1WZ1L

Crystal structure of the fv fragment complexed with dansyl-lysine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig light chain
publication title Conformational dynamics of complementarity-determining region H3 of an anti-dansyl Fv fragment in the presence of its hapten
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wz1L00
3ARSA 4LSRH 4KI5F 1MOEA 2AQ2A 3MROB 4Z7NF 2OZ4L 4LU5L 4ZNEE 3RUGB 5D72L 2B1AH 4OGXH 3CUPA 1I1FA 5KSBF 5I1EL 4JZNA 3F62A 3BKCH 3LRSB 3WHXB 5BJTA 3FFDB 2AK4E 3RWEA 4PGDB 3VGAB 1NUGA 4L3CA 3IDYC 4UV7L 5DK2B 1G7LA 3QFJD 3HI6H 5ESAB 3P4OA 4H1LG 4LCWB 2FIKA 3GSOB 2I27N 3WHE0 4BK5A 3KXFA 3WLBB 4RGND 2IAND 5JDJA 3SDYL 3T0EC 4AT6B 4E41E 4XWGL 5F7LB 3HR5A 3CIQA 5E8DL 1HH9A 3TBTA 4K9EH 4LEXH 2PXYD 3RUGE 4FQ1L 1A64A 4FXLA 3CX2A 1EGJA 1KCLA 1U92A 3QUZA 3V9FA 4N90E 1JFQH 1A1OA 2AXFB 1SHMA 4PJHF 5T1LD 1AGBA 3PWVB 5D6DA 5F7HA 2AEPH 2HFFA 5L9DH 2AXFA 2FGZA 4G7YL 5F3HA 4UAOB 1IM3B 4LARH 1CICD 3ARYA 4ZAKB 3D18A 1A22B 3WNOA 1SMOA 1TCMA 4G6AC 4R2GB 5JTWA 1GC1C 3KYNA 4LCWE 3BN9D 4XPAH 3HZMB 1EHLH 1WGOA 3VD7A 1R5IA 5L8JB 3C08H 5I6XB 5HHPA 2FATL 3IDXL 5I9QB 4HS8L 4X9GA 1FNSL 1GAFL 2VQUA 3GSVA 3LKRA 2EE9A 3LRGA 1WFOA 4GKNB 3ZTJG 3U30B 2VXSH 3V0AC 4JJHA 3VXOA 3DVIA 1DR9A 4YDJB 3WFDL 4AIOA 2CIKB 2XZQH 3MR9B 2FHCA 4O2FA 5EH1A 3F7VA 4OCWL 3RVVC 2H6PA 2HVJA 5DMGC 5C1MB 4GLRH 1BVLB 3DYPA 3T1FA 4YQXL 1BBJB 1G9NC 3CDFA 3G9VA 3BZ4A 4Y88A 2HT3D 4GAFB 1BZ9A 5GZNC 1YNTB 5B3JE 2X4OB 2OQJB 4A6YL 2WIMA 3TC9A 2C3XA 3IDNA 4M1CC 4NKQB 4Z6AT 4LNRB 1NJ9B 2DWEB 2GY5A 4R7DB 2QL1A 3KHQA 2W9DL 4D94A 2EDDA 3SDAC 1A7NH 3FT3A 1TJIH 4O02L 3AC0A 4JGUA 1R5VB 4CNIB 3U7YH 3G5VB 3EFFA 3LS5H 5JW4M 1EFXA 4KTDL 5DMKB 5E2VL 2ZP0T 4LKCA 1DVFA 4NUGH 1KNOA 1F13A 5EU3A 3C5SB 2VIRB 1INQB 2BERA 2APVA 2BNQD 4AEHL 1Q9WB 2XQBL 2VIRA 3NACL 2DQDH 4JKLA 2ZUUA 4L3ED 3RVTD 4M7LT 4HC1L 2EDTA 1AHWB 1FE8L 1Q0YH 4RFOH 3TEUA 3GBNH 1UXSA 5E8EA 4G9DA 1N26A 1FH5H 1GGCL 4R90H 4YDVB 3ZT7A 3IDGB 5TE6L 5E94A 4KI5C 4IOSD 1A9EA 4GXVH 5C0JB 5E6ZA 2XZCH 2MFNA 1FPTL 1MFDH 4OV5B 1T6WA 5E6ID 4UBDD 1MIML 4QGYA 5IB4B 1M7XA 1I3GL 2F5AL 1LWRA 1DQJB 3LMJH 1YN6B 2GT9A 1CGWA 1NEZG 5D96B 1YECL 4LIQH 4AH2A 5FK9A 3B2VL 4H88L 4DUXA 4OAWB 5I19H 5J9PA 5KZCD 3P73A 5BOPA 3D0VA 3TA3C 3RGVD 1EO5A 5E5MB 5SWQA 3L3KA 3O3DA 5GPRA 4LAQH 5CJXA 3MGOB 5F89B 1SBSH 4ONGH 4HFUL 3NBNA 4PD4J 4J3XA 4KMTH 1GOFA 4XXCC 3F7RA 5F88B 3R8BB 5EPMB 1V3JA 3O9WC 3IS0X 2ZOKA 3ILQC 4F7TB 1ZA6B 3EIFA 1EMTH 3GNML 4NQCB 1YEIL 4PLOB 5I17B 4L1DA 3NIGE 5JHDD 5ANMB 4M93B 1F45A 1C5CL 1FCGA 3N1FC 4YHZH 3L5XH 4L8CB 4LHJB 2XFXA 2EDHA 1AD0A 3FB8A 2VB5A 4PUBL 1NBQA 2NY7H 2BC4B 2RQ8A 4U3XA 4LHUD 4WTWA 3P0VL 1OY3B 4KKCC 2DMCA 3CXHJ 3IDMB 3JV4B 5FUOL 4I18C 4Y5XA 1KUMA 1NCBH 1RULL 3IDMA 4WCYL 4DFHA 1FBIH 3AXLB 2J5LC 4R96A 2VDNL 3VXTB 43C9B 3R0NA 4ZFGL 3VWJA 5ICXB 1M71B 4ZXBC 4OFYA 5IQ9B 4ZPTB 4NQCE 1KLUA 4S1RH 1UWGL 3C2AH 5ANME 3FRUB 1RZFH 3KYMA 1FZOB 3PXHA 4JQVC 4PRIA 2DMBA 2X70A 4UUJA 1MUJA 2I60H 3GM0A 4O5LH 4AY0A 4LK4A 5FGBA 4KGLA 1KEML 4Z7UF 3ZE1F 5BS0A 2BJML 4BKLB 1S78D 3PGDB 3VRJA 1MCBA 3OJDB 3ZKXC 4UIKL 3O8XD 2FR4B 1XZ0A 3BPCA 3WNPA 1MI5A 2VAJA 4KC3B 1JGLH 4YZFF 2EIBA 4KKAC 4F7EB 1JRHL 4PJGA 1EEZB 3FQXB 2WUCL 1KPVB 2P8LA 3KYKL 5A43C 3E6FA 4M62L 1T2QL 3EDFA 3FO0H 4XPFL 1G7PB 4LASH 5IR1B 2YZ1A 5JORB 4PP2A 3FB5A 4K55A 1I85A 1M7IA 3G9AB 2FNBA 3G5ZA 5JHLL 1BF2A 4WO4B 1I75A 1KB5B 2GY7B 3FHAA 1TTGA 4JN1H 1QPPA 1VFBB 3RDTD 4TVPH 1DL7H 2AAVA 2AKRB 3QXWA 3PL6C 1D5MB 4FXKB 4GMTH 3L95A 4QXUL 4WO4A 4PJBF 2L0DA 1MI5E 4WFHE 3JTTA 4UNTA 1MFNA 5CP7B 2OJZL 4UNVA 2W1NA 3G6AA 1CE1L 3I6GA 4ELMA 3STZB 1JWMA 4OM1L 4HUUB 2XXCB 2DLFL 1T5WA 3I02B 1QSEB 3LV3B 5EDXA 3FOLA 1CFBA 4TUKL 1RIVH 3UTZB 4NO0B 4U33A 2X4TB 4LDOB 4ODHH 3LV3A 1NGXA 4MSWA 1PBYA 32C2B 5CINL 4WI5A 3MRBA 1P7QA 3RKDD 2UV3A 1ZLUH 1I3UA 2FX9L 5HI3D 4HWBA 3H9HA 4KV5E 3MPCA 1SYVB 3P11H 2CK2A 1OPGL 1QVOA 2YBRA 3G5YA 4U6YA 4X7FC 1DN0A 4PG2A 1SYVA 1UKTA 4B41A 2Y9RT 5EZLB 3WO4C 2CLZB 3STLB 2HH0H 4IJ3B 3VXMA 3B9KB 5CGTA 4F33A 1UZ8B 1IGJB 4F57H 4G8FB 1OLLA 1QSEE 3SDDB 2V2TB 4JM2C 3VFGL 1RVFH 1J0JA 4U3CA 4OSUL 3PP3K 4RMWA 3H2WA 5LXGL 3QXAA 1IC5H 2XKUA 1JNHA 4BZ1L 3GKWH 3KPNB 4G9FB 1B2WH 4G8IB 1A6UL 4NQEA 3O4LB 4HT1H 3T04D 1WZKA 1C1EH 1HKLH 4PJIA 3D9AL 2ZKHH 1BECA 3H0TB 4QLRA 3TLRA 2VN7A 1QG3A 3O4LA 2VERN 5DEFA 2D7QA 3TT3H 3MRQA 5K9QI 2BRRL 1SJHA 4LNVA 4OCMC 4OZGB 2Z91B 2AJSH 4KUZL 4OT1H 1A6AA 4X6DB 4CU6A 2DBLL 1KPRB 4S10A 3VD9A 5BV7B 3WXWL 2UZIL 4NQDB 2C4FT 2EO1A 1TVHA 1ZV5A 1EZVY 4K71C 3TP4A 4D9QE 4YLQT 2Y36H 5I1HL 2DYPA 2E7CA 1N5YL 3CVHA 1AIFA 2Z8WC 3F7YB 1JZ3A 3RVVD 3LKOB 4C56D 1AXTH 4L9LC 4O9HH 5JPMA 2Y5EA 4HEPG 4R6UA 2Q7YB 4G9FE 3CXHK 1A2YA 5TDNA 3VXUA 3O4LE 2YK1H 2VLRA 1FSKC 1BREA 4XNYL 5DJXB 2CDFB 1QBMH 1KTRL 1II4E 1RJCA 3UPAA 4P3CH 4CVXA 4UT7H 1FDLH 3S36X 4OZGE 4LLYB 1HILA 3KPMA 1M4KA 1HSBA 4DEPB 4FQQB 4BSVA 3HRPA 2W9LA 4X6DE 5FGCB 3B9AA 2H1PL 3WLWD 4NM8H 4NQDE 1VFUA 3RVUD 4YHPA 1ZGLA 4RBPH 5TQ2L 5I1DA 3P9WB 3QHTC 1DUYA 1OT2A 1FORL 3GSXB 4PJ7F 5FXCH 1JWSB 1EFQA 1JTPA 3BX7C 1HXYA 5C0IB 1RUQL 1NFDF 3WKMH 4LLMB 1QLRB 5I76B 5FOBA 4M61B 4CAGA 4YDLC 4LKXA 1JP5A 1E28A 1N8ZB 4P2QD 4Z0BH 3ULUE 3OKKA 3QO1A 4N0UB 2AI0H 3INUH 1FGVL 4J1UB 2I9LB 2CO6B 4MJIB 1R3LA 4OZFA 1IEAB 4H1LH 3QEUB 4J1UA 4JO3H 4Y1AB 2Z9TA 4HWNA 1MCRA 4NRYB 5DMJB 5E95B 5FGCE 3LKSB 5L88L 1UB6A 4Y1AA 4F7PA 5IVZB 3KLHD 1N4XL 3TO4D 3BP6B 2I26N 2IC2A 1FVCA 4R0LC 1BZ7B 1D5ZB 2EXWD 3UZEA 2ADJB 4CGTA 2PW2A 2KDGA 2OBGA 3HE6A 3G08B 4F37K 3MJ7A 2ADJA 4X8JB 1MF2L 5FECA 2X44D 4NZUL 1BBDL 2KQNA 4PJ8C 1N5AA 2X4QB 2NY5L 4M8QB 3O2VH 4N0UE 4PJCF 1GGYA 4W70A 5F9DC 1IQDA 3U1SL 3UTQB 1NC4D 4PRAA 4Z7VB 4MJIE 5E8OB 2NY1C 5IMMA 5GGSY 3NFSH 4Y1AE 4YHNB 3LVEA 2GTWA 4JKPL 1NEUA 5C2UB 4RNRA 1LK3L 3QDHA 3MRJA 3GB7B 5GS0L 5DSCB 2YD2A 3QH3B 3RJQB 5K9QG 5JMRA 3GBMH 3VGGA 5L0QC 2G60H 5C08D 1CYGA 43CAB 3DXAD 1QEWA 1T21A 3MBED 3FT4B 3ZTJH 4JFFB 3DOSA 3MXWH 4F15B 4ZUWB 1YNKH 4KKCD 5B3NA 1VACA 3ARGA 4G8GA 4Y16B 1YDPB 3CVIH 5FO9A 3J8F7 4HX1A 3CSYA 1K2DA 3Q0HA 3WUZA 2KKQA 3O2DL 4AQ1B 2OMBA 4Z7VE 3MLSL 1S5HA 2BVQA 1MJ8H 3E3QC 5KJRL 1FVEB 4JPIA 1I8KB 2F74A 3UYOD 2F19H 4WI7A 3EAKA 1OAQH 4JFOA 1MRDH 1PLGH 3P9LB 1NLBL 3PUCA 4P4KC 3DX7A 3PWJB 5I1CL 4L4VD 3S37H 1YYML 4G43A 1GGBL 3QO0A 3C8KA 3PV7A 5GGSB 1MLCB 3SQOL 2XACC 3C60A 3UPRA 2BXYA 3EHBD 4AMKH 4JFFE 3W9EA 3V5HB 1QLFB 4NKOA 5IHBA 2VZUA 3WJJC 1YEFL 1S7XB 1KYOJ 5BQ7B 2JJVA 1MHHB 2BDNH 5I1KH 4MNGA 2P45B 1N64H 3TJEL 3UROR 3HAEA 3OTTA 4GBXC 2P7TA 4KXZI 4FN0A 1INDL 1Y6MR 4RRPA 1W72A 5TFSL 1FYTA 3ZL4L 3TN0C 1QNZH 5DRWA 5EUOA 1NMCC 1LMKA 3E8UL 3QDGD 4LF3A 4HPOH 4WNQB 3ECBB 4ZOAA 1G7MB 2V7HB 5EORL 4DGYH 3KPRA 4KZEH 2IPUG 4JZJC 1XIWB 4WNQA 3B9EA 2V7HA 5DEGB 4MQSB 1A0QH 5BRZD 1I9RH 5HYFA 4HD9A 2D0FA 2MHAB 3T4YB 1A02N 1D5XB 1NBZB 3ZSSA 1ZS8A 3AREB 4K3HA 5TDOB 4J3VA 5IMLA 1OWRM 1MJJA 1WJ3A 2IPTL 1CG9B 4I0PC 3NCFB 2AS5M 4J4PA 3EOBA 2VUOA 1EJ6A 2AQ1A 4I4WB 4HUVA 1F3DJ 5ALBH 1OSZA 1YEHL 3BT2H 4UDUB 1RHFA 1UM5H 5DRZA 2G9HB 2EDBA 3ES6A 3GHEL 3G6JF 3EYFB 4D0DB 1KB5H 4YHIB 4J3SA 3RAJL 3DX6B 2XTJB 4X6BA 3CLEH 4EI5B 4OGYH 2YN5A 1KB9J 4HKZA 1T7VA 2Y1VA 3SE8H 2W9EL 3DETC 5CJBA 4OI8A 4PRBB 1N2RA 1OAUL 3BPNB 5DWUH 3UDWC 1JGEA 4PRPB 2NY2D 2XG4A 1D6VH 4KVCL 4P0DA 4Z77B 3DX9A 3VFVA 3SGKC 2J3SA 1T1WA 3BQUD 2OTUB 1BX2B 2VWEE 4NOFA 4YAQB 3MV8A 4O58H 3BJ91 4GW1B 3GMRA 3OKDA 5D9SA 3MLWL 2MQ0A 4RBPK 3RZCA 5GS1A 3MMEA 4MQTB 4ZPVB 1T0MB 2YPKB 4YUEH 4QHKI 2E6QA 2QSCH 4MAYC 4PJXB 4TSCH 2XTJE 5LBSL 5H2BB 4QWWD 5FGSA 1T0MA 5FM4A 3BKJL 3Q5OA 2YD4A 4POZD 2C3VB 4U6HA 4N0FB 2FL5B 1GHFH 3B6SB 3MREA 4NHCL 3QUKA 4G42B 4B7IA 1UXWB 4K23H 4Y4FB 3ULVE 3CDGB 2AEIT 3MRGB 3SO3B 4PRPE 5IHZB 5DD0L 2I5YH 5H35A 3BEWB 1A3RL 4HGWB 4LSRL 1GYAA 2GK0A 4BQ6A 3BPLC 3SJVD 5CHNB 1AO7B 1OGAD 4E5XA 3V2AR 2UZYB 2B1AL 2X89D 2WLYA 2OS7A 4OGXL 5JPNA 4WTXA 1XGYH 3MV9D 3BKCL 1VCAA 1WBZA 5TE4H 3GMMA 3O81A 4PJXE 4PGEA 1P7KB 4W6YB 4O2CA 4LPYA 4Y4HB 2ENYA 4QOKA 5C0EB 4FFWC 2K1MA 5BV7H 3QJFB 3HI6L 4JO4H 3LEYH 2GI7A 1KBGH 5FYJH 1YMMB 3S4SG 4ZYKA 2ATKB 2X5PA 2WAHA 1ADQH 4Y5YC 3DSNA 3IVKB 2DQFB 1AO7E 3Q3GB 4K9EL 4TTDC 4IS6A 3VFWA 5IGXH 2WV3A 1FN4B 3Q3GA 1PZ5A 1JFQL 3VXRA 2N1KA 3MUZ1 4PGCB 3ULUH 1LNUB 3RU8H 2DTMH 4RGOH 4NKMA 2FRGP 2AEPL 4NFDA 3BGMA 1INEH 5L9DL 4PGCA 3T08A 1TQCC 1UJ3A 4LARL 1D9KB 2PYEB 4L8SA 1DBAH 3KJ6H 5C09D 3MBXL 4MLSA 5BCAA 3PDGA 3DV4B 2X7LB 4XPAL 1XGRB 3T0VA 4P57B 1EHLL 1RZIA 1JHLH 1RQ5A 1F02I 2HJFB 1O5DT 3RWCB 1KACB 2Q7NA 1CFVH 5MP6H 2ZCKL 1E0OB 5D1ZC 3MRDB 2GQHA 1I7TB 1K5NA 4Z7OF 3KLDA 2NY4C 4R9HA 3F7PC 4W81A 3T0AA 1I7TA 2C7UB 2XZQL 4X7TA 2XKNB 1HCFX 4GKSA 4CVZB 2PYEE 2XKNA 4XWOD 4JRXA 1ZE3C 5SX4I 4XPHH 1S9XA 2WQRA 2YUWA 3QIBD 4X6CF 1GZPA 4X4YA 2QHLA 5I8EA 5KVDH 3EO0A 2VISB 5IT2H 3WNNA 1L0QA 3T0DA 5DQ9A 1PX3A 1W0VB 5FCSH 1A9BB 2C3GA 4H0HB 5M7QA 3S9DB 1A7NL 1J1XH 1KXTB 4LCUA 3UBXA 4WWID 1Q0XH 4MXQD 1TJIL 5IBUG 3U7YL 3QI9A 1GPOH 3LS5L 3MJ9H 1EAPA 3HZVB 4XGZA 1N0LA 4MJ6A 5E5UB 4JREC 2FEDD 4AIZA 3SEPA 4NUGL 2H8PA 3N1GC 1ZVSB 2GJ6D 3HZVA 4U1IB 4K3GA 1D6EB 3SCMC 1U8IA 4IRJC 3QUXB 2DQDL 3SO5A 2DLHA 1DFBH 3T3PE 4PJAA 2VE6A 4PJ5B 1Q0YL 4RFOL 5DZLA 3GBNL 5DJ2A 4HXAL 1FH5L 4J3UA 4WFFD 4OUUB 5J1AB 4JPKH 5EO9A 4X6EA 2R1XA 1FC1A 3U2SA 4YXHH 1R3KA 4KFZC 2NTSP 2F54B 1OF2A 1M1SA 4GXVL 2XZCL 3W81A 1QOKA 2VDLH 1MFDL 5DQDH 3MCKB 1OAZH 3LQZA 2F54A 3KPSB 1U93B 2XWJA 2R9HD 3LMJL 3JTSB 3OX8B 3K4AA 3KPSA 3LSOA 4YWGH 3F6LA 1UH2A 4LIQL 2Y23A 2ILLA 1FIGH 3PIQB 5DUMH 5I19L 3BP7B 5DI8B 4BK4A 3KPPB 2XIDA 4LCCA 1Q38A 3PDDA 3CFCH 2FJGA 3PWNB 5J7CC 2K9UA 3S3PA 2VSCA 3LDBB 4LAQL 2ZG3A 4PJ5E 5E1HB 4ONGL 1T0PB 3QIUC 4KMTL 4DUVA 2GSIB 2PTTB 5BVPL 2Q3ZA 5IBUB 1HDMB 4FP8H 4TVSa 4K3DH 1EMTL 4KKBC 2F54E 4XMKH 2BSTA 5BXFA 3BH8B 2P24A 5IIEA 3C8HA 4I0KA 4YHZL 3KPSE 1U8PB 1J1PH 3BO8A 3BVNB 3L5XL 1IGTB 3MRRB 4WENB 3BWAB 5ICYA 1FNEB 2NY7L 5A40E 2JCCA 1KIRB 3AB0B 1U3HD 1S7TB 3KDMA 5EU5B 5GHWH 4WJ5B 1NCBL 3H3PH 1MRCH 4H5SB 1FBIL 4X7DC 1DANU 4XNUH 4Z7WA 3UTSD 1DBJH 1A8JH 2R0KL 4OFVA 3T8XB 4X6FB 4HKBA 2CDGA 3BDBA 1GGIH 4S1RL 1QRNB 1RZFL 4PTTB 4MJ5A 4BYHA 4QRRD 4Z9KB 4E9LA 2LU3A 2I60L 1T7YA 3IRZA 4O5LL 1KIQA 3LPFA 3QP3A 3W2DH 3MLTB 4NYLA 3RNQA 5TH2B 4IDLA 1BWMA 3LIZH 1BD2B 3WN5A 4DGIH 5EZJA 4CDGC 3WFEH 4QKXB 4N1EA 3GMLA 4OQTH 1XT5A 3TZVA 4LPTA 1YPZB 4AEIH 3HKFA 4GT7A 5C3TA 1JGLL 4LCYB 2A1WH 3NAAH 4EI6B 5FAAA 3WMSA 1IL1B 2C26A 4LPWA 4IOFD 1AY1H 3GFUA 5ENWA 5F1IA 3N1PC 2OTWB 3HS0A 1RHHB 5HGGS 3X14B 1QRNE 4LASL 3QUZC 4HJ0D 1RHHA 4LGSB 3PQYA 3OR7A 4OZ4B 1H15A 5D6DC 3NCBB 1RZGA 1V7MH 4JN1L 4XCEA 5KVEH 3SBWA 1S7SA 4TVPL 3U0WH 1LD9A 1BD2E 4GMTL 1JI1A 5F3BA 1GJIA 2AK1H 1IAMA 1SVCP 1JIBA 1MCLA 3I9GH 2CDEB 1YPZE 2PW1B 3FQUB 4BSJA 5IW1B 4NWUH 1IM9B 2BOCB 4KK9D 4KRPD 2B4CC 5IHUH 2OLDA 4RGMC 3ULVH 1CFSB 2UZXB 3TPKA 5EU6D 2WNGA 5A3IC 3PQYE 3UAJD 2AP2A 3RX7A 1RIVL 1CXLA 4ODHL 4OGAC 1WFTA 2HLFD 4LP4A 2Y07L 3HG1D 1XCTA 4BZ2H 5DMIH 5E6YA 4GRLA 4CADB 1KF9B 1I1AD 4YFLI 2Y5TA 3P11L 4FTVD 3B83A 4P4RB 5JOPD 1JPST 5EN2B 3MO1A 2HJKB 5I8OH 3MV7B 4LP5A 4WUUB 2YR3A 3TGXA 1CE6B 4WWKB 1QSVA 1T7WA 2HH0L 5D1QB 1MRFH 4LVOB 4F57L 2Q76A 4P2OD 5TPWH 2JB6A 4CRPA 1R24A 1RVFL 3V7MA 4EDXA 1DLHA 3KVQA 3K80A 1IC5L 1T5XA 3GKWL 1B2WL 2DQIH 4NHUA 4HT1L 5IK3A 1OGTB 1C1EL 1QQDA 5E00B 3OG4B 4P99A 2ZKHL 2ZUSA 4LLAA 4Y2DA 1K85A 3MGTA 1DVFC 5J11B 3TT3L 1OGTA 3S96B 4P46D 3MA7B 2YPLA 4X5LA 1T0NB 3WE6B 4H1LA 4L4TD 2Y4SA 1JYXA 2AJSL 2F53B 4OT1L 3T65B 5IP4A 3QIWB 3MV7E 4WUUE 1KTDA 4PYGA 4CVWA 5F96H 4ESKA 4QRTA 4OZHA 4ELMF 5DGQA 2Y36L 4ONOA 2J4WL 4JLRA 5F97E 5C8JA 1HQRA 1AXTL 1PKQB 2R1YA 2V5RA 4XT1C 2Q3AA 1KCUH 4M1DH 3TVMC 1RPQA 4D9LH 2YK1L 4LSVH 3LKQB 1PQZB 1BFVH 2FYYA 4PLKD 4NN7C 4APQD 1AD9A 2XN9A 4P3CL 2V9QA 3EFDH 3TBSA 4UT7L 4F7CA 1FDLL 3NCYS 4Z76B 2F53E 5H94A 1TLKA 2F58H 5F7FA 4QXTB 2WSKA 4YO0B 2VTFA 4Y19B 1RU9H 4XH2A 4NM8L 4U1MA 2M1KA 3TCLA 4U1JA 5CJXC 5T3ZH 4KH2A 1F11A 2QKIA 3MLRH 3QQ4A 4G80B 1FNHA 3WKML 1PKQE 5F7YC 3WFZA 2QV2A 4QHNB 5HGAB 3HZKB 4U1SB 1YQ2A 1H3TA 5HVHB 1I7RA 4WFEE 2FGWL 1OTSD 4E0RA 4Z0BL 1S9VB 2AI0L 2WM0A 3INUL 3RVXD 3UTPD 2NLJB 4YJZL 1HYRC 4XNZB 5DJZB 4Y4KD 4YR6B 1FLRH 1KELH 5GGUB 4JO3L 1DBKH 1ZGLP 3R06B 3MRHA 4TUOA 1EZVX 3NOIA 4RA0C 2XQYK 4Y19E 2R0LH 4WU7B 4EEEA 4XNQB 2N7BA 4ZTOH 3TBWA 2IAMA 4LGRB 4FQHB 1L4IA 2B8OT 5KS9A 3DV6B 1U8QB 4L8BA 1ZGLM 4RZCB 2ADGA 2PKDA 4OIIH 5HDOA 3ARFD 1IGYB 2ESVA 3GMPB 4PY8I 1C12B 1ZLWH 5EIIB 1ZWIB 2H9GB 3HE7A 5B8CB 2BNRD 3TNNA 3GMPA 1F6FB 4NO5B 3NN8A 2H9GA 2BVUA 4KVNH 1LP9A 2P49B 1UJTA 2UYLA 5D2NB 5J1TC 3TBVA 2A6DA 2NXZB 1PAMA 4Z8FH 1WCBB 2E3VA 2D0HA 1X5AA 3KR3H 4FXGA 4ODXA 5FGBC 5D2NA 3HI5H 1EEYA 1Q9KA 2FJHA 4I9WD 4MNHB 5MENB 4S0SD 1LEGB 2V2WA 3NFSL 3RBSA 1NKOA 4JY4B 2YEZA 1UWXH 5MHSE 1MQ8A 1KTLB 4HKXA 2NXYC 1C5DA 4OJFH 4YFDB 3ILPA 5CBEA 4N0CC 5BO1L 1KTLA 1CQYA 4PRNA 5D6CB 1SJEA 3H42H 3QEGH 1QRKA 3GBML 1RJYA 1BPVA 2OM5A 4D0CB 3AFLA 3OQ3B 1U8HA 4PJ9A 1MNUH 3RWGB 2MMXA 1T2JA 3MXWL 1YNKL 3MNWA 1ZT1B 3LS4H 5D2NE 3S5LG 15C8H 4WI6A 1NEZA 1KIPA 2AK4D 3MNZB 4GQPH 3QUYB 4XAKE 2HN7B 4L8DA 5MENE 1MJ8L 3OKLB 3RWJB 4IIQA 4JCLA 4N9GA 4EN3A 1GRWA 2F19L 2NR6C 4ORZC 1KJVB 1LO4H 2IBBA 4TYUA 4XCYB 1PD6A 2EE2A 2WP3T 1OAQL 3PWLA 4E41D 1MRDL 1PLGL 2XA8H 3OPZH 1NQBA 5FO8B 4WGVB 3S37L 2E6PA 3EJZC 2AJ3A 1NGZA 3O6FC 3NIFE 1AGEB 2OSLA 3JBG7 3QZWA 4N90D 5D7JA 1ZK9A 5IB3A 1JNNH 5IB1A 4XTRD 3QJHB 1MVUA 2GITA 1P2CA 2IPUK 5C3LD 2W59A 4URTB 5JXED 3FTGB 3RTQA 4HG4J 5AG9A 2XICA 1NCWH 2IANB 1QA9B 2BDNL 3PV6B 5I1KL 1IAIH 4XI5D 4KJQC 3ZYZA 3VCLB 2V7NB 3VRLE 5IW6B 3M17A 4YK4C 2YUVA 1U8LA 2YUXA 4K3JH 2B0SH 3WL9A 3O6LH 1QNZL 3G6DH 4YHMH 5F6IB 4O51B 4HPOL 5DHVA 5T1LB 3PNWA 4BH7B 4DGYL 5I0DA 1KT2B 4KZEL 3O2WH 3N9GH 1R3HB 5KTEH 1IGMH 3Q6GH 2SEBB 3GMQA 5GSRB 1Y0LB 4PJFB 5ISZB 4JAMA 1FAIH 2VAAA 3L3OB 1A0QL 2YSSA 1I9RL 4NBYB 4XCCH 4P9HH 1T1YA 5KSUB 4UZGA 5ELIA 2Z31A 4ZAKD 5HD8C 2XY1A 3PABA 1XAUA 4R2GD 3H3KA 3IKCA 5JOFA 4U1NA 5TDPB 4ODUB 3RY5A 3NMEA 4MJ2A 5JW5B 4QHKJ 3MYJB 5HHQB 3C5ZB 3CU7A 2CUHA 4KJYB 4LLVB 3OJMB 3MNVA 1LGVA 3OZ9H 4OGAD 1ED3A 4M1GH 1AXIB 4HK0A 4PG9B 1NCTA 5F1NA 4OGZA 4PJFE 5ISZE 1M05A 1A4KA 1WBYA 3BHBA 1IKNA 3BT2L 1PG7X 1QKZH 1H5BB 1NANI 3IT8D 5DO2D 4XNMB 5IEHB 3O3AA 2KZWA 2MJWA 2NY5C 1J8HA 1F5WA 3JV5A 3TF7C 2JIXB 3BI9X 1P4IH 1IVLA 1JBJA 9CGTA 2NMSA 2ZUQB 2C1OA 1RSFA 1OTUC 2WUBH 4EUPG 5J13C 3BOVA 1PFCA 1K8IB 3CLEL 2ZOLB 4OGYL 1Q94A 1RZ8B 5F9JB 2A83B 2EDQA 1RIHH 2WLZA 1OLZA 3DRTA 5GRVK 5SX4H 4JR9H 2DS4A 1K4DA 1D6VL 1F6AB 3C6SA 4ZUSB 1ETZA 2Q6WA 3BDXA 4E42B 5B39A 5IFAH 3VD4A 3MJ6A 2NW2A 5DD1H 3ZKMC 4PTUA 4NNXB 2FSEA 4CW1B 3VFPA 4LHUG 4O58L 4WI4A 2MOVA 3LOWA 4L3EB 2OK0H 3QEQA 4TNWK 3SKJH 5E7BA 1D5BA 1T20A 1ZHLA 5DHYA 5F8RC 4XVTH 4MCYA 4LCIH 5FF6A 4XCNA 4NN5B 1XF2B 4YUEL 3KJ4B 5FM5M 1JHKH 1FL5B 2QSCL 4TSCL 3CFKB 1QFWH 1XGQA 2B1HH 4F9LA 2YA2A 2F9BT 3DMMA 5EO1A 1NAMB 3IXAA 4Q6IB 1FL5A 5C6PB 4MXVE 4O2EA 4OF0A 2DM3A 5ESVB 1GHFL 3VGBA 1BLNA 3VD3A 4K23L 3CSGA 1FL3B 1J12A 4PRDB 1RFDH 2I5YL 3RL1A 1I9IH 5IFHH 3HE6C 4X5WB 2PO6B 1HZHH 1RUPH 3VXSB 2KPNA 1NCDL 3O6MH 3K7UA 1CFQA 1XF4A 3MLVH 4RFNB 4YEFA 3T1WA 4Z78A 4DUWA 5C9JB 1VEPA 2X4SB 1EUTA 1KJMA 1MELA 4FMFA 4EUPB 1Z6JT 3NVQA 5J6GB 3C6LB 1XGYL 3IDIB 5A1AA 5TE4L 4PJDA 3EUUA 1RZKH 3K2MC 5KSVB 5E8NA 5JHDB 2J8OA 4GUPA 3NIDF 5BV7L 3EBAA 35C8H 3LEYL 5HPOA 1U8KB 2X4NA 5EFIB 5FYJL 5JDSB 5LQBH 1HHKA 4NQCD 5D1XA 3L5WA 4ZG1A 4HG4K 1ADQL 1DDHA 4EVNB 2EDEA 3VXSE 4LHUB 5IJKA 3V6OE 3PJSA 4RIRB 2NY6C 5IGXL 1C5BH 1DUZA 3ARGC 1W0WA 3BIBX 4RIRA 2VXTH 5F7EH 4ZUTB 1C08B 4I0CC 3RU8L 2DTML 3QAZC 4RGOL 4KRNA 4DGVH 1INEL 4MYWB 3RGHA 4RFEA 2HLAB 1Z0NA 5DVOA 5IKCB 3GSRB 3HMXH 3VWJD 3BGAA 2J88H 3Q5YA 5JHDE 4JN2B 4D8PB 1DBAL 2VL5B 3L3IA 3U6RB 5IBLD 1WFNA 1WEJL 1PZUB 5ID1B 1OQXA 1JHLL 4PV9A 4C4KO 1FCCA 3P4NB 4GJTB 4TRPH 1CTNA 4Y8DC 4MA7H 1TJGH 1TQBB 2CKBA 1G7JA 1CFVL 1T22B 3EOAB 1HQ4B 3MLYH 3O8XB 1UQSA 3GJEB 3FQNB 1T22A 4I2XA 3IU3B 3TH3T 5FKAB 1MI5D 4WFHD 2MCPH 1BF8A 2OI9C 3IU3A 4PJEF 3M1BB 3K46A 1UZ6F 2IEPA 1MWAB 4MS8C 3M1BA 1NFIA 1X9QA 1XF3B 3LN4A 5I0ZA 5C07A 3V8CA 4XPHL 1TCRB 4H26A 4LVHC 1TZHB 3MSPA 4G6FB 2P44B 3C9NA 3N50A 5DJ0A 5KVDL 2V17L 2DTSA 5IT2L 3GI8H 5KVMC 4OKVB 4G8EB 2XZAH 4GFTB 5FA3A 4EKXA 1CI5A 4PP1D 2VABA 3FOMA 4KKNA 4WO4D 1J1XL 5CSZB 3U7WL 3ARTA 1Q0XL 3DBXB 4D0BA 1EVUA 2X10A 5JW4Q 1N7ML 2NQCA 5DURB 1GPOL 3MJ9L 5DUPH 5C0BB 4OLXH 1A7QH 4JFXA 5AEAA 3VFNB 3NFNB 4H0IA 4Q2ZA 3EOYG 1ORSA 1BQHG 5ADPH 2W91A 1T7XA 1CGXA 3H7LA 4WW1B 1DFBL 4J4PC 1UACH 1UA6H 2GAZB 5FUZH 1AGFB 4NO0D 1P7QD 4QF1A 3TESA 3ZZ1A 1CK0H 1ZLSH 3OAUH 3T0EB 2GW5A 4JPKL 1DE4A 1AR1C 1KGCE 4XXDA 4LOUC 4U6XA 1J05A 2GIYA 2H3NA 4YXHL 2WWMD 2VDLL 5DQDL 3BUTA 1OAZL 3MRPB 2VKWA 5C0BE 2XPGB 4ODWB 3OAZH 1E4KA 3WHE1 3B3IB 2JTDA 3REWA 5ACZB 3UJIH 4WEBL 4YWGL 5INCB 1N6UA 4NDMB 4LEOA 5DUML 4JHAH 2WZPD 4D9QD 1G7IA 2D7OA 3HC0A 3CFCL 4OQTA 5T1KA 1H3GA 1TNNA 1FV1A 5DFVC 1IKFH 4KDTA 1NGWB 2R2EB 1NBYB 4G9FD 3FCTB 3T0EE 1FFOB 1XR9A 2NYYC 1Y18B 3O4LD 1JZ5A 4K7PY 4R3SB 4FP8L 3ZE2E 3D3VA 3MGAA 4K3DL 3BE1H 4K9EC 3MRMA 3DYOA 3U9PH 1WICA 1H8OA 4HGMA 4XMKL 3HLAB 1JF1B 2W60A 1BIIB 5E5RB 3VU2A 4TTGA 1J1PL 3HC3H 1A5FH 4O00A 5C70A 1X7QA 1BQHB 5GS1C 2FBOJ 1YEJH 2OR9H 1A6WH 4UQ2A 4NBZB 2DYPD 3IJYA 2AV7A 1Q9OA 3CPLA 5D4QA 4ETYA 1HSAA 5HHNA 4HDIA 5D7LA 3QXDB 1U91B 3H3PL 1MRCL 4MHHI 4PJAF 1K4CB 1FZKA 4HFWA 3FO9A 3L9RA 3UC0H 1ZSDA 1UB5B 1DBMH 4CUCA 5J6HA 3OV6A 5EC2B 5FDWA 4XNUL 2CIIA 4JANA 3KWWB 4P49A 4UU9B 1UB5A 4BFGA 3KS0H 5T1DH 3BP5A 4ZFZA 3ULUD 4WHTB 3SDAB 1GGIL 1JHTA 3FO2B 2WBJA 3T3ME 12E8H 3FMGH 4JPVL 1S9YB 3GEWB 3CC5A 3W2DL 3DVNA 1KG0A 4OD2A 4J3OC 1IT9H 1KENH 2QBWA 3LIZL 4DGIL 3WFEL 5HVFB 2E9WA 4OQTL 5F93C 4MWFB 3ZDXF 3QHZH 4P2RA 4P2QB 5BZWA 2A1WL 3NAAL 3I84A 4IDJH 4NC1E 4CKVX 1AY1L 5CLWA 3MRIB 3I3DA 2O5YH 3NCMA 4LLDB 4P5MA 3CFJB 3BFOA 1PDKA 1T66C 5IVXB 4P5KA 3S3JA 2VDKH 4MJID 2R0ZH 3I6KB 5IESH 2UVEA 4Y1AD 4GH7B 4XPBH 4ZNCD 1GGUA 4TSAL 2JCCF 1V7ML 5KVEL 5KSBB 3U0WL 2AJYL 1UJ3C 5MERB 3RP1A 1MCHA 3H9SA 4HCRA 5DRXB 1JZ4A 1A6TA 2AK1L 4P2RE 5F9OH 5IF0A 4L8SC 4KQ4H 3I75A 1G9EA 1ES0B 3I9GL 4NQXA 2N56A 1MJUH 1UADC 4P2QE 2DL2A 2DOCA 1CVSC 3TA3B 2A6JA 4P5TA 1QO3A 1PKOA 4NWUL 5IHUL 4Z7WF 1P1ZB 1OTTD 3T2QA 3ULVL 1EJOH 4QHLA 1YZZA 3O9WB 5IVXE 3FB6B 2LTQC 3G04A 2GSGA 4KI5E 4R4NC 4KY1H 2CUMA 5L2KB 4Z7NE 2R1WA 1IBGH 5AD0B 2HYMA 5GSVB 2CR3A 1J0HA 3DUSA 4RAVA 4BZ2L 5KSBE 3SE9L 5DMIL 3BISA 1J0IA 4PLJD 3MBEB 3BH9A 5CIPB 4PJHA 5IM7B 1NAMH 1IAKA 3QQ3B 4I18B 5IB2A 1EHNA 2NY6D 3BZDA 5I8OL 1TZIA 5IM7A 3RNKB 4G8GD 4F2MB 3QQ3A 4JFFD 3HZYA 1XF5A 3PDOB 2J6EA 4FABH 3H6JA 1MRFL 4Y16D 2J5LB 4NSKB 4NQUA 5I74C 5TPWL 4F9PA 4ISVB 4JGJA 4ZXBB 1CDYA 4MX7B 5CGMA 5L2KE 5HYSG 5LGHH 1FLTX 5ECJE 1MH5A 2DQIL 3G5XA 3QI9C 3QUMB 5D7IA 4EUPH 1T04B 5LGKA 2HVKA 2X4UA 4PGZA 3SKMB 3IETA 5CZXC 1WZMA 4M7LH 4JFHE 3OF6A 3PHOB 5FYLE 4BQBA 3C60D 3S4SA 5L7XH 3QA3B 4CMHC 4D9RE 2NNAA 4R26L 3ZKXB 3W5NA 1N6QH 5F96L 4P23A 5JLZA 2D03H 4A2MA 4ACPA 4NGHH 1I4FA 1Q1JL 3EDDA 4LSUH 2G5RA 5CSBA 3BD3A 1ERNA 1WF5A 3UJTH 4XHJC 4MD5A 5IBTH 4AL8H 3EJYD 2FX7H 2AJZB 4PY8J 1YEDB 1NC2A 3RL2A 2OJEB 4YGVB 1KCUL 4M1DL 5IV2B 4D9LL 3VFSB 1F58H 4LSVL 1WC7B 2AV1B 1FZJB 1BFVL 1KLFA 1BJMA 2QJDA 3EFDL 1KFAH 4AM0A 4CL7A 3PL6B 3BP4B 5BRZB 3C5JB 5DJDB 2PUQT 1XIWD 2DMKA 1UWEH 4LCCC 3PGCA 5B3JF 4WU5B 1AP2A 4GKZA 4I13B 3BZEA 3PWUB 5EOCH 4NUJA 3DURA 5T3ZL 4NN6C 1OAKH 3OAZK 4NO3B 5HYSB 3MLRL 4I8DA 4U4BA 3B2UC 4HUXB 3DO7A 5SWSA 2HT4C 2PCPB 5KANG 5TF1L 3FAWA 2IH3B 1HHJB 4FG6D 2HKHH 4JFEA 5I1LB 3NGBC 1CFNA 4M9PA 2CRMA 5E2JA 1KELL 4QTIH 4GRMB 3BSZH 4G6ML 2EYRA 1DBKL 1MWAH 5BRZE 5KSAA 2YD7A 3DECA 3GMOB 3AU1B 2R0LL 1GL4B 4ZTOL 4OZHF 1LK2B 4KROC 4AQOA 1FJ1A 4NP4H 5K9OA 4NNYA 4NQSB 3TYFA 1LK2A 2P5EA 3MJGX 3FZUD 1MFBH 3AROA 4NKIH 4OIIL 5JZ7C 4CBPA 1OAXH 1T83A 4WDIB 5CWSB 3SY0A 4JM2B 1G9ML 1G0YR 3ZYIA 1MCSA 4Z8FL 4GG8B 5HHOA 2XTJD 3KR3L 3B9DA 1I8MA 3HI5L 1I9JH 3KPQB 1I1YA 1HK6A 4OLZH 4DKFL 4NKDB 3UTTA 5IG7A 3ULVD 2EKSA 4PRPD 4OJFL 5DYOA 5GGVY 3SQBA 5CEXA 1H8NA 3TZVC 3H42L 3MV8D 3RI5K 1MCNA 1YY9C 3QEGL 3WS3B 5GGRA 4X4ZA 2D7NA 2YD8A 3ARDA 4K71B 1CXIA 4JJ5A 4S1QH 1WQVT 3RZCD 3LD8C 3T2OA 3WS3A 3H3BC 1ZKAA 1MNUL 1PW3A 4NRXB 4PGBA 4FZEL 4L9LB 2B2XL 3S7GA 3LS4L 1BP3B 15C8L 4QXGH 5IEKA 4FQXA 3S35H 2IG2H 4KGJA 4TULL 1FSKB 3SBWC 3V5KA 1CFTB 4OB5H 5CD5D 5HTSA 4Y4FD 4Z7UB 3OHXB 1LO4L 3BW9A 3P77B 2L7JA 5KS9F 2XA8L 3VFOA 3OPZL 4LAJH 5ERWA 2V9TA 4RDQG 5HGBB 1UVQB 1G6RA 2DLEA 1AO7D 1RUMH 3JVGA 4HMCA 2R2HA 5GZOC 4HBCH 5AZEL 5HGBA 4U0RC 1AXSA 1JNNL 1LP9F 2FIRT 4YDLB 3MUY1 1GOHA 4KQ3H 4N1HB 4TOYH 1VFAB 4JG1H 4RISH 4Y4HD 3N1QC 5CSGA 1IAIL 1F8TH 1JF6A 4JY6A 2A73A 3MRCA 2ZSVA 4GRLC 4GW4B 4Z7UE 1X5YA 3ZE1E 3CH8A 4UT6H 1BGXH 4QRSA 2OL3B 4K3JL 3NZ8B 2B0SL 3O6LL 3IJSA 1G9NH 3G6DL 3SE4C 3LEVH 5C71A 1CLCA 3FB7B 1BOGA 3EKCA 3D69B 4R0LB 3VXRD 4PJBA 3O2WL 3N9GL 2H2SC 4ZOEA 4YZFE 5KTEL 1IGML 2GTZA 3Q6GL 1K3IA 2ED8A 8FABA 1RZ7H 1Z9OA 1FAIL 3WIHH 3IXTA 5IJVA 4XCCL 4P9MH 4PJ8B 4P9HL 5DJ6B 3ALXA 4AG4H 1D9KD 3JWOH 4DZBB 5DFTA 3WSQH 4Y2DC 3U46B 3CFBB 4DW2H 4RAUA 2HFGH 2EYSB 2DM4A 2NY1B 3U0TB 4U1KB 2COQA 4JM4H 4P3DA 4OKDA 2PN5A 3HMWH 1HEZB 4QXWA 3WNMA 4EOWH 5JA8B 4KMLB 3QNZA 4PPTA 4MDJA 4P59H 3OZ9L 4JFDB 4M1GL 2X4RA 2ICWI 2O61A 3DUHA 1RJLB 5E7FA 1G7QB 5L0QB 1C16B 3L6FA 2WBWB 3OXRA 5JO5A 5H8DA 1ITCA 2CSPA 5KG9A 3BPOC 3RPIB 1QKZL 4X4ME 4HIHA 2EO9A 1WZLA 2GJZB 1P4IL 3KPLA 3RPIA 5JW4R 3QIBB 4F3FB 2XWBA 3DIFB 4KV5F 5HPMA 5DVNA 3QULB 5F1OB 3REVB 4ZOCA 3MUGA 2CRYA 2JLLA 2AEWA 1CL7H 5DS8B 4QYOB 5I8CB 2VXUH 3GGWB 2A77H 4IOIA 3QCTH 4XMLH 4QY8A 1RIHL 1KJ3L 4JFDE 3L7EB 4P4KB 4ZMAT 3EYQC 3X12B 4DCQB 5HY9A 1KLGB 2QSTA 5IFAL 1EPFA 1T89A 3EJJX 3B43A 4K8RC 4HAFA 5DD1L 2P8MB 4RAHA 2QADC 3FQWA 5C0DA 2E7HA 3SDCA 3HI1A 3TBYB 2WINA 2AXGA 5C86A 2OK0L 3SKJL 3RVWD 1AGCA 1JWUA 3E3QE 5MEQA 4LCIL 3FFCB 3VE0B 4JKKA 5DUBB 1JHKL 3P4MA 3WIIH 3GSNA 1QFWL 2B1HL 4C59B 5CIPH 3VE0A 3MRLB 4GBXB 2AVGA 3FT2B 4XBGA 2FO4A 4ZDHB 3F58L 2D31B 5C0FA 1LE5A 1YEEH 2IAMC 3PWPA 3TN0B 1J0YA 5E1AA 1B0GB 1NMCB 1H3XA 2RFXB 2F54D 1RV6X 1JTOA 1XH3B 2R4RH 4RWYH 5F7KC 3QDJA 1RFDL 1XR8A 4HZLB 4JRYB 5CEZD 4LBEB 1I9IL 4JZJB 5IFHL 5JA9A 4LHQB 4Z0XA 2DD8H 2N4IA 3I6LE 1HZHL 3VI4E 3KPSD 3O3BA 7FABH 3RRQA 3WDJA 3O6ML 4XPGH 3FAXA 3MLVL 4PREA 1ZA3B 4M93C 5FA4A 4PJ7A 1BFOA 1EXUB 3QUMH 4DJMA 1NFDA 4OF7A 1NGYB 3N85H 3FFCE 2XRAH 1A3QA 2Z92B 4MA1C 4EDWL 1X6LA 1RZKL 2LU7A 1OB1A 3WFBH 1B4JH 3PWPE 1NAKH 5ITBH 4KDVA 4V1DA 5C0AB 3D85B 4IRSA 2BVTA 1EAJA 4JO1H 35C8L 5ID0B 1KN2H 5LQBL 4I0PB 1KJ2B 1IJ9A 2WK2A 5GS3A 2ZUYA 1QFOA 3IDUA 3SKNB 4JRYE 3VXNA 1KJ2A 3V6ZB 4XBPB 1J5OH 5CZVH 1T03L 4PJ9C 3VXQB 4QRUB 1MFAL 2BMKA 1C5BL 1UYWH 3VH8G 2EC8A 2X05A 3MTRA 3STBA 2IH1B 2G5BB 2W65A 2NW3B 4LDLB 2VXTL 5F7EL 5DRNA 4QNPF 1JUFB 3D39A 1YJDC 3IFPA 4DGVL 5FKPB 4IIQC 3OJVC 3GSNL 4EN3C 1IGFH 2BSRB 5GJTL 5GRWA 2J88L 5C0AE 4PJCA 3WUWA 1NL0H 1SY6H 2BSRA 2FBJH 4QRRB 3ELAT 2APBA 4S2SB 4WTZA 3T77A 2O5XH 1MAJA 5DJAA 4TRPL 2E9BA 5D7JC 4MA7L 5HJ3B 1TJGL 3HPJA 3MJ8B 5EBMA 1FO0H 2NZ9D 5E56A 2X4PA 3X13B 4GAYB 2C4XA 2GFBA 4HV8B 1BD2D 3RTQC 3TZVD 5HI4C 2MCPL 2B7DT 4PJDF 2I9TB 5SX5K 4WW2F 1ULVA 4N8VB 4FFVC 3VMNA 4DK3A 5SWZA 1LE9B 3ARVA 4QRRE 1ZHNA 4MAYA 3PE9A 1IE5A 4YHKH 1SMAA 4OQ1A 5CJ5A 5T3XE 3PQYD 4WV1A 3VH8B 3GI8L 2PR4H 3OBAA 1YN7B 2ICES 1JGUH 2XZAL 1YC8A 1KN4L 1HHIB 1JPFA 3MLZL 4HUKB 1YQVH 3BPLB 4L29B 2DKMA 2ICWA 2HTKC 4QRPB 3QFJA 4HH8A 1Q72H 2Z31C 2VXQH 3MOAH 2YRLA 3PF2A 5DUPL 4OLXL 4Z7VF 4KAQH 3UP1A 2YWZA 3I3BA 3DX8A 3QFDA 3LQAH 1TVDA 5FV1L 1PX4A 2RB8A 1OP9A 2BCKB 1I3VA 1XGTA 2PXYA 5ADPL 4LLUA 3QB7C 3JV6B 2HG5A 1YUHB 5H37G 4CMMA 1UACL 3M8OH 4HS6B 5F1SA 1PY9A 1H0DA 1CK0L 1ZLSL 3OAUL 4Y5YB 3S5LA 1CICA 5B38G 2H32H 2P8PA 1IKNC 2O5ZH 4U1LB 1WAAE 4QRPE 5HGHA 5D70H 1A47A 4N9OB 4TNVK 2A9MH 2V2XA 4MD0A 5ETUA 3WD5H 3MV7D 4WUUD 4J8RB 5K9KA 3AS0A 3HNVH 1YEKH 4KHTH 4WUKL 2VR9A 1TQCB 2W07A 5D5MF 2FJFA 5D1QD 4J8RA 2DLIA 4JHAL 3AMLA 2DQTH 3BMVA 2AERT 5BV7C 2Q86A 5FYKE 1IKFL 1N59B 1BVKA 3QWRD 2EIDA 4G3YH 3SDXB 1FFPA 4IBLT 4P46B 3TNMA 5HBBA 3QQ9C 4HEME 1CDIA 5EO0A 2XYCA 4LLQA 3EO1B 1U58B 2YPLD 3OKEB 3BE1L 4HWEH 4NZTH 3U9PL 1HOCA 1LO5A 5D1ZB 2BP3A 4PV8B 5IWLC 3HC3L 1A5FL 4HUWB 4TUJB 5TGBB 3MRFB 1BQSA 2D3VA 2NY4B 4UIMA 4XCFH 1CT8A 2AEQH 3WJLA 3G6JB 4BH8A 3AM8C 1YEJL 2OR9L 4M3KB 1A6WL 5MEPA 2LQRA 5INDB 2NY3D 2NZIA 4ZFOB 2VLJA 4F9LC 4HIIB 1WIPA 3P4LA 3DMMC 2DQEH 1HHGB 2ZNWA 4X5XA 5C0GA 5K9JL 1Q9LA 4PLNC 3MRNB 5B38B 1HHGA 1ZHKB 3QPQC 3HB3D 4YIQB 3UC0L 3SDXE 2J8UA 1DBML 2G75B 2HTLC 4NOBA 4R8WL 4HIJA 4WFED 5T1DL 4P3WA 1I7ZB 3DRQB 5T33H 1AGDB 2M26A 2BNQA 2LABA 3VXPB 5AAWA 3FQTB 1IEBA 4NCDA 3OGCA 5IOPA 3FMGL 2Y7QA 3HC4H 1JV5B 3QDMB 4HQQL 2D2OA 4Y19D 3V8OA 2BNUA 3VA2C 3G6JE 1YA5A 2E8ZA 3GSUB 4JREB 1UGNA 1IT9L 1U8JA 1KENL 4MA3B 3O11A 5HDLA 4WW2C 2DIJA 4IMLB 4C55A 2FWOB 1B0RB 5HHMB 3QNYA 3HPLA 1YMHA 4YXKH 2Q8AH 3N1MC 3SCMB 4X80H 4IRJB 3QHZL 5E6IA 3WFHB 4K7PX 5D1XC 4JFPA 2HJLB 4XZUA 4I5BA 1RZJC 2HT2C 2O5YL 1HWGB 2BSSA 1S7VA 3MX0A 3V6FA 2H26B 3BD4A 5DFWH 4G7VH 4G6KH 2P5WA 2VDKL 4YDKH 3BRDA 5IB5A 5IESL 2G2RB 2ITCB 4K2UH 3RGVA 4XPBL 2IAMD 1PGRB 2RIKA 3QDME 5MHSD 2OZ4A 3BXNB 3W0WB 1TVBA 4HWZB 4I1NB 3IF1A 4XP9H 5I18H 2R8SH 3U36B 4MDIB 1CDJA 1QSZA 5T1MA 3NPZB 2H41A 2BNRB 8CGTA 5F9OL 5HHME 4G6JH 4KQ4L 1T80A 3NTCH 1MHEA 3HE7D 3DROB 5I30H 1CD1A 1MJUL 1PY4A 3QNXB 1BOYA 3GM8A 3ULVF 2Z93B 4JZOA 4LSPH 4C57C 1FZMB 1EJOL 2W38A 5GQBA 1S7QA 2NXZD 2P5WE 3T4AA 1VERA 3VJ6A 4NC2B 4XAKD 2EE6A 1HIMH 1AQDA 3QIUA 4EXKA 5FB8B 5MEND 1BAFL 1MLBA 4KY1L 4M6MH 5E9DB 1IBGL 5C0ND 3W0WE 4M4RA 2EDWA 3V0VA 4OCNC 3LB6C 4HHAB 4XRCA 2NTFA 2BNRE 3RWDA 2APFA 3O45B 1QR1A 4HHAA 1NAML 2GKIA 3VD5A 5LWYH 5DDHB 1JRHI 1OVZA 4JPWL 4FABL 1DQQB 1R5WB 4R97C 3E2HB 5F7MC 3L3DB 5EBLA 4H25A 3KNBA 3O41B 3QUYD 4J23A 2RR3A 4G5ZH 3ESUF 5E9DE 5LGHL 1CN4A 1N3NA 3CUPB 3AGVA 5BOZG 1I1FB 3RY6C 1DP0A 3EDKA 4EBQH 3IRPX 3GSWA 5CCKH 4ZS6D 4JZNB 5GIRA 4C54A 3EZJB 1A14L 5BJTB 1I7UA 5D7JD 3RWEB 5L7XL 3UYRH 2P4AB 4YE4H 4L3CB 3TPUA 1EBPA 2C3HA 1N6QL 1G7LB 2D03L 5ADOH 3P4OB 4NGHL 2FIKB 1BMGA 3RTQD 5HI4D 3KXFB 4LSUL 1MQKH 3RDTA 3H8NA 4CU7A 3UJTL 4UDTA 5IBTL 3VMOA 4AL8L 3DVGA 2FX7L 3HR5B 4ZO8A 3WEXA 3BYYA 4A6YA 1HH9B 3TBTB 4X6CA 4FFVD 3BZFA 3R0MA 2M2DA 4S1DD 4ODVH 4MQXD 2PTUA 3QUZB 1U92B 1F58L 2O26U 3F5WA 1A1OB 1E4KC 1AGBB 3S36H 4M03A 3AREC 2HFFB 1KFAL 2EZ0D 5F3HB 4PY7A 5C0RH 1UWEL 3D18B 4TNWF 1DLFH 4AJ0A 5ISZD 3KYNB 4OZIA 5EOCL 4XP6H 3KXFE 2NY0C 4KDTC 1OAKL 2Z31D 1R5IB 2DN7A 1ZHBA 1BQLH 4ZFFA 3V7AG 4W4NA 4HC1A 3IFOA 4JFZH 4OLUH 3X3FH 5HHPB 3MCLH 1KEGH 4TN9A 3U9UA 5D7IF 3GSVB 3LKRB 4MMZC 2HKHL 3C5ZD 5DXWA 2XY2A 3VXOB 2X9WA 2BZDA 4RSVA 1EO7A 4YBLC 4O2FB 4QTIL 1MPAH 3F7VB 3BSZL 2H6PB 3TCXA 2HVJB 1MWAL 5ITFA 4DN4H 3T1FB 4EI5C 2VO5A 5BVJB 3BZ4B 1BZ9B 3PP3H 1FAKT 1IC1A 4NP4L 5SV4A 3T3PF 1DEEA 5BVJA 1MFBL 4NKIL 1H8SA 3GIZH 3IDNB 2P48B 3DJ9A 2P46B 1G84A 2JIXD 1OAXL 1T1ZA 3ZHLA 3S88H 2RBLA 2IADA 4N8CH 1YY8A 3GIVA 4S11A 3FT3B 2WBJC 3E0GA 1MFEH 2XT1B 4YNYA 4NT6A 3EOTH 1WBXA 1CZ8H 4N5EC 3EFFB 1BFTA 2YN3A 1I9JL 1EFXB 4XP1H 3L7FB 4U1GC 4DQOH 4LKCB 1DVFB 4OLZL 1KNOB 5EU3B 4C56A 3QQ9D 4GAGH 2YWYA 3L7FA 5E08H 4RX4D 1V5JA 1KCVH 1NLDH 3QEQD 4FRWA 4S1QL 2ERJC 4K7FA 1UXSB 2EICA 4G9DB 4KU1A 5E8EB 4GW5A 5E94B 3C09B 5JR1H 3CFDA 4W68A 1A9EB 3MACH 3A6BH 3ZTNH 4QXGL 3L3HA 4ZQKA 1J88A 3S35L 2N7AA 2IG2L 2E6JA 4NPYA 3KLAA 3X3GL 5EIQA 3TVMA 4KK5C 5GRZA 4NN7B 4YFEA 1IAIM 4OB5L 2GT9B 4YBQD 4AH2B 5FK9B 2BSED 4RQQA 5J9PB 3V7AE 1UENA 3VI3E 2PO6D 3P73B 3VXSD 5L2JA 3D0VB 5HI5C 4P5TC 5I16A 1RUML 4DKAA 3GSQA 3IGAA 3U79A 5SWQB 3L3KB 3O3DB 4HBCL 2W0FA 2ICWJ 3CFEA 2X1XR 4XBEH 3AUVA 4OCYH 4Z7QE 4LL9A 2ZOKB 3C6LD 5FIEA 4EIZC 3BMWA 5CGYC 4Q7DA 3OSKA 4KQ3L 3TO4A 1H3PL 4PRHA 4TOYL 5DTFA 4JG1L 4RISL 1JPSH 4LSSH 4O4YH 1IFHH 2EXYC 1OWWA 2X9YA 1F8TL 2XFXB 2DB8A 4Y5VA 1AD0B 3FB8B 2Y6SC 2IQAA 3WFCH 5H37H 1WWBX 4UT6L 1P6AB 1BGXL 4KKLC 1EEQA 2FEEI 1WVZA 4PS4H 1G9NL 4HS3A 4Y5XB 4AENA 2Z35A 3LEVL 3D6GA 5C6TH 1CD9B 5CZKA 1MHCA 1NC4A 5TQ0H 4R96B 1FHGA 1RZ7L 2VNCA 1U9KA 4F9PC 3VWJB 3WIHL 1H3VA 5C0CA 1CIUA 1J86A 3RX5A 1WT5A 4U7MA 1KLUB 3TFKC 3MFFB 4P9ML 3MODH 1AFVH 5A16A 1I8IA 3KYMB 1L0YA 4AG4L 3JWOL 4PRIB 3MFFA 2X70B 1FNLA 1MUJB 4UUJB 3WSQL 4DW2L 5C08A 2HFGL 2LV4A 3DVFA 4HLJA 4X9HA 5IW3A 4U7KA 5BS0B 3DXAA 5JOEA 4JM4L 5I2IA 1S9KC 3FJTA 3VRJB 4NO2B 1TITA 3SPVA 2P47B 3HMWL 1YPZF 4EOWL 4EQ3A 2NXYB 2PF6A 4P23C 4JDVA 3RHWF 4NO2A 1XZ0B 4OIBA 4P59L 5DQJA 2A2QT 5DJYA 3BPCB 3ROLA 2FO1A 1MI5B 4PJGB 1IC7H 4HUMB 3LB6D 4JRWA 4M6AA 2P8LB 3CCHA 5DEZA 5DGRA 3MLUH 1NDMA 3E6FB 1G9MC 2R2BA 4KJWC 1VENA 2NX5A 4PRIE 4L4VA 3ROOA 1HXMA 4PP2B 3FB5B 2VYRE 1M7IB 3QXTA 25C8H 5I1EH 5EBWA 3G5ZB 1CR9H 5BS0E 4M6NH 4G6FD 1E4XH 3L95B 1CL7L 1QFWM 4K94H 1IZJA 2CLRA 3JTTB 2A77L 3QCTL 4XMLL 2UVFA 1NUDA 4M3JA 4UV7H 1KGCD 4BFIA 2HFEA 4JO2H 4OF3A 3G6AB 4NZJA 4PJGE 4X9IA 3I6GB 4ELMB 2CMRH 5J12B 5DURD 1JWMB 4HPYH 3O6FA 5C0BD 1T5WB 1M7DA 1DQLH 3FOLB 4ZUVA 5T5FH 3FO1A 1XGUA 2HFTA 1ZTXH 4MJ4A 1NGXB 4MSWB 3B5TA 4EXPX 3QDGA 1M6OA 5I73C 3MRBB 5BZDA 3BUYA 1P7QB 3CZFA 3D1MC 5EU4A 1SEBA 5JNYA 3H9HB 1N0XH 4JQIH 3WIIL 5A2JH 4G7YH 2MWCA 5KSAC 3QSKB 4YK4B 1SY6A 5JIIA 3T0ED 2VLKA 2YBRB 1QVOB 3G5YB 4U6YB 3FONA 3GUTA 1DN0B 5EZIH 4HJGA 2YC1A 2JJWA 1DQDH 2UY7A 2UY6A 3UZQA 2R4RL 4RWYL 3ZKNC 4ELME 3VXMB 4DAGL 4F33B 1ACYH 2DD8L 3DUUA 5DJ8A 4CJ0A 1LEKB 1T83C 4ETQA 7FABL 1FO0A 4XPGL 1R3JA 1LEKA 5I8KL 3QXAB 2VUYA 1JNHB 2CLVA 1H9VA 3L3JA 2EIZA 5KVFH 3QUML 1UH4A 3BIAX 4NQEB 2AJUH 5JIKA 4H8WL 2F8OA 4PJIB 4QCIA 4G6AD 2VXVH 2XRAL 3MZGB 5DEFB 2E7LA 3MRQB 4I3RH 3WFBL 1B4JL 2X9XA 1SJHB 3VFTA 4C58B 5ITBL 1CS6A 1A6AB 4MNQB 4PD4K 4JO1L 1KN2L 3FQRA 4OZFG 5B21A 1A1MA 4MNQA 3Q6FA 1TVHB 3ARDC 3VXME 4DZ8B 3QXVA 4WFGE 3D5OF 1J5OL 5CZVL 3QCVH 1VKXA 2DYPB 3CVHB 1AIFB 4DZ8A 1QFUH 1RJZA 1UYWL 1V3LA 1XGPA 5JPMB 4LLWA 2DQJL 5EC1A 2GK2A 3NCYP 1A2YB 1EGJH 4FQXC 4P9HC 5DMGD 3CSBA 5TDNB 3VXUB 4NQEE 1NUNB 2VLRB 3ORJA 4PJIE 1U8MA 5DMYA 5E8PA 5GZND 4CVXB 3QG7H 1IGFL 4NZDA 1HILB 3KPMB 1HSBB 2EH7H 1NL0L 1SY6L 4BSVB 5J13B 4MNQE 1LEIA 4M1CD 2GCYB 3BQUA 5ESQA 2FBJL 3BDYL 3QWQB 5GISH 2EEDA 1C8PA 2WBJD 3JVGC 2O5XL 4YHPB 2GCYA 3SDAD 3X11A 5JXAH 1ZGLB 3D0LA 2Z8SA 2B4CH 5I1DB 1DUYB 1J87A 2A6IB 1FO0L 1HXYB 2H32A 5TE6H 1MCJA 5EA0H 2A6IA 3LY6A 1CGTA 4X9BA 3OXSA 4YPGA 5FOBB 1TPXC 4LKXB 4KTEH 1RK1A 3CX5J 3VXUE 3OAYH 4P48A 1E28B 2X1WL 4P2RD 2VLRE 1U3ZA 3HRZA 3OKKB 3QO1B 4UNUA 1RURL 1S8DA 1T6VN 1U0QA 2Z4QA 2EDFA 1R3LB 3EYOA 4OZFB 1JJUA 3O2DA 3RIFK 3SJVA 1OGAA 2CRZA 1JYVA 4H88H 5E4EB 2X89A 1UB6B 4X0KA 4YHKL 2VQ1B 4YGAB 4F7PB 1F2XK 4QHUA 1FVCB 4GO6B 1GSMA 3NZHL 2ADIA 4KI5D 5DC0A 5EZOH 2VQ1A 1URLA 3MV9A 2PR4L 1BFSA 2PW2B 1JGUL 3HE6B 4LVNC 1HH6A 5IMKA 1YQVL 3MJ7B 4CJ1A 2DKSA 5FECB 1YEIH 3F12A 4FFYH 5KN5A 1K8DA 1Q72L 1N5AB 4DOHB 3MOAL 2VXQL 2YKLH 5F21B 5HGDA 3VW3H 5HI5D 4KAQL 1IQDB 3KYOA 1A4JA 2A74A 2DI9A 4NRZA 4PRAB 3LQAL 5BW7A 3MV01 3TA3D 5IMMB 2XQYG 1DEDA 2GTWB 4GG6A 5IFJA 1GGTA 3OKOA 4F7MA 4RNRB 5FUOH 2VZSA 3MRJB 4NWTH 3RA7L 4Q9CA 5CGYD 3O9WD 4JKMA 2IGFH 3ILQD 3C87A 5EUKA 4ZO9A 3VFMA 3M8OL 2JF1A 5L2KD 4RRPG 1Z3GH 2VDPH 2CQVA 3SGJA 5FYKU 1QEWB 3D48R 1T21B 1XF1A 2O5ZL 4X98B 4QRQA 3FHQA 4JFQA 3ESVF 5J3HC 5C09A 2NY6B 2NPLX 5D70L 1VACB 4GAJH 3ARGB 2RAMA 4DOHE 4G8GB 4JFHD 4X98A 5FO9B 5FYLD 2A9ML 4HX1B 3CSYB 1K2DB 2FH8A 4D9RD 3MRKA 3WD5L 1EBAA 3QAZB 3RY4A 5KBNC 1S5HB 2BVQB 1YEKL 4GLRI 3VRLF 2WW8A 4JPIB 3U0PA 2OP4L 2F74B 2XWTA 4YFLF 3EW3B 2X1QA 4JDZA 2DQTL 1CQKA 1U3JA 2XNAA 4JFOB 3TFKD 4HXBH 3DX7B 4ZXBD 1S9WA 4N5UA 4G3YL 2EDXA 4G43B 3PHQA 3QO0B 1JRHH 3C8KB 1EUUA 2WUCH 3UPRB 3C60B 1EA9C 4LGPB 4HWEL 1T89C 4UQ3A 3W9EB 4NZTL 5JMOC 4NKOB 4I48A 2IJ0C 2VN4A 1T2QH 4G8GE 4XPFH 3SDCC 1FNGA 1F3DH 5J06A 5ALCH 4U7SA 4XCFL 2AEQL 3JWDH 1FFNA 3BGFC 3FRPA 2OI9B 5C7XH 5L8KB 5GS2H 4MNGB 3HAEB 5AUMA 1CGUA 4KKAD 2P7TB 2DQEL 4QXUH 3K0WA 4W6WB 3GO1H 2LFGA 1W72B 1FYTB 1WISA 4HH9A 4HMEA 5DRWB 5EUOB 2OJZH 3GJFB 5JIHA 4LF3B 4LVHB 3KPRB 5I71C 2GJ6A 3GJFA 1F42A 4Q58C 5CMAA 4MCZA 5J8OA 1JGDA 4S1SH 2BOBA 3HNTH 5T33L 2FZ3A 2BRQA 3T0WA 3QG6A 3HCVA 3RI5F 3WIFA 4JGMA 3PL6D 5DA0B 3HC4L 5HYQA 1WWAX 5DD6A 2XZZA 1MAMH 1ZS8B 2VJXA 4U2YA 4DVRH 4MNGE 4IHOA 4FQCL 3DGGB 5IMLB 3W82A 2VZ3A 4OD1H 1MJJB 5SWSD 1FYTE 4IRSC 4YXKL 1F4YH 2ATPA 3DGGA 2Q8AL 3VFUA 5EUOE 3VGDA 4MVBC 2VKXA 1BEYH 4YC2C 3GZKA 3KPRE 5LAXA 3EOBB 3TJHC 3GDBA 4HUVB 4N0YH 3O4OC 3UBXI 1OSZB 4G7VL 4JVWA 4G6KL 1C7TA 4YDKL 4GOSA 5DRZB 4K2UL 4BZ1H 1JZ8A 4BSWA 2FHFA 4ONHA 1U8NA 3ES6B 3LN5A 3W9DA 4OUOA 2VITA 2IWGA 3ARPA 4XP9L 5I18L 2R8SL 3THMH 5DD3H 4W6XB 1FVDA 4Z5RA 4G6JL 2OYPA 3NTCL 2JK5A 2DDQH 4X6BB 2GHWB 5I30L 1KULA 2DF3A 4HKZB 2MQCA 3CU1A 3WNLA 2EYTA 2J8UF 2UZIH 1N2RB 4JM2D 4LSPL 3ARBC 1ZANL 1JGEB 3K1DA 1U3HA 2V6HA 4Q9RH 1HIML 1TZGL 1JVKA 3DX9B 1J0ZA 3VFVB 4M6ML 1T1WB 1W2KT 2HMIC 1ND0A 5F7DA 3ET9F 3MV8B 3MA9H 3GMRB 3OKDB 5D93C 5D9SB 2R23A 4HWBH 3DI3B 3RZCB 3UTSA 4HBQA 5GS1B 3MMEB 3BKYL 1AKJA 3OR6A 1JTTA 3U4BH 4OI7A 1S7UB 3TIEA 2JJSA 2D7TH 3VRIA 5IMOA 4U6HB 5LWYL 3NIDE 4JY5H 1CD0A 5EG6C 2XXMB 3MREB 1S7UA 2ARJA 3QUKB 3OAYK 4XP5H 4WV1C 1HE7A 3GMNA 4AYFA 4CN6A 4ELKA 3HNSL 5H35B 1FORH 2GK0B 3L5JA 4E5XB 2VDQH 4G5ZL 2Z8RA 2D4FA 3MV8E 5FM8A 1WLHA 5JPNB 3LZFH 4EBQL 4RGNC 1Z5LA 1VGKA 4POYA 1TXKA 5DVLA 1WBZB 1E27A 4DTGH 3GMMB 4PGEB 2QR0A 2PXYC 3UYRL 4YE4L 4O2CB 1DQMH 4OCSH 1JGVH 4ZSOB 4AEFA 4QOKB 3TO2A 2BVPA 4PJEA 3IFNH 3UX9B 5MEOA 1JI2A 1WWCA 5ADOL 1MCKA 4ZSOA 3CH1A 4ZYKB 1MQKL 1J9CT 1CBVH 1XMWA 1A1NA 1KYOK 1MVFA 3CVHH 1CICC 2VDOH 3SKOA 3WV0A 1I3RA 1A6ZA 4ZUUA 4IS6B 3VFWB 3NPSC 4ODVL 3QWOA 3BN9C 4LEXL 1PZ5B 3VXRB 1E6OH 2YS4A 1CLOH 3S36L 4C83A 3UBXG 4NKMB 3U4EA 5EU6A 3BGMB 3A67H 1JN6A 1UJ3B 3NABH 3V4UH 2M8XA 4L8SB 4ZSOE 4QOKE 5LG1A 4PGJA 1ORQA 5D2LF 2AABH 1DLFL 3AAZA 3HUJA 2ZG2A 4XP6L 3LCYA 3HG1A 1ZT4A 1RZIB 4YX2H 2CJUH 1BQLL 4PJ8D 4R4BA 1AC0A 2ICEA 1QD0A 3OWEA 1I1AA 4JFZL 4OLUL 3X3FL 3MCLL 2LTQB 4FTVA 1CDCA 5HYJA 3C08L 1KEGL 2CPCA 2HT3C 2NY1D 3DTXA 4MQ7A 3VXRE 1K5NB 2V9RA 2ITDA 3WJLC 1VFOA 2APTA 3MLSH 4P2OA 4X7TB 1VA9A 4JFDD 1QFHA 1MPAL 2VXSL 5J56B 1UCTA 3QISA 1AQKH 4GKSB 4DVBA 4DN4L 2ZSWA 3TIDA 2QQNH 5I1AA 4JRXB 2EEAA 4KUCD 3MOBH 1S9XB 1GZPB 4X4YB 3OKMA 5I8EB 3EO0B 1U95A 2BY1A 4ORGA 4L4TA 5DQ9B 5JW3H 3S88L 1KPUA 1H3UA 4LCUB 3UBXB 4ZO6A 1MFEL 3EGSA 4HF5H 1P5UA 5CD3A 3EOTL 4PR5A 3RVTC 3A6CH 3QI9B 1EAPB 4KPHH 4XGZB 4MJ6B 1UC6A 1FNFA 2YD6A 3H7BA 4QTHA 2R56H 1KB9K 4XP1L 4HK3J 4AIZB 4DQOL 4P4KD 2H8PB 4RMRA 3OKNA 4KRLB 4R7NA 2DWDA 4GAGL 1CLZH 5E08L 4JRXE 4CMHB 2PYFA 4Q6IC 4OZIF 2E9IA 1D5IH 1U8IB 2GUOA 3I6LD 1KCVL 1KXQE 2UWEA 5E6IC 4UBDC 3ZL4H 1JK8A 1NLDL 1AI1H 2FCBA 2C1PA 4PJAB 2VE6B 4DKDC 4APQA 3P9MA 1NMAH 5E2WH 5DJ2B 2CUIA 1G6VK 4WGWB 1A6VH 1FP5A 2X1OA 5EO9B 4X6EB 2R1XB 3KPOA 4R90L 5JR1L 3FFCD 3D2UB 3U2SB 1R3KB 2AJXH 3MACL 1OF2B 4QEGA 3RIAF 3A6BL 3ZTNL 4KRMB 3RGVC 4NQVA 3ZHDA 3PWPD 4KK8C 4JG0H 3D2UA 4GBXD 3LQZB 4J3WA 1JPGA 1IAOA 3QHFH 3LKPA 3TN0D 2XWJB 2YHGA 3LSOB 3JUZA 4YHYC 4JRYD 4LCCB 3PGFH 2I07A 1VADA 2FJGB 2RJMA 3VWKA 1J1OH 4PJAE 3QEHA 4NN6B 2GYSA 4XBEL 4OCYL 4JE4B 3RWIB 5DJCA 1SBSL 3V4VH 1F97A 2ZCHH 5D7KE 1EEUA 4V1DD 3RWIA 3T3MF 2BSTB 5BXFB 1EV2E 2P24B 5IIEB 3BWUC 5C0AD 3GHEH 4LSSL 3BO8B 3D85D 4O4YL 1IFHL 4R4FH 5CEZE 3NGBB 4HLZG 3ARFA 1SYSA 2IPKA 5ICYB 3E6HA 4I0PD 1RK0A 2JCCB 4KHXH 2AXJA 3V5DB 3WFCL 4ZFOL 3KDMB 3LKNA 4AEEA 3W11C 1T1XA 1W72H 4PS4L 3V5DA 2A6KA 4YBHA 2ORBH 4KROB 5C6TL 2QSQA 1GZQA 4FA8A 3O3EA 5TQ0L 3D39D 3VFRA 4Z7WB 3K8LA 3B5GA 1T2XA 2R4SH 4DKEH 1S78C 3JSSA 1T3FA 3HR6A 4HKBB 2CDGB 5HDQH 1P4LA 3O8XC 3MODL 1QSFA 1TNMA 2D4DA 3IDJA 2V5SA 4MJ5B 6CGTA 1OM3H 3C2AL 3TM6A 4ZNEA 4OLWH 1KIQB 3BEVA 2VLLA 3L3GA 4NYLB 3RNQB 3DETD 2JCCE 5T3XD 3ZDYE 3WN5B 5EZJB 5ACLA 3QPXH 5I66A 3RWHA 3GMLB 3TZVB 4JFYA 2AK4A 1S7WA 3P0YH 3TT1H 4MB5A 4ODSH 3BIKA 4Z7WE 3RDTC 5FFLA 1IC7L 4LDEB 4ODTH 4LPVA 3LD8B 1AE6H 2J8HA 4X99A 1PG7H 5ENWB 5F1IB 3HS0B 3MLUL 3GBLA 1JE6A 1ZAGA 4X8XA 5SWZD 5GGTH 4E41A 4WEUD 1MCDA 4JB9H 5I1GH 4MAYD 3MROA 3PQYB 3FO0L 3R4DA 4FQLH 3OR7B 3RUGA 1H15B 1E6JH 25C8L 2MCG1 1RZGB 1CR9L 4XCEB 1S7SB 4M6NL 1LD9B 4B0MM 1E4XL 5F3BB 1G0DA 4K94L 3LRSA 1DL7L 3WHXA 4HK3N 4HW6A 2LVEA 4OM0H 3FFDA 2C5DC 2KUTA 5JXEA 4PGDA 5J89A 3RKDC 4JO2L 5HI3C 4QRPD 2DQUH 5DK2A 5ESAA 2CMRL 3V52H 5DZNA 4LCWA 4HPYL 3B8YA 4U0RB 3GSOA 4CU8A 3WLBA 3MCG1 1DQLL 5T5FL 4AT6A 1A7RH 1ZTXL 4OF8A 1CXKA 4BQ9A 1B6DA 3MLXH 3EDJA 4FFWD 1XCTB 1N0XL 2Y25A 4JQIL 2VL4A 3FKUS 5K33A 4M5ZH 5FYKD 3WS6A 3AS2A 1VESA 4GRLB 4OLEA 3MV11 3PWVA 1UM4H 2Y5TB 1IEHA 1IM3A 3MBXH 3MO1B 3NCEB 4Y8AA 3BRGC 5EZIL 1ROWA 1DQDL 4ZAKA 2IMMA 4TTDD 2Z0BA 3VGEA 1TTFA 1BZQK 1IGIH 3SE4A 3Q5TA 1ACYL 1IGCH 3HZMA 1X6NA 2Q76B 2JB6B 2C3WA 1R24B 4EDXB 1DLHB 5FV2A 2ZCKH 1T5XB 5HHXH 1A7BA 5KVFL 3LH2H 4NHUB 2AJUL 2EDJA 5IK3B 1QQDB 4Y2DB 2VXVL 3MGTB 4GKNA 5L6YH 4I3RL 4LMQI 2YPLB 1HKLL 4H1LB 1J10A 5DVKA 4YDJA 2CIKA 3MR9A 3GKZA 1EDQA 1MCWM 1KTDB 1PG7W 1BVLA 2W0KA 2BY3A 3OG6B 1SBBA 3K4ZA 4QRTB 4OZHB 5CJQH 1BBJA 4NC1C 5D1ZD 4JCMA 4NZRH 3QCVL 3IAQA 1YNTA 4JLRB 2X4OA 2OQJA 2NY3B 5C8JB 4HMDA 4GQ9H 1HQRB 2EE3A 1V7NH 2NY4D 4N8PA 1NDGB 2VLJD 2R1YB 1QFUL 1BWWA 4LNRA 1NJ9A 1JNJA 3BPOB 3WLWC 2DWEA 4R7DA 1EGJL 1NDGA 3RVUC 4O9HL 1B9ZA 3DLQR 3JWOC 3EYSH 4WVRA 2FYYB 1P7HL 2E5EA 1AD9B 2HRLA 1R5VA 2XN9B 4OV6F 4CNIA 3G5VA 2YPLE 3QG7L 3ISWA 3TBSB 4F7CB 3CNKA 3MZTA 3NH7H 2EH7L 3O0RH 5H94B 1QBML 5DMKA 4GRWB 5A2IH 3UEZA 4YDIH 5GISL 3C5SA 4XH2B 1WITA 1INQA 4OZHE 2FD6H 4U1MB 3TCLB 4KJPC 4U1JB 1Q9WA 5JXAL 4KXZH 5K59E 2B4CL 1F11B 2QKIB 3QQ4B 2HWZH 4HXAH 1EIBA 4NIKB 2P1YA 3M07A 3QDMD 1AHWA 5EA0L 3LN9A 1JNLH 4YDVA 3IDGA 2QADB 3KLHC 4KTEL 3TO4C 4M02A 1I7RB 4E0RB 5HHMD 2EXWC 5C0JA 3SCMD 4Y5VC 4OV5A 1UKQA 2XN9E 4IRJD 2BVEA 5IB4A 2ID5A 3SN6N 4GRWE 3LHPH 2OMNA 3MRHB 1DQJA 4TUOB 2YZ8A 4OI9A 1YN6A 2P5WD 3TBWB 2IAMB 4M7ZB 4Z95H 2I25N 4OAWA 5KS9B 5EZOL 4FQPA 4KK8D 4L8BB 4NNPH 2ADGB 2ZUWA 1HKFA 1Q8MA 5E5MA 2ESVB 4JM2F 5BVPH 1YNLH 1TETH 3MGOA 5F89A 3W0WD 3A6OA 5J4MA 3HE7B 1WT5C 2VZ1A 2DIAA 2VDMH 5F88A 3TNNB 2XA3A 5EPMA 4FFYL 3NN8B 1MAKA 3QZWG 4F7TA 1LP9B 1ZA6A 1NCAH 2UYLB 2YKLL 2A6DB 3TBVB 4NQCA 3UJJH 3VW3L 5I17A 1KCRH 3GJFK 4FXGB 4ODXB 3LQMA 5ANMA 1EEYB 1Q9KB 2FJHB 4UV4H 3O2VL 1QR4A 1VB9A 5JQ6H 5E03A 2V2WB 4MA1B 3MBEC 3BRFA 3IJHB 4L8CA 5KAQF 2YEZB 4UTAH 1HNGA 4HKXB 3QIUD 2BC4A 1C5DB 3IJHA 4NWTL 3CGTA 3ILPB 5CBEB 4EJ1C 2IGFL 3V0WH 2CXGA 5KS9E 4PRNB 5MI0C 3JV4A 1SJEB 4KKBD 5E9DD 5B22A 2DLGA 2EDKA 1RJYB 1Z3GL 2VDPL 2ESVE 1U8HB 1F4HA 2R0KH 1L9MA 4PJ9B 3AXLA 2G60L 4HUNB 3VXTA 43C9A 2D7PA 1X5JA 3V95A 3W11D 4WIQA 4GAJL 5ICXA 3MNWB 1LP9E 1M71A 5IQ9A 2EDLA 4ZPTA 1NEZB 1KIPB 3MLPA 5EB9A 3FRUA 4H8WC 3CVIL 5CEZH 3VDAA 4L8DB 1FZOA 4IIQB 2DM2A 3EHBC 4N9GB 4EN3B 5F72S 2DI8A 1U6AH 2HRPH 5J1SC 5TE7H 3ZE0E 2Y72A 3PWLB 4BKLA 1CLYH 4HXBL 3PGDA 3OJDA 2VR5A 3IKKA 5D7SH 5GRXG 2AJ3B 1NGZB 2FR4A 1MHPH 2OSLB 3DNKA 3QZWB 5D7JB 5IB3B 4F7EA 5IB1B 1Z0MA 5FO7B 3RZWA 1EEZA 3FQXA 1MVUB 2GITB 1P2CB 4AMKL 1KPVA 1LDPH 1RIUH 5FO7A 3RTQB 3FN3A 5ALCL 1G7PA 3KG5A 5IR1A 4Z18A 1OAYH 3JWDL 5JORA 5C7XL 2Q87A 4GG6F 1MFCH 2D7MA 5I1JH 3KXFD 3SGEI 3BESR 2B5IC 3M17B 1KB5A 2FECI 1VFBA 1U8LB 1N64L 3GO1L 2AKRA 3WL9B 1D5MA 4FXKA 1JF5A 5DHVB 4S0TD 3PNWB 2ICCA 4LSQH 5CP7A 3QUZD 4CVUA 3GMQB 4S1SL 4JAMB 3HNTL 1CTOA 2VAAB 1VPOH 3STZA 2YSSB 4HUUA 3I02A 1QSEA 1T1YB 2NCMA 5DC9B 1MAML 2Z31B 5B39G 3UTZA 4NO0A 1RMFH 2Y07H 2X4TA 5K93A 1HHHB 4XC3H 3PABB 4XB7A 4RDQF 5TJWK 4DVRL 32C2A 3IFLH 3IKCB 5JOFB 2E7LC 4U1NB 1ZEAH 1CGVA 1HHHA 3QRGH 5IVNA 1A3LH 4LMQE 4OD1L 1F4YL 3MNVB 1BEYL 5A3ID 1ED3B 5DA4A 5FUCC 3DYMA 4FOMA 4U0QB 4HK0B 3NA4A 2PETA 1S5IH 1UM6H 4N0YL 4KUCF 5EZLA 5F1NB 1M05B 2CLZA 3STLA 1A4KB 1ZVYA 1WBYB 3B9KA 3BHBB 3K8KA 4PB9H 1UZ8A 1IGJA 4HLZH 4LFHG 3D25B 4G8FA 2QLVB 1WCQA 3SDDA 5ALBL 2V2TA 3O3AB 1VDGA 4U31A 1J8HB 3D25A 1UM5L 2VLMD 3KPNA 4G9FA 2NY2C 4G8IA 3THML 2C1OB 3LQAC 3ARQA 5DD3L 5F1KC 1FNAA 2YD5A 1KB5L 3H0TA 2DDQL 4J12A 1FGNH 3BQUC 1Q94B 3AY4A 1YC7A 4OZGA 1D7FA 2ENSA 2Z91A 3OB8A 4FQ2H 3SKUD 5A2FA 4X6DA 3DRTB 1JMXA 6FABH 1KPRA 4DWHA 3SE8L 5JIPA 3NCCB 5GS0C 4M6OH 4NQDA 1K4DB 3VI4F 2J4WH 5CKAA 4Q9RL 5DWUL 3C6SB 1ETZB 4QWWC 2Q6WB 1ADQA 5B39B 1EFXD 3BAEH 2NW2B 4POZC 2IQ9H 1DVFD 4PTUB 2FSEB 3F7YA 3LKOA 1J8HE 3VFPB 3WO3B 3MA9L 3QEQB 2Q7YA 4HWBL 1D5BB 1T20B 1ZHLB 5DHYB 4KMQA 4MCYB 5FF6B 5IWLA 2YMXH 4XCNB 2PNDA 1W8OA 1D3CA 3U4BL 1XGQB 5DJXA 2CDFA 3PP4H 2CRIA 3AM8A 3DMMB 5EO1B 3IXAB 2ZUXA 5CBAB 2D7TL 4LLYA 1QLEH 4O2EB 4FQQA 4WI9A 2AJVH 4JY5L 5FYJE 4XP5L 1OL0A 1BLNB 5CBAA 2XOTA 1V8HA 3TVMD 3RL1B 3MQIA 5JUEH 2VDQL 3GSXA 1CFQB 1DTUA 1CIDA 1JWSA 1XF4B 3ZKQD 5C0IA 3PG2A 4Z78B 4LLMA 1QLRA 3QEQE 5I76A 1RAMA 2FGWH 3LZFL 4M61A 1KJMB 4YEEA 4IM8A 4KJPD 1BVZA 4QNPE 5BW7C 4DTGL 1N8ZA 4PJDB 4N0UA 4WW2B 2I9LA