3HC3H 5AWNL 2IBZY 2EDLA 2PYEB 5DJZA 1BD2D 1F4HA 4KGJA 5B22A 2HH0H 1KJ2B 5BZWA 4X9IA 3CMOH 1CG9A 5DO2C 2MWCA 3NZHH 2IBZX 4L5FH 3HI1B 4LU5H 4FQIL 1IGTB 1P84J 4X7FC 1INEH 5AG8A 3MUGB 3KWWB 1W72A 3IJYB 4G8FB 3FFDA 2EYTB 3NCYS 2UZXB 1IVLA 2E3VA 2VH5H 3TA3C 4PGCB 1MCWM 4K8RL 3DUHA 1CD9B 4NO0D 4LLAA 4UNUA 3RTQA 4Q6IC 3MJ9L 3UBXB 1QBLL 1U41A 3WN5C 4K3GA 5HHPB 2O5YL 5JUEL 4Y19E 3QEQA 3KWWA 4G8FA 4B7LA 1UM6L 4PJCB 1S7VB 2F15A 2XG4A 1CFVH 1Q72L 3CFBB 3F7YB 4PJ5E 3PWVA 4W4NA 4FNLH 1X5LA 3GI8H 1FFQA 1J87A 4GRWF 1MWAL 1DBBH 3P4OA 4ZFOA 4PBWD 3QH3B 4IIQC 2HLFC 1XGTB 3QDME 3QPQC 1HWGB 2Z92A 2DMBA 1CE1H 3K3QA 4G5ZH 2O93L 1WBZB 3DSFL 2A77L 1M6OB 5IF0B 1KCKA 1J88A 2P43B 4Z7UE 5CCKL 1GXEA 4R3SB 3CFBA 5J1TC 3QEUA 4CADB 5JDJA 4U7SA 2G2RB 4XCNB 3GO1H 1A6ZB 5EBWB 1NFDB 3QA3A 4YHYB 3TZVC 1F2QA 2CKBA 4HF5L 5E56A 2FL5A 3CSYB 4R7NA 2IH3A 1JHLL 2BXZA 5BRZA 3TWCL 2W0FB 1NSNH 4UU9A 4PTUB 5C2UB 3O4OB 4Y16C 4LEXL 4HX1B 1BX2B 2R15A 4PJXE 2FLRT 3HUJF 5BS0E 4M5ZH 3CSBA 1JWUA 4OCXL 3ULVC 2HLAA 2DLFH 4IOFC 5T1KB 2VC2L 3PWJB 5E6IC 4GLRH 2I9LB 4I2XA 5IVXB 4CAGA 3EYUL 4IOSD 2GITB 1XH3A 2Q76B 2V2XA 1VGKA 2CJUH 3FQTA 3I85A 4W70A 2X10A 3QR2A 1BM3L 5SX5H 2EDHA 1NGYB 1Z9LA 4KHXH 2W9EH 5J6GB 4XMKL 4OF7A 4UB0H 2FR4B 4L4TB 3TCXA 5F7DA 2GTZB 3D9AL 3M1BB 1JN6B 2RIKA 4OLXL 3BGFC 2I25N 1I9JH 1I1AD 4MJ5A 2YBRB 5I8CA 2NX5A 4M1CD 4RFNB 5DF0A 5GGQL 5IK3B 2DQEL 5A2FA 5F1OB 3WJLA 5DRWB 1N6VA 4YJZL 2PTVA 3FQRB 5IVOA 1JUFB 1DSFH 2ERJC 2FECI 1SJHA 4OT1H 1W72L 4HUMB 3RTQC 4HWBL 3BAEL 2NTFB 2AQ1A 3TJEL 1EDQA 3EYFB 3NIDE 3FN3A 2YKLH 3W39B 5IMOB 1Q9KB 1IBGL 4LPVA 2XN9B 3IETA 3PL6A 2VXQH 3RI5F 3V95A 4I77H 3MV7D 4JCLA 3MV7B 2V2XB 2WM0A 5KVGL 4ELMB 3BP4A 1G6RL 2WP3O 3LV3B 5AZEH 4R2GC 4P59H 3TIEA 3T8XB 3CXDL 2BVEA 4YXLL 3X17A 4XVJH 5D72L 4GSDL 4ZUUA 3F7VB 3B8YA 1JNLH 4IEFB 3BH9A 1JZ4A 1KIQB 4UUJA 2KL6A 1NANH 3UBXG 4BFEA 1JF1B 2ZKHH 2EDYA 3HS0A 3VFRA 1VFBA 2Q8AH 3NA9H 5DEFA 5K59E 4B0MM 4XBPA 1QSEE 5KZCB 4KVNL 5E8EB 5CILH 5LGJB 4I0PB 4YLQT 3IDIA 2X4QA 3D85B 1AHWB 5I1HL 3CCHA 3RGVB 1D5IL 3RI5K 4L4TD 5D7JA 1NUNB 2ZPKL 1MFDH 2VLJB 1S5IH 1XGUA 4P57A 1QBMH 4PV8A 5L2KB 1CF8H 1ZLUK 1HYRC 1MCOH 3C5ZB 3MRLB 5C0IB 5SWQB 1F90H 4HUVA 1QSED 3SCMC 1MHHB 4U6XA 1SBSH 2ICCA 1EGJH 1UA6H 5HYJA 1CXLA 4UQ3B 5DRNA 1KFAL 4HUVB 1QLFB 5FA4B 4P5TB 4M03A 4QT5B 2PXYB 3T0XA 3DIFB 3RVXC 2KZWA 1VKXB 1Q9OB 1WV7T 1NQBA 3V4VH 3LN5A 3QDGA 3CX5K 4JANA 3NGBB 1LNUB 4FABH 1CFQB 4I48B 1R3KA 3IXAA 1ZK9A 1YN7A 2JJUA 1WTGT 1AR1D 4WU7B 3V5DB 5JXAH 4P3WA 1K5NB 2ZOLA 5CBEA 1XR8A 1OTSC 4KTDH 3S88H 4HFWA 2ICWI 1A9EB 4MLSA 4MS8D 3MGAA 4YHNB 1ZLSH 5T33H 2AXFA 5FGBC 1XIWD 3AAZB 4OGXH 3LN5B 1F4AA 1KIPB 4AEHL 2NY2C 1AXTH 3HA0A 2XI9A 1E4XH 5GS0L 4HPYL 5JHLH 1NC2B 4U1NB 1QYGL 3U48A 2X1XR 3BZEA 3AU1A 2QV2A 1LMKA 3CX5J 4Y88A 3UROR 3HN3A 5C0BA 1MSPA 1EEQA 3FFCB 4DVRH 4JM2C 3MLYL 2FATL 3U2SB 3M45A 1A7QL 3CVHL 5HPMA 3SKMB 5DRZA 5AAWA 1CD0A 4EIGB 1CLYL 2CLVA 3ARGB 3SGEI 3WIFA 3QUXA 3E6HA 1AD9A 3QJFA 5F6IB 1Z9MA 1QFOA 4RNRA 2I5YL 4J23A 3AS0A 2P44B 4CU6A 3IJSA 1T1XB 5I1KL 4MQXD 3VH8A 1ZT1A 1INEL 2MCG1 5LBSH 3LHPH 4JN2A 3HE6D 5EU6A 5E2JA 1R3JA 1SVCP 2O61B 1JZ2A 1IQDA 1S7WB 1E27B 5DT1L 4TUOB 3FN0H 4OUUB 4F57H 4N9GA 5DZNA 1MJJB 1ZT1B 2VZUA 5K9KB 1AGCA 3BMVA 3LKNA 3SCMB 2R0ZH 3BKCH 4E5XB 4NRYA 4GKNB 5FUZH 2Z91B 1AD9B 3QJFB 1Q72H 1PG7L 1BOGB 2VR5A 3P4LA 3UTOA 2VDKL 1FYTB 1LP9A 4TSCL 4MXVE 4ODTL 5E9DD 5CEZE 5D2LF 5JPNB 1XGYL 1KTRL 3L9RB 2EO1A 3TEUA 3TH3T 4HUKB 3OKLB 4P5MB 2BHZA 5INDA 3O6LL 4KUCD 1B9ZA 2XZQL 4PJ5D 2FEDD 2X4SB 3MREA 5C0CA 3U7WL 5BV7C 1JZ3A 1NCBH 5AD0A 1YNLH 2XTJC 1QSVA 1LEKB 2A77H 2BVQB 5I76A 1ZVHA 4DZBB 1HXMA 3BKML 5DD0H 2MOVA 3RWIA 1GZPA 3MLSH 5EO9A 1FYTD 3MBED 4LLDA 2IFFL 2R1YA 4BH7B 2BRRL 4LFHD 3LIZL 1KCUH 3C8DA 4NHUA 1J8KA 4PJEA 5HY9A 3ET9F 5ISZE 4IOIA 1FZKA 4H26B 5IBTL 1I9IL 1QNZL 3U9PL 3MBXL 1PKQB 4EIZC 4ETYA 1RJYB 1JHKH 3ABZA 5DUPH 3B2UC 1MI5D 4MJID 3ZMRA 1IJ9A 2IQ9H 2X4OA 4ZUUB 2FIKA 3M1BA 1JPST 3PWJA 3A6OA 4ERSH 1WCBA 4F80A 4OCXH 2AV7A 3GHBH 2Y4SA 1MVUB 1B4RA 3NIDF 1NCAL 1T66D 2ADIB 3MROA 3O3BA 5HVHB 4JFDD 3CLEH 4TSAH 3FCTA 4GH7B 5TPWH 3VD5A 1NLBH 3DVNB 3LKSB 4R26L 3SDXF 4EN3A 3KYMA 1ROWA 4IOIB 2Q87A 2F58H 4PJGB 1GRWA 4HKJA 4HIEB 1CZ8L 5FYKE 3I02B 4CVZA 5HPOA 5DQ9A 1RZJL 3QQ3B 4Y8AA 4MD5B 1G7HA 4CADA 4F15B 4XNUL 3CDGB 4OIIL 2AI0H 2DLHA 3QDGE 4Y4FA 1FPTL 3TN0D 3JV4A 4HD9A 3HE7A 3SOBL 1NFDA 4L1HA 3P30L 5F3HB 1FL3A 2X1WL 2IC2A 5DQ9B 1S3KH 5DHXB 4NC1C 4XPGH 4TN9A 3TVMB 5T5NF 1I8IA 3MLXL 1JFQL 1IM3A 3ZTJG 3VW3H 1JTPA 1F3JB 2BJMH 1PZ5B 4PRIE 4AM0A 5TGBA 2ARWA 5CJXC 12E8H 1U3HD 1DUZB 4W68A 4O2FB 4X6BB 5T3XH 2H2PC 3MNVA 1JF6A 5CWSA 4JFZL 4DW2H 1DBMH 2BP3A 4KXZH 2DM2A 4LGRB 5AZEL 4LIQH 1CDYA 5CP3A 3EZ8A 3GMQA 4FHBD 2VDOH 2A6IB 4ODBD 2V17H 4EI6B 2VNCA 4U1MB 5E2VH 4Z7UB 1YEHH 1FO0L 4LHJB 4AIZA 4L4VE 1QR1B 2JKXA 4RGOH 2FGZA 3FOMA 2J6EL 5CAYB 3QUXD 3RL1A 4S0SD 4OIAA 4RGNB 5EZOL 3K1KC 4E0RB 1ES0B 1S9XB 1JGDA 5IKCB 2AGJL 3V4PL 4E9LA 4KVNH 2C3XA 3LH2H 3EO0B 3MLRH 4PG9B 3RPIB 2J5LC 1BFSA 4MX7A 3DBXA 2Z35A 3O8XB 4LCIH 1BPVA 4XC3H 9CGTA 3V7AG 4BH8A 4P57B 2AK4A 4EI5D 5HPMB 2XWTA 3H0TA 5D5MF 5ADPL 3LKPB 1Q8MA 1P84K 2XA8H 3RPIA 1SY6A 5KSBF 4D0DA 4YGAB 4GKSB 2Y5TB 5C6TH 1CIDA 1SBSL 4JPKH 1JGDB 5IKCA 1EGJL 1A6WH 2O5XH 5CEZH 3IDNB 5FYJD 4X6DB 4JVPA 5CEXB 2DQTH 1N59A 2DM3A 4UUJB 4LLMA 1G9EA 4LAQL 2OMNA 2Y06H 5KSAC 2IPKB 1CGYA 3CUPB 4WHCA 1I8MA 5GRUH 1MFEH 1RK1A 4E41B 1G7LB 5C0AB 3W9DB 5IR1B 3MJ8A 2WBJB 5T1LA 3X14B 2VAAB 3QO1A 3RDTC 3SDAC 2DL9A 4P2RA 1BIIB 4KKCD 5C0EB 1K2DB 3QIWA 4HJJL 3SPVB 1TJHL 3AM8C 4JRYB 4M6OL 1PBYA 4M7LL 4MGXA 1G0DA 1AO7B 3C60A 1IL1A 5IW1B 4OZGF 4X4MA 2Q7NA 2YS4A 3O0RH 2R2HA 3ZL4L 3TVMC 5BV7H 1FNAA 5I6XB 4Q9RL 4MQ7B 4QXGL 3Q3GA 3LKRB 4XCFH 5FCSH 5FV1L 1QFHA 3CD4A 4ZS6D 3X11A 1OGTB 4A6YH 7FABL 3D0VA 5F7FA 5FYLE 3U1SL 2JJSC 5EO9B 2X4SA 5H8DA 1E4XL 35C8L 3IDJA 4C4KT 4D8PA 3DO7A 1MHHA 1QYGH 2AXGB 3T77B 3CDYA 3IFOA 1C08A 5SWZA 3AROA 1KB5H 1RUKL 5E99L 5FGSA 4GG8A 1WIPA 4OLWL 2E6JA 1YYLL 1MI5E 1MLCB 2XFXB 4YDJA 5HDOA 2FATH 5TQ2L 3H3BC 2L4OA 1QRNE 2HMIC 1IKFH 3DI2B 3TNNA 3FB5B 4KH2A 2C3VB 1IEHA 1P1ZB 2VUYA 1CLYH 2BOCB 4LSUH 1MRFH 5B38A 1IGIL 4AIXA 4XP6L 4JKLA 4BUHA 4PB0H 1AGDB 4XBGA 4OI9A 5K93A 1AGCB 3DVGB 4UV7H 3ZT6A 3C6SB 1KNOB 4ODXA 5FK9A 3O3UN 2PW1B 2Q6WB 3RUGF 1E27A 5HHME 5DO2D 3WNOA 4N1HB 4R8WH 4FXLA 4KJWD 3O3AA 5KS9F 1UEYA 3HAEH 1I7ZB 1A1MA 2XYCA 5IMLA 5FHBL 5A43C 4ZNEE 1INDL 2D9CA 2X09A 2VITA 4IS6B 2Z31D 5JNYB 4NCDA 4XPHL 3SDYL 3WL9A 3BDXA 4ZUTB 4MB5A 1ZA6A 5F97E 4OD2A 1XGTA 5KSAA 4L3EB 1XGYH 1RD6A 1X5FA 5CIPH 3BDBA 2A1WL 2P1YA 3IYLW 2ZUVA 4HG4J 4APQA 1I3GL 3QHFH 5F3BB 4UQ2B 1HHKA 1YNLL 3PGDA 1I7ZA 1VDGA 5HGAB 5EOCL 1U8PB 4LHQB 2VOTA 5DJDB 1I3VA 3B3IA 4QRPA 3FRUA 2PTTB 2DQHH 2PO6C 4X4XA 5DD0L 3RWHA 4NZRL 4W6WB 1U0QA 4BKLB 3VXUD 1IILE 1IKNC 3LDBC 4LLQB 2IGFL 2BRRH 3MFFA 3ARED 3RWCB 2FEDC 1HHHB 3VGAC 4XRCA 2P8LB 3STBA 2JK5A 4JN2B 1WAAA 5F7MC 3MBXH 3TO4B 4JFDA 3X3FH 3MNWA 4RFNC 2MTPA 1G1YA 1NCDL 1T20A 3BUTA 3JSSA 4XNMB 4I2XB 3TA3B 1OGAA 3U0PA 1U42A 2YA2A 1H5BB 3QCUH 1T1ZA 1JNJA 1MNUH 3TCLB 1H0DA 1G0YR 3MNWB 3EO9H 2J8UB 4ZOAA 5IOPA 3QG6B 3ULUF 4JY6A 3L3JA 5C0GB 1NLBL 3G5VA 4PJ5B 2UZIH 4U7KA 3MRRA 3QEHB 1UCTA 4NN6C 5DHYB 4OI8A 2F58L 4KZEH 3FO1B 5HYSB 2X7LB 4Z76B 1MPAL 1RZJH 4KKBD 4Y4FB 3MLTB 1PFCA 1P7QD 1KLGB 1QRNB 2MMXA 3UTSE 4XNUH 4PLJD 4CNIA 2IPUG 2GK0A 3K8LA 1FG9C 3LPGA 2UWEB 3EYQC 4OLEA 2NX5B 2LTQB 4YQXH 3P30H 1XCQA 4Z7UF 3IDGA 1IM9A 2Q8BH 4NNXB 4UMGA 1VFOA 1XGQB 1QLRA 2EC9T 3LQAL 1XMWA 4EUPG 5CSZA 3RAJL 1JFQH 4IIQA 3R06B 5GGTA 1W8OA 2OZ4L 3TPUB 4LCWA 3O9WB 3MBEB 2YRZA 1WLHA 4OF6A 4JR9L 2VDQL 5LAXB 2GYSA 5LG1A 1FN4A 1AXIB 3EOAB 3ESVF 2F53B 3BGMA 1OT1A 3MZGB 1KN4H 4S10A 3CFEB 5FGCE 2VQTA 4X7TB 1UJ3A 3ZDXF 1OSPH 2V17L 4DKFL 3EFDL 3NACL 5FYLD 3CSGA 3VXQA 5D70L 2DICA 4JLRB 1RIUH 1S5HB 2NY7H 3L7FA 5DHVB 3X11B 4NNPH 4NM4L 4X0KA 4X5LA 3ARFA 2J6EH 4GT7A 3UC0H 3HG1A 3J7HA 1DE4B 4JHWL 1A47A 3RVWD 3BIAX 5F21B 2BVPA 3VXMA 3AY4A 3ZT5A 2EZ0C 5DC4B 1KEML 1C08B 1N26A 3OAZK 5GGRB 1M71B 4BH8B 1YN6B 2XNAA 3UPRB 5I66B 2X6MA 5DUBA 3ZE2F 4RMUA 3G6AA 4XH2A 1ZGLA 3NPSC 3VXNA 2LQRA 1MJ7L 1DE4A 3WXWL 1EHNA 4FZ8L 1KC5H 3QUML 3PQYB 5C9KA 3NGBC 1PAMA 4WGVB 5T3ZE 4XPAH 2JTDA 5L8LB 1JF1A 1TNNA 2X4PB 5CGMA 1F97A 3BP7A 3LOWA 4MDJB 2XXMB 3UDWA 2Q1EA 4NO5A 5FXCH 3RJDA 1S9YA 1MELA 4KK9C 5KAQG 1MCQA 1NJ9A 3QDMA 1D5BB 2EICA 3V7AE 1OARH 4LVEA 2F54A 3SBWA 4AH2A 1S7QB 1I1AB 1YDPA 5GZOD 3TV3L 1R0AL 1FVEB 3VG9B 4LAQH 4HHAB 4J6RL 3GMOB 4WO4C 3IJSB 4XPFH 1U8IB 4IRJB 4ONHB 3CLFL 5I8EB 5IW1A 4P4KA 5IR1A 3IDYC 1YMMB 4PRHB 5TJWK 1J0IA 3TN0A 5IT2H 2K9UA 1T0PB 4NM8L 1JCKA 2I26N 2C4FT 4DGVH 2EDOA 5IHZA 3IDXL 2AV1B 5LQBL 3QDJE 3A0OA 4M7LH 3DUSB 5BO1H 2YPLB 1YDPB 4LPCA 3EYSL 5KSAB 5D1XD 4ZSOB 1UH4A 5DQJA 4ZQKA 4LCYA 1NMCC 3MYZA 2WANA 4HV8A 3R4DA 4X8JA 2Q7YB 5IMKA 1HNGA 3IFOB 5C2BH 1FL6B 1NEZB 2AERT 2AJYH 4XCFL 3WJLC 5J7CC 3TT1L 1DVFA 5M94B 1HYSD 4GRLD 3PDGA 3KPOB 1MFBH 4NO0B 4H88L 1BLNA 1AQKH 5CJXA 3D87B 4JM2D 3UTTD 3G5YB 4P5KB 3QYCA 3VDBA 1HE7A 4EUPH 4WGWB 3RNKB 5FOBA 3JTSA 1YA5A 3O2VL 4QF1B 1N8ZA 4NKIH 5D7JC 4MHHI 5EFIA 3UO1H 4U1GC 2W65A 2XRAL 2HN7A 1I75A 2G60L 1S7TB 2CUMA 5D1ZD 3U0TA 2HT2C 2BOCA 5JR1L 2ADJA 3HC4H 1A6TB 2YD7A 2RB8A 1EGJA 4MJ6A 1V7ML 4LGPB 4HS6A 3S4SA 5IGXH 3L3DA 4TNVF 5L2KE 3ULUD 3Q5TA 5IHUH 4YUEL 1LO0L 1TZGH 1BZ7A 4FRWA 1QSFE 2F5BH 1ZLVH 4FQXA 4WFFD 5IQ7H 2VXTH 3QIWD 1R3LA 3ARXA 2AS5M 3DV6A 1WAAF 3O2DA 4LRIA 1A6ZA 1GAFH 2ATKA 3ULSA 1DVFC 5FYKD 1TDQA 2PCPB 3MRCB 1GYAA 4JKKA 3EGSB 4MNGB 2YC1A 4H5SB 5FHBH 1MWAA 5BZDB 3KLSA 4G7VH 1INDH 2GTWA 4Q9BA 1UH2A 3QRGH 2GSGA 4P23B 2LVCA 1PYWA 2VXUL 1AY1L 3ARGD 2UWEA 4NYLA 4NQEE 2NY1B 4AENB 5H2BB 3B83A 2HTKD 4L1DA 1FSKB 5FO7A 4ENEC 4MAUH 4J8RA 1K6QL 4RGMB 15C8H 1BJMA 4URTB 5ITFB 3PIQA 3T0EE 3GJFK 4N9GB 3U4BL 4U0QB 1UWEL 3E1F1 5CGYC 5IMMB 2CLRA 3C6LC 4DKAA 5JIIA 3UTTE 5CMAA 5FK9B 3GBMH 5LKNA 1HKFA 3QEQB 4NZRH 4CKVX 3VXME 5IHBA 4MD4A 2W1NA 3JWOH 3G04A 3QI9C 1YPZF 3HMXA 4JY4A 1KJMA 1DL7H 3VRIB 1BQLL 1GOFA 3HZYA 2B39A 1NLDL 3VFSA 3DRQB 4XNMA 2P46B 2X4NA 4ETQA 3WFZA 1MVUA 4KKLC 4JB9H 4HPOL 3A6BH 1OWRM 3HZKB 3O4LA 3PJSB 4Y5YA 4M93B 1WUNT 1QQDB 3MRMA 2X4OB 1E6JH 3IS0X 3LS4L 4MSWA 4XAKD 1WBZA 1PZUB 2EH8L 5KSUA 3O2WL 4JG1H 3T2NH 5DGRA 4JO1L 4M8QA 3EO9L 4RAVB 4PBVC 5MHSE 2FL5B 2BNUA 4RMQA 1QLFA 2NPLX 1I85C 2XTLA 1MCLA 5IJKC 4JZNB 1G84A 4M43H 2E9JA 3PHOB 5E4EC 4UTBL 5F1IA 4PJIF 3BX7C 4M3KB 1CS6A 1AGBA 1HWHB 1MPAH 1CR9L 2I07A 2C7UB 3VFUB 1SYVA 1C5CL 4MA1C 5GRWA 4KROB 4JZOB 3L5JA 3S37H 5IM7B 3ZKXB 1N7MH 4MSWB 2Z8SA 5E1HB 3ZYJA 3REWA 4XWOC 5LGHL 4L3EE 5D93B 5DC0A 3PWNB 4QOKE 1A7BA 5DD1L 5IB2A 3BT2H 4F58L 3PGFL 3INUL 3LQAH 4QXTB 1IEBB 1WT5A 3TN0B 3VWKA 3VFOA 3IU4H 4OTXH 5C09B 4EDWL 3L7FB 4PLNC 4YBLB 3O6ML 5J6HA 3U30B 5J56B 2BZDA 4NWTL 4EDXA 4UTAL 3MRJB 5F9JB 3SKOB 3G5ZA 1CDJA 4TULH 3AU1B 3BSZH 4XNQB 4G43A 5IFJA 3VJ6A 4YFEA 3IFLH 5E94A 4LVNC 3E2HC 3I6GB 4HWZA 3W0WA 2NY7L 4KI5D 1IAOB 1KIUA 2D7NA 3ARBB 3LEYH 4JFED 3OX8B 4LSTH 4V1DB 4DN3L 1PW3A 3ZKSD 4MB3A 1EEYA 3WN5B 1XFPA 1CI5A 1UZ6E 2WSKA 2XPGA 4IRSD 2BVYA 3MOAH 3F62A 4MHHG 4LVHC 5FKAB 5C08B 3BMWA 3WDHA 2GY5A 2O5ZL 4P4KD 1Y0LA 1MJ7H 4PJIA 3W0WB 3BKJH 3RWGB 3KYKL 1KC5L 1LP9E 3BHBA 3QUMB 4N68A 4Y5VC 1QSFA 4OLZL 5D5MA 3MUHL 2CDEB 1AFVL 2PYEE 5CIPA 3L95B 3ULUL 3QXWA 5C9JA 1QKZH 4MYWB 1AD0B 2ZUQB 4EDXB 1CU4L 2R69L 3MRQA 4F9LA 2N1KA 4K07A 4P4RA 4AL8L 4PJ7E 5IG7B 1E0OB 3D2UB 1CLZH 5GZNC 4AT6A 1J05B 2F74B 3P0YL 4M4RA 5F7EH 2WUBL 2XA3A 5I2IB 2AJUL 4X7SH 3HZVA 4YDVA 2WBJA 4KRMB 4U1IB 4JQXC 4LNRB 1S8DA 3TC9A 3I75A 4HCRA 3CFJB 4LCYB 2VJXA 2GCYB 5FUCC 3QZWG 2B4CC 4M6ML 2F74A 1VGEH 1G7JB 1EIBA 4L4VD 3JWDC 1WZLA 3GMMB 3IDMB 4MNQE 1HCVA 4HMCA 4WTXA 1IC1A 5DRZB 1CL7L 4PUBH 1KYOK 4N8VG 4PY8I 4UAOC 3UTTA 1AGFA 2XXCB 5FECB 2C1OA 4U3HA 2XOTA 4WTWA 2IF7A 2P5WA 2C4XA 4J8RB 5TE6L 4NDMB 3WIHH 1EUUA 4HUUB 2Q3ZA 2UWEF 1ZGLM 3MLZH 4X83A 4HWBA 1CGSL 3QDJA 5HDLA 4MA8L 1T5WB 5E8NB 5EH1A 1A14H 1A1OA 2P7TB 4U49A 1I1FA 2H9GA 4FXKB 1MLBA 1HILA 4ONFL 2IPTH 3BZFA 1MIMH 2DM4A 1NJ9B 2ADIA 2IADA 4KJQC 3KDMB 1CXFA 1RQ5A 1YEFL 5BVJA 1YMMA 4OLUL 1S8DB 3GMRA 1U6AH 3HNSL 4BFIA 3HS0B 4HKZA 3L5HA 3MRBA 4QY8A 1I9RH 2QTEA 2RR3A 1DQDH 2QEJA 1KOAA 3RBSA 3GSNB 2P8LA 5FYJH 4ALAL 3MRHA 4PGDB 2VISB 2DIAA 1NBQA 1F4WL 2H9GB 4FXKA 5EIQA 5DDHA 3DTXB 4G8IA 5IVZA 1IAKA 3SQOH 2CKBB 2CKBH 1OOAA 2ZUSA 2MHAB 5D9SB 4LRNH 5IP4A 3S35H 4YC2C 1KCVH 2EDFA 3RKPA 5DLMH 3EDDA 4YUEH 1LO0H 3C5ZA 3MRLA 1MQKL 5DJDA 4QTIH 1YMMD 4PJXA 3TIDB 1ITCA 3SDCA 4R90H 4NN5C 3I9GL 2FD6L 5F9WC 2ED9A 1P1ZA 1J11A 1ZSDB 2AEQH 3GBLA 3R8QA 1OCWH 3KYAA 4Z7QE 3B2VL 3RIFK 4G3YH 1CYGA 1AGEB 4X7CC 5D7IE 2QQLL 4OCYL 1Q9KA 3QRGL 1U8NA 1TJGL 4IMLB 3H9HA 6FABH 2NY3B 1Q9WB 3TYFB 2MCPL 5ILTL 1OVZA 2JCCA 4JPIB 1QRKA 4PYGA 2NW3A 4JFHD 3G04B 4XVUD 3REWB 5IIEB 4OUUA 2FSEB 3VU2A 4GKOA 4PJFB 3VXRD 4OQTH 2MKLC 5JOPD 3MLUH 3ARBC 2AK4E 4XB8A 1T7YA 1D9KC 1JI1A 4LLYA 3HZYB 5CMAB 5I19H 5HHNB 1KCRH 4DOHB 5I1IH 3OGCB 4HIXL 4QRPD 4H0HB 4ZTOH 2DBLH 2R4RH 1U91A 4L4TA 5ANMB 4ZYKB 1FLRH 4DFHA 1CCZA 1ZHNA 3IETB 1CDCA 1ORQA 2Z31B 3DLQR 4M9PA 1Z5LB 1B4JH 2CRMA 1H5BC 3QXDA 3N0PB 2PO6B 5DXWA 4B7IA 4ZFOL 2ZUTA 1CN4A 3NABH 4JDTH 2IBGA 1GHFL 5EU4A 2Z35B 1AGEA 4QRPE 4C58B 2MNUA 5E8OB 5JZ7C 1NUGA 1FL3B 1RUPL 2EH8H 3GI9L 3ARBA 1QSFD 3QUZC 1MAKA 5I8OH 3RGVC 4HSQA 4Z76A 4X9HA 1W2KT 1JWMA 2PYFA 5FA3A 4M1GH 5ISZB 4PRPD 5J11C 4OLYH 1JN6A 2VZTA 1H3PH 5DJXA 1GGCH 3K46A 3PABB 3GMQB 2FJHB 3I6LD 3VXTB 4X9BA 1YEGL 2XN9D 4I18A 1FZMA 4XP1L 1C5CH 1MCNA 2EEDA 3S37L 4Q74A 4JQXA 4QRUB 4WWKB 1QSFB 1LO3H 3GKWH 3B9KC 4E41A 1JJUA 3PWPB 3BISA 3WNPA 1G7MA 3Q5OA 4ZAKC 1TJIL 1WWAX 4XVTL 4J1UA 2GJJA 3TBSB 2OJEB 1S78C 5HHQB 1R5VA 1UZ8A 3IGAB 1IT9H 3INUH 4CDHA 2R29H 4L8BB 1BBDH 3ARDA 3AMLA 2ZG2A 2BSSA 1KBGL 1NDGB 2LTQC 2XKUA 4UT6H 4XMLL 4PJ8D 2R23A 4BJLA 1FAKT 3FOLB 3CFCL 3MV9B 3PABA 4M5YH 3TM6A 4XBEH 3RL2A 5HYJE 3KPQA 4F2MB 4IRSB 4NWTH 2ZCLH 5CJOH 1YEKH 4N0YL 3SCMD 5F6IC 4Z0BH 3T4AB 2ZSVB 1ZTXL 4NZJA 5IB3B 3JZ7A 3QIUC 1RUQL 5GJSH 3NCBB 5C0NC 4N0RA 4OZHA 2RCSL 3U9UB 4QOKB 1F58H 2AJ3A 1KJ3H 2KDGA 3EBAA 1Q1JH 3IKKA 4LCWE 3GRWH 4FQLL 2QADD 3FL7A 5GGRA 3MUZ1 5SX4I 1ZEAL 1I8LC 4DN3H 3N1GC 4HS3B 2APXA 2VMFA 4JJHA 5K33A 3HR6A 3MYJA 1OW0A 5EU6E 3HG1B 32C2B 3VI4E 5I15H 1G7MB 2E27L 5D7LE 1TTUA 25C8L 2DMKA 1X6LA 1BBJA 1SEBB 4I0PA 3ARFC 3MV01 5FCUH 2N56A 2VLMD 3QO1B 3PDDA 4HZLA 3GMPA 2N7AA 2ZG1A 3B6SB 5HHPA 1DN2A 2AAVA 2BC4B 3BPOC 3QDHA 1IQWH 1RK1B 1INQA 5EBLB 2IQAA 3FO0L 1NCWH 5MP6L 4CRPA 2VB5A 3GSUB 1OAKH 3BIKA 5DUMH 4F2MA 5C07D 4HK0B 1HQ4A 2XWJB 4NWUL 4WFGD 1RHHB 5EO0B 5EOQL 2P5WE 2R69H 2Y7QB 1YC8A 1UVQA 3D25A 3GRWA 3JVGA 4HJ0C 4M7ZB 1R3HA 5E08L 4YAQA 5GRJH 4L9LA 2MPAH 4Y4KC 3V6BR 3QCTH 2R0WL 2D31B 2ADFH 3LQMA 5EN2B 5IESL 2GJZA 3H6JA 1KENH 3WNKA 4MQ7A 1HK6A 1I4FA 1T89A 3B9VA 1B0GB 3Q6GH 4LPXA 4DAGL 4LSPL 3VFWB 1U8IA 4IRJA 5DFWH 5C09D 4D94A 1MHEA 3E0GA 1CFTA 4LHUA 4DN4H 1VCAA 2NQCA 4OD3H 1T22A 3QQ4B 1MAMH 3ROLB 1FDLL 4GRMB 4Z18A 1I7UA 4D8PB 3DO7B 3OX8A 3C5SB 1F8TL 1CL7H 4MNGA 2A73A 4XTRD 3RVVC 5D71L 5BVPL 4HW6A 4GRLB 1NPUA 5F96H 1E28B 2BFVH 4WCYL 2Q3AA 3RWIB 3U4EB 5JQHC 2VLRA 2NNAB 5ECJE 2ICWB 1HNFA 2AXFB 4R0LA 4HK0A 4LCCC 2BDNH 1CGSH 3KYNB 3SO5A 2FX8L 1MCHA 4HLJA 4JFFD 1U2HA 5MERA 1FO0A 1KPVB 4NZTL 5JOFB 4H1LG 4Y1AB 3SO3B 5DEGA 4ZDHB 5MENA 1NMCB 4J4PD 4Y2OA 3L3KB 3V5DA 1U8OA 3B9KB 2FECL 3VRLE 4P9HH 4JFXA 4M4PA 2AV7B 3MRBB 4HKZB 1UQSA 5MEPB 1TTGA 3KS0H 4NFBA 4RWHA 5JOFA 2EKJA 3MUJA 4UDTB 3A67L 3SE3A 2GSGB 5BJTA 1MFNA 4U6VL 5IBUB 2ZZUT 5DTFA 4YDIL 3QIBB 2VZVA 2D7QA 3OR7A 2AQ3A 1MRDL 3KVQA 3DGGB 3MV11 1GGIH 3RWEA 4BQ9A 3EUUA 4RZCB 3FO1A 4JN1H 5ALCL 5HYSA 4OZIF 4M3JA 4QEGA 4UT7H 4LRNL 4OGYL 1IAIM 4LARL 1CL7I 4JGMA 5EDXA 4ZXBD 3TNNB 1MQKH 2QADB 4ZXBC 4OM0H 4G6MH 4X6DE 5D8JH 3RZCC 4HKBA 2VZ3A 1RUMH 4YHLL 5CZKA 3MRKA 5LGKA 4FQJH 3OPZL 4YBQC 1TFHA 2LABA 3MACL 3CX2A 5JXEC 2EE9A 4Z7VE 5DQDH 1OSZB 2QQLH 4OCYH 5GGVH 4EKXA 4RZCA 4NRZA 3BZFB 2ADGB 4ZS7L 4JDZB 3WFDL 1URLA 1GGYA 4D0CB 4O9HH 4JRYD 3VXQB 3EOAA 1N6QL 2FH6A 4LASL 3CFEA 4JO2H 5IB4A 1B3JA 5C0AD 2R1WA 2VUOA 2CLRB 2X4TA 2GSIB 4FMFA 2XTJD 4OFVA 4DQOH 4YHOL 5EA0L 5E70A 1WIUA 4LP4A 2FHBA 4PP2B 2UWEE 5C0GA 4PRHE 3WO3B 5H2BA 3H7BA 2HFFA 4DKDC 3MOBH 2VZ1A 3RA7H 3SDXE 4LIQE 4UQ2A 3QI9A 3K74B 4JPVH 4UU9B 2EC8A 1HSAA 5L0QB 2RGSA 1CBVH 4IRZH 1ZOXA 5D2NE 3H9SA 4KI5E 3NABL 4GG6E 3D18B 4HJGB 5HI4D 3ARDC 2CR3A 3U9UA 4R9HA 2JIXD 3RQ3A 1MCCA 4AEFA 2PXYA 5FYKL 5T1LD 1I3RB 2CDFB 1DBJL 4K23L 4NUJB 4QNPF 1BHGA 4D0DB 4OCNC 3B3IB 1IAIL 5I9QC 1ED3A 4GAYA 4RAVA 1RZFH 2DD8L 4N5UA 5IFHL 3MA7B 4ZO9A 3AS2A 3JV6B 4OLYL 4JM2B 5GGSB 5C6PB 4GAJL 1H3PL 4DKEH 4NQED 2UYLA 5IB4B 1RSFA 4BQBA 3QNZB 2W91A 5J6GA 2QSVA 1AXSB 5D7IB 3ROOA 3LRSB 1EH9A 4XP1H 4ZO8A 4FFZL 2V5YA 1UKTA 3RDTA 1A3RH 5L8KB 3DMMA 1ZHKA 3QPXH 5KVDL 1H15A 4NP4L 2Y7QA 4LHUD 4XVTH 1GIGL 1JZ6A 1J10A 2PETA 3GB7A 4GKZA 1WWWX 3SY0A 5DJCB 3DGCR 1YQVL 1E6OH 2H26B 1YN6A 3PV6B 3O81A 4GG6B 1JP5A 3KJ6H 1UH3A 3VG9C 3LKOB 2AK1L 5DI8B 1UADC 3O6KL 4KY1H 2EKSA 3S36H 3OGOE 1BEYH 4QHLB 1JMXA 1GSMA 3GMLA 4C56B 2I9TB 3IRZA 2HRPH 1BAFH 1QRNA 3MOQA 1N2RA 2BHUA 5CGYD 4Z0BL 4EOWL 3LKQB 1NBZB 1ZTXH 5BS0A 3GBNL 5HDBF 4NBZB 4P2QA 5DURD 5CHNB 1ODAA 3MV8A 1AO7D 1T1WB 5ADOL 4HXAH 5L9DH 5EU3B 2HG5A 1RZKL 1T04A 4M7KH 5IEKB 4POZD 5F8RC 2NY0D 3SE8H 5I1GL 5DEGB 4ZDHA 5E4IA 3HC3L 3O45B 5AWNH 3RY4A 5B8CA 5I1AA 4WV1C 4FFYH 3QFJB 3PQYD 4N0CD 5I15L 4OZHE 4ORGA 3GM8A 25C8H 5C0DA 3GSWA 1MHPL 3QDGD 4LSQL 4PRPE 3RHWF 1I8MB 4JFDB 4L5FL 3RKDC 5FCUL 1T66C 2BK8A 1AO7E 3RWJA 2QADC 1U8JB 1W0YT 4NQXB 4JZJB 3AVEA 3MRQB 4YZFE 4P23C 1ULVA 1AR2A 1MY5A 4RMVA 1OAKL 5DUML 1EXUA 4QNPE 4PRNB 3HE7D 3KS0J 3EJZD 1F42A 4RDQF 2FDBP 4FTVA 5KVFL 1A7RH 1CLOH 4L9DA 4YDJB 1DEEB 4OZIB 2Q86A 5GRJL 4GW1B 4M62H 1FH5H 3EO1A 4LPTA 5J06A 1TZHB 4ZFZB 5L6YL 5D6CB 3FTGA 1EJOL 3KPRA 2A73B 2VN4A 3STLA 4FNLL 1OLZA 1T04B 4CN4A 1IEAB 2E7BA 4TQEL 5EZJB 1DBBL 2CKNA 2NR6D 4OD1L 4WUKH 1KIRA 2DAVA 3SDDB 3Q0HA 3I75B 3CZFA 3NFPB 4DEPC 1E4WH 1MAML 4G5ZL 4R7NB 5GS0D 2ENYA 2JELL 1DQQB 3VXRE 2YEZA 5EUOF 43CAA 4HQQL 4QRRD 1R3KB 3IXAB 1I8KA 4APQD 1J1OH 3OZ9H 3TYGH 5FYLL 4X4ME 4KK8D 4D9QE 4NQVB 4KUZH 1U58B 3TT3L 2VL5B 1PLGL 1JV5A 2DTMH 1HSBA 3B6SA 5HYQA 1XH3B 1A6TA 2Q76A 3CZJA 5CJQL 1W72B 3BRGC 4WO4D 1CICD 1FYTA 1LP9B 1DLFL 3D69A 1RHFA 2VABA 4KQ4H 2Y72A 1MCSA 4GXVH 4MWFA 4M1DL 2W60A 4WV1A 4MA3B 3T2OA 2DLFL 3I6KA 3QZWB 5FO8A 2ZOKA 4KK9D 4LQFH 3EYUH 1DBAH 2YXFA 3P0GB 4MNHA 1BM3H 2J8UE 4JFQA 1KT2A 3HMXL 3ULSB 3W9EA 4RX4A 1JGUL 2YN5A 4LLDB 5L7XL 2EDWA 4F37F 2YMXL 4BK4A 5I73B 1I9JL 4I2XE 1MRDH 1A1MB 2CQVA 3TH4T 1JYNA 4XCNA 3KPOA 5HYIA 2DQEH 1U92A 2YPVH 3Q1SL 5HYFA 4ZMAT 5TQ0H 4X4YA 1MCWW 5EBGA 4Y2DB 5F7WC 4EJ1C 1AKJD 4P2OA 4JVUA 1IM9B 4YXHL 1KT2B 3FMGL 1T1ZB 3VFOB 4XNXL 1RU9L 1X3DA 4LSVH 5F7YC 2X4UB 1X7QB 2B4CH 5EIVA 2PKDA 4NRYB 1ZHLA 3LAFA 4G42B 1OLLA 5CP3H 3PE9A 2WIIB 3GHEH 1S9XA 1Z5LA 2ZJSH 5JXEA 3BZDA 2JLLA 4Z9KB 1SHMA 3PF2A 3QEHA 2R1XA 4XRCB 1JWUB 2AKRB 5DWUH 4ZUWB 5BRZD 1G6RH 4TSBL 2CDGB 2NCMA 3KPSD 5I1DA 2VLKB 3L3DB 4HKJB 4CVZB 1NC4D 3NPZB 1MFAH 2JCCB 4JPIA 1DQJA 1QA9A 1JNLL 1OD7A 4DEPB 3VXPA 4CDGC 1NGWB 1G7HB 4HFUL 3ARDB 1U95A 2JIXA 4JRYE 5FGCB 3VFPB 4H1LH 4DQOL 1MCBA 5FF6A 1QFWH 3ILPB 4EVNA 4HJGA 5DMJB 1Q9WA 4AQ1B 5F93C 2E8YA 3V6ZA 1SMOA 1ZT7B 4AG4H 4JO4L 5KOMC 3WO4C 1J12A 1D5IH 4G80A 2GK2A 3LB6C 5SX4H 2OZ4A 2X9WA 2UY7A 1S5IL 3RX7A 1FGVL 3E6FB 2R9HD 4P46C 4UV4H 3QNYB 3O2DH 1JGLL 2FX9L 3MJ8B 2Z9TA 3GMNB 2W0KA 4KJPD 1OAYH 1YEJL 2XZCH 3A6CH 4HC1L 5A3ID 5ICZB 5B39G 5CJ8A 1U91B 5FDWB 1P9MC 1L9MA 1EFXD 4I8DA 3QG6A 4DFIA 5I1DB 3RTQD 3BDYL 3RL2B 4WEUD 3LRHA 4F7TB 2DD8H 3V79C 1RZIA 2P5ED 3TZVA 3KPSA 4ODHL 4GAJH 1BD2B 1XR8B 3DO3A 2B20A 1Q38A 3QWOB 3TESA 1H3WM 4PJBA 2BCKA 5CSGA 3ETBF 1NEUA 1U8MA 4XH2B 1VACA 1JPSL 2R1WB 1NAKL 2EECA 2GI7A 3D0LB 4J3SA 5HVHC 1EK3A 1XF4B 5JXAL 4L4VB 1QFPA 4NP4H 4JKWA 1SM3L 2Y9RT 4F37K 1CFNA 1MWAB 4Q2ZA 3P3YA 1YQVH 5B21A 5BZDA 3S88L 3Q2CA 4MMXC 2ZCHH 3P9LA 1WWCA 3WUWA 4QHLA 1ZANL 3LVEA 1L7TH 2ITCA 2R8SL 3CFDA 1Y0LB 2WV3A 3S36L 4BSVA 4OGXL 4L9LC 3FB6B 4NRXA 4M7JL 3MXWH 4XB7A 3U7AA 4DVBB 4NO3A 2HRPL 3M17A 1EHXA 1L6ZA 5GS0H 4AMKL 2E7HA 3KPMB 2WWKT 1KCLA 5ALBH 1JL8A 5CEYB 1J7VR 3UBXA 5TE7H 3BZ4B 5D7JB 5E2TH 5FKPA 2R2BA 4HXAL 5L9DL 2A83A 1T6WA 2VDLL 2VWEC 3QJHB 1IGJB 4G8EB 3C09C 5F71A 3ZDYF 4RFEA 4YC2B 4RQQA 5D7SL 3BYTA 2D31A 5SWSD 4HWUA 5A2KH 3DMMB 1YNTA 1ADQA 4BFIB 2XACC 5CBEB 1KJMB 4UIMA 4JM4L 3Q3GB 2KZ1B 4PRPB 2F5AH 4Q0XL 5ICXB 3KPNA 3W82A 3PP4L 1DANU 4CGTA 1ACYH 1FIGL 3SGEH 2NY5H 2JJVA 5ESVB 2IAND 3U36A 1RIVH 3BIKB 5T3ZH 5JW4R 4K8RD 3QUKB 1KEGH 4PYHA 4JHZA 2GT9A 1DQMH 4NO0A 1E4KA 1WBXB 1U8HA 2V5MA 4YHZL 1YEDA 1NFDF 1GPOH 2ILLA 5K9OA 4W4OA 2X4PA 4ODWA 4P4KC 1J1XH 1NDMA 3O6FA 2X4RB 5EC1B 2YK1L 5I1LA 4NDMA 1T5XB 4R2GD 5C0IA 1YPZA 4MJIA 5DQJB 5SV4A 2NMSA 3MR9B 1LEIB 5AD0B 4FG6D 2ZUXA 1AJ7H 5I66A 4C56E 3RX5A 2VDKH 2DB8A 2X4RA 5EC1A 4ODTH 3GSNL 3KPPB 3T3ME 4OD1H 2B1AH 1ZHBB 3VDAA 3FHAA 4J4PC 2GJ6A 4ISVB 2XZQH 4HGMA 5CGTA 4OV6F 2CO7B 2F9BT 4Y4FC 1S78D 3MFFB 3JWOC 3VXRB 1BZ7B 5TF1H 5GRVK 2VAJA 4K7FB 5DVNA 1NL0L 4LMQE 1UYWH 1EZVX 4Y2DD 1MCPH 4QRQA 2IFFH 1UB6B 1I4FB 1KUMA 2HJKA 3L3GA 1BJ1J 3SDCC 2PUQT 5TFSH 2W9LA 4WENB 2JCCF 5EU7C 5B8CC 2YWZA 1I9IH 3U9PH 2DYPD 4QCIA 4K3EL 4WI2A 3QFDB 4OCLC 3F6IA 4X7EC 5JTWA 4FQIH 1HZHL 2IQ9L 3HPLA 2OR8A 3EOTH 4UIKH 4PJ8B 4EUPA 2NYYC 4K9EH 2X9YA 1BIHA 1F3RB 5DMKA 2VE6A 4NQCA 3OKLA 4P5MA 3U82B 2DL2A 4LQFL 3U4EA 1ZVYA 2V2TA 3WFHA 3IU3B 1OAQH 5IMMA 1QBLH 4E41E 3S5LB 3VA6A 4R26H 3QO0A 1R24B 4TNWK 4D9RD 5D2NB 3TN0C 5DA0B 5F44A 3QXVA 1BFVH 1U8PA 1VENA 3RWFA 5TDNB 3SGJC 1IC4L 3T65B 5MENE 2DM7A 4DZ8A 5CJ5A 2FGWH 3DVGA 3WS6A 4XNYL 2LAAA 4YBLC 5TQ0L 2Y36H 3MJ7B 1IC7H 1NMAL 1PEWA 5L2KD 1G9NC 4LAJH 4ZFOB 4CN1A 4D9RE 3JV5A 1YEIL 4POZC 5E5UB 3ZHDA 1R3LB 3MLXH 1AE6L 4KK6D 3TLRA 3E2HB 1ZHNB 2VQUA 3K1DA 3GJFB 4LSVL 1HXYA 3MBEC 2IH1B 3IDIB 3S96A 2D7TL 4TRPL 4MD4B 5JW4Q 1BVZA 4JGUA 4PP1C 1DANT 5I1JH 3O3AB 3RVXD 5B3JE 2ZJSL 4R6UA 5CKGA 1RZKC 1NGZA 5MI0B 3FQWB 2P8MA 1KLUB 4GW5A 3MTRA 4G6KH 3TBYA 3B2UD 5I17B 2IWGA 4OBRA 2YXMA 3MROB 4Z6AT 1N5YH 4XZUB 4N5ED 5DZLA 3UJTH 2V6HA 5E2VL 3VXSE 1G6RB 3ZYOA 4YFLI 4M5ZL 4NUJA 5L88L 3T0EA 3LZFH 8FABA 1H3XA 5HGAA 1YEHL 1FO0H 3BP4B 4KWUA 5AG9A 3QA3B 5F7LB 4KVCL 3W2DH 3E6FA 3HZKA 4XMKH 2AGJH 3V4PH 1Z9OA 2H2SD 3O11B 4H1LB 5CEYA 1BX2A 3BWAB 3I2CH 4EXPX 4NUGH 3WXVL 5DJ2A 1ZWIB 5FB8B 1NAMA 1A7OH 4P2RE 3QIUB 5ESAB 3IXTA 4WU7A 3S3PA 1WTLA 3DROA 4OI7A 2YBRA 4Z78B 4PJCA 5MEND 1JWSA 3CAFA 4PB9H 2XA8L 3V52H 3QUYB 3MMEB 3UTQA 5A16B 4ZUWA 1QSEA 1T3FA 1EAJA 3KPLA 1W72H 4JPKL 1IFHL 4AY0A 2EIDA 2ARJQ 1QEWA 1M4KA 1YPZE 4XCCH 3ZE2E 5AUMB 1FLTX 2VLKD 1JHTB 4K2UH 3FB7A 3LDBB 4Z7UA 2VLRD 4JKPL 1OAXL 1OQOA 1T21A 2DYPB 3BN9C 2VXQL 4YWGH 3C08L 5GRUL 1JVKA 4QXTA 1P7KB 4YE4L 5DS8A 5J8OA 3KYOB 2YPLE 2NY5C 1FYHB 4HWEH 3BP6A 5BRZE 1MI5A 5FGRA 4A2LA 4L3EA 1T3FB 5EU3A 4MB4A 4EEEA 1UWXH 4G80B 1MF2L 2LU3A 2AEPH 2YHGA 4QF1A 4DUWA 2PYEA 4N8VB 2G5RA 3C5ZD 3EDFA 3T0DA 3ZKMD 2ZKHL 1HDMA 3SJVA 4N0CC 1R3IH 4X99A 2YZ1A 2Q8AL 5KVEL 3FO9A 3TNMB 1ZANH 1L7TL 1U8NB 4A6YA 3MUGA 1RURH 1F6AA 4XNZC 1OPGL 3QUZA 4A6YL 1D7FA 3GJFH 2LU4A 1DQTA 4PGCA 5I1CL 1DEDA 5TH2A 4ACPA 5CD3A 4M6NL 35C8H 5HHQA 5JHDA 1G7PA 3RVTC 1KLFA 5MI0C 4YDLC 4RRPG 4X6CB 3O8XA 1LE5B 1RUAL 1KB5L 2OL3B 4XPBH 3LSOB 4O2EA 4OZFA 2AV1A 4X0KB 1YYLH 4M48H