1I9IL

Native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DVVVTQTPLSLPVSLGDQASISCRSSQSIVHSNGNSYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9iL01
2VR9A 3NFNA 4TQEH 2BSTA 3MLXH 4YHNA 4WDIB 4XVSL 3RWIA 1J0YA 4ODXB 3ILPB 5GGQH 5CILL 1RHHA 2AEIT 3B43A 2ILLA 4HKBB 3FOLA 5HI5C 1JWMA 2FCBA 2NTSP 3O6LH 3QNZB 1FRGL 4WFGD 3QO0B 5IFJB 1CDCA 2WUCH 4PJIE 4Q2ZB 3F5WB 5A40E 1B4JL 3OR6B 4G42B 4XMKL 3N85H 1YN7B 1A1NA 4JE4B 1OB1B 3BKYL 1HHIB 3PHQA 3HMXA 4EDXB 1XGYH 4JFQA 5IB4A 1VADB 3DUHA 5GSRB 1BEYH 1T0MB 3G5XB 3HMWH 4S1DD 4UDTA 3VXSB 4XBEH 4IRJB 1UA6H 1U8OA 1UJ3B 3SKNB 1I7RA 2QSTA 2Y5TA 3BEVA 1WTGT 1F11A 4V2BA 4ZFGL 1G7PB 2WQRA 3DECA 3GI9H 3HMXL 4QHNB 3A6OA 2X7LA 1RUPH 2QLVB 3GMNB 3CVIL 4IRSD 3QHFH 3FJTA 4HF5L 3MV7A 4J1UA 4HCRA 3S88H 1FL3B 4KK5D 3V5HB 4MNGB 5EOTB 2QHLA 5T1MB 4P3CL 3EOBA 2B0SH 3BGMB 4N0FA 4IS6B 5DEGB 3V2AR 3THML 4MS8C 5DMGC 4HCRL 3IDUA 4ZMAT 1RFDL 2EXYD 2AK4E 2X4NB 4PJIF 1GGCL 4MAYA 2IJ0C 3B9AA 4HC1H 3TZVC 3C2AL 4FQHA 5ALCL 1BVZA 3CFJB 3A6BL 4EXPX 1GIGL 1CVSC 3QDJB 4CGTA 4JY4A 5F72S 3L3IA 3P77A 1MPAL 1MCWM 1JTTA 5KSAA 4UIKL 1DBAH 5FGCB 2VABA 1ZT1A 3B9DA 5JW4R 1NUNB 1JIBA 1P84J 1CICA 2IPUG 5IFHL 5CGYD 4NN6C 4CN1A 4U05A 2GSGA 1UCBL 1RK0B 3BHBA 3IJYB 1JHKL 2F54A 3PV6B 1FFNB 1R3HA 3HE7A 5IOPA 1OPGL 3TV3H 3HFMH 1A6AA 3CZFA 2PKDA 3TGXA 3E8UH 5IQ9A 3ECBA 4XNXL 4X6EB 4XNZB 3JUZA 5CLWA 1DL7L 4QKXB 3RTQA 2MCPL 5CEYB 5EBLB 5EUOE 4ZTPL 2YUZA 3EIFA 2H2SD 4JPKL 1U3ZA 4MWFB 1NSNL 2X10A 5GS1C 4Z0XA 3FONB 1A7PH 3RWHA 3MLPA 1VKXA 4WTZG 4MD0A 4OZFG 1QLEL 1CLOL 3MGAA 5KANG 4OLVH 2XN9E 2XRAL 3AY4C 1A1OA 5D2NE 2ZUUA 5DJCA 1OM3H 3HC0A 4DN4H 3KR3H 3T1FB 2VIRA 4FQXA 3UBXB 2OXHA 5D7JA 1JGLH 4XXDB 3WUZA 4ZXBC 5DZNA 4PV9B 1ONQA 3GBNH 3MBXH 4A6YB 4O2EB 4NQVA 3FMGH 3H9YA 5D6CA 5JXEC 5BVJA 1JHTB 1QKZL 2VDRL 3MLXL 2E27H 3KYNB 1G6RA 1R24A 5GGQL 4YQXL 4HWEH 4L4VB 1RZ8A 2VISB 3B4NA 5CIPH 2L4OA 4BH7B 3O6LL 4KUZH 2WUCL 3ARBD 2FJHA 2X4QA 2VDPH 3ZYIA 3N85L 2NNAA 1UXSB 2AXFA 3FB7B 4PTTA 3ZZ1A 3O8XA 2KZWA 4POZD 4CDHA 1XGYL 4XI5C 1BEYL 1P84K 3HMWL 1KFAL 1T0NA 3VA2C 2GKIA 3AMLA 4XBEL 3PJSB 5C0CA 5IIEB 2B1AH 3QJHA 1JBJA 3GI9L 1RUPL 1U92A 4JO2H 3V8CA 3QHFL 5C3TA 2D7QA 1RU9L 3RVVC 1MVUB 2A9NH 5CINH 5C0GA 5I1AA 1U3HB 5FYLH 2G5RA 4HBQA 5DUBA 4YHMH 4JFED 4HUXB 3PQYA 5T3XD 1U95A 3CLFH 3WL9B 2H8PA 4AQOA 4CMHB 4PRDA 3X12B 2OZ4H 4P49A 4JRXA 5I17A 5LCVH 4GAGH 4HC1L 1TVBB 4OZIE 1VEMA 4X4XA 4JFYA 1CD0A 4KGJA 1Q38A 1JNNH 3QRFM 5HI4D 4FMFA 1IJ9A 1WVZA 3FTGA 4WFFD 4U1HA 3I3DA 4NNXA 2ZZUT 3KLHD 1R3JB 2CDGB 1BBDH 1QSEA 3IDJA 1M7DB 4FQLL 4IOIA 5DD5H 1L0XA 3BD3A 4LCWD 4ODVL 3LZFH 4HK3J 3IFLH 4RFEB 1I8MA 1CQKA 5D7LD 4C56D 1K8IA 3RHWF 3TV3L 4NSKB 3KLSA 1B88A 5EU7C 3G5ZB 3TNNA 3E8UL 2DM7A 1C7SA 3BKCL 1MHCA 1ZGLM 1OCWL 1YPZB 2AJVH 4OJFH 5CBAB 1WLHA 4OGAC 4OBSA 5D7IF 2CIKB 3MA9H 3EYSL 4U1MA 1T0PB 3QIWD 1CTNA 1F4AA 5I8KH 3WBDA 1AD0B 2V2TB 4DTGL 1QSFE 4EVNB 1A7PL 4L3CB 3RIAF 4U49A 4WFFE 1H15B 3RI5F 1EFQA 3ULSB 2IALA 4OLVL 5C0RL 4AQ1B 1G7HA 1G7IB 4Q0XH 1I3RB 4WTZA 4FHBD 4LCWE 2BNRD 5DJ8B 4OZFA 3MROA 1CQYA 4NO0D 1NCDH 1OM3L 3SDAD 1FNSH 4MDJB 2DF3A 1UT9A 1YMHA 3KR3L 4YPJA 4DN4L 2AKRA 1H5BA 1JGLL 4C56E 4YX2H 3NAAH 1V3LA 1JTOA 2EDWA 3FAXA 4U3CA 5GGVY 1AQKH 4UILL 2E9IA 4MNQD 4LAQL 3MBXL 5JW4Q 2E7HA 2IEPA 4KKCC 4MXWL 3FMGL 5E94B 3LKNA 5CJBA 3WXWH 2E27L 3VWKD 2C3VB 3QUYB 4JKWA 4G6JL 4HWEL 2Z8SA 3VMOA 2XACC 2CRYA 4IHOA 4WO4D 2XA3A 4XPAH 4JO3H 1U8IA 5FYKD 5IW3A 4U6HA 2ZSVA 1NFDF 5F3HA 1Y6KR 4N9GB 4WI6A 3O6FC 2YN5A 5GZOD 1E27B 3O2DA 1WAAE 4LVHC 3ARFD 2HFGH 5C09D 3E6HB 4YIQB 5IBLD 1XF3A 1RUQH 2Z91A 3BQUC 5CBEA 1QSZA 1BECA 4LVNC 2C3GA 4JY6B 2V9TA 4E5XB 1QD0A 1QZ1A 3WNPA 2B1AL 4JPIB 3T0EA 5FAAA 3WCYA 1KTDA 2XKNB 5GJTL 4JFDA 3U0TA 1IGFL 4QF1A 5T5FH 4PRBA 1B0GA 1XIWD 4G8FA 2Y7QB 1NGPH 4JO2L 5CZKA 3DVNB 1KCUH 4K3JH 5C0AD 2DI8A 4KK8C 1BP3B 5KSUA 3L3GA 3VXTB 1AC6A 4C57C 3FQRB 5FYLL 3V8OA 4Y1AE 4YHML 1FL5A 5GRXG 4NC1C 3QUXD 5F1KC 3CLFL 1CXLA 4PJ7A 3RRQA 2OZ4L 4PJHE 3TO2A 2H6PB 3VI4F 4L8CB 2DI7A 3DTXB 5E0QA 2VDLL 1HQRB 3D18B 2GK0A 5INDB 2K1MA 3PWNA 3CSPA 3HUJF 4KROD 4TSAH 5HHME 1N6VA 3LDBB 5HYSB 3V6ZA 3V4VH 2I9TA 3QIBB 2LQRA 3DXAD 3FRUB 4AIZA 1QFWI 4LAJH 1OSPH 1BBDL 1IGJA 5K9QG 1T1WA 2NPLX 3DSNA 1B0RA 4H0HB 4OLUH 4MXQC 4N5UA 3IFLL 3CMGA 2EE6A 3FO1A 3GSOA 3IDMB 4NOBA 3GMLB 1T21B 1U9KA 4LLQB 3UJTH 4PG9A 3F7YB 3FCTB 1MCNA 1Z9LA 3MUHL 5J1SC 3P4NA 5T1KD 2UZIL 4NQUA 3AC0A 3DVFA 4JB9H 4OJFL 3AREA 4H1LG 3UZVB 4AM0B 1FNEA 4IOSD 5DSCA 3MA9L 1X5JA 4RX4A 2X1OA 5EO0B 3GFUA 3VXQB 1EUUA 3KG5A 5DJ0B 5F9DC 4GS7B 1LP9E 3O4LB 5GJSH 5DMIH 2OX5A 4QRPD 1ZHNB 3UXFA 3QWOA 1O7VA 3MFFA 4U1GC 4XNMB 3G6JA 1QQDB 1MIMH 5D7JC 4PYGA 3ALXA 2H41A 2APBA 4Y4KB 4GMSH 4Q0XL 3T3PF 1UKTA 1IQWH 5DJ2B 1NCDL 2I24N 5JHDA 1A4JB 2DL2A 2WUBL 4HFWB 4YX2L 3PWPA 2AEPH 3NAAL 4LSUH 1MF2H 2X4TA 4RDQF 3D2UD 1W72H 1AQKL 1CIDA 2A1WH 2VLLA 1IAKB 2VLKA 4XWOC 1J1OL 2XY1A 3GKWH 3T8XB 4MHHI 4LKCA 2LAAA 4NQCA 3WKMH 5E08H 3WXWL 3B9KA 4QWWC 3O81A 1EHNA 3OJ2C 3DNKA 1H3GA 1DLHA 1GGUA 5I74B 4KK6C 3L5WB 1D5MA 3E2HC 4XBGB 3SKMA 4XPAL 3O3BB 2XV6B 1BFVL 1CK0H 5D2LA 2A6DA 2HT3C 2V7HB 3TNMA 5IVXF 1F4XL 3FFCB 3VXOA 3WHE0 4Z7WA 2F15A 3MSPA 5E5UB 2UWEE 3UTQB 3QXTA 3NCYS 2HFGL 1S9XB 2Z31B 3VW3L 3MCLL 2FL5A 2C1PB 1TJHH 3QIUA 4LHJB 3BDYH 3H9ZA 4POUB 5CFHA 4JANB 2FIKB 2ZJSH 1YY8B 2CD0A 1I7TA 3TO4B 1QEWB 1KCUL 3VRIA 3GSXA 5F8RC 4ZUSA 1C1EH 4LU5L 3KPLB 1FV1A 2NYYC 3C08H 5E8DH 1ZKAA 4NN5B 3VG0H 3QI9C 3QG7L 1JPSH 1GZQA 1E4WH 3QRGL 1ADQH 4PJAF 4GBXB 2AQ1A 1JVKA 3QNXA 1F3DH 3IKKA 5AYUH 1YMME 5DK2A 3WXVH 3QUMA 4X6CA 2NY6C 1WCQA 4TSAL 4EKXA 4M1DH 1MCHA 3LN5A 5J3HC 2O5XH 1KB5A 1X6LA 1WZMA 3V4VL 3OL2A 2P24A 3RJDA 2PXYD 4UV4L 3SY0B 1HSAB 1Q9WA 1C8PA 4PG2C 1N4XH 3QUML 1HZHH 3AU1B 2Z8WC 1CFQA 1N0XL 1CT8A 1KB5L 2HRPH 4YPGA 4CKVX 2ARWA 1AP2B 4HJGA 3CSGA 1JYVA 2BSRA 3UJTL 4X7SL 1U8JB 1RJLB 4G8EB 4ZO6A 2KH2B 1TZIB 1KULA 1NANH 1IRAY 1MFEH 4JB9L 5D5ME 1E28A 3SE3A 3FZUC 3QFJE 4KVCH 4KJQC 4H1LA 3QEGH 3SQBA 5DS8A 1EHAA 2NY1D 4V1DE 5DDHB 5ISZB 3B6SA 5HDBE 5GJSL 2X9WA 2BP3A 4P46C 4IMLB 3RY6C 1TPXC 1FBIH 1F6FB 1BIHA 5EC2B 3E1F1 3GEWB 1JI2A 3K4AA 2R39A 1MIML 2VXSH 4HZLA 4MD5B 1W72A 4MSWB 4QRUA 5GRZA 3TN0C 3BP5A 4LF3A 4JKLA 3QWRA 5JOEA 2OJZH 2MNUA 1LE5A 2F5BH 2DQCH 3IJSB 3MXWL 3L3KB 5GS2D 3QQ4A 2XWJA 4Y7MA 4HQQL 4LSUL 4QRTB 1MF2L 2DM3A 3LRGA 1W72L 4Y5VC 1IAII 4Q6IC 2R56L 3LS5H 3V79C 4F9LA 4TN9A 3MRQB 3GKWL 2IPKA 4PREA 1J5OL 3T04D 5LGKA 1KPRB 4E0RB 5E08L 4XCYA 4GUPA 4WU5A 3WO4C 1BHGA 4TYUA 4E9LA 4BJLA 3EZ8A 2K3TA 4LSSH 1MCLA 3QUKB 4RZCB 1YEFH 5D5MF 5F6HI 3SDDB 4G6ML 4GW4A 5FGRA 3MO1A 4X7DC 3O41B 2R23A 4RGND 2HKHH 5TF0A 3CSYB 4S1RH 4M6NH 1FCCA 3CCHA 4HWUA 3MR9A 1IEAA 4RIRA 1P7HL 1SJXA 5HHVH 1JRHH 5SWSD 3QPXL 4K8RC 1TJHL 3BIAX 3BDYL 5JO5B 3RZCD 4X9GA 5I2IB 2OMNA 4JLRB 4I0PB 4WWKC 3EYFB 3RWJB 3PHOA 4HHAA 4QOKD 1WBYB 2ZJSL 2VITB 5I9QC 1YY9D 3ULUD 1FQ9C 1UZ6E 3LS4H 3KPRE 4OFYD 5I1IH 2KBGA 5JPNB 2HTLC 3PWLA 3OKDA 3C08L 1Q9OB 3PWJA 5A43C 5E8DL 3RU8H 5BS0E 1KF9B 4FXGB 3VG0L 3GRWH 1T66C 4Y4HA 3OKMA 2Y36H 1JPSL 5DUML 1XGUA 3DSFH 4JR9H 5FO8B 1ADQL 3GM8A 4PJIB 5CEZE 4YHKH 3NVQA 1GHFL 4H0GA 3QDHA 1FFPB 1MAKA 5AYUL 2VLMD 4OT1L 1X5XA 1N59A 4OCLC 4G8GA 5H37G 1KCRH 3HG1A 1U36A 2JJSA 3C60A 2ICWB 2MFNA 4M1DL 4NQXB 5HVGB 5D1QA 3CSBA 5F1NA 3TA3A 4QHLB 4UQ3B 5JORA 3AS2A 3G08A 1HZHL 4LLYB 2VXTH 2GITB 3N1MC 1UZ8B 1QFWM 4XCEA 5E6YA 2HRPL 4OM0H 4PP2B 4KQ4H 7CGTA 3ULUE 3TYFB 4JJHA 4JZNA 5JIKA 3ARGC 2FLRT 4Z95H 5TQ0H 3GHEH 1NCWL 2FJGA 2EDXA 2F53D 1LD9A 1MFEL 2BDNL 2X1WL 3KPPB 2AK4B 3T0BA 1NJ9A 3D39D 5IR1A 4KVCL 4LPUA 2DWEB 5E03A 2F8XC 3T4YB 2VZOA 3WS3B 3RUGA 4JZOA 1FBIL 1J1XL 5I15H 4JO1L 5K9JH 4L8DA 2FDBP 5HI5D 4NKIH 1MHPL 4WI2A 1TJGL 3P4OB 1LK2A 3OXSB 5ECJE 1IQDB 2HVKB 1EH9A 2OJZL 3INUH 3HE6B 1MELA 2DQCL 4IRSB 1JGEB 5GRJH 4GKNB 3ZLQC 1U58B 4WHTA 1ED3A 1BBJB 1FVDB 3Q48A 3LS5L 2YUWA 2NZ9D 4LCYA 4FTVE 1BIIB 1B90A 3OBAA 3CFBB 3UBXG 1LDSA 4WW2A 3BPOC 2I07B 4GW1A 3LN4A 1XT5A 3MUZ1 4GRLA 5EUOB 3VFTA 4LSSL 3D39E 1UYWH 4JRYA 4PJ8C 1YEFL 2P5WE 1R3KB 2VLJA 2EO9A 2IH1A 3CU1A 5FF6A 5DI8B 2QADD 1A6ZA 4U1NB 5JUEL 1T7ZA 4PJ5E 1P53A 4S1RL 4M6NL 4Z7QE 4U1JB 5GGRY 4BQ8A 4WDIA 1MSPA 3GB7B 3ILPA 4YBLB 4LLWB 5HHVL 2ZCLH 2XN9B 4OCRL 4MS8D 5D2NB 1NGQH 4HKBA 3VCLB 3NBNA 3WJLA 1JI1A 3QO0A 5IFJA 4JFFA 3TZVD 1F90H 3F5WA 3HZKA 4APQC 4GG6A 3OR6A 4G42A 1IMHC 1YN7A 1OB1A 2Z4QA 3GM0A 4EDXA 4LFHD 5SWZD 1VADA 5GSRA 1T0MA 3AUVA 3G5XA 5HVHB 5L0QC 5SX5K 1PDKA 3LS4L 5H35B 1I1RA 5I1IL 2R4SL 5I76B 2JJWA 5HPMB 2IH3B 3GSWB 4IRJA 1UJ3A 3SKNA 5H94A 3RU8L 2DWDB 3QZWB 4QHNA 3GRWL 3S35L 3WLBB 4HIXH 4JR9L 4HAGA 3GMNA 4KFZC 1DLFH 3VH8B 4YHKL 4WI7A 4F3FB 1FL3A 3V5HA 4MNGA 5EOTA 2XNAB 1UWXK 4Z7QF 5T1MA 1A6UH 1VGKB 3PL6B 5CKGA 4Q9CA 4QXUH 4OSUH 4IS6A 5DEGA 5FYKU 2FGZA 5L2KE 1VERA 1TQCC 1VFOA 4G9DB 3DROB 2BRRH 1KENH 4EI6B 3U7YH 4UOW0 4FQCL 1HQ4B 3KNBB 2VXTL 1P4LB 3CFJA 3F58H 4NRXB 3VFNB 3QDJA 4OM0L 5SWZE 1D5BB 3AAZB 3IF1B 3VXUE 5JDJA 4P3WA 4OKDA 3HZVB 4QCIB 4WI9A 4G5ZH 5TQ0L 3GHEL 1G9MH 3QFDB 4RFNC 4F37F 1RK0A 3IJYA 5BQ7B 1FH5H 3ARBB 2B5IB 4M1CC 4ZXBD 3PV6A 43C9B 1FFNA 4XP5L 1WICA 3KS0H 4JQVC 3T3MF 5DC9B 1ZLVK 1JUFB 1GOGA 4OZIB 1AGCB 3W81A 5JXED 1CI5A 2G5BB 2NY3B 4X4YA 1QFUL 4JY5L 4X6EA 1BM3H 5C9JB 1RJZB 5I15L 4UBDC 1TLKA 1X9QA 5CP7B 4NKIL 5CEYA 5EBLA 3P0YH 4L8SB 4JREC 4L1HA 4N5ED 1J10A 1TTGA 3FB8A 4K23L 5F88B 1OP5H 4J6RH 1QRKA 4H8WC 2DYPD 3B3IA 3FONA 4XI5D 3JV5A 4KMQA 4KGLA 1T6VN 2NXZD 1CLCA 1IAIM 1OP9A 1JZ6A 4PIRF 5FIEA 1HDMB 3PG2A 1J7VR 3UBXA 3T1FA 5F97E 2R8SH 2A0LC 1S5IH 1UYWL 4XXDA 3X3GH 1EMTL 4OQTH 1V3JA 4F7PB 2D7MA 1U8KB 4PV9A 4WI8A 4EZMA 2FWOB 3O9WB 4CN6A 1C5CH 4MD4B 4WENB 4A6YA 3RVVD 1P69B 4GAJL 1QSFB 4Z7NE 4BA8A 1JHTA 1IARB 3KYNA 3AS0A 4R3SB 1YNLH 5JDSA 2GUOB 2YBRB 4L4VA 2ZCLL 5JTWA 4BH7A 4LCWB 4A6YL 2ARJQ 4CW1B 5IBUB 4R4FH 5FECB 1CZ8H 1PG7H 4C56B 3ZKND 3KPMB 4KHXH 4PRHD 4Y16A 1UXSA 3FB7A 4LDOB 1XGTB 4I1NB 4KKLC 5C0EB 1C16B 2OTUB 1MCIA 1G7QA 1CDUA 4N1CA 1JP5A 5A3IC 3K4DA 5D9SB 3PJSA 3VG9B 4XGZB 3FFDB 3H6JA 3NPSC 3UDWC 3QIWB 3MNWB 4HIXL 1NKOA 1RUMH 5FOBB 1I4FB 1RZJL 3EUUA 4P23C 2VXUH 3O3AB 4KI1A 4JM2B 3CDGB 2PO6D 5HYEA 4PJFE 3DVIA 3PF2A 1KTKE 4AJ0A 1MVUA 5GGTA 5DWUH 1U3HA 5TH2B 3VDAA 1A6UL 5GRYA 3OQ3B 3L7EB 4HUXA 3LIZH 1P4IH 4OSUL 4OGAD 5ADOH 5DO2C 2DJUA 3WL9A 3X12A 3MGTB 2CIIB 1WBXB 1YJDC 2Z8RA 4ODSH 5FM5O 1U8MB 5HYFA 1KENL 2R0KL 3WN5A 3U7YL 3F58L 5HYSG 2EKSA 4MJ4A 4PGEB 1U8HA 4CADA 3ZDYE 3L1OH 5FDWB 1NMCC 2EIBA 5E7BA 3W82A 3SKUD 4Y1AB 2C3HA 2F19H 4G5ZL 4RCAA 1R3JA 2HFTA 2CDGA 4UUJB 1M7DA 1UKQA 4WO4B 5CJOH 4PJHB 4RFEA 3SGEI 3ZKQD 1FH5L 5AZ2L 3I75B 2GI7A 1DBJH 1FO0B 2EYSB 2EEBA 5BRZD 1YUHB 4NSKA 4FS0A 3QDMD 2WBKA 1AY1H 3KAAA 1BQHB 4J3SA 1J8KA 1UC6A 3ARFB 1KACB 3ZE1E 4YHYC 3GJFH 1YPZA 4OLYH 3ARDB 5CBAA 2L7UA 4DQOH 5D93B 1SHMA 1EV2E 5DD3L 4R26H 3CNKA 2ZUTA 3OKYA 2CIKA 3P0YL 2Y07L 4PJEE 4PJDE 4LSQH 1INQB 2XZQL 3DO7B 4EN3C 4RMUA 1XIWB 3OPZH 4JFXB 1KELH 4LSTH 3O6FD 4EI5B 4JHWH 2V2TA 3OKNB 5F21B 3ZDZE 6CGTA 2VMFA 5I8CB 2Q6WA 1EEYA 4EVNA 4L3CA 1P4BH 1G6VK 1H15A 4AK1A 4HGKC 4BQBA 4X8XA 3NCCB 3ULSA 2GJ6A 2X89D 1G7IA 2WINB 4JO4L 4KDTA 1I3RA 3QAZB 2YRZA 3SCMB 1OOAA 4MDJA 3SDCA 3LVEA 3STLB 2R8SL 5EUKB 4Y8AA 4PRPD 5DURD 5DHXB 1I3GH 2H1PH 1MI5D 4OQTL 4KK8D 1LP9B 1E6JH 3FT4B 1C5CL 3I6LD 3QCTH 4KROB 3WHXB 1JZ3A 4X4ZA 4OV5B 3WJLC 5J11B 2C3VA 3BP7A 2EKJA 3QUYA 1YNLL 4W68A 3L7FB 5E99H 2FX7H 1UM4H 1AO7D 5D1ZC 1AKJD 1A02N 4R4FL 1CZ8L 4HEPG 4FG6C 4N9GA 2W59A 4X0KB 3C6LB 3BPNB 2VL5B 4K7PY 3ZDZF 3L5JA 1E27A 4TVPD 1IGIH 3HRZB 1S9YB 1J9CT 1G9NC 3E6HA 5T1KB 5I1CH 4JY6A 3ES6B 3FO2B 1ZGLP 2Q8BH 4E5XA 2GT9B 2HH0H 2LU4A 3DETC 5JZ7D 4MXQD 4JPIA 5LGHH 2W9EH 1M4KA 2EE9A 2XKNA 5E9DD 2DKSA 1IM9D 1NUFA 2ICCA 2Y7QA 1QTYT 4QRPB 3I6LE 3T08A 3DVNA 2VXUL 2MHAB 5D1XC 2GJJA 3GSNH 2WWKT 1UH3A 5ENWB 4XVTH 3VXTA 5DWUL 4NC1E 4N0UE 2UWEB 4JDZA 4DFIA 1P4IL 1KIPB 5ADOL 1MHHB 3S97C 5LVEA 4KWUA 5BJTB 3RX7A 4L8CA 2RJMA 3DTXA 1CBVL 4GT7A 1HQRA 3D18A 4ODSL 3O6MH 4C55A 3D2UB 4LCCB 4M00A 3LOWA 5INDA 1OD7A 3NIDE 4YO0B 1EO8H 1NBQA 2HN7B 3B5TA 4ZQKB 1T83C 2WBWB 5E1HB 4URTB 5HYSA 4YNYB 3FQUB 3QIBA 3QEQD 3FRUA 2JB6B 2F19L 4R4BB 5F1SA 1V8HA 2BC4B 3KHQA 5EZOH 1LO3H 5E9DE 4FNLH 2OJEB 4P9ML 5CJOL 3VD7A 4PJ9C 4MMXC 5EZLB 1SEQH 4U31A 1DBJL 1FYHB 1BVKB 4H25B 1WUNT 4FXLA 2FHCA 1YMMB 3PDGA 1T21A 4LLQA 1AHWB 1AY1L 4HIEA 3F7YA 3FCTA 5DQJB 4F9PC 4QWWD 4C4KO 1EEQA 3QQ9C 1T04B 1RZKC 2MCG1 4WHCA 3DGCR 2QBWA 4J3TA 3HPLB 2YC1A 1NGWA 2IBZY 5F44A 5IHLB 5J6GB 4F57L 4ELKB 4NP4H 5EO0A 4M7KH 3VXQA 4MJID 2VSDA 2RHEA 2HT3D 5DJ0A 3OPZL 4YC2B 3O4LA 4LSTL 3NIDF 4PD4J 4JHWL 1ZHNA 2YEZB 4ZO9A 1ZXQA 3ELAT 5C71A 1PVHA 5JOPD 2EDQA 3VRJB 1Q94B 1RJYB 1S7QB 5FYJD 3QEQE 3CAFA 4Y4KA 4GO6B 4LARH 2DOCA 4Y0GA 4XC3L 1HSBA 5HPOA 2EC9T 1A4JA 4UTAH 4HFWA 3QFJB 5GISH 3IDYB 4AEIH 5TDPB 1I3GL 1R5VB 4HXBH 4V1DB 1ZK9A 1IAKA 4U7MA 3EHBC 1E6JL 2DLHA 1SVCP 3T8XA 1HINH 4KJYA 2NYYD 3GSRB 1T2XA 3GKZA 2RCSL 4U4BA 3RVXD 2UY7A 5E99L 4XT1C 5F1IA 4HFUH 3L5WA 4P5TB 3I2CH 4XBGA 2DQGH 4DGYH 3MJ8B 3I02B 2V7HA 3HC4H 3EDJA 3D0LB 3FFCA 4MQSB 5J3HD 3UTQA 1RIUH 5T3ZH 4I2XE 4GKSB 3JVGC 1S9XA 6FABH 2Z31A 5I1CL 1MH5B 4FQ2H 2Q8BL 2HH0L 3ARRA 1QNZH 4LRIC 4TUJB 3V0WL 5LGHL 2W9EL 1BF8A 1WFOA 3WDIA 4JANA 2FIKA 1YY8A 3S5LB 1T1YB 1AFVH 4QGTA 3TO4A 1FYTE 2F58H 5C6TH 5AEAA 4JRXE 1ORSB 4XVTL 4PGZA 3KPLA 1WSST 5FUCC 4NRZA 2XWBB 4N0CC 4PLJC 2JJVA 3WN5C 3C2SA 5CEXB 4HJJL 5C0BD 3FZUD 3REVA 1MCDA 4GBXA 5E2TH 4F7CA 2IQAB 2O5ZH 5MEND 3O6ML 4P46D 3RZWA 1QSEE 1ZHKB 4MB4A 2NY0C 5HHOA 4DUVA 2IBGA 3CXHK 4U1LA 3KPRB 3TN0D 1CYGA 1XGRB 3MQIA 4OCMC 5BS0B 3H2WA 1HSAA 1LO3L 4WEBH 4FNLL 4DZBA 3AU1A 3T77B 1ACZA 5HYJD 2H45A 3JUYA 5GSVB 1BOGB 2DQDH 4LPXA 1I1AC 4JQXC 3VDCA 2DIAA 2ZOKB 2V7NB 2ADGB 1U8JA 1RJLA 4G8EA 1JWUB 3RNKB 5C86A 2EEAA 1CD1B 1KJ3H 4IRZH 4AENB 5FCSH 8FABB 2H3NA 1FVCB 3OXRB 2ZUQC 4NP4L 4QOKB 5HYQB 1N5YH 2VQ1B 4M7KL 4Z9KB 1HH6B 2MMXA 3BYTA 4FQJL 5DDHA 1W8NA 4IMLA 5GIRB 1FCGA 3KYMB 1KGCE 3H42H 5EC2A 3RY5A 1IAOB 4L3AA 1E4KC 2GTWA 3SDCC 4WHYH 3DRQB 5D8JL 4MSWA 1A7NH 4MD5A 4WV1C 4K8RD 2HT4C 1NEZB 4GMTH 1EBAA 4LARL 3O2WH 3S96B 5JW4N 4JAMB 3IJSA 4UTAL 2Z8VC 3HR5B 1A8JH 5GISL 1YA5A 4QRTA 2FGWL 4AEIL 5BZWB 1EX0A 1D5XA 4HXBL 1UENA 1KEGH 5DMYA 4M6OH 4M7ZC 3AM8C 3MRQA 1KLUB 3IYLW 2BXZA 1HINL 1T80A 3A6CH 3P30L 1U3YA 2WANA 1GGBH 4U1IB 3NN8A 2RB8A 4E0RA 4WGVB 3WYRA 3RL1B 4WCYH 5HHPB 2YD6A 1OGTA 1A2YA 3QUKA 4RZCA 4HFUL 5E8EA 3SDDA 4HG4K 4BKLB 2DQGL 4P2RA 3PIQB 1WJ3A 1QVOA 5CSGA 1FLRH 3CSYA 3T0DA 5DHYA 3RGHA 4ESKA 3S6CA 4FTVB 1RIUL 5T3ZL 1S9VB 4FOMA 2Q1EA 2AJUH 8CGTA 1R3LB 4KY1H 4KTYA 5JO5A 5HHQB 5I2IA 5JW5A 4FMKA 4HKXB 4ZFOL 4KRNA 4JLRA 4I0PA 4PS4H 3D39B 2LAGB 3CX5J 4WUUD 3EYFA 3RWJA 2P5WB 4M9PA 1WBYA 2NX5D 2VITA 4PPTA 3ULVC 3TVMD 3KPSE 4RBPH 4PJ5B 5C6TL 2XA8L 4QXGL 4HPYL 3ARGD 5LQBL 3H7BB 5AZEH 2ATPA 3QZWG 5JPNA 1Q9OA 3ALPA 3P9MB 3QBTB 3VH8G 1P5UA 4FXGA 3C09C 2X6MA 3V6OC 1RVFH 4N8PA 3BSZL 5FO8A 1T2QH 4QT5B 5FHAH 5GGSY 1IT9H 3RWFB 2R2HA 2BVEA 2J7LA 2P5EA 2Q76B 3C5ZC 3OF6D 3RPIA 4LSPH 1FDLH 4TNVK 2ICWA 2A77H 4PUBL 3IFNH 4NQXA 1I1FA 3B83A 3QDGD 4DOHE 1JNLH 1BZ7B 4NCC2 4NC0B 4HV8A 4WUUE 1ERNA 2F5AH 1X44A 2PR4H 4QHLA 4WEBL 2IMMA 5CAYB 3IXAA 4LLYA 1W0VB 2GITA 1MQ8A 3CFIC 4E42B 4PP2A 1T7VA 4YHIB 4OLWL 2NY2C 3MX0A 4PJ7F 4U1KB 3TYFA 4YDLC 3P73B 2EH7H 4KI5C 3QXDB 3CMOH 3TJEH 5EN2B 5JIPA 3OKOB 4RSVA 5B38B 3SKOB 3DX7B 5GQBA 4P4KC 5L2KB 1XF2B 3KPPA 4X9FA 2XTJC 3MZTA 3TZVB 4XP9H 2AK4A 1A6WL 1OAUH 2XZCH 1N5YL 2DWEA 1RSFA 2BVUA 2HMID 4BZ1H 4L3ED 3T4YA 3UP1A 5SWZB 1QOKA 4PYHA 3GI8L 3WS3A 5JHDE 5DUPH 4TRPH 3VXUB 4Q74A 4I3GA 3QDGE 1KYOK 4NN6B 4D0CB 1A7NL 1I1YB 2OQJB 3W39B 2VZTA 3CX5K 3P4OA 3WFEL 4GMTL 1IQDA 1D5ZA 3UPRB 2HVKA 4APQD 3HC3L 3O2WL 2M26A 3HE6A 4IRSA 1JGEA 1ZGLB 4GKNA 3TCXA 1ND0B 1U58A 3MBEC 2W38A 3G04B 1BBJA 1UVQA 4IMKA 3WO3B 1FVDA 1KEGL 4M6OL 3QO1B 4MLSA 4CVWA 1BIIA 3CFBA 2APVA 4WNQB 2D2OA 5CWSB 2NY7L 2I07A 1KCKA 3OAUL 4HDIB 4Z7WE 5EUOA 4GAFB 3G6JF 1NAMH 1R3KA 4KAQL 5DI8A 3MRJA 1MFAH 5GS1B 2WBJC 3ARQA 4U1NA 2Y6SC 1DQJB 1FLRL 1VHPA 1NH6A 4U1JA 1N8ZB 4DFHA 5C70A 3GB7A 5DQ9B 3HAEB 4KXZH 3Q3GB 5IBUG 3BW9B 2EDTA 4GAYB 2R69H 5E2UL 5D2NA 1CDJA 2Z35B 2AJUL 2OTPA 3MRCB 3VCLA 2M8XA 1A0QH 4ZUTA 5C07E 4KY1L 3N1PC 5IB2B 1NGXB 3TFKD 4N8VB 1PJ9A 3HZMB 3ALWA 4ORZC 3TBWB 1U41A 2R0ZH 3NFPA 4GW5B 3U2SB 3UTSD 5D2LF 5H35A 3F7QA 3FT3B 5AZEL 5I76A 5TQ2H 5HPMA 1J86A 1CFNB 3GSWA 4HH9B 4LHUB 5BV7H 1BVLB 4O51A 1DVFC 2DWDA 1U8QB 3QZWA 4M1CD 3BN9C 3WLBA 1RVFL 2AV7B 5I1LB 1IGTB 5FHAL 3VH8A 1NC2B 4EEEA 1IT9L 4OM1H 5EBMB 5D7SL 3NGBC 3U4EB 3OKLB 4LSPL 5IF0B 1FDLL 3PL6A 3V7AE 4I0CC 2A77L 4ZNEE 2VKXA 3GDBA 3OR7B 1V7ML 1AQDB 1JNLL 1MCEA 4QRRD 4MGXA 4G9DA 4Z78A 1NPUA 4UU9B 2F5AL 2PR4L 4EI6A 3RVUC 1HQ4A 3KNBA 1P4LA 4NRXA 3VFNA 5K59E 4NKQB 1D5BA 3MV8E 3AAZA 3IF1A 4PJFB 2EH7L 4U33A 3SO3B 5FFLA 4BFIA 3RGVC 2VZVA 1F3DJ 3CMOL 1EAJA 2VO5A 3VGFA 1P9MA 2X40A 4R0LC 3QFDA 3VD9A 4TOYH 4X6CF 3SGDI 1NL0H 5BQ7A 3ARBA 43C9A 4XP9L 1T89C 5FKPB 4I13B 4O5LH 1OAUL 2ENYA 3FB6B 4C83B 1G7JB 4BZ1L 2FZ3A 2FR4B 3I50H 2VZUA 4TRPL 3MGOB 1BWWA 2X9YA 4GRMB 1RJZA 3WLWC 5KSBE 4HJ0C 1R5WB 1J0JA 5LWYL 3GSQB 5CP7A 1TITA 4X5XB 4L8SA 3HA0A 4NWTL 3HI5H 4JJ5B 1ZA6B 4CN4A 5F88A 1HCVA 4KV5E 3BUYB 1NC4B 4WIQA 2ZNWA 3PGDA 3TP4A 1V3KA 1FORH 1D7FA 5EU6D 4F33B 5A3ID 3MLUL 4LCUB 1T03H 2J8UF 1JE6A 4PJEB 3DMMC 4X7TB 4PJDB 1M7XA 3KPNB 4P23D 4F7PA 3MRIB 1U8KA 2FWOA 1ULVA 4HAFA 1MFAL 4MCYA 4MD4A 3PWVA 1S3KH 4Z7OF 4S1QH 2Z92B 3RWEB 1QSFA 4RQQB 3AS3A 1NCCH 5I0DA 1OGAD 3VWJC 2GUOA 2YBRA 1CDIA 3BIKB 2R69L 2CH8A 5AAWA 3O3DB 4LCWA 4I18C 4K7PX 3UZQA 1A0QL 2MTPA 2BSTB 5FECA 5D7LA 4LLUB 4C56A 5HVFB 4J3XA 4JHBA 3U83A 3KPMA 1UFUA 4KRPC 5FYJU 2XKUA 4GXVH 3W9EB 3D3VD 1EA9C 5B3JE 3BZEB 2R0ZL 1XGTA 2K7QA 3LEYH 2EDDA 3BH9B 1C16A 2OTUA 4H0IA 5CP3A 3BD4A 5IWLA 3VRLE 5I30L 1A7BA 1QO3B 4JDTL 5D9SA 5BV7L 4G8GE 3ARWA 5IVOA 3FFDA 5KAQG 1WTLA 3QIWA 1ZTXH 1GGIH 1J05B 1I4FA 5FK9A 1G7MB 3O3AA 2QEJA 1KJ2H 3CDGA 2Y5TB 4LVHB 3BEVB 3ET9F 3PABA 4ZPVB 1WAAA 3BQUB 1OGAE 4FQPA 4AZ8A 3MJ6A 4LVNB 4Y88A 3PP4H 2IFFH 1KSRA 2OXGA 3MGTA 1WBXA 3UTOA 5JLZB 1U8MA 3DLQR 4OFDA 3LRHA 3R8QA 4Y5XC 3VA6A 5CJXA 3WIIH 1II4E 1XF5A 4IIQC 4PGEA 1FE8H 4NZUL 3WIHH 4N0UB 4DGVH 4Y1AA 4ACPA 5DHVH 4BSJA 2BVOB 4UUJA 2YPKB 1EHLH 3FAWA 4WO4A 3RUGE 4TOYL 1MLBB 1NL0L 4CDGC 2FIRT 4NWUL 5IBTH 3VFOB 1FO0A 4S1DC 4O5LL 4I8DA 1CICB 1YUHA 1NBVH 1HILB 5F71A 1FAKT 3QEUB 3ARFA 3DPBA 2IBZX 1HWGB 1I8LC 5IOPB 3VXPA 1FO0L 3ARDA 4XNQB 1X4ZA 5B22A 1OARH 1EO7A 2LFGA 5EU3B 3L3HB 1OTSD 3BZ4B 5E9DB 4LQ1A 1NANI 3TCLB 3VGEA 4FG6D 3VGAC 1INQA 1PBYA 3DO7A 1XIWA 4JFXA 1VFBB 2VDNH 3HNTH 3V9FA 4EI5A 4RWYL 1RURH 3TBSB 3OKNA 1CGVA 1C5DB 3IDGB 5I8CA 3IRZA 2D7PA 3LPGA 1K8DB 1FORL 4KVNH 3RWDB 4RGOH 3DETD 2Q86B 3CLEL 3SCMA 1T03L 3RUGF 5TFSH 3GSVB 1S7UA 4MD0B 5EUKA 2APTA 5H8DA 2ITCB 4RFOH 3CFDB 1ZV5A 1CXKA 2DM2A 4WRLA 4YLQT 2X05A 3FT4A 1S3KL 4KTDL 3WJJA 1ETZB 4U1GB 3MRDB 1N7ML 2WM0A 4JFFE 4OV5A 4S0SD 5F7DA 5D7JB 3RIFF 3EJYD 4ZUVA 4GG6E 4M03A 1NCCL 3QEQB 2FRGP 3DXAA 3L7FA 1ONQB 4D9QE 4NQVB 3MC0A 5CZXC 4HLJA 2PYFB 1G6RB 4WW2F 1C12A 5CKAA 3GMOB 2VL5A 4HGMA 3GBMH 1Z5LA 4WFEE 4GXVL 3NABH 4HIIB 1V3MA 3TIEB 1CU4H 1QLRB 1S9YA 3HRZA 1PG7W 3LEYL 1VFMA 5T1KA 4K94C 2ADFH 3CDFA 4R9HA 1S7TB 1VESA 1LO0H 4YHZH 3ES6A 3E2HB 3FO2A 2CR6A 2AXFB 3S5LG 1JRHI 5EB9A 4PJ9D 3TT3H 1OP3H 1RD6A 1RV6X 4QRPA 3HN3A 2BX5A 5D6DC 1TCRA 3RDTC 1SVZA 5ENWA 2ESVE 4CU6A 4QEGA 4GQ9H 1SMOA 4RISL 3QQ9D 4LP5A 3F8UB 2Y1VA 3H9SE 4I2XB 2DKUA 2XOTA 3D87B 1KIPA 4LIQH 1YEIH 1MHHA 2IFFL 1NGZB 4OLEA 4BSWB 2VN4A 3STBA 1CGYA 4B50A 1WZLA 5C0GB 1PGRB 4BM7A 1SEBB 5IFAH 5TDNA 2YA2A 2X1PA 3D2UA 4OI9A 2NW3A 4NQDD 4YO0A 2EECA 3BPCB 4FFYH 2HN7A 1FYTB 3WIIL 3WFZA 5GGRB 1CIUA 1FE8L 4HWBH 1Z3GH 4X6BB 4ZQKA 1M6OB 4NO5B 3WIHL 2NTFA 3V5KB 3W0WD 4XVUD 5GS3A 4F7MB 4ZPTB 4DGVL 2DI9A 3QI9B 2JB6A 4UT7H 4X4XB 2BC4A 1PEZA 3VGGA 3SE4C 3NFSL 2OJEA 3D25B 4POZC 1T7YA 3BKJH 5IBTL 4MYWB 3LN9A 4KMTH 1BVKA 4NJ9H 4H25A 3BP6B 1QSEB 1YMMA 2I9LB 2NY6B 1NBVL 2KUTA 5FV1L 2HWZL 5I71C 1OSZB 1P6FA 1AHWA 2QV2A 2C3WA 3SDYH 5DQJA 1I8MB 1CGWA 4W6WB 1ZAGA 3GMRB 1T04A 4MJ6B 4I5BA 2IAMC 1QPXA 3HPLA 5J6GA 3WUWB 1JV5B 2VDNL 3PGFH 3W0WE 1Q94A 2EH8H 1NEZG 1RJYA 1S7QA 3KS0J 3LKOB 3V4UH 2I5YH 4CU8A 1BJ8A 4NN7C 4ALAH 3LSOB 3TWCL 4B41A 3MRGB 2Q20A 1P7QB 2BXYA 3QFJA 2IALB 1EGJA 4EBQH 4RFOL 1MWAA 1SYSA 1R5VA 4P46B 1TPXB 5I73C 4V1DA 4PLKC 3ZSSA 3KLHC 1PEWA 4OZFB 1BJ1H 3MROB 4OCNC 2W91A 4HLZG 1IC1A 1SJHB 3TN0B 3GSRA 3W2DL 4TTDD 2P8MB 1MAML 4W4OC 3BXNB 3HKFA 3ZKXC 4P5TA 4JVUA 2QHRL 3MJ7B 4QRSB 2W60A 3MJ8A 3GMPB 3PXHA 3JSSA 2G9HA 4Y5VB 4Q6IB 3GBML 5HJ3B 3D0LA 3NABL 3K8MA 4IHOB 4YWGH 2CKBB 1JNJA 1U8IB 1I9IH 1FFRA 4Z18A 2ADFL 3WO4B 2W65A 1MH5A 3CK0H 1LO0L 1X5HA 4U6XB 4TUJA 2CXKA 3R0MA 3HLAB 3TT3L 2WP3O 5TJWK 2PYED 4QTIH 4ZD3H 4ODTH 1I1AD 3S5LA 5CBEB 1T1YA 3GMMB 4RGMC 1DN2A 3MRKB 2IBBA 4XH2B 4BZ2L 1ORSA 5E5MB 3SDAC 1KTDB 4D2NA 4GQ9L 3MYJB 4QF1B 4V2CB 2XWBA 4AIXA 3L6FB 4EIGB 4H20H 4MAYD 5LKNA 5CEXA 1YEIL 1UM6H 2N56A 3L3GB 4WWKB 4BH8B 2XFXA 4I3RH 1MCOH 4WJ5A 2I60H 1YQ2A 4F7TB 2IQAA 3WFDL 1BFSA 3P11H 5I9QB 4CL7A 4JHAH 3VWKC 1ZHKA 4FFYL 5KSAD 3KPSB 3TO2B 2C4FU 4HWBL 1Q9KB 1Z3GL 1UXWB 3HR6A 3KPRA 3HNSH 1XGRA 2AAVA 2HT4D 1JPTH 1B3JA 2P8PB 3G6AB 3PWNB 4IJ3C 2VXQL 2DQJH 3GIVA 5GZOC 2PYEE 4XNYH 3UTZB 1Z0MA 3BKJL 4FABL 1YPZE 5GSVA 1A3LH 1BOGA 2D7NA 5MHSE 1DUZA 4KMTL 5HDQH 4NJ9L 1IKFH 3L5XH 5DZLA 5C2BH 4CJ0A 2ZOKA 5DVMA 1J11A 2V7NA 4NKOA 3SDYL 3RTQD 1JWUA 3NIFF 3RNKA 5ITBH 5SWSA 3ZHLA 3LKQA 1WIPA 5GRUH 5CEZL 2WQ8A 4JPWH 1CD1A 4XPFH 3RZCA 4DOHB 5AD0A 1JF6A 4AENA 8FABA 4OF0A 1FGVH 3LQZA 4LFHG 4WUUB 1E0OB 3OXRA 1CFSB 2GJ6E 1J0HA 4QOKA 5B3NA 2VQ1A 5HYQA 2VYRE 1WIOA 5MERB 1HH6A 2EIDA 2VC2L 5CCKH 1HNFA 3AREB 3QUXC 3PGFL 5GIRA 1ZLWH 3KYMA 1FN4B 3AROA 1CFVH 4MDIB 5J4MA 3NACH 3ARGB 3GZKA 1IAOA 2DD8H 3HRPA 1AGFA 1CDGA 4WUKL 5BOPA 5DJZA 2B1HH 4CMMA 4YAQA 1NEZA 2BNQD 1A7RH 3ULUL 4PJBE 3S96A 1IKNC 4JAMA 4JFPB 3HR5A 1YPZF 4EBQL 5BZWA 3UX9B 4ERSH 1TVHA 1DBBH 3LQAH 4XC1H 4XNZC 1U91A 3ROOB 1ZLUH 1KLUA 2DQFB 5TE4H 5JHDB 4IOFC 3QDGB 4CBPA 5CGMA 5TF1H 2XZAH 2QR0B 1UM5H 4LKCB 4W6YB 4N1HB 4BKLA 3PIQA 2CLRA 4M02A 3T2QA 5C1MB 1MNUH 4M4PA 3D48R 1F97A 3C5ZD 1CXHA 1NQBA 3VFMA 5BXFB 5JW4M 1VPOH 4MB5A 4OD1H 4KC3B 4YWGL 1YC7A 5C0CD 3BPOB 1I9IL 2X09A 4N8VG 2BNQE 3CK0L 4XWGH 4F8QA 4PJ8B 5HHQA 3MOAH 4HKXA 4Z7WB 4MMZC 3D39A 3ULVE 2P5WA 3HAEH 4QTIL 4ZD3L 5IMMA 1RIHH 4OFVA 4KI5D 1GPOH 5BW7C 3PQYD 5EOCH 4PJ5A 5EU5A 2G2RB 1MIEH 3M1BB 4ZTOL 3CZJA 1O0VA 3P9MA 1D9KC 4N68A 4C54A 4H20L 3VFSB 2XTJD 4APQB 5C07B 1DQDH 3VRIB 4I3RL 1MCOL 1G9EA 4QT5A 1MY5A 2I60L 2J88H 1QRND 2UY6A 3RWFA 5IHBA 5ILTH 2DB8A 2Q76A 2KQNA 4D3CL 5L0QB 4HX1B 4UT9H 3HNSL 3IGAB 3P9WB 4G9FD 3GJFK 4UIMB 1A6TA 4OFKA 3MRHB 3MLYL 3E3QC 1GOHA 2VLRD 5JQ6H 3SDXE 3LN5B 1W0VA 4XNYL 2GTZB 3G9AB 4E42A 1A3LL 3F6IA 1DBML 1KPVB 1WCBA 3LV3A 1IKFL 3L5XL 4HMCA 4U1KA 5B4MC 2AI0H 5C2BL 5I1EH 1FIGH 1EZVY 1ZOXA 5EN2A 5ITBL 2FJFA 3OKOA 1CT8B 4YPGB 3DX7A 3SKOA 5F9OH 1T6WA 5I0ZA 1BOYA 1XF2A 4JPWL 4HJGB 4XPFL 5I1GH 4O4YH 3TZVA 1FGVL 5GZND 1G9MC 1OWWA 2WBJD 3ZDXE 2Y6SD 1X5YA 3AMKA 3BX7C 5SWZA 3KXFD 3BE1H 4M5YH 3MV8B 4AT6B 2V5MA 1CFVL 1E28B 1TCMA 3L3JB 1IM3A 3P9LA 3VXUA 4EUPH 2DD8L 5L9DH 4YUEH 4FZ8H 1QBLH 3RBGA 4NNPH 1I1YA 4RFNB 2OQJA 1WK0A 3QULA 3W39A 2B1HL 1E4XH 1X5AA 4XVJH 1PYWB 1JPST 3O3UN 2VLRE 1T1ZB 4F15C 4Y8DC 3S8WA 2DLEA 1ZGLA 5DXWA 2AVGA 4HZLB 4QRUB 4D8PB 4TULH 4LF3B 3G04A 1N26A 5EFIB 1DBBL 3LQAL 2XG5A 2DJ4A 2PXYC 3QO1A 4LSRH 5E2WH 4ZG1A 1LE5B 2O93L 1CGSH 1RZGB 3G5VA 4YBHA 4LKXB 3RY4A 4WNQA 5C08E 5CWSA 5KSBB 5J13B 1TQBC 2AJ3B 1RMFL 2FECL 2OR8A 4UDUA 4HDIA 4QRRB 4L5FL 3MCKB 1RUAH 4R90H 4PREB 5ACZA 1HKLL 4E41E 3KYAA 4MVBD 5GS1A 2QQLH 4P2QD 3KXFE 4XCNA 2P47B 2E3VA 1RZ7H 1DQJA 2A9MH 3AY4A 5SV3A 4QNPE 4OD1L 1N8ZA 3TBYB 3MO1B 3Q3GA 3OTTA 3BW9A 4GAYA 1OTUC 4M3JA 5FYLD 3KPTA 4JFDD 2Z35A 2NY1C 5DK0B 4Y2OA 3MOAL 4ZXBA 5IB2A 2XPGA 4XVSH 1IEAB 4RIRB 3RVUD 1NGXA 5KS9E 2X4UB 4N8VA 3HZMA 1FJ1B 3IAPA 1MJ7L 4BFBD 3TBWA 5KVGL 3OB0H 2HA1A 3K80A 5JXEA 1OAXL 1RIHL 2GJZB 3R4DA 1GPOL 3RGVD 4GW5A 4L9DA 5EOCL 1QP1A 1MIEL 2X41A 1CFNA 4HH9A 4NQED 2QQKH 3N50A 1BVLA 2R0LH 4EDWH 4LLAA 5HHOE 1U8QA 4RAUB 1DQDL 2AV7A 1MCCA 1M05B 5I1LA 4X9BA 1VDGA 1ZT7B 1F58H 3ZTJG 4P2QE 2J88L 3OKDB 2AABL 3BIBX 5KOVC 5EIIA 4MCZB 5ILTL 1YEKH 3WHE1 5EBMA 1FFQA 4MXVE 1KOAA 3U4EA 3HMXH 3OKLA 4Y4HB 5IF0A 1UCTA 1XGUB 2FEDC 3WLWD 4HJ0D 4UT9L 1HOCA 4L9LC 1OLLA 4KK9C 4H88H 5FYLE 3RVTD 4CUCA 3NPSB 3IDIB 5CMAB 5F7EH 1AE6H 1AQDA 3VD4A 3HI6H 4RRPG 4UU9A 1XCTA 3QCVH 2BNUB 1AIFB 3WS6C 4DVRH 3THMH 4HCRH 5EO1B 4PJFA 4XHQA 2AI0L 1FIGL 5HXMA 3EO1A 1OGAB 4JGUA 1YEGH 5ALCH 3VJ6B 4NQEE 2NY4B 3C8HA 3S36X 3T0XA 4P2OC 5F9OL 5B8CC 5I1GL 1MPAH 2EYTB 1YY9C 4O4YL 4UIKH 5FKPA 3W11C 2NY5H 1BQLH 4PRHA 2FJGB 3FB6A 3H0TA 3D3VB 1T20A 4KDVA 4C83A 1G7JA 4MXVF 4ZUWB 1NMCB 1JHKH 3BE1L 2FR4A 4U7SA 2X4RA 3CFCL 3VWJD 3MGOA 2OR9H 4GRMA 3UCRA 3I3EA 5L9DL 1R5WA 4YUEL 4FZ8L 1QBLL 3L5IA 3GSQA 3I84A 1E4XL 3PWPD 2DMKA 3MMEA 5EC1B 4X5XA 5F7UA 4XNXH 4JZOB 2XICA 3H3KA 4JJ5A 2VLKD 1ZA6A 4KRPD 2MCPH 4Q9QH 3EYOB 1NC4A 3O45A 4NQCD 3B9KD 3I85A 2J8HA 4YHYB 4UB0H 4LSRL 4JPKH 2BZDA 4P2RE 3WV0A 4F33A 3MLRH 5IEHB 4LK4A 3VFGH 2LU3A 4NO2B 4LCUA 4M6AA 1OAQH 5IV2B 5J1AB 3ME0A 2AXJA 2MKWA 4EN3B 1QLEH 3RWCB 4LCYB 4GS7C 1LVEA 4PJEA 4R90L 4X7TA 4PJDA 4L4TE 2QSCH 4OZ4B 3KPNA 3MRIA 2J5LB 2QQLL 5J0BA 4GW1B 1F6AA 1RZ7L 3C6SB 4YBQC 3RWEA 3LN4B 1ZVYA 4RQQA 3NMEA 5DK3A 3TH2T 4YXLH 3R1GH 1G0YR 3BIKA 1CGXA 1WBZB 4Y89A 1KIQB 1A6ZB 4ZO8A 2CK0L 5DR5H 3O3DA 3ZHKA 4XTRD 2VDRH 1QKZH 5DT1H 4HSQA 2PCPA 4LLUA 4NNYA 4QHMA 4HUKB 4YQXH 1BX2B 5C8JB 3J8F7 1A47A 3RPKA 4PRID 3QDMA 3W9EA 1GGYA 3SHSA 3QCUH 3BZEA 4JFFB 1DQML 4P57B 1P5VA 3BH9A 3HZKB 5KVDL 4GG6B 1G6RH 1BJMA 2D0HA 2P5EE 1QO3A 2P43B 2QQKL 2Z4QB 5D1ZB 2R0LL 4EDWL 4P0DA 5TE6H 1C7TA 3AGVA 2NZ9C 1KFAH 5HGAB 2VZSA 3O6FA 4JN1L 1F58L 1J05A 1TDQA 3OKEB 4YK4C 1G7MA 2BSED 1ZHBB 2ZUXA 5MEQA 1YEKL 5H94B 2H32B 3DYPA 4ZPVA 4WEUD 5AYQA 3BQUA 4JG1H 3BRFA 2E7MA 3PDDA 3DX9B 4ONHB 2J6EA 4H88L 1S7VB 4X4MA 2WMPA 1RU9H 4M3KB 2QADC 4ZOBA 4ENED 4DKDC 5F7EL 1AE6L 5JLZA 3HI6L 1MI5A 1ZANH 3QCVL 2ZUWA 5D1XB 15C8H 4DVRL 2OI9C 4JFHD 4RRPA 4WFGE 2FD6H 4NPYB 3FO0H 1BQSA 2ESVB 4CVXA 4N0UA 1YEGL 3H9SB 1CTOA 2YR3A 3PV7A 3SO5A 2BVOA 2YPKA 2K7PA 1AO7A 1Q9LA 1HI6A 1MLBA 2Q3ZA 1AKJA 4F7EB 3DARA 3MJ9A 3VFOA 2NY5L 4NUJB 1RQ5A 1BQLL 1YDPA 2EICA 5J6HB 3VGDA 4FQLH 1HILA 3L3OB 4ODVH 2DN7A 3QEUA 4LBEB 4NJAH 3MTRA 1UWEH 2PW2B 2ERJC 2WZPD 2OR9L 4ZOAA 5FO9B 4XNQA 2H2PC 2X4SB 5EU3A 3WUWG 4PJ9B 5CZXD 3L3HA 4G6AD 3D85D 3BZ4A 5E9DA 3TCLA 5GGSB 4X4YB 1IM9A 3BKCH 5ACLA 4N1EA 1OCWH 2JK5B 1VFBA 5J89A 5FOJA 3TBSA 4TNWF 1C5DA 1VEPA 3IDGA 5DC4B 4Q9QL 1YZZA 2AQ2A 4OV6F 3EYSH 4UB0L 1LWRA 3DV4A 3QQNA 1DEEB 1KIRA 4NHCH 1K8DA 3UO1H 3FB8B 3ZSTA 3MLRL 4LPWA 3RWDA 3VFGL 2Q86A 4M62H 4DTGH 1ES0A 1GVIA 1OAQL 3ZE2E 4RAHA 3B3IB 3GSVA 1LO5B 3U48A 2ITCA 5C0RH 2QSCL 3CFDA 4CNIB 2E5EA 2OYPA 3RL2B 3RDTD 2Y06H 2OL3B 3HPJA 1ETZA 3MRDA 3GNML 2R1YB 1J88A 2HJLB 4RBPK 3W0WB 5DJDB 4YXHH 1QBAA 4X9IA 1C5BH 3QEQA 4UILH 1AC0A 3R1GL 4YXLL 2YS4A 1G7LB 4XHJD 4LAQH 4OCYH 2MKLC 3RA7H 1IGCL 4MXWH 5DR5L 4MX7A 3SN6N 4OZFH 1JF5A 2IAND 4NT6A 4JFOA 4M8QA 5F9JA 5DT1L 4MHHG 4P3DB 5E4IA 4RDQG 2PYFA 1L7TH 5JDSB 4G6JH 1S9KC 3GMOA 1EPFA 1L7IH 4D0BB 4HIIA 5EUOF 3TIEA 1QLRA 3QCUL 2E7LC 5BVPH 2XI9A 2YD9A 3ZTNL 4N5EC 5IGXL 4HEME 1S7TA 1G6RL 3V52H 4Y16B 1J0KA 1R0AL 5IG7B 5TE6L 3FN9A 4ZS7H 1EK3A 1G7QB 1SM3L 3C60D 1FIEA 2NXZC 2W9DH 4LPTA 1EIBA 2ZUVA 1OLZA 3LKRA 3BO8A 4MNHB 5F7WC 3O2DH 5GJTH 3QNYA 1IGFH 1OVZA 5IROC 3V5DB 3VMPA 1AH1A 4JG1L 4I2XA 1A9EB 2IAMD 3CH8A 1T1XB 1X7QB 2FBJL 1NGZA 4BSWA 1PY4A 1QA9A 1JZ2A 5K9KB 2V9QA 3RHWK 2R2BA 5DMKB 1SEBA 2XXMB 2QSQA 1ZANL 1L4IA 3BPCA 15C8L 1FYTA 1YC8A 4R2GB 5GGRA 4X6BA 2FD6L 4N0RA 1M6OA 3FO0L 1U8LB 2VDLH 4NO5A 3V5KA 5DZOA 4AH2B 3WN5B 4F7MA 4ZPTA 3WE6B 3ZKNC 3QI9A 2X1XR 2EKSB 4YZFE 2EEDA 3T1WA 1MVFA 1U8HB 3NTCH 3S3JA 4CADB 4GKZB 3D25A 2Q7YB 3BWUC 3IXTB 1I3UA 3BESR 4PLKD 3RIAK 2NY0B 3BP6A 3RI5K 2I9LA 2JKXA 3FN3A 1T5XB 4HXAH 1OSZA 5E8PB 2AJYL 2D4DA 3LKSB 4NJAL 2KDGA 1UWEL 3GMRA 4MJ6A 2MQ3A 2CPCA 2F9BT 4PG2A 2CRMA 4Y4FC 2R15A 2PO6C 4UOW1 2YOCA 4PR5B 4JFEE 2PYEB 1KBGL 5FHBH 1I1AB 5T3XE 2UZIH 3WUWA 1JV5A 4EXKA 1QFWL 2JE8A 2L7JA 2A83B 5JPMB 1ODAA 1O5DT 1JN6B 3LKOA 4K2UH 4UT6H 1JPFB 4NHCL 3UO1L 4OZIF 1OAKH 2D3VA 3MOQA 2WLYA 3LSOA 2VLJD 3BGFC 4M62L 2QQNH 5A16B 4K71C 2MOVA 5EWIH 2Q6WB 3MRGA 1EEYB 2ZUQB 1P7QA 4P5KB 3SBWC 5MENA 1RULH 1CXEA 2GJ6B 3QP3A 4P46A 3RY6A 1INDH 4U2YA 4I9WD 2Y06L 3ARZA 2F8OA 1L6XA 3SDCB 2WUBH 1SJHA 3C5SB 5D7LE 4WV1B 4YXKL 3TN0A 2YD7A 2DLFH 4IEFB 2WAHA 4ONOA 4YXHL 1C5BL 25C8H 2P8MA 3GBLA 3BXNA 1FLTX 4OCYL 3LD8C 3RA7L 2OCFD 1J1OH 1AI1H 1FZKA 5J9PB 2DQHL 3W5MA 3MJ7A 3EJJX 3U36A 4QRSA 4PJBB 5A2FA 3JZ7A 4JQIH 3GMPA 1HH9B 3BP7B 4Y5VA 1L7TL 2OR7A 2QSVA 4G43B 4Q6IA 4M7ZB 2GFBB 3K4ZA 1WGOA 5HJ3A 4PJXE 1L7IL 1I3VA 3VXSD 2A74B 2CKBA 4GRWE 4BSVB 4IRJD 1BFVH 5BVPL 3CVHB 4Z7UE 4OLZL 4X98B 2PF6A 5F7KC 1JZ5A 1BLNB 3V52L 4DKAA 1F4XH 1CE1H 4U6XA 4KXZI 2Z93B 3HLAA 1W8OA 2PNDA 1LGVA 2CKBL 4ZS7L 4EJ1C 3VW3H 1MFCL 3MCLH 1UGNA 2BNRE 3GMMA 2W9DL 5IW1B 3MRKA 5I6XC 4XH2A 4EOWH 3M8OH 3BD5A 4YBLC 5E5MA 3O2DL 5IVXA 3OHXB 3MYJA 2CGRL 2JB5L 2XQBL 4MNQE 1BAFL 2DJSA 3L6FA 5EO9A 3U6RB 5KN5B 3KYOB 2BNQB 5ICXB 4WWKA 4BH8A 1S7XA 4LCIH 2ZUYA 4LU5H 3QDJD 4F7TA 1U93B 4Y5YC 4JDZB 3F65A 3WD5H 1I7ZB 3QG7H 3KPSA 2FEEL 1FFOB 5IVZA 5FYKE 1B4RA 3QRGH 2YD2A 4GRWF 1Q9KA 2FX9H 1EEZB 3QUZC 4J23A 5E6IC 1UXWA 4KRMB 3BPLB 4JKMA 4KKBC 3C09B 3MRRB 4JM2F 2P8PA 5EG6C 3G6AA 4OIIH 1K4CB 4C4KT 3NTCL 1WAAF 5C09E 4EIZC 1EZVX 2DM4A 3JV6B 3UTZA 3SGDH 2HJFB 3ESVF 3V7AG 4UV4H 1DANT 3ZL4L 3S4SG 4HXAL 5JZ7C 3QUMH 4O02H 2AXGB 3I6KA 1PLGH 4IOFD 1N0XH 1WITA 1KB5H 1I9RL 5C0AE 3MLSH 4R6UA 1H3TA 2EDBA 5HGDB 1FG2B 4ORGB 4HIEB 3ZHDA 4X7SH 1H9VA 4WUUA 5CJ8A 3DV6B 1CFSA 5MP6H 3SDXB 5FHBL 5MERA 2NY2B 3WDHA 4YDLB 1X5IA 2JCCE 4FQQB 2YC1B 1NGWB 4PJHF 1FN4A 4MDIA 3ARGA 1F4YL 5IB1B 4K2UL 4UT6L 4P4KB 5LJYH 1C08A 1OAKL 5ABDE 2XTJB 1W2KT 4YGVB 2QQNL 2JIXD 5EWIL 2HP4A 1OD9A 1KXQE 2YUVA 2YKLL 4I4WA 3AB0C 4JFPA 4OZGE 4J3WA 3DXAE 4H1LH 1RULL 5JXAH 2NY3C 1INDL 1EVUA 4HULB 1HSBB 4L4VD 3ROOA 4DUXA 5EZJB 2DQFA 3MXWH 3MYZA 1L0QA 4HQQH 2DLFL 1D9KD 3EDEA 3OKKB 3QDGA 4LGSB 25C8L 2R56H 5D7KD 1AI1L 2VLRB 4ZFFB 2QR0A 4KJYB 1J5OH 4JEGB 4J7RA 3MBEB 4JQIL 2MWCA 4AMKH 4RA3A 5BXFA 4HMEA 5LGJB 5F1IB 3D5OF 3EO9L 5DFVC 5HSFA 4G6MH 5IW6A 3T2OA 1MFDH 4QRPE 5C08B 1LP9F 2AQ3A 3F12B 4PJ8A 2VR5A 1CE1L 5F7FA 2AGJH 4J2XA 4IDJH 1L9NA 2W07A 3ORJA 3UTTD 3O9WC 2WBJB 4PB9H 4E41B 2P48B 3QPXH 2YZ8A 1U3HD 2F8VA 5B4MD 4MAUH 4GSDH 3KXFB 5T33L 4EOWL 4N0YH 3M8OL 2A6KB 3F7RA 2G2RA 3M1BA 5JNYB 1DTUA 1JF1A 1KLGB 1N2RB 4U7KA 5E6ZA 4L29B 3BVNB 3VFSA 3BOVA 4APQA 5I1JH 5C07A 5CIPB 3UPCA 4NYLB 4LCIL 5BV7C 1B6UA 2D7TH 1X5LA 5KS9B 1DFBL 4NRZB 2VQTA 1SYVB 1WIUA 3BEWB 3MLVH 1AGEA 3WD5L 3RVXC 3U1SH 3IT8D 4U1SB 1KPUB 1FNFA 5DUMH 4G8IA 4HX1A 1PX3A 3OSKA 3REVB 1B2WH 3ARTA 2FX9L 1QBMH 1XR8B 4F7CB 1GHFH 3IGAA 5JW3H 5DJAB 5KAQF 1DVFB 4OT1H 1PSKL 3E3QE 5B21A 4UIMA 2EDYA 5HTSA 1H3XA 3MRHA 4OIIL 4X6FB 5HHOB 3UTTE 3V0VB 4FFZH 2UWEF 1Z9OA 4U1LB 3BJLA 4JM2C 2GTZA 1WQVT 4P2QB 2AEWA 4OGZA 5AAMA 3NGBB 1JL8A 4B7LA 1KPVA 2O26U 3FQTB 3MV11 1DSFH 4DZBB 4O02L 1A3RH 1OWRM 1PLGL 1OAZL 2BMKA 4ZNEA 2YWYA 5FA3B 3S4SA 5GS0H 3MLSL 2V5TA 3IRPX 2I26N 4QRQA 3HI1B 3BRDA 2GEEA 3TBTA 5GRWA 5EOQH 4OD2B 2N1KA 5F9AC 3P0VL 1NCWH 3VMNA 5MP6L 1KB9J 3SOBH 1TNNA 2BDNH 5CHNA 3MV8A 4DW2H 4AT6A 4P59H 1FP5A 2H3NB 4LLVB 2HT2C 3UTSA 2YD1A 3ISWA 1ITCA 3L3JA 1XAUA 3X3FH 1OTUD 1EJOL 3H3PH 4R0LB 4NQEB 4XXCC 3RX8A 1LDPL 1PYWA 1X5ZA 1T1ZA 2XWTA 1J1XH 4JQVA 1Q1JH 2COQA 4JO1H 2GTWB 3DBXA 4D8PA 4ZUUB 2VDMH 4OF5A 1MHPH 5SV4A 5JXAL 5EFIA 1TJGH 4YGAB 5C0IB 5JOFA 3TPKA 3D9AH 1RZGA 4LKXA 5KSBA 1ORQA 3WNKA 2AJ3A 2WWMD 3OJMB 1D5XB 4AEHL 4QRRA 4GJTB 2FHBA 2QTEA 3MCKA 1UWXH 1U8PB 2Y9RT 1S78C 1FHGA 3NN8B 5IUSA 1KN2H 3GMQB 1I7UB 4ISVB 5DFWH 4YFDB 4AMKL 3VXMD 4HPOH 1OGTB 1RJCA 2DMBA 1A2YB 2FEDD 1CL7H 5E8EB 1L9MA 3TBYA 4DZ8B 4KK9D 4P2RB 5T5NG 3IDNB 1QVOB 4M7LH 4BQ6A 1MFDL 4H8WL 1BJ1J 5HDBF 5JUEH 3WEXB 3P2TA 2BVTA 5DK0A 3DMMB 5DHYB 3O2VH 2AGJL 4KJWD 4IDJL 3DI2B 2X4UA 4P4RB 1FJ1A 4OCRH 1MJJB 4L4TB 4PB9L 2HLFC 5MI0C 4OCWL 4MAUL 3SGJC 2GJZA 4GSDL 5JW5B 1KC5L 1MHEB 4N0YL 1I85C 5E2VH 3VWJB 2LTQC 4G6KH 4OIBA 3TYGH 4I18B 4P2OD 3S37H 2J4WH 5ID1B 5I1JL 4IBLT 4RAUA 3W11D 3C6LC 1M05A 2ATPB 2EE2A 2R4SH 2D7TL 1ZT7A 4KRPB 2BFVH 2YA0A 3VXME 5EIVA 4MCZA 4LEXH 2UV3A 3MLVL 1DQTA 3NPZB 4J12A 1KG0B 3G5YB 3U1SL 5ICYB 3S35H 1B2WL 1QBML 3QXVA 1XCQB 1NGYB 1H8SA 4RGNE 5JW3L 2R2HB 2P5EB 5TGBB 4OI7A 3MCG1 4K7FB 3UDWA 3AS1A 3GUTB 2DTMH 3IDIA 2DBLL 5CMAA 3RPIB 4ETYA 4FFZL 5SWSE 4O9HH 4P23A 2BNUA 1AIFA 1I1FB 2JJTC 1Z9SA 5EO1A 4KU1A 4HV8B 4MQ7B 4FQCH 1DSFL 1OGAA 4QOKE 1A3RL 3IXAB 3VJ6A 2ATKB 5H37H 5GS0L 2BOCA 4NC2B 3TVMC 2EYTA 3O4LD 5E2JA 1FL6A 1U2HA 1UZ6F 4QHUA 4Y5XB 1MAJA 5EOQL 4Z7VE 5H2BB 2D9CA 2FYYB 2ID5A 4OKVB 2OM5A 3SOBL 4IIQB 1HHJB 2VZ3A 3D3VA 4YBQD 1ZVSB 3GK8H 3ABZA 1G0DA 4ZUWA 3BKML 4DW2L 4Y4KD 4P59L 4XP5H 2BY1A 2R2CA 3X3FL 5DVKA 3H3PL 2VLME 1EHXA 3WIFA 5EC1A 4H26B 1QFUH 4JY5H 3FB5B 4RNRA 1Q1JL 2B4CH 1HKFA 4LLDB 1JGDA 3EYOA 1MEXH 2VDML 3O11B 4NO3B 2ZCHH 1LEIA 1D5ZB 2OTWB 1F4WL 2IWGA 3D9AL 2OSLA 3QEHB 4U0RC 5IHUH 4K23H 5IEHA 3PNWB 1AXSA 5HYIA 4DCQA 4NO2A 4R7DB 4K3HA 5IV2A 1UVQB 3ULUF 5J1AA 1PG7X 1IL1B 3MUGA 4EN3A 4OF8A 3RWCA 3UC0H 4X6DE 4AY0A 4OZ4A 5DJ6B 4PBWD 2F53E 3Q2CA 1H3PH 1KN2L 1BFTA 2AJXH 3C6SA 4HPOL 1H8OA 1ZSDB 1CL7L 1EMTH 4PGJA 2I25N 3Q5OA 1WBZA 3MRJB 3STZB 4M7LL 1P6AB 1KIQA 3SKJL 2HMIC 4GAJH 5DD0L 3EFFB 3O2VL 3U0WL 4NM4L 4O2FA 1BX2A 1U42A 5C8JA 3LH2H 3RWGB 4A6YH 3EAKA 4ZUTB 1JGUH 3AXLB 3EO0B 2CLZB 4P57A 2WIMA 3BH8B 5E2VL 3FN0H 4G6KL 3CH1B 3BT2L 1LO2L 2BY2A 3TYGL 2BJMH 3QXWA 5I18H 3S37L 5D1ZA 3D85B 2J4WL 1CLZH 1JJUA 3NFPB 1YNKL 3HTLX 5EBGA 2V5SA 1AGDB 4J4PC 3VFWA 3FQNB 3U4AA 5HGAA 2BFVL 3OKEA 5ICZA 4QXTB 1ZHBA 4O51B 1Q0YL 4LEXL 4NKMB 1XF4A 2H32A 3DX8A 1K3IA 5DRWA 5HVWA 5TPWL 4F37K 3DX9A 1RZJH 4ONHA 2H2PD 4TUOB 1S7VA 2V6HA 4PJGE 5EOCJ 2DTML 3PDOB 4F8TA 3CD4A 3U82B 5E7FA 2P42B 4O9HL 5D1XA 4PP1C 3VE0B 4TTGA 4HGWB 3EDKA 4WY7H 2MQ0A 4NPYA 3HZYB 2ESVA 4Z78B 5GGTH 2R0KH 1ZLWK 3DRTB 3TFKC 3H9SA 1YEEH 5C7XH 5F9WC 4X5LA 1SY6A 2BK8A 1X4XA 2UVEA 4BFIB 4F7EA 5ISZD 2OS7A 4G7YL 1TIUA 1F02I 3SGKC 5C2UB 4NUJA 1UJTA 3CPLB 5J6HA 1N6UA 5F7MC 1CXFA 1SJVA 4NUGL 1WEJH 3GK8L 3L3OA 1T83A 4LBEA 5AZ2H 2RAMA 3OZ9H 2PW2A 1TTUA 1ZLUK 5D70L 1TJIL 5FO9A 4PV8B 1RZIB 2X4SA 2HFFA 4PJ9A 1ZMYA 4LPVA 2FZ3B 5GGSA 1DQQB 3TEUA 2JK5A 3CIQA 1CG9B 2B4CL 5DD3H 1MEXL 1WWBX 2ZCHL 4F9PA 3TJHC 2Y07H 4JGJA 2Z9TA 2XZQH 5GHWH 3U0PB 1TENA 1DEEA 4MA8H 5IHUL 2ZCKH 3SDDD 2C4XA 3SQOH 5T3ZD 3JTTB 4NOFA 4J3VA 1KXTB 2DLGA 2P7TB 2XKSA 2R4RL 1LO5A 3PGDB 2HRLA 2VAAA 3UC0L 4JFEB 4PY7B 3N1GC 3IS1X 4CNIA 4JO4H 5A2KH 5I75C 1XZ0B 3RL2A 4OB5H 1H3PL 4M48H 2OL3A 3MZGB 1CDHA 2AJXL 4Q6YA 2R1YA 4D9RD 2HJLA 3W0WA 5DJDA 4NN7B 1CWVA 5DGQA 1G7LA 3DUSB 2GHWB 4MCYB 3PWVB 2NW2B 4UQ2B 7FABH 4UAOC 2FECI 4P3DA 2EZ0C 5DRXB 2APFA 5I73B 1PKQE 3LH2L 4D0BA 1HHKB 4RMRA 1M7IB 5DRNB 5HI3C 3Q1SH 3ILQC 1JGUL 1IEBB 1IGYA 3CUPA 5D7LB 3FN0L 1CR9H 1NMBH 4HUNB 1ZS8B 4GFTB 2BJML 5I18L 4XPGL 2E9WA 3IU3B 3UJJL 2HLAB 5IG7A 1CLZL 5ERWB 2V17H 5T1DH 4S1SH 2CLVB 1UWGH 3TT1H 5ID0B 4UOJA 5FB8B 4PJXB 4Z6AT 2JF1A 4MNHA 4ELMB 3B9EA 3JVGA 4GRWB 1NDGB 3V5DA 4XPHL 1A9EA 4YH6A 5INCA 3F62A 4Z7UB 1T1XA 3DX6A 1X7QA 5FK9B 4AL8H 1OL0A 4LRIA 5DJXA 4Y4FD 4Z7NF 3OGCB 3PABB 4RMWA 5E56A 1X5GA 5K9KA 5E70A 5DMKA 4RGMB 4YE4L 1YEHH 4Z0BH 2BNRB 2D0GA 4NO0B 4UV7H 3SDAB 4WY7L 1MUJB 2VNCA 1U8LA 4P48A 1CBVH 1QR1B 4XCCL 5GGTL 3DYOA 4AH2A 3ULVH 4PRHE 3WE6A 4MNQB 1YEEL 1INEH 2AK4D 5C7XL 2LE9A 2DQTH 1XF5B 3IJHB 2H26B 3DGGB 2GSIB 2P8LB 1I75A 4GKZA 4OD3L 2Q7YA 3VWKB 1J8HD 2D03L 1MRCH 1YYMH 3IXTA 1GOFA 4FFVC 1EXUA 1T5XA 1WEJL 5E8PA 4P9MH 3LKSA 1T3FA 3OZ9L 3GHBH 3UYRH 2UZYB 5EU7E 4IJ3B 5FUOL 2X4PA 3HE6D 4LVOC 1GZPB 4XRCB 4PJFF 4PR5A 1QYGH 2EDJA 4XP4L 2HVJB 2PYEA 5C09B 3BDBA 1I1AA 4JQXA 3VXPB 5IJKC 1OF2B 1DUYA 3RVWC 2A83A 3DHMA 5JPMA 4OF6A 4F57H 4Y2DC 3SEPA 1JN6A 2Y25A 3OGOE 5GHWL 5KSVA 2PTTB 1JPFA 1MRDH 4MA8L 4CU7A 2ZCKL 3IAQA 5C0AB 3SQOL 5A16A 1Y0LB 3ZDYF 1J8HE 4YDJB 2ZOLA 4P5KA 1E4XI 2VOTA 1D6VH 4FP8L 3QUXB 5HGBA 4HKJB 4OB5L 4M48L 4R96A 2JCCB 4PJCA 4XC3H 1UH2A 2XN9D 3UZEA 1HYSC 1E4KA 3OB0K 4K9EC 2X1QA 1S7UB 3C5SA 4WV1A 3JWOH 3WNLA 3LQAC 5BRZE 3QHZH 5BCAA 3QDME 1LEGB 1ZA3A 5E5RB 5CS7A 5J9PA 5F7DB 3ZE1F 4PJBA 1MRFH 1RK1A 4KDWA 4ZUVB 7FABL 1HH9A 2RCSH 2E7CA 4OZGB 3DXAB 4CJ1A 2BCKB 4G43A 3AM8A 3QISA 2GFBA 4ZAKC 3FRPG 4N9OB 3X11B 2YD8A 2VWEC 3QUZD 2A74A 2VZ1A 5E6ID 4BSVA 1OTSC 3Q1SL 4MQTB 4PJEF 4KKBD 4PJDF 4YHPB 3S36H 1I9JH 3CVHA 4Q7DA 4X98A 1C12B 1U8NB 1CR9L 1NMBL 1BF2A 1BLNA 3CFEA 3MUJA 1Z5LB 1IC4H 4YR6B 2Z93A 1JK8B 2C3XA 4D0DA 5SX4H 1P1ZB 1GC1C 2V17L 5ETUB 4S1SL 5T1DL 2Q3AA 4BQCA 2VRAA 4BUHA 3CVHL 4X4ME 1A21A 1P7KB 1UWGL 3PL6D 3TBVA 4AG4H 5IW1A 3TT1L 3WFCL 3V0WH 4PRPE 4OGXH 4UMGA 3OHXA 1MI5E 1YECH 2IF7A 4MJ5B 3U6RA 3S9DB 4D94A 4AL8L 3KYOA 5KN5A 1TCRB 1BPVA 2BNQA 5ICXA 4DGIH 2JIXB 1IEHA 5CSZB 1K4DB 1U93A 1G1YA 1CN4A 4TQEL 3EJYC 4FQ1H 3U9UB 1I7ZA 1YEHL 4Z0BL 1AO7E 4HJJH 1FFOA 4UV7L 1A1MB 4U6VH 1EEZA 1AR1D 3B2UC 1A6PA 1D9KB 5TDNB 2HG5B 2NW3B 5I8OH 3ULVL 3MRRA 3V6OA 1INEL 1K4CA 4TVPE 1HE7A 2DQTL 2X4OB 3KPQB 3OAYK 2NTFB 5FKAB 3JV6A 3KPOB 5HDLA 1MRCL 4HWNA 1YYML 2NY3D 3C5ZA 2HJFA 1VEOA 1FNLA 3DI3B 1XMWA 1UA6L 2AXGA 1MREH 4JZJC 3GHBL 2DBJA 3UYRL 1D6EB 4GLRH 3O4OC 1FG2A 5HGDA 3T0VA 4ORGA 5FGBC 1LILA 3IETB 3HHRB 3UTTB 1QYGL 3S88L 3VU2A 3DV6A 3U30C 3SDXA 5F6IB 2EXWC 3D1MC 4HC1A 4I5BB 2B0SL 5I16B 3SO3C 1VFUA 4FQQA 1OW0C 5DFVD 4ZSOB 2CSPA 2ZKHH 4UNUA 4QGYA 5IB1A 5D7IE 4P4KA 4FQJH 1MRDL 1DCLA 2A2QT 4TSBH 1K2DA 4Q9BA 1IC5H 2J2ZA 4YGVA 2P1YA 1NDMB 4Q58C 2JLLA 3NCMA 3O9WD 2C4FT 5D8JH 1QRNA 4NCC1 4LP4A 1D6VL 4XVUC 1QSFD 3EFDH 4LQFH 5L7XH 4NRYA 1UG9A 2AERT 2F74B 1DBAL 5KZCD 5EZJA 1CS6A 2Y72A 1E4JA 3MREB 3QG6B 3JWOL 2E6JA 2WK2A 3SE8H 4G9FA 2VB5A 2FGWH 1MWAB 1SYSB 1YEDA 3OKKA 3QHZL 4M5ZH 4F15B 4C59B 4KZEH 1F42A 5JMOC 3PP3H 2VLRA 1XR9B 3QQ3B 5D72H 3P30H 4ZFFA 3HFML 1MRFL 4BYHA 5D96C 3HS0B 3JWNC 3MBEA 5EPMB 2JELH 1ZLSH 4WTXA 2PXYB 2WP3T 5C0FB 5LGJA 4MA3B 1KNOB 5F8QC 3P40A 5BZDB 1NFKA 4MJIE 5J8OA 3S36L 2IADA 2W60B 1I9JL 1TQBB 2E6QA 1ZWIB 2G9HB 3FRPA 5C08A 4OZHB 3V6FB 1NFDE 3IFOB 3P4MB 3F12A 3F7VB 5JOPE 1KXVC 1IC4L 2BOBB 2Q7NA 5FYJE 3O6KH 1S5HB 4JM2D 3UAJC 3L3DB 3UROR 1KT2B 2WBJA 1J18A 3QXAA 4E41A 2W65B 1DANU 3KXFA 3B9VA 4AG4L 2A6KA 3KHOA 1GH7A 4KQ3H 4OGXL 5AG8A 3KJ6H 5JNYA 2NY1B 3CDYA 5DEFB 1KLGA 1HHGB 1N2RA 5IB3B 1YECL 4L29A 2R0WH 3BVNA 4CVUA 3QA3A 2FBOJ 4DGIL 2XA8H 4QXGH 4X5WB 5CIPA 4HPYH 1JZ7A 5LQBH 4NYLA 4QLRA 3GBNL 5KS9A 4DEPC 4PGCB 5LBSH 4FQ1L 1SYVA 4TTDC 3BEWA 4JVPA 4RMQA 4NBXB 4WEMB 4U1SA 1JCKA 1KPUA 2HT2D 3RQ3A 4Y1AD 1SJEB 3BSZH 2XFXB 4U6VL 4WJ5B 1IAMA 4MA1C 4PD4K 5F93C 1XR8A 4UI2A 3VI4E 4KUZL 3EJZD 5DJAA 5I8OL 1DVFA 1GGTA 2DIBA 1M71B 1FVEB 3MUY1 4GQPH 4X6FA 2VDPL 4OIAA 5IK3B 3V0VA 4NZTH 1QFOA 4PUBH 3HUJE 1RAMA 5AUMB 4P2QA 5HHMD 3VXMB 1HNGA 2FNBA 2IPUK 1I9EA 3FQTA 1ZHLB 5HGGS 3VXRD 3ARDD 4L9LB 3GIVB 5ESQB 1RY7B 3T2NH 1GRWA 5MEOA 1GCFA 5FA3A 1MREL 4LGRB 2MSPA 4RGNB 3QPQC 1DUZB 5M7QA 1DN0B 4OLWH 3HI1A 4EI5D 4NKOB 2ITDA 1S78D 2OZ4A 4ODWA 5IB5B 4MLIA 4OD2A 1AXIB 5HD8C 1N3NB 5SWSB 4X99B 2A9NL 3LKQB 5CINL 3MODH 2OP4H 3VI3E 3RZCB 3E6FA 5C0BE 4MAYC 3RGVA 5AD0B 2NY5C 4LLVA 4ODUB 1PW3A 2ZKHL 3LQZB 1P2CB 3R06A 4WGWB 1A6WH 5MENE 3SCMD 3UJIH 1EBPA 4R0LA 3V95A 2FB4H 4P2OB 4NQEA 5B8CB 2VJXA 5LCVL 4TSBL 2WSKA 4GAGL 1IC5L 3GI8H 4PRAB 3TC9A 5KSAC 43CAB 3U9PH 1T89A 3U79A 1CICC 5CD3B 2ZUSA 1AGFB 2HLFD 4Z7VB 4ZUUA 5DJZB 1JNNL 2C5DC 3EFDL 4LQFL 1OT2A 4PGDA 4CMMB 5L7XL 4YAQB 3OAZH 2AEQH 3VXRE 3WFEH 5C0IA 2HTKC 5HGHB 2DL9A 3HE7C 3HC3H 5HYJE 3T3PE 5D4QA 5DD5L 3SE8L 5EU4B 1XGPA 3LZFL 3GJFB 1TVHB 2AJSH 4M5ZL 4KZEL 4YHOH 3C6LD 1U91B 1U8PA 1BFOB 5D72L 5IJVB 1FAIH 3RTQC 5L8LB 1AR2A 2NY7H 1CGUA 4GG8B 3GMQA 1I7UA 4ISVA 2ZPKH 2JELL 3OAUH 4I48B 1ZLSL 3VI3F 2R2EB 2AJVL 2DQIH 5K9OA 1A14H 3MRFA 2YPLD 4WTWA 4KAQH 4DZ8A 5C0NC 2GCYB 5ANME 4LMQI 3IDNA 2CLRB 3MRMB 3VFMB 3WEXA 4LVEA 5I1DB 4U3XA 5I8KL 1OTTC 4XX1E 3DMMA 1S9WB 5IVXE 1YN6B 4P4RA 3O6KL 4X6DB 5F7LB 1MJJA 4L4TA 1DP0A 5E2UH 5KANI 5IEKB 4BELD 2F53B 3Q6FB 3H8NA 1F3JA 4FQXC 1J0ZA 1FZJB