4DOHB

Il20/il201/il20r2 ternary complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
193
structure length
193
Chain Sequence
b'ILPAPQQLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRQSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-20
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohB02
4XCCH 1R0AH 2R1WB 4P2CG 1EZVY 1P7KB 4O2CB 4UIMB 1H5BB 3HE7A 1H8NA 4OGYL 1YEKL 4HF5H 3PGCA 5KG9A 4YNYB 1ZLSL 5I1HH 5KTEH 5JA9A 3S9DB 4QGYA 5FGRA 3MRPA 2W59A 4X6BA 5LWYL 2BZDA 3OAZK 4M7ZC 5K9JL 4CVZB 2Y07L 1UB5B 5JIPA 4DKEH 1JRHL 1BMGA 2V9RA 1KB5A 3UJIL 4OF6A 4WEBH 3T4YA 3W0WD 1M7DA 5CJBA 1DBKH 4ZO8A 1E4KA 4K3GA 2I27N 2E7LA 4G8GE 2YUVA 2NTFB 4XVJH 1AY1H 2BNUA 4Z7WA 5DO2D 5EIIB 1AHWC 4ZUTA 5FUOH 2ZJSH 3TPKA 5I19H 4FTVE 3EYSH 4WI4A 3D25B 5C0IA 1ZV5A 2NY0D 1NEZA 1Q94B 4HWBL 3S5LB 1RZKL 5SV3A 1CLOL 4MQTB 3SQOH 1MUJA 4YFEA 4K7PH 2DS4A 4LPUA 1IKNA 4HX1A 3QRFM 5DMYA 5ISZB 4ODUA 3L6FA 5E8PB 1S8DA 4BK5A 1T22A 1G1CA 5C0GA 5LKNA 2HKHL 1BWWA 2CUMA 4OZIB 1WZ1L 1ETZB 3EAKA 3OR7B 3GSWA 2EE6A 1OPGH 2ITCA 2XPGB 2FGWH 1AI1H 3PDGA 2UYLA 2FLRT 2RIKA 5JW5A 4JJHA 4WW2C 8FABB 3SCMB 1I9EA 3BQUC 5HI5D 3UBXI 3BFOA 3S36L 4Y4HA 4N90D 1J86A 1QRNA 2OLDA 3UAJC 3QNZA 3CLFL 4YWGL 4M7LL 1BEYH 2IBZY 3RGVC 3GB7A 1HQRB 1MFCL 4U1NA 5BZDA 2KPNA 3O41B 4LLQA 2I24N 5HD8D 3L3OB 5BMFL 5IM7B 3SGDH 4MMZC 2GYSA 4UV4L 4XZUB 1IL1A 5HVFB 1VFBB 3GSVA 5I66B 3ARPA 1LE5A 2LU7A 3BPLB 3LS4L 4EBQL 5HVHB 1OCWH 5IMOA 2PXYD 4XRCB 1CGVA 3HS0A 4EQ2A 3MRNA 3HRZA 2WLYA 5CD3A 3FQRB 4NFDA 3VXTB 5IHZA 3IVKB 4KV5F 1TFHA 2Y06H 1HYSC 3U36A 3DECA 3KDMB 2FX9L 1NCCL 3HZYB 1ZLVK 3BP7B 1ZA6B 4OSUH 3PHQB 4ZUSA 1FZMA 3EFFA 4YAQA 4FQLH 2CDFB 1I1CA 3ZDZE 2HG5B 2E6JA 2BK8A 2EIBA 1ZVHA 2J2ZA 2X1QA 4NKMB 1XGTB 1GZQA 2YMXH 3MGTA 1TZGH 3VI3E 4YUEH 2YBRA 5T1DL 5C09D 2O26U 4IRSA 5GGTL 3AMLA 4YIQA 2M2DA 1MSPA 2Z31A 3G9AB 3PNWA 5TDOB 4BJLA 3GI9H 2I9TB 2F5AL 1HK6A 3KHQA 2CMRL 2AV1A 5JPNA 5SX4I 3MOBH 4QOKD 2OSLA 3VMOA 3BGMA 1DLHA 5KAQF 2FIKB 3SKJH 3DJ9A 4GH7B 2NCMA 4MVBD 3K7UA 3OSKA 4RBPK 4JHBA 5HHNB 5C1MB 3T77A 4PD4J 5KN5B 2W07A 3G6JE 1FBIH 1FLRL 43CAA 3MRMA 4ONHA 2EH7L 4OFDA 3IRPX 4QNPF 1RIUL 5EZOH 1RJZB 3I6GB 5F8QC 5CBEA 1RY7B 1E0OB 1VPOH 5ALCH 4JFFD 2R4RL 1UWGL 2XWJB 4RRPA 5IB1A 5MERA 4CDHA 4KKNA 5IGXL 2QR0A 3KXFE 3JVGA 4EDXA 1OTUC 2E8ZA 2WIIA 4X6CB 1PG7L 4KROB 5EO0B 2FJFA 3AC0A 4YGVA 3MV8E 3MJ9H 5F96L 3C8KB 2CK0H 1MHHA 2NY1C 1HDMB 1MRDL 3WS3B 1CICA 2W91A 1LMKA 2HT3C 4CJ0A 3JUZA 2QQLH 3QULA 4NWUH 1WBZA 2AJUH 3MV7D 3RWFA 3V5KA 2EE3A 2LTQC 5GGQH 1QFWI 4E0RA 4OUUA 5LGJA 1I7RA 3LKNA 4UBDD 5ICXA 2YA1A 1D6VL 1PKQE 3QCTL 4Z78A 2X5PA 3ZZ1A 1DBAH 3MXVL 3THMH 3R06B 5IJVA 4LQFH 1AD0B 5DRXA 3UTPD 4N0FB 4JY6A 2R8SH 3F7RA 4GO6B 5SWSE 3GSXB 3DMMC 2DQFA 5MEOB 3ARED 2J88H 4QT5B 1OAQH 4NQCB 1U9KA 1TETH 1YEFL 3LB6D 4S1RH 1YN6A 2VE6B 3QUYB 5L8LB 4G6JL 5FYJL 4A6YL 1MFAH 2WBJB 4UQ3A 3HMWH 3UMTA 2YEZA 3O9WB 2D31A 4G5ZL 4PJ7F 1NDMB 1OAUL 1QLEL 2DIBA 5I17B 4C54A 2IF7A 1UXWB 3T0AA 4Y19A 5DF0A 3TO4D 1FNEA 1CF8L 3RDTA 1JTOA 2ZOLB 5LQBL 3DRTA 1Q1JL 5CSBA 4XBPB 1BJMA 5HYJB 3OX8A 3JTSA 2AK4D 1QBLH 2ZSVA 5CZVH 5H35B 1PX3A 4MAYA 4KK5D 1B4JL 5D93B 1D7FA 1CIDA 3SKMB 3OBAA 1S7TA 5I8CB 5SWZA 3OQ3B 3BSZH 1OSZA 4LQ1A 5EH1A 1QZ1A 5C2BL 3D9AH 4L3EE 4OT1H 3W5MA 1UB6A 4X99A 2NY2B 1AR2A 2AQ2A 2EICA 5HGAA 3U30C 1J1PH 2ZNXA 4MXWH 3B5GA 4N0YH 2R9HD 3QO1B 4ZFOB 1UM6L 2OP4H 2VZ3A 2R15A 3DO3A 5JXEA 4G3YL 4WIQA 1LDPH 1DQJA 3CFEA 2HT2D 3HPLA 4XNZB 2MHAA 3PL6D 4JPKL 5FCUL 4KHXH 1EUTA 3HNSL 4W4NA 5L88H 5EPMB 1MWAH 4LHUB 4WU5B 3FHQA 4QRPB 3V4VL 4GG6F 1AKJA 5GS0L 4H8WL 1NFIB 4JVWA 1T6VN 1GSMA 1F2QA 3MRQA 3CDFA 1YYMH 4P5TC 1MLCB 1ZEAL 4OIBA 1JN6B 5KSBB 2J8HA 3DURA 4EI5D 5HYSB 4NM8H 3IKCA 5E8NA 5EUOF 4NZRH 2IPUK 3I6KB 3F7YA 1D5MB 4WFFD 1EVTC 1PD6A 4AY0A 1MAJA 2LFGA 5CJQH 1HKFA 1BJ8A 4U7SA 4DCQB 4GKZA 3TPUA 3I75B 3O8XC 4PRPD 3BZDA 4HIHB 1EEYA 3VFRB 1CT8A 4Z7QE 1CG9A 4N8CH 3MROB 4IMKC 4R2GB 2DI7A 4F7MB 4JFHD 2ZWLT 3ZE2F 3BZ4A 1CXEA 3QFJD 1U2HA 1OAZH 5F9OH 1W0VB 4PV8B 1J0IA 3L1OH 4Y2DD 1F4YL 4PJBE 5T1MB 4UMGA 1DSFH 5ID0B 1K4CA 4P2QE 1YMME 5E2UH 3LSOA 4MCYB 1Q9WB 1JFQH 1QSEE 4KKLD 5D96B 4J3VA 1P84J 5DUBB 4JO3L 4FQQB 1MELA 5IG7B 1MIEH 2P5WE 4KVNL 4P5KA 4U6XB 3D85A 3CFBA 2AXGB 4S0TD 1AGFA 1SVZA 3MRIA 1CFNA 3BD3A 1OTTD 2GITA 4D0CB 2X4OA 4KK9C 2VISA 2QSVA 4YJZL 2VRAA 3DI3B 1F6AA 1WT5C 2QSTA 3FT2B 4JQIH 3DX8A 1BFOB 1U3HA 3FFCA 3VWKB 3OAUL 2ZG2A 1YEJL 4QXGL 2NXYB 4LSRL 2DKSA 5K9QI 1S7RB 3ULVL 5CGYC 3WEXB 4NJAH 5C0RL 3OHXA 2CKBH 1MEXL 2JTDA 4NHUB 2FO1A 1GZPA 3GMLB 2ZCHL 2VXVH 2BVEA 4RGOL 1FZJA 5CZXC 4J3TA 1ACZA 4JREC 3HUJE 1HKLH 2ZP0T 1KCSL 1KUMA 4JFEB 2VLJA 4ZXBD 1W72L 3EYVB 4DUXA 3EW3B 5IEKA 5DFWH 3MRJB 1YYLH 2AJVH 3VGEA 8CGTA 1OAYL 2NPLX 1ZLUK 1KCLA 1FG9C 5DT1H 4JGJA 1TNMA 2H2PD 4JFDD 1GOHA 5GIRA 5E9DB 1NGXA 3DIFA 5BS0E 5EORL 3O3AB 2IWGA 1EHLL 2IBBA 3C6LB 5D2NA 5EU6D 2DLEA 4YH6A 5KSAC 1V7NL 1CTOA 4JCLA 4KZDH 1JF6A 1WFTA 2YUZA 1H0DB 4P2OB 5FK9A 4IOIA 4WWKA 4N0UE 4GRLD 3KR3L 3GBNL 3K4DA 5FYLH 2PF6A 4M7KL 2HFEB 3RWDA 4OI9A 2NZ9D 3KYOB 1QSFD 2DQUH 2AI0L 1H3UA 5IVZA 3H9SD 1WBYA 2MWCA 2P42B 3MREA 4S0SD 2BNRE 1ULVA 5DD1H 3TT3H 1CE6B 2JLLA 2XYCA 4HWBA 4JO2L 4R90L 1J87A 4HIIA 4L4TE 3WE6B 3T1FA 1RFDL 25C8L 4EN3A 1U92A 3QAZC 4DK3A 1S7WB 1NLDL 4AEHL 5T33L 4B41A 2J8UE 3LEVH 1LO4L 4G80B 3CH1B 4IS6A 5GRYA 3K2UH 2YRPA 1IT9H 3NFPA 5IMMA 3CFKA 3OGCA 3NA9H 3MUZ1 2HFGH 4L3CA 3VFSB 1M6OB 3T0EA 5I1JL 2DTML 4I13B 1KYOK 4P5MB 1GIGL 3BHBA 2R0ZH 3O6LL 5L8JB 1G7HB 5CILH 5HYIA 5DVKA 5FXCH 1VFUA 3IRZA 2BNUB 1T2QH 2BNQE 5IP4A 5E95B 4Z77A 3TA3B 1MY7A 4LCCC 4RISH 4U1GB 3V7AE 1KTKE 1RULL 5DEFA 1HYRC 5CFHA 1C1EL 3CCHB 1J88A 3CXDH 1FGNL 3C8HA 3DX9A 1QFWM 2H32A 4JLRA 4LNRA 1BVKA 4NN7C 3QIWC 1L0QA 4AMKL 4LLWB 5T1LB 3V7AG 1S8DB 4HLJA 5HHME 2L7UA 2W9EH 3HNVH 3MBEC 2J6EL 2EDYA 4OM0L 3TZVB 1GGUA 4ZFGL 4KK8C 4FP8H 2AJSL 1FZOB 3RKDC 5BJTA 4K3HA 4U0RB 3QXUA 4YHMH 3GSWB 5IQ7H 2BC4A 1WK0A 2YA2A 3BZEA 3BIKA 4KKBD 4DKFH 3PWPA 1N3NB 1T7XA 1U36A 5C07E 1F97A 4F80A 2BOBB 2R2EB 1A22B 2HAZA 4AJ0A 4K55A 1FFPA 2X40A 4X9FA 1HZHL 5AYUH 4OLVH 5D1ZA 1YEIL 5GGTA 1B90A 1RZ8B 1KXQE 4K2UH 3H9ZA 2AEQH 4LSPL 1AGDB 3SQBA 5DC4B 1BFSA 4XNQB 1A2YB 5FYLD 3MACH 1ORQA 1T83C 4HQQL 3G9VA 5CEXA 3OTTA 1FQ9C 1F6LL 2P8PA 5E7BA 2OMNA 3TCLB 4JRXA 5C6TL 3RVWC 4KDWA 2BVQB 1YY9C 2OTWA 3MNZB 1NFDB 3ZDZF 1BIHA 3MRNB 4G9FE 4FMKA 1MJUL 4HWZA 2DQCH 4ZO9A 1CK0L 5DRNB 5EO9B 3VI3F 4CDGC 4KRPB 4ONFH 5HHXL 4ELKA 4N8VA 1MAMH 4DGIH 5AYQA 4HKXA 4PGEA 3WIIH 5BV7B 4YAQB 1RUAL 3SDXE 3PV6A 4GMSL 1TLKA 2A2QT 4EIZC 3LHPL 3CVHL 2HLAB 3MLUL 4ZNEE 1MVFA 3MRBB 5ENWA 2VIRA 4KWUA 3WJJC 5IR1B 3O11B 2BVOA 1X7QA 3TF7C 4NN6C 1FG2B 3M07A 3SCMD 5IK3B 4E41B 4XPBL 3VRLF 2FEDD 1FV1A 3QISA 4P46A 1IAKA 1UKQA 3X3FH 3JWOC 5A3IC 3T0DA 2RBLA 4PRHA 3LV3A 1WZLA 4O51B 3HAEA 1T2JA 4UOW0 5F7HA 4NQDA 3V7MA 5MEPA 5FDWB 4LSSH 1LD9B 4YHKL 5DD5L 2OR9H 2O93L 2NW3A 5F7EL 3WSQH 5DYOB 4OV6F 1A1NB 4OBRA 1L4IA 2VZSA 1IEAB 1DCLA 1F3DJ 2QJDA 1ZE3C 4EI6A 5B8CC 4ONHB 5FA3B 5L2JB 2ERJB 3FRPA 4MNQA 5D8JL 3FQNA 4F7PB 3CSPA 5CEZH 3WNNA 2N56A 3MV9A 4D2NA 1KULA 1SY6H 5BW7A 2BSSB 5D1QC 3X3GL 2WMPA 3L3DA 4OFVA 5HJ3A 3UTSA 3SDDC 4MDJB 4XC3L 1XCQB 1K2DB 5IJKA 4LSTH 4YHLL 4J12A 2WIIB 3V4PL 5E8OB 3IT8D 4LU5H 2J7LA 1DUYB 1NLBH 3NTCH 4PYGA 1IGJB 1SYVB 4Z0XB 4PG9B 1WIOA 4CU8A 4GXVL 4OFKA 5HGGS 2CH8A 1FL3A 3ZTJH 1ZHNA 3TVMB 3LH2H 5DMGD 2VR5A 2WINA 3GSQA 5LGJB 3LKNB 5ICXB 3AY4C 3O6MH 5E7FA 5BQ7B 5FYKE 2XACC 3EBAA 2ZNWA 3QG7L 2UY6A 4GQ9H 3S88H 3CFDA 5E2TL 3N1GC 1LNUB 1BFVL 1CD1A 4XI5D 4TVPH 4ZS7H 3FB5A 4POUB 4ENEC 4RFOH 4ZO6A 1RPQA 1QYGL 4W81A 5I1CL 4BFIB 5J1AA 3DSNA 4NCC1 1DQQB 4P9HH 4PV9B 5EDXA 2WLZA 5TE7L 3NN8B 4NBYB 5C9KA 1UACH 1R5WB 1U8PA 4NPYB 5HHVL 4YDLB 1ZGLP 4UV7L 1M71B 2CGRL 1XH3B 1I1AA 2XOTA 4HWUA 1D5IH 1YN6B 4JFQA 2EEBA 3GSOB 5D7IF 3TJHD 2IPTH 3MFGB 3U0WL 1LK3L 1R5IA 1AGBB 2R1YA 5DJ8B 1I7ZA 1WF5A 2YEZB 3H0TB 2Q7YA 2D31B 2X9WA 4KROD 4F33B 2OK0L 3R4DA 1S7XA 4MJ5A 3TH4T 1BPVA 2F53B 3MLVH 1X3DA 3UTTA 4ORGB 3RX5A 5H8DA 1N64L 3TO2A 1PLGL 1OAKH 5C0CA 3R8BB 1CN4A 3CSYB 4PJ9B 2CJUH 1BGXL 4LEOA 4UT6L 2IH1A 1FORH 3TBYA 4R4BA 3WKNA 3DNKA 1P9MC 5EZJA 3VCLA 1Q72L 3VDCA 4MJ4A 1U58A 3IS0X 1T3FA 1UJ3C 1I9JH 2MQ0A 1GPOL 1JGVL 4KJQD 2HJFA 1D5ZB 4S1DD 4GW1A 5L7XL 3R8QA 1KXTB 4GJTB 4WV1C 1BBDH 3QBTB 5TFSL 4NNPH 4LMQE 4YK4C 5JORB 5SWZB 5EC1A 1YNKH 4OCWL 5D6DA 1T0NA 3QJFB 5FYKU 1RI8A 4FQ2H 5CEZD 4NM4H 1CFQB 5HGAB 2HJKA 2WSKA 1X5HA 3Q5OA 4NQCD 4MHHI 1A7QH 2P45B 2P46B 5DJCB 4YDVB 1F4XH 1R3LA 1TQCC 4PY7B 3QUYD 3VDBA 1CFTA 1A4KA 2WBJD 3O9WD 1KTDA 2F58L 3BUYA 3BO8B 1MCBA 1ODAA 4UIKL 2BJMH 4RMTA 2Z9TA 2RCSL 1RHHB 1IC7H 2YRLA 4Z8FH 2M26A 5T5NG 4FZ8H 1EHXA 2R2HB 1FNGB 2QEJA 2C4FU 3N1QC 2E9IA 3P0VL 3L3GB 4HDIB 4POZC 4N5ED 1HHGA 4G8FB 1FVDA 5L9DH 5HYJD 4FQJL 2Q3AA 1YJDC 5E8NB 2JJTA 3GMNA 4HIXH 3E2HC 4Z7QF 2ZG1A 2FATL 1OAXL 2BMKB 1INDL 4RAUA 5CGMA 1CE1H 2PNDA 4IIQC 4PJIE 2NY2D 2C1OA 3TPUB 4QHLA 1WV7T 1SYSB 4KHTH 1IAII 4PTTA 4BQ6A 4HUVA 3VD9A 1CT8B 2C3XA 4PJCB 2DYPA 4PJBF 3RJQB 4WRLA 4NO2A 3B9EA 1J0YA 3WFHA 3O3BB 3UDWC 1SJXA 3GKZA 3VXNB 5C0BE 4LHUD 1MJ8L 2Q86A 4PREB 4YXLH 4QRPD 1ZWIB 3VXQA 1AGCA 4KDTA 1K4CB 2OQJA 1XF2A 1JPST 3DXAA 4X9GA 4J2XA 5JHDE 1W72A 2EE9A 1MREL 4LFHG 3UPAA 4Y8AA 5M7QA 1MNUH 4OF7A 3QDGA 4P5KB 4PJ7A 3CDGA 3V6OA 4CN6A 1NJ9A 3D85B 3I02B 4QCIB 3CFCL 3V6FB 5T1KA 3C5JA 3CK0H 3BKYH 4LSQH 2RFXB 32C2A 2E9BA 2FD6H 2FHCA 3SOBL 5JR1H 3GM8A 2VDRL 1NC4A 1WQVT 2VSCA 2XZZA 4JFPB 3LS5L 4Z7UE 5DK2B 1U3HB 1U93A 3FFCB 4WCYH 3QUXB 4R2GD 4NZJA 4S1SH 3EOAA 3KPLB 2X4SA 4Z7OE 4LMQI 1T7VA 3T2OA 2NTSP 1NAKH 1NC2A 4FQHB 4YHOH 3OHXB 4HKBB 1QA9A 4JR9L 5BRZA 3KPSA 3MRHB 1EA9C 1NGQH 5C0AA 1FL6A 3U4BH 3UJTH 4NN5B 2R69H 2QQKH 2X89D 3FT4A 5IMKB 2JB5L 5KVDL 3S34L 3B6SA 4WW1A 4I0CC 1KIUA 2O5XH 3ARDA 3BD4A 1IBGH 4QY8B 1JK8B 3I50L 4XBEH 2PKDA 3CC5B 1ROWA 3IFOB 4L8SA 1NGXB 1U8MB 4EXKA 4QHKI 5D2NB 4NKIH 2AGJL 1ZHKB 5GQBA 1S7VA 3MLRL 3PJSA 4K7FA 3MRGA 5IVOA 5T3XH 2OYPA 4YPGB 2ADFH 1KG0A 1A7NL 3C6SA 4LIQE 3HE6B 4IOIB 1SJEB 4KJPC 3U46A 3LQAL 1YQVL 5F1OB 1F58L 4GG6A 4JM2B 4Y4KC 1UZ8B 3P4MA 3WD5H 2H9GA 4M6ML 3VWKD 1F11B 4ODWA 2QHLA 3HG1B 5IFJA 2COQA 4MZ2A 5IVZB 2NXYD 1JNNL 1T1YA 3B9DA 2EYTB 2O5YH 2ATKA 4Y5YA 3MRFA 4M7JL 5EUOA 1F8TH 1N2RA 3A6CH 3CX5K 2J8UF 3SO5A 4GBXB 3VFWA 1HHIB 1NCBH 1PZ5B 3T1FB 4BKLA 1MFBL 1EJOL 1HQ4B 1V3LA 4EN3B 4JFED 4R8WH 1WWAX 3WXWH 2XFXA 2WUBH 4Z7VA 2J6EA 5GGUB 3VXRB 5CHNB 5GGVY 5ERWA 2PW2A 3IDXH 3NCEB 2V2WA 4KKCC 5FF6B 5E9DD 4IDJL 3C6LD 5T5FH 4HH8A 1YEDB 3B9KA 2AABL 4L3CB 4JY5H 4X4YB 6CGTA 3IAPA 4GS7B 1KT2A 1FZKA 3BHBB 2W0FA 3BP6A 5B38A 1FYTE 4WUKL 3TC9A 1M7IB 2ZCKH 2BSRA 3P77B 4FNLH 4P2OD 4DTGL 3LAFA 3O45A 4NP4L 2EEDA 4U6VH 1D9KA 4XNXH 2Q8AL 5DEFB 2I5YH 4MMXC 2E5EA 1JGLH 4HJJL 1MHEA 1EGJL 2X7LA 4W68A 2K9UA 5BVJA 1FRGH 3OKDB 3PWNA 4PJ5E 4UINH 1YZZA 1UEMA 4FFZH 1J5OL 1N7MH 4KGLA 1C5DB 1MRFH 2OM5A 3KPRA 4G6KH 4L8DA 1AXTL 4Y4FA 1AFVL 2X4TA 3D6GA 5ALBH 5AZEL 1S5IH 1HHKA 2MPAH 2EH8L 2ZOKA 1A6UL 1IARB 3VXUA 3INUH 5BV7H 1MFEL 3VD3A 4FQXC 2VNCA 4QHMB 1N5AB 3KLAA 3FONA 4Q9QL 2QHRL 1B9ZA 4BUHA 3MJ6A 4X4MA 3QNXA 2JJVA 3UBXA 3CVHA 2ESVB 2R4SL 4NO3B 3FTGA 1LK2A 4FQ1L 2IQ9L 1HEZB 5HXMA 3FFDB 2Q3ZA 3EYOA 3O2WH 3QCUL 5I18H 5T3XD 2A9MH 1C7TA 4F9LC 3Q5YA 3SDYL 4OZFB 1BX2B 1LO2L 1O0VA 3I2CL 2R0WL 3BEVA 4DN4H 2Y36L 5LGHH 1LO0H 4K3EH 1N6QL 3RWHB 1PQZB 4M4PA 1P2CB 1UA6L 4PJHB 3MTRA 3TA3D 2AJXH 4WFHE 2P8PB 2ATPA 4GAJH 3H3BC 2HH0H 1KIQA 4JRXB 5E1AB 3MJ7A 3MJGX 2GSGA 1UCBL 4UOJA 1MH5B 3HTLX 3L9RB 4R0LB 4P4KA 4QHNA 3SDXF 1U8QB 4TRPL 3KPNA 4QHKJ 4WI7A 2EEAA 1DDHB 1SM3L 5T1LD 2NX5E 3Q1SL 4NQTA 4MD4A 1I7TA 4M61A 4NSKA 3JTTA 1L9NA 1XGYH 3TZVD 4DGVH 4G6MH 4TULL 3NFSL 4NDMB 3S37L 2GJZB 5JMRA 3PV6B 1WWWX 4YHYC 3VG9B 5JQ6H 2DKMA 5FB8B 2YXFA 2X4NA 2VDPL 5DUML 1NCAH 1OGAE 2BVOB 5F9DC 1KENH 1JPFA 5DSCA 5TDPA 1ZT4B 4XAKE 2BX5A 4M02A 4KUCF 4Y4HD 2YD6A 1GOFA 1YECL 3FB7A 4Y5XB 5TJWK 1AO7B 5CJ5A 3L3JA 4PJEE 4ALAL 4BFEA 3TIEA 4GRWB 3KYNB 1ZS8B 4NQDB 5IFAH 4HPOH 3BH9A 4C83B 2PYEE 2X1PA 3BKCL 4MA1C 1MQKL 4P3DA 2VR4A 1J05B 4QTHB 3EJZC 4JEGB 5E6YA 1DQLL 4RMUA 2V9QA 1FNSH 4G8GA 4NT6A 5DRWA 2GAZA 3RIAK 1H3XA 2ZSWB 4Q58C 1E6JL 3IXAB 3U1SL 3GMOB 4W4OC 5TGBA 4XX1E 4QRSA 1YC7A 3NFNA 4FTVA 4JRYE 1TTGA 2BDNL 4HGKC 1AR1D 3P0YH 1BQLH 2BVPB 4U6YA 1X4ZA 2EYRA 2IADA 3C5SB 4CJ1A 2A1WH 4J3WA 3C2AH 1Q9OA 2AQ1A 1A3RL 2FX8H 1MCCA 2FSEA 3PXJA 3TIDB 4UAOB 1MCPH 4A6YB 5DFVD 2ILLA 2OZ4L 4XX1G 4CW1A 4KJYB 3MRRA 1IAIM 5ADPL 4TSAH 4E41D 4Q9RH 4KRMB 1Y6NR 2VC2L 2J1KA 4FXKA 1CFVL 2X44D 4L9LB 3PGDB 1B6UA 1DN0B 4BSWA 1RK0B 5I75B 4W6XB 3P2TA 3D0LB 5C0JA 4DEPB 3DPBA 1U8KA 2EXWD 4JPWH 4DOHE 2HMIC 2IAMC 3UCRA 5ICYA 3U82B 1MHCA 3EGSA 1AP2B 1KCVL 3FKUS 3KWWB 3MA9L 1KEGL 3SDAC 3RL1A 1QFOA 3KYKH 1U8PB 4HK0A 3MCG1 5D72H 4YR6B 3EJYC 3GJFA 3QWRA 4XAWH 2C9AA 3SBWC 2F54A 2ADGA 5EBMA 1OTSD 3PV7A 1VACB 2CXGA 2FZ3A 4X0KB 2R1YB 4MD0A 1I7ZB 2ENSA 1NGPH 3RGVA 1UM5H 3F65A 3QHZH 4B53A 4OQTH 5I30H 4MJ5B 4RFNB 1BD2E 5I1KL 1S78D 1WCBB 2ICEB 2D7PA 4Y16C 5F21B 3TO2B 4HIJA 4Y5VC 5HDQH 1W8NA 3QIBB 4LEOB 2VDNH 5AZ2L 3SDCC 4HHAA 1IQDA 4PGDA 4N1EA 3QEUA 4OD1H 3C9NB 4XP6H 3TVMD 4KI1A 2VDMH 4NWTL 5HDLA 1CGXA 4MJIE 1U58B 2VLLA 5I76A 3W2DL 3CVIH 5F7FA 3NCCB 4M5ZH 5HPMB 1TVHA 3PP3K 4OLEA 3IAQA 1R3IL 3WLWD 3RQ3A 1P4IL 3H7BB 2FL5A 4XT1C 3MV11 2HRPH 2XQBH 3STLB 1BQHB 4O58L 4NHCL 1HI6A 5T5NF 4FFVD 4DJMA 4JRWA 4XPTL 2DI8A 3QIUC 3UJJL 2FB4H 1JE6A 3FRUA 1T04A 2HJKB 4LRNH 3LD8B 3L5XL 4LCWB 2VWEC 4PJFE 3K3QA 4R7NA 1CR9H 3O81A 4YLQT 4QHUA 2N7AA 4LRIC 1SBSL 1AGEB 1VERA 3QDJA 4UOW1 5GZOD 3VGDA 5DI8B 4P2RB 2EDDA 3Q5TA 1G9NH 1FL5B 1JNLH 2BVUA 2IANE 2YK1H 1SEBA 1U8HA 4JO4H 2VWEE 2RJMA 3KXFA 4PJ9D 4ZOAA 5DZOA 3VXME 3AAZA 4NZUL 3GM0A 1J10A 1TJGL 4KPHL 3QA3B 3IB4A 4PJAE 4EOWH 2O5ZL 3MV8A 2NXZC 4WI5A 3MLSL 2PTVA 1B0GB 1HHGB 2BHZA 4QRQB 2XV6B 4MLIA 1FVDB 2G60H 2FEEI 4K8RL 5C3LD 4PJIF 2AK1L 4WENB 4XWOD 1KTLB 1JZ5A 3E3QC 3TNMA 1PZUB 5IW3A 5SWZD 3OKNB 1PKQA 1HOCA 4F7CA 1KJVB 3RA7H 3REWB 2C3HA 5DJDB 4ZFFA 5HHOE 1QR4A 1U8LA 2DM2A 5D70L 4OJFL 4XCNB 5SWSA 2YPLB 3LCYA 1JWUA 3LRSA 1T66C 4FMFA 4BELD 4ZTOL 5CMAB 4O9HH 1PEZA 3DV4B 3O2VH 4H20L 3CJJA 2OS7A 2PCPA 1GGTA 1X44A 1NCNA 5EN2A 1T20B 5AG8A 1EPFA 1EERB 2A73A 1H3VA 2D7TH 4GLRH 1NMAL 4LGSB 5ESAB 3WFBL 1C08A 1V05A 2XTJB 4M9OA 4Y2OA 3DXAB 4MQXC 4KTDL 4I2XB 1W72B 3TBWB 5K9OA 1TXKA 5BOPA 3NH7H 2LE9A 4HFUH 2XQYK 2HLFD 1ZLWK 5FYKL 1VEPA 3OAYK 4JM4L 4Z7UF 3HE7C 1IAIL 5DEGB 2YD3A 5DUPL 3TGXA 1TCMA 1N6UA 4Z7OF 3MJ8A 2E6PA 3S35L 4XCEB 3S4SB 4PFEA 5HY9A 4ZOEA 3HFMH 2WBKA 1DLFL 1JCKA 2KZWA 4HK3N 1DQDH 1XIWB 2WW8A 3NAAL 2F74B 3ECBA 3NZ8A 3QRGH 3EOAB 4OLWH 4L3EA 4AIOA 3BVNA 2IFGA 4OLYL 1E4KC 2FO4B 4XHQA 3W39A 4F2MA 4YXKH 5HPOA 3VA2C 3ARBB 3V6BR 5D1XB 1P69B 3K46A 1OT2A 2DM4A 1FL6B 5DQJB 1GGYA 3BT2L 1S9XA 4R4ND 5ETUB 5DHYA 5J12C 2WK2A 3FT4B 5ILTH 5E99H 2FWOB 4JHWH 1XR8B 3U0PA 1K3ZA 3B6SB 3RNKB 2NLJA 4ELMF 1R3HA 4R96B 5E08H 2WBWB 4JPIA 3I6LE 4N90E 1VADA 4HPYL 1Z9LA 3FJTA 5E2VH 5FGBC 4TUKH 4ZUVB 2AW2A 4FABL 4LARL 3D85D 4J4PD 1IZKA 4U1KA 1CGWA 3QDMB 2CIKB 5F9WB 5HGBA 4K7FB 1BOGB 1NL0L 3TH3T 2YOCA 3C6SB 5E4EB 4X80H 3VH8B 3AB0B 1U91A 4PGBB 3QWOA 1VB9A 3ULUH 3PABA 5CIPB 1RMFL 4PP2A 3IETA 3FB8A 1JP5A 1U3HD 3FFCD 3QUXD 3AROA 4XMLL 1DJSA 5TPWH 2G9HA 1NBVH 4GKOA 1T1YB 1T5XA 5CINL 4CVXB 4P5TA 4Y5YB 5FM8A 2XKUA 3IJHB 4EIGB 2AERT 1U8JB 1EGJA 1OSPH 1D6EB 1A1MB 3BEWA 1I85C 2H2SD 1L6ZA 4HXBH 3WUZA 3DTXB 1JHTB 4GG8A 1JVKA 3H9YA 5JUEH 1U3YA 3AS1A 5J11C 4PRDA 3D39B 4JFYB 4OI8A 1VFAB 1L7IL 1MI5B 1N5YH 3PF2A 5C09E 4Z7VB 3F12A 1NH6A 2A9NH 4H26A 4Y8DC 4WO4B 1S7QA 5F9AC 4HGMA 3TFKD 1T21A 2BHUA 4HCRL 5FECA 5EULV 5DGQA 4PJBA 2DD8H 1KELL 3LN9A 1K8IB 1YMMA 1A7PL 1A3LL 3UTZB 2PO6A 4QTIH 4L5FL 3P9WB 4PY8I 2W0FB 3V5HA 4DK6A 5B38B 2DB8A 3NIDF 3G6AA 4OZFH 3U7YL 4P99A 2P5WA 3ABZA 3O6FB 4FS0A 3MLXH 3O0RH 4WI2A 4JM2D 2E3VA 4K3JL 4E42A 4NBXB 5GS1A 3ZE0E 1D9KB 4IRSC 3OXRA 4PB0H 2Z31C 2X9XA 1YEEL 1YJDL 2QKIA 3VFVA 1GGCL 4MSWA 4DZ8A 3DV6A 3H3PH 4F8QA 3ZL4H 3AU1B 4KQ4H 1MCDA 4GSDH 1RU9L 4HS8L 1UADC 1CGSL 4TUOA 1BVLB 1J8HB 3BWAB 2VDQH 3QR2A 2R2CA 1A7RH 2AXFB 2X4PB 1NBYA 5ESQB 4EN3D 2DF3A 5E5RB 4HS3A 2DWEA 1I3UA 3FOMB 4OGAC 2XXCB 3VXRD 3VD4A 3KLAB 2FX7L 3RWJB 3ZYJA 5HHQA 1WEJL 1H3PH 5IESL 3UBXB 4M43L 5DJ0B 5F7NC 1NANI 1EAPB 5DDHA 3DBXB 3G04A 3HZVA 1DEEB 3JVGC 2HTLD 4XXDA 2G75A 4RAVB 3UTPE 1X4XA 4D0BA 5DTFA 4GRWH 5MI0C 2NY7H 4KRLB 5BS0A 3KYMB 1TZHB 2VXSH 3MFFB 4KU1A 5TE4H 2AEIT 2NY3B 3P4OB 2VXTH 1I8LA 2Y6SC 1LP9F 1CICC 3BGFC 3QJHA 4G43A 4PJDB 6FABH 3PHSA 1KIQB 4AL8L 3REVA 3SY0A 3BKJL 4D3CH 4XCFH 5ADOL 3R0MA 4N0UA 4OCNC 3E6HA 3HI5L 4LP5A 2VABB 3IDUA 4KZEH 3KPNB 2R1XA 4JCMA 5CCKL 3EFDH 2ITDB 4GW4A 4FFYH 1U8NB 3UPRA 3BP5B 1I7TB 5DLML 4QRRB 1LE9B 3PQYB 2BNRA 3PHOB 1S7SA 3U9PL 4PRAB 4XWGL 2Y5TB 1I75A 2DICA 4H0IA 2EDQA 3DVNB 3NCYP 3RFZC 3RVUC 5I74C 4QYOB 4L4TA 2H1PL 4PJEF 2DDQL 3RVTD 3RZCB 5GSRA 4Y1AB 3TJEL 4DVBB 5MENB 2X4NB 4UTBL 2ESVD 1QLEH 2DQIH 1JPFB 3BPNC 3F62A 2OZ4A 1CXFA 1T5WB 3K4AA 4H5SB 1CLZL 5GSVA 4H88L 5I6XC 2J8UA 2OJEA 4XVTH 4F3FB 5JHLH 1G9MH 1UC6A 2A83A 1PVHA 2IALA 3L3JB 3NBNA 1CDUA 3TIEB 4AIXA 3JV6B 3VGFA 1KYOJ 2FHFA 3F7VB 3BH9B 3OPZH 1ZVSB 1RVFH 4TN9A 4U1IB 2XZCH 4P3DB 3P30L 5EU5A 4OD2B 5IBLC 3RDTC 1QBML 1XF1A 3C09C 5JXAL 4JRXD 4M7ZB 5B39B 4Z0BL 4IOFD 2GW5A 1IGYA 1WBXB 1Z0MA 4J3UA 2ZCLH 4FTVB 4AIZA 4PY8J 5DK0A 5IQ9B 4LCIL 4MAYC 3IU4L 2AJ3B 15C8L 1NBQA 4M3JA 4LEXH 1KLUB 3L7FA 3GJEB 3QFDB 2V5MA 4WY7L 1AHWB 3WN5C 1T03L 3FN0L 4QXUH 4YHZL 2VUOA 2QTEA 4F8TA 1JNHB 4G6FB 4LVHC 1L7TH 2HKFH 4P9ML 4HEPG 1CDGA 1E4WL 3HC4L 4LAQH 5JXEC 5D7JA 3P4NB 3GIZH 5J9PB 4P59H 2XZAL 1B0RB 4NCC2 4KH2A 4ODBD 4X5WA 3MLPA 1UQSB 4PRHD 5C07A 4RFEB 4NQDD 3QIWA 5I1EH 2BRRH 3FO1B 3CZJA 5FCSH 4QRUB 3WYRA 3GZKA 4FXGA 3NCJL 5C0JB 1O5DT 1ZT1A 1PYWB 1RJCA 4HUXB 2YN5A 2P1YA 4V2BA 3MQIA 4PRPE 4P23C 4LSUL 4OTXH 1ZA3A 3G08B 3HR5B 1XGRA 2XNAB 3SGDI 3BXNA 3EYQC 3C5ZC 3HB3C 3MV9D 3OKEB 2YWYA 3CMOL 4WW2B 2R23A 5EA0H 3RGHA 1A0QH 1YY8A 3BQUB 4ERSH 1EVUA 1P4BH 4M6NL 5EBMB 4ODTL 3FQWA 2PYFB 1HIMH 3G5ZA 2K7PA 5GRVL 3VGAC 4G9FA 4TPRL 5DD3H 5EG6C 2GSIA 1S9WA 3MRCA 4NYLA 1K5NB 1UVQB 3HNTH 3RWCB 4JQXC 3N1MC 3U7AA 5IOPB 4HIJB 1OD9A 12E8H 2XA3A 4JB9L 1OQOA 1YPZB 3SDXA 1N8ZB 2DQJH 3QUML 1JZ7A 3FAWA 3B2VL 4BZ2H 2JIXA 3VXSB 1GGIH 2VLLB 5I76B 3N0PB 2DJUA 4XXCA 1WLHA 2Z4QA 3QPQD 5C92A 4OIIH 2Y9RT 1WWCA 5AD0A 1A1OB 1MCKA 4P0DA 3MA7A 3PP4H 2P44B 3R0NA 4UI2A 4WFED 4PJFF 1MPAH 3W9DA 5C7XH 1HI6B 4OD3H 4HIEA 4U6TA 2G5BA 3DSFL 1I8MA 4CU7A 1KCRL 2HYMA 4MQ7B 3NZHH 1T04B 5DJAA 3ESUF 4HSQA 3KLHC 3IFPA 4OCRL 1RUQL 3WKMH 3G6JB 5L2KB 1LWRA 5DC0A 5FOBB 3SKNB 3JWDL 4HKZA 4PJAF 3OKYA 2BFVH 4FG6C 5JOFA 1C12B 3BN9D 1G7JA 1DBJL 1JZ6A 3CLEH 4LASL 1C16A 3AAZB 2A77H 5B8CA 1UH2A 2P43B 2CQVA 1N0XL 2DBLL 1DE4B 4BUGA 2WWMC 3GJFK 3MR9B 3X12A 5GS0D 5EU6E 4M9PA 3HPJA 3O4LB 4OB5H 3AM8C 2A6KB 3SDDA 4OLZH 4NQUA 4BSVA 3GUTB 2DQTH 1ES0A 3CXHJ 3BRFA 5AUMA 4Q2ZA 5CBAA 3PUCA 4UB0L 2XICA 1Y6KR 1HOCB 4M1DL 4DVRL 2GFBB 3GBML 2FDBP 4P2YA 4DN3H 2ADJB 4G42B 3TN0A 3H9SE 2VZVA 3BESR 4LCWD 3VDAA 35C8H 4AG4L 4NO0A 2QQQA 1IGIH 3RUGE 3QEGH 4ODXB 1ONQB 5GGRY 3L5IA 2AEPH 2LTQB 1BHGA 3VFPA 4NQXA 4A2LA 4NRXA 3D87B 5HYQA 3AY4A 4EVNA 4W6WB 3OKMB 5EU4B 4E9LA 1UG9A 4J3XA 2VERN 3UYRH 1FIGH 4P2RD 4WWKC 5EN2B 3IJSA 1NGWB 3HC3H 3DRQA 2FEEL 3LEYH 5CGTA 1NMCC 4HZLA 3DMMB 3O2DH 4MQSB 4KJWD 3ZLQC 5KVEH 3WFDH 1ZOXA 3T4AA 4RGNC 3EIFA 3BP4B 3GO1L 1IFHH 4JDVB 4QF1B 1G6RB 1X5JA 4XP1H 2V2TA 1DVFC 1J1OL 3D3VB 2P7TB 4JY4A 3U2SA 5ICZA 1RZKC 4NUJB 2JCCF 1VEMA 1AQDB 2FJHB 2XWBA 1RURL 4J1UB 1KLGB 4FRWA 3WNKA 4BQ8A 1RZ7H 2P8LA 1A6WL 4NQEB 1K85A 5DD6B 1KN2L 4RGNE 2W60A 3V52L 3OZ9L 1WFNA 3HC0A 4U1HB 4FZEL 5CIPH 3UYPA 3QZWG 1NCDH 1XZ0A 1WZKA 4PJXB 3NZ8B 3GK8H 2FBJL 3T0EC 4EDWL 4OF0A 2DYPD 1FAIH 4HZAA 2JB6B 1EZVX 2WWKT 1FDLH 1OM3H 1CVRA 1O7SA 4L1DA 4F2MB 2VH5H 4P4RB 5T3ZL 1S7UA 3ULVD 1QTYT 5FV1L 4YX2L 3TLRA 3RY4A 5JZ7C 1IAOA 3SE9H 2NNAB 5C0DA 1ADQA 3VW3H 1UGNA 2XTJD 1S5HB 3DXAD 4JKKA 4K23H 4OGZA 1AIFA 3WFEH 5I8KH 4IMLA 1VADB 3VJ6A 1ZANL 3V6ZB 1OGTA 2A6DB 3JXAA 2X42A 3QDGD 5JO5A 4HCRA 4RGMC 4ONOA 4UILL 1HINH 5FYLE 5F1SA 5T1KD 2ARJA 1FE8L 4LLMA 2WZPD 5IT2H 1U6AH 3MOAL 4UQ2B 1HZHH 3QWOB 2BHYA 3BDBA 4XNYH 3QUZA 3BJLA 3IETB 4LOUC 1TVDA 1XIWD 4RWYH 4APQA 4WDIA 4OZHF 1XF4A 1JF1B 2XRAL 1B6DA 3GHBL 3OJ2C 5ISZE 5DK3A 2C7UB 3P9LB 1XF5B 4PJIA 2P5EE 1R6VA 1INQA 2B4CL 3BYTA 3HMXH 5TQ2L 4P5TB 5D1ZC 3QQ4A 5EU3B 2VB5A 4X7TB 3BYYA 3ARBD 5AWNL 1MIML 4KAQH 4OZIE 3PWPE 2HVJA 5D1XD 4AENA 5C0AD 3S5LG 1HH6B 3LDBB 5GRUL 1OP5K 3V5DB 2V5SA 4TQEH 1XFPA 4JN2B 4PP1D 3EDJA 3GIVA 3NABH 3VFUB 1A9EA 3RI5F 3IDNB 4NQSB 4ISVB 5E00A 3QPXH 3O8XB 4MNHA 1SQ2N 3SN6N 3ARDD 5A43C 3MBXH 3BPLC 4F57L 3W9EA 4JAMA 4WI3A 4P2QB 2F5BH 5B4MC 4DAGL 1NDGA 3W0WB 4H0GA 3QDMD 3ZE0F 1QSEB 2R0LL 1FO0B 4J3SA 3ARRA 2PR4H 2DQDL 2EDKA 4XPBH 1I8KA 1JRHI 3PDOA 1B2WL 2ZUUA 2P5WB 4QWWC 3RU8L 3WIHH 4Q97A 1LEGA 1TJHH 5IBUB 5FO9A 4DQOH 4ZPVA 3KJ4B 4E42B 1ZTXL 5AG9A 3R1GH 1BM3L 4M62L 1FLTX 4ZYKA 4P46C 5GGVH 3B8YA 2HN7B 4MDIA 3WDJA 2IH3A 2DQEH 4DZ8B 3VE0A 4Z7UA 3FAXA 4HH9A 5IHUL 4ZAKA 4TUOB 4HJGB 5IB2A 5IB3A 5D8JH 4CMMB 3CSBA 2OTUB 5DJXA 1NFKA 2E7BA 4Z76B 3TYFA 3U7WL 2DWEB 4RMVA 2IBGA 4WO4D 3SPVB 3CX2A 3P11L 4I5BA 4FXLA 4MYWB 2NY5L 3HUJB 2F19L 4JO1L 3UZQA 2B1AH 3AXLA 3MLYL 3K2MC 3JV0A 3ZDXF 1ED3B 5EZIL 5F3BA 5IJKC 1JPTL 5L6YH 5F7WC 2YC1B 4X6FB 3L3HB 1R3KA 3CU7A 4MLSA 1F4WL 3OL2A 2G75B 4XP9H 5I2IB 4JDZB 4ETYA 1FHGA 1NAMA 3O6FD 4IJ3C 4NO5A 5F72S 4LLDB 4ZDHB 1CS6A 5F7LB 2E7HA 4JREB 1H3WM 2E27H 2X1WL 4YE4L 4U7MA 5DD0H 4LHQB 4ELMA 3M1BA 1D9KD 3QEHB 3QJHB 4X5XB 4G43B 5D7SH 2VN7A 2VAAB 3H9HA 4R4FL 3ARSA 4OM1L 1Q0YL 1LEIB 4UNTA 7FABH 1A6AA 1RZJH 3Q3GB 3VG0L 1HWGB 3TM6A 1J8HD 3DVGB 2Y7QB 5KSAB 1JTTA 3ETBF 3LPFA 4EUPB 2Z0BA 5HHVH 4NKOA 4ZS6C 2X1XR 1OD7A 5F6HI 3MRKA 1AE6L 3QNYA 3BN3B 4NZTL 2VLME 4QGTA 1Y18A 5TE6L 3GI8H 1WTLA 5HI3D 2OK0H 1S9YA 2DQGL 1I1AC 1A5FH 1QFWH 1FN4B 4YBQD 1Q0XL 4IDLA 4M48H 5C08E 3ZKMD 5EIQA 4PJ8A 1A4JA 1XR9B 2X05A 2EDHA 3LQZB 4HUWB 1KPVA 3VRJA 2NY3D 4RIRB 3BAEH 3HCVB 1D5XA 3QAZB 3ZTNH 3KLDA 4JANB 4GUPB 4NQCE 2OL3B 4ZUUA 3S6CA 2Z92B 5H37H 1QPXA 1QOKA 1X5AA 4XCCL 1R0AL 2BNQB 3MUJA 4P4KD 4H8WC 2OTPA 3QXAB 3UTTE 3I3EA 5I1LA 2NZIA 2A74B 5DVMA 1P4LB 5FKAA 5I73C 1XF3B 5DK0B 4HF5L 5C0CE 4TYUA 5I1HL 2H3NB 5IV2A 4X83A 3PQYD 5KTEL 5EZLB 4E5XA 1HHJA 4FQPA 5D6DC 5KSUB 4RQQA 4C57C 3FO0H 4X8JA 4UDTA 1AJ7L 3SE3A 4LCCB 4DKEL 1FFNB 4CUCA 1KIPB 4WEBL 3PGFH 4KK6D 3DUSA 4Y0GA 4O2EA 1DBKL 2ZPKH 4XPFH 3IXTA 3T1WA 3DUUB 3F5WB 5EOTA 2Z93B 4XVJL 1AY1L 3DVIA 4TVPE 4G8IA 3ZTJG 4NN7B 4ZTPH 3SJVE 3QUMA 5FUOL 3QIWB 2ZJSL 4LGRB 2B2XH 4HKJA 5EBLB 5I19L 5I1AA 4XNZC 3EYSL 3O6KH 3MBEB 1F90H 4KXZH 3DARA 2OBGA 4LLVA 4C56B 1VA9A 2FYYB 3BD5A 3ROLB 3SQOL 3VXPB 1RJLB 4K7PL 2GIYA 3KPPA 3GGWB 1U8OB 3BXNB 4H25A 2VITB 2YPKB 4FTVD 4GKSB 5FO7A 1AQKH 5BXFA 3M8OH 1H9VA 1FVEA 5F7DB 2JJTC 2UUDK 3G5ZB 4YC2C 4WEUD 4BQBA 1OPGL 1LP9A 2FGWL 3VGGA 5I1DA 4WVRA 4NC0B 2GSIB 2E6QA 2W65B 2NX5A 4G6FD 3OXSB 3KPTA 1A6ZA 1JPGB 4D0DA 1F42A 1QACA 5IW1B 3FMGH 3QQ9C 3C60C 3SDXB 1FGVH 5KSBE 1BEYL 4ZD3H 3IDIA 5GHWH 5I0ZA 3GMRB 2EO9A 3SHSA 3D18A 3EOYG 1VGEH 3MA7B 4ZMAT 1WGOA 2APFA 5F6HJ 2R0KH 1HSAB 4MD5A 1OCWL 2D7MA 4PJEA 5HYSG 4HIEB 4JKPH 4JFOA 3PIQA 4J8RB 2FH8A 4NFBA 2W92A 1EEZB 1MCEA 2Y06L 5GZNC 4NN6B 4NJ9H 3IFPB 3QWRD 5CSZB 1G7IA 3BQUD 2EZ0C 4OSUL 3V6OC 4IHOB 4FQLL 1LO5B 3UAJD 4IBLT 2HJLA 3GDBA 3RGVD 2YMXL 3MV01 1TZGL 5D7LE 5JLZB 4JRYA 4YUEL 3VFTA 3EYFA 4K3DH 2HT4C 4M93C 3T65B 1T6WA 3GI9L 3ZHDA 5HHPB 5B8CB 1YA5A 2I9LA 4XVSH 3BJ91 4NRYA 3MOBL 3GKWH 2WUCH 1V3JA 3SKJL 3VXSD 1OARH 1G6RH 2DWDA 1IEHA 5MEQB 4OAWA 5D1QB 3LMJH 1HYSD 2JJWA 3GMMA 3FOLA 4BSVB 1TZIB 3BPOC 4LPWA 1FBIL 5F89A 3HI6H 3RUGF 1FH5H 5F93C 1QSZA 5ACZB 3QDAA 4MJ2A 4J23A 5EZOL 1I1YB 1KNOA 1UENA 4Q2ZB 5IIEA 5K9KA 1IM9B 1VPOL 5ALCL 5KS9B 5JW4N 3DETC 4N5UA 2WV3A 3PWVA 5BRZE 3KPSE 4YDJB 1HH9B 4NQVB 5D6CA 4L8SC 5F1NB 2ZUVA 1A14H 5D5ME 4CNIA 1T89A 5E6IA 3IYLW 3UEZA 4KKAC 4TSCH 43C9A 4NRXB 4EVNB 3RWGB 3MJ9L 3S36X 4MZ3A 2CK0L 4JZNB 2E9WA 5DMKB 4X6EB 2QQLL 5KANG 4HBCH 4NWUL 4PRIB 5DURB 2XA8H 3KXFD 2AJUL 1HXMA 4G8EA 1I9IH 5GGQL 3MGOA 4BQ9A 1N59B 3OJMB 2EDRA 3T4AB 1D3CA 2EDNA 5CEYB 4AEIH 3SDAA 2V2TB 1DBAL 1MCJA 3THML 3LY6A 3OR6A 3UO1H 3SBWA 4AT6A 4JY4B 4LQFL 2P8MA 3GSNB 2V6HA 2R8SL 2JE8A 4AZ8A 4PRBA 1OTUD 2Q6WB 1OL0A 4QXTB 4MJIA 2YKLL 1DUZA 3L5WA 1YQ2A 2HFFB 3ZE1F 4C59B 2J88L 4IDJH 1FSKB 2X70B 1BLNA 2ICWB 5E8EA 1OAQL 1P5VA 1AXSA 2NY1D 4GAYA 4ONGH 1TETL 1ITBB 4S1RL 4Y5VA 2HT3D 3SDCA 1ORSB 5EBWA 1MFAL 1MCOH 5SWSD 3LN5A 1XZ0B 3HMWL 3B9KC 4DTGH 3FL7A 3ESVF 5C0FB 1TTFA 1X6NA 4MX7A 1Z5LA 1UJ3B 4F37F 3MCKB 5IEHA 4JPVH 3OJVC 1KIRB 1ZT7A 3N1PC 1UKTA 4PJFA 1NUGA 1MRCH 1UH4A 3K4ZA 3BMWA 1KFAH 4JJ5B 4WV1B 3ZE2E 4KVCH 1RIHH 4YK4B 1JGDB 2AKRB 3DMMD 1ZHLB 4U1GC 3WLBA 2D03H 4XH2B 2IANA 1AIFB 4JZOA 4XC1H 5GGRB 4PR5A 3QUKA 1QBLL 4JFDB 5CZVL 3D3VD 5T3XE 3PXHA 3G5YA 3D2UB 3L3IA 4AM0A 1TQCB 3NVQA 3KPOA 4Y4FC 3RVVC 1OLLA 4PJAA 3TYGH 3RL2B 2UVFA 3BSZL 3ILPB 3TH2T 4ETQA 1R24B 3DX6A 4LRIA 4M6AA 4BZ1H 5KVGL 5DWUH 3D9AL 1B3JA 1RZIA 3LN4B 4NQED 3IDGA 4OT1L 2PUQT 5E6ZA 2ARJB 2YD5A 3JBG7 1FO0H 1J1PL 2AS5M 4MXWL 2FECI 3LIZH 4GRLB 4N0YL 1PG7X 2WP3O 1KJ2B 2Y72A 4U0RC 2VJXA 4OZIF 2AP2A 2I07B 4J6RH 3VXOA 1LDPL 1QSFB 4WDIB 1OB1B 4MAUH 3RNQB 1TQBC 3U4EA 4MA3B 5HHOA 4X7FC 4KHXL 5GXBB 3BOVA 5JNYA 1IE5A 1IGMH 5L88L 2D7NA 1CU4H 1MWAL 3MLWH 4R7DA 4YDKH 4LKCA 3E2HB 3OKLA 4X4ME 1YUHB 5KANI 3T3ME 4MWFA 1A6VH 5IROA 1MFNA 4HULB 1T1XA 1A9EB 4IIQB 1YYML 3B3IB 4NGHH 2CR3A 3ZT7A 4MA7H 4M5YH 4NM8L 5F1IA 1XGUB 1BJ1H 4OCSH 5C0BB 4NZRL 4KMTH 1QR1A 1W0WA 3ALWA 5CJ8A 3FQUA 1CQKA 1UWXH 1TCRA 1NDGB 3KYAA 5CJQL 4OIAA 5JHDB 5DJ6A 4DKDC 3V0VA 1SJHB 3ZMRA 4KRPC 4ZSOA 1F00I 2XN9B 5FV2A 5BV7C 4N8CL 1HSBB 3RY6C 4HAGA 1FVCB 1NFDE 4GAFB 5DZNA 1OAZL 3H42H 4YHPA 5F9OL 2JCCA 1G7PB 4P5TD 4Z7UB 1YNTB 4HH9B 1EK3A 3OV6A 4TNWK 1JWMA 3L1OL 3VFGH 1MJJA 3SGKA 1DSFL 2VKXA 1JV5A 5E2UL 5E94A 1QLRA 4X6DB 5DHVB 4O00A 4HMCA 4EUPH 5ESVB 1R5VA 4S2SA 1JFQL 4U6HB 1FJ1A 3BISA 3O8XD 5KZCB 4E41E 2V2XB 5E03A 5KSVA 1MIEL 2R29H 4F7EB 3L3KA 4LKXA 5H94B 1EBPA 4P2QD 3MODH 1VKXB 1RK1A 4JFZH 1G9EA 2BCKA 2X1OA 5F3BB 1QSED 4MNGE 5E2WH 1R3KB 2D0GA 3UTQA 4JQIL 4K94H 2P5WD 4RA0C 3LKOA 1E28B 2LABA 1P7HL 1I8IB 4F7TA 4X6CF 3CFJA 3M1BB 3QXDA 4CKVX 4G9DA 2XKSA 3FO9B 4XNMB 4O02H 2CKBL 4M00A 5TH2A 2OL3H 2LVCA 3N9GL 1BAFH 3DGGA 4ZUWB 4F15C 4EXPX 3UC0H 4WFGE 2VXVL 4I3RH 2JJUA 5FGBA 2PXYA 1E27B 2H45A 1MVUB 1TDQA 1UJTA 5CWSA 1GHFH 3DROB 1E4XH 3SE4C 1HKLL 2XY2A 2F8VA 4DGYH 1BZ9A 3O3EB 2VL5B 1CDIA 4JE4B 2ED7A 1QVOB 2X2YA 1YYLL 1KCKA 4KK9D 2AJVL 3STBA 1DBBH 2J5LC 4L29A 2I60H 2P24B 5DT1L 1CD8A 3MC0A 1TVBA 4OZHA 4Y4KB 3A67H 1V3KA 2VXUL 5A2FA 1EHNA 4NRZA 2C3VA 1NGYB 4I0PA 5C09A 4KZDL 4YDLC 2AV7B 5CGYD 3VFNB 2IMNA 4D9LH 4PJGE 5ID1B 4GW5B 1IM3A 4I8DA 1I85A 4JDTH 1IGTA 5FYLL 4CADA 5CZXD 2GTZB 4TNVF 5I15H 1QNZH 1FFOA 4LLUB 4V1DB 1NCWH 2DQUL 3NOIA 1QLFA 5FO8B 3IU3A 4NZDA 1FYTB 4S10A 2F54E 4WI9A 5CLWA 5DD1L 3TT3L 3GEWB 4RWHA 2CLVA 5B22A 2H26A 1K6QH 1EMTH 5HGDA 1IC4H 3DI2B 4L3AA 2F53E 2MQ3A 5KSAD 4BH7A 4I4WA 1I3RA 2E8YA 3IDMA 3LEVL 4PJ5B 4E5XB 3K2UL 4I48B 3IS1X 5FM4A 1IT9L 4RQQB 3M17A 3DHMA 4UDTB 5FA4A 2G2RA 3NIGE 3I85A 3NA9L 1Q9KA 5ITFB 1GXEA 2HFGL 3QG6A 4U1LA 2R0ZL 3QH3B 2DLFH 5CILL 1CXLA 1MLBA 2HVKA 5EOTB 5DJYA 3IDJA 1QG3A 1T2QL 1U41A 1KV3A 1NKRA 3PWLA 3LEXA 1JL8A 3KPMA 4I18A 2O5ZH 4RISL 3HLAA 5EU7C 3QQ3A 4GKNA 4P57B 3VRLE 4MJ6A 4POYA 3CXDL 2SEBB 5BZWA 5DQDH 3BIBX 4FQXB 2CDGA 1GAFH 2ORBH 2BNQD 3QDJE 1F6FB 5F9JA 1SMOA 3WL9A 4WHCA 2W9EL 3HNVL 5EU7E 3GBLA 5GISH 2NMSA 3MZTA 3CNKA 4FP8L 3JWOH 2BVTA 4A2MA 4YHML 5IQ7L 3VU2A 4DKFL 2XKNA 5KSBF 4LLYB 1YEHH 3BDYH 3ZKNC 2DM3A 5HHMD 3RVXC 5SX5K 5AYUL 1KOAA 5J56B 4HLZH 3TO4A 3N85H 3K81A 4OLVL 1FPTH 1MCIA 4YO0A 1NUFA 4K2UL 2AEQL 4PGCB 1GJIA 3DWTA 5C07D 1OGAB 4K9EH 3MACL 3QIWD 4RZCA 2YD7A 3BPCA 3JZ7A 2AJZB 3D5OF 3MBED 4D9QE 1PSKH 3O4OC 4HS6B 4XCYB 4KK8D 4C56D 2HP4A 2JK5A 1G0YR 4PJEB 5GRVK 2O61A 3RKDD 4H1LB 3B9AA 4YHYB 3PIQB 1FNAA 2PYEB 3X11A 4N9GA 2DQCL 1SBBA 1J8KA 2Z35A 1WFUA 1D5BA 4ONFL 3WNLA 1MAML 3LZFH 4DGIL 4PLKC 1XAUA 2WWKO 3WIIL 4KUZH 1XGPB 3RPIB 1DLFH 1QO3B 1LHZA 3IFNH 1KACB 4UT7H 4D8PA 2PN5A 4NNXA 4MA1B 1EV2E 5DFTA 4JQVA 5EOCH 1MF2H 5D7IE 3MJ9A 3PL6A 3GRWH 3X14B 4Z95H 3QXTA 3QEQB 2B39A 3X3FL 1NSNL 3LQAC 1PAMA 2I9LB 4L8BB 4O2FB 3RVWD 1YY9D 1CL7H 1ND0B 4LSSL 3GSRA 2JIXD 3U4AA 4YHNB 2OR9L 1CZ8H 4YQXH 3RX7A 3WSQL 3QHFH 3EHBC 1NCUA 5J6HB 4JGMA 4U3CA 3FOLB 4O5LH 5HGHA 3U83A 5F89B 3GSNH 5IBTH 2GT9B 3MRDB 5D5MF 5JPMB 4G6AC 5CEZL 2OX5A 5HSFA 3SE8H 1P7QB 3CFIC 3WN5A 3WHXB 3JV5A 1QEWB 1SY6L 2UZXB 3KNBA 3L95B 5LXGH 5IB5A 3FT3A 2V7NA 3MUGB 2IG2H 2DJ4A 4NUGH 3U6RB 4PRPA 4NKDA 3MXWH 1IRAY 4AK1A 2ZUSA 3ZYZA 4LSTL 3ELAT 1V3MA 3HHRB 3S98A 1I7UB 4WHTA 2IPKB 5A3ID 3SO3C 1UWEH 3MOQA 4QO1A 4LU5L 3VWJC 3IJYB 4WGWB 1NLBL 2YXMA 4LF3B 1TJIH 3NTCL 4OZ4B 3QFJA 3PE9A 5INCB 1U95A 3OG4B 3ULSA 3HE6C 3OB0K 1I3GH 3ARQA 4P23A 4UT9H 5C9JA 2KQNA 3LH2L 4G8EB 5F3HA 4Y2DA 4Y88A 2IAMB 2QADC 1BD2B 3O6ML 1QP1A 4HGWA 2JKXA 3C5ZA 5E8DH 1C7SA 2QSCH 4GQ9L 4MB3A 4FQCH 3S88L 3PDDA 3OR6B 5I8OH 5D1QD 4TVPL 3STZB 2VZUA 3GHEH 3SDDD 1JZ4A 4ZS7L 1JWSA 4RFOL 4GBXC 2B0SH 2V7HB 3QI9A 3EOBB 5FYKD 4P9HL 4Q0XH 4ODSH 1UACL 1G7MB 1JGEA 1Z9OA 1JUFA 2Q76A 1IM9D 3HG1E 1K8DA 4JQXA 4KI5C 4Y16B 5IF0B 5TF0A 1U8IB 1D5IL 2NYYC 5GJSH 4ZFOL 1KJ2H 2IPTL 1U2CA 4NO0D 4GRMB 4JZJA 3SDCB 5EBWB 2IQAA 3OAZH 1IC5H 2PO6C 3HZMA 2UY7A 1PEWA 3MLVL 1F13A 2APXA 2X4QA 2V17H 1CVSC 2APWA 3X17A 5DQ9B 1MOEA 4KI5E 5CP7B 1OAKL 4X9HA 3QYCA 4U1MA 3WO4C 1VENA 1ZSDA 2CJUL 3I3DA 3U9UB 4PRID 5DURD 5GS1C 1FORL 5ANMA 3ULUC 4ENED 1MWAA 3VA6A 1NKOA 3ROOB 3QIUB 1I9JL 2EDWA 3UXFA 5DJ2B 2EO1A 4WUUB 2FJGB 3ZYIA 1S3KH 1IGFH 2NW2B 3MZGB 4JZOB 2BERA 3VXMB 4N68A 1RZGB 1BBDL 4NNPL 3WXVH 3ULUE 1YNKL 1PDKA 1RZIB 2OJZH 4FQ2L 3DVFA 5EU6A 1CLYL 4NM4L 1A7OH 3KLSA 3ES6B 5DZLA 5A2IH 1WSST 1N6VA 3D0VA 4HV8B 4X98A 1QUNA 1A7QL 3D69B 1I1RA 3EO1A 1F4XL 1V7MH 3P73A 1LEKA 2JELH 2LV4A 3MYJA 4UUJB 4M8QA 1JPSH 4GMTH 3T3MF 2NXZB 5E5MB 2AVGA 3CZFB 4EJ1C 2BJML 4KTEH 3H9SA 4RAHA 4DZBB 5HHOB 4IRJC 1N4XH 3AM8A 1IC7L 4TTGA 4Z8FL 2R56H 5SWQA 3HI1A 3RUGA 1HXYA 4L4VE 1FP5A 2A6IA 4FZ8L 1KJ3H 1ZAGA 2BOCB 4R3SB 5DJZB 3EO0A 3TBVA 3AMKA 1RUKH 1I8LC 2OI9C 5GPRA 2WQRA 3TBTA 1I4FB 1NBZB 1A6TB 4ODHH 4EKXA 2GJ6E 4G7YH 4GLRI 2ESVE 4PLJC 5K59E 5L9DL 2AJYH 3CUPA 4XMPH 5F1IB 5J6GA 2NY4C 4HIXL 1KPRB 3D2UD 2FECL 4JG0H 4BH8B 3FQUB 5IUSA 2VLRB 2GTWB 2VZTA 4ZNCD 5IKCB 1BWMA 3DX7A 2V5TA 3OKOB 1DTUA 3TBSA 3MNVB 1NFDF 1CE1L 3BH8B 3UZVB 1VGKA 4PJHE 3V0VB 4Q6IB 1JJUA 1WIPA 4I77H 2Z91B 1ZLVH 2Q7NA 1XGQA 3CAFA 3QZWA 1T80A 4OZFG 5EUKA 4PTUB 2PTTA 3OJDB 3ZT6A 2C1PB 1IQWH 5EC2A 4POZD 5DXWA 2BXZA 4HUUB 4LIQH 2YA0A 1DVFA 5F7UA 1ZHBA 3EO9H 2IGFH 2CKBA 1P1ZA 3HE7B 4YXLL 5I16A 2R1WA 1P7KA 3PGCB 4O2CA 5KG9B 4UIMA 1H5BA 4M1CC 1A21A 1R5VB 3MRPB 1A3QA 4X6BB 2KBGA 1FJ1B 5JW3H 1OQXA 4RBPH 3CDCA 1I9RH 4LFHD 4YZFF 1MNUL 5E2JA 5BVPH 5C0BD 2KQMA 4OLUL 3KHOA 1AO7E 4ESKA 4LPXA 5I8EA 5CP3H 1KB5B 3T4YB 4CVZA 1T03H 3CK0L 3BKYL 1M7DB 1UB5A 4LSQL 4O4YH 2LU4A 5JHDD 2FD6L 4XP5H 5JR1L 4M6OH 4NNYA 2H41A 5H2BA 3JUYA 4Z7WB 3GSUA 2XN9D 4ZUTB 4LDLB 3LKOB 4HXAH 4WCYL 5J12B 2NTFA 2VLKE 4S1SL 4UTAH 4MA8H 5C0IB 5EIIA 3CFJB 1WAAE 4R26H 1YMHA 1NAKL 4YHOL 5D7JC 1NEZB 3BX7C 3D25A 1MUJB 1MFDH 4OBSA 4HX1B 1AC0A 3U4BL 1NGQL 3S5LA 4ODUB 3UJTL 2F15A 3L6FB 5CWSB 2QLVB 2R69L 3CD4A 4XHJC 2HFTA 3K1KC 2QQKL 2YSSA 1DQMH 1T22B 1JYNA 5ISZA 5C0GB 1BZ9B 3W82A 4Z6AT 2P5EA 5E8PA 3TCXA 4DUVA 4OLXH 5CSGA 3RTQC 2O5XL 1SEQH 1IBGL 4NCDA 2IMMA 4OZIA 2ITCB 5KZCD 4PJGF 1ETZA 1M4KA 2Q8BH 4XBEL 1TVBB 3RWIA 2UYLB 3E8UH 2ZKHH 5JW5B 4B7LA 4NKIL 3LOWA 2D0FA 4Y4HB 5T3XL 1QRNB 2ADFL 8FABA 3SCMA 3QNZB 4RNRA 1IM3B 3GB7B 3N06B 4JB9H 4U1NB 5BZDB 3W5NA 4CADB 3WD5L 3DYOA 4LLQB 1HQRA 3ARFC 5J11B 1IL1B 4HEME 3GSVB 3T2NH 4OF5A 3O41A 1LE5B 2CLRA 3L7EA 3L3OA 1F4AA 5IM7A 2O5YL 4XZUA 5CZKA 4DUWA 5IMOB 1F8TL 1VFBA 3B8SA 3A6CL 5I66A 2VDOH 3QIBC 3HS0B 2CLVB 3HRZB 2EKSA 5CD3B 5CD5C 1NCBL 4XRCA 4XXCC 5IHZB 1L6XA 2F9BT 4RX4D 3EYUH 4TSBH 3U36B 3FQRA 3NIGF 3CMGA 3OG6B 3VXTA 3MNWA 1FFQA 4R8WL 4X5LA 4K8RC 4XMKH 4ZUSB 3WXWL 3IVKA 1FZMB 3EFFB 2WUBL 1CXIA 4HWEL 2CR6A 2JF1A 3KDMA 5HI4C 1CQYA 3HZYA 3BP7A 1ZA6A 5J13B 4KJPD 3I9GH 4OCYH 5FHAH 4WTXA 1GZQB 3IDXL 3NACL 4C4KT 2CDFA 3ARGC 3MGTB 4XTRC 3UX9B 2A6JA 2HG5A 4Y4KD 2YBRB 3NGBC 4NKMA 5T5FL 1XGTA 4XNUH 4JY5L 4IRSB 2IFFH 4YIQB 2Z31B 3PNWB 1L9MA 4PUBH 1II4E 3TV3H 2ZCKL 1DBJH 2AV1B 5JPNB 4FNLL 2C3WA 4IRZH 2OSLB 5TDOA 3BGMB 1EJ6A 3WBDA 1UYWH 1DLHB 1X5GA 2W9DH 4U0QB 5KVFH 2XTLA 1GC1H 4XPHH 4TTDC 3QQ3B 4GKNB 4XNXL 2I5YL 4V1DD 4MJ6B 1JGLL 4GAGH 3T77B 4D9RE 1FYTD 2EIZA 3IDYC 43CAB 3MRMB 3QHTC 3KJ6H 4LCWE 1FRGL 4UINL 4X7SH 4H1LH 4FFZL 1YN7A 2D3VA 2CDGB 1BQHG 1N7ML 5CBEB 5FHBH 4MS8C 1MRFL 4G6KL 4I3SH 4KKCD 1RJZA 5ALBL 3WL9B 1S5IL 2MPAL 5IB1B 5MERB 1LVEA 3RX8A 2QR0B 4EDXB 3INUL 5BV7L 5FGCE 4PJ5D 3T0WA 4XVUC 1GH7A 2FJFB 3B2UC 4X4ZA 2ED8A 3RI5K 1J9CT 1OWWA 5MI0B 1U3JA 4YGVB 3F6IA 4BQCA 4X6CA 5EO0A 1MHHB 3TN0C 1CICB 4CRPA 3BGFB 3QULB 2Q87A 3O2WL 5I18L 1HDMA 2A9ML 3WS3A 1WBZB 3RWFB 3V5KB 4YO0B 5FUZH 3BKMH 4E0RB 4OUUB 1I7RB 3V2AR 4DN4L 5LGHL 1LO0L 4K3EL 1S9KC 4Z78B 3CXHK 2AJXL 1OOAA 5IJVB 4PJCF 5DRXB 4GAJL 4JY6B 2HH0L 2C4FT 1C5CH 5C08A 4R97C 3R06A 1AD0A 1ACYH 4YEFA 5TQ0H 3NPZB 5I74B 4FQXD 2DQFB 4LPTA 4OZGE 1A9BA 2YPLE 3GSXA 1KLFA 1EX0A 1H8SA 2Z35B 1D5BB 3BPNB 4WFHD 1SY6A 1XGYL 4G7VH 3RBGA 4NQCA 4G6ML 4DGVL 5I6XB 1TPXC 4UQ3B 4RCAA 2VE6A 3QUYA 5JQ6L 1OP9A 2WBJA 4JVUA 4KQ3H 3O9WA 1NCAL 1NDMA 1KENL 4LVNC 4Y19B 2XTJE 4HG4K 1FNEB 5I17A 5FIEA 1UXWA 3RDTB 4R9HA 3C09B 4I2XE 3MSPA 5D7KE 2L7JA 3DRTB 4N0CC 1JGUH 3S3JA 5KBNC 1Y6MR 1JHLH 3WUWG 5IFAL 4HPOL 4AEEA 3GSRB 1OGAD 3OX8B 3JTSB 2ZUTA 3RIFF 2ZSVB 4XBPA 4MAYB 4XAKD 1EFXA 1FNSL 1UZ6F 1S7TB 4LVOB 5H35A 3WJLA 4YXHH 1OSZB 2KZ1B 4PG2A 3SJVA 5JW4Q 3SKMA 2VDKH 1UB6B 2PYED 4X99B 3ARZA 4LNVA 3WN5B 2VKWA 1JZ3A 3FT3B 4M03A 1QKZH 3P0YL 1BQLL 1F45A 2MOVA 5F7KC 2A1WL 3C2AL 3S4SG 3ARTA 2EXYC 2FX8L 3QO1A 1DQJB 1DL7H 2KUTA 2X4UA 3CFEB 4WHTB 4Z5RA 3SKOA 3HPLB 4ZFOA 1ZLUH 5DA0B 4ZFZA 7CGTA 1RIVH 1MCPL 1UM4H 2MHAB 1JHKH 2DAVA 3E6FA 4TSAL 1MCRA 3QUZC 5E4EC 2YZ1A 2XG4A 3EJZD 3QEQD 3AB0C 4Q9RL 1EH9A 4APQC 3OMZA 4DFHA 1AKJB 1T1WA 2W9LA 3QCVH 4WU5A 4QRPA 4RDQG 1OT1A 4ZQKA 4GFTB 3MRQB 1NFIA 4JM2F 1FAKT 2KDGA 5EWIH 5CJXA 3QDME 4NOBA 3DURB 3IKCB 1RZFH 1MLCA 1JN6A 3F7YB 4KFZC 5KSBA 2P4AB 5J3HC 5HYSA 3F58H 3KS0J 3TWCH 3VGAB 3I6KA 3FZUC 4GKZB 5GRWA 4PS4H 3MLTA 1SMAA 1P7QD 5D72L 1JUFB 3S37X 4XAWL 4DCQA 1EEYB 1CG9B 4KI5F 3I75A 3VH8G 3C60A 4HIHA 2IQAB 3T09A 5IFHH 1NGPL 1UM5L 3BZ4B 4XPGH 5GRXG 3MROA 1NUDA 3QHZL 4X4XA 4OQTL 5I30L 4F7MA 1RUMH 2AEWA 3D39E 5L0QC 4MXQC 4U1MB 1KEMH 5HDQL 1MI5E 1CBVH 2VDNL 1KJMA 1W0VA 5FM5O 4PV8A 4OD1L 4LHJB 1MJ7H 3LSOB 4XP6L 2VDML 2OCFD 3JWNC 3RHWF 2HMID 4HUMB 2IAMD 5D7LA 3ULUF 1BD2D 2X89A 3CVIL 5T1MA 4M5ZL 3T2PA 2A0LC 3SDAD 5CUSH 3EJYD 3NMEA 1Q9WA 1J1XH 4ZAKC 1BFTA 3WCYA 3CFBB 5DUBA 4OCMC 1AGFB 3MRIB 5IG7A 1CFNB 1V5JA 4U6XA 2GITB 2FB4L 2AXGA 2X4OB 2VISB 4TOYH 4LRNL 3S3SA 1F6AB 1WTGT 2BSED 4D0CA 4Y16D 4X98B 3DX8B 1LEKB 1CR9L 5JTWA 4JG1H 3SDCD 2FHBA 4IOSD 3FT2A 3MYJB 5D2LE 4HC1H 1BFOA 3VWKA 5I9QC 5J1TC 4U4BA 2VMFA 1IZJA 2JJSC 1GZPB 5AEAA 3IAGC 1G9NL 1S7RA 4HFWA 5K59F 4Z7NE 1JNLL 3WEXA 2YK1L 4JFXA 4JO4L 3RUGB 1FZJB 1HXYB 4NHUA 5D5MA 1DBMH 3GMLA 2VLJB 1QHOA 2D4FA 4EOWL 2MJWA 4YFDB 2J4WH 5M94B 5IEKB 3QIUD 4JFEA 4OFIA 2G60L 4WUUD 3EYVA 3M45A 4FQIH 4PJHF 2IAND 5INDA 3MRJA 5GIRB 3VXMD 1ZGLM 1N26A 3DIFB 3A6OA 4P48A 1HCFX 5GRJH 1KB5H 3ZHKA 2LU3A 4ELME 3O3AA 3C6LA 1T2XA 1MHPH 3RA7L 5FK9B 3IKKA 4WWKB 4XP4H 1VCAA 4PJDE 1H0DA 4M1GH 3RWDB 4CVWA 1NMCB 3RZCC 1WBYB 2HFEA 4RGNB 1JYXA 2NXZD 4O9HL 3MREB 3O2VL 3ORJA 4DWHA 3MLZH 4PJ8C 3VI4E 5HHOD 4QRRE 4HIIB 2D7TL 3MUY1 1IKFH 1CE6A 1U92B 5I16B 3WE6A 1WCQA 4GRWF 4Y1AE 5MENE 1NMBH 3FO2A 1S7WA 4IS6B 1KBGH 3NH7L 5J57B 4HFUL 3NIFF 4HT1H 3NFPB 4G80A 5IMMB 3CFKB 3CH1A 3OGCB 1ZMYA 1F2XK 5I8EB 2VLRD 1T66D 1RZJC 4PGZA 3T0EB 4CU6A 4OV5A 1AJ7H 3G6DH 1WAAF 5HDOA 1DFBH 2RR3A 3CH8A 3VFSA 1M6OA 4NNYB 1UH3A 5H2BB 4P5MA 3HFML 1G7HA 1DQDL 3GSUB 4LSVH 4PBXA 4I9WE 1MCNA 3SE3C 4Z77B 3QRGL 4JHAH 4OLWL 2APTA 4F58H 3TA3A 5F88A 3NIDE 1YMHB 2L0DA 4OCXH 4MQXD 4LAJH 3DX9B 3WFCH 4YXKL 3QXWA 2H32B 4DW2H 3GNMH 1IC1A 4JLRB 3CCHA 4LNRB 1BVKB 2ZZUT 1T7YA 5A2LH 5B39G 2XI9A 3HE7D 2YSSB 4RGMB 3C08H 1HE7A 5ILTL 5E99L 2X10A 4JHWL 2P5EB 4LLWA 5T1LA 3EOTH 2EDJA 5BJTB 5E08L 3WDIA 1KF9B 2E7MA 3TZVA 4KMQA 2BC4B 3BZEB 3BIKB 3PWPB 5E2VL 5IW6A 1FZOA 5IMLA 3ILQC 4TUKL 3RWIB 3ZO0A 1QQDA 3IFLH 2D7QA 1N3NA 1KCUH 4PB9H 3RAJH 1FFPB 2BOBA 2B1HH 2R2EA 3WNMA 3AUVA 5DRZA 4RNRB 4X80L 5D1ZB 2DL9A 3I6LD 3ULUL 1IAMA 1ZVYA 1E6OH 2HWZH 3JWDC 4J7RA 2CRIA 1RZ8A 1ORQB 3V4UH 5EO1A 5CEXB 2E7CA 1M05A 1AGDA 5TPWL 2FCBA 4XNQA 1A2YA 1NBVL 2VXQH 2CLRB 3ZYOA 3L7EB 2BY0A 2OTWB 3O3UN 4F37K 3TCLA 1OSPL 5GS3A 2EKSB 4KMLB 4HXBL 2BVQA 4HWZB 1LP9E 2GQHA 5H37G 3MNZA 1NFDA 3V0WH 5JUEL 4ELKB 4N8VB 4F9PC 3WFZA 3AS0A 3MNWB 5DRNA 4HKXB 4PGEB 1N5YL 5EO9A 3NPSC 3BE1H 2A9NL 5ENWB 5EOQH 2VIRB 1YPZE 1LO3H 1NCTA 3HKFA 2A6JB 2DD8L 2BY1A 2HLAA 3S35X 3RY6A 4HUKB 1X7QB 3MRBA 4QTIL 2ICES 3VXSE 5IR1A 3O11A 1B88A 1FV1B 4P46B 5FUCC 1IAKB 4I0PD 3GMPA 1QRND 2VAJA 3CSGA 1FG2A 1HCVA 5IK3A 4E41A 2BY2A 4PRHB 3LV3B 3HAEB 5MEPB 3MLXL 3O0RL 2Z8VC 2NW3B 2GY7B 4O51A 5KJRH 3RRQA 2IJ0C 2X4RA 4Y7MA 5FDWA 1LD9A 4PB0L 1FNLA 4MNGA 1JIBA 2VQ1A 2DQHH 4EI6B 5DYOA 5HVGB 5FUCE 1FIEA 2EIZB 2FIRT 3U0TA 5BO1H 1A1NA 4MNQB 3H3PL 1IEAA 3ZL4L 1YN7B 2GK2A 4KQ4L 3FQNB 4GSDL 5L2KE 5L2JA 5FA3A 3MV9B 1MY5A 3ARVA 2VTFA 1VDGA 1M1SA 2VDQL 4F7PA 5D71H 1A7RL 3L3DB 5HJ3B 5KW9H 3UTSB 1CWVA 2BSSA 5J89A 4S1QH 4UZGA 1H3TA 5I1IH 3A6BH 4MDJA 1XCQA 1K2DA 1PKOA 4IJ3B 3I84A 1H3PL 1KC5H 5E8OA 2UZYB 4UNUA 4NOFA 2XT1B 1DUYA 2NY6C 5E5UB 1QFUH 4IRSD 3ET9F 4ODVH 1FL3B 1IGJA 1SYVA 2Z31D 2DBJA 2VDLH 4Z0XA 3TT1H 4PG9A 3O4LE 1T89C 1PJ9A 1ZHNB 5E6IC 1SHMA 3BIAX 2WINB 3GSQB 4HD9A 2NY7L 3W11C 2VXSL 2VZ1A 3TVMA 5TE4L 4OZGF 3LKRA 2VXTL 3SE4A 3CFDB 3MCLH 5BQ7A 4YDIH 1CD1B 5TF1H 5EBGA 1X4YA 6FABL 1DEDA 3FB5B 4YGAB 5C08B 1OHQA 3KG5A 4RMWA 4PJGA 1LNUA 5DR5H 4D3CL 4XCFL 4OGAD 2ZG3A 5MP6H 5J1AB 3ULVF 4KZEL 1A9BB 4RSVA 3PWUA 4BFIA 3EFDL 2YKLH 5BCAA 3Q6GH 3ALPA 4FFYL 1DQQA 2UZIH 4PV9A 1I1AB 2MCPH 3LQMA 3NN8A 4JFQB 1R5WA 4NPYA 1M71A 1R5IB 1XH3A 1J0JA 5T3ZE 4FFWC 1Z3GH 4R6UA 3GSOA 5HTSA 2Q7YB 3EDFA 2DLGA 1S7XB 1AGBA 4OCLC 3UTTB 5DJ8A 3BRDA 3H0TA 3WNPA 2WQ8A 4F33A 2DQIL 2Y6SD 2F53A 5C0CB 1CICD 2HTKC 4WTZG 2YD4A 4ORGA 1EXUA 3X13A 1GGBH 2IH1B 4XVTL 5JHLL 1G9ML 3TBYB 4R4BB 3CSYA 3D3VE 4PJ9A 5EZJB 5LCVH 3VCLB 5C0NC 1T3FB 3OPZL 4U3XA 1RVFL 2XZCL 1TITA 2HJFB 4HJ0C 4NQEE 1INEH 5I73B 4JN1H 2B4CC 4GW1B 1EFXB 1D5ZA 3QDHA 4P3CH 5EC1B 1T0NB 3RVUD 4KXZI 3SJVB 5JORA 5JDSA 2QQNH 4PJXE 2ZCLL 4RDQF 3QJFA 5KVGH 3SGJA 1CFQA 2XZQH 1R3LB 1WUNT 1KN4H 2NR6C 1CFTB 5I1GH 1PX4A 4LEXL 1A4KB 2X4UB 3SKOB 4Z5RB 5DJCA 4YDVA 1LQSR 4ZFZB 4PY7A 1KTDB 2CDEA 3S8WA 3BUYB 1IGCH 5F6IC 5K9QG 1JYWA 4QXUL 3BUTA 1BIIA 3WDHA 1L7TL 1C5BH 2HKFL 1G0XA 4OQTA 3E6FB 3BO8A 4Y19D 5DMIH 2DMCA 4LAQL 5IBLD 3RDTD 3GIZL 1RHHA 3NCMA 4P59L 1T1WB 2R2HA 1FNGA 3TESA 1V8HA 4ZQKB 5TDNA 5I1EL 1T1ZA 2BRRL 3L3GA 4HDIA 4YBLC 5EFIA 4XGZA 4TNVK 4G8FA 1RUPH 3GMNB 1RD6A 5FAAA 4MAYD 4OTXL 5IROC 4YC2B 2QL1A 4RAUB 1TENA 3LDBC 2BMKA 4C58B 3MLTB 2C1OB 5LBSH 4QHLB 3V79C 2FGZA 4PTTB 5EA0L 4W70A 1A0QL 4HUVB 2AXHA 4ERSL 1P4BL 1SYSA 5JXED 3C60B 2RQ8A 1HIML 4Z7VF 2DYPB 2NY5C 2UWEE 4NO2B 4PYHA 4X4XB 4P49A 5ITBH 4BK4A 5DD3L 4PJCA 3WFHB 1WC7A 1YNLL 3HNTL 5L8KB 4LCUA 4XPAH 3ZSTA 12E8L 3O3BA 1YEGH 2YPVH 4OGXH 2Q86B 5IHLB 1KJMB 2Y25A 2GI7A 5DO2C 2DQJL 4P23D 1AGCB 4TUJA 1AKJD 3VXNA 3VXQB 2OQJB 5I71B 1XF2B 1OWRM 4BZ2L 1CIUA 3KJ4C 3DO7A 1GGIL 4PREA 5D7LB 1ZWIA 2FR4A 1S9VA 3FQTA 3EYQD 4OGYH 1YEKH 5D7IA 2YD1A 3C5ZD 3W0WE 3HB3D 4ZSOE 1ZLSH 2NY0C 4OIIL 3PP4L 5LWYH 3QDGB 4PJ7B 3CDGB 1MPAL 1NJ9B 3SGKC 5C7XL 5K9JH 4B7IA 4OD3L 2Y07H 5T1KB 3C5JB 3QI9D 4GT7A 5D2LF 4J4PA 32C2B 3NZHL 5ABDE 1H15A 1JRHH 3NA4A 4KTYA 3UJIH 3I02A 4QCIA 3Q48A 2F8XC 3V6FA 1DZBA 2JCCE 2EECA 1NC4B 4M93B 2RFXA 2NQCA 4WHYH 3WKML 2ED9A 4Z7NF 1U93B 1U3ZA 2YR3A 4JFPA 5DK2A 2X4SB 2YUXA 5IBUG 1CDJA 2BFVL 2BSTA 3QUXA 1NC2B 3TEUA 5HI5C 3KPLA 1QA9B 5ACLA 5BRZB 3KPSB 4HFWB 4FQHA 4U33A 4HWBH 5C0AB 4JFXB 2C5DC 1RZKH 4HKBA 1CLOH 3BPOB 3CLEL 5D5MB 3N9GH 2D0HA 3WNOA 2A77L 3MRHA 5A1AA 1REIA 5HD8C 4WW1B 2HKHH 3ARDB 5IMKA 4OB5L 3WHE0 1WZ1H 3KLHD 1BVZA 4OLZL