3QG7L

Structural basis for ligand recognition and discrimination of a quorum quenching antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVLTQTPLSLPVSLGDQASISCRSSQRLVHSNGNIYLHWFLQKPGQSPKLLIYKLSSRFSGVPDRFSGSGSGTDFTLKISRVESEDLGIYYCSQTTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ligand Recognition and Discrimination of a Quorum-quenching Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords AP4-24H11 Antibody Heavy Chain
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L01
1KXTB 4UIMA 5K93A 2P8PB 3L3DA 3IETB 4GRMA 3MV8D 5IMLB 1DQMH 1B0WA 3S37H 2G60L 4A2LA 1NGQH 4G6KH 4HBCL 2NLJA 4EN3B 2GITA 3N9GH 3SKOB 5D7KD 5FECA 4I4WA 5ALBL 4MA3B 3NIFF 5DK3A 4UDTA 3QCVH 5ITFA 2Q20A 5T1LB 4NO0A 5I8KL 4HWUA 4EI5D 3BE1H 3HPLB 1IAMA 1VESA 5I1KL 5AWNL 4ZS6C 5BMFL 2WM0A 2DJ4A 3OR7B 3TCLA 5DQJB 2Y1VA 1A47A 2BSSA 1CCZA 4Y5YB 2YD4A 3L3OB 2DMBA 2ZUSA 5MEQA 1G7HB 4PGDA 1DANU 4PB0H 1MFEH 3OXRA 3C5ZC 1H0DA 1TVDA 5EU3B 3PL6B 4HUVA 4S0TD 3L3JB 5D7SH 3EGSB 2WLZA 8CGTA 3KNBA 4GXVH 2QV2A 4YLQT 3DHMA 4XP1L 3QUMA 3T77A 3HR5A 1AR1D 4KKAD 4X80H 3DOSA 2OJEB 3B9KC 4X4XB 2BY3A 4Y5YA 4A2MA 3LEVH 1WJ3A 1FNGA 3HE7B 1CU4H 2IH1B 2VDNH 1F6LL 5BS0B 3ARBD 1BD2E 5MEOB 2HLAA 4KUZL 2I25N 3MSPA 2DICA 5I6XB 4PGDB 5DO2D 5I74B 1UACH 3VXSE 3EHBD 2EDYA 2ZOKB 4IIQC 4U1KA 5EFIB 1BZ9A 3K2MC 5T33H 4XRCB 4P5KA 2V5YA 5I9QC 1AGDA 2ICES 4WWKC 1EAPA 4WTWA 1WCBA 3ROOA 2VTFA 5JHDD 1D5IH 5HYIA 2R2BA 2DQHH 5CILH 1B88A 2VJXA 2W9EL 2APVA 1IT9H 3KPLB 3PDOA 4N0UA 2HJLB 3LRGA 3DYOA 1YJDL 4X6DA 1FGNH 1W8OA 3LB6D 1EHNA 3JWOL 4HX1A 3VXSB 2GYSA 4J7RA 1FNLA 3ZKMD 1QP1A 4RMQA 2DI7A 5C08A 5DMGD 3IETA 1G7IA 2FX9L 4JRXD 2HH0L 4KXZH 3L6FB 5F96H 2IFFL 3FQXA 5KOMC 3CX2A 1MCPH 5ESQB 3MACH 1UC6A 3D1MC 2RGSA 3DARA 4X8XA 1NBZB 1KGCE 2VDRH 2W59A 4PUBL 4K2UL 2V2XA 2CKNA 2N4IA 5FCSH 1OAXH 4HH9B 5GRUL 4P9MH 2WMPA 5FKPB 4GRWE 4X9BA 2WANA 3T0XA 4GW1A 1A6UH 3ILQC 2W65B 4PJ5A 4N0FA 1NGXB 4XC3H 3EOBA 1GGCH 2AQ1A 4OFKA 5IFAL 1PG7X 1HK6A 3OAUL 4JPKH 2QSQA 5C0NC 4MNGB 5JOFB 1ZVSA 4KK8D 3GO1H 5A2KH 4KKBC 1S7RB 3BW9B 1RHHA 3EGSA 3QDMA 2K7PA 2BXYA 5C1MB 1S7TB 3MV9A 4HPYH 1WCQA 1GOGA 3GMQB 4U49A 1DDHB 1NBYA 4HCRH 4NQVB 2GY5A 4B7LA 4UILH 2DQIL 3KPQB 1T03L 4O4YL 4FXLA 1J8HD 1GRWA 3CNKA 3KYKL 2DM4A 2XZCH 3NZHL 3GJFK 4LIQH 4OI8A 3OQ3B 1BX2B 1RZKL 5FYKU 4NO3B 3TC9A 3RUGF 5J8OA 1LK2A 4XVSH 4MXWH 4F7TB 4P4KB 5HHQB 1G7MB 2V9QA 3AUVA 1IC4L 2J5LB 3D0LB 5E2JA 4HKBB 3SGDH 3K74B 5GGQH 4KKLD 1G9MC 2H2PC 5FAAA 1YY8B 4MAYD 1E0OB 3S5LB 3HR6A 1FAKT 1ZOXA 1H8NA 3GIZL 43C9B 4KJQD 2HT3D 2A6DA 1HH6A 2EC8A 4MZ2A 1XCTB 1YEIL 1ZHBB 1D5XB 5FOJA 3CZFA 3O3EA 1S3KL 4OZIB 4HEME 3K3QA 3QCVL 5DRNA 2O5YL 3O8XC 2QLVB 1W72L 5ICYA 1ROWA 2BFVL 1LP9F 1U8OB 3Q6FB 1KC5H 5TJWK 4N8PA 1EEQA 5IVZA 3CXHJ 4M1DH 1EMTL 3SDAA 3F7YB 3PQYA 2ATPA 4AIXA 5C2UB 1G6VK 3U9PL 4G8GB 5E9DD 1XGPA 2NY0C 4LKCA 2X9YA 3DVNA 1MI5B 5KBNC 1WAAE 5ESQA 4K23H 5F97E 3I6GA 4MNQE 4QGTA 4JM2D 1MFEL 1MSPA 2A83B 3KPSD 2LTQC 5E1AA 3D48R 4JDTH 1RJZA 5DJZB 1PX3A 4M7ZB 3GSXB 3GMRA 3QCTH 4QRUA 2HA1A 3KPPB 3D2UD 1JRHL 5DJCA 2YN3A 4FTVB 3I3BA 5D8JH 1KJ2B 3WN5B 4LPTA 5H2BB 4OTXH 2DTSA 1F02I 2UZYB 4CJ0A 5AWNH 4BSVB 4NGHH 5ANMA 3TWCH 3LY6A 4F37F 2R0ZL 3TA3B 1HSBA 1R5VB 3CC5A 4HIXH 1ZA3A 1RJLB 4F58L 2YZ8A 4O9HL 4ODHL 4UOJA 2DMKA 4L4JA 4K7FB 1JRHI 4MD4B 5E5UB 5E2TH 4QRTB 5HI4D 4FQIH 5D1XB 3S37X 4OSUL 4NZRH 5BOZG 1N6VA 4LCCC 3EUUA 2CLVA 5IG7A 4XP1H 3LS5H 1MUJA 3P4MB 4RGNC 4JQIH 4J4PD 3RP1A 5KSBF 1J5OL 1HINL 1H3VA 4WDIB 1ZHNA 1BGXH 3D0LA 1IAII 2ESVE 5SV3A 1M6OA 4FQJH 2V2TB 1XAUA 4AZ8A 5D7IF 4MVBD 1ZLUK 1HHIB 3VXNB 3AB0C 5F7EH 4KUZH 3VXUA 4PJBB 1QZ1A 4XC1H 4XX1E 3R8QA 2RR3A 5HHXL 1FIGH 2A6IB 4JGUA 3HLAB 3SGJA 3QUXC 4OF3A 5KSAD 4PD4J 1GZPB 5MHSE 3RDTA 4WHDA 2ZNXA 2WAHA 1BVLA 2ZOLB 5FDWA 1S7VB 2ERJB 5F88B 5JDSA 1JMZA 5CJQH 4R4BB 3RU8L 4XGZB 3FB6A 4B5EA 3EW3B 3JTTB 4JB9H 3VFPB 2HFGH 5FYJH 1BIIA 1UKSA 4C56E 3AGVA 5SWQB 2BC4A 2QR0B 1U41A 3RA7L 4YDLC 3JWOH 1AHWC 3CFJB 3VXQB 2CDGA 2B1HL 4CJ1A 1U2HA 3K1KC 1W0YT 4D8PA 4AT6A 3RL1A 1EO7A 3SCMC 3ES6A 3P77A 3AS2A 4F7EB 2C7UA 2Z92A 1TZGL 3MNVB 4OF6A 4WI4A 3MMEB 3HZYB 1TFHA 2OQJA 3IGAA 1NSNH 3C2AL 3X3GL 3HUJF 2XFXB 3W9EB 4JFOA 5C8JB 1RZFH 1EVTC 2WUCL 1G9EA 1YY9D 4LVHB 4UI2A 4JQVA 4RGMC 3QDJE 1I8KA 4XC3L 3TA3A 3KYMB 3S34H 5IQ9A 3OHXB 2NYYD 3JV6B 2FR4B 2EDRA 3RWGA 2DQTL 1TPXB 2SEBB 3KYOA 3EYSL 3G9VA 1A2YB 4NQXA 3HMXL 4ZNEE 4RSVA 2BVPA 1UCBL 1H3TA 4LU5H 3LD8C 2X1PA 3EJZC 4YHML 3GSRB 3FFCD 1QLEH 2DI9A 3VWJB 1AXTH 4M93B 5TE4L 3QDAA 2PYEB 3W5NA 5E7BA 3QXDA 4NOBA 4IRSA 1KTLA 2PO6B 4LLYA 2ADGA 2Y36L 1RZKH 2VWEE 4JFXB 1EBPA 4OB5L 3HE6C 3F7PC 1JVKA 2R2HB 4Y88A 2GJZB 2ZPKH 5SWSA 4AL8H 4ZUVB 1NDMA 1PX4A 4LOUC 4YR6A 2J8UA 3NFSL 2IH3A 5D1ZD 5SWSD 2FD6L 2IEPA 2XZAL 4LSUL 2CDFA 4NZUL 5F9WC 5JIKA 2NZ9C 4GG6F 2XZZA 1FSKC 3G5ZA 1OPGH 2FZ3B 1Z3GH 1UYWL 2EKSA 4DZBA 4HUXB 1MVFA 3HC3L 2ZSWA 2O61A 1S3KH 5C0DA 4PJFA 3C6SB 1BHGA 3CLFL 1QSFD 2BNRA 1I1RA 2DWDA 3SHSA 3MV7B 1MLBB 1L7TH 2AJ3B 3C60B 1QYGH 4ZFFB 1ZT4A 4C4KO 1FO0H 3W9DA 3PGFL 1AGEB 2QADD 4HIXL 1VFOA 1ZTXL 3UPCA 3T0EB 5K9QI 1H3UA 1PEZA 1NAMB 4NWTL 1GGIL 4M9PA 2ED9A 5E8OB 2YRZA 1BVKB 5E2TL 3SCMB 5ISZB 2H26A 1YMHA 4FQIL 4NM8L 4ACPA 2O61B 3NFPB 4YHPB 1S7RA 3DECA 5DD3L 4EN3A 1QR1B 1PLGH 5T1LA 1NMAL 3U7WL 4LSPH 4RBPH 3U0WH 3MLWH 1EK3A 3BPOC 1UB5A 4DFHA 2BNQA 3HC0A 5E56A 5I2IB 1MH5B 2XG4A 2Z8WC 1F11B 3ZSTA 3CCHB 1AGEA 2HFEA 3V8CA 3MRGA 3ILPB 1KIQA 4M4PA 3FZUD 3WFBH 1MCOL 1HCFX 3CMGA 5EU4B 3UZVB 2LE9A 1DANT 4R3SB 1T1YB 1CFVH 5I30L 1KN2L 1MHHB 3TEUA 3GRWH 1TXKA 2AJYL 2UVEA 1OAQH 5HGAB 5EU4A 5JW4R 2F19L 2FCBA 3RBSA 1M7XA 3R4DA 3ORJA 1H3GA 1A5FH 1ZHKB 3OPZL 1EZVX 5FUCC 4Z7VF 3AU1B 2VO5A 1V3KA 5C2BH 2YBRB 3C6LA 3HMWH 4NNPH 3QIUD 4RA3A 3RA7H 2HWZH 4YH6A 3EYOB 1OF2A 1W72B 4EVNA 4H20L 4P5TC 4HWBL 4WVRA 1QR4A 4IDLA 1UGNA 1QFPA 3VFOA 5HHOB 1NGPL 3I75B 1WBYA 2A73A 1MCHA 3TCXA 4M9OA 2ZJSL 3LKQB 4WW2B 1FIGL 1BZ9B 2GUOA 4L4VE 1AY1L 1QSZA 2DM3A 4S1QH 3WIHA 4HIJA 2IFGA 1KBGH 4LSVH 3TN0B 2CKBH 2DQCL 2IAMB 3FFCE 5D70H 5D71L 4F7CB 3JV4B 4MJ5A 2Z4QA 1RZFL 4HHAA 2WUCH 3M8OH 5CJQL 5CJXA 2ZUWA 2ITCB 1I3RA 1S78D 4L29B 5D2NE 1KEGH 3QNXB 3FONA 3TNNB 1L0XA 4RISL 1TZIB 3BSZL 4JY6B 3TA3D 2WP3T 1N4XL 3B2VH 4NN7B 3RZCD 4FXGB 4MA8L 1RD6A 4YWGL 5JW3L 4LAQL 2WZPD 3TBWB 2Z8SA 5C7XH 1EAJA 3SDCD 3BISA 3LQMA 4OZ4B 5KSBA 1NCWH 3CFBB 3NFPA 4YHPA 2EZ0D 4TRPL 3PABB 3ZHLA 4Z6AT 3EO0B 3SE9H 1I4FA 4Z0BL 3HA0A 3IDYB 4ZO7A 1OTUC 4L1HA 3BW9A 3NN8B 4YHMH 4QT5A 1SM3L 5TE4H 4JREB 3UC0H 3BEVB 2NR6D 3DVGB 3NAAL 1KENH 2VYRE 4K7PX 4R7DA 3NOIA 1C16A 3NABH 4JKLA 4IOFC 1XGTB 2CPCA 5KTEL 3THMH 3O2WH 4YDVB 4KGLA 5KVDH 1CICB 3MCLL 1FBIH 3JWNC 4R4ND 2DL2A 5DMYA 2NY4C 3WNKA 3BKYL 1MJ7L 3TNMA 3VE0A 3HG1D 1BLNB 4TOYL 1WAAF 1J1OL 4Y4FD 1G6RL 3ECBB 1JBJA 3IDGA 4IRZH 4WU7A 3S35X 1O0VA 3BHBB 5ERWB 2QTEA 4NRZB 5IHBA 3V6OC 5I1DB 5INDB 4KWUA 1FNSH 3NACH 5FCUH 5CBEA 1UCBH 5D7KE 4NSKB 5F6IB 3MRCA 3VDCA 4OLZH 5DLML 3ARGC 3F7QA 1CZ8L 1GH7A 5CFHA 2G2RB 1JGUL 4X6EB 1YMMB 4WI6A 4GG8B 4QGYA 5H94A 3MLRH 3VRLE 5JTWA 2Y4SA 3TIDA 4HC1L 3REVA 3N85H 1EO5A 1EEZA 3MGTB 3FQXB 3CUPB 1TVHA 3IDGB 4LASL 4ZSOB 3RTQA 1AI1L 3VFVA 4LNVA 1PW3A 3HI1B 2XXCB 4P46D 4KI5C 3VFGL 5C9JB 1N59A 3W0WD 2MOVA 4WIQA 5GJSL 4GW4A 3UTZA 2VAAA 4NZTL 4GMSH 4MNQA 2EDFA 4OGYL 4Z95L 1FZJB 3BPLB 3VXME 1EAPB 4PS4H 3GMPA 4WWID 2BERA 4JZNB 5CD5C 5CHNA 1DBKH 3LEXA 4OZHB 3K4ZA 4ZO9A 4ZYKB 5SX4H 3GSOA 3SDXB 4X7TA 2FH8A 7CGTA 4PJCB 4QRPB 4G6AD 1FZMA 4XGZA 3VFTA 1KNOB 2CLRB 5JA9A 1FGVH 5F7WC 1A1MB 3ME0A 1BECA 1I1YA 4WFFD 1DR9A 1CFTB 1IAKA 4WEBL 3QDGB 3ET9F 1A6PA 4ZTPL 1F3DJ 4JM2A 2X4UA 2E7HA 1A3LL 4JFYB 4LLUA 1YEJL 4H5SA 2NY6C 3NIGF 1BBDH 4IRSD 3IXTA 3SGEI 9CGTA 2QHLA 4LP4A 1Q72L 5E2VL 3MLSH 4NCC1 1F3JB 4PRIB 3VRIB 1U8IA 3ZKND 4LPWA 1B0GA 1A6VH 3WUWA 5GGSY 4HWBH 2E7LC 2D03H 3BP5B 4PPTA 3W0WA 2VUYA 5FGBC 5I8KH 1RY7B 3LQAH 1P7KA 2V7NB 3GRWL 4K3GA 5GGTH 3RX5A 2WINA 3RWEA 3BHBA 5DJ0B 4GRLC 1AGFB 1J88A 1HNFA 4OLUH 1HH6B 2A74A 2Z31A 1NDGA 4H5SB 4P4KC 2YWZA 4BH8B 1ZE3C 3PHOA 1IM9B 1TPXC 5D2LE 4H1LB 1CDUA 1NEZG 2D7TH 4U33A 3MOQA 5F6HI 5IROA 1U8IB 4DUWA 2LU7A 3RAJL 1WFNA 1XGQA 3GSWA 4WFGD 4M5YL 3BSZH 4YPGA 2J8UF 1HH9A 5D1QC 2Z35B 1J7VR 2MHAB 1JGEA 3KPOA 4NJ9L 2AGJL 2VLJE 4OFPA 4YWGH 1WIOA 2UWEB 3ULSB 4YQXH 3HLAA 5C0AD 3MBXL 3WS6A 5IBUB 3N1GC 2AV7B 3RUGA 4KKCC 1TLKA 1RZ7H 2G5BA 3AFLA 3AREC 4HAGA 3PGCA 1CU4L 3QG6A 3IJYA 3BP7B 2JJUA 5KOVC 3RWCB 4LSVL 2RJMA 3U30C 2YPVH 5F9AC 5I1LB 4R0LA 3ARSA 2NCMA 2J6EL 4HUUA 4U3CA 1P84J 1CR9H 3AM8A 5JW5A 5E70A 5EO0B 2EIZB 3NABL 1FG9C 3IS1X 1T4KB 1SYVB 3O3UN 4RISH 2X4SA 3BPNC 3MRRA 3VW3L 5D96C 1IAOA 1RZKC 3B2VL 4FQCL 2AS5M 4BUGA 4XCFH 3T0WA 1MNUH 1DUYA 2HFFB 2Y9RT 1GIGH 5F8QC 4IRZL 4L8SB 4Q0XH 3DNKA 5B22A 4ODXA 2BSED 1MCCA 4JZJB 2HH0H 5JW5B 1OAUH 2E6JA 4XNMA 1HOCB 2SEBA 4Y5XA 4RBPK 4X9FA 4Y16D 2J88H 4S1DC 2NY7H 5IESL 1P84K 3H3KA 4K2UH 2APTA 2NNAB 3O3AA 3MRKB 3QPXH 5EBGA 2HTLD 1CLYL 3FQWA 3UTTB 4ODVH 3CXDL 4U1GC 2APXA 5I1GL 3TYFB 1N0LA 1MFDL 1MJJA 3MGOB 4MJIB 4YBLC 3HI6H 1G6RH 4P57A 5CIPA 2NY4D 3C60D 2YEZB 4YXLH 5CJBA 5DURB 5TQ0L 1NDMB 5GJSH 1BMGA 2EYTA 3GO1L 2ZCKH 3CU1A 5J6HB 2XQYG 1K8DA 2R8SL 5L2KE 3VFPA 1Q9WB 1XIWD 1FFQA 2D2OA 1UB6B 4K7PH 4P0DA 1DFBL 1U8KA 3GHBL 4PY8J 4MX7B 5DUML 4L4TB 3ARVA 2P5WE 3O9WA 1IAIL 2EYTB 4E42A 4HCRL 1N0XH 5HHPB 4X9HA 4ELMF 5KVGL 5SWZA 1R0AH 7FABH 3BEWA 4M1GH 3DO7A 2Q7YA 3BO8B 5T3XL 2JJVA 3C6SA 1MLBA 4NO0D 3G08A 5IEHB 3SY0A 4PRID 4YDIH 4TTGA 1QFUL 2JB5H 3DX6B 1OQOA 1IC4H 4ORGA 4POZD 4M43H 5EIIA 4ENED 3VXOB 5D7JD 1ED3B 5EORH 4ZFFA 2AQ3A 5HYQA 5DYOA 2Q8BH 4RAUA 5FO8A 1JHLH 4XBPA 3PP3K 4U1SB 4HZLB 3WHE0 2CRZA 3L3GB 2BXZA 4D0DB 3JV4A 1XGRA 4X7CC 5L0QC 3QULA 5D5MB 2DLIA 2HFFA 4APQB 4U1JA 5C09A 2GHWB 3ROOB 4I4WB 2J4WH 4R90L 1EMTH 3DVIA 4KK5C 3MRPA 3FQUA 3ALPA 4PRIE 3LVEA 1IKNC 3D9AH 5CUSH 5J1AA 3O2DL 1Q38A 2DBLL 3CDGA 1KJ3L 5E94B 1OY3B 1EO8H 1U91A 3NPSC 3WFZA 1FG2A 3IDMA 4C56D 1X6LA 5DC0A 4PR5A 1YJDC 4F9PA 3KYMA 2AEPH 1RIVL 2VQ1B 4IOIA 3FN3A 5B4MC 2FH6A 2DKSA 4YQXL 3H9HA 1LGVA 1WCBB 2VQUA 1AQKH 4LGRB 5CBAB 1CGVA 3TWCL 4JVPA 3G5VB 4M7JH 2BZDA 1MCKA 3VXRE 4PG9B 1AE6H 5BV7H 4PJ7E 4Z7QF 2YPVL 1NAMH 4G8IA 4XNQB 2KBGA 4GRWF 1CD8A 5IIEA 4JY5H 3U7AA 4DGVL 4U1LA 3RAJH 4HG4J 3KPLA 4NKDA 2X2YA 5SWZB 3FO9B 4UTBL 4U6XA 1MCEA 3GSQA 4Z7UA 3I50L 1E4JA 4TUOB 4HW6A 3ARUA 3L95B 1WFTA 2CXGA 3BPCB 1MNUL 4XB7A 3GBLA 1U8OA 4BZ2L 1DUZB 1Q9KB 1YMME 1CVRA 5I1HL 2GSIA 1CIDA 1IGYA 1HQ4B 1U95B 2OXGA 5E4EB 4WO4D 1BX2A 2D4DA 4N0YH 2YD5A 5DEZA 3TVMA 5FO9A 5FYJE 2YN5A 3WXWL 2J6EH 3PJSB 3HZKB 5DYOB 3TYGH 5D2NC 2ZG1A 4RGOH 5DFVC 2BNRB 3U1SL 4K3JH 3U6RA 4ZDHB 1XGYH 2W0FB 3MNWB 3SE3A 2PTTB 3MV7A 4XAWH 1F90H 1Z9LA 1TDQA 5DJZA 4NQTA 2YPLA 3CXDH 4XCFL 3KJ4B 4JB9L 4F7PA 1OB1B 2DJSA 3GBMH 3F7RA 1V3LA 4ZPVB 3MFGB 4FP8L 3QO0B 1I8MB 3LSOA 4ORZC 4QLRA 4XMLH 1UH2A 3DURA 2D7QA 1QFWI 2VWEC 2WINB 2ZCKL 3KHQA 1IQDB 1LD9A 4MWFB 2RHEA 4GQ9H 4RIRA 2LAAA 3E3QE 2X42A 2GEEA 4OCYH 3QIUB 2IMMA 5KVEH 1UWEH 5A2FA 3TFKD 4QRTA 1TCMA 4UNVA 4M8QB 5DT1H 3P9WB 5JOFA 3WDJA 4NUGH 5D9SB 4Y4FA 5E5MB 3T65B 1XCTA 1R0AL 1VFBA 2NTFB 2VZUA 3VDAA 3KAAA 4JR9H 3MRFB 3WIHH 4PRHD 5I75C 4I3RL 3GSNB 2JB6A 3QH3A 2E9BA 3B9VA 4QCIB 1BZ7A 2I5YH 4XCNB 3D85A 4Y5VB 4ZUWA 5KVMC 3V7MA 4ZFZB 5JORB 1JP5A 4TUKH 4F9PC 4RFOL 5E4IA 4I2XA 5D7LB 1URLA 3RTQB 1BM3L 2R2BB 4OAWB 4HIHA 1OLLA 4U6YB 1CDGA 3G5YB 5J9PB 1TJIH 3QUZD 4L4VB 1JCKA 4OLYL 1L9NA 1CXLA 4G6JL 1MLCB 4QRQA 4OI7A 1QLEL 3RGHA 4V2BA 1AXTL 4NN7C 2B1AL 4X6DB 1AIFB 4ZO6A 5E7FA 2H8PA 4QCIA 5GJTH 5L6YL 1R6VA 3SE4A 2VKWA 4DAGL 1AKJD 5J12B 4I3GA 5CAYB 3VGAC 1IQWH 1A21A 4M7KH 4ZUUB 3S5LA 1I9EA 3N1FC 4LCIL 3TJHC 3L7FB 4NWUH 4AT6B 1U3HB 3QZWA 2A6DB 4P3CL 2CKBB 3QXTA 4UIKH 2W9LA 2R2EB 3P9MA 3LKNA 2RIKA 3NGBC 4GW1B 4G6KL 3OAZH 1T3FA 4MDIB 4R2GC 5ICYB 4G3YL 4K9EH 3QHZL 4QOKE 3ZE0E 1E4KC 1QBLL 3KDMB 3QJFA 2BVEA 1P5UA 3TH2T 4X6BA 2HMIC 4QHUA 1RUKL 5DMJB 4JM2B 3BDYL 2R56H 4GUPB 5IR1B 2YUXA 2OL3L 3W11C 2CLVB 5HDBE 4F57H 4QRRA 1HHIA 1F3RB 2R15A 3D9AL 4YDJB 1IAIM 3TA3C 2NPLX 3SPVA 1YQVH 1A0QL 3PHQB 3U4EA 3G6DL 3CX5K 2FJGB 5TDOA 4YXHL 4K55A 4OZHF 1IGTB 1KPRB 3QA3A 5C92A 4LSPL 3MLWL 4S0SD 4Y2DD 1NCBL 2F53D 4P2OA 5KSAA 1QQDA 3TO4A 1U8KB 3RJDA 3TT3H 3FAWA 5EBLA 3FAXA 5KSUB 1GC1H 4JE4B 2DQJL 1MY5A 5JQHC 4AH2B 3LDBB 4OUOA 2JCCB 1J0YA 3VFUB 3WFBL 3IU3B 3BP6A 3DRTA 1I7TB 3OKEB 4ZO8A 5F9OH 5BV7L 1HDMB 1QSEE 3BZ4A 1U3JA 3MFFA 1NAML 3HAEA 3AREB 2IPKB 4AYFA 1FVDB 3QEHB 2IPTH 3DX8B 4JN2A 5EZLB 2NY2B 1LO0H 5DK2B 4JZOB 2PYFA 3KLHD 1DN0A 4M61B 5C0CA 5I73C 2EEDA 3DVFA 1X5FA 1CL7I 3VJ6A 1G7PA 2FL5B 3OPZH 4N0UE 3ZZ1A 1GOFA 4DQOH 3QEHA 4ODTH 4OFVA 1RMFL 2R0LL 1CDHA 4BZYA 1DTUA 1T89C 5LGHL 2ICEB 2VL4A 1ORSB 1EXUB 2VLKA 4YIQA 4FFVD 4L1DA 3RX7A 2HWZL 1K2DA 4RFEA 4JFED 4L8DB 1PY4A 1YYLH 2GK0B 3QQ3A 5B8CC 5IW1A 1XF3B 1A4KA 3LN4A 2BNRD 1ZT1A 1GHFH 1NGPH 1XMWA 5DR5H 4H8WH 5F21B 4PTTB 3STZA 4P99A 1UXWA 4KRNA 1RUPL 4OCYL 5CSZA 5E2UH 3UTOA 1OTSD 1MJUL 4KRPC 1RK0B 1EGJL 1CG9A 4K3JL 4NPYA 2HJFA 2DDQL 5DA0B 4YHNB 3JTTA 3HCVA 4PD4K 2PCPB 1ZA6A 4Z5RB 5C0CE 2YS4A 4NO2B 2ICWI 2JJSA 2FJFB 1ZANH 3O6MH 5F7LB 1SJXA 3RVXD 5D6CB 5DF0A 5KZCB 4NKQB 2CDEB 1TJGH 3GBML 4KKLC 1E27B 1JGLL 1GGBH 2C3XA 4OFYA 4I3RH 1PFCA 2QQQA 4MD0A 2Y23A 1PZ5B 2I5YL 5GZOC 4PRDB 3S36X 1OOAA 1VCAA 3SPVB 4BH7B 12E8L 4CMMA 5DJAB 2HLAB 2VKXA 4LHQB 4KDVA 4UOW1 1AQDB 1HHHA 4LRIC 3NZ8B 2R1WA 2BMKB 3GI9H 5IBLC 1ZHNB 3KPOB 2GY7B 4MAUH 1MJ8L 4OD2B 3NFNB 4PRBA 1BEYL 3D87B 4PJXB 5DHVA 1RVFL 4YR6B 4PRPE 2DAVA 4K8RD 4Q6IA 2XQBL 1A7NL 5D1XC 2ZUQB 3WIHL 5A40E 5KS9E 4CADB 4G9FA 3HZMB 3JVGA 4UQ3B 3UCRA 5KTEH 5IMMA 2X1XR 3FTGB 3TN0C 3CK0L 2CXKA 2V6HA 4MXVE 4PP1C 1EZVY 3AY4C 1YEHL 3FRUA 2J2ZA 1R3HB 2IBZX 4YDKL 5I19L 4OKVB 4KC3B 2PUQT 5F7KC 1FL3B 3EO1B 3R0MA 2UYLA 5I8OH 1BM3H 2P4AB 3V52H 2BX5A 4PJDF 1YPZA 1YEIH 5B38A 2DD8H 1R5WB 3FO1B 3NACL 5FCUL 3WHE1 2X4PB 3BFOA 5FFLA 4EZMA 4KDTC 5TH2B 2O5YH 3QRGL 4LLYB 4LPXA 1W72H 5HYFA 5IIEB 5ICXA 1BOGB 3MR9B 1CF8L 2NLJB 1G6RA 3LKRA 4NNYA 1B4JH 5GJTL 5L6YH 1HE7A 3U46A 1X4XA 2NY3B 3FRPA 3LCYA 3UZEA 4P2OD 4Y16C 5GGUA 5GGSB 4E5XB 1LDPH 2HRPH 4HK3J 4JY6A 2CRIA 3BYTA 4Q9CA 4JFOB 2Y06H 1OGAD 2IBZY 2R1YB 1KLFA 2D7NA 3RJQB 3IU4H 1ZSDB 1QO3B 1WZ1L 5EZIL 3QCTL 1RUAH 2YKLH 4MJIE 3QIUA 5I1EH 1U6AL 3HG1A 5JOEA 3QWOA 1OGAB 2PXYD 4JANB 1BF8A 1SMAA 4R9HA 4I1NB 5E94A 2VLJD 3MRRB 4HJJH 1L6XA 2Q3ZA 4KDTA 5DO2C 4DOHB 1QSVA 4PV9A 3ULUD 3CDFA 3O2DA 2XRAH 1WSST 1PEWA 5LXGL 3EYVB 1KTKE 4FMFA 3QUYC 3UZQA 4EKXA 4BK5A 3RHWK 1QPPA 5DK0B 4HSQA 1DLHB 4KVNH 1IE5A 1FNEA 1X5LA 1ZLVH 3EDDA 3P2TA 3TH4T 1LO0L 1QSED 3DX9B 3U7YL 1FZKA 5ITBL 4Z77A 1FYTD 4NZRL 3BGMA 2OI9B 4WJ5B 2IH1A 3HUJB 1MHPH 1XEDA 4ONGH 3E6HB 2NQCA 3QUMB 5CINH 3IJSA 3SDCA 3T77B 2HKFH 3SJVE 4I18C 4HWEL 2FIKB 4ODTL 4JQIL 1JNJA 3VFWB 5FGSA 4JFHE 5FV1L 2CRMA 3QJHB 5EO9B 1Q72H 5E2VH 3O6FA 1NBYB 1ES0A 1WIPA 2IQ9H 1DQJB 2UZIH 2VLKD 3ULUF 3MRCB 1B0RB 3H9ZA 3JWOC 1IVLA 4LCWD 1FORH 3GK8L 3PL6A 3RIAK 5F7EL 3CH1A 1Q9OB 3F5WB 3QFDB 4XC1L 2BVOA 1GXEA 4L9LA 3ZMRA 2VXTL 2EC9U 1ETZA 2VISB 4AQOA 3VFRB 2IPTL 5F71A 4Z7UB 1KLUB 4U1IB 1C12A 1AFVL 3F12A 3ESUF 4Y8AA 3WDIA 1CXHA 1A7RH 5T3ZD 2OSLB 4ERSL 4NRYB 4BSJA 2L7UA 3ULVF 3O6ML 2QADC 3I02B 1JNHA 5SX4I 2X1QA 2VABB 4LLMB 2HFGL 3A6CL 1JGLH 1GGBL 2BCKA 4M7LT 5HI4C 2V2XB 2M2DA 4Q9BA 3FQRA 4U1NB 1Z5LB 4FQXC 4H88L 2DF3A 5HY9B 1Y0LB 4Q9RL 3P11L 5DWUH 1IC1A 3G5XA 5D7LD 4D2NA 3T1FB 1KCRH 5L7XL 5JA8B 1IC7L 2XQYK 2QBWA 1TZGH 4FQQB 1TCRA 3CFKA 2D0GA 3J7HA 4HH9A 4TULH 4YGVA 5T1KA 2GQHA 5HHNA 5IKCB 3X3GH 3MROA 4L3EA 4MHHI 5DGRA 5E6YA 5DHYB 4P9HC 4R7NA 4OD3H 1A7OH 1S9VB 3P73B 2DDQH 5EH1A 3BYYA 3K8KA 5IQ7L 4O02L 4G7VL 4E41E 1MI5A 2OZ4L 3MJ8B 4P5TB 5CKAA 3L6FA 4U3XA 2XA8H 1F4AA 1Z5LA 2XKNB 1EJOH 1GOHA 5IG7B 2FGZA 4OBSA 4P2OB 4KI5F 4Y4FB 4KDWA 3BWAB 2Q7NA 3VW3H 4OGZA 5LQBH 2ORBL 4HLJA 4P59L 2C4FU 3IF1B 2A9NH 5SX5H 5JPNA 2Z93B 1S7SA 2BNQD 1C16B 4Z7UF 4FQ2L 5DJ6B 2ZKHH 2VQTA 3EYSH 4AM0B 4OCNC 1J0ZA 1AO7D 1LP9A 3RWHA 1CT8B 5TF1H 4LU5L 1PD6A 5BOPA 3HAEG 1FO0A 1BEYH 2VE6A 4JKMA 4GS7B 2VDLH 5F1OB 5FM5M 5F9JB 4DTGH 1XH3B 1AJ7H 5AYUL 2ZUTA 5JMRA 3QQ4B 1CFNB 4O00A 2A2QT 3BZEB 2HVJB 1Z0MA 3PE9A 4YFDB 1ZHBA 5HVHC 2GJ6B 2AI0L 5DJYA 4D9QE 4I18B 4E0RB 4PJCF 4ODVL 3TVMB 4FXKB 2AW2A 2FD6H 2XZAH 1KJVB 2Z35A 5I1GH 4HKXB 5JHDE 5INDA 5DQDH 3OKMA 2HKHH 5IJKC 4CW1B 3WFHB 3R1GH 5I8OL 1DQLH 4FZEH 5C0GB 1P7KB 2GW5A 4PJEA 3OZ9L 3TBYB 4IEFB 4PJIA 2CIIA 1G9MH 1GZQB 4PJ7A 5IB2B 3P9LA 2IAMD 1V7ML 1CWVA 3UBXG 5GRZA 5E6IA 3BP4A 2WBWB 1B4JL 3R0NA 2IAMC 3RPKA 4U3HA 5BS0E 1RPQA 3QUYD 4GAFB 1E4KA 1IZKA 1WWCA 5LXGH 4U6TA 4KK8C 2AK4E 3WL9A 2VZVA 3RQ3A 3VG0H 1U8MB 4OZGF 4UB0H 5EUOA 5GSRB 4DUVA 5LBSL 3WJLA 1CGUA 3RIAF 4F3FB 4YDLB 4WTZA 1I4FB 4DWHA 3AXLB 5GRJL 4U6VL 5KSAC 5HBBA 5BCAA 5ITBH 2VH5H 5DJCB 43CAB 4YDIL 1EIBA 4WUKH 1F13A 1S9YA 2XWTA 1T1WA 2C3VA 1T7VA 1DN2A 3OKLB 1RUAL 1RZIA 2YKLL 5CINL 2EDJA 1FNAA 5MP6H 4KMQA 3UTTE 2A38A 3QQNA 4N0CD 4BSVA 3H7LA 4XPFH 4XNMB 5K9KA 3U9UB 1LE9B 1MI5D 1NCDH 5I17B 4W6WB 1CE1H 1QSFE 3KXFE 4XZUB 4NC1C 2VL5A 1EV2E 3UJTL 5C6PB 1FHGA 4XNYL 4P2OC 4NUJB 2K3TA 2C3HA 3RHWF 4L8BA 1JZ5A 3RBGA 4JFFD 2YOCA 1WAAA 4CNIB 1RJYB 5DRZB 4WHTB 4XNZB 5ID0A 3G6AA 4ZD3H 3CFDB 3PIQB 3DIFB 3MRIB 1U8JA 2MMXA 1JYVA 1IQDA 3FN0H 3G04B 3BD3A 6FABH 1R3HA 3WMSA 3VH8B 1D6EB 2E7LA 1J8KA 4NP4H 1VGKB 1DE4A 4GKNB 3HAEB 3BPLC 4ERSH 4QF1B 5H94B 2OL3A 4DK3A 3MCG1 1D5BB 15C8L 3TJEL 2C4FT 2NX5D 3OKDB 2WUBL 1EBAA 1WEJH 1H9VA 4HWZA 3FQNA 2UZIL 2NY3C 3MJ7A 3GSRA 3S96B 1G1CA 2VZSA 2LVCA 3IJYB 4Q9RH 5IEKB 1TQBB 1NC4D 1JWUB 1ORQA 2HT2D 1NL0L 4CVZA 1HCVA 3O9WD 5D1QB 4RMUA 3T3PE 4P2YA 3O3DA 4JN2B 4FZ8L 2VITA 5EZLA 1BIIB 1A6TA 3FB5A 4CU6A 4R4BA 3GEWB 1UZ6E 2R1YA 1F2XK 5FKAB 3TESA 2X7LB 2FZ3A 5DC9B 3CSYB 4JO2H 4YFLI 4PJAA 5HHOE 3TP4A 4F7EA 2G9HA 3MXWL 5IT2H 2EC9T 2KPNA 4HPOH 2VAJA 4N1EA 2QQNL 5C8JA 4Y1AA 3P11H 3QG7L 4OZGA 5EUOF 3E8UH 3D25B 3PWLA 2DI8A 3RPIA 3ZSSA 3W5MA 3GMOA 3BIAX 4R3SA 5BZWA 4ZS6D 4P2QD 2FBOJ 5E6ID 2H1PH 3VRJB 2EIDA 5I1HH 1I9RH 3BO8A 4QXTB 3IKCB 2CK0H 4MJIA 1AO7E 1T5XA 4Z0BH 3VMOA 4RMVA 3KPMA 3P4MA 5ADOH 1VEPA 1X44A 3TGXA 2IADA 2A0LC 1NC4A 3T4YB 4ONOA 1JUFA 4J3UA 1MIEL 2YZ1A 1CE6B 1TTFA 5HI3D 4ZPTA 4U1GB 1QLRB 2R1WB 5GGRB 2GKIA 3RY5A 3KS0H 2FR4A 4LLWB 3FFDA 2FHFA 3HMXA 5CS7A 3QCUL 1RFDH 4MCYB 4WCYH 4XCEB 1MJ7H 4PJXA 3IDXL 4NT6A 5DK2A 3CSPA 1YDPA 4FP8H 3WKMH 1RZJL 5FA3B 2BK8A 3NZ8A 3MRBA 5D7JA 4XMLL 5DHXB 5CEYA 4OZHE 1T5WA 4OCMC 4X4YA 1G7JB 2DYPA 1MIML 4LVHC 5D2LF 1H3PL 1S9XB 4J23A 4PJXF 3MRMA 3T0EE 2PO6A 4CN4A 2DQFB 5KSUA 1OSZB 3MRDA 4P23C 1WUNT 2CDGB 4J3TA 4M00A 3B83A 4HC1H 1KYOK 5FO8B 1XF2A 1VFAB 3RFZC 3GJFB 1SY6L 4LASH 3T0VA 1D7FA 4WRLA 5C0EB 2ZCHH 5MHSD 2IG2L 2KH2B 4P46A 4QHLB 5F3BA 5F1SA 1FPTH 2P5WB 1T22B 5HPOA 4Y2DC 2PW1A 4YGAB 5JDJA 4HZLA 2DYPB 2EICA 4OGYH 1G9ML 1V7MH 4PS4L 1XGUB 4EJ1C 3IAPA 3WIIH 1IFHL 5T5NG 4HIEA 3LAFA 4N5ED 4UT9H 5MI0C 4XNXL 3W11D 1MH5A 5HI5D 1VPOL 5J13B 5T3XE 5J6GA 4OCSH 2DQDL 3SY0B 5BW7C 5HDQH 1YY9C 1U8PB 5FYJD 3I02A 3X12B 2PTTA 3LN5B 2HMID 1DP0A 1T22A 2D7MA 1NFDE 3ILPA 1IKNA 4BKLB 2H26B 5DJ2B 1S9WA 5ENWA 5J13C 2CSPA 3D3VD 3JBG7 1FL6B 1T1YA 5HXMA 2VH5L 4U7SA 3E1F1 2X4QA 3HZYA 1F4WH 2ADJA 2JLLA 3MNZB 4F33B 4WEBH 2D3VA 4ZTPH 2G75A 1CE6A 2O93L 4KTEL 4HK0A 2X89D 1GGUA 1VADA 5K59E 4UIKL 2A77L 4GJTB 1UZ6F 1I7RB 3ARBC 3W39A 3KS0J 3JV5A 5IP4A 1S7TA 5D1XD 5EFIA 4JGJA 1S8DA 3T8XA 35C8H 1IMHC 3BT2L 3B5HA 3S3SA 5HD8C 1KFAH 3S8WA 1REIA 3WE6A 4MMXC 2AJVL 4X83A 4XP9H 4C54A 1P4BL 1U3YA 4OZFB 4FNLL 4PRAB 4OF0A 3OL2A 3L7EA 1PZ5A 4FQPA 2IC2A 2JK5A 4PJFE 4Z7VE 3MA7A 5TGBB 4EIZC 4I48A 4RX4D 2GJ6A 4GH7B 3H6JA 3P0GB 1CI5A 3E6HA 3HI5H 1HEZA 3K8MA 2R4SL 2F58H 4JFFA 4WW2C 3SO5A 1RUQL 3B43A 4JRYB 1HXMA 1ES0B 1OAYH 3Q48A 3PXJA 1ZT7B 5GSVB 1UWXK 4JJ5A 1INDL 4M5YH 4CDHA 5C0CD 1UADC 2EDHA 4FFWC 5IVXA 1LP9B 1JZ4A 1OAZL 3ALWA 2GCYB 5IGXL 1JHTB 2D4FA 3LKQA 5C0JA 5BRZD 5SWSB 2A73B 1KXQE 1JPST 2PR4L 5BO1H 2AJZA 2P5WA 5EO1A 1ZEAH 1MRCH 1IGIL 1TVBB 2EDLA 3P4OB 2XICA 3QEQB 4M6NL 1F42A 3ESVF 3TVMC 5IHLB 5ADOL 4PLJC 3TV3H 2ICWB 3LRSA 2EE3A 2X4OB 3ARRA 3DURB 1TVHB 2QEJA 4RDQF 3GSUA 5HHOD 3D39A 3SE3C 3OR6B 2X44D 3QHFL 4RAUB 1NGXA 2R23A 2FSEB 3OGCA 5A2IH 5EBWA 3BMVA 3WBDA 4CL7A 1CGSH 4GLRI 1OW0A 1BFVH 4APQA 2VDKL 4P2QB 4OIIH 3ARED 3OJ2C 3O4LD 5FK9B 1XT5A 4K3DH 4YPJA 3ARQA 1NJ9A 1GC1C 3OKOA 1WVZA 3KLHC 5KANG 5MEPB 2ZCLL 3SE8H 5TFSL 1TCRB 2OXHA 1HHJA 4I8DA 4P2QA 5ANMB 4YAQB 2AERT 4HT1L 3QIBA 1I9RL 3GIVB 1T83C 5KN5B 4ZXBC 5CEZH 3L3IB 3D39B 3O6FC 4PFEA 5K9JH 4XP6H 1NCAL 4LQFH 5KAQF 3WS6C 3ECBA 3H3BC 4OD1L 4WY7L 1QVOA 4LCYA 2NY0D 4R97B 3D6GA 2COQA 2FJGA 3C08L 5ETUB 4QTIL 5HHMD 2P5WD 4JY4B 4OT1L 3V8OA 1A7QL 1QNZL 1QVOB 5DZLA 2XZQH 3NCBB 2VZOA 2R4RL 1LEKB 1YUHA 2KUTA 5TGBA 4RWYH 3GMMB 1OGTA 4L8CA 1E28A 2L0DA 5EUOE 4ODWB 1Q0XL 4S1SH 5KN5A 3HI6L 1FPTL 1ONQB 2AXGA 4XAKD 2YUWA 4G8IB 4XNQA 4P2QE 5DDHA 4XWOC 1CGYA 3U82B 1W2KT 3Q1SH 5C9KA 2YXFA 4LMQI 1DEEB 1CFNA 4YXKL 2NY6D 1MI5E 3ZLQC 1WV7T 3UDWA 2YHGA 3QI9C 3RKDC 4G8GE 4DUXA 1KCKA 3MUY1 3PDDA 2XV6B 3V5KB 1RZGA 4FXGA 4XNXH 5EZJB 4BA8A 4WO4B 2AV1A 4WNQB 1PYWA 4HKXA 2HN7A 2DQDH 4EDXB 2R0WH 2OTUA 4ZXBB 1MAML 4PJ8C 1A4JA 1ZVHA 4ISVA 3PXHA 1TTGA 3GSWB 3GMNB 2IG2H 5CKGA 4HWZB 4RMSA 4K94L 1BQSA 1N6QL 2UWEF 3DRQA 3CK0H 2FJHA 3S6CA 3DTXB 5DJ8B 4NQSA 4O58H 5DSCA 4FQ1H 4H1LG 1H15B 5EBWB 4AMKL 1R3JB 5GISH 3BKCH 4PTTA 3STZB 3V6ZA 1MWAL 2W91A 2Q1EA 2AVGA 2VR5A 2JIXA 3FFCA 2Y5TA 2X70B 1AXSB 2CUIA 2DD8L 1P7QB 1DQTA 1CG9B 5I75B 4LAJH 2W65A 4WW1A 3O0RH 5DMIH 1KB9J 3SGJC 3NCCB 3BGFB 2JE8A 3VRIA 4Z7VB 3NCEB 4LBEB 1DQQA 1MRDH 4Y19A 4XZUA 4WEUD 4L4VD 5F6HJ 4Z7WA 2R4SH 5CBEB 3L3IA 5H2BA 3OJMB 2C1PA 2EH8L 2VDML 4MA7L 3STLB 4ZUTB 1P69B 1ZWIA 5B8CB 1KULA 4PRHE 2EYRA 3MFFB 2VR4A 4NC1E 5C0IA 3RIFK 3F6LA 5EZIH 3PQYE 3ZKMC 1MCFA 1CDBA 1IEAB 3IU3A 4RMWA 3O41B 1H3WM 1RIVH 1NGQL 5GRVK 3MJ9A 5FB8A 3V79C 2ZG3A 3WIFA 2C4XA 4N9GB 5EN2A 3KWWA 2IQAB 1J1PH 4G6ML 3P3YA 5JUEL 3WFDL 4X9GA 4LCUA 3EDEA 1LWRA 3LPWA 4QOKB 3UTQB 4GKSA 1MRCL 3I85A 3BPOB 5TDNB 3HNSL 2C9AA 1MFAL 3D2UA 1KJMA 2Y72A 2DYPD 3ARWA 3MLVH 3VWKD 1DVFA 3EHBC 3T0DA 4R26H 2YEZA 4OZIF 5CP7B 1MJJB 3MGOA 2HTKC 5EWIL 5F89B 3O3EB 3RWEB 3RZWA 2FB4H 5FB8B 2PETA 1MHPL 5E99H 4DW2L 3DI2B 3RDTD 3JTSB 5FKAA 1AQDA 4KK9C 3GJEB 5CGYC 1Q94B 5D7SL 4X99B 4KQ4H 1KTDB 5JO5A 4LSTH 4ISVB 1CDYA 1KJ2L 1YEFL 5AD0B 4WUUE 2ESVD 5TFSH 2E9IA 4GG6B 4K3EH 2PR4H 4XMKH 5BO1L 1M05A 3GK8H 3PGDB 1IGIH 4OZGB 2CGRL 2VR9A 1OD9A 1EJ6A 1YYMH 4WO4C 1MWAB 4LFHG 2BDNH 2HRLA 4PJ7F 1S78C 5IVOA 4IRJA 5C0BB 5D7LE 2Q7YB 3UYOD 3W9DB 5ACZA 1YNLH 3EYUH 4PJBE 1YQ2A 1VEMA 3TYGL 4ZUVA 3W82A 4KU1A 4ORGB 4F7MB 4OLXH 4CVWA 4QTIH 3GMPB 1FFPA 4WW1B 5T33L 4UZGA 4Y0GA 3T09A 2VXQH 4JG0H 4NQEB 3SKMA 5B3JF 1CXKA 2P5EB 4U1MA 4RWYL 4HS8H 4ZTOH 1KB5A 5JXAL 4Y4HB 4M7ZC 1T5XB 1IT9L 1W0VB 4NRXB 5DD5L 3IYLW 3V4PH 1YJDH 5FA4A 1EFQA 3MUZ1 1R3LA 2ILLA 3T2PA 2GJZA 4WI9A 5C0IB 1CFTA 3U30B 1X6NA 3RTQD 5L7XH 1F4XL 5DMKA 4GQ9L 1K4DA 1IEAA 1D5BA 1V3JA 4LVEA 4XCEA 2VDOH 3C8HA 4LVOB 3GMLA 1MHHA 4G8EA 4U0RB 4HXAL 4LLWA 1VACA 1CDJA 1K6QL 1N64H 5HHME 1KF9B 1N7MH 1NC2A 1FYHB 3MV01 1T0MA 1JPGA 5EN2B 4NQDD 4W4OA 3Q6GH 4Y2DA 3RNQA 3UTTA 1DQDH 1A2YA 3VFNB 3ZT6A 1X3DA 4M6OH 5IMOB 4PRHA 4LEOB 4YNYA 4DCQA 1OSZA 3MRDB 3IDMB 5C0BE 2YD6A 1QA9A 1NGWA 3MRMB 5TQ2H 1ULVA 4B7IA 1R3KA 3BVNB 4GLRH 4WWKA 3FB8B 4OUUA 3QEQE 3HNVH 3REWA 3DMMB 3PQYD 4BJLA 2NY5C 4ALAL 4MS8C 1OM3L 2X4SB 5E8DL 2AK1H 3C5JB 3CU7A 3O9WB 5GHWH 4OZIE 1XF2B 4GMTL 2H3NA 4IIQB 4PREA 1QR1A 1UJ3A 2A6KB 5C07E 3EKCA 1CN4A 4U1KB 4GRLD 5SWQA 3WKNA 1AJ7L 5AYUH 4WFHD 4WW2F 2DLFH 1QLFB 4XHJC 1YN7B 3E3QC 3ES6B 3P77B 2YPKB 3VU2A 2Q6WB 3NZHH 3QJHA 1WBZB 3WFEH 3DGCR 1S7WB 5C0BA 1ED3A 3BDBA 4GBXC 2FGWH 4M7KL 1PDKA 4AG4H 4XI5D 3VDBA 2A1WH 4ZS7L 4NWUL 1ERNA 1G84A 1WFUA 3JWDH 1T04A 4IRSC 1FL5A 4PJFB 2EXWD 1MHEA 5TE7H 4APQC 5LVEA 4OZ4A 3G6JB 1BWWA 2P43B 5L9DL 2NXZC 5EA0L 2I07A 2HG5A 1GCFA 4CVXB 3KPRA 4TVPL 4Z8FL 3QAZC 2YC1A 1I7RA 5D1ZC 3IJSB 3HZKA 3SDCB 5JUEH 1X5AA 4TSCH 3NH7H 4PGEA 4R2GD 3V2AR 5JW4N 4PB9H 1E4XI 5IK3B 3DXAE 1HHKA 1WBZA 4LRNL 3VWKC 4GRMB 4CUCA 1BREA 5BV7B 4JLRA 3U0PA 1FZKB 1RSFA 4FFYH 1YUHB 1LEKA 3HNSH 4L8SA 4AQ1B 4QYOA 5IWLC 1MFAH 1T66D 4NQXB 1K8DB 5DRWA 3WJJC 2O5ZL 4MJ2A 1TZHB 3RVVC 1XF4B 4XP4H 3PWVA 3P4LA 4PG9A 5D7IA 1BQHB 5HJ3B 3UTSA 2FB4L 3DXAA 2ZSVA 1N8ZA 3IVKA 3DUSA 1DBJL 1MFBH 3DBXA 3V5HA 4AEHL 4RFNB 1JI2A 4P46C 5TPWL 1YEFH 3IDYC 1TNMA 4WWKB 4DGYL 1WT5C 1NLDH 1X5JA 2E27H 2ZZUT 5BXFA 5I1IH 2W9DH 2WWMC 1G0YR 2PW1B 2R29L 4YHKH 4HF5H 2ZWLT 4C56B 1PQZA 1UKTA 5CZKA 4EBQL 1RUMH 1TQCB 1KELH 3MRHB 4G8GA 1UQSB 3B3IB 4O9HH 4F58H 5EIVA 4E0RA 3DUSB 4KMTH 4N8VB 3BQUD 1FFOA 4R8WH 3SQBA 5AZEH 4Y4KC 5B3NA 3V5HB 1X4ZA 3I75A 1PQZB 3MR9A 3TT1H 2W07A 4DW2H 5HYSA 1I75A 5BXFB 4M1CC 4FQXA 1X5HA 2X70A 2IPUK 4JFZH 1X5XA 3DO3A 3HE7C 5TE6H 3TPKA 5BQ7B 4DKFH 2GJ6E 4C83B 4OZIA 1ZS8B 2WBJB 3GI8L 4HMEA 4LHUA 4LSRH 4NBXB 2AV1B 4WNQA 3HRZA 3QIBD 2EE2A 1WZLA 3TBSB 1EHXA 1GVIA 2YPLB 5IB3A 2E9WA 2YD1A 1MAKA 4HFWA 3SEPA 2B20A 3E2HC 5DJYB 43CAA 3AMKA 3DRQB 4UOW0 4ZDHA 5T1KD 3TBWA 2IBGA 3HRPA 5D1QD 4X6CA 5IHZA 2AJXH 2HFEB 4RRPG 1C08B 3EYQC 2F9BT 3QO0A 1VGEL 3A6BL 3MODH 1LE9A 2CR3A 4YHYB 3C9NA 5EC2B 4R7NB 4OCXL 4KV5E 3T3MF 2R9HD 4X6BB 4NYLA 5ANME 5C6TH 4MB4A 4M48L 4G7YL 1EUUA 2B1HH 4FTVE 1NUNB 1I7ZB 4JG1H 1V5JA 2JCCF 5E8DH 2F8XC 4L5FL 2AXGB 3GSQB 5GHWL 5I1AA 2ITDA 3BEVA 2EDOA 3CLEH 2LABA 1OW0C 2A74B 1NSNL 3C2AH 3O8XA 1OGTB 5T3XD 1U92B 3QDGD 2XPGA 2WBKA 2XQBH 1NANI 4X7FC 2DN7A 3CH1B 3KPRD 2HFTA 4CU8A 4JPIB 4MS8D 4HLZG 3OGOE 3W2DL 1U3HC 4URTB 4PLNC 4YO0A 3ZDXE 4MNGA 3VD3A 1YEHH 1OHQA 5I15L 3C5ZA 2A6JB 4PGBA 3B3IA 4YHLL 1U8HA 2VC2H 4KUCD 3QIUC 3I2CL 3S9DB 5I66B 4OCRH 1J0JA 5H35A 3T2NH 1C8PA 1U8NB 2I60L 3E2HB 3V6BR 1XGPB 1I1YB 1AD9A 4TUJB 1FVDA 2XWBA 4FQHB 5C07D 1A1NA 3HMXH 2E9JA 4JM2C 1A6TB 1EX0A 3UO1L 1RIHL 2UUDH 1FQ9C 1U0QA 4GRLA 4LRNH 2H2SD 3QUKB 2R2EA 3ZL4L 4D0BB 3V4VH 4BELD 5M7QA 1MVUA 4JN1L 3C5ZB 3HRZB 1JWMA 5CCKL 2Y36H 2CK2A 4ZUUA 5I1KH 3FQNB 4JZNA 4Q6IC 3O8XD 1E4XH 1YY8A 1T20B 1UA6L 2ICWA 3LRSB 2OMNA 4KTYA 2DS4A 4LP5A 5D9SA 3RPIB 3WS3A 2HT3C 4KAQH 3VI3F 1DBJH 4Y7MA 2C7UB 4LF3A 1SYSA 4KPHL 4ODUB 4R7DB 3O4OB 3S37L 3IFOB 5F1KC 3L1OH 4YX2L 4X6DF 4MAYC 5FGCB 1K4CA 4ZG1A 2OP4H 1WWWX 5ALBH 4NFCA 3Q2CA 3G6AB 4MNGE 5I1LA 3I3EA 4LSQH 1NLDL 4XNZC 4F7PB 4MAYB 4X4ME 4PGCA 3VG9B 5GZND 4IJ3C 1J87A 1JV5B 3MGAA 2FHCA 4X80L 3CMOL 4PP2A 3TNMB 5FOBB 1QRNA 2BJML 4JREC 4LCCA 4UT7H 3DPBA 4DOHE 2P49B 3PUCA 4POZC 3PV6A 1CVSC 4PGJA 5I1DA 3LV3A 1D5MA 2OCFD 2VLRD 3NGBB 1BP3B 5AZEL 3F7VA 2DWEB 1F4WL 4NSKA 3ZHKA 4AEIL 5BVPL 5L0QB 2VDQL 4NQEE 4OIBA 2OTWB 5BZWB 4X5XB 1PLGL 3O4LE 3IKCA 1HWGB 4G9DB 1SJVA 4JFZL 1MCBA 4PJCE 4QRPE 2NR6C 2IQ9L 5CIPH 3W0WB 1M6OB 4ETYA 5EUKA 1IGCL 3PHOB 2FDBP 4GKSB 1KJMB 1JF1B 4LOUD 4QF1A 3ISWA 4HWNA 3JTSA 3CH8A 3BRDA 4V1DE 4MXQC 4X5LA 4ODBD 2F5AH 1PG7H 1MCOH 2VXTH 2GJ6D 4JFDA 1U3ZA 4F8QA 1UVQB 4Z76A 2EZ0C 4KJYA 3T0EA 3O11A 3TPUB 4IRJD 4L8DA 2HYMA 1WC7A 4R8WL 5EOTB 1IARB 3K1DA 3EJZD 1NANH 5D7LA 4RDQG 3DV6B 3LQZB 1F58H 3VXNA 1U8QB 5EZOH 1TQBC 1JFQH 3QEUB 1MHEB 5IMLA 4LEXL 1INDH 1BFOB 5IMKA 3EFDL 4P9ML 2X4TA 4K3HA 4HIEB 1T1ZB 3TZVB 4OFYD 1UZ8B 3TLRA 1YC7A 1G6RB 1T89A 3LKRB 4QRRD 3C2SA 5C86A 2MQ0A 4YE4L 1QBBA 1IC7H 1PSKH 5E08L 4LF3B 1ZVYA 4UMGA 3C87A 4JG1L 2X1WL 3WS3B 2J6EA 1F2QA 4O5LL 1W8NA 4PJXE 2A83A 2EDXA 3SDAD 2ZJSH 4B53A 1ZAGA 5CSBA 3MLXH 2NW2A 4PRNA 4XXDB 3AM8C 1A7OL 4NRXA 5EO0A 4NFDA 4G7VH 1J10A 1WICA 2AJSH 2AJXL 2OR8A 3CVIH 5I18H 4U2YA 3BIKB 3MODL 1JIBA 1SBSH 3ARDC 4LSDA 1F3DH 2NW2B 4PRNB 4XXDA 3UEZA 2VDKH 3S98A 2LU4A 5IJKA 1OP9A 2H2SC 2VXVH 3L3JA 2ADIA 2PYEA 2JJSC 4Q2ZA 1IGJB 3AAZB 3FO2A 2A9NL 5DEGB 1A6WH 3B9KD 1NBVL 3DJ9A 5F7YC 4CMMB 4EUPA 3SE8L 4F9LC 1AKJA 5HSFA 5DFTA 1HIML 4MDJB 1HHKB 4YK4C 1I9IH 5C0CB 3TBVB 3K81A 1J1XH 3MRNB 3UYRL 1JPGB 4ODSH 3G6JE 3KJ4C 1XGQB 4MQXC 4QWWD 2PO6D 1HXMB 5HI3C 1K8IA 4EUPH 3FTGA 4N8CL 2Q86A 3RVUC 4NRYA 3UP1A 5E9DA 4WDIA 1L0QA 3MYJA 1UVQA 2PKDA 3FT2A 4AH2A 1LO3L 2CLZA 3QNZB 3FO1A 4XPAH 4UU9A 3M1BA 4MZ3A 2W0LA 4U1NA 1YZZA 3T4AA 3TO4D 2UYLB 4KHXH 5I15H 1B4RA 3PWPD 3ULVD 4Z7UE 2EDQA 3I2CH 1N5YH 5DQDL 5HHPA 5ADPL 3PWPA 4QHNA 5DD1H 3RWIA 3FT2B 2BVOB 1GL4B 3F58L 4RGND 1S9WB 5E9DE 5E8OA 1UM4H 5I8EA 2H32B 5E5RB 4ZQKA 5EIQA 4ZFOB 3CIQA 4LNRB 5GS1A 1NBZA 1LEGA 4KRPB 3T0ED 3PL6C 3D3VB 3ARDB 4BFIA 2QKIA 1CZ8H 1C08A 5GPRA 4QO1A 4UQ2B 3QNXA 1CFBA 4HS6A 5C0DB 2VQ1A 5FKPA 5E8EA 3AS3A 1SJEA 1YEKL 1FL5B 4YBLB 3ARFA 2F74A 1D5ZA 4OKDA 2NZ9D 3O81A 4CGTA 1H0DB 1DLFL 3WNLA 1CICD 5C0AB 3OKKA 5DVLA 1Q0YH 5IB1A 4JHWL 4PTUA 5AAWA 1T1XB 1P2CA 5IFHH 4AMKH 2NY3D 3E6FA 2VERN 3KXFB 3L1OL 3T2QA 1F6FB 3MLUH 2YSSB 5MENB 1J0KA 4NZTH 2BSSB 3FCTA 4Q97A 2X4RB 2FJFA 2B7DT 4YHZH 1NAKH 2X4OA 4BQ6A 3D85D 1RK1B 5IJVA 1Z6JT 2XN9E 5JLZA 4NQUA 4XNYH 5F9JA 5JOPD 3IAGC 2N1KA 3KR3L 2H6PB 4HUWA 2CMRH 2XWJA 2F5AL 3TM6A 1MAJA 2BJMH 3H2WA 4JPVL 5T1MB 4RMRA 5D7JB 3FO0H 1JMXA 3FN0L 1UJ3C 2PW2B 3GBNL 1FGVL 4PGBB 1W72A 4I0PC 5JIIA 4AEIH 5HYJD 2EKJA 1RULL 4MA7H 5HPMA 4KJQC 1G7MA 3C09C 3C6LB 4DGIL 1KN4L 1KOAA 3DUHA 4EN3C 5KVFH 1G0XA 3LRHA 5J3HC 5FUZL 3G5YA 5J9PA 5AAMA 3MV7E 4PRPA 4J3SA 5FYJL 4DZ8B 2P5ED 2IF7A 4GG8A 2D03L 3N0PB 5EIIB 3MO1B 3NCYS 4Z0XA 3UYPA 2HT4D 3FRUB 4X6DE 5F93C 4MCZA 3V7AG 3DV4A 2BCKB 3IS0X 2GK2A 2MWCA 1DEDA 4M6AA 2BVQA 4NQCB 3EAKA 5I8EB 4XWGH 2VLLB 2W0FA 4FABH 1AP2A 4L9LC 1N2RB 1M7DB 2I9LB 2AJUL 3MLVL 2OSLA 1UWGH 5IHUL 3VFMA 3G5XB 4P3WA 4MA3A 4LLQA 5IB4A 1KLGA 3WXVL 4LGSB 4PJGE 3OKMB 2R69L 4DVRL 2WK2A 4UTAL 3PHSA 1FAIL 2DKMA 1JHTA 2MCPH 2V17H 3MXWH 5KS9B 4IJ3B 3RU8H 4PRPB 1P6FA 4K7PY 3PWUB 4QT5B 5C0ND 2HT4C 4Y19E 1F4HA 1P4IL 5KS9F 2B0SH 4MNQD 1NBVH 2F53E 4LSTL 4MWFA 3KPSB 4M6ML 5I1CH 2AGJH 3HS0A 3LS4H 2A9MH 2H1PL 1VADB 5FK9A 1HSBB 2CGRH 3WLWD 3GSOB 3SDXA 1JPFB 2BDNL 2FO4A 3MLXL 3UYRH 5FXCH 3NN8A 3Q3GB 1D5MB 2DQTH 2FSEA 3OGCB 4F8TA 1EA9C 4XCCL 1YNLL 2UZXB 2V7HA 3BD4A 4AEEA 1D9KD 4GAYA 4AM0A 3OAYH 3J8F7 3QDME 1B0RA 1T2QL 4NQCD 3MV9B 2EYRB 4J4PC 3T3PF 5ITFB 1XF5B 2FEDC 1A3RH 1FO0B 4LKXA 4XXCA 5DMGC 5E1AB 1A3QA 4LVNB 3ZDYE 3P0VH 3KPRE 1MLCA 2FYYA 4QRQB 5DVKA 2YA0A 1LO2H 4G5ZH 1JZ6A 5T1MA 4OM1L 4KVCH 4LARL 2NTFA 4RQQB 1KV3A 2NX5E 4WEMB 3WKML 1RAMA 3NCJL 5IVZB 3NFSH 4U2ZA 4LSUH 3U4AA 3PIQA 4DN3H 4Q0XL 1RJYA 5DRZA 1F4XH 4ZFGL 1ZT7A 1B3JA 1B90A 1RJLA 4NKIH 4P23D 4PJ9D 1A1OB 3PWJB 3L95A 5SX5K 3NTCH 4Y4KB 4TUOA 1BBJA 4TUJA 1F6AB 2GCYA 3CUPA 4JQXC 1NGYB 2AEIT 1WK0A 3LIZH 1JNLH 1CICC 2DOCA 4ONFL 4WI2A 1LO3H 2P24B 5C0BD 2DQGL 2RAMA 1L7IH 4MQ7A 4UAOC 1RURL 2BY1A 1G7IB 1QG3A 1BLNA 1CLCA 3AVEA 1ZTXH 1CL7H 2JJTA 2XWBB 4FQHA 3QUML 3ULUL 3F58H 5TQ2L 3NA9L 4UV7L 3GMRB 4QRUB 1LEIA 3P30H 1BQLH 1NPUA 4EDXA 3FQTB 3S4SA 2JCCA 1S7XA 5JIHA 3F12B 1SQ2N 4LKCB 1U8MA 1D5XA 3C5SB 5BRZA 3LEXB 3TVMD 1NGZA 1X9QA 1Y18B 3O3BA 1FVEA 3OAYK 4G8GD 4XB8A 4X4ZA 3VXRA 2DM7A 2GTWA 1OP5K 4HV8A 4QHKI 5CD3B 4TNVF 2VXSL 2AK4D 3AXLA 1I8LC 4OCSL 3ZKQD 5HDQL 4XP5H 1CGTA 3MRLA 5IFJB 5JQ6H 4NWTH 1F3JA 3PWLB 5EPMA 1J05A 2J8UE 3QRFM 3RVUD 1IM3A 4TPRL 3WJLC 1YDPB 4AG4L 5CMAA 4YUEH 3CSBA 3RI5K 3RKPA 3VRJA 3O4OC 2F54D 3MLUL 4JY4A 4QWWC 1AGBA 4HMCA 4TSBL 2IPUG 5KVFL 5TE7L 4K94C 4H0HB 4XBGA 4YHZL 4QRRB 5FUZH 5ALCH 5IM7A 4NN6B 4D94A 1KFAL 5A1AA 1TNNA 1JV5A 1S5HB 2ZUQC 4FOMA 4OF5A 4WHYH 5KANI 2WIIB 4TSCL 4ODWA 4XPTL 1CFVL 3TO2B 3VA6A 1VFAA 2B5IC 1I1FA 3KYNB 3VGAB 3ZE1E 4U7MA 1WLHA 2ADGB 3X11A 2HTKD 4R90H 3ULUC 3FB8A 5F3BB 2R2HA 3BUTA 3MCKB 3ZHDA 1VFMA 3GJEA 5IOPA 2B4CH 1NUDA 4MNHA 1YNKL 1MUJB 3HE6D 2CKBL 2DQCH 5GS3A 5HYJB 3TO4B 3RY6C 4LK4A 1JWUA 1UCTA 5F44A 4JCMA 1JWMB 1TETH 3MV7D 1A6UL 5AZ2L 2Y6SD 4MNHB 5IW3A 2YWYA 1LDSA 1KEGL 5I73B 1NC2B 4JFQA 2X7LA 4Z78A 3AS0A 1LQSR 5F3HB 3LS4L 2Q86B 3X11B 2QHRL 5ICXB 1MF2H 3F62A 4DEPB 2R29H 2VSCA 5IQ9B 1Y18A 3G08B 1T1ZA 4JQVC 2EYSA 4RFNC 3SO3B 3SE4C 4UAOB 5ILTH 3I3DA 4M7JL 2DQEL 1KELL 1ZT1B 4U6HB 4PJ8B 1G9NC 3CVHB 4OQ1A 4A6YL 3K46A 5E03A 3HPJA 3ARTA 3IXAA 1MFNA 2R69H 4DVRH 2VSDA 1OWRM 3VFSB 2AABL 3DX6A 3VMNA 1BFVL 1YEGH 4JAMB 4RWHA 2EE9A 4QXTA 3UJIH 5CZVL 5C09D 1MELA 3KYKH 4UTBH 3INUL 2H32A 3P0VL 1RZ8B 4IRJC 3UC0L 5CEXB 2XA3A 1KENL 3NAAH 1YPZB 1RK1A 4QRRE 1N4XH 5ESVA 5HVGB 1D5IL 2Z91A 5DMKB 2LAGB 4OGAD 3THML 3MMEA 2W9EH 4Z7WB 4MXQD 5EULV 1FBIL 2DLTA 4MA1C 3BZFB 1AH1A 3IJHB 5EU7C 1NFIA 4BZ2H 3L5WA 1ITBB 3NFNA 2OR9H 5MENE 5DD6B 2XWTB 1UWXH 3TYFA 3HPLA 1OT1A 3V0VB 1J1OH 3PHQA 3OB0K 4NKIL 1TZHA 2FX9H 3UPRA 2IFFH 5ESAA 1KIUA 3O3AB 3HZMA 4UQ3A 5I76A 1FNSL 3A67L 4GW5A 1A14H 4LL9A 5C6WH 2VB5A 4OT1H 1J0HA 4HK0B 4PGCB 1L7IL 4PJ8D 4QEGA 5KVDL 5SWZD 1ZK9A 1VGEH 2AEWA 3KNBB 5DTFB 3UAJC 2VUOA 2X09A 3D3VE 4NT6B 3SDYL 4PJBA 2A6IA 3N85L 2EIEA 4OZFA 2X4NA 3U9PH 3WSQL 2RCSL 5EOCL 1JYXA 1LVEA 1GGCL 5IFAH 3CDCA 1BQLL 1DQJA 3P30L 3JUZA 4O51B 3RKDD 3OAUH 1Q9KA 4UDUB 2AK4B 3VI3E 4DN3L 5J3HD 2IBBA 5FO7B 4G7YH 3MRJA 1HOCA 4LSSL 3SBWA 3RVXC 1B9ZA 4I48B 1G1YA 5IBTL 4F15C 3QIWC 4DN4L 5D8JL 2WQRA 4PJ5E 3HTLX 2DRUA 3MJ7B 2CLZB 2OJZL 3QNZA 3V4UH 5MERA 3B9EA 3FO9A 1JGUH 1UB5B 1DBBL 3QWOB 4XP5L 4RFEB 2W60A 4RGMB 3SGKA 1FSKB 5FECB 1IGML 2CUMA 1Q9WA 4Z9KB 3MREB 3X14A 4YHOH 4PREB 4JR9L 2XZCL 1ZSDA 3ULUH 1EFXA 4OLVH 2WWKT 4TPRH 4FQ1L 1A6ZA 2FRGP 5IROC 2EDTA 4MXWL 2KZWA 4JDVB 2XNAA 1J8HB 5ENWB 1I8IA 3GHEH 4GMSL 4TSBH 3MZGB 4DVBB 4H25A 1RZ8A 5E2WL 5C08B 1GPOH 4X7EC 1UH3A 3CFKB 3LPFA 2MKWA 1KCVL 3LD8B 1BBDL 2P7TB 3LKOB 4HAFA 4UQ2A 3B2UC 1I8IB 5C71A 4GKZB 3HNTH 2XKNA 3PDGA 2NXZB 1EGJA 5GGVH 5C0RH 4IOIB 3OXSB 3WJJA 2EXYC 1A22B 1QEWA 2BSRA 1F97A 5CCKH 5EG6C 4CDGC 4HKZA 4M1DL 2XTJE 3EDKA 4DKEL 5GGTL 5AG9A 1A7PH 2L7JA 3T8XB 1IQWL 5ABDE 3IF1A 4F2MA 5JLZB 4WV1C 4KAQL 1KCLA 4I77L 2V5SA 5F1IB 4RIRB 2I27N 2OTPA 5D5ME 3CCHA 1TETL 4JDTL 2G5RA 3M1BB 3RWDA 4LHUD 3QUYB 5FYJU 4X4XA 1JRHH 3V5KA 2KL6A 4G3YH 5E95B 4K9EL 4Z7OE 1LO4L 4M8QA 4O51A 5H8DA 4Y1AD 2WNGA 4OTXL 3GB7B 4G9FD 4PJHE 4V1DA 1YMMA 1M7IA 4ZXBA 4PJGA 3IB4A 3CMOH 3DROB 1BFSA 3MBXH 1ZV5A 3BUYA 3V6OA 2R0ZH 1FC2D 3GMNA 3FMGL 2DQEH 2PXYA 1LK2B 5C0JB 2VZ3A 5CGTA 4CRPA 1PVHA 3T04D 4MJ6A 1SEQL 4HUXA 4KROD 2X5PA 5CLTA 4EOWH 2RQ8A 1MQKL 5EWIH 2IMNA 1S7QA 2FIKA 1YECH 1HQ4A 1U95A 5EBMA 4LFHD 1QBMH 3A0OA 2DWDB 4QXGL 4UBDC 1LO5B 1KGCD 3WD5H 4NBZB 3HAEH 4V1DB 3VGGA 4OQTA 5FYKL 1KJ2H 1NCBH 2PNDA 1FZJA 1OARL 2VIRA 4A6YA 4JHAL 1T80A 4PJIE 2OZ4A 4K3EL 1MREH 3GNML 3W0WE 4OZHA 1BGXL 1XGTA 3RUGE 2XPGB 1WZKA 5E8NA 2UY6A 3PWUA 3WL9B 1KLGB 1PG7L 2MPAH 4X7DC 1JGVL 2P8PA 3L3DB 4EI6B 2V5RA 1MVUB 3VXRD 3C09B 1WGOA 3ZYOA 4BQCA 4XPGL 1EEZB 3MGTA 3IRPX 3CFEB 3RWFA 3H3PL 2AABH 4LCWA 3PABA 1F58L 1P5VA 1T20A 1I3GL 3LKOA 1NJ9B 1YEGL 1ZLUH 3K4DA 5HHNB 5IKCA 5ELIA 5KSBB 1II4E 3D69B 3ELAT 4KMLB 3ILQD 4P4RB 3MLYH 2DM2A 1N5AB 1BQHG 4M62H 2NY7L 1JZ7A 5FHAL 1DSFL 1C5CL 1CK0H 4HS8L 4EN3D 3QIBB 4OB5H 3NPSB 3JV0A 4P5TA 4RX4A 1NFDF 4V2CB 1FZOB 4D9QD 3GIVA 4JKKA 3VD4A 4X6EA 1HQRB 5AEAA 5FGCE 5T1KB 1HYRC 4H0IA 4ZOCA 3I9GL 1K9TA 1KIPB 1QSFB 1R24A 3C6LD 2D31A 1YA5A 5E1HB 4LCWB 3I6KB 5TQ0H 2IALA 4PJ9A 1ZHKA 3BKMH 2V5TA 3DBXB 3D0VA 1WQVT 4Z7OF 3S35H 2VXUL 1PKOA 3CD4A 3BDXA 1D6VH 4Q6YA 1EGJH 3FHAA 5CP3A 1NMCC 1T1WB 2C3VB 2XY2A 3K2UL 3O45A 3VE0B 2BSTB 3M45A 1QHOA 4PJEF 3QXVA 3PGFH 3QA3B 2FECI 3NIFE 3DSFL 1S7SB 5KVGH 4M1GL 4Q7DA 1CD0A 1U92A 4PP1D 5EU7E 3BD5A 2QSCL 3TN0D 1HWHB 3IFLH 1OTTD 2AV7A 3RUGB 1I1AB 3GHEL 3CZFB 5I8CB 2NXZD 5EBMB 5E2WH 2AK1L 4NQSB 5KZCD 2GAZA 5GSVA 3UBXA 3WUWG 4K8RC 3IFPB 3ROLA 3QFJD 3DX7B 4DN4H 4A6YB 4YHIA 4MHHG 2BOBB 1I3RB 3FT4B 4NKMA 1PAMA 3GI9L 3V4UL 1DQML 1FRGL 3DGGA 1IAIH 4LLDB 3N1QC 2G60H 4OF8A 4JEGB 3HNTL 4U1HA 4NDMA 4LLVB 5D72L 1N3NB 5C0GA 5LAXA 1JF5A 4OI9A 2DLFL 4JHZA 2J1KA 2AP2A 3ARXA 3SDDB 2DIJA 2NY5H 4X99A 1A7NH 1CBVH 1KCSL 5IB3B 3WFEL 4XPAL 4YC2C 2J5LC 3C8KA 2DBJA 4OLVL 5DUPH 3WEXB 5GZOD 4ZAKB 2A1WL 3S96A 1B2WL 1OAQL 3BI9X 3VXSD 4M43L 1D9KA 3O6LL 5ADPH 3EO0A 4WI8A 3EJYD 1P53A 3S4SG 1DDHA 3ULVC 4BH7A 4NO5B 5E00A 5GSRA 1A9EA 2Y7QB 5E6IC 4XVTL 1D6EA 3V52L 3N9GL 1S9KC 5HDOA 1J86A 1DL7L 3C9NB 3JUYA 4OCLC 5EC2A 5EPMB 1LO4H 4MLIA 1FV1A 5HGGS 1DBMH 4JFYA 4LLUB 1FCGA 1TJHL 4MQXD 3HCVB 3X13B 1Z9MA 2Z93A 4KZDL 3V0WL 3MUJA 1NFDA 3QDGE 4TTDC 1E6OH 4PRIA 3U0TB 2NNAA 3LEVL 4ZUTA 3AMLA 2VDNL 5JPMA 1Y6NR 3LOWA 4P57B 5CIPB 1YECL 5B4MD 2VITB 5D71H 1NGYA 1WISA 4N9GA 1JTTA 3AB0B 3G5ZB 5F72S 3SDXE 3M8OL 3PV6B 4K9EC 4G42B 3MBEC 5JPMB 3KYOB 4IOSD 3OX8B 4U4BA 2HT2C 3BZDA 5C08E 1I7TA 3OKEA 4AEFA 3H42L 4BUHA 3LH2H 4H1LA 2CRYA 1CTNA 4GSDL 1BF2A 3GSNA 1JN6B 4R0LC 4HF5L 3BIKA 4KK5D 4QHMA 3OX8A 5JZ7D 1IAOB 1NMBL 1MCNA 3HI1A 5KSAB 1NCWL 1HKLL 3CDYA 3U36B 4XPGH 1YN6B 4NHUA 2LU3A 1H5BA 4NQDB 1YMMD 4KVNL 1ZKAA 2DL9A 1MQKH 4MQSB 1A1OA 3PWJA 5HYJA 5JMOC 3QQ3B 4N0YL 4QHMB 3DMMA 1H3XA 4PY8I 4L8SC 1MCPL 1FDLL 2DQUL 1QUNA 5ID1B 2BVYA 4YZFE 4PYHA 4KUCF 2AK4A 4PLKC 2OQJB 3GFUA 4LLVA 2B2XH 2VDRL 1YNTB 4PUBH 4AJ0A 3RWCA 1DSFH 4LDEB 2YMXH 5FYKH 2HKFL 4QRPD 3VFSA 4JHAH 5CILL 1I1CA 5TE6L 1U42A 1AHWA 3MCLH 3GNMH 4KJWD 4IRJB 5FDYA 1IM3B 4JFDB 3WV0A 4FS0A 4U6HA 3KXFD 4F80A 2FJHB 2MPAL 1LE5B 1BFOA 5IMKB 3OKLA 2Z31C 2PYEE 1S9YB 1HHGA 2E6PA 3EYQD 3SDDC 1CD1B 3MLTA 1U8QA 3OWEA 3ULVL 1BJ1J 3P9MB 2NX5B 4ELMA 1AY1H 2NTSP 3S35L 5K9KB 1I8KB 3MLZL 5C70A 1R3LB 1D6VL 1XCQA 3PG2A 2MJWA 3KPMB 4M62L 1FYTB 1HSAA 3LZFL 4Y5XC 3GSVB 3IJHA 2V17L 2MCPL 4Y4HA 2UV3A 3ZT5A 5HVWA 2DQIH 3H9SA 1IBGH 3R06A 2Y07H 5I76B 4GXUM 3T08A 1JL8A 5IW1B 4DEPC 2AKRA 2HG5B 4LGPB 4OLWH 1AI1H 4M48H 3V0VA 3I9GH 3IFLL 5C08D 5I1CL 1M71B 5J1TC 3T4AB 4PV9B 4NKOA 5A2LH 3HE7A 5BS0A 3TZVD 3EOYG 4GRWH 5GGQL 1HXYB 1YPZE 5C0FB 4HPYL 1UWEL 2GJJA 1P4LB 3CLEL 4BQ8A 1HNGA 3MRKA 2VXUH 1AKJB 3QUZC 1EHLL 5IEKA 4Y8DC 2GFBA 1KYOJ 4OD3L 3IDJB 1DCLA 4O02H 5HPMB 3B9KB 1EH9A 1TJIL 3IFNL 2H9GA 1SHMA 5FYKE 5HGBB 3S3JA 3VGEA 1PBYA 1GYAA 1C1EH 1KT2A 1T7XA 1KACB 4MDJA 3O3DB 4GXUN 3S7GA 2FEEL 4NHUB 3C5JA 4POYA 4KVCL 3SO3C 1I9JL 4QNPE 4NNYB 3OR7A 1ZLSH 1G0DA 2ICCA 2B8OT 2BVUA 4TOYH 3IDNA 2ED7A 4R0LB 2ZKHL 5ID1A 1YEJH 1ZA6B 4Z5RA 3FL7A 2WIMA 1S9XA 4NO0B 4X98B 1R3KB 3BVNA 2EDWA 4ZFGH 3P4OA 3QXUA 4ZOAA 1MOEA 4XH2A 2F54B 5HGHB 1C12B 4N68A 2GUOB 1SYVA 4OLYH 3AROA 2R23B 3C8DA 3QXAB 1FN4A 5D2LB 2X4RA 1BFTA 1P7HL 1A6ZB 3QHZH 2RFXA 1OCWL 3UTSD 3CFJA 4ONFH 5D1ZB 2E6QA 2DQGH 2F54A 3QFJA 2I07B 2D7PA 1FCCA 3MLRL 5IVXB 3WO4B 1MWAA 3VXOA 5BV7C 5IW6A 3EJJX 4NCDA 3S36H 5D5MA 1B2WH 2AI0H 4P2CG 2KQMA 4G8EB 4N8VG 3VCLB 2HLFC 3HS0B 5LGKA 4HUVB 4HCRA 4K71C 1L0YA 4LCIH 4KK6D 3NA9H 4P3CH 5GS2H 1KPUA 1XR8B 1U2CA 1NH6A 1NC2D 3M17B 5INCA 5HDLA 1QLRA 2BVTA 1BIHA 5DHVB 5HYQB 5ERWA 3LSOB 5GS1B 1INQB 3OF6A 5HGAA 2EO1A 2XTJB 5FUOL 4J8RA 4YXHH 4OSUH 1U3HD 4GKZA 3VI4F 5I1AB 4HKJA 1UM6H 3KLDA 4LSQL 4U1MB 3TCLB 3FN9A 1FNEB 2XTJC 5E8EB 1AD0A 4S2SA 3V0WH 3U6RB 1G7HA 1E6OL 4FQJL 4YDVA 1ACYL 2BRRL 3L5WB 4F37K 3EO1A 3L3OA 3BPCA 3HFML 1ND0A 3MA7B 1HILA 2YPLE 4J3OC 4R2GB 4I0KA 5E8PA 1EUTA 5D7IB 5HJ3A 3UTSB 3SKNA 3ZDZE 3ZYJA 3G6DH 4OGXL 1J8HE 2GSIB 3B4NA 4QTHA 4GW5B 3QZWG 4N5UA 2FBJH 3S5LG 1AXIB 2E3VA 3LS5L 5L8LB 2BNUA 5IB5B 1SMOA 1AD0B 3H42H 1T2XA 5ALCL 5IMOA 4OZFG 1U58A 1U8LA 4MSWA 1OT2A 4PY7A 5GRWA 4GSDH 1NQBA 2DQJH 3S88H 1PYWB 1UQSA 5EZJA 1J8HA 4XPTH 5J7CC 3CVHH 4PJ5B 2CDFB 4CMHB 3ARBA 4MJ6B 1JF6A 2GTZA 1GHFL 3RGVD 4OF7A 4WFHE 2IAMA 4N0UB 3QIBC 5DR5L 4HUMB 4FQXB 5F70A 2DQUH 3QH3B 2JF1A 1X5YA 6FABL 5CD5D 1L6ZA 1N59B 1CYGA 2J88L 2RFXB 2A6KA 4XPHL 5IESH 5M94B 4LEXH 5D2LA 2NY2D 3EFDH 2D7TL 3ARGB 3B8YA 2R0LH 3MOBL 4N8VA 4Q9QL 3V6ZB 1ZLWH 1QSEB 4EVNB 1QLFA 1ZS8A 3MJ8A 5E4EC 2ATKA 4OLWL 4ZAKC 1RHHB 1MFDH 4BFBD 1XIWB 1YMHB 2PXYC 4IS6A 4H26A 4M93C 4YBQD 4O2EA 4H8WL 1IZJA 2E7BA 4FFWD 4ELME 1RUPH 3BWAA 3KXFA 4FZ8H 3CZJA 1I8MA 5EC1B 2NY4B 1OP3H 5ILTL 3MLZH 4Y5VC 5EOQH 1I7UB 4NRZA 4C55A 3MV9E 2AJSL 3CVIL 5I18L 5DUMH 4L9DA 3WYRA 2D31B 3BWUC 4TVPE 3IFNH 1MCWW 4MAUL 5DEFB 5IWLA 1CR9L 2CUHA 1J12A 1ZANL 1IBGL 2JJWA 4C56A 4JFPA 3MROB 1MRFH 1P1ZA 3D85B 5D93C 3BH9B 4ENEC 3NBNA 4GAYB 3NMEA 2EDNA 4PLOB 1OAKH 1A6WL 1S7UA 4WU7B 1JPFA 2FO4B 2PTUA 3DVGA 1HIMH 1Z9SA 4AL8L 1FV1B 43C9A 3SKNB 3TFKC 1E28B 4AK1A 3KPSE 5IFJA 4YO0B 5L2JB 4C4KT 4IMKA 5DJ8A 5D2NA 4NNXA 4JPIA 4LLMA 1OPGL 5DZNA 4KXZI 1TENA 1Z3GL 2VIRB 3EO9L 2IANA 2Q8BL 3RL2A 2NXYB 3HC3H 2BSTA 3TBYA 5T5NF 4D0CB 4I0PB 5GXBB 3EFFA 5GS0D 1FFRA 4ZUSB 1RZGB 5CBAA 3FQTA 1KJVA 5CWSA 4KHXL 3S36L 2W38A 1JF1A 5IF0B 1JZ2A 2BP3A 3WN5C 1M7DA 1FO0L 2I9LA 1LILA 2NZIA 1CLYH 4HBQA 1ADQA 2PXYB 3D5OF 1E4WH 4NHCH 5HYJE 3L3KA 3KPTA 1M05B 3GMOB 1ZLSL 4YHIB 1PKQA 3RZCC 4NC0B 2Z4QB 3IFPA 3ROLB 3V9FA 1FFNA 3O2DH 1JWSA 4LLDA 2HTLC 2CLRA 1UYWH 1KJ3H 4CVZB 1FZMB 4GAJH 1EO8L 3GSNL 2V9TA 1CLZL 1LHZA 3IU4L 4JZJA 4Y4HD 2I9TB 3DUUA 5LWYL 1TZIA 4ZYKA 2Z8RA 4IMKC 1H5BB 4NQDA 3U7WH 3VGDA 4JRXA 1DQQB 1KB9K 3QRGH 2P46B 2VLKE 5FV2A 3IAQA 1U6AH 3EOBB 5D7IE 3UTSE 5JNYA 3BZEA 2XN9D 4M03A 1QYGL 4MDIA 3VFTB 1AQKL 5FHBH 4I5BB 3CPLA 1YNTA 1ACYH 2BRRH 4MD4A 4IS6B 2Y5TB 3UMTA