4DOHB

Il20/il201/il20r2 ternary complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
193
structure length
193
Chain Sequence
ILPAPQQLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRQSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Interleukin-20
total genus 34
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohB02
1DQQA 5C70A 3S3JA 5ID1B 2EO1A 4N0CC 1HIML 1PYWA 2BHZA 1LO4L 2KL6A 1KJ3H 3CFEA 2HT2C 5GS1B 1N64H 4CW1B 1T1YB 3OF6D 3PJSB 1N5YL 1AGCB 1OAKL 1RPQA 3VXOB 1N0XH 1YEKH 3VXTB 3DURB 3VW3H 1FNEB 1CE6A 4XHQA 5CEXA 4MZ3A 2Z35B 5ID0A 1JYXA 1VA9A 2DJUA 3L6FA 3ROLB 2YRPA 5JIPA 2VLLB 3RNQA 4JFOA 2GW5A 5C6WH 2FO4A 2BMKA 2PCPA 3L9RA 1LEGB 1J87A 3MC0A 1Q9LA 1FGNL 4CN4A 4GRMA 1QQDB 3TH2T 2EZ0C 4AT6A 1LNUB 4FQ2H 4Z76B 3WIHH 3VFTA 1FBIL 1IGIL 5I74C 2ZOLB 3V52H 5C3LD 1A7OL 5EUKA 4YBHA 4HBCL 3L3JB 3DO7B 1PQZA 3ZTJG 2CLVA 1T7WA 2GIYA 1MFEL 3SE3C 1QVOA 4FQJH 3VGHA 1FL6A 1YN7B 3VGDA 4P57B 3MR9B 1C1EL 3DX8A 4G6FD 3OWEA 4BSVA 4JVUA 5IBTL 4LLUB 3KJ6L 5DHVH 4J6RL 4LSSL 1BOGA 4BUGA 5EBGA 1T83A 5FV2A 2I9LB 5CEYB 1AGBA 5DD0L 4LCCC 2D0HA 2FB4H 3D39A 4HUVB 1E4XL 5A2JH 2EC8A 3IXTA 5T1LD 3QIUC 1AD9A 1ZHBB 5D2NB 3RVUC 2FBJL 3H42H 2DYPB 4JHAH 4K3EL 1HDMA 1VACB 5IG7B 4GKSB 3VRJB 3F8UB 4OAWB 1MHPL 1KCRH 2XQYK 1ODAA 1D6VH 1OCWH 5EC1A 3S5LG 2AK1L 6FABL 2FX9H 3QXVA 4PY7A 3GBMH 3ZKSD 2E9IA 4EDWL 5FYJE 4P4RB 4RWYL 1HCVA 3NCJL 3MO1B 4HXBL 3G6DL 5D7JD 2E5EA 4HXBH 5BQ7A 3NCJH 1VEMA 5D2LF 2Q7YA 3V6BR 4XBGB 5EU3A 4MQXC 2PO6A 4EDWH 3QPQD 1FIEA 4XPGH 1AGFA 1OCWL 4MNGB 3V8OA 3VRIB 5F3HB 1KCRL 3C5SB 3T1FA 3ARUA 3D18B 4HBQA 3CDGA 4WTZG 2IQAA 1R3HB 3U46B 3SDXE 3J7HA 3QUXB 3P4NB 2EIEA 4TULL 3SPVA 3FQRA 4GG6B 1A3LH 1PBYA 1S7VA 4KKBC 1Z3GL 1YPZB 2QADB 3V0AC 1I7RB 5IIEA 1JPGA 3GGWB 4BSJA 2XPGA 1NLBH 3QFJB 1OTSC 1HQ4A 1RIUH 1WBZA 3BEWB 3SKNB 5C0AE 2K1MA 5IBTH 3QRGL 1JN6A 1C1EH 1FC2D 1FZJB 3S98A 5C0BD 2OR7A 4KHTH 3TYGH 3OAUL 3R0MA 4PGDA 1JI1A 1AI1H 2IGFL 4ISVB 1JWUB 3ZSSA 1QYGH 1D9KA 4G8EB 4M6OL 4JFDE 2BNUA 2FO4B 4ZO6A 3L3IB 1RU9L 2C26A 1BFOB 3IXAA 3T4YA 2VLKA 5DMIH 2H32A 5IFJB 1FBIH 2FZ3B 2BSTB 4FQ2L 1LNUA 4U1SA 3BHBA 3ECBB 3ILPA 5J3HC 5KOMC 1CDGA 3JWOL 5I1KH 1KCSH 1IAOA 4N0YL 5I1AA 1OW0A 2X1WL 4G6MH 3SGDI 1AXTH 1FO0B 3EIFA 4URTB 5F44A 2W38A 2IAMA 1KB9J 4ENED 3BQUB 3CFJA 5E1AB 4GBXA 5HGAB 3VW3L 1AR1D 2J88L 3WHE0 3MR9A 1HCFX 1MPAL 3N0PB 1IZJA 1RJLA 5BZDA 1KENL 1YQVL 1KJ3L 1F11A 1AO7E 1LO4H 3MREB 2P8MA 4JY5L 4GMTL 5FO7A 1FFRA 3EYSH 5GS2H 3D39B 4MVBD 1DN2A 4U1MA 1P6FA 2R2BA 1WV7T 2LFGA 3IAPA 3CH1A 3Q5OA 2O5XH 1CGTA 2QSTA 2OXHA 2RCSL 4X6CE 3WFDL 3LPGA 1WIPA 3RZCA 3PP4H 3HZVB 5L0QC 1YPZF 4Z7NE 3DRQB 1XR9A 2VISB 2DLFL 1SJHB 4IOFD 4NPYB 1JYVA 4ZUWB 4F57L 2XI9A 3AUVA 1XGTA 3RDTD 4AMKL 2OR9L 4K3HA 5B8CA 4R90H 5EPMA 5MEOB 4OZGE 5E03A 1FL3A 4N0CD 4Y2DC 4UT9L 4GQ9L 4TVPH 5GGUB 1I1AC 2QQQA 2YPVL 3Q6FB 2QR0B 5I73B 4ZFZA 3LEVH 4K8RL 1FSKB 4M03A 5J7CC 4YHOL 4G9DB 5GQBA 4ZYKB 2YPLE 1LO3L 1T22A 3KR3H 4WW1B 3K2UH 1WT5C 1SBBA 2FX7L 1YNLL 1W72H 5IIEB 1HKFA 4MQXD 3SJVA 3ARGB 2Q7NA 4L8CA 3WYRA 4HCRH 5JORB 5DZNA 5DFTA 3U2SA 1T0NA 4X5XB 3TFKD 4M7ZB 5MP6L 2XTLA 3RTQB 5E6ZA 4D9QE 3VXOA 4N5ED 1NGWB 3S8WA 1U3HC 1NL0L 5KVFH 1F90L 1MY7A 1WGOA 4FOMA 1QNZL 4WFFE 5CBEA 4ONHB 2EH8H 4DZ8B 4PJIA 1BFOA 3IXAB 1R3LB 4M6AA 4RX4D 1OWWA 2Z0BA 4UUJA 1WCBA 3GJFB 3U83A 3F7YA 3GMPA 5IQ9B 1DLFH 2BDNL 3TYFA 1MFNA 3ES6A 5F88B 5ICXB 3QDMD 4PRAA 3U7YH 1QOKA 4TPRL 4PFEA 1NCBH 1X5JA 3IJSA 4MS8D 2ZCKL 4PBXA 4DVRL 3HE7A 1P4IH 2IEPA 1KLUB 4JO2H 4EDXA 4IBLT 2ZCLH 3BZ4A 2GSGA 1CZ8L 5HTSA 2J6EL 3E6FB 3OPZH 3KPRE 4LSQH 1Q9KB 3BWUC 3QJFB 1KIQA 3MLPA 2WINA 2NXYD 5DHYB 2NY0B 4ODUA 3Q5TA 4XP4L 1I9IL 2GYSA 5I1JL 1ERNA 1QFWL 2BY3A 2F53D 2P24B 3HG1E 2X4UB 3LCYA 2AW2A 4LIQL 4M4RA 2AABL 1OARL 1NQBA 5TPWH 1KPUB 4N9GA 5HHVL 3VU2A 2HFEB 2YXMA 3LIZL 1P4BH 1RSFA 3VFPB 4XX1G 4JG1H 1SM3H 2CUIA 3U6RB 2QKIB 1BZ9B 5M95B 3QNYB 5CLTA 1VACA 3C60D 3S7GA 1OAQH 2ICEB 1XGUA 3FT4B 1SYVB 1ZT1B 4O51A 5L8LB 1DBBL 4F7CA 4KTEL 5B8CB 3C6LC 3O45B 3QULA 1AXSB 2HA1A 3RWGA 4RGNC 3TVMA 4IIQB 4HT1L 5HYFA 2YC1A 2C7UA 2QQLL 4RBPK 5HI3C 4GAGH 3WO3B 1MCPL 3DI2B 5GGQL 2DWEA 4IHOB 3ZDYF 2GITB 3OAZH 4XVTL 3VRLE 2C4FT 3C5SA 2WBJB 1L9NA 3CSGA 4WEBL 5CZVH 5FGCB 1ZHLB 4G6AD 3LHPL 4KRNA 3HC0A 1IT9H 3QXWA 4PPTA 5E8DL 4JM4H 3MROA 3QDHA 4HAGA 1AGEB 4NHCL 5IB1B 1T03H 4PS4H 5EOQH 1K2DB 3RUGA 3WHE1 5I1GL 5ADOL 2R15A 3U0TA 1ND0B 3QNXB 3VA6A 2YUVA 3SCMD 1G7HB 3GGWA 5ENWA 3A67H 1A9EB 3MRMB 1I3GH 1IEBA 2GT9A 4PJ5E 2H45A 2NR6D 4GAYA 4PD4K 4ZUUA 1HDMB 2B8OT 2A83A 2RIKA 1A9BB 1MSPA 3CVHL 2QQKH 4PGDB 3BAEL 2PR4H 2JJVA 3CDCA 3L5WA 2D7PA 1CE1H 4QHKJ 4XWOD 3GRWH 1CIUA 4G9FE 2YK1L 3NZHH 4UU9B 3LRHA 4XBGA 1RZ8A 4R3SA 2MOVA 1X4XA 2ESVB 3V5HB 1KB9K 1GGIH 1QG3A 2X1PA 3REVB 5F7HA 2X41A 5E94A 5CAYB 1U95A 4WWKB 3VXMA 4TOYL 1VADA 4NN5C 1FLTX 1RJCA 4NQSB 4JY6B 2LABA 3OKMB 2XQYG 3HE7D 4M62L 4JRYD 3MODH 3QCTL 4HIXH 5DF0A 4CNIA 1D5MA 5EO0B 1HYSC 3V7AE 2V5MA 4KI5E 4XVSL 4XMKL 5EG6C 4AG4L 1I8MA 3B8SA 4KKNA 5TFSH 4LKCA 5AZ2H 3QDMA 5D7LA 2D03L 4BQBA 2D7MA 2H1PL 1UM5H 3AB0B 3CMOL 1PKOA 3MRIB 2R2CA 4KDTA 4OZIB 1GAFH 1ETZA 4KDVA 1DTUA 2QTEA 4PJAA 5JXEA 2OJZL 3NA9L 3L1OH 4DK6A 1V7NL 1C16A 4O9HH 2XNAA 4U3CA 1XGUB 3FT4A 4F8TA 3GEWB 4GLRH 3V8CA 1CGUA 2E7CA 1QFHA 5HDOA 3NCFB 1CLZL 1Z5LA 2Z93B 4RCAA 5I8KL 3BE1L 1S5IH 1UKQA 4KUCF 4Q6IA 5D6DA 4HX1A 5FIEA 4RMUA 4NRZA 4LGRB 2V9QA 5DVMA 2DBLH 2ORBH 3BKCH 1BZ7B 2UWEB 3WO4B 3EUUA 3OR6A 3D39D 4QHLB 4YDIH 2W65B 4AEEA 4MCZB 4I2XE 1QRNA 1GPOH 3HR6A 5DK0A 2FJFA 4U2YA 1P7QA 3NVQA 4ZPVB 1U92A 4OLXL 5EBLA 4ZFOA 3O41B 4KPHL 1W0WB 5JQ6L 1LP9F 2PXYC 1DJSA 1KV3A 4HZLB 3V6ZA 2VLRE 4O58L 2P5WD 4PRNA 1DQLH 5EOCJ 2FX8H 3GJFH 3UTQA 2A83B 4PRBA 4WV1B 1LK3L 3Q5YA 4QEGA 2EIZA 4LSVL 2B2XL 4I9WE 5F6IB 4EUPH 3QIWC 4U31A 1X4YA 1YECH 3LB6D 3GHBL 5CBEB 4GJTB 1C5DA 4ELMA 3LEYH 5KSBF 3WXWL 4XCFH 4M61A 3GHBH 1DZBA 1T1XB 3FFDB 4LSVH 1OB1B 5BZWB 5BVJB 1EAPB 4N1HB 1DDHA 1FNGB 3OKOB 3FJTA 4OD3L 3KPTA 4UIKH 3DUSA 2OI9B 3VFWA 1KN2L 2R1XA 3HS0A 4GUPA 4GQPH 2DN7A 2YEZB 1FVCA 2NW3B 5GRJH 1A1NB 1RZKL 1IAIL 3S88L 1DN0B 2CKBL 3SDDD 4XP1L 5DA4A 3B9AA 1UXSA 3MXVL 2E8ZA 1XF5A 3B2VL 1QSEA 2P7TB 2B1HL 2IH1A 4M7LL 1LO0L 5JZ7D 2W0LA 5LGHL 1DSFH 1QPPA 4FZ8H 1OVZA 1NBYA 1CFQB 4N8CH 1PSKH 2ORBL 3BKCL 3VFPA 2R1YB 4P2QA 4KUZH 1KB5H 5EOTB 1CFTB 4YFEA 2MFNA 2XTJB 3P30L 1RJYB 5T3XL 1DUYA 4OZ4A 2LTQC 2UZIH 4U7KA 1CLZH 5I8KH 4ZD3H 2UYLA 3TN0C 1U93A 2AXFA 1MI5B 3EOBB 2BVPB 1BZQK 3H9SE 5DD6A 4F7PB 3JV6B 1RIHL 2JJSA 1KCUH 3EFDH 3L1OL 5CP7A 5E7BA 3LH2H 1PZUB 4HWBL 4WUUE 3HRZA 3MZGB 3SCMA 1YMHA 3BZ4B 1RUKL 2ZCHL 4Y5XB 1QZ1A 5FKAB 4NKOA 5HHOB 3ZHKA 5HYIA 1XGQA 2WBJC 2A9NL 1NMCB 1BLNB 4ZFOB 3ZKND 4DWHA 3CFBB 4X7FC 2F74A 1SVZA 5M94B 3QDJB 1UM6H 5AZEH 4XMKH 4JDTL 3UTSD 2BY2A 2NW2B 4HKXB 4NZTL 1CDYA 1YN6B 1TXKA 4I13B 1Y18A 3MODL 3X17A 4NZRL 1MCKA 4M62H 1RIVL 3HZYB 1MCDA 1LE5B 4BZYA 3MBXH 4ODXA 2EXWD 5DMJB 3FQXA 3B5TA 4RIRA 4B7LA 3FO2A 1MCHA 4HPYH 1IGYB 5IMLB 1TZGL 4OZHA 1XEDA 4NDMB 4I2XB 4NUGH 1EBAA 3DVGB 1HXMB 1QP1A 4AENA 1EEZA 2UV3A 4KVNH 5KZCD 4J3UA 5EN2B 3F7RA 5EIQA 4YFLF 5AWNH 3T0EC 4HWEL 3RGHA 5DJ8A 3RDTC 1IBGL 1SEQL 1UB5A 5AYUL 4GXUM 5AAWA 2HWZH 2Q6WA 5TDOB 1A4JA 3HMXA 8FABA 4YJZL 3P40A 1B4JH 1AD0B 4LPUA 4A2LA 5E94B 2RQ8A 1FFOA 3RHWF 4H1LA 1T2XA 1MCNA 4RAUA 4NFBA 1JGUL 4BH7A 4NQSA 4KK5D 3MRDA 4UDUB 1X5HA 4OGXH 1ZS8B 2JJTA 1U8JA 2JB6A 3GO1H 4QKXB 4UDTA 1A6UL 1XF5B 1NDGB 1MAMH 4HS3A 1RURL 2QHRH 4M93B 2VTFA 1JP5A 2AJZB 1WIUA 4PJBE 5J89A 1T89C 1T1YA 1JYNA 3OGCB 5C6TL 4FXGA 4JG0L 3WJLC 3IJHB 3IF1B 4O2EA 4DTGL 2EYRA 2JJWA 3VXQB 1QFUH 1MRFH 4NQDE 1ZSDB 4N0UE 4RA0C 3V9FA 5GGQH 3EZ8A 5KW9L 1BGXL 2GSIB 4LHUA 2CR3A 3UYPA 3B9KD 1V3MA 2XXCB 1MI5E 4J3VA 1S9YB 1G6RL 4P2OB 5EORL 1OTSD 5EZLA 5FA4B 1SBSH 2P49B 3KS0H 1UCBL 2PCPB 1ZMYA 4KTEH 5FXCH 4Z7QF 5F9JB 3PXJA 2E7BA 4PJ8D 1H3UA 2P5ED 4JPWH 3KJ4B 1UWGH 1ZT7B 2F53A 4YHYB 5IP4A 5IJKC 4H25B 5CIPB 3ZZ1A 5T1LB 1PGRB 4ZUSA 2JCCB 4JG1L 1S5HA 1B90A 1RZKC 4JGJA 4K3DL 1EGJL 4KJYA 4JFEB 5JOPE 1OARH 1E4WL 4Q58C 2ENSA 2FJGB 4TSBH 4LIQH 5HHQB 2DTSA 5JHDE 1ZLVK 3DX8B 5BS0A 1H5BC 1T66C 4R8WL 1JGVL 1WICA 1I8MB 1RHHB 3TGXA 1YN6A 1WZLA 2QADC 4FFVC 4RFOH 4L4TD 4N9OB 5IR1B 4XCCH 2EEAA 1WEJH 5FKPB 3U9PL 4P9HC 4MAYB 3D3VB 4PJEF 1FO0H 2I07A 5C08E 3IS1X 2ZCLL 2H8PA 2NXZD 2X4RB 5DTFB 3OKKA 4CU6A 5IMKB 3WCYA 1FZMB 32C2A 1QKZL 4Y19A 4YDJA 2NLJA 3HHRB 4X4XA 1GH7A 1JNLH 1KIRA 3L5JA 5F9WB 4NRYB 2AV1B 2Q1EA 1XCQB 1JZ4A 1DLFL 4YXHL 4PJ9B 4QWWC 4PRHD 4OCWL 5GZOC 3V0VA 4QOKD 5EZOH 2MTPA 2I5YH 1UZ6E 4NKQB 3RWEA 5K33A 3ZSTA 4N1EA 3IDXH 4LP5A 1BVLA 5EO9A 1UA6L 5H94A 2XZAL 3LKPB 2D4DA 3TLRA 3MRLB 3WIIL 1RUQH 1U8HB 2BNQD 1FJ1B 3SY0B 3C6SA 5J11B 4LPTA 1UG9A 3VFRA 2J8UF 5B39G 5KJRH 3LQMA 3LPFA 1JTPA 5EOCL 1LO3H 3K81A 1AE6H 2ARWA 1T20B 3JTTB 3D39E 1TMCB 1UM4H 4WWKD 3WNPA 2R0KH 3BO8A 2NR6C 1CL7L 4QXGH 3D1MC 2YPVH 5EUOA 3QQ3B 3CZFA 5C9JA 1K5NB 4AK1A 4MQ7A 4PTTB 4X6DE 3MV9A 2VZTA 1FVDB 4HUWA 3SE8H 3QUXD 5C0AA 4D0CA 2ENYA 4HWNA 3UO1H 4U1SB 2NYYC 5GRWA 4HIEA 5T3ZD 4WU7A 4P23C 5K9JH 1JPSH 4NQVB 4PY8J 4O00A 1ZLSL 2HT3C 2I60L 3RVWD 4JFFB 2VOTA 5IKCB 1DANT 3UXFA 3WFCL 3TP4A 3U4BL 3RY4A 1U3ZA 1XIWC 2P1YA 3L3GA 2OZ4A 3DX7A 1YN7A 4PG2A 4JY5H 2DIJA 4LHJB 1HYSD 4NO5B 1CGXA 1F11B 1QLFA 4G8IB 1YMMB 4NYLA 5KSBE 1F58L 4XHJC 2IH1B 3MFGB 1HZHL 3GMRA 3ARGC 1MPAH 3VFVB 4WTWA 2J88H 4HDIB 1M7DA 1KELH 1BVKB 1ZA6A 3KYOA 5DTFA 2J4WL 4M7ZC 1AXTL 1WISA 1AD9B 5D2NA 5JW5A 4G6ML 5ICZB 2R1YA 2VLJA 5TDPB 3RZCB 1KIRB 4NO0D 4LARH 4OZHB 4Y4KC 2A1WL 1V3KA 2VQUA 3I6KA 4OZ4B 3RKPA 4PJ9A 1FFPA 1HHHA 5EU5B 1EEZB 1EHXA 3G6JA 4WI3A 2BVPA 4YXKH 4X4YA 1GJIA 1RU9H 5MEOA 2HKHL 3U1SH 4XZUB 3RZWA 4P4RA 3RDTB 5DJ8B 1U8PA 1MCCA 4M5ZH 5IB3B 3EYFB 4GRWF 4CN6A 3QDJD 2X4SB 3QEHB 3G6AA 1AI1L 2IGFH 1E4KC 3DGGA 3TV3L 4UTAL 5SWSD 3GSNL 1I3RB 1ZTXL 3E8UH 3LKSB 2VLRD 4LEXL 1EERB 1Z9LA 3KYNB 4PJDE 3SKJL 1OM3L 1ZA3A 1DQDL 5DS8A 3TZVC 1NLBL 3ZYIA 1GIGH 3V4UH 1YEDB 4S0SD 2VABB 4JKWA 3QUMH 4PB0L 3SJVB 2A77H 4AEIL 4KJPD 5DEGB 1A2YA 3JTTA 4WGVB 3N1QC 3VXUA 2XICA 2AJSL 3ULUF 2XPGB 4UQ2B 3PWUA 1F8TL 5HY9A 3RTQA 1H3PH 2EECA 4ZDHA 2FDBP 1B0RB 2JK5B 2UUDH 5FDWB 3ZTNL 4ZODA 1A5FL 4JFZL 1U41A 3HA0A 5CINH 4TQEH 5C0GA 2YN5A 5ETUB 4P2RE 3MZTA 2V5RA 3RY6C 4ETQA 3EJYC 4JHBA 3O8XC 4JFDB 3A6BH 3JUZA 3OTTA 4AYFA 1D6VL 4FFVD 3OZ9L 4O2CA 5FF6A 2FZ3A 4JREB 1MHPH 4RGNB 5SX4I 4Z78A 4UAOC 5B38B 4LVHB 2X4QA 5CIPA 3WMSA 1V5JA 3D3VD 4ZNCD 2Y9RT 4JHAL 3MRQB 1UEYA 5H35A 1K4CB 5CILL 3MRDB 4UDUA 1WAAF 2CK0H 3WUWG 1YMME 4J3TA 3MCKA 4PB0H 2B1AL 4C4KT 4XGZA 2G60H 4G6AC 1T3FA 1GIGL 2FIKA 1KGCD 4MJ6A 1QBLH 4U1HB 2HN7B 2MQCA 4XNMA 3PHQB 2AP2A 2X7LA 3C09C 3BSZL 1U3JA 3IF1A 2FNBA 3VWKD 4PV9B 4LPVA 3VWKB 1MFEH 4U1JB 3PHOB 1R0AL 1CICC 2XYCA 1RK0B 2HJLB 1U8MB 4UOW0 1JVKA 4OD1H 4YDJB 4XRCA 4L9LB 4P2OA 3WIHL 4NNXB 1SYVA 1ZT1A 1X7QA 3L3HA 3VD9A 4LARL 3TBVA 4ZFGH 2ID5A 4LLMB 3TO2B 3JWDL 4NQXA 5T1KD 3HC4H 2ESVE 3G9AB 4KKBD 4LCUA 2MSPA 1WITA 3B83A 4NC2B 5LWYL 1KPRA 2Y6SC 4F2MA 3MJ9A 3U7WH 4CJ1A 3EYUL 4JRYA 1MHEA 2P46B 4DGVL 2XRAH 1N64L 1P1ZB 2Q8AH 1MJ7H 3DMMC 4WFHD 5TQ0L 5I30H 5D9SA 4IMKC 4E41A 1JV5A 2HTLC 2VLKD 1JRHI 2H3NB 1P4LB 3WFCH 3FB6B 4MQSB 3TT1H 1FNSH 4AJ0A 5F1SA 4L3ED 4PG9B 4DGYL 5F9DC 1XGRA 4L8CB 2ZNXA 4H1LG 1ZLSH 1FORL 2GT9B 2NQCA 3BD5A 3GMQB 4JLRA 1JPSL 5ERWB 4HS8H 4WW2C 5D5MA 4P48A 3UO1L 2NY7L 1MCOL 4E0RA 2EYSB 4Y8DC 1IM9A 1LEIB 4DKFL 5FUOH 4HF5H 3DXAA 2K7QA 3GSXB 4NKDA 3SKMB 1DVFA 4FQQA 4HJJH 4GG6F 5F1IB 3BT2H 1BFTA 1IFHL 3T65A 1KYOJ 1R3IH 2CDEA 3LKOB 3QHTC 4PJ7B 3O4LE 1NUDA 3NCMA 3EOYG 5H94B 3VXRB 1EJOH 2IPUG 1NBVH 4Z0XA 4HUUB 2WLZA 2BVOA 3PG2A 3KG5A 5KJRL 3HUJA 5DJXB 3QHFH 3L3KA 2PYFB 4Y4KD 4X6BA 4J3WA 1NGPH 4Y4FA 3E6FA 1U8LB 3VFSB 3T3PF 3LD8B 1Y0LB 4Z7UE 3LDBB 3ARZA 1CR9L 2IFFL 4JPKL 1Q94B 1A8JH 5C08B 3WIIH 3R06B 1GYAA 2CUMA 3MA7A 5DSCA 1MH5A 3RU8H 5D96C 4XNXL 1X5GA 2ZNWA 1Z9SA 4YNYA 3BH9A 3DETC 3MLXH 4YDKH 1L7IH 4RNRB 4C83B 3CXHK 2ADFL 5CSZB 1EO5A 5CHNA 4JQVC 3LSOB 3WKML 3GSUB 1RMFL 4CVZB 3QUZB 2NZIA 4JPVL 4GRWE 4FRWA 3ZYZA 1VFAB 2EE2A 4YXHH 3KLAA 4DZBA 1AC0A 4P0DA 4JFHD 5JW4R 4DCQA 4X9HA 2WLYA 1ZEAL 3TPKA 3VXME 4QHUA 3GIVB 5CCKH 5F1OB 3ZKXB 4X4YB 4WU7B 3BZFA 1S7SB 1F4HA 5ADPH 4HMEA 5KN5B 2BVYA 2HFGL 3DHJA 4JRYB 3RL1A 3WUZA 1NCUA 3C5ZC 3CJJA 5D2LB 5HYQA 2VO5A 1HH6B 2HYMA 5FO9A 4D9RD 2WBJA 1JGVH 4FTVB 1WWBX 4PRHB 1JV5B 4PGEB 1CK0H 2EC9U 2YPLD 5JPMB 1G9ML 4GW5B 5LJYH 3C9NB 4NQDB 4JDZA 5DEGA 1D5IH 5I18L 4ODBD 3U0TB 2YUZA 5KSBA 1CLCA 1CDIA 4KDWA 1U36A 4FABL 3S3PA 2NPLX 1HXYB 3WNOA 2DQGH 1JPST 4S1QL 4QRRE 1FSKC 3MV8B 1D5ZB 1SHMA 3KPMB 4JPWL 1A6TB 3BKML 4I0PA 4DOHE 1J9CT 2DQCH 1WVZA 5AD0A 3MJ7A 4EN3B 5J06A 4YDVA 5EORH 3Q1SH 5HHME 3QFDB 1YEHL 2R56H 1P53A 5F1IA 1S78C 5FM8A 3T2NL 4KY1H 4X7TB 3TN0B 4C59B 3UJJH 1YNKL 3IDYB 3DX6A 4JN1H 3BN3B 3H8NA 2CXGA 1FH5H 3KYKH 3MJ9H 3SJVD 4HUNB 2ZUYA 1EV2E 3DGGB 2K3TA 1MCIA 1DQTA 5C6TH 3RTQC 3BIKB 4KRPD 7FABL 5IFAL 3L3JA 1QRNE 3GMNA 5IV2B 5DFVD 1KCKA 2C1OA 3P0YL 4JFYA 3T0VA 2NY4C 5I0ZA 1F2XK 4OTXL 1NMCC 1U6AL 2Y36L 4PJCA 2J8HA 1D5MB 3FQUA 1OGAD 2HRPL 4MLIA 3FB7B 2ZG1A 3ZE2E 1OAZH 2V7HA 5D1ZC 1GZPB 1RUPH 43CAB 5GS1A 1R3JA 2R1WB 5IB2A 5DMKB 2PW2A 2G9HA 1T04B 4P2RD 3W5MA 4PV9A 2N4IA 1G6RA 5FDWA 5EBMA 1NFIB 1SEQH 3FQNA 2NTFA 4FN0A 2YSSB 3Q48A 1ETZB 4FMFA 3CPLB 1E28A 2JJUA 4L5FL 1F4XL 2D3VA 4KVNL 3TA3D 4OI8A 1IILE 3P2TA 4XWOC 4L9LC 5A2LH 1EIBA 3WD5L 1YZZA 5E9DA 3UTTE 1KC5L 2BVEA 2WBKA 3L9RB 4M6MH 5CWSB 3RI5F 1OTTD 1ZGLA 4K7FA 4O2CB 3U4AA 4WU5B 3HG1B 4TNVF 4HPYL 4AM0B 3SDCD 4Z76A 5GS0L 5DUML 2CRIA 1VFOA 3QNZB 5DD5L 2A6DB 1LMKA 2OQJA 1BM3H 2IF7A 3MBXL 5D70L 2C3VA 5D8JL 1P7KA 3HRZB 3DV4B 5SX5K 2EDFA 2BX5A 4X98A 4I18C 3ARDA 4YR6B 1HH6A 5FO9B 3BRFA 4RSVA 4JDTH 4Z18A 3CK0H 1UM6L 4XGZB 5AZEL 3BWAA 1R3HA 2F9BT 3TBWA 3U46A 1P7HL 2J5LB 2XN9B 2CIIB 5KZCB 4LQFL 5IEHA 2UWEE 4OF3A 2Y72A 4JFXA 2NX5A 5IVOA 1KG0A 1RZFH 4DEPB 4NZJA 4Q6IC 5D6DC 4HWBH 2JKXA 4XNYL 1LE5A 5F96L 4DN4L 3U9UA 4G3YH 1FNFA 4P5MA 2ZUQB 3FO2B 1VKXB 3KPMA 3V6OC 1MFDL 1A6AB 2YPKA 1QLRA 5GJTL 4MD4A 2YUWA 4LP4A 4M1DL 3TCXA 4Y19E 4KK8D 5K9OA 3OKEA 3U4EB 1HHGB 2OX5A 3K46A 4IMKA 2EE6A 4JPIA 4FFWD 2SEBB 5ELIA 2ATKB 1A7PL 1IQDA 1PSKL 3R1GH 3KLHD 3PWVB 2DICA 5D7SL 4S0TD 3MLTB 1MCFA 3P73A 3ILPB 5LGHH 1BEYL 1LO0H 4QXTB 5JUEH 2MKLC 3WLWC 1ADQA 3BD3A 3OX8B 3ARYA 4X7DC 4XNUL 1S7RB 2AJYL 2IQAB 2MPAL 4GW4A 2VDRL 2AK4B 5JHDD 3MRRB 1C12A 1JJUA 2Z92B 4CKVX 1XGYL 1N6QH 4LLQA 4OM1H 4XP5L 3IFNH 2DQTH 4UILL 1H5BB 2CRYA 5FYLL 1NDGA 1MHCA 1OGTB 1NC4A 3UDWA 1OAUH 5GGRB 4I48A 3OGCA 5IB2B 5BO1H 4HKJB 4NKMB 1PYWB 3OXRA 5ERWA 1F6LL 1JZ7A 3VGBA 8CGTA 4HUMB 1SJEA 4XCFL 4L8SC 4OFVA 3DTXA 3IDIB 3O2DL 5MEND 1EA9C 5TE4H 1MFBL 4RRPG 5F9OH 4FQLH 4FQQB 2YWYA 3MNZB 3F12B 1WWCA 2J3SA 3T4YB 3K1DA 1MNUH 2F54A 1LK2A 1CG9B 3CLFH 3DUUB 1G7IA 3MXWH 3V7MA 2CKBB 4RFNC 3AXLB 1EXUA 4P23A 3FB5A 2V2TA 1S5HB 2DI7A 2DQUH 3P0VL 4P99A 4YO0A 4JJ5B 3DVNB 5CP7B 5D7IF 2FBOJ 4MMXC 2X89A 4HUUA 5FO8A 2A2QT 5D72H 5DR5L 5EBWB 1PKQB 2KBGA 5FUZH 2YD5A 1D9KC 2QSQA 3OJMB 2FWOA 3ARDD 1IAKA 4GSDH 5D7KE 4PP1C 4WO4C 5J1AA 2VZ1A 4OFDA 4WW1A 3V2AR 4JFDD 3T0DA 3ILQC 4B5EA 3HMXL 4YDIL 3D48R 5DK2B 3SDCA 3GSWA 2CQVA 1Q0YH 4PLKC 4M7JL 2ED7A 4HKBA 2APXA 1GXEA 3FN0H 1AQDB 3NIFF 5L2KB 1WJ3A 4RNRA 4IOSD 5E8NB 4C83A 4M8QA 5GS2D 3QI9B 1RJZA 4J4PD 3SKOA 1CXKA 2UZXB 3BE1H 3M17A 2AJUL 4X7CC 1RUMH 4H1LH 4N5EC 3X3FH 5DUPH 5IGXH 5IG7A 1FVEB 4PJFA 1OL0A 1XCTB 4NSKB 5IW1B 1I7TA 5DQJB 4WUUA 5E6IB 3G5VB 1F5WA 2MWCA 4Z9KB 5IW6A 1DQJA 5KBNC 5CJQL 1NMBL 2PTUA 5F88A 4RWHA 2P4AB 5ICXA 4JQXC 3UTSE 2CJUL 3SBWC 1TZHA 1YPZE 3LN5B 3CNKA 5TDOA 4D3CH 4MDJA 4Z7WF 3UTZB 1WC7A 3WS6C 4ALAH 1ED3A 3TNMB 4RQQA 1WUNT 2W9EH 1XIWB 3INUH 3B8YA 2VDNH 3RY5A 3ARWA 1ZS8A 3GJEA 1WSST 3DVFA 2CH8A 3LRSA 2E9WA 3RP1A 3I85A 4UINL 3VXPB 3HLAA 1DFBH 1WBXA 2NXZB 1S9KC 1JZ6A 3ARBB 1TTGA 3PGDB 3AY4C 4HXAL 3B9EA 5C0BA 43CAA 4WEUD 5JDSA 4JZJB 2EDDA 2CMRL 3NZHL 5DJYB 3PWJA 1OTUD 2IJ0C 3CZFB 4ZAKD 5C9JB 4Q9RL 4N8VA 3QUYD 2R8SH 3GRWL 2UY6A 1ZHNB 3QO0A 5IROC 1F4YL 1R3LA 4OF0A 3ALXA 4JRXE 5MEPA 1MREL 1D6EA 1NBZA 4UT6L 5E9DB 4EBQL 5BRZD 3TYFB 3BIBX 4L4VB 4HIEB 3QG6B 4XTRD 1MCQA 4ZTPL 3V6FA 1ZK9A 3RL2A 2ICWI 2AQ2A 2E7MA 1ZLVH 5MEQA 3IJSB 4XI5D 3A67L 2K9UA 1MRCH 1DBJL 5KSAD 3W9EB 1QBBA 1ZVSB 3STZB 4ZXBB 2DJ4A 4ZTPH 2PO6D 1FO0A 3GMMA 5I1GH 3Q0HA 4Q2ZA 4YIQB 4JFYB 2Q8BH 3HPJA 1T03L 2ZPKH 1MREH 3T3ME 4UOW1 3MRKB 1IEHA 5MHSD 4L29A 4LCIH 3RBGA 4ODVL 4PJAE 3SJVE 4WEBH 5C09A 2R2HA 4OT1L 3MPCA 1CLYH 5CJOH 2P24A 3WS3B 4NJAH 4LBEB 1JWMB 4H88L 3WUWB 1R24B 1MIEH 1L0XA 4Y19D 2Z91A 3QWRD 1RJZB 1PG7L 1CF8L 3JV4A 1XF1A 1DLHB 1NFDF 5FAAA 4OGZA 5B38G 2GK2A 1E27A 1FZMA 5EWIH 2V2XA 4P2OC 2DLIA 5EUOF 4M48L 4OFYA 1BD2E 5CUSH 3DRQA 5HDBF 3EJYD 4K7FB 5L88H 1AXSA 5I1HH 1IQDB 4KROD 3LIZH 4JQIH 4UU9A 1XF4B 3LOWA 3MRHA 5IWLA 4BZ1H 5CP3A 2FATL 4K9EL 1I3RA 4ZFOL 4G7VL 4P2CG 4ZPTB 4G7YL 3DLQR 1CXLA 2EICA 1F97A 3Q3GA 4FHBD 4Q6YA 4KQ4H 4LF3A 1YEDA 4A6YB 3UBXA 3U7AA 3VDAA 5J12B 2ICWJ 3IYLW 3MUHL 1UFUA 3BGMB 4BYHA 2V5SA 4XNQA 3BP5A 4ZO9A 1IRAY 3MUY1 3ZE1E 5F71A 2J6EH 2AVGA 3TVMC 4LSRH 3MBED 2G2RA 4MAYC 4WIQA 5A16A 5D7LB 3MLUL 1HNGA 4ZDHB 1NCBL 3AU1B 3VWKC 2Y07L 1UJTA 5HHOE 3RUGE 1WBYA 4WY7H 1CYGA 2BOCA 4OZIA 1T2QH 3QPXH 4OZGA 1FV1B 4LLYA 4L8SB 2XZZA 3ZMRA 1U8NB 3DARA 2G5BA 4QWWD 1DVFC 1U58B 5LAXB 3BFOA 3LMJH 5FUZL 2EIDA 2UWEF 3BZEB 4J7RA 3DECA 2NXYC 2AXGA 3EHBC 1HH9B 4Q7DA 4KRPB 5F7YC 5L6YL 3NFSH 2F54E 2YD8A 5IKCA 1X5XA 5FO8B 2E7LC 1X44A 3IU4L 1IC4H 2H26B 1OSPH 4PJHB 4FQLL 2X70B 1RZGB 4LIQE 5DJZB 4R7NA 2VDQL 1JK8A 5EU6A 1RVFH 1Q9OB 5MI0B 5J1AB 4QRPE 4FNLH 4JHWH 1ZGLM 1DBML 1W0WA 1YEEH 4I48B 1LVEA 4LOUD 3ARFC 3SDAC 4Y89A 4UIMA 1PDKA 1KTRL 3Q2CA 3DIFB 4I3RL 4P2RB 3OXRB 4DQOH 3WLBA 5DZLA 3SDYH 3MRCB 3E6HB 4CMHC 2ICWA 5BO1L 1PG7X 1ZA6B 1Y6KR 5E8NA 1Z6JT 1CN4A 4IEFB 4NNYB 1SJEB 2UVFA 4R90L 5ESVB 1E27B 1KACB 1VCAA 4WHYH 3ZDZF 2DQTL 1GZQB 3GSVB 1YC7A 3L3HB 4XMLL 3JVGA 2DLFH 1NUGA 4NQCE 1N4XL 1LK2B 4P9MH 5GSRA 1GHFH 5JMRA 4P46C 1U8IB 2HG5B 3G6JB 2RCSH 1NC4D 4F7CB 2X9XA 1NAMA 3QUMA 4P2QE 3S96B 4NRZB 4LCUB 3SDDA 5J9PA 3BJLA 1CICA 1UH4A 3N9GH 3W9DB 5D7SH 5BZWA 4F2MB 3OR6B 4R97C 3P9WB 1HWHB 3IAQA 4LSTH 2VQTA 4F80A 2IAMD 4NN7B 1GSMA 3P0GB 5I17A 1KENH 1A4KB 3QB7C 3TNMA 3P11H 2YEZA 4I77H 2VC2H 3BP6A 3O41A 2WP3O 2VL5A 3IB4A 3HZMB 5B39B 1YPZA 1KJ2A 2F54D 3MROB 1IZKA 2X4TB 1KFAL 4G42B 4OLZH 3QRFM 5ID1A 4YWGH 4N0YH 1J0IA 2AGJL 1AFVH 1BIIA 5TQ2H 1AJ7H 4NKIL 4QRTB 5J13B 4J1UB 5ITBL 1FV1A 3KPRA 5DLML 2XKNB 3M45A 3PWJB 1FVEA 4PJFB 1CE6B 5D5ME 2VRAA 3DXAB 2YA1A 3I3EA 2APVA 3C8KB 3P9MB 5B3JE 4F7MA 1EGJA 3VJ6B 2ZP0T 3VGGA 1NDMB 2AEPL 5CD3A 1CLOL 3TO4B 3PP3K 3JWOC 4KHTL 2N7BA 3TYGL 1LEGA 1FLRL 3WXVH 5EO1B 3RIFF 2KH2B 1IAOB 1TENA 4R2GC 3RL2B 4R3SB 5D70H 5D8JH 2E9JA 4POYA 1B6DA 4PJBF 1BM3L 3PDGA 5DGRA 1RIUL 4PRPD 4TSCL 3C08H 4UT7H 2RR3A 4ENEC 1T80A 1ORQB 5DFVC 4FFZL 4WI5A 5ALCH 3SCMB 4DKEH 3O6FA 3WBDA 4JANA 4M6ML 1OF2B 3EAKA 4ZUVB 4XBPA 1BF2A 1FL5A 3RVXD 1JNJA 1DN0A 3WNKA 4TULH 1BJ1H 4Y1AD 3TEUA 5J4MA 5DSCB 1QSEB 4FQIH 4PJXF 1T1ZB 2YD4A 2VE6A 3GMLA 4V1DE 4APQD 1MCWW 5B3NA 4V2CB 4TVSa 4WWID 1TTUA 4CW1A 2ICWB 4KVCL 2R2BB 1JTTA 2CUHA 1IEAA 4JZJA 4PJHE 3QZWB 5ICYB 1OAZL 4GXVH 1XH3B 2DQJH 3IDMA 4PJCE 3I9GH 5JXED 3L6FB 3GBML 1RJYA 4POUB 5HPOA 3K4DA 5D1ZD 3SE9H 5EZJB 2JIXA 3SKUD 4HG4K 1C7SA 1U8IA 4X99B 4D0DB 2OTPA 4F9LA 4NQDD 4K3EH 4HQQH 5E70A 4JREC 7FABH 1MLBA 2IALB 3VFTB 3LEXA 1L6ZA 3GBNH 4LNRA 3HNTH 4U6HA 5C6PB 3O0RH 2FD6H 4ODTL 1YEJL 2WUBH 1KTKE 2YMXH 2A74A 1AD0A 4YIQA 3UJJL 4KY1L 3UTPE 4E42A 3T2NH 3F6LA 5FHBL 5CS7A 2AXJA 3DNKA 4LLVA 1U8KA 2AI0H 3VXMD 2IANE 4PGEA 5J12C 4IRZL 4MNHA 2P48B 3EW3B 4FQJL 4LVEA 3OQ3B 1MUJA 3C9NA 2X4TA 3QHZL 4M02A 3S36H 1P4LA 1WFNA 2IQ9L 3MV11 3WUWA 5KAQG 4YGVB 1JPGB 2DQGL 3HZYA 4NO3A 3B9DA 1T6VN 4OQTA 3KPRB 3JUYA 3LS4H 2LAAA 5DWUH 1QR1A 4X6CA 3KXFD 3MX0A 5FA3B 2CR6A 2M8XA 3PL6C 3FFCB 1A64A 3H9SD 2YN3A 5C71A 3BJ91 3OAZK 3FONB 1VDGA 1MQKL 5LAXA 2GUOA 4C4KO 1P5UA 4YPGB 3ARFD 2LU7A 4PRIE 4NT6B 1FZOA 4UQ3A 3ECBA 2F53B 1HWGB 1ES0B 5I8OL 1B3JA 4FQPA 4G6FB 4OBRA 5TF1H 3TZVA 2ITCB 5CEZH 5E99H 5GRVK 5IVXF 1FIGH 3HNVL 1T2JA 1J18A 1H3XA 2DAVA 5DHYA 4XNZC 3VFSA 1F02I 5KVDH 4RISH 4I3SL 4XVUD 3VXRD 5C08A 3H3PL 3SKNA 4FXGB 4LVHC 1FCGA 4P2RA 3QP3A 2R69L 4M6NL 4UV4H 1GCFA 5TE7H 5EU7C 3RU8L 1EO7A 3SQOH 1MCEA 5IQ7L 5F1KC 3RVTD 4R0LA 4NNYA 3N1PC 3RGVB 4OI9A 3ZO0A 5D6CA 1ITCA 4PRIB 1MF2L 1NSNH 5DDHA 5L0QB 2VLKB 2B0SH 5KSUA 3VE0B 3MSPA 5IB4B 1NBVL 1YEFH 1IE5A 4D0BA 2JB5L 5HD8C 2P45B 3HFMH 3VD7A 3LQAL 1TETL 1NC2B 3MLSH 1DE4B 1W72B 4PP2A 1MQ8A 4IHOA 5FUCC 1G0XA 5GS0D 5I73C 1A6ZA 4KK8C 5DT1H 4RAHA 1MF2H 1NSNL 4MA1B 4JQVA 4NWTL 4XCYB 12E8H 3D87B 2DQEH 4Y5XA 1U8HA 4MAUH 1Q1JH 2XN9A 3SQOL 5ALBH 5E7FA 4FTVA 4UV4L 3C5JA 3BP6B 4NM8L 4OLUH 4HMDA 5GZNC 5E2TH 1UACH 4ONGH 4MDIA 4P46A 5DUBB 4PLJC 3LZFL 5D96B 1HSBB 3RVVC 5D5MF 3ARGA 2NY6C 3I2CH 4ODWB 3WLWD 3TC9A 1NPUA 1VGEH 4G6KH 1H8SA 3ARDC 4DGIH 4LFHD 4KK6C 1A6AA 4YHZH 1WFTA 4HV8A 4LAJH 3TT1L 3VD4A 3G9VA 4DAGL 2WW8A 4PUBH 4KKLD 4ONFL 1N8ZA 5F8RC 2DMKA 2DIAA 2DTMH 1OAYH 4O4YH 4MQ7B 2XKSA 5TQ0H 3CUPA 5DHVB 2Q8AL 5HHMB 2XRAL 5LGKA 4BKLA 4LAQL 1AO7B 3TO4C 3VI3F 2DF3A 2D7TL 5BVPL 1SYSB 3SGDH 3ETBF 3D69B 2QR0A 1BECA 4QXTA 3QCUH 3RUGF 5L7XH 3T8XA 5I66B 1VEPA 2RFXA 1I8IA 4ZSOA 1ZLWH 1JIBA 3LKNA 4I5BA 3GUTB 2AJXL 3OKMA 3SCMC 4BK4A 3WS6A 1D5BB 4KQ3L 2O5ZL 2X40A 4X6CF 4ZYKA 2WBWB 4K8RD 3MJ8B 1JBJA 4Z7WA 1ZLWK 1UVQB 5HGDA 4MXVE 4OD1L 4Y5YA 2JELL 1IGTA 4UDTB 5INCB 5CZXC 4Z6AT 4F8QA 2IQ9H 3ARGD 3MACH 1JYWA 5MENE 1NAMH 1M7DB 3BSZH 4XT1C 4GG6E 5KSVA 4W4OA 3FT3A 4KGJA 1FAIH 1I9JH 4JKPL 5ICYA 4WI9A 5HYJE 4IRSD 1J8HB 5JW5B 3TIEA 3DX9A 1R3KA 4DUWA 2WIIA 1MWAL 3BKYL 1E28B 2VDPL 3CPLA 2Y06H 5F7EH 4PGBA 1H8NA 1H3WM 5EU7E 5C0AB 4D0CB 3MV7D 4ODTH 5EZJA 2JIXB 5FYKE 2CXKA 1A6WH 4JO3H 3V95A 1H9VA 3GBNL 5J6GA 2EDHA 1ZGLP 3MMEA 1V3JA 3T0EA 5T5NF 1EMTH 5GS1C 2UZYB 4NWUH 3OG6B 2Q86B 3RWFB 3RRQA 4ERSL 3VMNA 3QXDB 4U1GC 4JN2B 2PO6C 2XY1A 1S9XB 3ZDZE 3D9AH 1JPFA 2GJ6E 2W91A 2EDBA 2OL3B 1IAKB 1S3KL 1U8KB 4F37K 1ZXQA 2HH0L 4B50A 2XN9E 1GOFA 4XB7A 5D1ZB 4LGSB 2IMMA 3TJHC 4FQIL 5I74B 4YGVA 2P8LB 4OM0H 1G7HA 4YBQD 2VDOH 3WN5A 1GGCL 4K71C 4PRBB 4WV1A 2E3VA 4DVBB 5GRUH 5A2KH 4MA3B 1QA9A 4IRSA 2A77L 1J5OL 2C3XA 3ULUD 2NLJB 5C0IB 2I25N 5ETUA 1F3DJ 5E6IA 4L4TE 3V4UL 3RWDA 1BQHA 4UT7L 4TSCH 2OMNA 4Y1AA 2N7AA 5E9DE 3UTTA 4FXLA 3SDCC 2OL3L 1ZTXH 2OZ4L 3ARBD 3H6JA 1U2HA 4FFYL 4LKXB 5EB9A 3KPLB 5ISZD 3VH8G 3P4MA 4U6HB 5FF6B 1TZHB 4L8BB 3ULUL 4WNQB 5E2JA 5DEFB 3RWEB 5D2NC 3P73B 1GC1L 2VXTH 3RKDD 1DQML 2XTJE 2R29L 9CGTA 4GUPB 4H20L 4WWKC 3U1SL 3OX8A 3LKPA 1ZKAA 1JHKL 1DBAL 3IFPB 1S7UA 2R39A 5B22A 4WJ5B 4NOFA 5ILTL 2X09A 1KCVH 1Z2KA 5ITBH 4KKCC 4NKIH 5I1DA 1H0DB 4YHPB 1AJ7L 1UKSA 3TWCL 1IAMA 3H0TA 1J88A 1H5BA 3V5KB 5LXGH 3MRBA 4KMTH 4Q9QL 4X4MA 2R4RL 4GAJH 5ANMB 4TVPE 1QHOA 3EDDA 5JDSB 3WIFB 3PIQA 1B0RA 5GGTH 3AB0C 1CFQA 3MYJB 4YHIA 1HZHH 4I77L 1KJ2L 2XV6B 4U1LB 1K8DB 3RGVC 3IJYA 1AQKL 5JPNA 3VFNB 4DUXA 4PTTA 4LEOA 3MNZA 4M43L 3U48A 4ORGA 5GZND 3U4BH 3QG6A 3K4AA 1FNAA 1J0JA 3MMEB 4FQXA 3UDWC 2NY1C 3GHEH 5TGBB 2X4QB 4POZD 3UX9B 5EUKB 3GMOA 1YYMH 2V17L 1VPOL 4M1CD 1S9XA 2VXUH 2BNQB 2GFBA 3O6KL 1M6OA 1LO5B 4OQTH 3ZL4L 3BYTA 1YJDH 3L7FA 5ACZB 4H26B 2FJFB 2IPKB 4KZEL 1OT2A 2HN7A 3X13B 5KOVC 2NW2A 3VWJC 3O6LH 4DQOL 3T0EE 4KH2A 1FPTH 5LBSL 1I85C 3MLVL 3CFDA 4BH8A 1XGRB 2VLJD 2NY3D 3WN5B 1UM4L 1VFBA 3WDJA 5CEZD 5L2KA 4XX1E 3MGAA 2DD8L 3CFIC 4L8DB 3TIDB 5IMMB 5BRZB 2EIZB 3PNWB 3T3PE 1IM9B 2IBZY 1S7QB 1KEMH 1LEIA 3CFKB 4B0MM 2WWKO 5L6YH 3LQZB 1I1FB 3B43A 2P44B 4MJ4A 4D9RE 4BKLB 3O6MH 3KPSA 8FABB 1CFVH 1U3YA 2DM4A 3OB8A 5IB3A 4B7IA 4ZPTA 5H2BA 1LQSR 1U0QA 1UWXK 4H1LB 5J57B 5ACMA 3VGEA 5HDQL 5GPRA 5JLZA 1V7MH 2W9LA 1J8HD 4LL9A 4OCLC 1L4IA 4LLWB 3Q6GH 4W6YB 1HYRC 2NW3A 3J8F7 5GIRB 2Y07H 3OKLA 1JGEB 4NUJB 4Z7WB 3MLUH 1UVQA 1E6OH 1UKTA 4NHUB 4FP8H 4HWZB 2X05A 4MB4A 5JOFB 4Y16D 2XWBB 1N6VA 1FO0L 5JR1L 5SWQB 2P42B 2AQ1A 3PWUB 5C0ND 1WTGT 3L3DB 4XPFL 1HE7A 1U3HD 2HJFA 4TRPH 3L7EB 4LVOB 1Q72H 1I1YB 4FG6C 1SJVA 4GBXC 2A0LC 1QLEH 5E2VL 4G7YH 3UJTH 1U8OA 2O93L 3FFCD 3QO0B 4PB9H 3CCHA 4Z77A 4K9EH 1NGYA 5FM4A 1F6FB 1IC5H 2VLLA 2VXVL 3RNQB 4TSBL 2AJ3B 1R5WA 4OLYH 3P4LA 1D9KD 2JCCE 5AUMA 5IHUL 1AKJB 4YHKH 1EGJH 4ZS7L 3FQWB 3LV3A 1C8PA 2VITB 2UVEA 4NM4H 4ZUSB 4KI5D 3GNMH 1I8LC 3BUYA 5MEQB 1NANH 3QUYB 2HP4A 1WZKA 4CVWA 5CUSL 3VFGL 2BNQA 1FZKB 3U82B 2GCYB 4LDLB 4YAQA 3BW9A 4M48H 5BOZG 2QSCL 3QEUA 1PQZB 5EWIL 1FHGA 3DROA 4CN1A 3TA3A 5GISH 5JW4M 5GJSH 4C55A 5FYJU 4JO4H 1J1XH 2BFVH 3FO0L 5I1LA 1RHHA 1MIEL 4B53A 5E1HB 4F7TB 4RFNB 3G6JF 3NACL 1ZVHA 5FOBA 2DWDB 1NGQH 3O3DB 3L5HA 3OB0H 4OT1H 4DTGH 3MRCA 1NAKL 4WFEE 5IFHH 1S9WA 4ODVH 4OB5H 2X4RA 3UYOD 5IM7B 4JZJC 1HXYA 2DOCA 2APFA 2QHRL 3VMOA 5CBAB 1MAML 4JDVB 1A6UH 4XAKD 3FHQA 2ERJB 1XF2A 4HD9A 1A6TA 2Q8BL 2RBLA 2FECL 1G9NL 3E2HC 4D8PA 4Q97A 3NOIA 1A6VL 4OGYL 4KKAC 1B88A 4OZFH 3CDFA 4XP6H 3VI4F 3DVGA 4YDVB 1ZLUK 1DBJH 4QTIL 4G9FB 3HE6D 4MXVF 4UMGA 4K23H 2YZ8A 3GM8A 3SDDB 1B4JL 5F1NA 1JL8A 4N8VG 4XC1L 5GGUA 1P84J 4PR5B 5J1TC 1IGFH 4R2GB 4NFDA 3QXTA 1JF1A 2P5WA 1JPFB 2OSLA 2FECI 4PJIE 4OB5L 2GY7B 3RGVD 1A7RL 5DRXA 5E5MB 1LDPH 2C1OB 3BISA 1CDUA 3OKLB 4WI4A 1WLHA 3GJFK 3EYOA 3LRGA 3ARPA 2GJZA 3O2WL 3GSRA 3UYRH 4NQDA 4HXAH 1NMAH 1LO2L 5DEZA 5DJCA 3FB6A 3U0PB 4PGCB 35C8H 4M93C 1DFBL 4N0FA 4OCNC 5GISL 4UINH 2ADJB 3EGSB 3QEQA 2QQNL 5K9KA 2N56A 1T5WA 2BCKA 3BN9D 4O2EB 3MV8A 3O11B 1YJDC 4N1CA 3CFCH 1AIFB 3CXHJ 5C0IA 2LU3A 3MJ7B 2W60A 4EN3A 5DQDL 3NCYS 3NH7L 4LPYA 4Y1AB 3BEVA 2A9NH 3AMLA 5IHUH 4LSPL 4Q0XH 4NC0B 5CJQH 4JQXA 2EXYD 5EO1A 3MFFB 3LKOA 2A6DA 1MVFA 4H25A 2F5BH 3PV6A 3IKCA 1KB5A 4HHAA 3CAFA 4H8WH 1OTUC 2VR9A 4MX7A 1ACYH 3UAJC 2VLRA 3UTSB 4M00A 3X3FL 3CFJB 5E1AA 3QDGA 2FJGA 1TJIH 1T0MA 3P3YA 1J11A 5A1AA 1BAFL 1I4FA 4H26A 3W0WA 1KB5L 4Y5VA 4AZ8A 1B6UA 3VFOB 5HXMA 3AY4A 3VG9C 2NY2B 4LNVA 5SWZA 2O26U 5DMKA 4FZ8L 4YHLH 1IC7L 2HKFH 2W1NA 5CIPH 3T0AA 4MXWH 2B1HH 1Z9MA 5HDQH 3HTLX 4RAVB 4GSDL 4U0QB 3MUJA 4JO1H 5A3ID 3SN6N 3T0WA 1K3IA 4PRHE 3D2UD 5I1IL 4RMSA 3PNWA 3O6ML 2AV1A 5GRJL 4S1RL 3BPLC 4G9FA 4OD2A 3FFCE 3ZKMD 4HGMA 1M05A 2ATKA 3ULSA 1TDQA 4JRXA 1EO8L 3FOMB 1H8OA 1QO3A 2D0FA 2ZUWA 3K8KA 3BKJL 1BBJA 5HI4D 5F93C 4TTDC 1MEXH 3FOLA 3O2DH 5L8JB 1WFOA 3LEYL 1RZ7L 4HIIB 5JLZB 5HYQB 2A6KB 3B3IB 4NP4H 1U3HA 3FB8A 4R4FH 4CL7A 3SGJA 1KG0B 3RVVD 3MUZ1 3ARFB 1ND0A 1K9TA 3EO0A 4KZEH 4LFHG 1XFPA 3MA9L 4KV5F 2NNAB 1F42A 4JE4B 1T89A 5HVHC 5KS9F 3CSYB 5D7IE 4MMZC 2XWBA 4G5ZL 4JRWA 3KYMB 1L6XA 3B6SB 3IFNL 5EA0L 5EFIB 4OM1L 3O11A 3AAZB 2ATPB 4OZFA 3ARVA 1KXQE 4PYGA 3L3DA 3PUCA 3T04D 2KPNA 3BYYA 4NQEA 3RTQD 1EX0A 2AJYH 3GHEL 3MLWL 5I8CB 4KJQD 4JPIB 4AEFA 5JUEL 1YY8B 1HSAA 5I16A 3VJ6A 3VDCA 5IHBA 4YZFE 2X1XR 1OGAA 3NZ8B 2GY5A 4NT6A 3LPWA 2AEQH 2X44D 4PD4J 5JTWA 3UMTA 3AC0A 3H9SA 2VN4A 5JA8B 1CD0A 5KSAC 3W39A 1U95B 4ZMAT 3QUYA 1KEGL 4KDTC 1KJ2H 1S5IL 2P5EB 3DVNA 3MGTA 1SMAA 4E5XA 4F7EA 3NN8A 2ITCA 3DMMA 4NN7C 4RMQA 4QF1A 4ZNEE 1BJ8A 4MA1C 4PYHA 5IW3A 2FSEA 1TJGL 3V0WL 2FIKB 3T4AA 1FL5B 4O9HL 4KMTL 1KIQB 1NC4B 1P2CA 4G3YL 4ZQKB 3TWCH 5E8OA 5F7NC 2NXYB 4ODUB 4PJ9D 1CGVA 1GAFL 4NYLB 3KDMB 3VWKA 1MOEA 1NC2D 3O8XD 4KRPC 4G8GE 1CDJA 2X4UA 1AQDA 1JHKH 1BVKA 1I1AB 1G7MA 5SWZD 1X5YA 4MYWB 2R29H 4GKOA 4L4TB 1P9MA 2Y7QB 3NIDF 3OMZA 3BQUC 3CK0L 4AG4H 1TFHA 4PRIA 3RZCC 5FYJD 1MFCH 2HFTA 2O5YH 4OIAA 1HILB 4MQTB 2COQA 4HIXL 2E27L 2R0LL 2F54B 4KJWD 3QQ9D 4JZOA 5A2IH 4S1SH 4PGJA 4L4VD 4IRJC 5EU5A 2LAGB 3AXLA 5D4QA 4C56A 3AS0A 3L95B 2BNRD 4WU5A 4MVBC 3RWGB 2BXZA 2GAZB 4YO0B 4JFFA 5DC4B 5IOPB 5EU6E 3CU1A 4UBDD 3EOTH 2C3VB 3IETB 3QEUB 5ANME 3WD5H 4WCYH 3KLSA 1GGCH 4MCZA 1NFDE 5DMYA 1YY9D 5E5MA 2QBWA 4P46B 5DUBA 3O8XA 2GJZB 2DWDA 3CSYA 1CU4H 3GB7A 2HRPH 1KN4H 4PRPB 5DI8B 5EH1A 3JXAA 5C07B 2NY3C 2PF6A 4R97B 4X9IA 3HE6B 5I71C 1TZIA 4HPOL 4N0UB 4F9PC 2IADB 3KPSD 4HFWB 3VG0H 3WDHA 2O61A 1CXIA 4EUPG 1IM9D 1LDSA 2VLMD 4R2GD 4NHCH 2XA8L 1EMTL 4JM4L 4WO4A 5E8DH 1CBVL 1G7PB 1BP3B 1FFPB 1HHHB 2C1PA 5I9QC 1A6WL 5F89A 3S4SB 4AL8L 3UEZA 3THMH 4HWUA 3AS1A 1WAAE 2BMKB 3KYKL 3MJ9L 5T5FH 4EI6B 2EDXA 4PR5A 1YNKH 4QO1A 1EHAA 4CGTA 4ZOEA 3BPOB 3KNBB 1YEHH 4CADB 4U1GB 2FH8A 2MHAB 2Q76B 2AEQL 3HUJB 1KB5B 3S3SA 1DBBH 4F33A 1A7NL 4KGLA 3H9ZA 4NQCB 4Z7UB 2EYTB 4NO2B 2XWTB 3GIZH 1C12B 3QDGB 4CNIB 3MOBL 4W4NA 1PY4A 1F13A 1Q94A 3R06A 1SM3L 1UXWA 2HTLD 4GMSH 5FEBA 3FQTA 2R2HB 3MNWA 3KDMA 4XXDA 2V6HA 5TPWL 1N26A 4IIQC 2V9TA 2BSSA 2BCKB 3TCLA 3FHAA 2X7LB 5JO5A 1R6VA 1IKFH 3MJGX 2AJXH 2DL9A 4K2UH 1S9VB 3JV4B 4E41E 3SDXF 2WIIB 5CGYD 1CFTA 4TUOA 3RGVA 1WTLA 1HEZB 5BVPH 4JVWA 4R4FL 4YDLB 2P47B 3TH3T 2GTWB 1UWEL 4NP4L 4HIHB 3U36A 5ADPL 3V6FB 2F8VA 3C6LA 4XC3L 3OBAA 4ORZC 1M05B 1V05A 5ISZA 4OZHE 5DC9B 5JXAH 3SO3B 5SWSB 5FGBC 4WW2F 3RWFA 5BQ7B 4R26H 4TPRH 3QIUA 2OLDA 4ZUTB 1AGFB 4MJID 5H35B 4PLNC 5GRYA 4NKOB 1RZJL 1MHHA 2DBJA 2E6PA 4JPVH 2E7LA 2YOCA 4XCEB 3ZYOA 1JRHH 5GGRY 4S1RH 3VI4E 4PRHA 4XH2A 2YHGA 5E95B 4R9HA 4ZPVA 2BVTA 2YS4A 3CU7A 3LZFH 1F90H 4KKCD 2ZSVB 4ONGL 2ADGB 4PJCF 4Z0BL 1H15B 5FYKH 4XNMB 4WUKH 3ESUF 4J23A 1AKJD 5ALBL 5DVOA 3RWHB 4IOIA 5DK2A 2ICCA 1IC7H 3PL6D 4HK0B 2DQEL 2YKLH 1HQ4B 1WBZB 3BEWA 5EFIA 1EHNA 3UTQB 4X0KA 1MIML 3NTCH 3D85A 3HFML 4NQEB 1IJ9A 5ABDE 4L8SA 3HAEH 2C1PB 1YEFL 5IBUG 2IBGA 4OUUB 4K7PL 3U0WL 1NUNB 3ZDYE 4LCYB 1TNMA 3L3IA 2B0SL 4G80A 1JUFA 2FIRT 3MO1A 3NTCL 4H8WL 1PD6A 1U91A 1UB5B 1OGAB 1FNLA 3VXUD 1U2CA 5DEFA 4QT5A 2F5BL 4HS6A 5FM5M 2HMIC 1HHIB 3MNVB 5GRVL 1OB1A 4POZC 3S35H 5BVJA 3MRJA 2OK0L 1UC6A 3PWPD 2YD6A 3RA7H 4R96B 5HI5D 4DKFH 4LSPH 5I75B 2EYTA 3BP7B 2X4OB 5MERB 1ED3B 5D2LE 4C58B 3VDBA 1L7TH 2YBRA 3WV0A 1R5IA 3RBSA 5HGDB 3RWJA 4RISL 4KMLB 1TQCC 3QQ4A 4LOUC 4DGYH 1PJ9A 3QFJA 5L2KD 2ARJB 4Q9BA 5IVZA 4R26L 1Q9WA 2R9HD 3AU1A 4MD0B 5BCAA 5E99L 1N3NB 5EBMB 1NCNA 1X4ZA 5J8OA 3LKRA 3PJSA 1CXFA 1RAMA 1IGJB 1NMAL 2H6PB 5I30L 2EO9A 5JXEC 1MJ7L 1JWUA 3O2WH 1EFXB 1J8HA 4O5LH 3EYUH 1KTDA 1P6AB 4WFGD 3VWJD 3TT3H 4XWGH 1JMZA 3D0LB 3G5XA 2IPUK 3JTSA 4JFOB 1MQKH 3TO4D 3T09A 4ZSOE 4MSWB 3HN3A 4FQXB 4HW6A 3HG1A 4AM0A 3MLZH 2XY2A 3HCVA 3QSKB 4K2UL 1LD9A 1KPVA 1IGFL 3PGCA 3WL9B 4BK5A 5HPMB 3PXHA 5HHPB 5A2FA 2P5EA 4EVNB 4XC1H 3LS4L 3V6OE 1PLGL 3UZQA 5LGJA 3S6CA 4MA7L 3QXAA 4X5WA 2JIXD 2BZDA 4ZFFA 1F3RB 2GJJA 2XFXA 1IL1A 4HC1H 5IESH 3MOBH 5HHMD 3RJQB 3QPQC 1DVFD 4GKZA 2E6QA 1CTOA 3E3QE 1F4WH 5KVEL 3QDJA 2VH5L 3MUGB 4JFEE 5C0CA 1N6UA 1NEUA 5LKNA 2PYEE 5IFHL 3FMGH 1W0VA 5DI8A 2NY3B 2G60L 2VL4A 4L8DA 2BNRB 4WRLA 4X4XB 5E4IA 1DLHA 4AL8H 1HILA 3HNTL 5CILH 5ITFB 3CFKA 5E0QA 3FRPG 5JHDB 3VWJA 5D1QA 2VZ3A 4U1IB 2B4CC 2HG5A 4OJFH 5E08L 3PWVA 4PLJD 2WUCL 3W81A 1I7UA 2NX5D 4I8DA 4P49A 3IDYC 1S7SA 1YEGH 2V5YA 4D9LL 4QT5B 1I7ZB 1A02N 3TNNA 2AV7B 2KZWA 4M1GH 2PO6B 4NQEE 1KN4L 1N0LA 1J1PL 1NCCH 4CADA 4LCWE 3B5HA 1ORSA 4X7SL 4JGMA 3AS2A 2FX9L 5D7IA 2AK1H 2GK0A 6FABH 4Z7UA 4KTDH 4ZUVA 3OHXA 2FHBA 5H8DA 1BBDL 2OS7A 3S97C 1H0DA 2HLFD 4MD5A 4YHPA 4WFGE 3SEPA 4NN6C 4BFBD 4X6FB 4L1DA 4QRSA 3H42L 3G08B 1EPFA 3NPSB 3VD3A 2BSRA 4PJGF 2V7HB 4F3FA 2ZUUA 1PG7W 4QY8B 4PJBB 2EH7L 1T1WA 3OR7B 4U49A 5JO5B 3DHMA 3QUML 3IJHA 4NNPL 4P3WA 4KROB 1I1YA 3KLHC 4YK4C 1E6OL 2EC9T 1JE6A 3C08L 1AY1H 3KJ6H 4U1NB 1KTDB 3C8KA 3P9MA 1BZ9A 3GSNH 4JCMA 1FVDA 3S35X 3F12A 4LGPB 2R0LH 2VNCA 3VFNA 2E27H 1EAJA 4U7MA 3S4SA 2O5YL 1MFCL 1QSVA 2CPCA 4PJXB 4M5ZL 3WJJA 2H32B 5IFJA 1XGPA 3BXNA 2VITA 5DJ2A 3KPSE 4YHNB 2V2TB 5SWSA 4YXKL 3BIKA 4YAQB 1BQHG 4EDXB 2D4FA 2Z31C 2XA3A 3D0VA 2ZUTA 5BS0D 4X98B 5DHXB 4F33B 4OF7A 2A1WH 4JANB 5C8JA 2GITA 1BD2A 3VH8A 3PWNB 2Y5TA 1EEQA 4OZIE 4OLZL 1KFAH 1KEML 2FYYA 1J05A 2X70A 4J3OC 4EQ2A 4Y5VC 2VXQL 3DBXB 5IEHB 1KELL 5IB1A 3UPCA 3C87A 1GOHA 3GMLB 3GSWB 2DD8H 1CL7I 1I8LA 2VC2L 2BSSB 3MV8D 4Z7VB 3QNXA 1T04A 3LKQB 1S9WB 1KPUA 2HMID 1BQLL 3WLBB 3E3QC 4OLVL 1REIA 1S9VA 3FQNB 1XH3A 4PJGA 3WDIA 5TDPA 3VCLB 4R0LC 5JHLL 1HHKB 4PJXE 1QLRB 3PQYB 4BFIB 5IK3A 4X9BA 5J6HA 3FO1A 4EJ1C 2X1OA 5C07E 1UGNA 4OCYL 2DYPD 1E4JA 1EZVX 3MLWH 4MZ2A 5T5NG 4D0DA 3RQ3A 1ZGLB 3ZL4H 4M7KH 4OQTL 4XMPL 3BPNB 4DOHB 4RGOH 1LP9A 4OSUL 1I85A 5C07D 4RGOL 3G5ZB 2X4SA 2IH3B 5GRZA 1JPTL 4QRQA 2AJVH 4UQ3B 5TH2A 2D7QA 4K71B 4ETYA 2WQ8A 4J4PA 2CSPA 5FV1L 3KHOA 4BUHA 3D25B 3SE4C 5I75C 4A2MA 1YUHA 2CIIA 2VAJA 5AG9A 1YY9C 1CTNA 3ISWA 4KXZI 1H15A 2R0KL 4FNLL 3DVIA 1CD9B 5DJCB 1KNOA 1MEXL 2VDQH 4PY8I 4PJ5A 3OAYK 2VZUA 3BZDA 3ILQD 2NY2C 4QY8A 5AG8A 5K9KB 3BESR 4I0CC 2HVKA 1IMHC 4NKMA 2VIRA 1RZIB 1EO8H 2B4CL 3HKFA 4UB0H 1P84K 1WZ1H 1F3JA 1NFDA 5K9OB 2CDFB 3U4EA 1RUQL 4KJQC 4NZUL 4HH9B 2PW1B 2Q3ZA 1TVBB 1F3DH 5D1XC 2C3GA 2FGWH 3X3GL 1DUZA 4JO1L 5KSUB 3DSFL 5L9DH 3FN3A 2EDRA 2ESVA 1A7QH 3V5HA 4MXWL 4H0IA 1SVCP 1BFSA 1OPGL 1JTOA 3ULUH 1D3CA 5A40E 3KAAA 1T2QL 4LVNC 4ELKB 2XWJA 2VLRB 1TPXB 4GW4B 1BD2B 3B9KC 5EDXA 4Z5RA 1AY1L 4K3JH 3C60B 3OKNB 4LLUA 4D94A 1MHCB 3AREA 1ACYL 5F7WC 1INQB 4QTHA 1C5CL 4HKJA 1DEEB 4A6YL 4JZNB 4TUJB 3QWRA 4G7VH 1BBDH 2DI9A 3X12A 1IARB 1P9MC 4GKSA 1CFBA 2OR8A 4HV8B 4LK4A 5D93B 3M17B 5I2IA 4X7SH 4MJ2A 5AEAA 4IDJL 3VFMB 4JQIL 3ZLQC 5HGHA 3G5XB 5ESQB 1IM3B 4KC3B 5F7KC 3D9AL 4JGUA 1MCSA 5DJDB 3DOSA 3G5ZA 3ZE0E 2Y23A 1G7LB 1EEUA 3IDNB 4AQOA 3PGCB 1B9ZA 5HPMA 5C86A 4OJFL 1EZVY 2QQNH 3WFHB 1AHWA 5FHAH 3NAAH 5FYLD 3T1FB 4LMQE 1G6RH 1FE8L 1RUAH 1MCJA 3DUSB 1QRNB 5DVKA 2VLME 3P4NA 1CGYA 5KW9H 1SY6A 2Y06L 3BKYH 1CIDA 3PF2A 4MNQD 3VGAB 3FMGL 4QHKI 4DFIA 1OOAA 4QNPE 4KRLB 4NN6B 1K2DA 3RUGB 1BWMA 1FG2A 4Y7MA 5KVEH 1JN6B 1VSCA 4X4ZA 4UQ2A 3MBEA 5T1MA 3C5ZB 4OZFB 3N1MC 3DXAE 1OT1A 5HVFB 3HZKA 4X6EA 4GAYB 4HC1L 4ZUUB 2JK5A 1LP9E 1N8ZB 4GRLA 4DK3A 2B39A 2WNGA 3ZE2F 3STLB 3BX7C 4CMMA 25C8L 3MRPB 1CXHA 1PLGH 5F8QC 3ROLA 1ZANH 4ELMB 2DB8A 1RI8A 4CRPA 3L3OB 4JFDA 4RDQG 4EBQH 5DO2C 1U93B 2AXFB 2DQDL 1JF6A 5IHZB 2DM2A 1T1XA 2CO7B 1G0YR 1IBGH 2AV7A 5JOPD 3MLZL 4XVUC 3W39B 5FYKD 1HOCA 4FQCL 4Q9RH 2D7TH 4Y1AE 1I3UA 4MB5A 4XWGL 2CMRH 3I02A 3GUTA 4NUGL 2FEDC 5I1EL 4O5LL 2MQ0A 1LWRA 4WUUD 1TCRB 5GGSA 3GMMB 5J0BA 4CJ0A 1TZGH 3REWB 1MRDL 3BDYL 4JO4L 4M3KB 4O4YL 2DTML 4M4PA 2E9BA 4FXKA 5GJSL 2VSDA 2NZ9C 4XP9H 3MRKA 4ONFH 4MNQA 2PXYD 5GHWL 2XQBH 1UXSB 4FS0A 3CSPA 3ESVF 3KXFB 2DKUA 4NZRH 1MI5D 2NYYD 2BSRB 2QSCH 5BXFB 4S1DC 4YHZL 3DV6A 4YNYB 2W9EL 4WVRA 3VFGH 2HT2D 3KPRD 1Q0XH 3GI8H 2R9HC 1L7TL 1VGKB 2DQHL 3VXTA 3DRTB 3HE6C 2F5AL 3GSQA 1RULH 4DVBA 1EVTC 3QWOA 3LS5H 2F15A 4QCIB 1XAUA 4MCYB 3RA7L 4I2XA 1IM3A 3LH2L 1SEBA 1U8QB 1QLEL 5E2VH 2W92A 1XGTB 5JW3H 3S36X 3OF6A 1M7XA 4XPFH 3QXDA 5DUPL 1KXTB 5IGXL 3LQAH 5KN5A 5JR1H 3QIBD 4ZFZB 1RUML 2JB5H 43C9B 2UZIL 4YHMH 5DXWA 3O6FC 4MNGA 3P30H 1P7QD 3VRIA 4OKVA 2ED8A 1A6ZB 4CAGA 4JFED 4KUZL 3PWNA 1MHEB 1YYLL 3S37L 4OCSH 3FN0L 4N8CL 3SOBL 1BLNA 1MIMH 2P8PA 3KPOB 3Q6GL 4AH2A 5D9SB 3O2VL 4BFEA 3FQRB 1DSFL 4OFPA 4GW5A 2YKLL 3UBXG 1V7ML 1AGDA 5GSVB 5JW4N 2X2YA 3VXUE 5E56A 4XAWL 1T0NB 1QFPA 1CI5A 5ANMA 3S5LB 2ESVD 3TJHD 3MOQA 1HHKA 3CX5J 3QUZD 2N1KA 1K85A 4Y8AA 2RAMA 1BD2D 5KVDL 1F3JB 1NFDB 1RZJH 2EYSA 3O81A 1K8DA 3P9LB 5LCVH 1KF9B 1GGBL 2J5LC 1L0QA 1NDMA 2P5WE 4N5UA 3MXWL 3HNVH 2HAZA 3GJFA 4MA8L 1DVFB 5CEZL 5EIVA 3KPLA 5JXAL 1A0QH 4U4BA 4JY4A 2J7LA 1X6NA 4M61B 3MRHB 1HOCB 1Q38A 1SYSA 3GMOB 1WF5A 2A6IB 2VWEE 1UWEH 5I1AB 3MLVH 4JAMB 4NJ9L 1FPTL 3I75A 1M6OB 5MENB 3B9KB 3UTTD 4NO2A 1M71B 2KKQA 1ADQL 5EUOE 3C60C 5F7DB 5HHNB 1I7RA 1DQLL 1ZHKB 2X4PB 4EI5B 3E1F1 1S7TA 4UILH 2F58L 2G2RB 4XXDB 3O6KH 1N6QL 5HVHB 3NGBB 5F3BB 1LHZA 1CQYA 1HN1A 3CFDB 4ZS6D 5JQ6H 3DIFA 3BP4B 2VMFA 5KSAA 1ZSDA 3PQYE 1NFIA 1KLGB 3HMWH 2XZQH 4OLXH 3RWCB 4N8PA 5DRZB 3QWOB 5T3ZE 1OY3B 3SGKA 1A7NH 5HSFA 1OQXA 5I2IB 2G5BB 2GTWA 4UV7L 2AI0L 5HGHB 5KANG 4AIZA 4PGZA 2DJSA 1A7PH 3BZEA 4ZUWA 1G7QA 1MLBB 4WDIA 4IIQA 3ULVF 1TIUA 2LV4A 5DD6B 3KWWA 1YEJH 5EPMB 5T5FL 3RPKA 3THML 1R5VA 4JM2A 2YA2A 2JCCA 5GGTL 2ARJQ 3O0RL 3KYAA 4YUEH 1A1OA 3K8MA 5GJTH 1XF3B 2GFBB 2EDTA 3U79A 1GL4B 2FJHA 4Y16A 15C8L 4HQQL 1CBVH 4WW2B 1YMHB 3BDXA 4NQED 5LXGL 3HC3H 2P8PB 3TBWB 2XXMB 1C08B 4XNYH 3VG0L 3T77A 1A47A 5HHXH 1RZFL 1KCVL 3PP3H 1DBAH 3RAJL 3SHSA 4Z8FH 4NUJA 1T21B 4NIKB 5FGBA 5AZ2L 1KJVB 3FO9B 5TFSL 1A9EA 4NQUA 5JOFA 4PJDA 5C0RL 4NRXA 4Y4HD 4XVSH 4I0PD 3F65A 5C07A 2XG4A 1BIIB 4ODXB 3QCTH 3ET9F 1K8IA 4ZOAA 1QEWB 5HJ3B 2OZ4H 4FFYH 2OL3H 4MA3A 4M5YH 4X7EC 1I3VA 5EU6D 3VFMA 4PTUB 3QQ3A 4PJGE 4J3SA 4LU5L 4NPYA 4YE4H 3EOTL 4F7MB 1OSZA 2K7PA 3LD8C 2F8XC 4L4VE 2LVEA 4XXCA 2BOBB 4FFZH 4QHMA 5M7QA 1V3LA 1RZ8B 3AFLA 4YE4L 4RA3A 2A6JA 3KPSB 2XKUA 3T0ED 2M2DA 4RFEA 2CKNA 1I1AD 1J7VR 1MJJB 4HIJB 1TCMA 4YEFA 1RK1B 4F9PA 4LLDA 3BGFB 2PR4L 4JHZA 1J0KA 1KGCE 1ORQA 2QQKL 2W59A 4GG8A 4TSAL 1M7IA 3H2WA 1G84A 5GGSB 3IFPA 3SGEI 1MELA 4XBPB 2V7NA 4Z7NF 1XR8B 1NLDL 3RAJH 5ECJE 2R2EA 4HWZA 5FCUH 3D3VE 2ARJA 4G8IA 3EOAA 3M1BB 3FQTB 4HS3B 2V2WA 3FT2A 3HI5H 4DJMA 2LVCA 4PS4L 4HSQA 1AP2A 3QFJE 3HC3L 4P5TB 1KCLA 4X6EB 3VXNA 3QDGD 1I9EA 5BS0E 2HLFC 2JF1A 5D6CB 5EUOB 4P3CH 5E8EB 5CZVL 1NJ9B 4YUEL 3QG7L 1C16B 2H2PC 4JO3L 4JM2F 3ZTJH 4CMMB 4KRMB 1U8OB 2QKIA 1WCQA 5HBBA 1EFXD 4XVTH 1FH5L 4HUWB 3JVGC 3C2AH 4OV5B 3P11L 5D7LE 4PG2C 3L3OA 2VDPH 3TO4A 4TVPD 5AUMB 2A0LD 1G7IB 2QQLH 4D9QD 1O5DT 4ORGB 4EEEA 2J6EA 1YMMD 5F9JA 4LSTL 3ZHLA 4FZEL 4UV7H 1FAIL 1I9JL 2GEEA 3F7QA 3N9GL 4LCCB 4LRIA 5AYQA 1DL7H 4LNRB 3HNSH 3G6AB 5LGJB 4Z7UF 1PKQA 3MACL 3QH3A 3QIUB 1IVLA 4QHLA 43C9A 1OAQL 1XMWA 4ODSL 3QUZC 2J1KA 3ALPA 1J0HA 1GHFL 2BC4A 2Y4SA 4XCEA 5SWSE 2A38A 4FXKB 5I1LB 2F58H 1MJUH 5EA0H 5F6HJ 4AH2B 3KXFA 1T1ZA 3PL6A 3MUGA 5IF0A 4N90D 2VERN 4KJPC 5GSVA 4XBEH 4BSWA 4QHNA 4Y88A 1F6AA 1EJ6A 1W0VB 5L7XL 3KYOB 4N9GB 4M8QB 4HAFA 2MNUA 3CD4A 4N90E 4H5SB 4JDVA 3U6RA 4YK4B 4X0KB 3QQ9C 5IMKA 1AIFA 1CZ8H 4MD4B 4U7SA 5IW1A 3P9LA 2FGZA 3T2PA 1P4IL 5KTEH 1A0QL 3MRNB 4BM7A 4DVRH 5L2JA 4I4WA 3IU4H 2APTA 5CCKL 4PUBL 2X1QA 3LQZA 3H3BC 4MA8H 3C6LD 5C0CE 2SEBA 4EI5D 2R23B 4PJ7E 5IVXA 1GGBH 4X9FA 2C7UB 3RVWC 1EAPA 4EXPX 1I8IB 4ZSOB 4BFGA 4P4KC 4P2YA 3HS0B 4MJIE 5EO9B 1W0YT 1RD6A 1Y6NR 5D7IB 3MLXL 3LMJL 1ZHLA 5DS8B 5C0NC 1BJ1J 1EEYB 5C0BE 4NM8H 4OLUL 4TNWK 4XNXH 4MNHB 4XAWH 4HKZA 4DKAA 2C9AA 1AGEA 4RX4A 4JPKH 4MAUL 1GRWA 3DYMA 2W0FB 4P2OD 4YHLL 1CDBA 4NWTH 4X8XA 1K6QH 2PTTA 3EDKA 3DSNA 3H3KA 4WY7L 1FRGH 5GGRA 3EGSA 1AP2B 1T1WB 3MLSL 5KSVB 5IVZB 1YYLH 3S37H 1BAFH 3VMPA 4IRSC 1EUTA 1HINH 3DX9B 5DURB 4R0LB 2F8OA 5MHSE 2DMCA 4GKNB 4HGKC 4XHJD 4ETQB 5MEPB 3E0GA 3LEVL 2HFFA 1X7QB 1R3IL 1IFHH 4KQ4L 5LVEA 3UPRB 4F7PA 5DO2D 3BPNC 3N06B 5FUOL 2OR9H 2FATH 4Q0XL 4BZ1L 3K7UA 3FOMA 3LS5L 1ES0A 4CDGC 3EFFA 4JKKA 5GS3A 3VXMB 1ZV5A 4MAYD 2ZUQC 4Y2DD 3L5XH 4EVNA 4RBPH 5C9KA 2F5AH 1FYTA 1BOYA 4YXLL 2BC4B 1FORH 3GI8L 3JWNC 2W07A 3QXAB 4X5WB 4FFWC 4W6XB 3WFDH 3IVKA 4HIIA 1N2RB 3WHXB 4IM8A 1INDH 1J05B 4PREA 2YRZA 1AH1A 2X4PA 2WQRA 4KTYA 3C5JB 3MRFA 2NY5C 4QRRA 1NGZA 3TESA 5F9AC 4M3JA 3EJZD 2I9LA 1AGBB 1T21A 3SO3C 1CF8H 4GMTH 4S1DD 2VR5A 1S7XA 1LO2H 1NBQA 1MRDH 1PG7H 1TQBC 3UYRL 3O3DA 1IGMH 4L3EE 3TZVD 3ARSA 3MLRL 5HGBB 3TN0D 4H88H 4UOJA 2CLRA 5FECA 5CJOL 5IK3B 5J6HB 1RFDH 5DD3H 1ZOXA 4PTUA 4AENB 4AIZB 4F37F 4J8RA 4OD2B 4XPBL 4I4WB 2I27N 5MI0C 5A3IC 4HK3N 3IS0X 5DWUL 1KJMB 5IVXB 1IKNA 2D31A 4Y5YC 4WNQA 3A6CH 4K23L 25C8H 1MRCL 2PN5A 2QL1A 4L9DA 1W72A 5K59E 4JFQA 3FFDA 4U6XA 4HIJA 1RK1A 2PKDA 3BPCA 4M6OH 2PYEA 5I66A 1A6VH 4XCYA 3GSOA 3C2SA 3D25A 1G9NH 1P1ZA 1TPXC 4IDLA 4LF3B 4V1DA 1CFNB 2ZUXA 3MV9E 1YNTA 5EULV 2B7DT 3L3KB 5EBLB 1F4YH 3MV7E 4MJ5B 3ZKNC 1ZWIB 2MKWA 1QBML 4LLAA 4NBYB 5C1MB 5FCSH 3FO9A 3HLAB 1HI6A 2YMXL 5INCA 5E8OB 2BP3A 3NACH 2B1AH 4KHXL 4M9PA 2I9TB 2V2WB 2FD6L 4N0FB 3FT2B 5C0BB 1Z3GH 1NCAH 2EXYC 3AAZA 4G43B 3NAAL 4JFFD 2Y7QA 4U1KA 4GKNA 2GJ6D 3DURA 2PW1A 4G8GD 4OCRL 5BV7C 2VDKH 3CX2A 5E24E 3CUPB 3INUL 4W70A 1XZ0B 3IDJB 1NCDL 1X5AA 3BOVA 2NCMA 5C0FB 2FL5B 3GIVA 2NY0C 2DQJL 1UT9A 4HUXB 4ZS7H 1OAXL 1HQRB 3T08A 1X5LA 1MJJA 4C56B 1JHTA 4NC1E 1DEDA 5E00A 5CINL 5T33L 1IC5L 3QA3B 1A5FH 4JFZH 1OGAE 2FHCA 4QF1B 3EDJA 4QRPD 4HHAB 1E0OB 2CRMA 1NEZB 3RIAK 3DWTA 4Q2ZB 3O4OB 1XGQB 2AJSH 4PREB 4TRPL 4R7NB 1LE9B 3AREB 4CU8A 1E4XH 3ULVE 2FB4L 3DBXA 5KG9B 3M1BA 1JZ2A 4X9GA 4FP8L 2IWGA 3GKZA 1OM3H 2YD2A 3UP1A 3DMMD 3TM6A 1R24A 3RIAF 5IMOB 3ZT7A 4M7JH 4P3DB 4RGNE 1FLRH 4JM2D 4Y19B 3PHOA 1FFNA 2DYPA 1IGYA 4EIGB 2AS5M 3RX7A 1IAII 2OMBA 4WO4B 1BX2A 3T0BA 2EIBA 3V0VB 4ESKA 5BOPA 1CFVL 2Z9TA 5T1KA 1IGIH 2OTWB 2EEDA 2FGWL 3X3GH 5DR5H 4CDHA 3KPPA 4PJEB 4NZUH 4KFZC 2GHWB 2DQUL 4NBZB 4QRQB 1WZ1L 4APQC 4YWGL 5TH2B 2CDGB 2FLRT 3FN9A 3P77B 4P4KB 5FKAA 5HHOA 2J4WH 5I17B 2QJDA 2Y6SD 3R8BB 4MB3A 3CDGB 3CFBA 5HYSB 4EOWH 4E41D 4ELMF 4OLEA 1S7VB 4B41A 5B8CC 1SMOA