3TFKC

42f3-p4b10/h2-ld
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
201
structure length
201
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkC01
4NWTH 2SEBA 5DC4B 4D0BA 5I1LB 2HFEB 4K94C 3ESUF 2WP3T 3DIFB 1MCIA 5T1LD 4X4ME 5GIRA 3QXVA 3OKNA 1BGXH 1IEAA 3GM0A 4I3RH 5DF0A 2RAMA 4L5FL 1JPFA 4HFWB 4RAHA 5MENE 4XVTH 5FK9A 1FFOA 3SCMC 1IKFL 1INDH 4YHOL 4N8VA 4OF8A 3SKNB 3C08H 3G6JB 2MQCA 5DJ8B 4EN3A 1HHIA 1IKNC 5DTFA 3P9MB 2E3VA 5I0DA 4MJ6A 4Z7VF 3C6LB 3EZJB 2JE8A 2VDLL 3MOAL 4UDUB 2VABA 2Z9TA 1EGJL 3RI5F 8FABB 2XN9D 3A6OA 3I85A 1WFUA 5AYUL 1IGYA 5JLZA 3TNMA 2BVTA 4UV7L 5IVXE 4PRIB 4MHHG 2WBKA 2Y7QB 2YR3A 1TJIL 2IMNA 3H9HA 1A7PL 4QHMB 4PYGA 5DQJA 4YHNB 4N90D 1QR1A 1FYTD 2HRPL 4HKJA 4WI2A 2HVJA 4KKBD 5D1ZC 1NDGA 1IKFH 5K33A 5D96B 4YHOH 5BV7C 4K9EC 1AP2A 4UNTA 2HJKA 4NC2B 5JQ6L 2CSPA 2CH8A 3CC5B 4TTDD 1JWSB 5D2NB 1BD2E 1N4XL 2ZOKB 2R1WA 4IM8A 5GSVA 4JVPA 1S9YB 1JYVA 2X7LB 5F44A 3MOAH 2VDLH 4J1UB 1DQJB 5AYUH 4UV7H 4RMQA 1UT9A 4LF3A 1VEPA 1XF4A 4BQ9A 1TJIH 1S7QB 3D85A 1YPZF 1A7PH 4RGOL 2V9QA 3G5XA 2AK4B 1T21A 2HRPH 3E3QE 4H8WC 4OAWA 5MENA 4ZOBA 3TPUB 1QBLL 2OTUB 3R0NA 3WIIL 3T0AA 5CEZE 3VRIA 5C86A 2MFNA 5JQ6H 1MUJA 4H8WH 4N0CD 1J8HE 1T1ZB 3NGBB 3C5JA 2BNQE 3QJFB 4ZDHB 4F37K 5EZJB 1N4XH 2YBRA 2Y6SD 2OQJA 4FQXD 4DVBA 5C0DB 5K9KA 5DA4A 1P2CB 2NPLX 1I1FA 4HS3B 2OL3L 2IAMB 4Y16A 3RWEB 4PTUA 3QCUL 4OF0A 5DHVH 4OGYL 4U7SA 1BFOB 3CPLB 1VCAA 3MRLA 4YHZL 2PW2B 4XAWL 1SYVA 2Y5EA 3EYVB 5IVXA 1HILA 1VFBB 4C57C 3C5SA 4KMQA 1KCVL 1FFPB 4A6YB 2MKLC 3LQAL 1JYXA 1T66D 1LK2B 4RGOH 1UEYA 2GCYB 3VFUB 5FUZL 2VXUL 1QBLH 1CFNB 1MJUL 3WIIH 1WJ3A 4NN7C 1QSFD 2F54E 2DRUA 5C09E 1X4YA 3VFGL 3MFGB 4Q2ZB 5I74C 3EW3B 3BQUC 2FHFA 4U1MA 1KJVA 4H25B 3NFNB 1KTLA 2DD8L 5E6IC 3TJHC 3KPNB 3LQAC 2OL3H 3D69A 3QFDA 4FXKA 3NBNA 1T1YA 3QCUH 1VFMA 4NCC1 3U9UB 5KW9L 1B4RA 5D93C 4IMKA 1OCWL 3RGVA 3RX7A 5JIKA 5GZNC 4KKCC 1IC4L 5E24E 1FO0L 1WFTA 1KCVH 2VDQL 1I7TA 3LQAH 2G9HB 1AHWA 5TH2B 3DV6A 1UM6L 2V17L 2NTSP 4LLDB 5FUZH 5EN2A 2VXUH 3CSPA 1MJUH 2CLVA 3LRSA 3B6SB 5EU6E 5JHDB 5HHOA 1S9VA 1QVOA 1EH9A 1MI5E 32C2B 4QLRA 1RURL 4O5LH 3VFGH 2MOVA 1A6TB 2W9DL 1J8HA 4PJ5D 1FVCA 5F7WC 2BNQA 3DVIA 3JWOL 4U1KB 5DA0B 1YJDC 1DVFB 3O6FC 1R3HB 1JNJA 2OLDA 4YAQA 3K4ZA 4CMHB 3DXAE 3NCBB 3DVGA 2DD8H 2H26A 2I9TA 2R1XA 4RMTA 5KW9H 1M7DB 5HYSA 4RRPG 3W11C 1OCWH 2YPLE 2PO6D 3C87A 1IC4H 1CGYA 1MVFA 1J86A 3STLB 4DUXA 2VDQH 3QBTB 3KXFA 2APFA 5DMKB 3RY5A 4Q58C 1UM6H 4Z7UF 2V17H 3DI3B 4GUPB 4RZCB 5KSVB 2HFGL 1GH7A 5DEGA 4H0HB 4X8JB 2CIIB 3JWOC 4XRCA 2ICWA 4G6FD 2EO1A 4I0CC 1OP3H 4QYOB 2F54A 5GGVL 1RURH 3BKCL 3QIBB 5DK0A 2W9DH 4K7PY 1OW0A 3JWOH 4ENEC 1MLBA 1DBKL 4HLZH 3VE0A 4ODBD 5ERWA 5SWSA 4X98B 1LO5B 2GK0B 2HJFB 4YFLF 1C5CL 2YWYA 43C9A 4NO3B 2EDRA 1G7IA 4XZUA 1RZGA 3AMKA 2MSPA 3OJDB 1OT2A 3AS3A 5DGRA 1XF2A 4NNYA 4XHJC 3W9EA 3BPCA 2P8PB 1UB6A 4WUUB 1FL3A 2FEDC 2HFGH 2VKXA 1GGUA 4PRBA 4OBRA 5C0BA 3LPWA 4QRPB 4ACPA 3ES6A 2ATPB 5EU6A 2XQYK 3BPNB 3SO5A 1NMCB 4PP1C 5GGVH 4HUUB 3BKCH 2ICES 3QWOB 4BFIB 3O41B 3BI9X 5TE7L 3AXLA 3SJVD 3RA7L 1WWBX 4EXPX 3QHZL 1DBKH 1TJGL 1AR1D 5C3LD 2UY6A 2XNAA 4IRJB 5EOQL 1FFQA 3DXAA 4OLEA 4TPRL 3WFDH 3HZMA 3ZO0A 1C5CH 4L4VB 4LLVB 4LDEB 1RZ8B 2LU4A 2NLJA 5DMJB 3WHE0 4ZUSA 4HH9A 3LPGA 1EEUA 3M1BA 5CILL 2YUVA 2BSTB 3TVMB 4JFOB 5BVJA 3FJTA 3P73A 3EFDL 5GS2H 5ABDE 2H6PA 4PGEA 3TA3B 3RQ3A 1QPXA 1U92A 2L0DA 3O3AA 4X0KB 5E95B 4U1SB 1X5JA 4HXBH 4R8WL 3WE6A 3TLRA 3OAYK 4PR5B 5EO1A 3ISWA 5F7UA 4PB9L 3BZEB 3O4LD 4NRYA 5TE7H 1G0DA 2NTFB 3KPLA 3QHZH 4KFZC 1A0QL 1TJGH 3TH2T 1NLBH 1T83C 3VXOB 2VIRA 4HJGA 5CGTA 3BKJL 3GO1L 5FIEA 1A6WL 3OL2A 5EOQH 2W0FB 4TPRH 3VFSA 2HLAA 5C6TL 2ARWA 4HUWA 5T33L 1K2DB 1KENL 3QUXB 4IJ3B 5CILH 2FLRT 1HHJA 2G60L 5J6HA 3EFDH 1QSEA 4Y0GA 4UB0L 1EEYA 3PGCB 5C2BL 3C5ZA 3T4YB 3VWKC 1DUYB 1IC5L 3O9WD 4R8WH 1XFPA 1CICB 1TVBB 2B1HL 4KK8C 1P7KA 5I18H 4LLMA 4LASL 3EKCA 3O3DA 4MAYC 4YFEA 4YPJA 4PB9H 3QHTC 3OX8B 4DZBA 3NCJL 4WHDA 1VADB 1DLHA 4Z7VB 1A8JH 2FYYA 1CBVL 1A0QH 5EUOE 2R0ZL 3BKJH 3GO1H 4NKMA 1A6WH 3TWCL 1WTGT 1IILE 2DI9A 3RVTC 4NDMB 5C6TH 4M61A 5T33H 1AD0B 3LD8B 1PYWA 4LLAA 2Q6WB 3FB8B 3JBG7 1BBJB 1T1XA 5JIPA 2G60H 3GI8L 3KPSE 4C56B 1KT2B 3JUYA 4UB0H 4PPTA 2ADFL 4UBDC 35C8L 5C2BH 4U0RB 3E6HB 1YEJL 1IC5H 3U7YL 3O6FA 3MJ7A 5AUMB 4LASH 4Y4HD 2H3NA 3WJLC 1G7HA 3SDDD 3NCJH 4CMMB 3EJJX 4JQXC 1CBVH 3BDXA 3LKSB 2R0ZH 5E00A 3DRQA 2R1YB 3TWCH 3VDAA 5GS1B 1KTRL 3F5WA 2P5WB 4J3XA 1NMBL 3P77A 4L3AA 2UV3A 5LWYL 5HHPA 5T1KA 2ITCA 1YPZB 3E6FA 1V8HA 1Z3GL 5FM5O 3GI8H 5EU4B 1CFTA 4LPXA 2FEEL 1BAFL 4U2ZA 2ADFH 3KLHC 3TH4T 35C8H 3O45A 4KK9C 1YEJH 3OR7B 3U7YH 2LTQC 3O8XB 2Y72A 3M17B 5E5RB 3MLVL 3ZKNC 5A3IC 2NY0C 2HG5B 1YEDA 4BSVA 4YDVB 3EO9L 1P6AB 2ARJB 4MB3A 4J3SA 5EULV 4MLSA 3DHJA 3HRPA 3MRDA 3S5LB 2DQGL 5EUOA 3S5LG 2AXJA 1VKXB 2JIXB 4LAQL 1FFRA 4ETQA 3ULVC 3TJEL 3RNKA 2LV4A 5CHNB 5HD8D 1NMBH 3QULB 4XGZB 2V7NB 3OPZL 2VNCA 4XPTH 4E41B 5LWYH 4GRMB 5JW3L 4HV8A 5D7KD 1Z3GH 3ULVH 3CCHA 3KPSA 3MACL 2YD2A 1NANH 4F57L 4OZFH 3HS0B 1CDHA 1OSZB 4Q9CA 5ANME 5CP3A 2P7TB 5LKNA 3GSOA 3VDBA 3CFDB 2G5RA 1NBZA 1OAXL 3GJEB 3MLVH 2F53B 2D2OA 2WIMA 1SM3L 2H32H 1VFUA 4P3WA 3UTTB 2HJLB 3EO9H 1HKLL 1XZ0B 4JKLA 4ODWB 5GGSY 5F7YC 2P47B 2BVQB 4MQ7B 2Z8SA 1U3HB 2DQGH 4ISVB 4J4PC 4J3VA 4P5MB 4LAQH 4PREB 1UB5B 1EHNA 3TJEH 1EVTC 3OV6A 3F7YB 3OPZH 2GJ6D 2VB5A 3DGGB 5I15L 1BEYL 3W9DA 4IEFB 5JW3H 1PBYA 4OSUL 4HT1L 4L4TD 3OGCA 3CLEL 5CEYB 3MACH 1ZHKA 3WS3B 5IBTL 1N0XL 3MUHL 5J7CC 1EVUA 1J0KA 5JW5A 1Z5LA 3EIFA 1N6QL 1C8PA 1NKRA 2CKBA 3QO0A 4QOKD 2FZ3A 3UTQB 1J0ZA 1T83A 3GI9L 2XOTA 4X6DA 4XXDA 4WFGE 1FCCA 1KCRH 1OAXH 4RFEB 3G5YA 5E8EA 1SM3H 4LU5L 2BJML 4GQPH 1HKLH 2WNGA 5HYIA 4MVBD 1D5IL 1T5WB 3DYOA 4F37F 4KWUA 1JK8B 2QKIB 3V5HB 5IW6B 3DO7A 2NZIA 2F9BT 1X6LA 3WDIA 2DBLL 5I15H 1DLFL 1MHHA 3DX9A 4Y8DC 3VWKA 4XP6L 1BEYH 3VRJA 3IJHB 4OSUH 5ENWB 4HT1H 2OM5A 3MUGB 2HTKC 4Z7UB 5DJZB 3CLEH 1S7VB 2NY4C 4MAYA 1N0XH 5IBTH 3MRPB 4JZJC 3RWJB 1U8HA 2R0WL 1HINL 4KKAD 5ANMA 4Q9QL 2YSSB 2ZUUA 3GI9H 3QEUB 4WW1A 5HPMB 2O26U 3OXRA 1KPVB 4P4RA 4RAVA 3VGAB 3ZTJG 3IDNA 3T0ED 4LU5H 2QQLH 2BJMH 3SKMA 4PJCE 1B88A 5IW3A 1CICD 4KVCL 4APQD 3F7VA 3DETC 1D5IH 4POUB 4HXAL 4YQXL 3GHBL 4WJ5A 5EOTA 4HIJA 5F3HA 5ID0A 4L8BB 1D9KC 1U91B 2DBLH 4YZFE 4P46C 4PBVC 4EI6B 1DLFH 4JRYE 4XP6H 1S7RA 1P6FA 1CG9B 1WBZB 1I7ZB 3I2CL 2F5AL 3IJYB 4G7YL 3HB3D 4OV5B 1U8OA 5IEHA 2C7UB 3LEVL 1WC7B 5ID1A 3E2HB 1LP9F 2R0WH 1HINH 3MRHB 4Q9QH 5AYQA 3OB0H 5LGKA 3X3GL 4LVOB 5EB9A 4U1JB 4Y19D 4RX4A 4MD5A 5E94A 3LKPA 3BFOA 2P24A 4LDOB 1SY6A 4H20L 2MNUA 4BSWB 3B9AA 5I0ZA 3NACL 4E5XB 1ORSB 2EH8L 1DDHA 3LSOB 1RV6X 4KVCH 5EZLA 2ZUSA 2IPUG 4LVHB 5INCA 2D0FA 2JJUA 4HXAH 4YQXH 3ULUC 1T6WA 3GHBH 2I07A 4IS6A 3RWFA 3DPBA 3EOTL 3L3JB 1S7SA 4P5KB 4X5LA 4RA0C 2MQ0A 2GFBB 1FVDB 3IDJA 3MV01 3BN3B 5C71A 3AGVA 4ZO9A 4ZQKB 3OG4B 1ONQA 2IQAB 4D0DB 1GCFA 4I4WA 3I2CH 2F5AH 4G7YH 4JFHE 2H2SD 1Y18B 3LEVH 3KDMB 1KPUA 5FM5M 3V0WL 3X3GH 4YUEH 5HGDB 1M7IA 2PXYC 3ELAT 4JAMA 3QNYA 5J12C 3QIUD 4AL8L 2IANE 4H20H 1XCTA 4PJCA 5DVLA 3NACH 4O51A 3QIWD 5F89B 2EH8H 2R2BA 4EI5C 3O8XD 4KQ4L 1F97A 1MHEA 4X6FB 1KXQE 3H9SB 1L4IA 2A74A 3BPLC 3OJ2C 4JRWA 1WQVT 3QISA 3BJLA 3EJYD 3G6AA 3EOTH 3NIGE 1A5FH 4PGBA 1LO4L 3L1OL 25C8L 4JRYA 3QUMA 5DR5L 2EDBA 4JN2B 5DO2C 3GSXA 2Q7YA 2A6DB 3K7UA 4Q9RL 4PJDE 2Z92A 5GGTL 3FT3A 3V0WH 5JDSB 2IPKB 4NQVB 3ZT7A 4J4PA 2D7NA 1H15B 4ZAKD 3KLAA 1CDUA 3MUY1 4AL8H 1MCPL 1TFHA 3NH7L 1FNLA 1MQKL 3CVHA 4KQ4H 3IAPA 1OP5K 2YD9A 4WGWB 1UKSA 1T4KA 3H9ZA 3OG6B 4QRSB 2FD6L 3MV7D 2V2TB 1BJ1H 5DJ0A 4HUVB 1P9MA 1LO4H 5F8QC 2BC4A 3L1OH 3U7AA 4WTWA 3CFJA 3D2UB 3BRGC 1VACA 5DR5H 3GUTA 2HTLC 2VLRA 4Y5YA 3OXSA 5DS8B 3QHFL 2KH2B 4OI9A 1ZLVK 4Q9RH 1ZT4A 2V5RA 4ODVL 5GGTH 1GOFA 1IC1A 1EPFA 1ZHBA 1UJ3A 2OS7A 4NQCD 4KAQL 3V6ZA 4TUKL 2IH3A 3CMGA 2EYSA 1XF5B 2PYEE 1MCPH 1A2YB 3ZDXE 2OYPA 3NH7H 1N8ZB 1H3PL 1BFSA 4ONHA 3FTGA 1ZHLA 5JXEA 4U6HA 3CX5J 3MBEA 4LSUL 3RGHA 4KROB 3BE1L 3IS1X 2HMIC 4RGNE 2FD6H 1ZT7A 5EC1B 3SKOB 3GDBA 4HCRL 4H5SB 4JZJA 3EOBA 1G9ML 3MGTB 3P9LB 3I75A 5ICZA 4NJAL 3NOIA 4BKLA 3VFRA 1OM3L 5DYOB 4Z76A 3FQUB 1BVLA 3QHFH 4ODVH 3DX7B 1NGXB 2N7BA 2XTLA 4HK3N 3TGXA 3MV11 4G8GD 4K3JL 5EIQA 1CK0H 4JN1L 4FXGA 4KAQH 5KAQF 4TUKH 2DMCA 3QA3A 4XWGL 1IZJA 4UNUA 2AJ3A 3NTCL 2P4AB 3MNZB 1DN0B 3LQMA 4J12A 3VXRD 1R6VA 3KJ4C 2A0LC 1H3PH 4P46A 4F7TA 1QNZL 5DQ9B 5I73C 2C1PA 3VFTA 1S8DB 2WIIB 4LSUH 1CD1B 1DANT 2JK5A 1N5AA 1KCUL 3BE1H 2FSEB 1T7ZA 2WINB 4HCRH 5GS0L 1NGPL 1CDJA 1G9MH 1MCRA 4I2XA 5IM7A 1KLFA 4YPGA 1R5VA 4NJAH 4X5XA 2EZ0D 1OM3H 3LV3A 1CGTA 4GRLB 3VXSE 2OZ4A 1Z6JT 4OZHE 3JTTA 2VQ1A 3D18A 2V9TA 1BREA 4K3JH 4JN1H 1CIDA 2ZNWA 1NCDL 3BGAA 4M62L 1LE5A 4XWGH 4KKBC 2DQIL 3NTCH 4JQIL 1QO3B 5AG9A 5DD3L 5LGHL 2AGJL 4FG6C 1QNZH 4BUHA 1JN6A 4N0FA 3WO4B 1U41A 4XCNB 4ZXBB 1KCUH 2XYCA 3N9GL 1C12B 4RIRA 5HHQA 4G43A 5GS0H 1NGPH 3GMNA 1MAKA 2A83A 3ILPB 1G7LB 3BHBA 4KRPD 1WEJL 3NN8B 3VW3L 1HHHB 4OCRL 3U0TB 2PXYA 3ARRA 4PLKD 5KSBF 1NGQL 4YEEA 4MHHI 3PQYB 3SKJL 1NJ9A 2DLHA 3O6ML 3KPPA 1SEBB 2GITA 4MCZA 4WENB 4ZTPL 1NCDH 4M62H 3ZT5A 5IIEA 5GRUL 3S96A 2QBWA 2X40A 2DQIH 4HK3J 4LCWE 4NPYB 4JQIH 4JHZA 3UTZB 3ORJA 5DD3H 1FC2D 1FRGL 3UAJD 1KNOA 1Q9KB 2AGJH 3MRFA 5LGHH 4DFIA 1TITA 1WCQA 4Z95L 3OJMB 4FQ1L 4N0CC 4HS8H 2VLLB 4PRDB 1FPTL 1M05A 3RPIB 1P4IL 4KK5C 4LKXA 3ILQD 3N9GH 4MNGA 4P2OC 1ITCA 4FQXC 3WJJA 2JTDA 4BM7A 4P5TB 2VAAA 4BZ2L 4X9GA 2AV1A 3QRFM 4EDXB 1FAKT 3IAQA 1QRND 3MC0A 1WEJH 2LFGA 3VW3H 2BNRB 4OCRH 4KI5F 3ROLB 3FO2B 1NGQH 2VYRE 1RQ5A 3MROA 4MMZC 1G7PA 3SKJH 3VXSA 5DJ2B 1EO7A 1OF2B 3ARQA 2J8UA 4AG4L 1NUNB 4CADA 3BX7C 3O6MH 4Y4KA 1I3GL 4WHCA 4ZTPH 4WY7L 3UX9B 4HEPG 1BZ7A 3DWTA 1AXIB 1MWAA 1R5WA 3UPRA 3C8KB 3WNPA 1Q8MA 5TGBA 1T7WA 1FRGH 3NMEA 4MA7L 4U6XA 1AKJD 3RL2A 2E9BA 3PWLA 5F7LB 1WICA 4Z95H 3IXTA 2OP4L 1MCDA 1TNNA 4FQ1H 4P48A 1CN4A 5ACZA 5GSRB 1Q94B 3NCCB 1HK6A 1FPTH 2XN9E 1P4IH 1CLCA 3T09A 4DVRL 4JKMA 1N26A 4BZ2H 1FYTE 2DYPD 4WO4B 5H2BA 2V5YA 3BEVA 3BT2H 3NA9L 2YEZA 1U8LB 1Z2KA 3FO9A 4P23B 3NIFE 3ARDB 4NO2A 4RWHA 4D9LL 5LBSL 4JCMA 1HIML 4IRSD 1G6RL 4OLZL 4AG4H 2R29L 1HSAB 1I3GH 4WY7H 1NBQA 3WFEL 4LCWA 3JTSA 1ZKAA 2CLZA 3QDGB 1UQSB 3P4LA 4CJ0A 3RAJL 2X4RA 4MA7H 4D0CA 5D5ME 4R97C 2OP4H 2X4NB 3RDTB 1Y0LB 3UPAA 2X4QA 1EIBA 1A3LL 4DVRH 3PWJA 1RHHA 4JGMA 4FS0A 3I3DA 4HDIB 3OF6D 2Y9RT 2P44B 1E27B 4F7CB 4F80A 5DMGC 3NA9H 1KXVC 1ACYL 3BGFB 2VXQL 3MMEA 4D9LH 2ZPKL 5H37H 5LBSH 5DVMA 1HIMH 2W59A 1G6RH 4OLZH 1OB1B 3QP3A 2R29H 4CN1A 5SX4H 3LPFA 4RGMB 5IGXL 1EAPA 3WFEH 1JZ3A 1MSPA 5IK3A 1WLHA 3S37L 5B38A 3RAJH 4FA8A 3DUUA 4KXZI 4L3EB 1AC6A 1I4FA 5MEOA 3ARFB 4WTZG 3KPQB 2XN9A 4OFKA 1A3LH 1BM3H 3IDIB 4OT1L 5IHLB 4UV4L 1OSPL 5A2FA 2X2YA 2JJWA 3MV9B 3T77B 2PCPB 3T1FA 3FZUD 5J9PB 1FYTA 5C8JB 4XCEB 4LSQL 4WEMB 2Y06L 1ACYH 4Z8FH 1H0DB 1XMWA 3BXNA 5CSZB 1QSFE 3TCLB 1B0GA 4BQBA 1K8DB 5T1MB 2D4DA 3MRKA 4Y8AA 1PAMA 5IGXH 2APXA 4G6JL 1I3VA 1TQBB 4WUKL 2BK8A 4OZGE 1U36A 5EZOL 3KNBA 3QUZB 3S37H 4PJ8D 2DMBA 5GGVY 2XQYG 5GGRY 4V1DB 5D5MA 3QZWA 4JO3L 4DGYL 1T1WB 1QFWL 4X6CE 2VDRL 5KVEL 2IALB 4HKBB 1E4XL 2IC2A 2Q3ZA 5TDNA 2ZKHL 4OT1H 3B4NA 1OSPH 4UV4H 1AR1C 3NAAL 3SPVB 3IF1B 2X1OA 4HKXA 3FO0L 1AQKL 5C08E 2E7LC 4PG9A 1TCRB 4ZXBD 4FOMA 1JGUL 1JGDB 4QXGL 4O58L 3S3SA 4LSQH 2Y06H 1DBML 1AGBA 4M00A 1YUHA 1GIGL 5BQ7A 3VCLA 2OXHA 1IGFL 1IM9B 1N2RA 1A7BA 4XVUD 5IVXF 2MCPL 4PJ5E 4ZSOA 3VXPB 4G6JH 4JPIA 4WUKH 5FKAB 4B53A 5EZOH 1AO7B 4FQXA 1WVZA 2IBGA 5E8OA 5L2JB 4GG6E 4JO3H 3RWHA 4DGYH 4KJPD 1QFWH 4XHQA 4LSDA 1NAMB 2VDRH 5KVEH 3RJQB 1E4XH 1YN7B 4HGWB 4S1DC 3T2QA 2ZKHH 3TBVB 2P43B 3QAZC 4CNIB 5IMLA 3TN0B 3NAAH 3QXAA 1UXSB 2BVOB 3FO0H 1AQKH 1FG2A 1AIFA 4P2QB 5KSUB 3OKLA 1KB5A 1JGUH 2ORBL 4QXGH 4HGMA 5I1KH 5HTSA 4O58H 4QHUA 1DBMH 2J4WH 1GIGH 1EBAA 1K3IA 4NQXA 4UT9L 1JYNA 1DJSA 2QQKL 1QSFA 2IEPA 1IGFH 3ZLQC 5KAQG 1WWWX 3QXDB 2MCPH 3TIEB 1K5NB 1QOKA 3MRRB 5IG7A 2DL9A 3OKKA 4ZFGL 5HHXL 5LG1A 2OR7A 1U8NA 4JO2L 3G6JE 3CXHK 2AVGA 4O02L 4KGLA 3TFKD 3RBSA 3CMOL 1A64A 1WCBB 2HFFA 5D7JC 4DEPC 4R26L 2ZCKL 3D1MC 1T5XB 3MRNB 5FCSH 1E6JL 3CD4A 5IQ7L 4IHOA 1DTUA 4O2CB 3DBXA 1X4XA 4U6VL 5IHUL 3P4MA 3L3IA 2P5EB 2XTJC 2ORBH 3ARSA 2F74B 2XZAL 3LS5H 4PRIE 2APBA 4UT9H 3CFEA 4UIMA 4HX1A 4XMKL 7FABL 4YC2B 2QQKH 1S7XB 4HC1L 4WI3A 3DI2B 4FFVD 3NCMA 4PJ5A 3RZCC 5IW1B 5CP7A 4MWFA 5D1XC 5HHXH 4JFFA 4P23D 2NNAA 3MCLL 2YWZA 4JRXB 5E9DB 1RZFL 3UYOD 4CRPA 3NPSB 4JO2H 4Z18A 5IQ9B 1OHQA 4O02H 4Y4FB 5TDOB 2FJHA 3CMOH 3SDDC 3O3UN 3VXTA 1MCBA 1IGIL 4Q6YA 4R26H 3QPQD 2ZCKH 2PO6A 1JUFB 4M5ZL 4FQIL 4AIZB 3MODL 5F6HJ 4CVZA 3RIFK 1MEXH 1E6JH 5IQ7H 1CL7I 1P69B 4AENB 1K4DB 4U6VH 5IHUH 5KSBB 3DIFA 1UZ8B 3QG7L 2XZAH 4LSPL 4NJ9L 4U1LA 2O61A 1KYOJ 1F4HA 1K8IA 5I2IA 2XKNB 1FJ1B 1YY9C 4XMKH 5GGSB 3SGJA 7FABH 3D25B 2A6IA 3GSQB 3VXMD 4HC1H 4P2RB 1QACA 5E99L 1DP0A 1S9WA 4L29B 3MCLH 1RZFH 2COQA 3SKNA 3G6JA 5HPOA 1KFAL 3TESA 3DUSA 2ESVB 3W0WD 1IGIH 1HQ4B 4HWZA 1SEQL 4M5ZH 4YDIL 5EC2B 4LRIC 4FQIH 4L3ED 3MODH 4B50A 2ZG2A 4EOWH 4Y1AB 3ROOB 2Q87A 3QNZB 3ARFD 4WFED 3O4OC 3NIDE 4TVPL 3LDBB 8FABA 4K7FB 4AEIL 5HD8C 2YD5A 3QG7H 1MJJA 4LSPH 4NJ9H 2GK2A 1MCEA 5C07D 1EDQA 2EC8A 3FQRA 3PG2A 4PJ7A 4YHNA 5FV2A 5KG9A 4NZJA 3OKYA 1OTSD 3P4OA 2P8MB 2Z35A 5DI8A 1C5BL 5E99H 1N3NA 3SJVA 2A9ML 4FFZL 2DI7A 2DM4A 4LKCA 3PV7A 1KFAH 4MA3A 2E7LA 3PL6D 3HCVB 1QKZL 1IM3B 4Z9KB 5I8KL 1SEQH 5D71H 4YDIH 3WNNA 5I66A 3FHQA 1MLCB 5FYLL 1YMMD 4CN4A 4NRXA 3DTXB 3V79C 4J1UA 4TVPH 2SEBB 2QJDA 4AEIH 2DQDL 4D0BB 1AGDA 2XZQL 1LDPL 4PJ9C 4B7LA 4JFYA 2X1QA 4M7LL 3PE9A 2D31A 3KPOA 3ZKXB 5FUCE 2A9NL 5CD5C 3OKNB 1IEAB 3Q5OA 4ZOCA 1C5BH 1OTTC 1JIBA 1JPFB 1NGWA 3O4LA 4FQJL 1QFPA 1ZLWH 5FK9B 1FFOB 2A9MH 4FFZH 5JHDE 2NY7L 1PEWA 4N8VB 4N8VG 4W6YB 4QY8A 3J7HA 2X4UA 5CGYD 1HOCA 1IAIM 1WITA 4YEFA 3PABA 1ERNA 1QKZH 3WIFB 4EN3B 1HHIB 3FB7B 5I8KH 5DTFB 4MVBC 1DQML 5FYLH 3FOMB 4OQTA 5E70A 2VABB 2DQDH 5EOCJ 4ELME 2XZQH 1LDPH 4NQED 4M7LH 2DWEA 1VFBA 1IGYB 3O9WA 1FFPA 4GXUM 3TNMB 1CXHA 1A14L 2A9NH 5DJ6A 4M9OA 2C4FT 4P2QD 3H9HB 5DQJB 4FQJH 1QR1B 4WI5A 1NGZA 3ZYIA 2HVJB 5D7IA 4CJ1A 2NY7H 1NDGB 3HNVL 1HDMA 2WBJD 1IL1A 3CFCL 1AP2B 4Q2ZA 4HIXL 3V5DA 3WN5B 2HJKB 1MAJA 1L7TL 4OGXL 4R90L 3VFOA 1TQCC 5I9QC 3IFNL 1AGFA 4PLJD 3ARUA 2R1WB 4TNWK 3MLXH 5GSVB 5D7KE 1DQMH 2EEBA 4C83A 4KRNA 5J11B 2QSCL 5D1XA 3WLBA 4LRNL 4I0PD 5SV4A 5FA4A 2FCBA 3K4DA 4R2GB 4LF3B 3BD5A 2IH1A 4Y4HA 2JJTC 1NPUA 1T21B 3SDDA 5HXMA 4OAWB 5MENB 4QRPE 2HKFL 5CS7A 3ZTNL 3N1GC 3WL9A 3STBA 4RMVA 1YEFL 3HNVH 4W4OA 3VRIB 3CFCH 3RU8L 4HIXH 1A6TA 2XWBA 3J8F7 4PLOB 1IC7L 1L7TH 4OGXH 1MUJB 4PJIE 4Y5VC 4LBEA 4R90H 3P2TA 4OCLC 3C5JB 3IFNH 1GC1L 3MLTA 1A3QA 2BCKB 2YBRB 2OQJB 4L4TE 2ENYA 4YFLI 4DVBB 5F6HI 2QSCH 1I1FB 5EUOF 4Y16B 4PTUB 5E7BA 4ELMA 3R8BB 3MRLB 1R0AL 4ZNCD 5IVZB 1SYVB 4LRNH 3O0RL 1TZGL 3ZE0F 5IVXB 1HILB 4MSWA 3C5SB 1QBBA 2XT1B 4MCYA 1WT5C 1NEZA 4KU1A 3BZ4A 1ITBB 2V6HA 4PY7A 4YBQC 4HWEL 3V5KA 2VKWA 2HKFH 2APTA 3ZTNH 4X7TA 5I1EL 5DSCA 4LRIA 5DC0A 4P4KC 2CMRL 4P2RD 3QIUC 4P2CG 3RU8H 1HZHL 2DKUA 2K7QA 1IC7H 4EKXA 3KVQA 2NZ9C 4B7IA 2YD8A 5JORA 5GRVK 1I9RL 3MRQA 1ULVA 2NY1D 4H1LH 4DGIL 1GC1H 3QIWC 3UC0L 4U1MB 1NMAL 1B4JL 2XZCL 2VZVA 3GZKA 4BH7A 1KTLB 3FB5A 1Q9WA 1KGCD 3QUYC 4RCAA 3D69B 3GKWL 3QFDB 4FXKB 1T1YB 5IBUB 1G9NL 1GZPA 3ARBD 5DD1L 5IBUG 1I3UA 1R0AH 3RGVB 4WHYG 4Y1AD 4WEUD 3O0RH 1TZGH 4ZOAA 1I7TB 1AHWB 3DV6B 4L9LB 3V7MA 3T0EE 5SWQA 4HWEH 1UH4A 3TZVC 4G5ZL 4PBXA 1PY9A 2FECI 5EN2B 4DKEL 2CLVB 5I1EH 3LRSB 5D2LA 2CMRH 4M7JL 4HIEB 4ZAKC 1A1MA 5HHOB 1S9VB 1QVOB 1HZHH 4X6DF 3PWPD 3IDMB 4PJIA 4Z7VE 3FQNA 4OCNC 1J8HB 4ZUWA 4OKDA 1MCWM 2GJ6A 4DGIH 2BNQB 2VAJA 4JY5L 4DUVA 1G9NC 4K3EL 1CQYA 1NMAH 1B4JH 2XZCH 3KYKL 3C9NB 4L4TA 4YAQB 2VZ3A 3DVGB 4O9HL 3CFKA 1W72L 1P4LA 2H26B 2I9TB 3GKWH 2R1XB 4XWOD 2D7OA 5B21A 5F7DB 1G9NH 5HYSB 1YNLL 5HYSG 3B8YA 4QOKA 3K74B 5DQDL 5FF6A 5AD0B 4ZO7A 2VL5A 3KXFB 2H8PA 3MOQA 1HXMA 1WWAX 3C60C 5AAMA 4HAGA 4G5ZH 4NZUL 5DEGB 4DKEH 4XRCB 3KYOB 3UMTA 2EXWD 5CJ5A 4M7JH 5E4EB 2WV3A 2P45B 2F54B 3R8QA 5DK0B 2I9LA 4JY5H 1FLTX 4G7VL 3SDAC 1MLBB 4K3EH 4DFHA 3KYKH 2YXFA 3UEZA 1HCVA 3HI6L 5ERWB 4O9HH 1BFVL 5SWSB 3RY4A 5DD0L 43C9B 2OR9L 4E0RA 1T22A 1G7IB 1UVQA 1YNLH 4XZUB 1RZGB 1YPZE 1J9CT 5D1ZB 5DQDH 1XF2B 5BV7B 3SDCD 1OD9A 3GRWL 3W9EB 3BPCB 3T0EA 1UB6B 4NZUH 1H5BA 4PRBB 1JPTL 1CICA 5C0BB 2QQQA 4APQA 3VJ6A 4GBXC 2D7QA 1EO8L 2DQJL 3ES6B 4GG8A 5T5NF 4OF3A 5EU6B 2W60A 5ESAB 1QRKA 1IGJA 4OZ4A 4RMRA 3OKMA 4WU5A 5T3ZD 1OAZL 3AXLB 2JB6A 3HRZB 4G7VH 3WS6A 3ZL4L 2OTWA 5J1SC 4ZFOA 3HI6H 1BFVH 3DXAB 4OM0L 4EIGB 2X1PA 5DD0H 3HZMB 4M1CC 3FT2A 2OR9H 4JREC 3CLFL 5KSAD 3RKDC 2NLJB 1CVSC 3FT4A 4MNQD 4P3DA 4HH9B 4ZUSB 4EUPH 2UY7A 3LQZA 4Y19A 1CI5A 1BECA 3M1BB 4LPWA 5BVJB 3GRWH 3B2VL 5LAXA 3P73B 1YEKL 4Y5VA 2H6PB 4PGEB 1CE1L 1U92B 2CDFA 3O3AB 1JPTH 1F02I 3ZKQD 3B9KC 5DRZA 4R2GD 1EO8H 2DQJH 4Z7QE 5BMFL 3WE6B 1NBVL 4G8FA 3MV7E 3KPMA 1NCWL 3QRGL 4XI5D 4NRYB 1X5FA 1OAZH 3NZ8B 4X7DC 3LEYL 1A21A 2QEJA 3KPLB 3EDKA 3ZL4H 4PJCF 5I19L 4HJGB 3ZT6A 1JGLL 5C0RL 4OM0H 1WT5A 3KPTA 4X9BA 3OKDA 3VFSB 2HLAB 5FHAL 4HUWB 3RIFF 5EUKA 3CLFH 4NQCE 2K7PA 3BW9A 4HKZA 4YZFF 1CLOL 4P4KA 3UBXI 1HHJB 3QIUA 3BMVA 4NN7B 4LPYA 5J6HB 3B2VH 1MY7A 1QSEB 1YEKH 4X9HA 3T65A 4OCSH 2AKRA 4GS7B 4AIXA 1KTDA 3BQUB 1EEYB 3HNTL 3QIWA 5J1AB 3C5ZB 1B6UA 5BMFH 4F33A 4JO1L 1NBVH 2EE2A 1P7KB 4PJBE 1JCKA 4LLMB 3K46A 1KELL 3O3DB 4FQHA 1NCWH 3QRGH 4QRTA 1EEQA 3MPCA 4R96A 1V3KA 3PHOA 2Q76A 4DZBB 1HXYA 4XCCL 1DLHB 3LEYH 1HHGA 3RVXD 3QDHA 2FYYB 2OXGA 1NBYA 3K80A 4EIZC 5I19H 1JGLH 5C0RH 4NKMB 3EYQD 4XGZA 4M61B 5M94B 1UKTA 1PYWB 1IGTA 1ZXQA 5JOPD 4N9GA 1BJ8A 3SO3C 1CLOH 4MJID 1T1XB 4ZAKA 3BIAX 3HS0A 5DHYA 1YA5A 1OSZA 3S3PA 5A2IH 4XAKE 5EBLA 2VSDA 1II4E 3HNTH 1JTPA 2VXVL 4Z5RA 3O6FB 3DX6A 3MJ7B 4D9RE 4RFNC 2X41A 4JO1H 4PGDA 1RJYA 1KELH 3MV7A 4HQQL 2H3NB 2HT2D 3D0LA 1G7HB 1BQSA 4XCCH 2BVQA 5LCVL 5LXGL 5IWLA 3ABZA 4GKOA 1GSMA 1I1CA 3L3GA 1FNAA 1YNTA 1WBXA 1U95A 2CGRL 5E00B 3DRQB 5BO1L 2K1MA 2XXCB 3BPOC 3F5WB 4LVNB 3P77B 1G1CA 2V5TA 4U6YA 4NQCA 5HHPB 3NIGF 2NW3A 2ITCB 1L6ZA 3E6FB 1CFTB 5I6XC 4UTBL 5FFLA 3SCMD 1MCWW 3O45B 2AQ1A 2FH6A 2VXVH 1BZ9A 1EUTA 2J3SA 3KXFD 3SQOL 4PJBA 3AAZA 3OAUL 4HQQH 1YEDB 4BSVB 3VGEA 4XMPL 2C3WA 5BCAA 5LCVH 5LXGH 4X4XA 1T5WA 1JNLL 3B2UD 4MDJA 5KANG 3C09C 3MRDB 2CGRH 5EUOB 5BO1H 4R7NA 4NQDD 4ETQB 1VERA 3RNKB 3D5OF 4G8GA 2WZPD 4OIAA 3PHQA 3WO3B 2NXZC 3KPSB 4HPOL 3N85L 1ZANH 3VXRA 2Z93A 3PP4L 4UTBH 5D1ZD 5FA3A 4OD2B 3UZVB 3HUJB 5K59E 3GSOB 1KPVA 1DBAL 4WWID 3SQOH 3OAUH 4MB4A 4HF5L 3RWIA 3ULUF 3U48A 3VG9C 5C0BD 4XMPH 1QRNE 1JNLH 2W0LA 3H9SE 2ADIA 3BEWA 1XCQA 4U05A 3ZDXF 4LFHG 1I75A 1S7WA 5EU7C 1QEWA 4K55A 4TNWF 1X5ZA 3KHOA 3DARA 2DB8A 4YWGH 2X44D 3FZUC 1H3WM 2OR8A 1CG9A 4S1RL 2HT3C 3W9DB 3NCYS 4BH8A 3OGCB 4HPOH 3N85H 1ZHKB 3H6JA 3PP4H 4PJAE 4UDTA 1LEKA 4DGVL 2AJZA 2NY6B 1A47A 2BSRA 4HWBH 2H9GA 5JW5B 1JJUA 2CKBB 3QO0B 1PQZA 2FZ3B 5F88A 1DBAH 4X6DB 4XXDB 4WWKD 3IRPX 2L7UA 3S88L 3L5HA 5E8EB 2B7DT 4HF5H 5JPMA 3IFLL 2VZOA 1G0YR 4Z7NE 2FDBP 3DROA 3BGMA 1ZEAL 3TNNA 4G3YH 5IEKA 4QGYA 5JMOC 3DO7B 4CAGA 2G2RA 1JZ4A 1FVDA 4MA8L 3PDGA 4LQ1A 3DX9B 1MHHB 3VWKB 3K81A 3VRJB 3SBWC 4UOW0 1LMKA 2AV7B 2D3VA 3CH8A 4ETYA 2BY3A 4MAYB 2ADGA 4KQ3L 4F7EA 2W38A 5C0CD 2OSLA 1U8HB 5JPNB 3U4AA 4XVUC 5ANMB 1V7NH 15C8L 2AJYL 2AXHA 4WW1B 2J8UF 1NCTA 1Y6KR 3S88H 3IU3A 3OXRB 4P4RB 3L3HA 5DLML 3I02A 4RAVB 3BQUD 3IDNB 3SKMB 3IFLH 2KBGA 5EIVA 4KJPC 3TT1L 1QRNA 1EEZA 3LN4A 4NWUL 4GAFB 3F7VB 5CWSA 4EZMA 3U0PB 2CUMA 5E6ID 4WJ5B 1ZEAH 5EOTB 4HIJB 5F3HB 1RK1A 5ID0B 3ZDZE 3FFDA 3HAEA 4MA8H 4DZ8B 2P42B 1RZIA 4KKCD 4HAFA 1KEML 1W2KT 2DQUL 3F7QA 4MJ5A 4U2YA 3E8UL 2NY2B 3HN3A 3WKML 4FTVD 3KPRD 3Q2CA 4YHYB 1U8OB 3EYFA 4KQ3H 5IEHB 1JRHI 1AKJA 4PJAA 5T5NG 1ZWIA 5JNYA 15C8H 2AJYH 4KDTC 4MD5B 1KSRA 5E94B 1FN4A 2LU7A 5DLMH 2MJWA 1AGCA 2P24B 1IEBA 2D9CA 3TV3L 1KB9K 4JVUA 3GNML 4Q6IC 4NT6A 2DYPA 4NWUH 1DDHB 4OIIL 5EZLB 1KJ2A 5TF1L 5INCB 4R4NC 3NFSL 4LLUB 3QEQD 1LK3L 3GEWB 3VXUD 2I07B 4IS6B 3RWFB 2CDEA 3W11D 1REIA 3MZTA 5E7FA 4IRSA 3MGOA 4FXLA 4UAOB 5D1QC 1CDGA 1U58B 1KEMH 2DQUH 3HMWL 4FFWC 3IDJB 1RPQA 1YECL 1OQXA 2YXMA 3E8UH 1X5AA 4NC1C 1ONQB 4I4WB 2NY0B 3BUYA 1KPUB 4M4RA 3SQBA 2EDTA 4MNHA 5E1HB 3MRMA 4JAMB 3QNYB 1AD9A 5ESVA 3ARYA 3R1GL 2BY0A 3TV3H 1XCTB 4ENED 4K8RL 1DR9A 3OF6A 4PJCB 4CW1A 3GNMH 3VD5A 3U83A 4O51B 2R2BB 2JELL 1MHEB 4RBPH 5TF1H 2A74B 3NFSH 4IIQC 4I9WE 5GRZA 1LK3H 4H5SA 3G6AB 1JF1A 4GMSL 3WHE1 4PGBB 1WF5A 4JRYB 5DYOA 3QUMB 2F5BL 3DSFL 1YECH 1MCQA 3TIDA 3GSXB 1NGXA 3PQYE 2Q7YB 2EIDA 2Z92B 3FT3B 1OD7A 4LAJH 3L95A 1FZOA 1XGRA 2W07A 3PIQA 2MMXA 4JFPA 5C1MB 2AW2A 3KLAB 3RFZC 5MHSD 4OD3L 1LHZA 3R1GH 2C3HA 5DQ9A 4K8RH 1KN2L 1Q1JH 1S8DA 3MLSL 5L2KD 3CVHB 4J23A 2JELH 4HWBA 4NBZB 5D5MF 4OUUA 2IPTL 5HI5D 3L9RA 5GS2D 4GMSH 1JPST 4S1SL 5DJ0B 2CUHA 4XNQA 2BNRE 4PRHD 3RUGE 1HYRC 3UBXA 2F5BH 3HZVA 3CFJB 3DSFH 1VACB 4M93C 1T3FA 3FCTA 3GUTB 2VLRB 1LO2L 4Y5YB 3OXSB 4PJ8A 3B5TA 3IGAA 1S7UA 1ZT4B 4XMLL 5ITBL 4QRRD 1ZHBB 3R4DA 1UJ3B 4KGJA 4Y88A 5F1SA 5HJ3B 3EO1A 1ZA3A 3V6ZB 4V2CB 1CFSA 2IH3B 2GTWB 2EYSB 4OD3H 2DDQL 5CLTA 1WAAA 1KN2H 4NZDA 3MLSH 3PL6C 4ONHB 3FTGB 1MY5A 1ZHLB 3DO3A 3LKOA 3SBWA 3G9AB 4L4JA 4U6HB 3MBEB 1FHGA 4D94A 1C12A 5D2NC 5HHVL 5C6PB 2NY4B 1ZT7B 1FG9C 4HMEA 3G5VA 3FHAA 3QG6A 4JZJB 3EOBB 4S1SH 3L6FA 5ICZB 3I75B 5D6DC 3U82B 3ECBA 4BKLB 3VFRB 4Z76B 1LO2H 1VGEL 1B6DA 1RI8A 5MI0B 4XMLH 3QDJD 5ITBH 5KVDL 1A1OA 3IDGA 1X4ZA 4D8PB 4KK8D 4FXGB 1EBPA 3QA3B 3BAEL 1BMGA 4PJHB 2AJ3B 5GZOD 1DQLL 3QDMD 2DDQH 4A6YL 3DURA 2JCCE 5DFTA 1D9KB 5DMYA 5JIIA 4P46B 4F7TB 5HYFA 2C1PB 3VFTB 4XH2A 3QR2A 2JK5B 1N5AB 2ZOLA 5HHVH 3QFJD 2G75A 3OAZH 1DUZA 4YGAB 4PRPD 1EV2E 4S0TD 2Q20A 4I2XB 5IM7B 2BOBA 4M8VA 4P57A 4YPGB 1R5VB 3RUGA 4X5XB 4S0SD 1OQOA 5HDQL 3IFPA 3EOYG 4KDTA 2VXTL 1UJTA 4I8DA 3MJ9L 2AI0L 4UBDD 2F8VA 5KVDH 3JTTB 3D18B 3BP6A 4Q6IA 1D5MB 4I77L 3W0WE 3VWJD 3ARPA 5F97E 1LE5B 3BAEH 5TQ0L 5HYQA 4DJMA 3VD7A 4L3EE 4FABL 2JJVA 1DQLH 2WBJC 3BISA 3FFCB 4A6YH 1FDLL 2VR4A 4MB5A 4WFEE 1RJZA 4G9DA 1JN6B 1GGYA 4N0FB 5DGQA 1J05B 3MV9E 4NFDA 4RIRB 3RVWD 5HHQB 4NKIL 4NQSA 1ZLUK 2FJGA 4G43B 4U6TA 4XBGA 5DJAA 3GMNB 2GY5A 1CTNA 2A83B 4OQ1A 2Z91A 3BHBB 5IROC 5BS0D 4G8IA 5HDQH 4P23A 5DURB 2PXYB 3VFWA 5J12B 1J0IA 4XNUL 1CDIA 2C4FU 5I71C 2HN7A 1LWRA 2GTZA 1A7QL 3MJ9H 2AI0H 4M02A 5E0QA 4ZS7L 1NJ9B 4WFFD 3VD3A 4I77H 3KPPB 4MCZB 2GITB 1D5ZB 5IIEB 4IIQA 3BPLB 5TQ0H 3S96B 4JO4H 3ZKND 1A6AA 2I5YL 3TYFA 4V1DE 4FABH 1MH5A 5T1DL 1FDLH 1KNOB 2JCCA 3FRPA 3MRFB 2R0KL 3CSBA 1AE6L 1J7VR 3G6JF 1M05B 3HE6D 3ULVD 4LKXB 4O2FA 5FYKL 4MNGB 1DVFC 4NKIH 4LGPB 4U1IB 5TE6L 2AJSL 3VXMA 4CMHC 2AV1B 1EFXD 5AZ2L 4XTRC 1X5GA 2VUOA 3MROB 1G7PB 3IB4A 3MRCA 1A7QH 2MHAA 3SGKC 3VXSB 4ZS7H 3V7AE 2J8UB 5CBEA 4PFEA 1PW3A 4CADB 1U2HA 4Y4KB 3T04D 4PJ7F 1AO7E 5L7XH 3V8CA 3W0WA 5FGSA 1BZ7B 2ZCHL 2I5YH 3T2PA 1MWAB 1R5WB 5GJTL 3UPRB 1IAKA 4D2NA 2J5LC 5TGBB 5T1DH 4U6XB 3RL2B 2R0KH 3PWLB 3ARFA 1A02N 4TUJA 3IXTB 1AE6H 4KKLD 3BH9A 3SY0A 3VFNA 2BDNL 3PNWA 4WCYL 5ACZB 1VEOA 4NQEE 3D39A 1IAMA 5GXBB 2ILLA 6FABL 4S11A 1FNEA 5FYKH 5C07A 3HC0A 3RY6C 1R3LA 4P2QE 3PWUA 5TE6H 4W6XB 2AJSH 2A73A 3BH8A 3JZ7A 4M9PA 4XCEA 3T4AA 4NOFA 5H2BB 3ARBC 2WWKT 3BEVB 3P40A 4Q74A 5DRWB 1T0NB 5AZ2H 1EAJA 2YEZB 2IGFL 3FO9B 2BSED 4NO2B 4LARL 1E0OB 4JJ5A 3MLZH 1WFOA 2J6EL 3PL6A 4CGTA 3VMNA 1T7VA 4M1DL 5C0IA 4QHNA 2UWEE 1CGXA 2BOCA 2ZCHH 4UMGA 5C9JA 4LCWB 3JTSB 1JE6A 2CLZB 5GJTH 5A43C 2CO6B 3GMPA 4NKQB 5KN5A 1YMMA 2X4RB 4D0CB 4IOFC 4X9FA 1RUQH 2IALA 3H8NA 4DCQA 5HBBA 3GGWB 3PV6A 2BDNH 4WCYH 4I48A 4S1QL 4OKVA 4WDIA 2X4QB 4M8QA 3GHEL 3BIKA 2BXYA 3X17A 1L9NA 6FABH 4JM2D 3PWJB 1SBSL 1RHHB 4MA1C 4PGZA 4D9QD 2XFXA 3N1FC 2Y36L 4IRJC 4QHKJ 4XWOC 4YGVA 4RWYL 4R0LC 2EDXA 5HGBA 2NY4D 3NIDF 3IFOB 2IGFH 4RDQF 3MMEB 4LARH 1QLRB 3KJ4B 4F15B 3BIBX 3RWGA 3TVMC 2QQNL 5I73B 4OI7A 2J6EH 1XIWC 2VMFA 4M1DH 1PG7L 1EAPB 2P46B 4YR6A 2QADD 5IK3B 1URLA 5B38B 2EXWC 5B38G 2XIDA 5C7XL 3DUUB 5D7IF 1I4FB 3DETD 5MEOB 5IFHL 2E7MA 1UWXK 4NQEA 3GHEH 1CDBA 2YK1L 1OGTA 1SBSH 3LOWA 1F6LL 1D9KD 1BOGA 2IJ0C 5KSBE 1TCMA 3AS2A 2Y36H 43CAA 3T1FB 3ZDYF 1FYTB 4RWYH 3TYGL 3VI4F 1KYOK 1Q9LA 2VOTA 5CAYB 1U8JA 2WBJA 3BXNB 4P2RE 1CL7L 1B0GB 3SDCC 5JW4Q 2QQNH 3MRKB 3T0BA 2CDGA 3SN6N 1PG7H 1RZJL 2UWEA 4RQQB 2GYSA 5MEQA 4AM0A 4PD4K 3KNBB 3UYRH 5C7XH 2ESVE 5D5MB 1KGCE 3QZWG 5KVFL 1PFCA 2DOCA 5IFHH 2GI7A 2PW1A 1HNFA 5TDNB 2B8OT 2KUTA 3L5WA 1BJMA 1AFVL 1I1RA 2YK1H 3FFCD 4Y1AE 1IZKA 2A6JA 1KLUA 4I0PA 1TENA 3FONB 4HKXB 2G5BA 4WHTA 1S9XA 4PG9B 3QWRD 5HYJB 5FO8A 2W1NA 1N59A 4AEFA 3TYGH 5A1AA 5KSAC 2Y25A 1NC2D 4PGCA 4Z6AT 1YUHB 5BQ7B 1OGAD 4ELMF 3VCLB 2GSGA 3PWPE 5FV1L 1N2RB 4ZSOB 1RZJH 4JPIB 2DKMA 2WWMD 2DQHL 4U0RC 5I8OL 3GK8L 1ADQL 4FQXB 5E8OB 3S34L 1F00I 4EI5D 3RWHB 5KVFH 1S5HA 1UACL 4NZTL 4LPTA 3QPXL 5JZ7D 1IGCL 5IMLB 2NQCA 5FEBA 1NDMA 1VB9A 3MV8D 3QXAB 4AENA 3SGKA 2E9IA 3GJFH 5SWZB 1FG2B 1AIFB 1ZGLA 4G9FD 3OKLB 1KB5B 1ZA6A 2E7CA 2VL4A 5ICXA 4QHUB 2LQRA 4NQXB 4P2RA 3AU1A 1CXLA 1QSFB 4ZFZA 3X3FL 5B39A 4L29A 5IG7B 2AEQL 3OKKB 3X12A 3O2DA 2DQHH 1A7OH 5I8OH 3GK8H 1ADQH 5IVOA 1U8NB 1UCBL 3PXHA 3S34H 3JWNC 1TTUA 5D2LF 1AC0A 4LLYA 4Q0XL 1UACH 4NZTH 1XR9B 2HFFB 3ARBA 3QPXH 5EC2A 1IGCH 4X6EB 4PJIF 4AIOA 4IRZL 5DFWH 3EYQC 3QQ3A 4IHOB 3VA6A 1TXKA 4HUXA 3DBXB 1Z9OA 3CFBA 3P4MB 2HTLD 3L3IB 3UPCA 2CR3A 3ALWA 3MOBL 3CFEB 4LGSB 4UIMB 1XGPA 1U3JA 3LS4L 4HX1B 1RSFA 2VDOL 3JV0A 3X3FH 3PWPA 3QO1A 4R97B 4PJ5B 5D7LB 1FYHB 3D0VA 3X13A 2AEQH 4GRWF 5CP7B 5I1HL 2YKLH 4MWFB 4JFFB 2NNAB 5F96L 1UKQA 1UCBH 3WEXA 3AMLA 3VXNA 3TBTB 3WKNA 2H2PD 2FJHB 2HT2C 4Q0XH 4OCYL 5HDBF 4K23H 4KVNL 3VXTB 1MIML 1L0XA 2HMID 4M43L 4F2MA 1A7NL 1OAQL 2PO6B 1YMHA 2XI9A 1JP5A 4CVZB 5E5MA 2XACC 2UUDK 4LGRB 1Q9OA 1M6OB 4QHKI 1I3RA 1X5XA 4U1LB 2O61B 4WW2A 4HG4K 2VWEE 3MOBH 1D7FA 1K8IB 4G6FB 5I2IB 5SX5K 2VDOH 5CLWA 2A6IB 1CD8A 5IKCA 2DICA 1RZ7L 1I1AC 5I1HH 2DIAA 1S9WB 4U1HA 5F96H 5FUOL 1J1XL 4IMLA 4MQXD 3CXHJ 3GMLA 2A0LD 4OFDA 1FQ9C 4YXHL 1F4WL 4XNXH 3DUSB 1JHTA 2VH5H 4OCYH 4JZNA 3WIFA 3FB7A 4KVNH 4Z78A 5IMOA 4X83A 4LHUD 1MIMH 3MNVA 4XP5L 3UP1A 3B2UC 4HWZB 4M43H 3MXVL 1A7NH 1OAQH 2DS4A 5ISZA 2C9AA 3FOMA 4IOIA 2EYRA 2RIKA 3SDCA 1T80A 2ZZUT 1DEEA 3TPKA 1MJJB 3TBYA 4RFOL 4JKWA 4Z7WE 3S36L 1IQWL 1J0JA 3FQRB 4YHKL 4PJ7B 5KG9B 4MZ3A 3VG0L 4L5FH 2Y1VA 3P4OB 2Z35B 5DI8B 4HMDA 4LEOA 1RZ7H 1N3NB 2R15A 3SJVB 3HZKB 1E28A 4LKCB 5FUOH 5GQBA 3WN5A 5A40E 2YD7A 4FG6D 3P3YA 5GS0D 3T0XA 4YXHH 1F4WH 3LIZL 4MA3B 1T6VN 5EORL 5KOVC 4P3CL 5KSAA 5JOPE 3BOVA 1BOYA 4XP5H 3MRGB 3ZYOA 3MXVH 1TLKA 1PD6A 5KANI 4MNQA 1HQRA 3K0WA 4MJIE 3RL1A 5I66B 5DJXA 4NRXB 1EGJH 1HEZA 2XWJA 2EKJA 3ZTJH 2QSQA 1AGDB 4XNZB 3BJ91 3LRHA 4JFYB 4RFOH 2D31B 3CSYA 3KPOB 5D4QA 3S36H 1AQDA 1IQWH 3TO4D 1BHGA 4YHKH 1IGML 1WBYA 4JPKL 5HYJD 3VG0H 4NP4L 4HK0A 3JV6A 1NGWB 3O4LB 3ZHKA 2RQ8A 4AH2A 3E2HC 4OTXL 3QAZB 4GXUN 5HHOE 2ICEA 1JTTA 1JV5A 1FZKA 1GVIA 2IFFL 4WWKC 1ZMYA 5IJKC 3JV4B 3LIZH 1F8TL 4QY8B 5EORH 3BWAA 2X4UB 3L5XL 1FVEA 1HOCB 4P3CH 4PJEA 2FECL 3PABB 4KK5D 2NX5D 1P1ZA 4P2OD 2APWA 2BCKA 3RTQC 1I8LC 4I13B 1PSKL 2VLKD 4LVHC 4E42A 1C5DA 4TN9A 4MDIA 3OMZA 3I3EA 4BFEA 5IVZA 4RDQG 2DWEB 1ORQA 3O9WB 2VITA 3NCEB 5KTEL 3KXFE 5A2KH 5SWZD 4Z7WA 5DJ6B 3KR3L 1Y6NR 1KTKE 1IGMH 4JPKH 1N0LA 5JXAL 4NP4H 3MYJA 3GMRA 3HI5L 4DEPB 1NGZB 4OTXH 5D7IB 1BIIA 3SGEI 1HDMB 1U8IA 1U0QA 2IFFH 3LH2L 1IL1B 1S5IL 4RSVA 1FV1B 2DLIA 3KAAA 3V5DB 1F8TH 2C26A 4Z7QF 3L5XH 3HMXL 3GSNA 3S98A 3VFOB 2XTJB 1ZT1A 2R39A 2LE9A 1AGFB 1HWHB 1BD2D 2GQHA 3I6LD 1PSKH 4MJIA 5SWSE 4C83B 3HLAB 1PZ5A 4OGYH 2RFXA 4YHZH 1L6XA 4XAWH 5D1XB 3WLBB 4KUCD 1W0VA 4M3KB 5KTEH 1T0PB 4BJLA 5FA4B 3KR3H 4L9LA 2IH1B 1Z9SA 5JXAH 4Y4HB 3RJDA 1KACB 1DFBL 4EQ2A 4M3JA 4GOSA 5C0BE 3HI5H 3SDDB 3M07A 5EOCL 3FQXA 3WL9B 4HIEA 2PETA 3LH2H 1S5IH 3IDMA 3PF2A 3U30B 1AI1L 2M2DA 2XWBB 5D7LD 3WHXA 3T2NL 4LBEB 1K4CA 3HMXH 5HGGS 4JFFD 4PJBF 3T3PE 1DQQA 3C9NA 5JUEL 4KMTL 3MLTB 1K3ZA 2YHGA 3M45A 1CE6A 2VERN 3MJ8A 4QT5A 1QA9A 2EE6A 5F7DA 5DMGD 1OWWA 3SCMA 1J1OL 4ELMB 5C92A 1FO0H 5CIPH 5AD0A 4MSWB 4KJQC 1QTYT 4AK1A 4MCYB 3QT2A 3SE9L 1NEZB 1NEZG 1DFBH 3BZ4B 5HY9A 1T0MA 4FZEL 4PY7B 1IKNA 1EJ6A 1U8QA 3V5KB 3L3DA 5EOCH 2BHUA 3KYOA 4X7TB 5DSCB 1KIUA 2BSSA 4S2SA 1AI1H 4NQDA 3O4OB 5C0ND 3T2NH 4YK4C 1UFUA 5C09D 1CT8B 4U7MA 3LN9A 5C0AB 5JORB 3MRQB 3CXDL 2EDEA 5JUEH 5F8RC 4KMTH 4BH7B 1GYAA 5HGAA 4OFIA 3HZYA 4DAGL 2E8YA 3FB5B 2R9HD 1AY1L 1Q9WB 1SJXA 4FNLL 4HGKC 3DOSA 5C0CE 1J1OH 1GZPB 5D1ZA 4P99A 1L9MA 1JPGA 4YDLC 4OGZA 1A4JA 1LE9A 4O00A 1QSEE 4P9HL 5C3TA 3TBSA 2DTML 3UYPA 3QXUA 4ZO6A 1I7RA 1EGJA 4FZEH 4I3SL 5SWQB 2CRYA 1Z0MA 2V9RA 5E6YA 2N56A 5D2LB 3UDWC 5ESAA 5BRZD 1FBIL 1A1MB 3STZA 1FAIL 3V0AC 4M03A 5E4IA 5DWUL 4PJIB 4C55A 3HRZA 3UTSD 3FQNB 4ZUWB 4BUGA 2GJ6B 4PJ9B 3CXDH 2VE6A 3V6FA 1ZSDA 3ARGC 3NCFB 4L4TB 4PRAA 3IJSA 4FTVE 3CFKB 4DAGH 5HI5C 1WZKA 3G5ZA 1P4LB 4FNLH 4OIBA 5F1NA 1WZ1L 5BW7C 5BZWA 1K6QL 4QOKB 4U1NA 2O5ZL 2YPLD 1WZMA 1R5IA 4WWKA 1ZK9A 4P9HH 5EWIL 5FF6B 5IJKA 1M1SA 2VL5B 2DTMH 4GRWB 2H8PB 4TTGA 1HXMB 5TDPA 3F7PC 5DHVA 4I3SH 1T89C 2NYYC 2B5IB 3I50L 2YA2A 3RTQA 1RU9L 1RJLA 1JHKL 3QEQE 4XPGL 1FBIH 1FAIH 3VXUE 5K59F 3EDEA 1LGVA 2F15A 3NZ8A 5DWUH 4S1DD 3RA7H 2I9LB 2R4SL 3O2WL 4KKNA 4NO0D 1TVHA 1U42A 5CEXA 4C59B 3S37X 4NQUA 3DSNA 1YN6A 1UENA 2WAHA 5F7EL 4QCIB 1CXFA 5C0CA 4E0RB 1T22B 1UVQB 1WZ1H 4JDVA 2BVYA 3WUWA 5EPMA 3CZJA 5EWIH 1H8SA 2OL3A 3BQUA 3T0EB 5J1AA 1TQCB 1H5BB 4HH8A 5FOJA 3I50H 4APQB 1RU9H 3VJ6B 4PJAF 1JHKH 4GG8B 2E8ZA 3H7LA 5E6IA 4F7PA 2W60B 5GZOC 2LU3A 5EBWA 1IGJB 4OZ4B 5D7JD 3OKMB 4WU5B 2R4SH 3O2WH 3CDYA 2MCG1 2JB6B 4W68A 1ETZA 5DHXB 4NYLA 2OTWB 4ZFOB 3ZZ1A 2XG5A 2R2EA 4G42A 5F7EH 4Z7NF 4NN6C 1KENH 1SYSA 3KPRA 4FTVA 4J6RL 3ZE0E 2XTJD 3CDGA 1CGVA 3FT2B 2HLFC 3NFPA 3DJ9A 3WMSA 3GBLA 5CBAA 1MFBL 3FT4B 4P3DB 3BDYL 3LQZB 4Y19B 4DN3L 4I18C 3VA2C 4NCC2 5MHSE 5LAXB 3HPJA 4YLQT 1B0RA 3RZCD 4Y5VB 1IAII 3F6LA 5D1XD 5ILTL 3HUJE 2CDFB 5D9SA 5C0FA 5L2KE 4HZLA 3V4PL 1A6UL 2B1HH 1F58L 1G7JA 5DRZB 3VWJC 2I60L 3QEQA 1FO0A 3GKZA 3QXTA 4G8FB 3VXUA 3KPMB 4LPCA 5DXWA 2OI9C 1MHCA 2HRLA 4ORGB 5ADOL 1XGQA 4KPHL 1UH2A 3GSUA 1FIGL 3AVEA 4QXUL 1NFDA 3RVWC 4J6RH 2ZUXA 3OKDB 5DZOA 4YIQA 4LSTL 5EUKB 4BQCA 2FO4A 3DVNA 1MFBH 1YY9D 3BW9B 3ZDZF 1G7MA 3B43A 4HKZB 3BDYH 4DN3H 4NFCA 4Z0XA 4P4KB 3QIUB 4GKNA 2CJUL 3T65B 3ARDC 2AKRB 5ILTH 1KTDB 1BX2A 3ETBF 4X6DE 3QIWB 3V4PH 1ZGLM 1A6UH 2DQCL 4YDKL 5IB1A 1F58H 2I60H 3O3EA 5FYJL 4F33B 3OSKA 1JZ6A 5EDXA 4FQHB 4QRTB 4R96B 3AM8C 3PHOB 3I3BA 2Q76B 1HXYB 3V4UL 3EO0A 3HE7D 4P59L 1HHGB 5E1AA 5ADOH 1NBYB 4KPHH 3HE6C 5JMRA 3VGFA 1FIGH 3DMMC 4QXUH 1A4KA 1KC5L 3QUKB 2IBZY 5C0AD 1I8IB 3Q48A 3B9VA 3T3ME 5GGRA 5HHMD 4LSTH 2MWCA 1J10A 1IGTB 4N9GB 3U46A 2EDDA 4WRLA 1KJMA 2BZDA 3RZWA 3H7BB 4ZAKB 1BAFH 5DHYB 4S10A 3QDME 2ZSVA 5JA9A 3BGFC 3IU4L 1KJ3L 2VTFA 4M1GL 5EBLB 4OD2A 4N5EC 1UWEL 3HUJA 1DQTA 1X5HA 5L2KA 1HHKA 2ZUWA 2DQCH 4UT7L 4YDKH 3ARGA 4Z5RB 4RGMC 3DX6B 5FYJH 2X42A 2YD4A 3QFJE 4PGDB 4Y2DC 1RJYB 3MV7B 4TVPD 3B8SA 5IBLC 4DK3A 4PRPE 1R3IL 4PG2C 3D0LB 3V4UH 4KKLC 5BW7A 4PRHA 3Q1SL 4NUGL 4P59H 1WAAF 4ZPTA 4FQ2L 3JUZA 1YNTB 3CNKA 1WBXB 1U95B 3L3GB 1KULA 2FNBA 1KC5H 3JWDL 2DKSA 4PJ9D 3SDYL 1N6VA 4K07A 4QRRA 1N7ML 4U6YB 1N64L 2X9YA 3IAGC 2NXYC 5FM4A 4NQCB 1A7RL 4JQVC 2NW3B 2VLJD 5CD5D 4GAYA 1LO0L 4F57H 3SKUD 1OTTD 2C3GA 1KJ3H 3IU4H 2HKHL 4L3CA 4M1GH 4MXVE 1UWEH 4NM8L 4UT7H 3MA9L 1BZ9B 1V05A 5E2VL 2EIBA 5FYLD 4PJBB 4TOYL 3AAZB 1QBML 1JWUA 1JRHL 1R3IH 1XGUA 4X4XB 4NUGH 1QHPA 4GJTB 4MDJB 5TPWL 5BS0E 1EMTL 4PYHA 4FQ2H 1RUKL 2IFGA 4JM2C 1NFIA 4R7NB 1ED3A 5E8NA 3JWDH 5J4MA 3SDYH 3IKKA 3QDJA 2HT4D 4G8GB 4WFFE 1N64H 1NAML 4N0UE 1A7RH 2AV7A 3PHQB 2QHRL 1YC8A 1YQVL 1LO0H 2CIKA 3RUGF 3O11A 3QDMA 3V6OC 1F90L 2HKHH 2Z93B 3VXRB 3CSGA 5JPNA 1CCZA 1N6QH 1F6FB 2IBBA 3BZFA 4NM8H 5FA3B 3MA9H 1YDPA 3ULVE 1PKQE 2QADC 2VZTA 4TOYH 2DI8A 3QFJA 1QBMH 1JRHH 4PRPA 4EJ1C 1NKOA 3RWIB 4FZ8L 1D3CA 3BMWA 3MBXL 3U0PA 1GOGA 1A3RL 1JF5A 2ADIB 3BEWB 1XCQB 5TPWH 3BD3A 1CDCA 3OAYH 1RUKH 1S7WB 3HG1D 4I18A 4JFZL 1T04A 1WK0A 1QEWB 5JOFB 3LVEA 3TN0C 4DZ8A 1F42A 4LIQL 1GL4B 3HI1A 5DFVD 1NAMH 4PIRF 2PTTA 5T5FL 2XQBL 1QSZA 3VWJA 2CR6A 2QHRH 1YQVH 1ZHNA 2N4IA 4BH8B 3WJLA 4UILL 3BZDA 1F90H 2N1KA 2PF6A 1LEKB 4UDTB 4JQXA 2AJZB 5CJXC 5FO9A 2BSRB 5DJYA 2H9GB 1PQZB 5F88B 2JF1A 3FN9A 3NA4A 4WFGD 4UT6L 4NHUB 3BYYA 5JPMB 3NVQA 4FZ8H 3MBXH 2AJVL 1A3RH 4LLUA 4KRPB 2JCCF 5BS0A 5E5UB 2CRZA 3DROB 3BGMB 4JFZH 3TNNB 4PJXE 5IEKB 3B83A 5B3NA 2G2RB 1U58A 4LIQH 2AS5M 4PJGA 2VLRE 4LLWA 2NW2A 4N0UA 2XQBH 4BYHA 3EOAA 2HH0L 4X7EC 5FO7A 5F3BA 4HHAA 4H0GA 1YY8A 4UILH 4YBQD 1X9QA 2WWKO 4ODTL 3C8HA 2ADGB 1DN2A 4X4YB 4F7EB 1T2JA 1HSBA 2OSLB 3MRIA 2ZG1A 4YC2C 4P4KD 1JZ7A 1DQDL 3HE6A 2WWMC 4KJWC 1PKQA 3IU3B 3L3HB 1HN1A 2NZ9D 2FJFA 4MLIA 3F58L 3I02B 5DVOA 4D9QE 1TJHL 4JY6A 4OZFA 3NPSC 5ECJE 4POZD 1TETL 1MOEA 1EFXA 2AJVH 4H26A 1QRNB 1EEZB 3LN4B 3SO3B 5CWSB 4BFGA 3CX2A 3PP3K 4XP9L 5JZ7C 3QUYD 1RK1B 3PJSA 3V6OE 4ZOEA 4JDZA 2H32A 3FFDB 3HAEB 3ZE1E 4R6UA 3HAEG 2YS4A 1RZIB 4ZPVA 3HA0A 3DRTA 2HH0H 4MJ5B 4Y2DA 4ODTH 3EYFB 3TZVD 5KS9B 4PG2A 1U93A 1AKJB 4PJAB 1ZTXL 2VQTA 3D9AL 4JCLA 5T3XL 1FZJA 1AGEA 1ZWIB 4LPVA 4PJHE 3SGDI 5JNYB 1DQDH 5F93C 4MQTB 1FN4B 2R2HA 5IB3A 1AGCB 3F58H 1I8KA 3WIHL 1IEBB 3BPOB 4ZS6C 1TETH 1F5WA 1QD0A 1FSKB 4NT6B 2DYPB 5EZIL 4NKDA 1KJ2B 1VEMA 4XP9H 1BFTA 3SE8L 1XGTA 4PJXA 4I2XE 2CDEB 1RJCA 4N0RA 5I6XB 25C8H 1EZVY 4IRSB 4AY0A 3MGOB 2JJSC 1MNUL 4KI5C 4QRQA 1J12A 3LDBC 2JKXA 3HHRB 3ARVA 1OTUC 1OY3B 5I1IL 5EIIA 3C60D 4JJHA 2VLME 5F9WC 4J3OC 3BUYB 3R06A 1P7QD 3EFFA 5KBNC 1ZTXH 3D9AH 5HJ3A 5T3XH 5IJVA 3Q3GA 5HHNA 3ULUE 3P11L 4LCUA 4MNHB 3C09B 3MRMB 2YD6A 1K9TA 2GTWA 3FFCE 1AD9B 4JM2A 2EDQA 5ESVB 4GW5A 4PTTA 3WIHH 2OJEA 2WANA 1MQKH 3SDAD 4CW1B 2H2PC 2IAND 4ZG1A 4JANA 5EZIH 3GMQA 5I1AA 5BZDA 1RK0A 1H3XA 1IMHC 4G6AD 4D3CL 4GKSA 3SE8H 1IARB 1GAFL 1JF1B 3V6OA 4M6ML 4DKAA 1ZVSA 1MNUH 3PGFL 5C70A 4PV9A 4NIKB 4G8EA 4QF1A 3TIDB 2KQMA 3EBAA 5I1IH 3HKFA 5FB8A 4LSRL 3CUPA 3VG9B 3L95B 4D8PA 4GBXD 3HR5A 3IT8D 4RISL 1FZOB 3MUJA 4G80A 1XGRB 3P11H 3PIQB 4PJHA 2VC2L 4JFPB 3BVNA 1TMCB 3QNXA 4XNMB 5FECA 3MV8E 4MQXC 1D9KA 1KB9J 4P0DA 1I9JL 2UWEF 2PNDA 3JV5A 1G9MC 1JZ5A 1UGNA 1HYSC 2YD1A 5IT2L 4XCFL 4G9FE 5DD5L 4OJFL 2A6KA 4MNGE 2WUBL 3H0TA 3L3OA 1INEL 4D3CH 5IV2A 3N0PB 1PG7W 4OUUB 1UA6L 4M1CD 5CZVL 5I75B 1F4AA 1GAFH 4YH6A 3L9RB 4M6MH 3MRBA 4ESKA 5CJXA 3RKDD 2ARJQ 4XNQB 3PGFH 3KLDA 1F3DH 2CXKA 2D0GA 4NFBA 4PBWD 3HZVB 3UBXB 3UBXG 1T3FB 3FCTB 4N1CA 3WV0A 4PJ8B 3QI9C 3IGAB 1S7UB 2J8UE 5L8LB 1D5MA 3OR6A 3B9KD 4XB7A 3RVUD 4Z77A 4RISH 3FQTB 3EO1B 1CS6A 1ZA3B 2VC2H 3GSWA 3FFCA 1CFSB 1NC4D 4XCYA 2I27N 1I9JH 4CU8A 5GS0C 1CDYA 4X7CC 2PYED 4MXQD 2GY7B 5IT2H 4XCFH 3QWRA 5DD5H 2M26A 1J05A 3FB6A 3LKOB 4OJFH 1QQDA 1NC2A 5L0QB 2WUBH 4ZNEE 1INEH 1UA6H 1OGAA 1H8NA 4DOHE 4KZDL 3G5VB 1R3JA 2GAZA 3QG6B 1SQ2N 1GRWA 2CK2A 2O5YL 1CD0A 1JGEA 3L6FB 5EU3A 4RAUA 3ECBB 5K9OA 5F9JA 1CYGA 4MD0A 4XBEL 3TO4C 3DNKA 5IHZA 4CDGC 4EI5A 4CVWA 1D5ZA 1A1OB 1AXSB 3IDGB 1P53A 2A77L 2Q8BL 2QSTA 3ARED 4OGAD 3MV8A 1KUMA 3DURB 4HWNA 3V8OA 4P49A 4Y5XC 2XZZA 5I1DA 4J3WA 3PXJA 4G9FA 4N8CL 1MFCL 2Z31C 4CU7A 4XH2B 4X80L 4YHIA 3K8KA 2ZOLB 3KJ6L 2YC1A 4U1IA 4NSKA 2G75B 1DUZB 4FFYL 4KZDH 2O5YH 3FRUA 2BOBB 4YBLB 4P57B 3RUGB 1F11B 4UTAL 3EHBC 4HLJA 4O2EA 3IFPB 5GRWA 3V0VA 1FGVL 4XBEH 2WSKA 4WU7A 1WUNT 2ITDA 5TFSL 3K4AA 2OJZL 3FL7A 3BP6B 3CH1A 4Q6IB 3RX8A 5GRJL 1L0YA 5GRUH 4M7LT 2A77H 2Q8BH 1P4BL 2EDFA 5HYQB 2GJZA 5GGTA 4XPHL 5EBMA 1ZS8B 3OTTA 4LPUA 1RJZB 4N8CH 4G9DB 1X7QA 1MFCH 3GIVA 1B3JA 2CKNA 2YZ1A 4X80H 2WM0A 1I9EA 4ZNEA 5E2WL 1KIRA 3ZKMC 3ZYJA 1UWGL 3QQ9C 1W0YT 1OP3K 5CEZL 4FFYH 4NQSB 4CVUA 5GGUA 2FJGB 5DJAB 4XBGB 2YD3A 4N90E 1I85C 1VESA 5DRNA 5DRWA 1T0NA 2Z91B 4K94L 4G8IB 4UTAH 5EO9A 5D70L 3REVB 1BQHA 3VFWB 4IMKC 1EFQA 1FGVH 5TFSH 2HN7B 2GTZB 4WW2F 3V9FA 1EHLL 4HS6A 1SJEA 2XA8L 2BY1A 1AHWC 5GRJH 1ZOXA 4FMFA 1U8KA 4WHYH 4KDVA 4BQ8A 3E3QC 4IOSD 5FXCH 4IIQB 4BSJA 1P4BH 5JO5A 4MS8C 1A6AB 3TYFB 1MH5B 4XPHH 3GGWA 2JCCB 3FRPG 2BXZA 1Z9MA 1E4KC 4XPBL 5E2WH 1I7UB 4O2FB 1UWGH 5CEZH 5CGMA 1NSNL 5HYJE 1F4YL 3VXMB 4JG0L 2Y07L 3CU7A 1PY4A 4PY8J 3MR9A 1IBGL 1OP5H 4FMKA 4K94H 3IFOA 4KRLB 3VFMA 5D70H 2NXZD 4L9DA 3F12A 3IVKA 2VSCA 3BYTA 4GSDL 1QLRA 5DZLA 3LEXA 1HNGA 4HCRA 4WI7A 5E2TL 3MRCB 2MHAB 4ZSOE 1EHLH 2XA8H 5CBEB 1A1NA 5EBGA 2IADA 3DX8A 5F9AC 2NX5E 4LHUA 3W0WB 2ED9A 2H41A 4UINL 5CSBA 1ZLVH 2VLKE 1IAKB 5FAAA 5BV7L 3AC0A 4K9EL 5E4EC 3SDXA 2NY3D 4TUJB 5C0NC 3BH9B 3SY0B 3VFNB 3PNWB 1F3RB 4XPBH 3S35X 4M93B 2R23A 2YPKA 3D39B 3MO1A 1OW0C 3VGBA 1FNEB 2ZG3A 5C07B 3QI9A 5SWZE 3HC0B 1NSNH 1R3LB 2AJUL 3PWUB 4LEXL 1F4YH 4U1GC 4YNYA 1GZQA 2R9HC 2A73B 3BH8B 5ADPL 4JG0H 2Y07H 3AB0B 4UOW1 2HT3D 3T4AB 1IBGH 5FHBL 4HULB 3MLRL 2VXQH 2I26N 1M7XA 3NCYP 1FFNA 2X6MA 4UQ3A 1XH3A 4GSDH 5DUML 2ZPKH 2X89D 5E2TH 2XV6B 4JJ5B 5CCKL 2VDML 3Q6GL 3PL6B 4RQQA 4MGXA 1JVKA 3BESR 4H8WL 2ICCA 5C0IB 4QHNB 2BOCB 3ESVF 4JFDD 5C9JB 3I6LE 4UINH 4M7ZB 3PUCA 4R7DA 3GMPB 1VA9A 2J1KA 5KN5B 4NHCL 5BV7H 1YMMB 4K9EH 5F21B 4DCQB 1G9EA 2D0HA 5F7NC 3PV6B 2FR4A 3WCYA 4I48B 4WDIB 4OKVB 1IVLA 2WW8A 2VXSL 4M8QB 3BIKB 1PGRB 3FONA 5E2UL 1XEDA 4PJEF 3QQ4A 3TO4A 4X4MA 2AJUH 4LEXH 5HYJA 2XFXB 5ADPH 1EJOL 3EUUA 2X09A 2QL1A 1KIPA 1D5BA 5FHBH 4YGVB 3TCXA 3QEHA 4OFPA 1PEZA 3IETA 3MLRH 5HGBB 4JFEB 4H0IA 5DUMH 2I24N 1F6AA 1F4XL 1CQKA 3AFLA 4A2LA 5KVMC 5C0JA 4Y5XA 2E27L 5D7LE 5EFIA 2LVEA 2X9XA 3RWGB 5CCKH 5I17B 2VDMH 3V7AG 5CD3A 3Q6GH 2Z8VC 4UNVA 4Z7WF 4JFFE 2Z31A 2NX5A 5D6CA 2VRAA 4P2OA 4YR6B 3MZGB 1TZIA 2VLKA 3OQ3B 4NHCH 4U33A 2AABL 5HVGB 2FO1A 3T0WA 5GGQL 3ZE2E 1U8MA 3WNMA 4NQEB 2VXSH 1EK3A 3UXFA 4YX2L 1DL7L 1OGTB 5E2UH 2K9UA 5SWZA 1AH1A 1BOGB 43CAB 1EJOH 4HIHB 4HUNB 3OB8A 4NNPL 1BVKA 1Q9LB 2O93L 5IP4A 4I5BA 1U8JB 1F4XH 2WBJB 3ULSA 1FCGA 2E27H 4ZYKA 2AEIT 3WFBL 1KIQA 5IESL 2CDGB 4O5LL 1KBGL 2ZUVA 2UWEB 4GS7C 5MEQB 4AM0B 3V2AR 3TO2A 1BD2A 3C5ZC 2IF7A 1FNGA 4YO0A 3QSKB 2ZUTA 1I85A 2AABH 1XR9A 5GGQH 4R4ND 4M5YL 4X6EA 2PW1B 2GSIA 5J0BA 4YX2H 3L5WB 1F2XK 1YJDL 1T2XA 2A6JB 1DL7H 1KLUB 4I0PB 1PX4A 4OUOA 5I71B 5D1QD 2G5BB 4WHTB 4ELKB 3N1MC 1S9XB 4FFWD 5EA0L 1XR8A 4KY1L 1MCHA 5C08D 5FO8B 1N59B 2FX7L 5E03A 4NNPH 4PGCB 4PJ7E 4ZUTA 5BRZE 2VISA 1VFAA 2GSGB 5D7LA 3SJVE 1E4KA 3WFBH 4ZFGH 3UTSE 5IESH 2GHWB 5HSFA 1C16A 1H8OA 1KBGH 2GUOA 1U6AL 2ERJB 2AERT 4WV1C 1RHFA 4X5WA 3TBTA 1VFOA 1LEGA 3TF7C 1G6RA 2X4TA 4QHLA 3L7FA 4JGUA 1S5HB 4M5YH 3JVGC 2EXYC 4L1DA 1G6VK 1MELA 1MVUB 2V2WA 1YJDH 1NDMB 1D5XA 3BO8A 3I6GA 1EERB 2XXMB 3L3KB 2K3TA 3PGDA 1M6OA 5EA0H 1N5YL 4KY1H 2B4CL 4X6BA 1ZGLB 5H94B 2ZSWA 4PY8I 2FX7H 5L8JB 4LVNC 1ZA6B 5ICXB 3IDYC 1YEGL 2ZWLT 2J5LB 2DL2A 3AU1B 4ZFZB 3L5IA 4K8RD 3O4LE 3CU1A 2Z0BA 5C09A 5B39B 4E9LA 2RR3A 1ND0A 5B39G 2NY1B 5MEPA 4PD4J 3X12B 2DWDA 1U6AH 3S4SA 3RIAF 1WTLA 3E0GA 2ZUQC 2EH7L 1CIUA 2BNUA 3QH3A 1FL5A 1OAUL 4LLYB 3WFDL 2B4CC 3ARBB 3HE7C 1YYLL 1R3KA 4AT6A 2APVA 1SJHA 1JNNL 3RWDA 3T3PF 3C6LD 3QQ3B 4HUXB 1N5YH 1UEMA 2B4CH 2Y4SA 4F58L 4NN5C 1X5YA 3D39D 3CFBB 4K7PX 3OKEB 5DK2A 5F6IC 1YEGH 2X9WA 4PRID 1XGPB 5BRZA 4HXBL 2R2CA 1V3MA 3DV4B 5GRXG 3PWPB 4YFDB 3QO1B 1MI5A 5E8PA 3UTSA 3HZKA 5D7IE 3D0VB 2HA1A 3X13B 5MERA 5JDJA 1NCNA 1AXTL 2DN7A 2AJXL 4MA1B 3WEXB 1NLBL 2EH7H 4JM4L 3T8XA 3VXNB 3OHXA 4K3DL 3WLWD 2XTJE 3OZ9L 3C2AL 1OAUH 3MRGA 4GW4A 2P8LA 4R0LB 3KWWA 1LD9A 1MCOL 1YYLH 5CP3H 5J57B 2CKBL 4F2MB 5ALCL 3ZDYE 3U2SA 3EYSL 1YMHB 4FHBD 2YPLA 1JNNH 4MD4A 4XNYL 3VI4E 4J2XA 1NUGA 1R24A 2F19L 1VGKA 1SBBA 2FL5B 4HJJL 5E5MB 5CJQL 4AYFA 4F58H 1MFEL 1Q9OB 1XIWB 3RPKA 1I3RB 2AQ3A 3Q5TA 3K1KC 4WW2B 4Q97A 1JWMA 4KTDL 3VH8A 3PWVA 5I18L 5IKCB 5BXFA 3W39A 3G08A 1MJ8L 4KK6D 2A38A 4Z0BL 2AK4D 1C1EL 4ZODA 5J1TC 4JFED 2NY6C 2XY2A 4NO0A 5F7HA 3H3PL 4U1HB 1AXTH 3VFVA 2AJXH 4IMLB 3JV4A 3GMLB 4JM4H 4K3DH 1JHTB 3C2AH 3OZ9H 2AXFB 3K2UL 3QYCA 4JZNB 3N50A 1HKFA 4Z78B 1MFNA 4NKOA 5IMOB 1MCOH 3MNVB 2CKBH 3OB0K 5ALCH 3SGEH 5AG8A 3EYSH 5ISZB 4XNYH 4AQOA 4IOIB 2F19H 2EYRB 4K71B 3SDCB 4HJJH 5CJQH 1RUPL 1T7YA 2V5SA 2IAMD 5A16A 1MFEH 4QTIL 1DEEB 2EDWA 4OM1L 2HT4C 1AR2A 3TBYB 4KJYA 3GM8A 5FDYA 3N1PC 3IYLW 4KTDH 5FDWA 1F3JA 5D7JA 1MJ8H 4Z0BH 1C1EH 2P1YA 4LEOB 2YA1A 3O3BA 1E28B 5HYEA 1Q0YL 3H3PH 1FV1A 3FQWA 4X8XA 3VFPA 1JF6A 5C0AE 4UU9A 5J06A 1S7TB 3K2UH 5HHME 5KSAB 4NRZA 5ALBL 3X11B 3PWNA 2DLEA 4ZUVA 4MNQB 1HQRB 3ZHDA 4Z7OF 2X05A 3HLAA 3RL1B 1CGWA 5DJXB 2XWJB 1HEZB 1SY6L 1RUPH 3RZCA 4MJ4A 4QTIH 4OM1H 4HG4J 5DFVC 1OT1A 5IB5A 1NFDF 5KOMC 3QCVL