3QG7L

Structural basis for ligand recognition and discrimination of a quorum quenching antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVLTQTPLSLPVSLGDQASISCRSSQRLVHSNGNIYLHWFLQKPGQSPKLLIYKLSSRFSGVPDRFSGSGSGTDFTLKISRVESEDLGIYYCSQTTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords AP4-24H11 Antibody Heavy Chain
publication title Structural Basis for Ligand Recognition and Discrimination of a Quorum-quenching Antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L01
4XVJL 4Y1AA 2LVEA 4S1DD 2VTFA 3NFNA 4BFIA 5B8CB 4P2QD 2EIDA 2YBRA 2PXYB 1I7UB 2I07B 1C16B 2Z31B 4R96A 4TULH 3HLAA 5C0RL 3BUYB 4IRSD 4U1MA 5F6IC 2XXMB 4Q0XH 3WD5L 5KVGH 2VLKE 5HSFA 3QO1B 4K8RH 1HQ4B 5FDYA 2NY2D 3BT2L 3U4AA 3GBNH 1EDQA 1PJ9A 1A21A 4HJGA 3IB4A 5BRZE 5L7XH 2CO6B 5TGBB 3ZDYF 3RWJB 1LP9E 2R1WA 2ATKA 3QQ3A 4ZXBC 1F3RB 2J4WH 2V7HB 5GJSL 5A16B 4MNQE 5L0QC 2R0LH 3Q6GL 3GSOB 5C2BL 3TIEA 5KSAB 3VXSA 1A9EB 1RK1B 3ARXA 3KHQA 3S3PA 4FXKA 5BS0E 5E8NA 3T2OA 2VXTH 2YD4A 4WFEE 2R2HB 4OV5A 1FC2D 3BJ91 2X6MA 4KPHL 1YEGL 3ARED 1MQKH 2FLBT 4PJ5A 3TESA 1HSAA 4AIZB 3UTSA 3WIFA 5I74C 1W0WA 2B1HH 3BPLB 3QIUA 2Q8BL 2FATH 3C5SA 4PLOB 3VG0L 4LPVA 2NY0D 1LEKB 3IDGB 1S78D 3SY0B 1GJIA 4MA8L 4URTB 4RAVA 4JKPH 4KVNH 1NDGB 1C1EL 3LV3A 4ONGH 5DI8A 3RZCC 4F9PC 2VKWA 2X4QB 4Z95H 4I3RL 2OL3A 2ERJB 1N4XL 1N2RB 5I8EA 2PW1A 3H7BA 4U1SA 3U9PL 4NN7B 3LEXA 3QRGH 3DX6A 3TBSA 4F9LC 3X11B 2OP4L 2FJHB 1MFAL 2B1AL 2AEQH 1NFDB 4EI5C 3M17A 3D1MC 2IQ9L 5ETUB 3S3SA 3SBWC 5I2IB 5KZCD 5DRNA 3RIFF 1HXMB 4P4RB 3MLWL 4EVNA 1LO5B 1T0MA 4N0RA 4J4PC 1E27A 1E6JH 4AL8L 3RWEB 5M7QA 4PREB 3VXQB 4XPAH 1YN7B 4QOKB 4JHWL 3I6KA 4X5WB 4Y5YB 3VWJA 4NYLA 4JO2L 5HVHC 1I1AC 1AGCB 2HTKD 1Z2KA 4NPYA 4AG4L 3QG6A 3NIGF 3QCVH 3BZ4B 5DRWB 2CD0A 4OI9A 5KS9A 5C08D 4U1NA 4GW1A 3DNKA 5CSZB 1WFNA 1F2QA 2FX7L 2CKBA 5HD8D 4P2OC 5DVOA 3ZSSA 2IANA 1IC1A 3O9WD 4GG6F 2E7BA 4XNZB 3GBMH 1JZ8A 3NFSH 1G7MB 3UTTD 5CZXD 1W0VB 1IM9B 3ZTJG 1J8KA 2DI8A 5C0NC 5I1AB 4OCSH 1EUTA 3CU1A 3VGFA 1Z5LB 1AGDA 4X4MA 4FFYH 3ULSB 1YMMA 4LSSL 4R97B 4LBEB 4H8WL 5TFSH 4MJIE 3SDCA 3SGKC 2VDNH 1MCOH 1FLTX 2BXYA 3LKPB 2WLYA 3IDMA 3DOSA 2EDJA 1D9KD 2VXVL 3FN0L 3OB8A 5DQJB 1RHFA 3O6FD 1U58A 2P49B 3KS0J 5I8OL 1TPXC 2OQJA 1NCDH 2WBJC 3SDAB 3EOTL 3JWOC 4HH9A 1KTLA 2XQBH 5IR1B 5K93A 2W92A 5DHXB 5GGQL 5F1IA 1MUJA 2F15A 3TV3L 2NY6B 3QIWA 3T2NH 3JUZA 5ADPH 3I9GH 5CP7B 3RX7A 4N0UE 5KOMC 2UUDK 3EDEA 4MA1C 3ARBB 4D0BA 2KDGA 1NEZB 4OZGA 5HVFB 1TJGH 1CE6B 5DFWH 1PG7H 1GRWA 5E9DE 2GY5A 4UT9L 3HAEB 4HK0A 5F3BB 2BMKA 1A14H 1AXTL 3EOAB 3FKUS 4YBLB 4I0PA 3UO1H 1IGJA 4M00A 5GRXG 1HKLL 2QR0B 1JPSH 3RY6A 1UB6A 2JJUA 2EC9U 4JRXB 1DL7H 4C57C 4PB0L 4GRLA 3F7RA 3HAEH 5FA3A 1SYVB 3E8UH 4Y19B 5HTSA 4WUKH 4DUXA 3S35X 3SJVA 2BXZA 2PYED 4X5LA 1UJ3A 3O45A 4RISH 2COQA 2J8UE 4L29B 4GXUN 3AMKA 3E0GA 3P77B 1H8SA 1KJ2B 3KYNB 3MJ9L 2EEDA 4HUWA 2F5BH 5GS0L 1YQ2A 1BZ9A 1RHHA 1MHPL 1ZGLA 4UOW0 2F54E 2A6IB 4DW2L 5D2LB 2ZZUT 4P2RE 4DAGH 1HZHH 4LHUD 5ISZD 1E4XL 4WU5A 1LHZA 1QA9A 1WFOA 3WS3A 4MD4A 5ADOH 1LE9A 3J8F7 3SQBA 4UV7L 1KJ2H 1CQYA 1P2CB 1BBDL 4MAUL 5JQ6L 2BVQA 4FTVB 4WI3A 1X7QA 4JM2A 3E2HC 4PD4K 2JK5A 4U1HA 1FNEA 3QB7C 4XVUC 5HDBF 1EFXD 3KWWA 3PQYE 4WGWB 4FQQA 2ESVD 5LBSL 1S7UA 3VU2A 5F9JB 4HIHB 5LG1A 5KANG 4K8RC 4X7EC 1L9NA 1MJ7H 3R0MA 5B8CC 1EX0A 1UH4A 2PXYC 4HIIA 3I6LE 1N26A 3HNTH 3S97C 4XB7A 2Z31C 3I02A 3FO9B 1KLGA 1R3HA 5EU6B 3R06A 5DD5L 1MREL 2O5ZH 3NN8B 1P6AB 4DN3L 1KEGH 4OQTL 2Z4QB 4X83A 1IAOB 3MLVL 3WYRA 2Y5TB 2DJSA 4UINH 2DQIL 1RIHH 4XP4H 4PR5A 3VJ6A 3MOBH 5MENE 4YHYB 1CE1H 4OZIF 2BNQD 2D0FA 2DIJA 3CLFL 1JNNH 4H5SB 4C54A 2NTFA 1ZE3C 1XR9A 1HCVA 4LLQA 4LQFH 3BD4A 4G80A 4PJFE 3FQUA 4H20L 1J8HE 2H2SD 1QSFB 3Q5OA 2QL1A 1MRFH 3VXPB 2WWMC 5DS8B 3DUUA 5KSAC 1KPUA 2FHBA 4ZFGL 2AI0L 5E2TH 3T65B 1TZGL 3V7AG 4O00A 2YWYA 1H3PH 1FNHA 4KRNA 4JFDD 3G08A 1A7RL 4NZTL 3KPOB 5KVDL 1GZQA 2Y7QA 5EUOA 1J10A 3JTTA 5B3JF 3GIZL 1LO0H 1U93B 3BPLC 4P3DA 4RZCA 3CFJA 2DQCL 4KHTH 3L3OA 3HE6D 1CGTA 2NPLX 2DYPA 2CIIA 25C8L 3FB5A 3TZVD 4DZBB 4PG9B 1U8JA 1IC4H 1GOGA 2M2DA 2NNAA 1CVRA 5D7IE 2YK1H 4PV9B 2D7TL 1M6OB 1A3LH 3CCHA 3T3PF 4M5YH 3QUKB 1KT2B 1EMTL 1PLGL 4F7EA 2ERJC 4QCIA 5GZNC 2MPAL 2V2XA 2HJFB 3HC0B 2FL5A 4NN7C 2H32A 3RY4A 1FVCA 5K33A 2F53D 4MB4A 5IESH 3BZEB 4QRUA 4B7IA 3NGBB 3O8XD 3WNMA 2DICA 4CJ0A 4HFUL 3DV4B 2I9TB 4B50A 2P5EA 5BJTB 1UM5H 2BP3A 5D6DA 1R3LB 1IKNA 3QNXA 4E41A 3OJ2C 3L3HB 2VZVA 1BD2B 4R7NB 4Y5YC 4Q2ZA 5IM7A 4A2MA 1QNZH 1JZ7A 1HHIB 4LOUC 5HYJB 3WJLC 2G2RB 2NYYC 1AGEB 3TN0D 4NQEA 3GSNL 4PJCB 4JO3H 3F65A 5GRYA 2DL9A 2LU3A 1IVLA 2W0FB 5GRZA 4U33A 5TF1L 4QNPE 5I76A 4JDVA 1P7KB 4I2XB 4X7TA 3KPMA 4NO0A 3PWUB 4OTXH 2V5TA 2FR4B 4KMQA 1H15B 2W9EH 3V4VL 4PP2A 4GXUM 4YUEL 3KYMA 4PJAA 4OLXH 3LRGA 3B9DA 5IB1B 1P9MC 1YEJL 5I19H 4XNZC 1OB1B 2DLIA 5FUCC 4K7FB 3EOBA 5HHME 4QRPB 3MNVA 3QI9B 1Q9LA 4G8FA 1JBJA 3N1GC 3EJYD 1IKFL 3NTCL 3ZDXF 2CDEA 2FB4L 5EBGA 3U7WH 3HI6H 2PW2A 4NM4L 5L2KD 1VEPA 2AEWA 5I1LA 4EUPB 1IC5L 4TTDD 2Y36L 4XMKH 1H3TA 5TPWH 4R97C 5IK3A 4ZG1A 3FOMB 1MQ8A 3CD4A 2EIBA 1SJHA 1Z6JT 1N64H 3B8YA 3BH9B 4O51B 4OUOA 5HGBA 1QUNA 2DQFB 4CN6A 1P84K 1XF1A 4H26B 5ECJE 5D71L 4PJGF 1T5XA 3ESVF 1T5WB 3SDAC 5C0BE 4I8DA 3MRDB 1DUYA 4N90E 3LH2L 2UY6A 4YXLH 4EUPH 1RV6X 2FEDC 4GG6B 2EH8H 3VFGH 2Q7YB 5CS7A 5DR5H 3AGVA 5J4MA 3RKDD 2NY6C 4AJ0A 3QWRD 3DROB 2C3XA 3MA7B 2JCCE 1DQJB 3UBXB 1MHEB 3ARBC 2YA2A 1B4RA 3OZ9H 1RIVL 2MQ3A 4JHBA 4JFFE 1FIEA 4V2CB 4IJ3B 4LLWB 3C5JB 5LKNA 4YBLC 1AO7D 1IC7L 5K9JL 2UVFA 5C0CD 1A6WL 3LRSA 3K3QA 1S9YA 4LPUA 4NWTH 4S1RL 3A0OA 3MV7B 5L6YH 5BMFL 2VDLL 3QUZA 2R9HD 1AR1D 4Y4FA 1ZVYA 3BWAB 1I3VA 2VISA 5JW4R 3T0EB 4R7DA 4PGCA 1D7FA 1QRNA 3U46B 4N1HB 1HXYB 3TYFB 3VMOA 2D7PA 4L8BA 4E5XA 3HNVL 1S9WA 4NHUA 4JN2B 1WWAX 2YD6A 1MLCB 4QHLB 3T4YB 3S37L 1T03L 5BOZG 1V7ML 5H35B 4TVPE 4WI4A 5I1KH 3GZKA 5IJVA 3O11B 5IB5B 2NCMA 1D6VL 5FCUL 1ORSA 4X6CF 1HN1A 1U8HB 4P3CL 5FGCB 2X4PB 2N4IA 5EO9B 5CP3A 1B88A 3OR6A 4MCYA 1UKSA 4N9OB 1AJ7L 1RZIA 5JIIA 4M9OA 3JV4B 5D7LB 4LPYA 1NCBH 4LSVL 2R4SL 4NQVB 4LCCA 3WEXA 3U0WL 3TJHD 1YMHA 3AXLA 2HKHL 2NXZB 3X14A 1T21A 1M71B 4ZFOL 4U1IA 5H94A 1U8KB 3KPQB 3OKOA 4JCMA 1D5XB 3O3DA 2VZ1A 3G6JA 4MD0A 1OGAD 3WV0A 5EIIA 1QBLL 5JW4Q 3HG1A 5ILTL 3D0VA 4LCWE 4M1DH 4PJEB 3RWHB 4I77H 1UFUA 2HKFH 4OI8A 3QDME 4RMWA 4LLYB 2EYTA 5LQBH 4NRZB 5CHNA 1XF3A 3FFCB 4TVPL 3OKLB 1HH9A 1BWMA 2YC1B 4WI6A 4Y16B 2CRZA 4G7VL 5FYJE 5JUEL 4HKZB 1CLZH 4J3UA 3SDXA 3FO0L 3VD5A 3UTQB 4YHYC 2CLZB 4KWUA 4PIRF 5CJQL 2VDKH 3F6LA 4KDTA 3ARFA 3B5GA 5DSCA 1SEQH 4QT5B 3MRMB 1HEZA 3QR2A 4J1UA 4XVSH 3QFJB 4JEGB 1AH1A 3GSQB 5ITFA 1BQSA 4XCFH 1DSFH 5F7DB 1U8LB 5IB3A 4X8JB 3ZE0F 3BH8B 3ULUE 2QEJA 4FG6D 3VWKD 2OBGA 3L5WB 1OARL 4WDIB 3IDIB 5ITBH 1U8NA 1AY1L 1PKOA 4HKBA 4I0CC 5C0FA 2VABB 1AGBB 5T1MA 1KSRA 3WCYA 1P4BL 3ZHKA 2HLFD 4LEXL 5GGTL 1A3RH 4OAWB 2HVKB 5H37H 5IMOB 3V0VA 1J0JA 4GW5B 1I8LA 3D9AL 3BRDA 1GGUA 3GK8H 5EZJB 3RY5A 1UH2A 1S5HB 3KPRD 4NGHH 1AXIB 1CXKA 2XTJD 5IQ7L 2ICWB 3QDHA 4U3XA 1Y6MR 3ZE1F 5LWYL 2V7NA 3DRTB 1Z9SA 2IADB 2A6KB 1JGUH 5FYJL 3UMTA 1JNHB 1LILA 5E2WL 2E7LC 3GMLA 1F3JB 3WXVL 1YY9D 1XGUA 4TUKL 2Q76B 4NQDE 3IDJB 2PETA 1JK8A 3NGBC 3L6FB 1MCIA 4ZUUA 4MQSB 4KTYA 1MFCL 3QDJB 3CX2A 4IDJL 1AGFB 1I9RH 2R0KL 3KLHD 1XMWA 3ULUL 5DJ0A 1JWUA 2OMNA 5I1EL 1GPOL 4NM8L 2DMBA 5FFLA 4XBPA 3DHMA 4HS8H 4JFXB 4YNYA 2HMID 4R4BA 4BZ1H 5HGAB 4Y2DB 1DCLA 3PABB 4PLNC 3MV9B 5TE6H 4DVBB 1GH7A 3BD3A 3LMJH 1UEYA 5INDB 5JW5B 15C8L 1FP5A 1NBVL 1ETZB 4MXVE 5EUKB 4JGJA 1MRCL 1MWAB 4G3YH 4ONHA 2GJ6E 2P43B 1F58H 4DCQB 1AQDB 2VDPL 1FIGL 4GUPB 3KR3L 4I5BA 3QNZA 3C6SA 4OF8A 4EBQL 3V5DA 1IGMH 3E6FB 5GRVK 3DWTA 1JNLL 1PD6A 4LP4A 3PG2A 1WF5A 3OKKA 1FRGH 5JQHC 3HZMA 1MCRA 3QI9C 3RIAF 3T3MF 1UADC 4S1QH 2Z91A 1MWAH 3GHEL 1IAIL 3LN9A 3W0WD 2ZCHH 3MRKB 1RZFH 2AKRA 3QUMA 3Q1SL 4Z5RA 2D03L 4GJTB 4MJ6A 4JZOB 3F58L 3C9NB 4M6MH 1MCDA 2EZ0C 3S5LA 4F3FB 4XPBH 4JN1L 2WINB 4HPYH 5TJWK 2B39A 2RFXA 1H3GA 5GISH 3KHOA 5B21A 4P9MH 1BGXL 1CGWA 3VXMB 3AFLA 3BE1L 3D85B 3PNWA 4LRIA 4XC3H 1ZTXL 3SE8L 2APWA 5F9DC 3TBVA 4DKFL 4OZFA 4XCNA 4ODHH 1YQVL 1OWWA 4KRPB 4S2SB 4YR6A 3TFKC 4LLDB 4F57L 3KPNB 2YXMA 3GIVA 3CJJA 4K7PL 2IQAB 2XN9D 5ICYB 1XZ0A 4XXCA 3OAYK 1XF2B 4IJ3C 4PJDE 4FN0A 4L8CA 2N7AA 4HV8B 2VDRL 4JY6A 5BXFA 2YR3A 4YBQD 2JB5L 2BOBA 4JR9L 3RAJL 4KY1H 1CDJA 1DDHA 4Q7DA 5KSBE 3WHE0 1YNLL 2X1PA 1HILA 3KJ6L 2IPUG 1U3ZA 4LDOB 3T0EC 3TJEL 3WO4B 5BRZD 3FFDA 3ZYZA 2QKIB 3V5HB 1ZA6A 1LEGA 5DO2D 1DBKL 4NQCA 4WI8A 4MNQD 1KIPA 5EU4A 4P49A 1SVCP 3D0LA 2KZ1B 4PRBB 4WNQA 3V79C 1OSPL 3D39A 5BS0D 1SHMA 1Q1JL 3RNQA 4WFED 3V0WL 5FGSA 3NPSB 1T7XA 1WCBB 1ONQA 1VGKA 1ADQH 4MX7A 4PJBE 3S37X 4LF3B 4F8QA 4HHAA 4OCRH 2CSPA 5C86A 4UIKL 5C9JA 2EXYD 4GMTH 3THML 2NXZC 4AYFA 4DVRH 3L1OH 2NW2A 4YDJB 1FG2A 5HI3C 2HFEB 4UBDC 3RTQD 3LQAH 3KXFE 3TCLB 4OGAC 5DUMH 4P5TB 4XP9H 4U3HA 1ZANH 4UQ3A 3OKEB 1IGCH 2MCG1 4F80A 12E8L 4JGMA 2O61B 1K6QL 4YBHA 4MA7H 2VWEC 3TCXA 3MBXH 2BVOB 3LN4B 2EC8A 4KV5F 3FQTB 4CBPA 4W4OC 4RGNB 3WKML 2DQEH 3MFFA 5HDQH 1OT1A 5F7KC 1SM3H 5ALBH 4XHJD 4Y16C 2E27H 4QHMB 1K8IA 3BP5A 1DQLL 3QDGA 4KKAC 3RFZC 3MR9A 4KJQC 5JOFB 4R26L 1BP3B 5IB2B 2FWOB 5HYQA 2H6PB 1I7TA 3RDTD 1YEKL 4R4ND 1QPXA 4XRCA 4LVOB 2V9RA 2VLJB 3PWJB 4BSJA 4GRWE 3IFOB 4ORZC 3EOYG 5FM5M 4IOIA 1P7QB 4OZGF 4NT6A 4EKXA 1EAJA 2VLKA 2XY2A 1T0PB 2EE6A 3X3FL 5E8DH 5TH2A 4D0DA 3WFHB 3RPIB 3LN5A 5FUZL 4CMMB 1JZ6A 1JYVA 3D3VE 1CK0H 5HI5C 1YEEL 1MFDH 4FQLH 3C5ZB 4QRSA 1GC1H 1MVUB 1P69B 4G9FE 1NDMB 3CVHB 5AWNL 1MAML 4MJID 1ES0A 3WE6B 4EIZC 4RRPG 4UMGA 3EJZC 4EOWL 4OCXH 2IFFH 3QIBB 5B3NA 3MV8B 1U2CA 3KYAA 4Q9BA 5EG6C 4U1LB 4HKJA 3TO2B 1OAQL 5GS0D 3FQNA 2X70A 4PGDA 2XACC 5EFIB 3CVHH 3MBED 2DQHL 4RWYL 4U05A 3A6BL 5F72S 3SOBL 4E0RA 4HGWA 1G7LB 2QQLL 4Y5XB 1JWMB 3B2UC 3WNLA 3IDYB 4HXAL 5KTEH 3U82B 3O3EB 2EH7L 3BPCB 4Y2DC 3MCG1 1SEBB 1UZ6F 2WQRA 3ARDD 5E9DD 4JM2F 3LKSA 4FXGA 4NKOB 4MAYB 4ZUWB 2A77H 4NQUA 4OLUH 5D9SB 3VFRA 1F97A 2HP4A 4TRPL 1RURL 4FNLH 4K23L 4HWEH 2BK8A 1KOAA 1FVEB 1R5WB 3ZL4L 3MRIA 1OQOA 1OHQA 1IGIL 3QEGL 5D7JA 3M8OH 5C7XL 3ULVE 5C6TH 4NNPL 4XPGL 2VR5A 2LU7A 4KJPD 4M8QA 4P5KA 5EBMB 5TE7H 2P24B 4I9WE 3WN5A 5IHUH 5FGRA 1TCRB 2X1OA 2X4OB 4HLZH 3REWB 2FGWL 1J0IA 1BVKA 1QLFB 2GTWA 4G8GA 4UIMB 3RVVD 4BH7B 2DQJL 2AXFA 5HPMB 2QQNL 4OFVA 1ZSDB 2F54D 2X4SB 4A6YL 3CFDB 3F7VA 2H2PD 4P2RD 4PG2C 4FQXA 4ZPTB 1T66D 4JFQA 2Q8AL 4JB9H 2E6QA 3BZFA 4KI5C 4Y1AB 1IT9L 2R39A 4U1JA 2WM0A 3NFNB 4BFIB 3EYOA 5ANME 5BVPH 2H9GB 3U30B 2ZP0T 4R96B 1DVFD 1TITA 2CIKA 2C3GA 4CN1A 5LAXA 4KRPC 3HLAB 3TNNB 3LEVL 5EA0H 4WUUE 1OWRM 2A6DA 1U6AH 3PQYD 5D1XA 5GPRA 1XF5A 4U1MB 5DMJB 4Z76B 1DANU 2M8XA 2VITA 5EBLA 1CF8H 5EUOF 1IQWH 4K2UH 1XGYL 3ULVL 5HGDA 1GIGH 2ICWI 2VO5A 5FYKH 1JVKA 1AKJD 2B8OT 4HJGB 3NA9L 3JV5A 4UV4H 3I6LD 2DLFL 2XZCH 5DD1L 3FB6A 4XAWH 4UTBH 4UT7L 3UJTH 2J6EL 4RMRA 2ATKB 3QQ3B 1R6VA 4YHMH 4U6VL 4K7PX 1RUKH 4FQIL 1NAKL 5E5UB 3HTLX 3M1BA 3TPKA 3HMXL 3MJ9A 1UQSA 3DVNA 1CD1A 1NC4A 2R2EB 2Z92A 1JI2A 3TIEB 4YXHH 3VXSB 5IVOA 4YX2L 4FXKB 4JZJA 5E8NB 1K4DA 4LU5H 3LQMA 5MEND 3WO4C 5IT2L 2C4FU 2NR6D 4OV5B 3X3GL 3BP4A 3B2VH 1KFAH 2AAVA 3OAUH 4PJ5B 3RGHA 4N0UA 1HSAB 3MLUH 5I66A 2CLVA 3JXAA 3UTSB 1EO5A 3WIFB 3V7AE 1W0WB 3EHBC 3WFCH 3QIUB 1J8HD 1NCAH 1T2QL 6CGTA 1DLFL 1I1FB 2BY1A 4POUB 5ID0A 3W9DA 5MP6H 3VH8A 3GB7A 1ZV5A 3CLEL 3G6DH 4RAVB 1WEJL 3LV3B 3NPSC 1KLUA 5DI8B 5JIPA 3R1GL 2BHUA 3OL2A 3LQAC 5DD3H 2ARWA 5IHBA 2MMXA 2OL3B 1U8IB 1A7NH 5T5FL 3ZTNH 3WIHL 1GSMA 4GAYB 3VXUE 3T08A 1T89A 1P5VA 4PRPA 2PW1B 3H7BB 4U1SB 3LEXB 2OR8A 2Q87A 4UT6H 3MMEA 3TBSB 32C2A 4JPVH 1RZ8A 5C70A 1KC5L 1DN0A 2HJKA 5EZLA 3FONA 5SWSE 1RULL 3M17B 1C8PA 5EC1A 1K5NA 5DRNB 3SHSA 4AEEA 4PJAF 4EVNB 5L9DL 2OL3H 4NZRH 4P5TC 2FLRT 3WDJA 1CLOL 1KCVL 1FH5L 1GHFL 4FHBD 3U4EA 1RZ7L 4BQ9A 3I6KB 5EWIH 3IVKA 1NC2D 3VWJB 2OJZH 4NYLB 1J1OL 3PGCB 4RGNC 4G6KL 4P2QB 3S98A 4ZPVA 3BSZH 4NPYB 3QG6B 5FO8A 5J6HA 5EU5A 3RVWD 4QRRE 4MMZC 5FK9A 5KS9B 4U1NB 4GW1B 1E4JA 1FL3A 1MJUH 2ZPKL 4NHCL 1OLLA 2CKBB 4OV6F 3T1WA 4DTGH 1H9VA 4TNVF 4X6FA 5FA4A 2IANB 2NY2B 1S7TA 4L9DA 2MKWA 3GFUA 4CVWA 4LVOC 4JM4H 4RGOH 2DQDL 3G04A 5ESQA 3IFNH 3BO8A 1NCTA 2R0ZL 3FOLA 2BFVL 2VN4A 1FZMB 3ALXA 1AGDB 1GC1C 3ILQD 2CKBH 3UYOD 5JXED 1YMMB 1A4JA 2ED9A 3HC4H 3TVMA 4H0GA 5CILL 3SDCB 1F8TH 3K4AA 4M61A 1J1PH 1V7NH 3IDMB 3CGTA 4RCAA 4YHKL 5HHMD 2X1WL 3AREB 1U58B 4JFOA 2OQJB 3MLRL 2F74A 2HT3C 4HH9B 1KTLB 1ACYL 1RVFH 3BKCL 2RCSH 5KW9H 2AEPL 3C5ZC 2GJZB 1H8OA 3B9KD 4R3SA 4ZS6C 5F1IB 1MUJB 4GAGL 3BI9X 3EYFA 2AP2A 3BPNB 1DR9A 2ADFH 3DTXB 3QIBC 2OR7A 4F58L 2Q86A 3OJMB 4JFPA 4HJJL 4OZGB 3P4LA 5IQ9A 3MOAH 3VG9B 2JJSA 2NX5A 4HK0B 3RVUC 5C0BD 2VIRA 3RHWK 5IBLD 2IBZX 2BMKB 4N90D 3O6MH 4DOHB 2DAVA 3EJJX 4HAFA 1IGJB 1FGNL 1Z9MA 5DD6A 1MIEL 4Y5XC 3K2UH 1UB6B 2AV1A 3IDYC 5DJZA 1DE4B 5J56B 1REIA 4ZUVA 2VB5A 2IPTH 1E6OL 3MRRB 2ZUXA 4D0CB 4GRLB 5FA3B 4JFFD 3F5WA 4MAYC 5AYUL 3IU3A 1UJ3B 3O45B 1NBYA 5T3XE 3UROR 4ZYKA 1ACZA 4HX1B 2PTUA 1C5DA 2BC4A 4HUWB 4JZNA 5HVGB 1BZ9B 1G7IA 1LO2H 1ZGLB 1CIDA 3L3KA 3G6JF 2B4CH 2ICES 2P5WE 1E4KA 3VCLA 2D7MA 1QFWH 4OLYH 1X3DA 3CX5J 4WHYH 3VDAA 3CUPA 1I7ZA 5IUSA 1OAYH 3W5MA 4WU5B 1T0NA 4N0FA 1L4IA 3WS3B 3I2CL 4MD4B 4BM7A 2VUOA 1CD0A 4HK3J 2APBA 2BVQB 3VFMA 1FGVL 2ADIA 3BDXA 1X7QB 4JM2B 5C0EA 3LKOA 4MWFA 2JK5B 4U1HB 1AI1H 1FNEB 4LVEA 4MXWH 4TVPD 3TH2T 4O02L 1I85C 2E9IA 3UTTB 4JANB 3RA7H 2X4NA 4HZLA 4GSDH 4LHUG 3KWWB 4MMXC 1XT5A 3IDXL 1UA6H 4FQQB 2V2TA 1FSKB 1QFUL 3QJFA 1S7UB 4HWBA 4BFGA 4PLJD 5D1QD 3HR6A 3HI5H 2BRQA 4GH7B 4HIIB 3H3BC 4L5FH 2ED7A 3U30C 3GI9L 3AROA 3I02B 5T3XL 1KLGB 1R3HB 4L4TA 4ODVL 3MRFA 2MKLC 35C8H 3GM8A 3ISWA 3R06B 1GGTA 4HG4K 2YPKA 3HZKA 1WITA 3HC3H 1NKOA 4PP1C 2MNUA 5BV7L 1RFDL 4PR5B 3OKDA 3VJ6B 1Q9OB 4Y4HD 7FABL 5E56A 4ZNEA 4OKDA 4LCWD 3W82A 4PRIA 4D9LH 2NTFB 5GGVL 1SY6A 4LLQB 2XA3A 4JKWA 2BOCA 5CZVL 4NN5B 4G80B 4BELD 1MI5E 1A6ZA 1XIWD 1KENH 2DM2A 1N0LA 1KF9B 1PKQE 2ORBL 4JFEA 4PJDF 3MFGB 3CFCH 3DUUB 1LO4L 1KIQA 1KPUB 3VFWA 3QYCA 5HDOA 3WDIA 3B5TA 5FYJD 3NAAH 3I6GA 4YIQA 1P4IH 3MGOA 1FYTA 1LO3L 1XCQA 3QUXA 3DXAE 3G08B 2EKSB 1GZQB 5DJYA 5F7UA 1MFEH 5EUOB 4PFEA 3SCMA 5HHXH 5M95B 1INDH 3QIUC 4P3DB 2VL4A 3GMOA 5FB8A 1DZBA 3CFJB 3EYQD 3L3OB 1TETH 1URLA 1Z0MA 3H3PL 2DYPB 2CIIB 1NLDH 4Q6IB 2BSTA 3ALWA 3FB5B 2HH0L 4OUUA 4Z7OF 1U8JB 2BDNH 3PHQA 1F4XH 3QXUA 5GRJL 2NNAB 4M3JA 4MVBD 3ULUD 5D93B 3VXRA 4X4ZA 5T1KA 5HI4C 4ZFOA 1OAXH 1YECH 3O4LA 5F8QC 3QHFL 4OIIL 3QWQB 4JPWH 1FV1A 4QCIB 4X6DA 3UBXG 2V2XB 1BFOA 1MCHA 2SEBA 3OR7B 4WEBL 3RJQB 4PJHF 4OD3H 3WNNA 2FL5B 2H32B 2UWEE 4L1HA 1KELH 2VXQL 2IH3A 3MLXH 1EJOL 4QRUB 2DKMA 1RJLA 4QYOA 4XMLH 1UM6L 2DWEA 3ZDZF 3AS0A 4CADA 3MJ7A 4WI2A 4PBWD 3RI5K 1OM3H 1L0XA 3QNXB 4E41B 1EFXB 2H32H 4PRNB 3N1QC 5KVFH 2Y06H 4JDTL 4YAQB 1S5IL 3VGHA 2WWKO 4Q2ZB 3VWJC 5DZNA 4P46D 4S1DC 2CO7B 1KB5A 4YFDB 5DMIL 4U0RB 4KTDL 4NQEB 4JO4H 4BQ8A 5B39G 4MJ2A 4K3JH 1OP5H 3RWGA 1FBIL 2OS7A 3N85L 4JDVB 3SE9H 4X7TB 3KPMB 4NO0B 3HUJA 1U3HD 1WFUA 3MRHA 4PJAB 1RJCA 4LSTL 2YSSB 2NY2C 4WTWA 5GJTL 3AU1A 2DM3A 5F71A 4FABH 1CU4L 1PFCA 2DOCA 5C09A 1YYMH 3SDYH 5GGTA 3MNVB 4RMUA 3BN9C 3FO2A 1Q9LB 1T80A 4G8FB 4ZTOH 5FKPA 5FECA 4JJHA 1UM4H 2GJ6D 3QDMA 2CDEB 4KVCH 2DN7A 2PW2B 4OLZL 1U92B 4UZGA 3VGEA 5IK3B 5HXMA 3SDCC 2DTSA 1SJHB 4GRWF 4M1CC 3IU4H 4OB5H 4AQ1B 1PSKL 2D4DA 1KCLA 3ZHLA 5HGBB 1CLCA 4HMDA 1MHHA 4GBXA 4RFNB 1OTSD 1O7VA 5E24E 4LMQE 3ARQA 4TQEL 5I1HL 1DUYB 2YZ1A 4X9IA 1BFVH 1S78C 5IFAH 3TZVB 3BPNC 3MREA 2BSRA 2E9JA 1U8OA 3BKMH 3BPOB 4V1DD 4UUJA 3GRWL 1OPGL 4PTUA 1WQVT 3H9SE 1T1YA 1JPTL 3DX7A 4TNWF 4Q9QL 5EO1B 5LCVH 2IALA 3VG9C 2XWBA 1QQDA 4ELME 2VJXA 2NY4D 3CSBA 1IEHA 4M62L 1M7IA 1JMZA 3IKCA 5E6ID 2VLRE 2IGFL 1BOYA 4OM0H 3MTRA 1X9QA 5JHDE 1CI5A 2J88L 2AJXH 4GOSA 6FABH 3QA3A 3WNKA 5ABDE 3O8XB 4ODXA 1A6UL 3QUZB 4Y4FB 2B4CC 4OD2B 4TUJA 2XT1B 3OX8A 4GRLC 5IP4A 1O5DT 4R7DB 1LQSR 1Q9KA 2HRPL 4NDMA 4PGCB 1QRNB 1UJ3C 1BIIB 4NQDA 4L8BB 5E2VL 4E5XB 5HJ3B 1S9WB 4NHUB 4PYGA 4OSUL 5B8CA 4NBXB 2KKQA 4OM1H 2I07A 3UJIH 2CQVA 4BH8A 1A7OH 5K9QG 2WANA 1EHNA 1CICD 1OL0A 2Z35A 4IRJA 4DN4H 5IJVB 4X5XA 5CCKL 4MB3A 1ZVHA 5DHYA 4F7MA 5EZOH 4M7LL 1ORSB 2D7QA 2C7UA 2FX8L 3M07A 2O5YL 3FMGH 3OR6B 4MCYB 2CRMA 1RZIB 5HD8C 4IMKA 4JM2C 5EIVA 1OP3H 3ZHDA 4LSUL 4OFYA 4LCCB 4APQD 3WEXB 3RWJA 4ZFFA 2O93L 1DQDL 1YMHB 3AXLB 4K3EH 3PJSA 4GT7A 5DT1H 1F4HA 5I8CA 1XFPA 4PJXE 5H94B 5F88A 1FSKC 1JPGA 2ZOLA 3V6ZA 5CP3H 3VMPA 3O3DB 3G6JB 4POYA 4MD0B 3CMOL 5EIIB 3ZKQD 1DJSA 4J23A 3HG1B 4DQOL 4LL9A 2R2HA 1JHLH 5EB9A 4JFYA 2PR4L 4H0IA 3HN3A 4YGVA 2EYTB 4KHXH 1S7XA 5CHNB 5HYFA 4O2CB 1NGWA 1J05A 1XF3B 3PWPE 1GGBH 3CPLB 1DTUA 4X4XA 3LIZH 3MUZ1 4XC1L 3GI8H 3KXFD 4OQ1A 1HH9B 3BKJH 1ZHKA 5TQ2L 3L5IA 5IWLA 3NABH 5EU7C 1ZOXA 3AUVA 3SDXB 4O4YL 2GCYA 4TSCH 5CWSA 4HH8A 4WCYH 5A3ID 5DSCB 1FFPA 3PHOB 4OZHE 1HEZB 4ERSH 4KQ4H 4NN5C 1MRDH 5FUOL 4J1UB 3VW3L 3JWOL 4G7YH 1DBBH 1U3JA 4Z9KB 5ITFB 1DBJL 4QF1B 2V2WA 2VAAA 2ZJSH 5HBBA 2EDWA 2OZ4L 4HCRL 3X11A 5IB3B 3Q6FA 1V8HA 3T1FA 4H1LB 2DF3A 3C09B 5AZEH 1U8NB 5GS2D 4YE4L 3IKKA 5D70H 4HKBB 5C0FB 5T1MB 1W72L 1BEYL 1B4JH 1QFWI 5GRWA 2FHCA 2FBOJ 2GT9A 3KNBB 3KPLA 4Q6IC 3SKNA 4X99A 5E1AA 3V0VB 1FO0A 4Y5YA 1S7SB 2C26A 3ZE2E 4H1LH 4MJ5B 5D93C 3E1F1 2E6PA 1UCTA 4YZFF 3WJLA 1XF4A 3IXTA 4ODTH 1UXSA 3ARRA 1RUMH 2V7NB 3D25A 2J7LA 3NIDE 3KYKH 4TSAH 4XCEB 1AC0A 3RGVD 3GMLB 4EDXB 1XGUB 4PJIA 1CBVH 5E95B 5JHLL 5IEHA 3D3VD 4XWGL 3HFMH 5DGRA 3C87A 3VD7A 2YPVH 1JK8B 4MZ2A 1T04A 4ZUUB 1FE8L 3INUH 4XWOD 1L7TH 3FB8A 3L5XH 3LHPH 4HGMA 1HINL 3A6OA 5D6DC 4G9FD 4APQA 4I1NB 3LVEA 2CMRL 5DJ0B 5E6YA 1IKNC 5IGXH 4O2FA 1N5AA 4XP6H 5IBTH 4YNYB 1RU9H 4R4BB 2AJSH 3LQZA 3LB6D 3QZWG 2EDOA 4G6ML 4U0RC 4Z0BL 3V4PL 1AR2A 1WBYB 4G6AC 2BY0A 3C2SA 5DMGC 5F96H 1PZ5A 4ONHB 3FHQA 1WJ3A 1VEOA 4Q0XL 4I18A 4QHKI 2CDFA 4YFEA 3ZLQC 4I5BB 5FYLH 4K8RL 2A0LD 3QNZB 3C6SB 3TYGL 3V5DB 3GBNL 3V9FA 5IW3A 1MF2H 2ARJA 3OKKB 4HPOH 5L7XL 4WVRA 4EDWH 1BVLA 3HZMB 5K59E 5AEAA 2J4WL 2Z91B 1NEZA 1XGPA 1CE6A 1KYOK 1QSEA 4JJ5A 4P4KD 2R0LL 1EEYA 2AKRB 3QUMB 2AQ3A 4Z5RB 5F3BA 3HE7A 4X4YA 4MJ6B 3ULVD 1FAIH 2VXTL 1CFVH 4RMSA 5INCA 1R24A 4I9WD 3CVIH 4B5EA 4KK6C 1MQKL 3ARGA 1N3NB 4RFNC 3PF2A 1D6EA 2OR9H 2B1HL 1UJTA 1B2WH 3PNWB 3BEVA 1NFDE 2FATL 1SYVA 3QUMH 5AG8A 5HYSG 3K4DA 4OZFB 5CGYC 4WY7H 4XCNB 1YA5A 1EGJH 1HDMA 4L29A 4P99A 3BRFA 4YR6B 4AH2B 3BPOC 4KVNL 3GIVB 2NXYD 1KIRA 4QOKE 1KCUL 1OTUD 3OB0H 1IFHH 2XTJB 4Z95L 5CD5D 2Y5EA 2DB8A 3VFNA 1F4YL 4YHNA 4MNGA 2ENYA 4OZFH 4L8CB 2DTML 5JIKA 3QRGL 2EDDA 3D2UA 4JY6B 3ARVA 5DQDH 5BXFB 4M6OH 1J18A 2BOBB 3ROLA 1P2CA 1DDHB 4WUUD 1GAFH 5BO1H 2AEQL 3O8XC 5JMRA 3QUZC 2XV6B 4Y4FC 3SEPA 3RVXD 1E6JL 1HILB 4OIAA 4R0LA 2YRZA 5FHBL 3P0YH 4MS8C 3O2DH 4G6FD 1OCWL 3DX8A 4XPAL 3FFDB 1JNJA 3I84A 1ZA6B 1LEGB 2B7DT 4YDKL 1NANH 4D9QE 3QG7H 4NQCB 1DLHA 3PGDA 2AJUL 1KIPB 3UYRL 3UJJH 3D0LB 2IG2L 3QQ9D 5CLWA 3QCVL 4JFZH 4WNQB 1R3IH 1G7HB 3FO9A 4A6YA 3D39B 4AM0A 2HT4C 3VD9A 2R29H 1M05B 3C6LA 1ONQB 2IC2A 1VGKB 1EH9A 2W9DH 1DP0A 3MX0A 3PUCA 4MX7B 4WTZG 1TTUA 3HCVA 1C12B 4HHAB 5IVZA 2UUDH 3GBML 4JQIL 5C9JB 4LCCC 5I17A 5CGTA 1JRHH 1JYNA 1FG2B 2XYCA 2XRAH 1L0YA 3W0WB 3C8HA 3FTGA 3IFLL 4OCSL 2GK0A 1CLYL 4K9EH 1OSZB 4FFYL 4JPKH 5EO0A 5TFSL 4NNYA 1N7MH 2FJGA 4UQ3B 2VDNL 1MCOL 2D4FA 3VXUD 4Z77A 4L4VD 3PXJA 4ZAKA 1Y18A 4XB8A 2J6EA 1NCDL 3LCYA 3U2SA 5C0RH 1U93A 3WUZA 5J57B 2X10A 5SWSD 3MFFB 3HMXA 3WD5H 1A5FL 1PDKA 2W91A 4K71B 2X7LA 4PG9A 1AIFA 4DGVL 3BT2H 4UI2A 3RKDC 4HKXA 1K8IB 3BP5B 2Q3AA 1W8OA 3QDGB 4Z6AT 1XR8B 2YUZA 3MR9B 5C0AE 2XN9B 1TJGL 1ZLVK 5E5MA 1TVBA 5DJCB 5HHOA 2EE9A 4N8VG 3ARPA 5GJSH 2HG5A 1A6VH 1VFOA 2HJFA 5HYQB 2D9QB 1I7TB 3Q6GH 2R8SH 1G0XA 4NJAH 5C2BH 1OLZA 4XRCB 4CDHA 4YXKH 4QRRD 5EPMB 1IL1A 1JPSL 2DBLL 3C09C 2YA1A 5E03A 4R6UA 1DL7L 2D0HA 5KVEH 2K1MA 4ENED 2VLKB 1MCSA 4FTVE 3U4BH 4WUKL 2X4RA 5TH2B 4WTXA 4D0DB 2Q8BH 3RP1A 4PRHA 4JKLA 1ZLSH 3LN5B 3VG0H 2N56A 5BRZB 3MLYH 1BD2A 3U9UA 1R3JA 4GLRI 4P23A 4R7NA 1I8LC 1PBYA 1YEDB 5J89A 2F5BL 4N5ED 1FQ9C 4QRSB 4PJCA 3DYOA 3EZJB 2GITA 4M02A 3IS1X 4I3RH 2W0FA 4JHAH 1G9EA 1ES0B 3TO4A 3TF7C 3L7EA 4WO4A 1PW3A 3IAQA 3ES6A 3KPSA 3U9PH 5EU6E 5ADOL 1NH6A 1KJ2L 3DX9A 4HUMB 5IVXF 3VRJA 4YQXL 2ZSWA 2FZ3A 1WAAE 3FQNB 5IB1A 2X70B 3O6LH 4PGDB 1OB1A 4LCIL 4K3GA 1S9XB 3BW9B 1ZVSA 4MQXC 3QXVA 4FXLA 4QTHA 3TJHC 4E0RB 3MJGX 4AL8H 4HGWB 5K9KA 4JRYA 4PJ8D 3B6SA 1D5ZA 3RTQB 2HT2C 1MJ7L 1IAKA 1QSFE 3EYUH 2ZOKA 3FOMA 3ZKMC 5F7YC 1QHPA 3LKSB 4FXGB 4ELKA 3HNTL 3VFRB 4DGYH 5JPMA 2JJVA 2FECL 3QPXL 1T1XA 4RGMB 4OD1H 5DTFA 3MRIB 4LKXA 5D7JB 4UINL 3BQUD 4IS6A 4XP4L 2FX7H 2XIDA 1NL0H 4R2GB 4XPFH 3MOBL 4M8QB 4P5KB 4KUZH 4HEPG 1CE1L 3W9EA 1GGIH 1F3DJ 3WN5B 1VESA 3X13A 4NUGL 1MHEA 3MLTA 1BVKB 1WLHA 2GTWB 3ZDYE 4G8GB 3AMLA 5T3XD 5JR1H 2P42B 3LEYH 1MRFL 2AXFB 2C3VA 3C5JA 1CYGA 4CVZA 5KVMC 3QEQE 3PGFH 1DN2A 2I9LA 5IKCB 1CT8B 1ED3A 2BNRA 2P5WD 5E2TL 3HZYB 1KPRA 3F7VB 4UNVA 4ZD3L 4H8WH 4W68A 1H3PL 4FQXB 4KROD 4YHOH 4JFQB 4XMPH 4MLSA 3S3JA 3FN0H 3BZFB 2APVA 4RA3A 5I8OH 1LO0L 3QUYA 4U1JB 1QP1A 5DLMH 3VDBA 1WTGT 2W60A 3EYOB 4LRIC 4KHTL 5CJ8A 5JZ7D 3P4OA 1PG7W 3CMGA 5GGQH 4HSQA 2CIKB 5T33H 1HXYA 5LAXB 3GSWA 4C56E 1SYSA 3TV3H 5AYQA 2A6DB 5D1XB 3BVNB 2YK1L 3CSYA 1XF5B 1A3LL 5EBLB 2VITB 4M5YL 1FORH 2A74A 2XTJC 4XXCC 5HGDB 3BAEH 4P9HH 2M1KA 4CUCA 1PVHA 5JA9A 3IJSA 4UT9H 2YUXA 4IBLT 1AXTH 3FB6B 1LK2A 3WS6A 4MZ3A 4HIEB 1ZLWK 1DANT 3M1BB 3BGMB 1HKLH 1UQSB 3DVNB 3O6KH 5ACMA 1UM5L 1NC4B 2Z92B 4X6DF 3P9LA 2F9BT 1K4DB 1M71A 5DA4A 3OF6A 3D5OF 2V5YA 4QRPE 3BP4B 5CEXA 4N0UB 2DRUA 4PJ8A 3MACH 5I66B 2CLVB 2QTEA 1YDPA 1MI5D 4Q6YA 3MJ9H 3MLPA 2RHEA 4PJEA 3BDYH 5D1ZA 3NIGE 5ID0B 5D7SL 5C0IA 3W9DB 4X98A 3C60D 1FZKA 3VH8B 4BK4A 4ZSOA 2C4FT 5IFJB 4NRZA 4OTXL 4W4OA 1KLUB 5FDWB 4JO1H 2W9EL 3DXAD 2H3NA 4K9EC 3JTSA 4OLXL 1UKQA 4MAUH 2HA1A 4KU1A 5I19L 4PRPB 4GG6E 4JFDE 4O9HH 5A43C 5T1LA 3MXWH 3MMEB 32C2B 1R5IA 1RZ8B 5GSRA 4LDLB 1NGPL 3MO1A 4G43A 1DN0B 3HUJF 3U7WL 4HC1A 3QFJA 5EZLB 3FONB 3PWLA 3DMMD 4PGZA 4XT1C 5EC1B 4XMKL 5TPWL 5IJKA 1OF2A 1N64L 2G9HB 4GKOA 4B41A 1NUFA 3U4EB 3IDIA 3A6CH 3GJEB 1RK0A 43CAA 4WHYG 3IVKB 4M7JH 3MV7E 3RUGA 5DD5H 2IAMA 4LARH 4DN3H 3PXHA 4ACPA 3T77A 4YXLL 4AZ8A 4ZPVB 5FO8B 5J6HB 4OAWA 5EU5B 2EH8L 2O26U 2R2BA 2AW2A 4K71C 3VFGL 5LVEA 3T0EE 4GW5A 5FK9B 1T7ZA 1FNSH 5I71B 4GAJL 2A73A 1K8DA 1FL3B 2ICWA 5SWZA 1T7YA 3OZ9L 3PIQA 1QG3A 4XVTH 5FA4B 1VGEH 3PE9A 3RPKA 1AKJB 1TIUA 3V8CA 2ZWLT 4OZHF 3ZKXB 4DGIH 5JW3H 2AI0H 3IRPX 5ESQB 4JG0H 2B0SH 2UZXB 2A1WH 2EDTA 5L6YL 5FGCE 3BO8B 3L6FA 5GZOC 5GS3A 1NANI 3WBDA 1EEZB 1SBSL 4OFPA 3TVMB 5EULV 3GIZH 5D7LE 3VXTA 4M43H 1V05A 4M61B 3IF1A 2EDLA 2DQCH 4YGAB 1FNLA 2X89A 1JFQH 1IZJA 5BCAA 4JFOB 4E9LA 3PABA 3N1PC 2FX9H 5DO2C 2F74B 3LZFH 1UYWL 4PJFB 2NY3D 1MI5A 3RZCD 4KMTL 4PJ9D 1FFOA 2GY7B 1KIUA 4R3SB 5I1KL 3EYFB 2FSEA 4Z7UA 2CUHA 2VAJA 2VWEE 2G5RA 5L2KE 1QR4A 2Q86B 1UB5B 1J86A 4JFPB 4C4KT 4OGXL 1U42A 4GKSA 2I25N 2NX5B 2MJWA 2VIRB 4EI5D 4ODWA 1NCBL 2ZNWA 4HFUH 5DUPH 5DMKA 4J4PD 5IEKA 3S34H 4QHUB 4Y8DC 1D5BA 4FP8H 5DD6B 1CD8A 4RAUA 3P0VH 3C2AH 5E4IA 5D7IB 3DBXA 4WI7A 4ZUVB 3RTQC 3H9SD 2L7JA 4JZOA 1D5IH 3GMQA 2YZ8A 1I1AD 4OT1L 4F3FA 2P8PA 2WINA 3F5WB 1QOKA 3GO1H 3K2MC 4I77L 2VLRD 3PV7A 5T3ZH 1NBYB 1BF2A 2HKFL 4XNQA 4ZYKB 1VPOH 4RGMC 1C5DB 2BC4B 4JZNB 1G0YR 1G7IB 3CZFA 1TJHL 5D7JC 3SQOH 1MNUH 5E1HB 1ZWIA 5F21B 3T0AA 3VCLB 4P2OD 4R2GC 3HNSH 1CLZL 4XPHL 4YEEA 4H8WC 5IG7A 3CUPB 4UOJA 3WN5C 4OZIE 1SEQL 2CR6A 1T0NB 4P5MB 2KQNA 2MOVA 4KXZI 4OCLC 4KUCD 4XVSL 3NCYS 4QWWC 3MUJA 1XF2A 3VFMB 1IKFH 3NTCH 2EIEA 1NFIB 2UVEA 5C0ND 5BW7C 5C0EB 2APFA 2XG5A 5I30L 3LKOB 4MWFB 3TNMA 4XCFL 2DD8H 1P4LA 2E9BA 1IC5H 1DSFL 2Y36H 5K59F 4J3SA 4M48L 2KL6A 3P30H 4HZLB 2AK4E 2Z93A 2N1KA 4FQXC 2DLEA 2V2TB 2W0PA 3QJFB 3UAJC 5ITBL 2W65A 1NCNA 2BHYA 2WBJD 4P9HC 5B3JE 4PUBH 2HWZL 5DWUH 4YHZL 3H8NA 2YD7A 3QDJE 5JXAH 4Y4KA 3LAFA 5B38G 3NFPA 5DJAA 3DETC 2YMXL 1YPZA 3C8DA 4L1DA 3JWDH 3MRFB 2X4TA 5D1XC 3P40A 4KJWD 5CJXA 2YPKB 1MHCA 1JGEB 2XKUA 5F8RC 5C07A 2W9LA 3PDOA 3WXWH 3HZKB 2G5BA 4HWBH 1JGUL 1NAMA 1HNFA 1QD0A 3OKDB 1RIVH 4H88L 3KAAA 4PRIB 5K9JH 1EBAA 2BOCB 1P53A 1IGFL 1A6ZB 4S1RH 5FF6A 4LF3A 4JFEB 4PD4J 1QZ1A 1QFPA 2VDLH 1KIQB 5E5RB 3VFWB 5SWQB 4NJ9H 2Q20A 1I9RL 1T22B 2QSCL 3I6GB 2AQ1A 1INQA 4YIQB 2HFEA 1FYTB 1XCQB 3QUXB 4Z0XB 4HS8L 1SY6H 4ZS7H 4BZ1L 1A7PH 3TCLA 3H9SA 1D3CA 3SCMB 3HNVH 4P5TA 4EQ2A 3FN9A 3GMOB 3LMJL 5FB8B 4HWZB 4JFFB 3CDGA 5HYEA 1S3KH 5FO9B 1C5CL 1A8JH 3S37H 1T03H 2BSTB 4OUUB 3MUHL 4U1GB 3PHQB 3LN4A 4G3YL 3FQTA 2EE2A 4G8EA 3BISA 5FGBA 5JHDA 1F58L 5T1KB 1D6VH 4NZDA 4FFZH 2K3TA 1KN4H 4ZFOB 3OKYA 4CAGA 1QBMH 2YXFA 3O4LB 4N1EA 3VXME 3FT2A 1B0WA 2VSDA 1FV1B 1IGML 2P48B 3PV6A 4X6DB 1TZHB 1BFOB 1BHGA 1CXEA 2SEBB 5LGHL 1T89C 1JN6A 1Q38A 2DQTH 4X7SH 4LSVH 2R4SH 2EEAA 5E8EA 4XVUD 1S7WB 4S1QL 3OAYH 1YC7A 1MWAL 2IH3B 4TTGA 1BX2B 3TA3D 5JOFA 5F97E 2ZCHL 1RZFL 3L3DA 3ZDXE 1RJLB 1K85A 3NZHL 4K8RD 5E7FA 4CADB 4L8SB 4M6ML 3MJ7B 2PXYD 1CFQA 2Y6SD 4HPYL 3OXRB 5TDOA 2GTZA 2XNAA 2Z31D 4P9ML 2LV4A 2R15A 3QHTC 1MAJA 4ZO9A 4PJGE 1CZ8H 3QBTB 3OPZH 1N6VA 2D7OA 3S36H 4O5LL 1PAMA 4ODHL 2WV3A 3T0BA 1UACH 4B53A 3VGAB 3RWGB 1SMOA 2OZ4A 3B3IA 4HCRA 3ESUF 4IRZH 2LFGA 4PBVC 2EIZB 3N0PB 3C5ZA 5H2BB 1DBAH 4PY8I 4WHTA 5ELIA 4EEEA 3MRHB 2GHWB 4PS4H 3T4AA 4QKXB 4HT1H 2VZTA 3QCTL 3AU1B 4PLKC 5TE4H 5C09B 4Y4HB 5DEGA 5KSAD 4LCWB 3QIBA 5E70A 5FECB 5F1NA 4KY1L 2R56L 3QDMB 4U1LA 5EOCH 1OARH 3VFOA 3PWPA 1AY1H 5EFIA 1WWWX 4UDTA 5D2LF 3TVMC 1P4BH 5CZKA 1WIOA 4M4PA 4EN3D 1J12A 1O7SA 5GGTH 4GBXB 4EI6A 3DSFL 5E08H 2I24N 1E4XI 3RWCA 1NGQL 1SEBA 4F7PA 2V5RA 1A7QH 2X44D 4OCYH 1RZGA 1K3IA 5IQ7H 4QHNB 5GGVY 5GZND 1ZGLP 5LWYH 4M7LT 3AS3A 3WIIL 3MREB 1OD9A 2BSRB 4CU8A 1U8OB 5E2WH 4X6CE 1YN6A 4MCZA 4PTUB 2XWTA 5E99H 3DX7B 2QHRH 4JDZA 1WGOA 2XG4A 3BX7C 2XWBB 3TT3H 1QQDB 2JJSC 3UDWA 5I1IH 4BKLA 4OCWH 3QQ4A 4OCRL 3DGGA 4BYHA 1M7IB 2XKSA 4JQXA 3FAXA 3OAZH 3IKCB 2A6JA 1TCRA 3OJDB 2X4OA 2XQYG 4GMTL 3PDDA 3QWOA 4DVRL 3RHWF 4OJFL 2R0KH 5CSGA 3QA3B 4ODXB 4QOKD 4RX4A 3LQAL 5DDHB 2XFXA 4HF5H 4TUJB 2VDQH 3OX8B 3CFDA 2DDQL 1I8IA 1ZANL 2YD1A 1IGCL 4LOUD 1JHKL 1Q9KB 4NDMB 4ZPTA 3WFDH 1P84J 3SE3C 4MA7L 1A1MA 3MBXL 2VLJE 1NBVH 3SDDD 4NQDB 5DZOA 4XP1L 3MLZH 5DEFA 4LIQH 5TDNA 1QR1A 4AENA 1EEQA 4QXGH 2YPLE 2VDPH 4RRPA 5ALBL 4BH8B 5BOPA 2H9GA 2Z35B 1E4KC 1I8KA 3KR3H 5F9OH 4IRJB 2E27L 3BKYH 4X5XB 4EBQH 3TNNA 5DHYB 4F7MB 3RVTC 1QPPA 4U2YA 1BIHA 2C7UB 3SE4A 3M45A 4Z76A 1F11A 4CMHB 5D96B 1IM9D 1ODAA 4M93B 1AC6A 2CJUH 1A6TA 4D9QD 1IAIH 1H3VA 2HTLC 3UZVB 3GUTA 1NCCH 3DUSA 4M5ZL 4KKLC 2EDFA 5L8LB 1A1NA 4ZFFB 1IM3A 1T2XA 3F58H 5J12B 2VE6A 3JWDC 3PJSB 3ZE0E 1JV5A 1KCRL 4Y7MA 5I8CB 1PZUB 4JN1H 5F88B 1JPGB 3V6ZB 2ZOLB 3MV8E 1PQZA 5EN2A 2C5DC 4ISVA 4HUVA 1GCFA 2VERN 2CKNA 2R2EA 1HOCA 3NCJL 3SDAD 5DURD 3BE1H 3EO0B 3MXVH 3OGOE 5E8DL 1VERA 5GHWH 3I50H 1UZ8A 1AP2A 2FEDD 3O0RH 2EYSA 3REVB 1CK0L 4JFYB 2NY6D 4N0CD 4YGVB 1HYSD 1S7XB 1MFDL 2ARJQ 1NGWB 4FQLL 1J05B 4DKEH 3LPGA 1H0DA 4HFWA 3ARBD 4X4XB 4FA8A 2CK0L 1I1FA 3ZE1E 1ZHKB 2OLDA 3SGDH 2I60H 2GCYB 4RDQF 5CWSB 4OCXL 2IFFL 1CXFA 1FFPB 2VDRH 3C8KA 3PL6D 4BZYA 3L9RA 3JBG7 5D5MA 1U8IA 2JB5H 3OKMA 5CAYB 4GAYA 1MPAH 4PJCF 4Z7QF 5I15L 3QXAA 4JRXD 1F13A 2V2WB 2VAAB 1YNLH 3JV0A 4HUXA 4LNVA 1BQUA 5KSUA 1ZHBB 3Q6FB 3T1FB 3MNWA 3TP4A 3QUXC 5KTEL 4D3CH 4MXQD 5C0AD 3S5LG 4NSKA 3T0XA 4P59H 3SCMC 3NCFB 4QGTA 3K1KC 5DJXA 3DO3A 5L2JA 2OXHA 3WJJA 3KPLB 2GT9B 2HRLA 3QAZB 3SKNB 1JF5A 4FNLL 2XPGA 4X99B 1FO0B 5E1AB 4U1GC 1JGVH 1OSPH 5J1AA 2ICEB 4OZFG 2FDBP 1U91A 3PGCA 3CK0H 1A9BA 3DARA 4P2QA 3M8OL 4G9DA 4Y89A 1XF4B 3IXTB 3P9WB 1UXSB 3D25B 3OB0K 5IF0A 4PPTA 4FTVD 5TE7L 2WAHA 5A2IH 4PJIB 4IRSA 5I1JH 1BAFH 1FO0H 5IEHB 1EVUA 3T3ME 3THMH 4OF0A 1BFTA 1T04B 1BQHG 1UENA 1GL4B 3FB8B 5A2FA 2WK2A 4MB5A 4APQB 4L8SC 3ZYOA 4O58H 4XPTL 4O2FB 1N5AB 4JB9L 2WIMA 3IT8D 5EU6D 1FZMA 3EO1A 1ITBB 3LQZB 5DK3A 1BJ1J 4PLJC 3ECBA 2Y1VA 4PJBB 3WKMH 3VXSE 1WC7B 4S10A 2VC2L 4OGYH 1N8ZB 3AREA 1KXQE 3VGAC 4U0QB 5EA0L 1WZ1H 1PZ5B 5CLTA 1U6AL 4PJ5E 4I18B 1CF8L 2CDFB 1IQWL 2NY1B 4K2UL 2GJZA 3UTSE 3EDFA 3ZYIA 4NCDA 1QSFD 1AQKL 5KN5A 4BUGA 4QXTA 2ARJB 4X80L 2XZCL 4Y4HC 1NUNB 4XAWL 3DTXA 2RAMA 1I9IL 4UQ2B 1BVLB 4UTBL 1L7IH 3TH4T 4YHML 4G5ZL 3PL6A 1MCLA 1RUKL 1XGPB 1X5ZA 1EZVY 1QSEB 4JJ5B 1EEYB 4NKMA 1AD0A 5MERA 4KJYA 3HE7B 3WUWG 4X4YB 4YXHL 5JPNB 5IOPA 5A1AA 3DSNA 4LU5L 4UU9B 5INCB 8FABA 5KJRH 1R24B 1DEDA 3LKNA 3ARGB 1KFAL 4U7MA 4GBXC 3T0DA 1DE4A 1PY9A 1D6EB 4CDGC 3MRRA 3BEVB 1NCAL 4D0CA 1ZT4A 1JF1A 3MRQA 4WEUD 3QEQD 1FFRA 2WUCH 4UB0H 2FYYA 1NLBL 4YC2B 3V5KA 1RUPH 1HDMB 3EO9L 1JIBA 3ARZA 3RWIA 1N6QH 4HX1A 1CGSL 5SV4A 1KIRB 1A2YB 4EOWH 5DD3L 4W70A 1CGVA 4H0HB 3VFNB 4YHNB 4MNGB 2ZUTA 2JELH 4PJEF 3D2UB 1B0RA 4UT6L 5C08A 1X4XA 3IS0X 3S4SG 2DQHH 4C56D 3ROLB 3A6BH 3QXWA 1I3RB 1HI6A 2HFGH 2BHZA 2IMNA 2VQ1A 3O9WA 2OL3L 4NZRL 3GSXA 2YKLH 3UTTA 4JANA 4R0LB 5HYJD 4KFZC 4ZUTB 3DX8B 3EAKA 4HK3N 5HHNA 1BPVA 5IIEA 5EWIL 4TRPH 1RURH 2OJZL 1MH5A 4HQQH 4KV5E 1R0AL 3GJFK 5CINH 4LLUA 1DLHB 3ZL4H 3PGDB 5T1DH 2E7MA 3BSZL 1WIUA 4X4ME 4Z7WA 3QEGH 1YMME 5DHVA 1QFOA 4IRJC 2AS5M 1D9KA 1QFHA 1CFNA 5GGUB 4A6YB 3O6FA 3EW3B 4AM0B 2H1PH 5D72H 3QXTA 4QRPD 3MROA 1MJUL 4Z7NF 3QI9D 4CMHC 3C6LB 5D96C 3RUGF 4M93C 2HLAA 2UY7A 2RBLA 5J3HD 4DTGL 4HS3A 4WFGE 2BJML 2DQJH 4KK5C 4IMKC 4PB9H 1Q9OA 2ZCLL 3HCVB 2FIKB 1FNAA 5IVZB 2QQNH 5I17B 3F7YA 4RGOL 4JM4L 1MFBH 4A6YH 4XNYH 5J12C 4EJ1C 3K1DA 4TVSa 1B9ZA 3N50A 3MCKA 3FTGB 3MODL 2GK0B 2VZUA 2Q8AH 1MFNA 1HHJA 5A2LH 4OZGE 2FEEL 2CKBL 1QEWB 3HC4L 5EO0B 3I3DA 4NNYB 1IT9H 1F8TL 3U0PB 3UPRA 2FJGB 4NO2A 3VXNB 4X6BB 4Z77B 1KJ3L 3D18A 4HMEA 1AFVH 2EKSA 5F9WB 4ZAKB 1Y18B 5DMYA 5F7MC 3TFKD 4Z7VA 3NZ8A 1NCUA 3R8QA 3U2SB 1Z9OA 1RVFL 2X42A 2RCSL 4OCNC 2DQUH 4HBCH 3UXFA 3TC9A 2ICCA 4RFEB 5IWLC 4Q6IA 3ULVH 2PYEA 2X7LB 1AIFB 1VENA 2QADB 3N9GH 4HKXB 3SJVE 2ATPA 1X5XA 3MV11 2R4RH 5DD1H 4LFHG 4MHHG 2VRAA 2J6EH 3P2TA 5E5MB 3MV7D 3MOAL 1MCKA 1TVBB 5HHOB 1ROWA 4FQIH 1FG9C 2K7PA 2HG5B 3OR7A 2RR3A 1MCQA 5EOCJ 3DI2B 3O6ML 3MA9H 2WNGA 3HMXH 4LHUA 5ISZA 3MRCA 3Q3GA 8CGTA 2PN5A 1UWGH 4HS6B 2EO1A 3T0ED 4HD9A 5B4MC 1KJVA 4N5UA 1CTOA 1IL1B 5ERWB 4E42A 3K2UL 5IT2H 2Z8VC 4PRAA 5DC0A 2PO6D 3X3GH 1CXLA 4U4BA 5HPOA 2IPTL 4R90H 3GHBL 3V95A 5KSVA 3FQRA 3MGTA 1CDGA 1UZ6E 3O3BA 3CIQA 1X5YA 1BWWA 2X4RB 2VLLA 4NUJB 4Y5VA 1EFXA 4PRHB 1WWCA 4PRNA 4UILH 3QAZC 2ESVA 4YAQA 4TSBH 3U9UB 1R3JB 4P23B 5FAAA 1J0YA 1H3WM 5E8PA 2EKJA 2I27N 4EIGB 4RNRA 3MYZA 1LO2L 3G5VA 5HHVL 2B4CL 1IAII 3R1GH 4WHCA 4M03A 2DM4A 1UC6A 1QFWL 2GITB 1NFKA 4OLYL 3S9DB 3RIAK 3TO4B 2C4XA 5D7LD 1OAYL 3L7EB 4WO4B 1YEHH 3ES6B 3KPSB 5IBUG 2ED8A 1DQMH 4KI5F 4HXBL 1I3GH 3DX9B 2YD9A 2EYRB 5HI3D 3VRJB 2FJFB 4UBDD 2YSSA 2ZSWB 2FZ3B 1RULH 4OGAD 2BNQA 1AI1L 2FRGP 4WWKD 4APQC 4N0YH 5L9DH 1ZVSB 4FZ8H 3RA7L 5FV1L 3OTTA 4QTHB 4GSDL 1UA6L 1NCWH 1C08A 4RA0C 5K9KB 4JRYB 3ORJA 1A1OA 3B6SB 3BP6A 1D5ZB 2X1XR 5F3HA 1KN2L 1U92A 2BSSA 2MFNA 4NKIH 1IAKB 1LE5A 1XH3A 1VACA 2ZOKB 3HI5L 3RBGA 4G6KH 3SGDI 4ELKB 4L5FL 3VXUB 3FFCD 4MYWB 1KJMA 3CSPA 4Y16D 4JFDA 3STZA 5JPMB 1VDGA 1CL7L 35C8L 5EC2B 1T1XB 5DTFB 3P9MA 4LKXB 1X5IA 3L7FA 4KKAD 1QYGH 4I18C 4KJQD 1SJVA 3HC3L 2NY1C 3H42H 3MRLB 2R69H 5EUOE 1J7VR 4IS6B 3HE6A 2QSQA 4NHCH 3TZVA 3W9EB 3B9VA 3ETBF 5I8KH 1IARB 1IE5A 3X13B 3MLTB 1YPZF 5SV3A 5EO1A 3IXAB 1KENL 2DQDH 1FZJB 2C3VB 3P11H 4BK5A 2KUTA 3CFCL 3HE7C 4CVZB 4ZOEA 4D8PB 2I9LB 2BFVH 2BNRB 1ED3B 4ODBD 4WJ5A 1EHLH 1KPRB 2F53A 3NAAL 4NKQB 5ICZB 1UGNA 4XTRC 2X4UA 3ARGC 3O8XA 5GGSA 3QEHA 1MFEL 4OD2A 5HI5D 4Q9RH 3H3KA 3QUYB 5B39A 5HHXL 1BMGA 1INDL 2W60B 3G5XA 5I75B 1UCBH 1TETL 2P5EE 4TYUA 3BKCH 5DFTA 3P4OB 1NLDL 4YC2C 3HMWH 2BDNL 1BIIA 3GSWB 3GSUA 1SYSB 5HJ3A 4M6NL 2AK4D 5CFHA 3QDAA 3EJZD 3CSYB 3RNKA 5IFHH 1YECL 1S7RA 2A74B 4JPWL 3TN0A 4F58H 3IAPA 1G7PA 4HJJH 3L3GA 4AMKH 3IJSB 4ZUSB 4NQEE 3QDJD 1LK2B 1LNUA 4KRMB 2NW3A 4XNMA 4LRNH 3B2UD 4XWOC 4Y2DD 2XZZA 4PJAE 3PP3K 1E6OH 4WU7A 2BVYA 3P9LB 1OM3L 1RUQH 4R0LC 5KVFL 2VUYA 1F4WL 2C3WA 3CFIC 5CEXB 4PJ8B 4AT6B 5L2KA 5HY9B 2B2XH 5FYJU 1YDPB 1JUFA 4FZEL 1GZPA 3LB6C 4KGJA 4K07A 1CVSC 2NY7L 4JO4L 5D1ZB 5C0IB 4K3JL 5J7CC 4X98B 1FZKB 4ZSOB 1S9KC 3W39A 3SE9L 4R4FH 4KDWA 3VRIA 2R2CA 4O2CA 2H3NB 3C6LC 1Q94A 3CPLA 1Q72H 2DKUA 3JTSB 1VA9A 3MCLL 1LGVA 2VDMH 3OGCA 4XNUL 2Z0BA 3SKMA 3FQWA 1YYML 3QWRA 3SDYL 5T1LB 5FCSH 3PHOA 1R5IB 4O02H 1UM4L 5GSRB 3MO1B 4G43B 1GOHA 4KAQL 1EAPA 2EDEA 4XBEH 4KVCL 2BRRL 3PWLB 2D9CA 3VXMD 4QF1A 1PX4A 1YZZA 3D85D 1AO7A 4FFVD 5C0CA 2GIYA 3ULVC 1OF2B 3IU4L 5ICXB 2F8VA 4H1LA 1RK0B 5J6GA 43CAB 1JJUA 5F9WC 4ZAKC 4ETQB 4KRPD 3UZEA 1YY8A 1U9KA 3RUGB 1KCSH 4ODVH 1CN4A 4HC1H 2IAMB 3T77B 3HR5B 4PJ7A 4HULB 2R2BB 3KNBA 2BY2A 5IFAL 1OAUH 3MSPA 2QADC 3BKML 1S7SA 1QRNE 2AXGA 4MJ5A 4F33A 2Y23A 2A73B 1K8DB 4FFWC 1A6PA 4LHQB 5GGVH 5SWZB 5LCVL 3PIQB 4JQVA 4ORGB 3G5ZA 4NP4H 4XCEA 2DWDB 4ESKA 4EDXA 1UVQA 1LD9A 4OLVL 4C83A 3VI4F 1YEIL 3ZT7A 4JVUA 5DJ8A 3K0WA 3O2WH 2HJLA 3OJVC 3EHBD 2PF6A 2NY5L 1JTPA 2P45B 1BOGA 3VXTB 3F7QA 5L88H 4S0SD 3IF1B 1OAKH 2J8OA 1NMBL 3H3PH 1JL8A 3G5YA 3K80A 2RB8A 1MAKA 2WUBH 4P23C 2HH0H 1WVZA 3SKJL 3QH3A 4Q58C 1OGAA 1MI5B 4OM1L 3RBSA 1T7WA 5FM8A 3UJIL 3G6JE 1FFOB 1WBYA 4OIIH 4DN4L 4N8CH 2YA0A 3HG1E 3RU8H 3TO4C 2BVTA 2FSEB 4X0KA 4Z7UB 5EZOL 4WO4C 5I6XB 1CDHA 4IMLA 3FMGL 4KKBC 4M7ZB 4GKSB 3U0TA 2HVJB 1HNGA 4ODWB 1X5AA 4WEMB 2OXGA 1J1XL 3I3EA 5J11B 5DMKB 3BFOA 4HW6A 5IEKB 1D5BB 2C1OA 1YJDH 2AJYH 4RAUB 1YUHA 1G9NL 2YHGA 4MD5A 3DBXB 3DMMB 5D4QA 1S5IH 5C0DA 1EGJA 4NC2B 4RGND 5MHSE 3GMQB 1JWSA 2P8PB 4V1DE 1RJYA 3CH8A 3VWKA 1WIPA 4Y0GA 2AJ3A 1N3NA 2UWEB 4XNQB 3V7MA 1YEFL 4KHXL 1OP9A 3N85H 5D7KE 5CEZH 2BX5A 1GGBL 5F6IB 3CZFB 5F7EH 4YK4B 1ZWIB 3GI8L 3BKJL 2ZCKL 3NABL 2RQ8A 2Q7NA 4TSCL 5IG7B 4LSTH 4AH2A 3EYVA 4GXVH 4QRQA 3KPRA 4ERSL 2VLJD 1MRDL 5I0DA 4PJGA 1P7QD 1DBBL 5F7WC 4Z8FH 3CXHK 1I1RA 4F37K 4LDEB 3TNMB 3O2DA 2YPLD 2ZJSL 1P4LB 4M3KB 2DMCA 4AQOA 1QLEH 5DC4B 1IBGL 1NMCB 3IJYA 2HFTA 1TNMA 3LPFA 2Z93B 3K74B 2EICA 3NACL 2H26A 3QZWA 5AZEL 2W65B 5KANI 5D5MF 2KPNA 5D2NE 4U7SA 3QUYC 4HIJA 2HT3D 5I75C 4TQEH 4Y4KB 7CGTA 2CUIA 4ZS6D 3NFPB 1KXVC 5DJAB 3U7YH 4AIOA 4Z7OE 1YPZB 2X4TB 1R5VA 1OVZA 1KCKA 3MV8D 1MHCB 5C07B 2NY3B 3PDOB 2VQUA 4ODTL 5AUMA 2G5BB 1G6RA 2DJ4A 5FYLE 1ORQA 4PJ9B 1DUZB 4GQ9L 5DK2A 1NAMB 3KYKL 3RRQA 1G7HA 4TSAL 3QEUA 3RVUD 4AEHH 4KMLB 4C4KO 4PJHE 5I1GH 1OQXA 4NBZB 4LPTA 3CFBB 3WS6C 5I73B 2IGFH 4KZEL 1M05A 2P1YA 3AY4C 3HFML 5FF6B 2XKNA 1L7TL 3L5XL 4GMSH 1C12A 1IEBA 1HWHB 3TT1L 3ZDZE 1NAMH 4DUWA 2ADJA 5KS9F 2P44B 1INQB 4MAYD 4EXPX 5IGXL 2BNUA 3W0WA 3VMNA 5IBTL 2JJWA 4IOFC 3K81A 4X6CA 5HYSA 4PJ8C 1OSZA 3DVGA 3H9SB 4IHOA 1P1ZA 4GRMA 3B9EA 3MRJB 1NMAH 3NCCB 3CDGB 3KG5A 5EU3A 1ZEAH 1AD9A 4NZJA 5D1ZC 1XGTA 5GGSY 1MCCA 3IFPA 5HGHA 1F90L 3ZO0A 5CCKH 4G8EB 4HG4J 4I13B 5JHDB 4MHHI 1U95A 3QO0A 4UDUA 4XNXH 3UEZA 5FYLL 3FT2B 3AAZA 1Q0YH 2JB6A 3PV6B 3I85A 2VOTA 4YHLL 3BN3B 1MF2L 4HPOL 1JN6B 1C7SA 4FQCL 4EDWL 4QY8A 1MEXL 5E8EB 3RJDA 4LSUH 1FZOA 1XR8A 1UWXK 3GSVA 3OAZK 1RIUH 3HRPA 2F5AL 2XN9A 4FQPA 1FJ1A 2JIXD 5DJCA 3L3DB 4XZUA 4Y1AD 4K3HA 3MC0A 1FAIL 2XZAH 4RFOH 2NTSP 1TCMA 1CFVL 2AV7B 5IJKC 1BBJA 1IILE 1CFQB 3GJFA 3V4UH 3PWNA 5EPMA 3CVIL 1QFWM 5TDOB 2EDRA 2GTZB 2XNAB 1V3KA 1HQRA 3CXDL 1FAKT 2OR9L 3V52L 2PR4H 1B2WL 2DQGH 43C9B 2IAMC 4QLRA 3TBTA 3QUML 5CMAA 2LTQB 3VRLF 4N8PA 1A3QA 3KPTA 4WY7L 5EOQH 2X05A 2Y9RT 4PP1D 3P3YA 1ZGLM 5BRZA 3B3IB 1LP9A 1YNKH 1YEDA 3MJ6A 4YHIA 5AZ2H 1A47A 4O4YH 1EXUA 5EORH 1H5BA 3D69A 4ZODA 4WTZA 5DRXA 5CEYA 1EFQA 4MNQA 4WHTB 4ONFL 2YRLA 5FOJA 5EBWA 3T09A 1NGXB 4NQCE 3P4MA 3T4AB 3VW3H 2A9NL 5FHAH 2E7HA 1WBXA 4TOYH 5BS0A 3GMPA 3GMMA 4G8IA 5DEGB 3VXSD 3AM8A 1ZK9A 3D39E 1MOEA 4M6OL 1CFSA 2OZ4H 5F1NB 4HCRH 4XI5C 1I3UA 3D87B 3WFZA 1F45A 3MZTA 5BO1L 3VFOB 4PJ5D 1U8MA 4FQHB 3O2VH 2GUOA 3PWPB 5CJOL 3CFKA 4UDTB 3UTSD 4KK9C 1S9XA 3BW9A 3QIUD 2EDNA 3MUY1 1MLBB 1X5HA 2YS4A 4U1KA 3CH1A 2IH1A 3V6OE 4W4NA 5T5NF 1TTGA 4EI6B 3RTQA 3RWCB 3FZUC 4F7PB 3QG7L 3O41A 5HI4D 2R1XA 2XWJB 3UJJL 4CN4A 4KDVA 2WP3T 1RZGB 1W0YT 1ZHLB 2D2OA 4JFZL 3NIFF 4LEOB 1YJDC 1FC1A 1Q9WA 1A4KA 2FO1A 5CSBA 1YN6B 4MCZB 3CC5A 2R29L 4N8VA 5I6XC 4BSVA 1K4CA 4GAFB 2XWTB 1ZMYA 2UZIH 4JDZB 1F2XK 5JHLH 4L3CA 4M7ZC 3WHE1 4BKLB 3QQ4B 4Z7WF 3DGGB 1FE8H 5IMKA 3TH3T 2XOTA 2A6JB 5J11C 4M9PA 1ZLVH 3QWOB 4LSQH 1JRHL 5F6HI 4K3DH 3QDGE 2VH5H 2XRAL 3TA3B 2CMRH 4NFCA 1MCFA 5BW7A 4K9EL 3DMMC 2XFXB 4JPKL 3VWJD 1ZA3A 5IKCA 3RDTA 1N7ML 1CT8A 4F2MB 3HZYA 1I8IB 2EXWC 2QQKH 4JRWA 4IEFB 4G6MH 3TIDA 4Z0BH 3V4PH 3V6BR 1RJZA 1UG9A 1BM3L 1A1MB 1DFBH 5DEFB 1E4WL 5TDNB 4Z78A 1QR1B 4AENB 3VFVA 1IZKA 4YK4C 1NBZA 1T83A 2FGZA 1I8KB 3TYGH 2IAND 1N0XH 4KK8C 4OGZA 2F19H 3BVNA 4CNIA 1KTKE 3D48R 1F11B 3BN9D 4Z7VF 4BQ6A 1A6TB 1A6VL 3GUTB 3DUSB 4MJIA 2R8SL 4NJAL 1A1NB 1YMMD 1IM3B 4YXKL 1NMCC 3SDCD 5IV2A 2OTWA 4M1CD 2VE6B 1JV5B 3GKWH 4HIEA 5F7HA 5EN2B 1PQZB 3BGMA 1BQLH 4NKDA 4ISVB 4HUVB 5F6HJ 5KVEL 1KTRL 4MGXA 1HOCB 5ESVA 3U4BL 4WFGD 3MBEA 1MCNA 1UZ8B 4IIQA 1AP2B 1IEAA 4Y4KC 1CD9B 1ZLSL 3MLYL 4EN3B 2EYSB 3DYPA 1JGDA 3QIWD 3QQNA 2OSLA 2WSKA 5CJXC 3ARDA 5E9DA 1H0DB 2NY3C 4HFWB 4HUNB 1OGTB 2AJZA 4YZFE 4LSRH 1KCUH 4PJ9C 1QKZL 4K55A 1I1YA 4JHAL 4HEME 2B20A 1F4YH 5H8DA 5C6PB 1Y0LA 4I0PD 5IFJA 1A0QH 4PGJA 2DTMH 3FHAA 5DUBA 3ZKND 5FDWA 5I73C 2AVGA 2WW8A 1BJMA 3C8KB 4HJ0C 2I5YH 3L9RB 3DV6B 5D5MB 1VCAA 1QACA 3ME0A 3OKMB 2O5XL 5F70A 3O6LL 3UYPA 3QXAB 2DLGA 2ICWJ 1NEZG 4L4VE 4HUXB 4GRLD 3HAEG 5KSUB 1UH3A 5CUSH 2J8UA 4ZTPH 3MNWB 3U79A 4NO3A 3SJVD 5FHBH 4MNHA 1OCWH 4G8GE 4WV1A 4ZO8A 4OQTA 1W2KT 3SKOB 2X41A 4NSKB 2AK1H 2F54A 3EYUL 4YDKH 4JG1L 4X9GA 2AJUH 3F7PC 4P2RA 1KBGH 5DJXB 5GS1B 3UYRH 5C8JA 5DYOA 4MQ7A 2G9HA 3P0GB 2IG2H 3R4DA 4DGYL 5L2JB 2XPGB 3GJEA 3SDDB 4W6XB 5J1AB 4OD1L 1FVDA 5FGBC 1U91B 3DPBA 1NGYB 1A9BB 2AGJL 4G9DB 3MNZA 4HIXH 4ODSL 1NPUA 4XPFL 1NL0L 5IF0B 2EEBA 1MCWW 3DURA 1DVFA 2FD6H 4KUZL 4JM2D 1CIUA 1GGIL 2YEZA 3O3AA 4QTIL 1C5BL 3PQYA 4IRSB 4JQIH 4DKAA 4H25A 5HGGS 2WQ8A 5JR1L 1J5OH 4GFTB 2YD8A 3LEYL 5DZLA 4FS0A 1VSCA 1WTLA 3IFLH 3PGFL 1AKJA 1AE6L 1CLYH 5FKAA 2L7UA 3MLSL 2VZ3A 2KBGA 3SKUD 1RMFH 4LLVA 1ZLWH 4YHOL 4XMPL 3DHJA 1CR9L 1FPTH 1EEZA 2J2ZA 3FL7A 5DLML 3EO1B 2NZ9D 3ECBB 5DURB 1U8PA 2LTQC 5MENA 2P8MA 1A5FH 5T33L 2CPCA 4TNWK 5TQ0H 3CDFA 4CGTA 4DGVH 4FQ1H 3HB3C 4KJWC 4PJFA 1FORL 3F8UB 2MQCA 3NCBB 1J8HA 1V3LA 2X2YA 5JMOC 5IW1B 3BAEL 4P9HL 2NY0B 1MY5A 1WV7T 3OG4B 1BZ7A 3EFFA 5KN5B 4OZ4A 4QXTB 3QNYA 1OT2A 4BQBA 1A6AA 3QCUL 3TGXA 3PL6B 4JFHE 1UB5A 2P46B 2HFFA 1E0OB 2EECA 5GGRA 3O6KL 4NKMB 1IQDB 3L3JA 2DBLH 1AD0B 5MERB 4KJYB 4LMQI 2G60H 5IOPB 3GSNA 3WLBA 3JVGC 4QHUA 4JKMA 1GVIA 4BUHA 8FABB 3JWNC 4PRPE 3GNMH 4I3GA 3LKNB 2DYPD 1NUGA 5D7IA 5CJBA 4Q74A 5KZCB 3MACL 5C0AB 3S88H 1ZT4B 5IHZA 1JF1B 3NH7H 2YOCA 1WZKA 3T2PA 3MRQB 3BDYL 4NWUH 2FYYB 3SE3A 3V5KB 1KB9K 1QSVA 3RWIB 1VFAA 1NC2A 3FB7A 4JO1L 2J5LB 4OFKA 4J3OC 5ID1A 1LK3H 1GXEA 1HWGB 1N6UA 3UDWC 4I3SH 4YQXH 1Z3GL 2P5ED 4JQXC 4O9HL 1UXWA 3VFPA 1B0RB 3MXWL 5C08B 1CWVA 4P5MA 1KEMH 5IW6B 4LCIH 1KYOJ 3NCEB 4E41D 3TA3C 2YUVA 3IDNA 1HI6B 1YNTA 1NFIA 3FCTA 2VQ1B 3O9WB 3GSXB 2DLTA 3SDXF 1RPQA 1F4AA 4QGYA 2Y6SC 4NQED 3TM6A 2WWKT 4G6AD 3A6CL 3LS5H 3BD5A 5HHNB 2AEIT 5DMGD 5IIEB 1CS6A 4UAOB 5HHQA 4M7JL 1MH5B 1R3KA 1VEMA 2E9WA 3NVQA 5FXCH 3QPXH 2K7QA 4LARL 4NO0D 4RDQG 4LLUB 5JXEA 1V3MA 3LKRA 5E2UL 4QXUH 4Z7WB 5DHVB 3OXSA 2VXSH 4I4WB 1D9KB 1UEMA 2VL5A 1CFNB 4PGEA 1ZT7A 3O6FB 2C1PA 1AHWB 5JORA 3MPCA 1FNSL 1JP5A 3HPLA 3LKQA 3DUHA 3MROB 3SE4C 1JGEA 2E8YA 3FT3A 4NUGH 5F1SA 2HLAB 3GGWA 4HS3B 4XVTL 3B9KA 3UZQA 1VGEL 1OAZH 5GRUH 4PJ7F 4Y88A 5DHVH 5D8JH 3F7YB 1W8NA 4DGIL 5JW3L 5ACZA 2ZUQB 4U3CA 4JG0L 2B0SL 4ZD3H 2A1WL 3WHXA 4LGPB 4KK6D 3MCKB 5BQ7A 2LAAA 5I1CH 1RUAH 1HHGA 5C0BA 1HHJB 4TPRH 5LXGH 4AEIH 4S1SH 1CG9A 3MRPA 5E8OA 5EOTB 5SWQA 2NX5E 3H0TA 5J9PB 1ZHNA 4M43L 5FEBA 3UPRB 1T22A 2MTPA 4JKKA 4JCLA 4NO2B 2MCPH 4TUOA 5CGYD 3D18B 2YN3A 4EUPG 4EN3C 1JFQL 2F58H 4Z0XA 5T3ZE 2H41A 2JCCA 3UP1A 2FX9L 3NZ8B 4Z7VB 3LZFL 4HWZA 4JFFA 1UWEL 2Y72A 4FQJH 2CRYA 5FO9A 3EGSA 3QEQB 2PYEB 1T3FA 4M7KH 1VADA 1ULVA 3TWCL 2ATPB 5E4EB 2L4OA 4D9RE 2RGSA 3HS0B 5DK0A 1ZT1A 5IVXE 3RX5A 1TZHA 3STLA 4IOSD 3QUZD 1DBML 4Y4FD 4LHUB 5ISZB 3MRCB 3Q3GB 5DUPL 3S34L 4LSPH 2CLRB 2YWZA 1S7WA 4FP8L 1SJEA 5DQ9A 1BX2A 1KJVB 4MS8D 4E42B 4FOMA 1QRND 4C56B 3C2AL 3P0VL 4PRAB 2NQCA 5KSVB 5C1MB 1C7TA 4O2EA 3FQRB 1D5IL 3MGTB 4XH2A 2AJVH 3TLRA 5B38A 4L8SA 3O3BB 4JLRA 2LE9A 2VLLB 3KLDA 4Y5VB 3OXRA 2NLJA 3GO1L 5GS1C 3WJJC 5T3ZL 2ESVB 4KZDH 3WMSA 4HWNA 1VPOL 5D7SH 3SDDC 5E8PB 4XBGA 2HT4D 4RNRB 3V2AR 3G5VB 5E94A 3DRQB 3SQOL 1MNUL 4RQQA 5D1QA 2XA8H 5F1KC 2YN5A 3HNSL 5DJ2A 1U2HA 1K9TA 3I3BA 1YYLL 4PYHA 3O4OB 3S8WA 4IRSC 3FN3A 4L4TE 2NMSA 5I16A 2EIZA 3QJHA 3W11D 2QLVB 2VDOH 3EZ8A 5H2BA 4P2YA 4J6RH 3ARSA 1NGPH 3MGAA 4LGRB 4Y4HA 3A67H 2DD8L 3QT2A 2BNQB