1WZ1L

Crystal structure of the fv fragment complexed with dansyl-lysine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational dynamics of complementarity-determining region H3 of an anti-dansyl Fv fragment in the presence of its hapten
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig light chain
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wz1L00
3SE9H 1B0GA 4XVTH 1DE4A 1AHWB 4LARL 3WLWD 3AXLA 4U31A 3ARFC 2J6EA 3MV7A 4DFHA 3VI3F 4A6YB 4LGSB 2A0LD 2CDGA 5I0DA 1N5YL 5TDOA 4X7TA 4OV5B 1RHHA 2VLRE 4ZS7L 5J56B 3RWIB 3GJFK 1QA9A 5FYLL 3MTRA 1OQXA 2VQ1A 4HWEL 4HSQA 5A3ID 1R0AL 5GSRB 2EICA 4PGEB 4FA8A 1DQDL 3K1DA 1SEBA 3LHPL 1BBDL 4NRXB 3IKCA 3IJHB 5JPMA 3RUGF 5ADPH 1B9ZA 4MS8D 5FYLD 4R0LB 3MYZA 2DYPB 4XPHH 5CEXA 4PY7B 1RU9L 2FJFB 1QA9B 4OCWH 5IHUH 3OKMA 2EDLA 4WW2A 5IMMA 3MSPA 1XGTB 4UT7H 5JLZB 2A74B 5GRVL 3AXLB 2NW2B 3P11L 2BNQE 4KUCF 3EYFB 3OKLB 5LAXA 3PHSA 1T83C 4OTXH 3RNQA 2FATL 2QR0A 3PABB 5FCSH 4JFQA 1XCTB 1OSPH 3N1MC 4YEEA 3BZFA 1I1RA 4DN4H 2YD2A 5IB2B 2DQFA 3UBXG 1A7BA 2VN7A 1BPVA 1X5YA 2NY6D 1G7LB 1LO3L 1VSCA 3BGMB 4F7CB 4XWGL 4D0DB 4CKVX 3QUMB 2BX5A 5CJOL 4LVHB 4FHBD 1UZ8A 1DUYB 2CIKB 4RFEA 4X0KB 4HKBA 4KRPB 1K3IA 1DBKL 1I3RB 1WV7T 4RDQG 3WIFB 4IHOA 1J86A 1V8HA 3GI9L 1Q0YH 5HHME 1HHJB 1C1EL 1QBML 5CP7B 4NO2A 2ADIA 3EJZC 3I6KB 1NDMA 4Y1AE 2XKNB 2EYTA 4HIHA 1HILA 2ZUYA 4XGZB 2HRLA 1T04B 4OM0H 1E4KC 1DQQB 4I18B 4Y4KD 43C9B 3LN5B 4CN1A 3QUZB 1RIHH 5EPMB 1CXEA 3TIEA 3RKPA 1RHFA 2D7OA 1W72L 4P2QE 3CMOL 3BXNA 3Q3GB 3IJYB 3SQOL 2Z92B 3GMMB 2CPCA 3HMWL 5BVPH 4OT1L 4RA3A 3R8QA 1BWWA 1WEJL 1I8MA 5DEGA 5E2WH 1KIPB 5J12B 3RX5A 5GS2D 4FABL 4N0YH 3SBWA 4AL8L 3KDMB 4IEFB 5FO8A 5BW7A 3P0VL 3VRLE 3WXVL 1TVBB 4OZ4B 3C60C 5HDBF 4C83B 1GAFL 5GIRA 2XPGB 5BO1L 4P23B 4RNRB 1WBYB 3MV9A 2J8UE 3L1OL 3UTQA 3B9KB 5DQDH 2RR3A 1HHKB 5I73B 2DM3A 1T6WA 1JWUB 5EOCH 2CGRL 1XF4A 1EX0A 1NGXB 2X89A 4R7NA 3GSQA 3QXDB 2BOBB 2JIXD 4POYA 3CSBA 2ZG2A 2NLJA 4N8CL 2DDQL 2E8ZA 1MHPL 3UJJL 4HJ0C 4PJ5B 1CZ8L 1G7JB 1ADQA 4G3YL 3S37L 2HMIC 1Q9OB 4P2CG 3PGFH 3QZWA 3QQ4B 3G08A 2YA2A 4NRZA 2BSTA 3QPQC 4QRPB 3TO2B 2VH5L 5F3HB 4OGAC 5IHLB 2QSVA 3HG1E 3P4NB 3GJFB 3IDJA 3MUHL 4EOWH 1CICD 5EN2A 4ODUB 5B8CC 5EU6A 3GMNB 4BFGA 2X4TB 5J89A 3SDXF 5GJTL 4IRZH 2Z31C 1UEMA 5IJKA 1M71A 4LRNH 3RGVB 1QSFD 4YAQB 4HJGA 2C3GA 5ANMB 2GTWA 4OZIA 3D0VB 3ZDZF 4NQSA 2J12B 1T7VA 1IC4L 4PJ9D 3T0WA 4R97C 5FUZH 3O3UN 2D31A 3MQIA 2FIKB 2ZOKB 3AS0A 4ZS6D 1MRDL 5E2UL 4JO2L 5BRZB 5FYKU 4BK5A 5CD5C 4OD2B 3L3IA 4MQSB 1F45A 2BFVL 1Q1JH 1CLYH 3DVGA 3TBWB 2GJ6D 2VXQH 2Y23A 2JIXA 3FRUB 3V5KA 1T83A 2YRZA 2IH1B 4F8TA 5C3LD 1TQBB 2HTKD 3U2SB 1IKNC 2EH7L 3FT3B 1L6ZA 4NQEE 4KK5D 1JHTB 4WW2C 1YDPB 4NM8H 1Y0LA 4QEGA 1FJ1B 3LN9A 4X98B 1AJ7H 1JHKH 1U8OA 2YRPA 4GRWH 4GXVH 3S36X 3NZ8B 1J1OL 1EAPB 1KC5L 2JJSA 4HMEA 4WEBH 3HC0B 5ILTH 5C8JA 3ABZA 1EFXD 5C0BA 4NQSB 3OJDA 4TUKL 4PTTA 5I66A 4PJAE 4ERSH 2HJLA 1J8KA 4I1NB 2BC4B 2NY1B 4P2OA 4UNTA 1LO4L 1GGBH 4B41A 3WO3B 2EYRA 2FHFA 5FK9A 5KJRL 4RFOL 2RFXA 5DQ9B 4RX4A 5FOBA 4GLRI 1ZA3B 4Y4KA 2E9BA 4GQ9L 3Q5YA 1TZGL 1QZ1A 4I0CC 4PRPE 1JPTL 3IDJB 2FJHB 3NIDE 4FFZL 4N5ED 3MLSH 4X6DA 3VD3A 4JM4L 5IT2L 2W9LA 5IESL 4WY7H 3LEVH 4KJQD 2WBJD 1X6NA 3QQ4A 4PUBL 4XNMA 1BQLL 2FH6A 2NNAB 2GHWB 3EO0A 4PRDA 1EZVX 3ZLQC 2R56H 2FO4B 1TXKA 5DD6A 5F9WB 3MRDA 2UY7A 2VLKE 4LDEB 4PRID 4Y5YA 2FD6H 4PLKC 3GMQB 1P4IH 1N59B 1INQB 1EERB 4Y0GA 4LCWA 4KI5F 3O41A 1QLFA 1FNEB 4JFFE 1JWUA 3SEPA 1UC6A 5GGSA 3ZKQD 1EO8L 3EGSB 5DTFB 3QB7C 2BVEA 2A9NH 1YMHA 3F12B 5I1EL 1NEZB 5E2TH 4ALAH 2JB6B 3MROB 3U7AA 3VFMB 3DARA 4HJJL 5JR1L 2LAAA 3P40A 1OF2A 1MCPL 4J23A 5HVHB 2Z35B 3E3QE 3H9SA 1I8MB 3T2NL 1AC6A 1HH9B 5J4MA 2H45A 1U8OB 1EEQA 2Y36H 3NFSL 4KKBD 3BSZH 1C5BL 2NX5E 4GAJL 1TZHB 3HE6B 1W8NA 3OF6A 3ILQC 4TUOA 5GJSH 4EVNB 5L2JA 2GIYA 4B7IA 2N4IA 2F58L 2PUQT 3S5LA 3O6MH 4Q0XH 2VXVL 3HI1A 3UTSE 4U2YA 1AI1H 4OQTH 1E0OB 1IC1A 1JF5A 1HIMH 4CNIB 3K4ZA 3T0EC 4H5SB 3V7MA 5AZEL 5D72H 3RL1A 5SV3A 5FECB 4Q74A 5DMYA 2OR7A 1ORQB 3KNBA 4K8RL 4LHUB 4L3EA 5ID0A 1R5IA 4QLRA 3QFDB 4NQED 1EK3A 2B4CH 5IBLC 3VFUB 4PRBA 4WO4C 3O2VL 3VWJA 3BD5A 2A6IA 1CDGA 2B1AH 3KPPA 3BIKA 2BOCA 1KB5B 5E8PA 3ZKMC 1RI8A 1SYVA 1FZJB 1NUNB 1UJ3B 4QT5A 3NCJH 3MLSL 1ACZA 3LKSB 3MC0A 2DF3A 5FYJE 3KR3L 5DHYB 5CUSL 1XGPB 4HUXA 5L6YL 4L4VD 3NCYS 2AJXL 5D2LE 1RK0B 3QDAA 1BWMA 1GZPB 2CLZB 4JFQB 5GRJH 1E28B 1Q9KA 3GIZH 4I77H 5C7XL 1A64A 4N8CH 4O58H 3T1FA 3FB7B 3G5YA 4EUPB 1G7MB 3GO1H 3NFPB 2JJTC 5JLZA 2QSQA 4L3EE 4XNXL 5ADOH 4IS6B 5EC2B 4ZXBC 5IG7B 1Q38A 4XVUC 2FBJL 1FZOB 3FO2A 5F1SA 2CMRH 4FP8H 2IAMB 5E9DA 2XZCL 4YAQA 5CEXB 1F4WL 4RAUB 2HLAB 5IW6A 5KJRH 3ZTNH 4F37F 2CUMA 5CEZH 4Q9RL 5LBSL 1SEBB 3ARGB 5TQ2H 2WINB 3G04B 2FEEL 4MQXC 2BMKB 2Z0BA 4M03A 3HUJE 4HC1A 3GZKA 1OCWL 2Y6SD 1LO2H 1A14L 1KCUH 2BSTB 1P7QB 1VADB 5HVHC 4X9GA 3I6GA 1XGUB 5ID1B 4MA3B 3NABL 1BM3L 4P4KD 3QDJD 2A1WH 4WFFD 1GOHA 1WFNA 3RVTC 1MI5E 3ARRA 3KPSA 4LCIL 4PRHE 4U3HA 5K33A 4PRNA 3X3FH 5KANI 5HYSG 3WJLA 4MJID 4GW1A 3QR2A 2ORBL 1EFQA 4KUZH 1TCRB 1YJDC 4CN4A 4BSWB 3PJSB 4L1DA 2P5ED 3DUUB 4M3KB 1FNHA 4F7PB 4B7LA 1QOKA 4LGRB 4EN3B 4HF5L 4Y2DB 3SQOH 4MLSA 2OSLB 4ONOA 5F71A 3C5SA 3PWJB 2BZDA 3QQ9C 3GI8L 4E42B 5FCUL 4QY8B 1S7QA 4XHQA 2FEDD 5D1QB 1KNOB 5I9QC 1IGJB 4Z77A 1NDMB 4X4XB 2N7BA 5E6ID 5IHZA 2VNCA 2VSCA 3WS3B 3KGRA 4CVZB 4MCZA 1MJ7H 1NLBL 4JHAL 5DEGB 3MREA 1RZ7L 5BRZE 4XMPL 4F58L 4JN1L 2BY0A 3NFSH 4K94H 3PDDA 4IRJA 1LP9B 1DLHB 15C8L 4WWKC 1IGCL 1U8PA 4XP6H 5GS0C 5ICYB 1R24B 3IDIB 4XNZB 4G6ML 5FA3A 2QSCH 1FE8L 3TP4A 2DTMH 2R9HC 2VXUL 1KG0A 4K3EH 4AIOA 2DQJL 3LEYH 3OAUL 4LLAA 3QA3B 4QGTA 4AIXA 4F7TB 3PWVB 5CCKL 2RCSH 5AZ2H 4X5XB 1QLEH 1T0PB 2BK8A 5DZLA 2ZUVA 1L6XA 4XCYB 2DWEB 4KHXL 2OTWB 3RVWD 3FT2B 1HKLL 3O45A 5DZNA 3T2QA 4DGIH 3L7EB 3CAFA 3CC5A 1DCLA 1FL3A 2EDDA 3PUCA 1QEWB 3WIFA 5LXGH 4MCZB 3TYGL 2DLEA 1P7QA 2HT2C 1NFIA 1B2WH 2GJ6B 4OD3H 3O4LD 3KPLA 4OIIL 4N0CD 4QHKI 3LDBB 4P2OC 1I1FB 4L5FH 4TVPD 3OPZH 3P2TA 4TSAL 5HXMA 3RVUD 2Q7YA 4OF8A 3RX7A 4YFEA 4IDLA 5JIKA 4PGEA 1PKQB 1BX2B 1QLRA 2QQQA 4YNYA 2PKDA 4K3DL 3O4LB 1HEZB 2APFA 4GSDH 1FVEB 4QGYA 2B2XL 4G9FE 3HPJA 3MO1B 4LSDA 5EH1A 5FUZL 2VABA 5DD5L 1J0HA 3PP4H 4OM0L 4XC3L 1AP2A 5AG9A 5BXFA 4DEPC 4NQDE 2IH3B 3KPSB 3MZGB 3CPLA 3KPNB 2VAAA 1U3HB 5I6XB 2PYEE 1XGUA 5ID1A 1FC1A 3U9PL 2JTDA 3MV01 3QIUB 3P9MA 5I1GL 4LNRA 1FYTA 1WWCA 5ALCL 2BNUB 1WBXB 4PGDA 1Q9KB 1CIUA 4BKLB 1KUMA 5GGRY 1FPTH 4XB7A 3H9HA 3GHEL 3ZTNL 4Z7UF 1L4IA 3IJHA 3LQAL 3UZQA 3N1QC 4JZOB 4X9BA 3TFKC 3GM0A 5DRNB 2VQ1B 1KN4L 3GSWB 1IGFH 3LRSB 3EYQC 4TTGA 4I8DA 4PJGB 4APQC 5D7IA 4HCRA 3KPPB 3MRHA 4D9LL 3CXDH 1W0WA 4RA0C 4Z7VE 3UJIH 3E8UL 1HINL 1HHIA 1URLA 5SWZA 1OTUD 2D2OA 5EZJB 3IJSA 3M1BA 4JFZL 4WHCA 1KGCD 1QLEL 2DN7A 2AEQH 1LO5A 3RU8H 3SDXA 5JHLL 4XNZC 3TVMD 4KROD 4X5XA 1BFOA 3VXUE 4XVJH 5DRWB 4W70A 1NBYB 1P5VA 3A6BL 3HUJF 5JW3H 2R0LL 4O02L 4AYFA 2O5XH 4BQ6A 4U4BA 2KL6A 2R4SH 1D5BB 2HH0L 1N26A 4PJBB 5JPNB 3QFDA 1II4E 2AK1L 3VFUA 4Y19A 25C8L 1S5IH 3GMLB 4XBPB 2EXYD 4PJCB 5SWQB 4D0CA 4UT9H 3QUYD 4MNQD 3MZTA 1Q72H 4POZC 3W0WB 3W5NA 5HHPA 5B39B 1MUJB 5E8DL 5JQ6L 5A2KH 4YDLB 3WNLA 4JZNB 5F9OH 2FECL 3HFML 4ODSL 2XWJB 1ED3B 3AB0B 4K8RH 4RFOH 1CDYA 2DQGL 4H20L 4EXPX 3S5LB 1EEZA 3UJJH 4D3CL 4LQ1A 3DWTA 1DUZA 3KPMB 2RJMA 2P8MA 1CT8B 1F4HA 4FFVD 3GMRA 5B4MD 3QCUH 4IMKC 4L3CB 3WJJA 3MRMA 5I71C 3B5HA 3F58L 3WJLC 5DK3A 4GW1B 1MHEB 5DD1H 3GSVB 4LKCA 3P77A 4RISL 4WTXA 2BXZA 2OZ4H 2E9WA 3V4PH 1C16A 5EZIH 3QNYB 2R29H 2LVCA 2B0SH 1YPZF 4WUKL 1MVUB 1BM3H 2R0KH 1E4XL 4JDTH 1RPQA 3DXAB 2Q76A 4FQXD 1I3UA 3ZDZE 4O2CA 4M8QA 1JHLH 2L7UA 4OKDA 2X70B 2IANB 4KJPC 3LCYA 1XIWC 1WGOA 4G8FA 3A6CL 4Y16A 3MCKA 1OSPL 1AQKH 5FM4A 4XT1C 3SKMA 1AXSA 2WBJA 3L9RA 4R26H 3WFDL 4NP4H 4MXQD 4N0RA 4JRWA 1I7UA 1X5XA 5A16B 2CRIA 3EOYG 1VCAA 4AT6A 4ODSH 3RWJB 4LDLB 5C0CD 3U0PA 4TULH 3VXMD 2CR6A 1QP1A 1F8TH 1G1CA 4Z7UA 4PJ8C 1MCJA 3V6OA 1QKZH 3IU4L 2QQNH 1I4FA 2JJTA 2RQ8A 3VFPA 5J3HC 3L6FB 5EO9B 1CFQA 3HAEB 4JANA 5C07A 3RJQB 1FJ1A 1NFDE 1RZ8B 5HYJA 4ZOCA 2E6PA 4WEUD 4IIQB 3L5WA 4NYLB 5DGQA 9CGTA 4XX1G 3MNWA 4I0PD 3CVHB 1RZGA 4RSVA 5HHNA 2EZ0C 1UENA 3FB5B 1VKXA 3CD4A 4OFYA 3BI9X 3GSNH 2W0FB 4WW1B 4YHNB 2V17L 2OI9C 2F8OA 3F65A 2BC4A 3BO8B 3FO1A 1KB5A 3WHE1 1I3GL 3MMEB 2F5BH 4N9GA 3W2DL 5FV2A 3PGFL 5IIEA 1JYNA 1CU4L 2DQHL 3VXRB 2P8PB 4ZAKB 1IM3A 1HKLH 5CD3B 2CDEB 4JO4H 4G8EA 5C8JB 3S96A 1A1NB 2DM4A 3HC0A 1GGBL 1P84K 4R8WH 5CINL 2OJEA 1PJ9A 5BV7C 2H32H 3RNKA 5JMOC 4N0YL 1E6OH 3VXRD 3MPCA 5D8JH 3ECBA 3RUGA 1T7XA 4HJGB 1CLZH 1SMOA 4PB0H 5A3IC 1JI1A 1VFMA 4EN3D 1RZ7H 3S88H 2DQIH 4LEOA 2X4QB 3FONB 5IVXB 3BHBA 1QFWL 3ALWA 1DN0A 3QWOA 1N4XH 3UJTL 1MWAB 2WNGA 2I26N 1FNSL 3ARZA 3J8F7 1PQZA 4JG0H 4YDJB 5E6IB 2O5YL 4OZGE 4UUJB 4M61A 2FX7L 5MHSD 1U36A 2E9JA 1OTTD 3GSNL 1A6TA 2N7AA 2VOTA 4YO0A 5D7LD 1M7IB 4MDJA 4QHLA 5I8CB 3QO0B 2YPLD 3JV4A 1G7HB 1KYOK 5HJ3B 4RWHA 3CMOH 3MUGA 3KVQA 2VXSL 3RIFK 2GQHA 1V3LA 4OI7A 1KCVH 2FGWH 2PYEB 2VO5A 3ALPA 3QIWB 3MV7E 1KXTB 2ZG3A 3MV8D 5FYJH 4O4YH 4L8SC 1WAAF 2HRPH 4IRSB 1AD0B 2AK1H 2FB4H 1UM5H 3MLPA 2FD6L 1S5HA 4UTAH 4RMQA 4RMRA 2ZCKH 4Y5YB 4HW6A 1TZIA 3D39D 3MFGB 1HXMA 3TPKA 2F19H 1BOGA 4LFHD 4YJZL 2R1WA 4NQCE 4EZMA 2R23B 1I8KB 4YO0B 3O2DH 2CUIA 1PEWA 5KZCD 1DLFL 2ICWB 5GGVH 4Y88A 3GSVA 1IMHC 4KMQA 5E6IA 5AWNL 4YEFA 1IQWL 1P7QD 1UXSB 3OX8A 3QZWG 5IQ7H 1TPXC 1XF4B 4JFDA 5GGQL 5SWSE 4FQXA 4DZBA 2A83B 3BX7C 4KQ3L 4MZ3A 4AEIH 1ODAA 1CL7L 1DBBL 3U4EB 1GOGA 3ZE1E 3BSZL 1MLCA 2XOTA 3U6RA 2NY2D 2P5EA 4AQ1B 5C0JB 1JZ7A 4P5TC 3SKNA 4U05A 1NJ9B 2XY2A 1OTSD 3OJDB 3GJEB 1M05B 1T4KA 3BQUD 1IAOB 1QQDA 4Z76A 4IHOB 2V9TA 5C92A 4JY4A 1KTLA 1GSMA 1YEGL 5BV7L 1NGZB 1YEGH 4F33A 4GSDL 6CGTA 4CVXA 3BE1H 3ARBA 4LSPL 3RVXC 3I02A 1DL7L 3GNML 3DX8A 4NPYB 5DWUH 3K4DA 5SWSA 3V7AG 2Q7NA 1OGTB 4J3SA 4HWBA 3U9UA 2R69H 3OKDB 4LIQE 5DUBB 1BAFH 1RULH 5F7FA 5IB2A 2KH2B 3Q1SL 5DO2C 4ZUVB 3CFEB 5A43C 1UCTA 4G6JH 1L9MA 3VW3H 1G9EA 3HNVH 3EHBD 3I6KA 2HWZH 5E8EB 5FM8A 4Z5RB 1NANH 2APVA 2V7NA 4C57C 2CK0H 4JEGB 1GGCL 5DI8A 4PYHA 1FFPA 3WFCL 5JW3L 1BD2E 2X6MA 2FIKA 2ZOKA 3B6SB 1AGEA 4GMTH 1FBIL 4U1KA 1UB5B 4HDIA 2K7QA 3V6OC 3TJHC 4APQB 2ZSVA 4MHHI 1FVDA 1KJMB 3TNNB 4GKZA 1CQYA 2AV7B 4G80B 3RWEA 4H25A 2FJFA 3FMGL 5DRZB 5E0QA 1XR8A 4KU1A 3KPTA 5FUOL 3DMMC 2DIBA 4MMXC 4D0DA 4JB9H 4P2RB 3JTTB 2BSSB 4DN4L 4JO1H 5JPMB 1RUMH 4Z0XB 5DEFB 1RURH 2J8HA 4IRSC 3MBEB 3PWPB 3QCVH 1FL6A 2YC1A 2WLYA 5JHDE 2VQTA 3CVHH 4JPVH 4LPXA 1ZT4A 5IVXE 3S34H 4OFPA 1MCWW 4QOKD 4ALAL 3RNQB 4JE4B 4WCYL 5ETUB 5LG1A 1QHOA 5HVFB 3HE7D 4FN0A 3U0WH 1AR1C 4Y4HC 4BZ2L 5IFHL 4DWHA 4LF3A 5E03A 3T65A 3W0WD 4OGYL 3JWOL 5JW4M 5GS0H 3QI9D 5K9JL 3HI5L 2CK0L 2FX8L 1D6VH 4WV1B 3HE7B 4HKZA 3HZVA 3CU7A 1WQVT 1RUQL 1XGYH 1YNTB 2LABA 5SX5K 3VFWA 2HTKC 3RDTA 4UT7L 1XF2A 1RY7B 3CFDA 3NMEA 2LU4A 3VJ6B 2X1XR 1NMBL 4WFGD 3RGHA 2Y25A 5L2KE 4ONGH 1JE6A 4PY8J 1ND0B 4EQ2A 1MY7A 3C60A 2CDFA 1F90L 2XPGA 2VLRB 3S35H 3CFKA 4HBCL 3IU3A 2ZWLT 5DYOB 1OD9A 3BKCL 5CKGA 4PJ5D 2IBGA 4LAQL 2X41A 1NBVH 3TO4D 3MBXH 3T2OA 4K23H 1TJGL 3LRHA 4F3FA 1UWXK 4KRPC 4H26A 4IOIB 1T22A 4PJCA 5EU7C 3KYNB 5D2NE 1MNUL 1T21B 2GYSA 5TFSH 4Z7WF 1NCCL 3LQZA 2QQNL 4QRRB 4HD9A 1GIGH 4KI5C 4YPGA 5SWZD 1S9YA 4H8WC 1BVLA 3BWAA 2Y7QB 4YGVB 1AGBB 2H1PH 4PLOB 1FZMA 4I18A 3QWQB 2HG5B 3WSQH 4P57A 4K55A 3OR7B 5D1ZB 3OG4B 3H7LA 5I76A 3DO7A 4RCAA 5D1XD 4Y16D 3BISA 4XPTH 4HUWA 2EDKA 2W9DL 4OD1L 4LEXH 2VXUH 3KJ6L 4HIIA 3MJ8B 4Y5VA 5KAQF 3AM8C 1OWRM 3R0NA 3EOBB 2GFBB 4L8DA 3SE3C 4Z78A 1N0XL 1QBLH 2EC8A 2D0FA 1LK3H 2BY3A 3BAEL 1QYGL 4HHAA 1SMAA 2CDFB 3IETA 5HHQB 4E41D 4F8QA 5I1CL 2GJZA 2FYYA 5I74C 4IDJH 4HGWB 2ITDB 3HAEG 2ZKHH 1JK8A 4OCNC 2X1PA 3LKRA 1NC2B 3MOBL 4Y2DA 2V6HA 3EYUH 1JPTH 3BPOC 4GS7B 1D5XA 4I48B 4N0UE 4XH2B 2HWZL 1B0WA 1P6AB 4WU5B 4ZNEA 2GY5A 2P44B 3RWFB 1X5AA 3EYFA 5DT1L 2UZIL 5E2JA 1PYWB 2OXHA 2AJXH 4YXKL 5DHVH 3E2HB 2OI9B 2BRRL 5HPMA 3BRFA 4DCQA 3CPLB 1I7RB 3RRQA 4TVPL 1WZMA 1KJVB 3MX0A 4BELD 1A6WH 1NCDL 3FRPA 4HKJA 2N1KA 3B9AA 3MUY1 4UT6H 3RWFA 4RAVB 1FFOA 5JA8B 1HDMB 1NAML 2VLJD 5F7NC 3BZEB 4WU5A 2V9RA 3C5JA 1PG7X 3IFPA 5EA0H 3D85B 4X6FA 3T0EB 1HCVA 1HEZA 5T1DL 4G6JL 4YZFE 1L7IH 5IR1B 2A2QT 2VZOA 1MCBA 5GXBB 1I9IH 4A2LA 1OAKL 4FXKB 4J3XA 1EZVY 2A73A 2IAND 1I1YB 3PWLB 3DGGA 4RAUA 5T1MB 3SDCD 2J4WH 5I1JH 2CRYA 3KPLB 5DMJB 5F7MC 3IETB 3HPLA 1P69B 4M4RA 3LKOA 5FHBH 3C6LB 5JOPE 3DX9B 1T6VN 4C56D 3MRCB 1G9NH 4PLJD 1MQKL 3O6LH 4ZUUA 1UYWL 4PJEB 1MAMH 1NC4D 1P7KB 4HC1H 4HC1L 1W72A 2B1HL 3OAZK 3PE9A 1GGYA 4GAJH 4JY5H 1D6EB 5CKAA 3V0WH 4XP6L 5FHAH 5F6IC 4Y5XA 4U33A 5HI4D 3S34L 3O2WL 3O2WH 5HYQB 4XPTL 3BDBA 2YPLA 4ODWA 5IJVA 1XGPA 3DX8B 3CSGA 2NX5A 4OB5L 3CDGB 3TCLB 5BZDB 5DK2B 4OTXL 4KKAC 1PVHA 2IAMC 3ARBB 4LMQI 4CADB 4HWZB 1WBZB 3IXAB 3B8SA 4FQ1L 4KROB 4S11A 2BJML 4YC2B 1IQDA 4BH8A 5ISZD 1E6JH 3MYJB 3WEXB 3KPRA 1KTLB 1JGEB 3PF2A 4PRBB 2JK5B 4GJTB 1YPZA 1QBBA 3VRJB 1T1ZB 4J3UA 3UTSA 1RSFA 3QHZH 4CJ0A 1V7NL 1CTNA 4LPYA 3D5OF 4GOSA 4NBXB 1CGUA 4WHYH 4KZEL 4Y19D 3SKNB 5MERB 4KZDH 3LN4B 4FQQA 3MLUL 1G0DA 4HK3J 1RUKH 3QUYB 2EDYA 4JRYA 1KEGL 2XN9E 1TETL 5D70L 3PL6D 3W9EB 4P9ML 4PJDF 1QFWM 2YPLE 3U4EA 1J87A 1BP3B 3QUMH 2BRQA 3UEZA 1PDKA 3QUXC 3FKUS 4RGNB 4OGXL 3CDFA 4QCIB 3GMPB 2JB5L 1HQRB 4NJAH 2VZTA 2O5ZL 3MNZB 3BQUB 5D2LA 4OZIE 2RCSL 1EMTL 4NNXA 1JGUH 1U95B 4Y89A 4C56E 4FXGB 4P5TB 2C9AA 2ZUXA 2BERA 2E7LA 4M8VA 3ETBF 4GRWF 2ZZUT 3S4SG 3FFCB 3QI9A 3TH3T 1FVCB 4F80A 5F7YC 3HG1B 4PJIF 3LVEA 1ACYL 2WINA 4ZDHB 3BUTA 4JHAH 1KJ2L 4GXVL 4P2RA 2DI7A 1QSFE 3ME0A 3DRTB 4P59L 3Q0HA 2F5AL 3MCLH 1MCCA 2C5DC 4CUCA 4KH2A 3GSOA 1QPPA 1FVDB 1JVKA 1KJMA 2VRAA 1G0XA 5T1LB 3MLXH 1JGDB 5C0CB 3QEGH 1XR9B 4XNMB 4Z95H 3QUZC 2YZ1A 1BIHA 1FFPB 5BOZG 2E3VA 3QG6B 5E4EC 2E5EA 3V6ZA 2EIZA 1OAZL 5DJ2A 3STBA 3C5ZC 3ARGD 3MBED 3PGDB 4BSVA 1BEYL 4YIQB 5I18L 4MD4B 3U9UB 1BZQK 4GAYB 4FQQB 3PWNA 3ULVE 3RIAF 3LD8B 4X6EA 2XZQH 3OXSA 5JUEL 2YSSB 3HMXL 2QHRH 3DNKA 1B2WL 5CZXD 1HOCA 1UEYA 4ZFOA 4QTHB 4PP1C 4G8EB 1G84A 1WFOA 2VXVH 3HLAA 1JGEA 1ZLWK 1T4KB 1DEDA 2IPTH 3ILPB 3MCLL 4Z7QE 3OKOA 2HTLC 1HI6B 3KLAB 5E00A 2X4UB 3OHXA 2JKXA 4Y4HB 3V0WL 2X4PB 2P5EB 1HZHH 4DKEH 4PJHF 2VUYA 35C8H 4ORGB 35C8L 4CU6A 4M6NH 4NZRL 1DLFH 1YYMH 4ODBD 3STZB 5E24E 1MLBA 5DGRA 5HHNB 1TQCB 4HUNB 3D87B 2MCPL 3D69B 1E6OL 2NY6B 2NY3C 4XX1E 4DZBB 3PGDA 2B20A 3WKMH 2I9LA 5ADPL 1QFHA 5IM7B 3TBWA 3HE6A 4MNGE 5GS0L 3TO4B 5I1GH 1K5NA 1K4DB 3KJ4B 3SO3B 2DWDB 5TE6H 2DLHA 1DBMH 4OM1H 2XA3A 4JR9L 4L1HA 2D31B 3U36A 2OK0H 2VIRB 3TZVA 2F8XC 4WEMB 4I2XB 1I7ZB 2AQ1A 1MFEH 3CFIC 3PWLA 5T1MA 1T1WB 3QIWC 4G7YL 1NMCB 3FZUC 4PJAF 3MROA 5LJYH 3VMNA 3O6KL 4XZUA 3KLHC 4W6YB 3SOBL 3MRNA 3GSUA 4E0RA 4E5XA 2AJ3B 3MCKB 1ZHNB 3D85A 4X6FB 5D2NC 3L9RB 4L8BA 4AG4L 4Y5YC 3MV8B 1LP9E 2FR4A 2EDWA 3FB6B 1JNHA 3OB0H 3LMJH 1V7NH 3FCTA 4M6OH 1CGWA 4LKXA 4HK0A 3T3ME 4D8PA 1I9JH 1MVUA 5T1KA 5CBAB 2PO6D 2CK2A 1IFHL 4MAYC 4J3VA 4NNXB 3O3AA 1LP9F 2VE6B 4OUOA 3LH2H 2X1OA 1ZMYA 1HQRA 3P0YH 4XH2A 3V4UH 5IB3A 1I8LA 3GBNL 3FB8A 1PSKH 2XI9A 1WC7B 2HKFL 4R6UA 7FABL 5MENE 2AK4D 4MNQA 2XRAH 4Y4KC 5SX5H 2H8PA 4KWUA 1UKQA 3DVFA 1DN0B 3QWOB 1FE8H 5GJTH 5FOBB 1EVUA 2X4QA 3TN0D 4KKCC 3B9KD 2WSKA 3BPLB 4WI4A 4BQCA 4Q9CA 4GBXA 1JGLL 1NUGA 3IS0X 4KFZC 5DFVC 3S35L 4DQOL 5EIIB 3FN9A 3WDHA 4JZNA 1FG2A 5I9QB 3QDJA 4KXZI 4HFWB 2FBJH 4D0CB 2ESVB 4YDVA 1BECA 3FHAA 4OKVB 1D7FA 4M48L 1S9WB 2MFNA 3MLTB 1WVZA 1QSZA 1ZHKA 2CKBH 3C60D 4PJFA 5I71B 5DJZA 4Y4FD 3BN9D 3BXNB 3TBTB 3IKKA 5LGJB 1BBDH 1GIGL 1JTPA 1S8DB 5DVNA 4F2MB 4YHZL 3JWOH 3F58H 3Q6FA 4NO0B 1ZS8A 5HY9B 2WP3T 2YMXL 4Z9KB 3ULVF 2ZCKL 5F1IA 3RWCA 5GRUL 2XN9B 1DQQA 1KJ3L 1OAXL 5DHXB 5HYQA 5I1AA 3V5KB 2AJUH 4O00A 4PJHA 1D6EA 3FN0H 5IVZA 3T4AB 6FABH 2CJUH 2G2RB 3G6JF 2YN5A 1QO3B 4U6VL 5SWZB 1W0VA 1NAMH 3HAEA 1F90H 3UCRA 5IBTL 2W0LA 4J4PC 4P48A 1T5XA 2QSTA 1BHGA 4HKBB 3C6LA 2D7QA 5JOEA 5BVJA 2EDBA 4PLNC 3DHMA 3FQWA 3HC4H 4RWYL 1IBGL 3NCCB 1B4JH 2Z31A 3UYOD 1ONQA 3DMMB 1N0LA 1ZAGA 4P2QA 2AXJA 2PF6A 5DUPL 5KVDL 8FABB 3VFWB 5IR1A 1NPUA 5CSGA 1G9MC 4MCYA 1SVZA 3S3PA 4NBYB 1DBJL 3WD5L 4BKLA 3M17A 2D9CA 3K46A 2X1WL 4N1CA 4XWOC 1H5BA 5DFTA 4E41B 1JYWA 4O51B 2GK0A 4HS3B 4PJ9C 1TJHH 1Y6NR 2VAAB 3MRLA 2DD8L 2Y06H 3FO9B 5EUKB 2W91A 1U3HA 5IUSA 3BH9A 2XT1B 2H9GA 2MHAA 3MRFA 1WISA 2GY7B 2HFEA 3N1GC 3RA7H 3D39E 4NKIH 2H26A 4WV1C 1CLYL 4EBQL 3W11D 5IFHH 4ZNCD 3U46A 3JV6A 2B8OT 3GMRB 5DEZA 2V7HA 4KTEL 2IGFL 3N0PB 5EULV 5GSRA 2Q7YB 1JF1B 2IC2A 3MA7B 1BF8A 3CLFL 2DM2A 1EUTA 4GRLA 5IB5B 1WEJH 3SE4A 2XWJA 5I1JL 5DXWA 3QDMB 3GHEH 2GJ6A 3O9WD 2HH0H 3O0RL 3ULUL 2V5SA 5I73C 2IQAB 2OJZL 3B6SA 4YPJA 1INEH 3V79C 3T4YB 3CSYA 4TSCL 1A7OH 4XMPH 3BKJL 4K7FA 4F58H 2BNRB 4LLQB 3MJ8A 2Q8AH 5IVZB 2VLJE 4PRPD 3HNSL 2JELH 5E99L 2YUWA 4TNVK 3H7BA 2AJUL 4JRXB 3C2SA 3L3KB 2AERT 3BE1L 3QULB 3EOTL 1XF3B 5IB4B 1JZ8A 3OR7A 5D1ZA 3MJ9A 5HHXL 1XGRB 1XF3A 4LVNB 1NUFA 4L4VE 4K07A 3Q6FB 3OKEA 1SY6A 4GKNB 5DD0H 4LCCA 4N5EC 1RZFL 2Z91A 4AY0A 4YHLH 1A21A 2NXZD 2APBA 4NN5B 4HIHB 1AKJD 1G9NC 1XFPA 4GRLD 3X12B 5K9JH 5KG9B 3SY0A 3KYKH 5FYLE 4JJHA 4U6HB 3EIFA 4ODTL 3DXAE 1EGJH 1U42A 2ARJB 3MJ9H 4UB0L 4WTZG 3VGGA 5MEOB 2NR6D 1NJ9A 2WIIB 2XIDA 5DJ0B 4PG9A 2M2DA 2VLJA 1UM6H 1J8HA 4LSSL 3D25A 4M7JH 2RAMA 3B5TA 2LFGA 3SE9L 4W81A 4X4XA 2X7LB 1DBJH 1FNGB 5JXEC 1E4WL 3FAWA 5ISZB 3EDDA 5D1QA 2GTZA 4OF0A 1ZWIB 4MA7H 4TRPL 3OAZH 4RRPA 2ESVE 2H8PB 2X89D 4MNQB 2OSLA 3T8XA 2Y06L 2HFGH 5L8LB 1CFSA 4IJ3C 5ALBH 3ARFB 2XICA 1T66D 4AMKH 2BNUA 2CKBB 2L0DA 4OAWA 3BH9B 1TPXB 3P9MB 3QIUA 2XV6B 2IMMA 2UWEA 4HS6B 1IEAB 4LL9A 3P4OA 3I6GB 4Z0BL 2DQCL 1VADA 1A1MA 5SWZE 2Y9RT 5ADOL 1SJVA 1WZ1L 4OCXL 3VW3L 1LGVA 3HRZA 3T09A 5E94A 3B9DA 5I19L 4K3GA 1YEIL 1OAXH 1F3DJ 4ZQKB 3BEWB 2ZJSL 1CFVL 3MBEA 3UX9B 5L7XL 4LOUD 3RTQD 3EYSH 4NC1E 4D0BB 3LIZL 1FL6B 4MJ5A 1B88A 3NCMA 4IRZL 4M93B 3RHWF 2HLAA 2VZUA 5HGDB 3ZKNC 1XR8B 3DXAD 3QP3A 5T1KD 1MIML 3T0ED 3VXTB 5C6WH 3X13B 4UQ2B 5HDOA 2W07A 5IB1B 4PBXA 2P5WE 3JTSB 4JHWL 1MQ8A 1TQCC 1RUPL 2XTJC 5IBLD 3MJGX 4OIBA 3HR6A 5D6DA 5DVLA 4EUPA 2X4RA 3G5VB 2NY0C 5GS0D 1C7SA 4I3RL 1IRAY 3ALXA 4Z5RA 2BSRA 4OFYD 3LKPB 4PY8I 5IVXF 5CJXA 2DMCA 4QYOB 4BH7A 1F4YL 3OKDA 4XXCC 3U9PH 3OXRA 3T2NH 4HUXB 2X4OB 2R2BA 3WFHA 4XTRD 1LMKA 3GIVB 3TPUA 1S7TA 1S8DA 4M1GH 4NN5C 2BNQD 3SCMD 2C3XA 4F2MA 4AIZA 3VWJB 2YZ8A 1UJ3A 3ULSA 4FQHA 5E00B 2R0KL 3D39B 4RQQA 1KLFA 2P5WA 1ACYH 1XZ0A 3U7WH 1T3FA 5IK3B 3FFDB 4YXLH 5FKPB 4H8WL 5EFIA 4HWNA 4X9IA 1AGFB 1UH3A 4ZFOB 4H5SA 1OGAA 3FQUB 4P4KB 1AE6L 3QDJB 4MD0B 2H3NB 1M05A 5IBUG 5F7EL 5BV7B 5C0RL 4HF5H 3U6RB 2YD4A 4MB5A 2GCYB 1WIUA 1OAKH 4WFGE 2B39A 4N0UB 1H3UA 4HH9A 1WZLA 5HYJD 4E42A 2NYYC 3PWUA 3VXME 3G6AA 4X7EC 4XC3H 4OLUH 3I3EA 4G7VL 3CFJB 3I2CL 4TUOB 2UVFA 2C7UA 5E56A 1UXSA 4Y2DD 4QRUA 1DP0A 3ZTJG 5L2JB 3BP4B 1I9JL 1UB6B 1MCKA 2NTFA 2E7BA 5GGTA 3ZKSD 1YN6A 2UUDH 2X1QA 3QUKA 5JW4Q 1I8KA 1ORSA 1QSEE 2Q8AL 1S78C 3K2UH 5C0CA 1YEIH 4MD5B 1GL4B 5DSCB 2DJUA 5CLWA 1C8PA 1LEKB 1BZ9A 4HWBL 3SGJC 2O5YH 4G6MH 1IEBB 1JNHB 4LCIH 4LCWD 2FCBA 3RWJA 4UT6L 5CJQL 4LARH 4RMSA 1CDBA 5A16A 1EUUA 3BH8B 3N9GL 5D5MF 5KVGH 3A6CH 1DVFB 1S9VB 3TBSA 1AI1L 3VDCA 4ZFZA 2YA0A 3FHQA 4JQIL 2AJ3A 3VXQB 4WUUB 3SGEH 4FTVD 2DL9A 1TJIL 3TT1H 4BQ9A 1HYSD 3VXPA 2PW1A 3RWDB 1LD9B 4JKLA 2QBWA 2VDLL 3SGDI 1CGYA 1Q9WA 5MI0C 1UXWB 3UPRB 1KLUA 1AXIB 5CJ8A 2JCCB 1MSPA 3ELAT 4Z7WA 1O7SA 5JHDA 1KV3A 4MDJB 1LDSA 3OR6B 4GRWE 1B6DA 3BVNB 3QO0A 1ZK9A 2NXYC 4F9LA 4UTAL 4ESKA 1CFNB 4MA7L 2ZUWA 4TRPH 4V1DD 2J8OA 1BJ8A 2WM0A 4ODXB 1AHWC 1LEIA 3RUGE 2FJHA 1ADQL 3RI5K 1A6VH 3D18B 4ZD3L 5AAWA 1RJYA 1MEXH 2VR4A 2PO6B 5INCB 3GIZL 4L4JA 4R4NC 3NA4A 2ADJA 4URTB 4U1JB 2PTTB 4OI9A 3U7YH 2F53A 4QXGL 3OZ9H 5EZLB 4X5WA 3B3IB 2DYPD 4UV7H 3FQUA 1D9KA 1UA6H 4PRHB 5JA9A 1TJGH 1U58B 1OD7A 5F9OL 1ZHBB 4WI5A 1N5AA 1KJ2B 1YY9C 3DYMA 4C4KT 3KPRB 3IFOA 4Q9RH 2R1XA 2P8PA 3NVQA 4RMTA 4ZAKA 1PW3A 5TQ0L 3C6SA 2H32B 3QIUD 2OR9L 1ETZA 4NJ9L 4MXVE 3FO0H 4MD4A 2R2BB 3OJVC 1MCEA 4WFHE 1JNLL 3BZ4A 3RZCC 1EHNA 3VWKA 1AXTH 1RJLA 1ZVYA 2MNUA 1MRFH 5K59E 2JIXB 1HINH 4JG0L 5KBNC 2B2XH 1INDH 5ICZB 3MXVH 1P7KA 5GRVK 1I85C 4NKIL 1CDUA 4LSQL 5T1LA 3H2WA 1I4FB 5L0QB 3P30H 1SBSL 3PNWB 4CW1A 1UWGH 3RZWA 3D48R 1YC7A 4PP2B 4OZGF 3TWCH 5IV2B 3OKKA 4Z7UB 2F53B 1X5JA 3IF1A 4I0PA 3HAEH 1YZZA 4Z18A 5H35B 1K9TA 3ROOB 3MLVL 4YFLF 4YR6A 5F3BA 4H20H 4HUKB 4J7RA 1UG9A 4U1NA 3QIBC 1WITA 3M07A 3LIZH 5DR5L 5JHDD 1LEGA 3NCEB 1CVRA 3IVKB 1JYVA 1A7NH 4QRTA 4KPHH 4LHQB 5D2NB 1OW0C 3TCXA 1KN4H 1WBXA 4JVPA 1B4RA 4X99A 4LPCA 5ESVB 3BP5A 1ZANL 5FGCB 5HGHA 5GS1B 3P0YL 3V4UL 4C54A 4OCWL 2Q87A 1RAMA 5ABDE 3RY6A 5FGCE 5C71A 1HWGB 3TLRA 5CD5D 5EO0B 4Z7WB 2YPKB 2CKBA 3O4OB 3GMPA 4KROC 3AROA 3L3HB 3QJFB 2PXYC 5GRXG 3T8XB 1AQKL 1MFAL 3VXPB 3MLZL 2ARJQ 1NGXA 3TA3D 4HFUH 5KVEH 3JWNC 3B4NA 1J0JA 2VXTL 4C83A 4HV8A 4L9LB 1JN6B 3WFCH 2FYYB 5T3ZH 1FNGA 4PJBF 4NT6A 3EOAB 3ARDB 3Q5OA 1S7RA 4XPGL 4NQCB 1CLCA 1PG7H 3WFEH 1TVBA 4PJCF 1XGQA 1KIPA 1UM6L 3J7HA 4Z8FL 3QUYC 5CGYC 4NIKB 4ZFFB 3E6HA 5B39A 4LIQL 4JO3H 2F74A 1T1ZA 1WCQA 4OIIH 4TUJB 5JIHA 1H15A 4JG1L 1T3FB 4YBQD 5IK3A 2ENYA 2IFGA 1IL1A 1CD0A 5CP3H 3GRWA 3E3QC 3IJYA 4UNVA 5GGVY 2J6EL 3PL6C 5HVGB 4AIZB 4CADA 3CLEH 2EDNA 4KK9C 1G9MH 1XT5A 3TIEB 1FO0A 2ITCB 2WQ8A 4M43L 3I50H 4P5MA 4I3GA 5E8NA 4GAFB 1MFBL 1NCBL 1YNLH 2A38A 2QQKL 5CAYB 5JIIA 1KBGH 2AGJH 4QYOA 1NBYA 5ACMA 3BUYA 3B8YA 3VFNB 5JW5A 1F97A 2HVJA 4Q2ZA 1FZKA 3SGEI 3W81A 4HJ0D 3UDWC 4JDVA 5KVEL 2FZ3B 4K2UL 4XPHL 2Q3AA 3V5HA 1OP5H 4OD2A 2YOCA 3E6FB 3DIFB 2YD6A 4LLWA 1WF5A 1I3RA 3GI8H 5DA4A 3VFSA 2P24B 2IBBA 3TT3L 1PG7L 3VXUA 4OGAD 5TQ0H 2QHRL 4FFWC 1KNOA 2VL4A 2UZYB 1S7QB 2HYMA 5IOPA 2IALB 3GSWA 3QXUA 4YX2H 5FFLA 1MHCB 1U8MB 2HLFD 5AYUH 2NTSP 3JVGA 3RVVC 1N3NA 5IROA 5GHWH 3DETC 4X4ZA 4TN9A 3QEQB 3S6CA 4IOSD 1FAIH 1GJIA 1Z9LA 4K3DH 3GBLA 4AM0A 3ULUF 4NCC2 1J0YA 1B0RB 1BBJB 2ED9A 3GJFA 2J8UA 4PJ9B 4YUEL 5FYLH 4ELKB 1MHPH 3QNZA 3H42H 1BAFL 3O6FB 3IAGC 3G08B 1Q0XH 2HT4C 1FH5L 3RTQA 3QZWB 3FO9A 5EU6D 5IQ9B 1T03H 4YBLC 4OGYH 2ERJC 2UWEB 5J6HB 4NNYB 2X9XA 4OAWB 1WZ1H 4GRMB 4OCXH 4FFZH 4PJ7E 4G8GA 1U2HA 2FX8H 2DLTA 2IH3A 3VXTA 4FRWA 4PJ9A 1A6UL 1H5BB 3PQYD 4UINL 4XHJD 3WNMA 4KAQH 4ZO9A 4JR9H 1U8KB 1T80A 4Y8AA 4OM1L 2XKSA 3D9AL 5J9PB 2AP2A 1RIVH 3RHWK 2YC1B 4R0LA 5IKCA 4K7PL 1OM3H 4MJ5B 1K8DB 1CI5A 5B22A 1INDL 1JWMB 4MGXA 2VLKB 1GGIH 4ZQKA 4OBRA 3TN0A 5I8OH 3KJ6H 3RWIA 5C0IA 4FMFA 2ICWJ 5C1MB 5EBLB 2NY1C 3HRZB 3FN3A 2OQJA 1R3HB 2WIIA 3ES6B 3RBGA 1X4XA 3U30C 4P2RE 2HTLD 2YR3A 5TF1H 1W0VB 5DD5H 3QDMD 3EDKA 1QFOA 5KG9A 1ITCA 1CXFA 1R3JB 3CC5B 3HMXA 4FG6C 3L7EA 5HYSA 1CR9L 3O9WB 5GGVL 1MF2H 1U92A 4M6MH 3CFEA 4UAOC 4XCCH 2IBZY 4FMKA 4OLYL 1KFAL 5LCVL 3IDUA 4KGJA 2PYED 2R1YA 3QCUL 2B5IC 5DHYA 3BEVB 3OF6D 3D3VE 5C0DA 4Z7UE 4H1LH 4OCSL 2OBGA 4YQXL 5B3NA 3D3VB 4LLYA 1WWBX 5ISZA 3VMPA 3NPSC 1U93A 5C07D 3ARBC 3P9LA 4P46C 4X7CC 3N85L 1S7UA 2E27H 4DW2L 5JNYA 3QRFM 2KKQA 1QRNB 1GZQB 3G6DL 3T08A 3VXUB 3RWGA 6FABL 1QVOA 1J05A 1QPXA 4G7YH 3CSYB 4JZJC 4ONGL 3GSXB 5L88L 3L3GB 2F74B 4P4RA 4F57H 4OLEA 3BKMH 4LLVA 1RFDH 4YDIL 2G60L 3QIWD 2HN7B 3T0VA 3SDDD 5JNYB 3LS4H 3WS3A 1RZJH 1XAUA 1YEHL 3P9LB 3UTZA 5M94B 3CVHL 4JPVL 4HPYH 4N90E 4PJIB 4AEHH 4HK3N 1HH6A 3G5XA 1CE1L 4U2ZA 4AJ0A 4I9WD 4XNQA 5TDPB 3VJ6A 5I30L 4YHPA 4EN3A 5DZOA 4AK1A 5CEZL 2XTJE 2P42B 2COQA 2ZUUA 2LU7A 4UQ3B 2R39A 2C4FU 3IU4H 2OL3H 4F9PA 3S36H 3W39B 1FIGL 5A40E 4BSWA 1MREH 4AZ8A 5HHMD 43CAB 1NEZG 4GG6A 4NC1C 3OKLA 4FQPA 4LRIA 5IHUL 2MHAB 1LE9B 4YBLB 4S1DD 1H3PL 5EZIL 1NGWA 2Q1EA 1HKFA 1CGVA 3KPRD 2IEPA 3IFNL 4OZFG 2XQYG 3ES6A 5K9KB 3QHFL 3TBYA 5GISH 1DSFL 4NQEB 4XP4H 3Q2CA 1IGFL 4NZTH 2J88H 3WFBL 5I1KH 1R5WA 2G60H 5CS7A 1BFVH 3P30L 4QXGH 5CZKA 4OZFB 3K2MC 5L9DH 3M45A 4L8SA 5K9OB 2DQHH 1PLGH 5IKCB 2ZCHH 5TJWK 5DRZA 3QISA 1NCAL 1C12B 3B5GA 4OUUB 3MRDB 4DN3H 4WO4B 5FCUH 2ATKB 3LSOA 5EOQL 1R0AH 4JHZA 3EYSL 3KPRE 4HDIB 4CW1B 1YNKL 3PP3K 2VIRA 5IG7A 2X05A 4HUVA 3CFCL 2B1AL 1P4LA 3MJ7B 5DDHA 4FTVB 1PEZA 2XTJB 4HKXA 2QHLA 3FB7A 5DI8B 1K4DA 4LASH 1OT2A 3NFPA 4ZPVA 4HT1L 1C1EH 4E41A 4BUGA 4PJHB 4ENEC 4OLXH 2OYPA 1KCSH 1HNGA 1GZPA 3DX7A 3DLQR 3HNTH 3VE0B 1FSKC 4MJ6A 4JFED 5DUBA 5E5MA 4F7MA 4MWFA 3FN0L 2XN9A 4WFFE 1OGTA 2CR3A 1NCDH 2VKXA 2EYRB 5FK9B 4PFEA 3EO9H 4P2RD 4KI1A 2VLLA 5F88A 4HQQH 1A02N 3B83A 3O6ML 1MAKA 2J88L 3IF1B 2VYRE 4ZO7A 3OHXB 4JQIH 3ZKXB 1M7DB 5HD8C 5FO9A 4JM2C 4PJFB 1M6OB 5DUMH 4HUUB 2VISB 5DLMH 2AJSL 3G5ZB 1JZ4A 1O5DT 2YEZA 5AAMA 4UIKH 1ROWA 1BMGA 2BNQB 5DVOA 3ARWA 3VGEA 4KI5E 3HA0A 3QH3A 4JFDE 3RWHA 1I7TB 3QEUA 4WDIB 4JQVC 1EEYB 4UDUA 4M1DH 4QF1B 1JPSH 4HZAA 5JW5B 3RAJH 2GW5A 1JMXA 3DV4B 1GH7A 2DQDH 3G9VA 1GAFH 1S3KH 2MWCA 2C4FT 4PJFE 1P2CA 1VKXB 3OG6B 1VPOL 5D6CB 3QCVL 3NCFB 3C5ZA 2F19L 4YHOH 1WC7A 3TJEL 2EDXA 3V6ZB 4XRCB 4N1HB 3VXSE 1RZ8A 5HYJB 2R1XB 3IXTA 3QDME 3IDNA 5FA4B 3A6OA 3IFOB 1CFNA 1KACB 5HHXH 3DOSA 4Q7DA 3L6FA 4XXDA 3BKML 1RZFH 3AREC 5A1AA 1MPAL 2JCCA 1GOFA 1NLDH 3MV8A 3VH8A 5FGSA 3SCMA 1AQDB 3UC0L 3KG5A 1IC7L 5IESH 4GXUM 3DX6B 1YJDL 4NQDB 5D4QA 3QYCA 1L0QA 2F54E 1YY8A 4JKWA 1F8TL 3H8NA 4KK8C 3QQ9D 3SDCC 1KPVA 1BLNA 1CLZL 1RK1B 4PB0L 1FNEA 3KYOB 1A7QL 5DD3H 4NKOA 1M4KA 2VDOL 3GI9H 1OP3K 1EHLL 4PJIE 5C0EA 3FOMB 2UV3A 2Q76B 1W2KT 1IGYB 4KRPD 3TNMB 5BV7H 5KAQG 2NY4C 1MJ8L 2AXGA 3T3PF 1OTUC 1KULA 3DRQB 4OF6A 4PJ5A 1BZ7B 1CK0L 5J6GB 1G9ML 4QRRD 5E7FA 1ZT1A 4G6KH 3EUUA 4LKCB 4G42A 1VESA 4O5LL 2O5ZH 1RIUL 3TVMC 2NTFB 3QT2A 5DJDB 3SDAB 4PTUB 3C09C 1ZSDB 4YHZH 5DQ9A 3MRNB 4HAFA 3DSFL 4Y4KB 3PWUB 3PHQA 4LQFH 2CIIB 4GRLC 2DRUA 5FF6B 5FKAA 3G6JB 4S0TD 2ZJSH 1ZGLA 4YHKH 4S0SD 2KBGA 5CWSB 4PTTB 5I66B 5JUEH 3VFGH 1KN2L 4P3CH 3O6FD 1KSRA 4P23C 3TA3B 5SWQA 1NLBH 5GZOD 2PR4L 4L29B 4R3SB 2WMPA 5FA4A 5AYUL 4RX4D 4XRCA 5HTSA 2P5WB 2GJ6E 3E0GA 1GHFL 1U3HD 4MVBC 1RUML 4IJ3B 3TIDB 4HIXL 15C8H 2BSED 1IC5H 3CUPB 2M26A 1P2CB 1JHTA 3QFJE 5F9JA 5EORH 2ZPKH 1Y6MR 1T04A 4U1MA 4PG2A 4NUJA 5C08D 4R90L 3SJVB 5DQJA 1LO0H 2X4PA 3LKPA 3CVHA 1I7TA 1T66C 4HIEB 2AEQL 3UBXA 4GW5B 4N1EA 1NLDL 4PS4H 5HI5C 3VRLF 2FGWL 4P4KA 4PJEA 3ULUD 1QFWH 5CHNB 3JVGC 2BNQA 5DMGC 3GEWB 3V4PL 3C6LD 1D9KB 1M7DA 2OK0L 1W0WB 3K3QA 5GQBA 3B2VL 3REWA 5FO9B 3WNKA 4JFEE 1G6RA 4RZCA 3G6JA 3LRSA 5I8OL 4JM2A 4P0DA 1JTTA 1VA9A 5I17B 3BJ91 4Q0XL 5ITFB 4MNQE 1V3MA 1HHHA 3L1OH 1J8HE 4PREA 5DLML 1KENL 1G6RH 3MGOA 3MOAL 4HIJB 3BW9A 5EU4B 4ZUWA 1RZJL 2YWZA 3MLRH 1LNUA 2CMRL 3CLEL 2EIZB 2YXFA 2F15A 5GS1C 4JGMA 3QG6A 4NRZB 4NJAL 3BD4A 4JCLA 2DKSA 2KZWA 2UYLA 1NC4B 2FIRT 3BGFB 5TFSL 3KPNA 2QL1A 1QUNA 3DV6A 1A5FL 1IGTA 3GRWL 3RI5F 3KYMB 2CRZA 5GZND 5CEZD 3TNMA 2E7HA 3EJZD 4ZOAA 3CMGA 1EJOL 5D1XA 2NLJB 1XCQB 3BP7B 1XMWA 1YEFL 2AW2A 3U4BH 1K2DA 3SDAC 5K9OA 1TFHA 5L6YH 4MNGB 3O81A 1PBYA 1PSKL 2ZSWB 3RWDA 1V5JA 4DGYL 1GPOH 1NGYB 3WHXA 1EA9C 4JQXC 4Y2OA 5J0BA 1Z9MA 4P23A 4HEPG 2EDQA 2GTZB 1S5IL 4HGWA 4KK5C 4M7ZB 5K9KA 5F7WC 3ARDC 3X11A 1OAQL 4NQEA 3VH8B 3O8XC 1U91B 2BCKB 3BPNC 3KDMA 3MACL 3AB0C 5EIQA 1ZV5A 4QHUB 5F44A 3F7VB 2BJMH 2VL5A 5D96B 4WI7A 5L9DL 1LK3L 3LS4L 4DTGH 3DPBA 5IFAH 3E8UH 5ACZA 4FZ8L 4XXDB 4ETQA 4HH8A 2OL3A 1DEEB 1X4ZA 2Z92A 2CO6B 2XACC 4PJBA 4Z7NE 3QPXL 4O4YL 4NQVA 4XCCL 2G5BB 3FQTA 5IEHB 3O2VH 4F7EA 1UCBH 1T2QL 3LZFL 2VDNH 1ZLVH 1KG0B 3CFJA 2YMXH 4XNQB 5BO1H 3BDYH 1XGRA 1H0DB 3AMKA 4JJ5A 4LHUG 3UTSD 3OGCB 5GRWA 1UKSA 2BHYA 4KAQL 4Z7OE 5ICYA 4EI6B 5IFJB 2EYTB 1C5BH 4JPWH 4M7LT 4X9HA 4XGZA 3L5HA 1OTTC 4WWKA 5DK0A 5CZVH 5CZVL 4X6DE 1CF8L 3GSXA 2WWKT 5C6PB 2XYCA 3T0BA 1RIUH 2YUZA 1T0NA 1J1OH 4Z6AT 5EFIB 4EQ3A 1ZEAL 2JK5A 2IQAA 2MPAH 2CUHA 4GRWB 1LK2A 3O3DA 4KJPD 1QVOB 5T1DH 3HS0B 2CLVB 1I75A 4LAQH 1A7RL 2OX5A 5DYOA 4LLYB 4XPFL 4LLUA 2ZUQB 3ULSB 2A9NL 4ZPTB 1ZTXH 3CCHA 2AXFA 4LCUB 5B3JE 3CIQA 3VWKD 2WUBH 3L5XH 3WFHB 2J4WL 3FQNB 3HMXH 1OPGH 2N56A 5KSVB 4XP9L 1ZLVK 4BH7B 4MJ6B 3VWJD 3CFCH 1VHPA 3SDDB 3CFBB 3VE0A 1E4WH 2WBWB 5GS2H 5SV4A 2PO6C 2X4RB 3G5VA 3LB6D 1X9QA 1GHFH 3QEQD 4K3JH 4DCQB 4PUBH 5EU3A 3VXRE 5E08H 1EHAA 2A1WL 2VN4A 4CAGA 2Y07L 4NM4L 2YUVA 1U91A 2BCKA 4YXHH 2DM7A 1QSEA 5BXFB 4KDTA 5I16B 2E6JA 2BDNH 4U1IA 3FFCE 2FJGA 1KBGL 4J3TA 4MJIA 1FVEA 3EFFA 1PY4A 2DQJH 3LEYL 3OAUH 3MA7A 3KPOB 4HPOH 5KS9B 4WFED 1AE6H 3EYVA 3ZDYE 2OTUB 5D7JC 8FABA 3TN0C 1QBLL 2R4RL 4H0IA 1P4BH 5KTEL 3UAJC 4NP4L 1LDPH 5IW6B 3AY4C 1OB1A 1U3ZA 4UIKL 3C5JB 5FM5O 2LVEA 1AY1H 1HNFA 2PTVA 4YBHA 2E8YA 4K9EC 2E9IA 1CDIA 5FGRA 2Z93A 1TVDA 5LWYH 3BIAX 1AGCA 1KIUA 1AFVL 4OJFH 3QO1A 3EJJX 2FBOJ 4JFHD 4XCFL 2V2WA 1KN2H 4P9HL 4KDTC 4NNYA 4MX7A 2K7PA 4Z8FH 2QADD 2OL3L 1NDGA 4LLMA 1AGEB 3P4OB 1AJ7L 1JHKL 4JDZB 4LHUD 5I1DA 4HS6A 3O6FA 2C1OB 3WN5A 1B0GB 2DQIL 7CGTA 5IMKA 4RISH 4HS8L 4NHCH 3KLSA 4IRJD 5C0AD 1B0RA 2R2EB 1T20A 4JLRB 2I07A 3SDDA 2OM5A 3DSNA 5FHAL 2JJUA 1G0YR 3LKRB 4TSBL 3MRGB 4HXAH 5ITFA 1E27A 3HN3A 3UZVB 3WIHL 1NBQA 3DROA 4I9WE 5HYJE 2DQGH 4HQQL 3NGBC 4MQTB 3NPSB 5HGAB 4LSVL 4EBQH 2ZUSA 1EMTH 3N9GH 5KVGL 5JDSA 1BVKA 2OXGA 4N5UA 3PG2A 1YECH 1HSBA 2GI7A 4P49A 3CZFB 4RBPK 2ZCHL 3JSSA 1BIIB 2FL5A 2ZCLL 3V5HB 5FECA 1IBGH 1WIOA 3GJEA 5J8OA 2FZ3A 4CVZA 2YD8A 3MXWL 5D7KE 3VRIB 4N8VA 3JWDL 1IGIH 4PJAB 3KAAA 1U8HB 3QG7H 1RZKL 1S7UB 5DQJB 5HHVH 2OR9H 1S9XB 3S3SA 4NUJB 2V2TB 2NY5L 2AEPH 5I1AB 3NTCH 4U0RC 3BP6B 4BZYA 4HBCH 3L3DB 2Y1VA 3CUPA 4HX1B 4JFDB 4K8RD 4YPGB 1LHZA 3DI3B 5LGJA 2JCCF 1A4KA 3Q6GL 4QOKB 5IEHA 2PCPB 4AG4H 3PL6A 1T2XA 1NUDA 5EU5B 3OKNA 1VGKB 5A2IH 1YQVH 3AGVA 2QEJA 3E6HB 3L3OB 1DSFH 1S9WA 4IOIA 4TUJA 1A6PA 4U6YB 1T2JA 3RVTD 4H0GA 3T4YA 5LQBH 3OAYK 3GO1L 2VL5B 4QWWC 2HA1A 1IM9A 3O8XA 1YEEL 2P5WD 5CWSA 3OWEA 2PXYD 4TVPE 1S7RB 3CFKB 4RGMB 4WRLA 1FYTD 5GGTH 2CLRB 3KXFD 4QTIH 3VD4A 1WCBA 4L9DA 5E9DD 1A1OA 3TN0B 3NAAL 3V4VL 2VR5A 1CS6A 5IEKA 2W92A 2FNBA 4YHKL 1R5VB 4JDTL 4MNGA 3EYVB 3IDGB 3IFLL 1SYSB 2NY2C 1N59A 4KJWC 4MJ2A 5ECJE 1BD2D 4JY6B 1KIRA 3PQYE 3QAZB 3B2UD 1MIMH 1IAMA 1PX3A 5DF0A 4I4WA 4ONHA 3HE7A 1T1WA 2XA8H 1WSST 1FFQA 2KQMA 4JO1L 3K8MA 3MRFB 3FQXA 4U7SA 4D9LH 1G6VK 1KELH 3KWWB 4N0FB 1CICB 4UV7L 1UH4A 2X2YA 2HAZA 3ZHLA 3CX5K 1X5GA 4KKLD 4D8PB 4NC0B 2OLDA 1XF1A 4G6KL 4NCDA 1NC4A 1PKQE 1K5NB 4PD4J 3IT8D 3NACH 3I3DA 1A0QH 2F53D 3JUYA 3VD7A 3ZKMD 3LEXB 4PR5A 3KHQA 4X99B 4LSTH 5F7UA 5DMIL 4S1QL 1SJEB 4DK3A 1IFHH 1AC0A 1Y18A 2WUCL 3DX6A 4LEOB 4B5EA 2QQLH 5EBWA 3QIBA 1S7SA 4XZUB 2VH5H 1FZJA 1KXQE 2EXWC 3P73B 4CVXB 3LKNA 3MXWH 3RVWC 4LLUB 2R4SL 3MNVB 5C6TH 4PP2A 1I1AA 1YMMB 1GGIL 4NFDA 4BJLA 2P24A 1EAPA 4X4YA 4GG8B 5DJXB 1KC5H 2V5TA 3WE6B 4X8XA 3EDFA 5J06A 5C0NC 5ICZA 2FRGP 2HLFC 4WW2F 1CD9B 1JPGB 4WFEE 2XFXA 3WNPA 1TENA 3BUYB 4DKEL 1ZXQA 4DGVL 3D69A 3QEGL 2D7MA 3PWPE 1MLBB 4M43H 1HQ4B 3VD9A 1DZBA 1FFRA 4Q9QL 1MH5A 2Z8WC 3PDOA 1JPGA 4EDXA 1EEYA 3MNWB 3WKML 2VXQL 4EI5C 3QRGL 3C6SB 1D5MB 1MAML 4KHXH 1MI5A 1FV1A 2H1PL 4PV9B 4PRHA 3SE8L 1H15B 1TJHL 4Z7WE 3K2UL 5DQDL 1CDHA 1YMMA 5I1IH 1J10A 3GBNH 4WI8A 1BOGB 3D2UD 4HFWA 1REIA 2VTFA 2Y07H 5ANMA 2IQ9L 1VFUA 1RVFH 2VDKL 1KPRB 3OXSB 3MXVL 2AJVH 3G6DH 5EZLA 3MRKB 4X6EB 1JGVH 4X80L 3PHQB 1ZLWH 1V7MH 3ESVF 1NANI 4JB9L 2ICCA 1FAKT 2I60L 4KQ4H 1MCOL 5E5MB 1U8LA 2HT3C 4KQ4L 3IYLW 3BRDA 2EC9U 3WHXB 3MLZH 3RKDD 4FQXB 3P3YA 4ODXA 4RGNC 1LEIB 4PTUA 2NY1D 4MJ4A 4M00A 4ODHH 4QRPA 4ODHL 2ZNXA 3L7FA 3VFTA 3BVNA 5DJ8A 3TVMA 1U95A 1EXUB 3KPQB 2XTLA 5EO0A 3HC3L 2C26A 3MGTA 3KPQA 3LHPH 4TOYL 4TNVF 1DQDH 1OAZH 2V2XB 4PJ7B 4O2FA 1I1AD 3DV6B 1MQKH 4LKXB 5F9WC 3FOMA 1KIRB 5F89B 1A6AB 4YDJA 3GSQB 4LHJB 5MP6L 4I3SL 4L8SB 3DURA 2J7LA 2P8LB 3F5WB 4R4FL 2OP4H 3VGBA 2V5RA 3HUJA 3KLDA 5IEKB 5CIPA 1Q94B 4E5XB 4KKAD 1JHLL 3VFVA 1WBYA 4YXLL 4DUXA 1FLTX 3W9DA 5DRXA 1RJCA 1UGNA 3H0TA 2BFVH 5J1AB 2XY1A 3OQ3B 5EC1B 3ZO0A 2A6KA 1I9EA 3GGWA 1I3GH 1TJIH 3TT1L 4UOJA 1NGWB 5E8DH 4WI6A 4MD5A 3VCLA 3ARFD 1E4JA 3EYOA 1V3JA 3RDTC 3U36B 4Y19E 1IE5A 4ODTH 3SDDC 3NZ8A 1T89A 2ICEB 5H94B 2CDEA 3HC4L 2IADA 4XAWH 4JPIB 3SHSA 1MFNA 1X7QA 1JPFA 3PQYB 1FN4B 1A4KB 1K4CB 1G7IB 4NHUA 4GS7C 1W0YT 3HCVB 4ZSOA 3UTTD 3PV7A 1WBZA 4NJ9H 4OFDA 1J5OH 2VR9A 1KJ2H 1T7YA 4NKDB 3FMGH 3WD5H 1A9BA 3LH2L 1F42A 4WFHD 3F7PC 2J2ZA 3T0EE 1TNMA 2IBZX 3DV4A 5DRWA 4XP5H 4XMLL 5TE7H 4ORGA 2NMSA 4MS8C 4NZUH 1F2XK 1RZGB 5CBEA 4OZFH 5E08L 1I3VA 5IMOA 4N8VB 5C2BH 4Q6IB 1M1SA 5BRZA 4MB3A 4GBXD 3OKOB 2F8VA 3ARXA 1DVFC 3HLAB 3WE6A 1AO7E 1F6AA 1Q9LA 1GZQA 2GKIA 3DVNB 3VRJA 1DN2A 3MRIA 4FQHB 2YWYA 1EIBA 5A2FA 3EKCA 1HIML 4PBVC 1M6OA 5C0AB 1U8NB 2W65B 4PRIE 3OGOE 3DROB 4M48H 1E27B 3D1MC 1I7UB 3NAAH 5I75B 5LVEA 4KTDL 3VXOA 4J8RB 1MCSA 5ESAA 2PO6A 2DQFB 3IAPA 5F96H 3VI4E 2EH8H 2NXYB 3QBTB 5DR5H 3AS3A 4CDHA 1NSNH 5DJ6B 3MLUH 1AD9B 4ZMAT 4IIQA 1HDMA 5CJXC 4JM2F 5BJTA 3AU1A 1OCWH 3E1F1 5DD1L 3CK0L 3ZTJH 1A4JA 4IIQC 5KW9L 3S4SB 2FO1A 4C4KO 1CFQB 1SY6L 2P46B 5LGHL 5F6IB 3ZYJA 5D6DC 2CGRH 5HGBB 3PXHA 1YEDB 2IPUK 1OOAA 1NAMA 3GSOB 1FGNL 5EBLA 4NWUH 4FQCH 1IAKB 3EO9L 2A77H 4HEME 4AMKL 1HN1A 3VGFA 5DJCB 4JREC 1Q9WB 4FXKA 1SYSA 1BX2A 1QLRB 1MJUL 1YEEH 3BEWA 2AKRB 4YNYB 2APWA 5A2LH 5SWSD 2H2PD 3KPOA 2IAMD 3SKMB 1JK8B 2P1YA 4PRAB 1ZLUK 3RFZC 3A0OA 4OI8A 1KT2B 1DVFA 3WO4B 4NQDA 4G8GB 5D5ME 4RAVA 3HE6D 1FNFA 5E94B 5DHVB 2EH8L 5KSAB 4LRIC 4GKOA 1LEKA 3TYGH 1FYTE 1S7VB 1C16B 2EDRA 4WJ5B 43CAA 2W0KA 5EU5A 5KANG 4BM7A 3FJTA 1VENA 3MNZA 3WBDA 1D5BA 2EDFA 3NN8A 5MEQA 3OKNB 4AM0B 3V8OA 4UQ3A 5KSVA 4FS0A 3QUZA 3ZE0E 4NSKB 1F5WA 3L3DA 2NY3D 5EG6C 5DWUL 5B4MC 3CCHB 4EDWH 1H8NA 4ZO8A 3TGXA 4IOFC 4OLZH 4YZFF 3GK8H 2FATH 2C3VB 5D5MA 3LN4A 4S1QH 1S9XA 2GCYA 1YECL 4HHAB 1EGJA 4AENB 3GSRA 4UDUB 1MCQA 4KC3B 4P46B 4DKFH 4P4RB 1T0NB 3ZT7A 3B9EA 5FXCH 2ARJA 4U3CA 5IMLB 3SJVE 3EAKA 3QSKB 4JDVB 3SDXE 3FFCD 4HUWB 3LQAH 1WJ3A 1X5IA 4M7JL 2RIKA 2C3VA 4G8GE 5D5MB 4NKMA 2EO9A 3T1WA 1OWWA 5GSVB 5T33L 4JN2A 3ULUE 3L95A 4QHNA 4P57B 5GGUB 1EHLH 1FLRH 2NY4B 3MUJA 4S1RH 2VC2L 4X6CA 5ESQB 1BQHA 5FAAA 2HJFB 3ULVC 3LQZB 1IJ9A 5CIPH 4LLQA 3MLRL 5ELIA 5I1CH 3HZVB 1KCRL 4HKZB 2NY4D 2VJXA 3HFMH 4ZFGL 5J1TC 4NOBA 2C1OA 5KVDH 4H26B 5FHBL 1R3HA 1JUFA 4HCRL 3LKOB 4U1LB 2GSGB 1JNNL 5HSFA 1LVEA 1BGXL 1J1XL 5I1HL 4LASL 4KTYA 5TE4H 3TV3H 4PJGA 5C2UB 3ARGC 5IVOA 4WY7L 1A3LH 3LV3A 5HGDA 3QFJB 3QHZL 2OTUA 1T1XB 3DUSA 5L7XH 3VFOB 4BYHA 4D9QE 2MQCA 2NZ9D 3U7WL 4Y4FA 3ARQA 5DA0B 5C0GA 4MJIB 2K9UA 12E8L 4UIMA 2YPKA 5HDQH 3MA9H 5EC2A 5EUKA 1PKOA 4GRMA 5EU7E 4A6YA 1YUHA 1JBJA 4BQBA 4DOHE 3MLXL 1IEAA 1U3HC 1YYLL 4Y5XC 1ZLSL 5MHSE 2WP3O 4XCNA 3FT2A 3K7UA 2V7NB 2GK0B 1BBJA 4HS3A 3H9SD 5FYKE 4XCYA 3CFBA 4Y4FB 4PJGE 3FL7A 3D0LB 3T3PE 3RIFF 5K93A 1A5FH 3MOBH 4NO5A 4U1NB 4ELMF 3RZCD 4OCRL 1ZVSA 3O3BB 3I85A 4P2QB 5H35A 5FA3B 2XNAB 1A6ZB 5DO2D 2P49B 4NN6B 1EGJL 3REWB 3O2DA 4LAJH 1FBIH 2IALA 1FQ9C 4R4FH 5B38A 4NGHH 1N64L 1CGSL 4U1LA 4CBPA 3CNKA 1ES0A 2EDOA 5MEND 1X3DA 2E27L 4OFVA 4DW2H 3WXWH 5CHNA 4DKDC 4J4PD 4YWGL 4U1KB 3MREB 2NY5H 4OD1H 4OZGB 5DD0L 1GRWA 1KOAA 4FFWD 3I6LD 4QXTB 4ZXBD 4G9DB 3E6FA 4X8JB 1MCWM 1SBSH 1DDHB 3CZJA 4ZUVA 2K3TA 4DVRL 1ZGLP 3U48A 4NO0A 4XVSL 2EKSB 3PWPD 3GUTA 3PIQA 3F6LA 4G7VH 1ZS8B 5HY9A 5B3JF 1HSAA 4WGWB 4YH6A 3IGAA 3QQ3B 2G5BA 4IMKA 4JRXA 2DQTH 1U0QA 2EE2A 3SDCA 2YPVH 2ICWA 1UM5L 3HE7C 3O9WA 1T5WA 4P3DB 2ZP0T 5D71H 3MLTA 5DT1H 1CN4A 4UOW0 5JOPD 3B3IA 4N8VG 4YHOL 3IFNH 3DECA 1ZGLB 1MEXL 4HXBH 4YE4L 3X11B 1AGDB 5E6YA 2WAHA 1JRHH 4ACPA 5JXEA 4E41E 2PTTA 4U3XA 4RGMC 2VITB 4PJDA 3L3JB 5D96C 4B53A 2QTEA 1Q94A 3ZYZA 1NCNA 2GEEA 4I0KA 4NO0D 1NL0L 3PJSA 4LSUL 5DJCA 1YNTA 4DGVH 3FB8B 1NMAL 1ZTXL 2IAMA 5E9DB 3O9WC 3H9YA 2XWBA 1OTSC 1T7WA 4UAOB 4YUEH 4ZFGH 3EW3B 4HJJH 2FLBT 5JR1H 5DJAB 1SJXA 4YLQT 3O3AB 4OF3A 1TDQA 3TC9A 4IMLA 4U1SA 1IGTB 1R3KA 2FB4L 3UPAA 1ULVA 4MDIA 4M61B 2DAVA 1CCZA 3KYOA 2APTA 3RPKA 5TE6L 3RVXD 2AABL 1N6QH 1BLNB 1KT2A 3DO3A 1U8QB 5C09A 2CLZA 4PRAA 2ID5A 4PREB 1QHPA 4HULB 4J12A 1ZA3A 1B6UA 2VDQL 4X5LA 4HIJA 4ZUWB 3G04A 5EORL 2WWMD 3NIDF 3BJLA 4DJMA 5GS3A 3C8DA 2FECI 1TVHB 1N3NB 1YYML 1V7ML 4ELMA 5JO5A 1RULL 5I17A 5A2JH 1XH3B 1AKJB 1C7TA 1RFDL 4FTVE 1DQTA 3MRQA 2ZUQC 1UKTA 1AH1A 4JPKL 1YEDA 4QNPF 4I2XA 1NBVL 1N8ZB 2DWDA 1A1NA 1FG9C 3VFSB 3TO4A 2FLRT 1GC1H 3EDEA 3IXTB 5CD3A 4G6AD 2G75A 5E8EA 3BP4A 3WUWA 3VWKC 4NM8L 1MCDA 5HI3C 5IBUB 2C7UB 3RZCA 4Q9BA 2IPKB 4U1MB 4XMKL 2XZZA 4UMGA 3FONA 5IVXA 3DVIA 5E8NB 5FYJU 1SY6H 3FRUA 1P1ZA 4OQ1A 1SYVB 2XFXB 4JPWL 4JY5L 5C0AA 5D7LE 1Q8MA 1TZHA 2Y6SC 4NGHL 4PJXB 1X7QB 4ZD3H 1NGZA 3L3IB 5CILH 5FOJA 2WBKA 4I2XE 2DTML 2UWEF 2QSCL 1L9NA 4JO2H 4MA1B 3AY4A 5EO9A 3EYOB 1C5CL 2Q8BL 2EE6A 1U58A 3GRWH 5CCKH 4JFOB 2GTWB 4PJ5E 2D7TH 4PJXA 4CDGC 3PWNB 1D9KC 5FF6A 2YSSA 3KYKL 3ZMRA 3W11C 1GVIA 2JB6A 5FUCE 3SE3A 5FKAB 2VLKD 4DZ8A 1CE1H 4GBXB 3UAJD 2W0FA 4G9FB 4BSVB 2NY3B 2NY6C 1IAIL 1JRHI 3EGSA 1TMCB 4EUPH 3CVIH 4HLZH 2DBLH 1AXSB 2WBJB 1YA5A 2IPKA 3DURB 3F5WA 4GFTB 1ZSDA 3D18A 1MHHB 2VDMH 5C0AE 1LE5B 2IG2L 2AV1B 4F9LC 3P0GB 4JVWA 3D3VD 1ZT1B 5IHBA 2D0GA 5T5NF 4UT9L 2IADB 1BZ7A 2SEBA 5D71L 5DD6B 1FSKB 4TSAH 4U1SB 4KKNA 4K3JL 4LVNC 4LCYB 2ADFH 4DTGL 3BGFC 4I13B 1F13A 4ENED 4IRJC 3MRQB 3L7FB 1R3LB 5CMAB 3V6BR 5D7LB 1R3IH 4U6VH 1FRGL 1NEZA 2R69L 3MRMB 5HI4C 4LSTL 2NCMA 2NX5D 3KHOA 2YRLA 1MFCH 5GRZA 2PW1B 5EOTB 1G7PA 2NXZB 3SCMC 4KTEH 4JGUA 3FFCA 3QJHB 3ARBD 1QRND 5GRUH 1FVCA 4MJIE 4QTIL 3U4BL 3R06A 4G6FD 1J1PH 4I0PB 2W59A 1CLOH 4K9EL 2R29L 2L4OA 4UU9A 2X70A 4OCMC 5FO8B 4U6TA 1CFVH 5H2BB 4HLJA 5BW7C 5FUCC 5DFWH 2QJDA 2XKUA 2EXYC 3W0WA 4GMSL 2AJVL 4UTBL 5FV1L 3ZSTA 1FV1B 4G5ZL 5GISL 1RZJC 3QNYA 4LEXL 4ZG1A 5FUOH 4JKKA 1ZOXA 1ITBB 3K4AA 2XWBB 1K8IA 2C1PA 4JN1H 4QOKA 1Y0LB 3IDNB 2DKUA 4P2OD 2BY2A 1A7RH 4PPTA 1I8LC 1MH5B 3WN5C 1OLLA 2Y4SA 1OVZA 3G6AB 3R0MA 2YK1L 5KZCB 3AS1A 4RMWA 3FTGB 4M7LH 3UYRH 2J3SA 4LPTA 1J7VR 2HJKA 4WI9A 3CSPA 3VDAA 4N68A 3Q1SH 1L0XA 3RWHB 1T03L 1F4YH 3UROR 3KLAA 5MEOA 3RJDA 3MUZ1 4QXTA 4N8PA 3QEUB 4WDIA 3NIFE 3R8BB 5FKPA 1KJ2A 2B1HH 4LPWA 1D5IL 1UWXH 4R0LC 2BVUA 1U6AL 1FDLH 3CXHK 3D9AH 3UTSB 4NQUA 4LVOB 4KTDH 4HWZA 2EEDA 2VISA 5C0BE 2CXGA 3QAZC 5KS9F 3D3VA 1TLKA 2ED7A 3BO8A 2VLLB 5F88B 5JQHC 1M7XA 2X4OA 1PZUB 1S7SB 1I9RH 4LOUC 3RTQC 5IB4A 5I75C 1HCFX 3OPZL 3FOLA 2ADJB 5I1KL 1Y6KR 3V0AC 5INCA 2I27N 1X5FA 2KZ1B 3WHE0 5IP4A 1N2RB 5F7EH 4DKAA 2VXSH 1IC5L 5FO7B 3MRBB 3TJEH 3P4LA 4GLRH 4LSPH 4NO3A 5CGTA 5MENB 3ARYA 4WI3A 3MLVH 5L0QC 2DICA 5DDHB 3BT2L 3F6IA 4NN7C 5H37G 2IANE 2D4DA 4HUVB 1JGDA 1ZA6B 4ZTOL 2IMNA 1HHIB 3VA2C 1QKZL 2DOCA 2Z4QB 4QHKJ 4OV6F 3V9FA 1HWHB 4WI2A 1IQWH 4ZS6C 3RU8L 5JHLH 3RAJL 3OKMB 2R15A 4WO4A 4ZTPL 1AGCB 3MR9B 3LKNB 4NWTH 3JWOC 3F7YB 5C0GB 4U1GC 3WSQL 3HPJB 3MO1A 4MAUL 1OP9A 3C5ZD 2VLKA 1M71B 1X5LA 4D0BA 3BWUC 3O3BA 1ZVSB 1SBBA 4AH2A 4XTRC 1CGSH 4HWBH 1TTFA 4JFDD 1LQSR 2H26B 4CJ1A 5D7JB 4HZLB 1U8KA 1FFOB 3EO1A 3C8HA 3P4NA 4PJFF 4OSUH 3TESA 1F3JB 4UDTA 2DI9A 1YPZE 3WO4C 3NIGF 2H9GB 4MDIB 1G6RL 3MOAH 1I7RA 1QEWA 4TTDC 1QYGH 4N0FA 5HPMB 4MSWB 5D7SL 3FQXB 3LS5L 4G8GD 4YDKH 3I75B 3B43A 5I6XC 3H9SE 4OZIF 3QIUC 3M17B 3BRGC 1A0QL 3QPXH 4ODVL 4HWEH 4CU8A 3DBXA 1BJMA 3QG7L 3VFOA 1CFSB 4Y1AD 1N6VA 4EN3C 2BVOA 5D1QD 4BFIA 4QRUB 1PKQA 3KJ4C 3SO3C 1BGXH 1J1XH 4LNVA 1C5DB 2YD5A 1DQLL 1JPST 1U8MA 4LU5H 3V8CA 4XMLH 4M9OA 2ADGB 4U1HA 3FQRA 3MFFB 4XBGA 5KN5A 1BQLH 2LTQB 1T1YB 3N85H 1CTOA 1RVFL 1JUFB 4KJQC 1MFEL 3G9AB 3OV6A 5HHPB 4MD0A 4HIIB 4C56A 3ARED 3VXSD 3VGHA 2VLRD 3EOBA 4U6XA 4FXLA 4NZTL 3X12A 3TH2T 4O2EB 5F8RC 1KLGA 5JPNA 4LCCC 3RWGB 5D1ZD 1KELL 1Z9SA 1N7MH 4X4MA 2ZOLB 2PW2B 3OKEB 1KIQB 1VACB 1JL8A 3ZDYF 3LS5H 3O4LE 1NCAH 3RKDC 3SQBA 4ERSL 3IS1X 1OGAE 4XAWL 4LCWE 4XP1H 1HYSC 3MRGA 4P5KA 1CLOL 4K9EH 2YA1A 1QR4A 3OXRB 5FYKD 1BQHG 3EJYD 1HILB 2I5YL 4FQJH 2PW2A 4FQJL 3C8KB 4KMLB 1A7NL 2X9YA 1UZ6F 1LP9A 3WUZA 3VXMA 2R2HA 5AD0B 3TBVA 5T3XE 1WICA 1HHJA 2XG4A 1GYAA 4HBQA 1BIIA 1S7VA 5J3HD 3CZFA 5KSAA 5F1KC 3QUZD 1KTDA 1IGCH 1EFXA 5C0BD 4OZHB 3EOAA 1NAKH 4JRYE 3SDAD 2R56L 5IB5A 1GXEA 5D7IB 4PY7A 5HGAA 5C0CE 1JF1A 1MRDH 5E2UH 2BDNL 3NOIA 4L8CA 2JJSC 2V9QA 5E9DE 3H9ZA 5C0IB 2OMBA 2AK4B 4KUZL 5C08A 1EDQA 1MIEL 4NSKA 3U46B 1MFCL 3V0VB 3RDTB 4JPKH 1RZKC 5E95B 2ZSWA 1JZ6A 4KKCD 3CFDB 3KPSD 5DC0A 4UILH 2WLZA 3ZHDA 1A8JH 3DBXB 3IFPB 2QR0B 3PABA 5ALCH 5TF1L 2NY5C 1B4JL 4WV1A 1FYTB 4XBEL 5J6HA 3I75A 4OZHE 4XI5C 1VGEH 4PG2C 4PP1D 3LPFA 5L8JB 1ZHLB 3V7AE 4BQ8A 1YY9D 3EYUL 1CGXA 2ATPB 1H5BC 4ELKA 1I9RL 3VG0H 1FC2D 2RGSA 3QO1B 3R1GL 2J8UB 4TNWF 4Y4FC 3EDJA 1Z5LB 2F5AH 2VABB 1LEGB 4KK9D 3BPCA 2CD0A 3IVKA 3CH8A 5TGBA 2VQUA 1GGUA 5GJSL 1NC2A 4GT7A 4OCYL 1QSFA 3ARGA 5I1EH 4NWUL 1LO4H 1BQUA 1P53A 2X4NA 4XP4L 1T7ZA 3F7YA 4YHMH 3U7YL 2GJZB 5HI5D 3BGAA 4G3YH 1QSEB 3TZVB 2GUOB 4G8IB 1OT1A 3ULUC 4OZHA 3MRRB 1N0XH 3KS0H 1NAMB 1J8HB 1DQJA 2ZSVB 4GO6B 2WBJC 3ZE2F 3C6LC 3K80A 4LLWB 5BOPA 5BS0A 4HPYL 4AEHL 4DGIL 2VDPL 2MMXA 4Y5VB 4ORZC 3G5YB 3T3MF 4FQLH 4XVUD 3VXMB 5F21B 1CQKA 4CVWA 4HIEA 5D9SA 4WTZA 5DUPH