3QG7L

Structural basis for ligand recognition and discrimination of a quorum quenching antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
b'DVVLTQTPLSLPVSLGDQASISCRSSQRLVHSNGNIYLHWFLQKPGQSPKLLIYKLSSRFSGVPDRFSGSGSGTDFTLKISRVESEDLGIYYCSQTTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP4-24H11 Antibody Heavy Chain
publication title Structural Basis for Ligand Recognition and Discrimination of a Quorum-quenching Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L01
3E6HB 4U1JA 2EO1A 2FHBA 2OTUA 5J06A 4XP1L 5F7WC 3TP4A 4ZO7A 4Z95H 5DT1H 2H2PD 3UBXB 1MI5E 3W0WE 2GCYA 1I9RL 1RIUL 5DMGD 1KCVH 1CK0L 4BA8A 5JOPD 2EXYD 1PQZB 4P2OD 3D9AL 3O6FD 5FO9A 1AP2B 2J3SA 1JRHI 3SCMD 2AXGB 4NQDA 4RAUB 1EPFA 5B39B 3BW9A 2VXVL 2E6JA 1FNEB 3AS3A 4M4PA 5L2KA 2ZCHL 1HHIB 1U92A 3VJ6A 1HINL 3QAZB 2LU3A 3OBAA 1WBZB 4M6AA 4DGYH 1CQKA 2A77L 4WI3A 5C0BD 3VDCA 1CZ8H 3RUGA 5D7JD 5E6IA 1KXQE 1GGBL 43C9B 1PGRB 5DD1L 1D7FA 3IXAB 3QDJA 4U33A 2ZUWA 1OAXL 3QUXD 3B9VA 1QLFB 3GJEB 4YPJA 4NOBA 4MJ6A 3RUGF 1J1XH 4LPUA 2Z8WC 5D1QB 3GKWL 3RTQC 3GHEH 1WC7B 4OQTH 4ODXA 3I02A 2XTJB 4KJYA 3V8OA 4BUHA 1RZGB 4JPWH 1QQDB 5JHLL 1SQ2N 1OGAD 1T04A 2HKFL 4K7PL 4MNQA 4PJDA 4YHOL 4LEOA 4PG2A 3RZCB 3OHXA 3VI3F 3CFDB 1ADQA 5EU3A 4WI6A 4DVRH 5K9OA 2HA1A 3FQUA 4AZ8A 2QQNL 3FO2A 1MI5D 1TJIL 2FD6L 1NAKH 5JOEA 3BVNA 3RWJB 2UZYB 1WBYA 3LAFA 3R8QA 3MCKB 4YR6B 3QA3A 2HJLA 3VWJB 5H94A 1FNAA 1IAOB 3SE9L 4M48H 3CFBA 4CN4A 3QDGA 1JYNA 3GRWH 2W65B 5HYFA 3FZUD 5D2NE 5C0GB 2I60L 3GSWB 3QEGL 5FA4A 4WO4A 2YHGA 2ZUSA 3TGXA 4P3WA 1GHFL 5I2IA 1G9NL 1DBJH 1L0YA 1P4IL 2CKBH 4TN9A 3V6ZA 4HIIB 4CADB 4JFEA 2BXZA 1KIUA 1IZJA 3QDME 3AREC 1A14H 4LCYB 4PTUB 3PV6A 5TH2B 1FFOB 4GLRH 2QSCH 3CFCH 4EOWH 1HEZA 2VISB 1PDKA 5E9DA 3QNZB 3OG4B 4HCRL 6CGTA 4K9EH 2HKHL 1DEEA 5GGUA 3VFTA 4PGZA 3VW3H 1NCNA 4PJHA 2UUDH 4XNQA 1BWMA 1VGEH 1R3LA 5EN2B 3RGVD 3K8MA 4CMHC 5LKNA 4X7TA 1OP5K 2FWOB 1L9MA 1D5MA 2ATKB 2J88L 4DZ8B 4M4RA 4PJHF 5GGRY 2FJGA 3QH3A 1UB5B 1FQ9C 1INEH 5DEGB 5LWYL 2AKRA 4OF3A 1I3VA 5EULV 3WFDL 3ZKXB 4KVCH 2MCPL 3L1OH 4AEFA 2IALA 5D93C 4RX4D 5BQ7A 4QTIH 3BUTA 4PJ5B 3TBVA 2XN9E 4HIEA 4NHCL 4BSJA 3EDDA 4F7TB 3WFBH 1IM3B 5TQ2H 3GSNL 2DQFB 5T1LB 4HXAL 4GAJH 4HIHB 4MNGA 4S2SB 1HHJA 2EYTB 1MCNA 3MRQB 2V7HB 3QIWC 3JSSA 4EVNB 3QDMD 1BOYA 1MQKL 1D6EA 4Z7WE 4AYFA 1RZJH 4KAQL 5EO9A 4OFYA 1JWUB 5CZXC 3PWPB 1C5BL 2A6DA 3G6JE 4P9MH 5J9PB 3OSKA 5HHME 5KVGL 3ARBA 2B1HH 4HS3A 4JE4B 3X11B 4MQXD 1FH5H 5EPMB 3G5YB 5IK3B 3KVQA 3PABA 1BLNA 1CS6A 5BW7C 1FFNB 3D85D 1F42A 3HI5H 5DQDL 4NQVB 2ESVE 2ZKHL 2EDQA 1NKOA 3L9RA 1T66D 1NBQA 4R4NC 5DR5H 2XRAL 1IAII 5E8EB 1JUFB 1QFUH 2AV7A 3HMWH 4JFPA 4X83A 3QUMB 2VQ1A 3HG1A 2E7CA 4ZAKD 4U0RC 5HHVL 2ZCLH 1MLCA 3H3KA 4M7KL 2NY3B 4JPIB 2FGWH 2XN9D 1UCBH 1N4XL 4H25B 1XH3B 2IG2L 1ZXQA 1FYTB 4ONOA 3RI5K 4ZFOL 5I6XB 1L9NA 1Q9LA 2XG4A 4BSVB 1CFNB 4OQTA 3VFNA 5D8JL 4ISVA 4XVTH 3WO3B 4KK8C 1KELH 4NKDA 3SKMB 5HY9B 3ZYZA 4PJ9A 5JLZA 3OKKA 3JBG7 3OX8A 2BVPA 5HHOB 3VE0B 1ZT1B 4YDJB 4PJFB 2EDTA 3ILPA 5HHMD 1DQQA 4HT1L 5D71L 2E8YA 3KLDA 3TNMB 1OTUC 3PWVA 4XPHH 2WW8A 3PGDA 4HUWB 4CU8A 5JMRA 3VGGA 2UY6A 3GRWA 4YIQA 4DGVL 2IPKB 1NFIB 2ESVD 1UGNA 2VDNL 5KW9L 1MCWW 1F97A 2X5PA 1JZ7A 5DJXA 3CZFA 5ACLA 5CAYB 2CKBA 4R26L 1N2RA 3FMGH 4GMTH 4JZJC 1U3HA 1JHTB 5EOTA 4Z7NF 3C6LC 2WIIB 1FG2B 1MCOL 4NFDA 5C0FB 4NGHH 3W82A 5DMIH 3OXRB 3QI9D 4IRSD 5JNYB 4QRPA 4D9LH 3T2NH 8FABB 2RGSA 2KH2B 4N0UA 3KR3L 2J8OA 2ZG1A 1P2CA 3OAYH 3K2MC 1BVLA 1A22B 2CR3A 2Y72A 3DX6A 2D0GA 4AIZB 3T0EB 4K71C 3FOLA 4BYHA 4OV5B 4ODVH 2FL5A 3O6LH 4FQXA 4LSVH 1UC6A 5JHDE 3RWHB 5GISL 1EAPA 3GSOB 2VWEE 1M7IB 2R8SL 5CWSA 3V4VH 2X4UB 4QRQB 5E8DL 5ESVB 1TJHH 2BNRA 4HWEH 2EYRA 5J11C 4GMSL 3S3PA 4ODTL 1EVUA 5ERWB 2YZ8A 1S9WB 2AJXH 1T22B 3BPLB 5SWZE 3QNXA 5HVWA 1U91A 2R0ZL 2VDPL 3ZKND 4NZRH 3O8XD 4KHTH 4K9EC 2RIKA 3EJJX 1F58L 3LV3B 5D1XC 4LL9A 1NCBH 3ZMRA 4YBHA 1KFAH 4L1DA 2CGRH 4GS7C 4W6YB 4K7PY 2IGFH 1FBIH 2YUXA 3INUL 4EJ1C 4ODHH 4IHOB 4ZFZA 4CUCA 5FGBC 3RL1A 1U8QB 2MPAH 4HGWB 35C8H 2WBJD 4RWYL 1YEJL 3MLSL 5IBUB 3L3GB 3MSPA 3P4NB 3RX7A 1R5IB 2R9HC 3RHWK 4UQ3A 4P2RD 1HDMA 1U41A 3JV6B 3Q6GL 5IQ9A 1MIEH 4LVEA 5JHDD 4GW1A 1CDCA 2YUZA 4YBQD 2I5YL 1JNHA 3X3FH 3A6BH 3MJ8B 5DRNB 1I9IH 2QBWA 1DSFH 2VAAA 4OLYL 3EYSL 1G7IB 1P7HL 5AZEL 2AI0H 3O3AB 1W72B 3X13A 2AP2A 2R4RL 2B0SH 2D03H 5SWZD 3KYNA 2X4NB 3GMRB 3NABL 3TT1H 1GAFL 3BPCA 3SDCA 2HN7A 1MVFA 5ALBH 5CGYC 2JCCB 1M7DB 3W39A 1Y6KR 2VZ3A 3DGGA 4JFHD 4F33B 2R1XA 3MLUL 5T3XL 5DQJB 3O9WB 3B2VL 3DO7B 1F45A 3TBTB 1CF8H 4KI5C 4PREA 1FL3A 4W68A 4NQXB 2EICA 2VZOA 2QQLH 1DVFD 4S1SL 2AJYH 5DURB 4NC1C 1ZV5A 1VFUA 1B6DA 5H2BA 4OT1H 4GKNB 4F37K 1DP0A 2NY1C 4TQEH 5CS7A 1AD0B 1SJEB 1BAFH 2XKUA 3IU4L 3O6KH 3L7EA 4P59H 4PLKC 3JWOC 3T4YB 2P8LA 4PJAB 4M5ZL 1JGEA 3MYJB 1V3KA 5IP4A 1SY6L 5GXBB 4HUUB 4MAYD 5D1ZD 2ADIB 4OB5H 1NMCB 2EXWD 1CD1A 3IDJB 5F6IC 3VFOB 1IC7H 1IGCH 1IGYA 3CFIC 3H7BB 3QZWB 4ZOAA 1AXTL 1CLYL 1IGJA 3MNWB 4MQ7B 4TYUA 1EFQA 4LCWE 2EDWA 5CEYB 2VUOA 5E8OB 3AXLA 3CGTA 5JW3L 4JHBA 2MQ3A 2VLLA 3QIUC 3SDAA 4YH6A 1CXKA 5EZLA 4WW2C 4Z95L 5DT1L 2Z92B 4OKVA 3RWCB 4WU7B 4JKPH 5E94A 3ARGC 3TEUA 3NZHL 4YXLH 3R1GL 2DQUH 3WFCH 4IOIB 1OTSD 3G6AA 3WHE1 5DHXB 1G7JA 5DTFA 1DBKH 4XBPB 4ZYKA 3ZSTA 4NP4L 2YUVA 3QUYD 4ELKB 3T0XA 2C1PA 1YEDB 2Y7QA 4LRNH 4GO6B 4O58H 1FLTX 1TCRB 4I1NB 2VABB 3C6SB 3GFUA 4WW1B 4EI5B 2QSTA 3NN8B 4F7CA 1KCSH 3IJSA 3BD5A 3SQOL 1A0QH 1T7YA 2BSED 4CN1A 3V0WH 1I8IA 1Q9OA 1DBBL 1KB5B 5EO1B 4G7VH 2F54A 2YD4A 1U8OB 4OLZH 2VZTA 1SYSA 4L4TA 4P9HC 1J1XL 3CFKB 3UTSD 4Y5XC 4WJ5B 3G04B 3IF1B 4OQTL 4LCWD 3QCTH 5EUOA 4IJ3B 2IBZY 4JPWL 1T2JA 5GS0C 3QQ3B 5I17A 5BV7H 4OI9A 3K74B 1WUNT 1PVHA 4XNMA 4DVRL 4F58H 4FP8H 4KI1A 3DVGB 4K8RH 5CLTA 5EUOF 3D5OF 5EU4B 2JJSA 3FONB 1RJYA 3D1MC 3DRQB 2DMCA 4J23A 2Y36H 4PP2A 1NAKL 3TESA 1EJOH 3WN5C 2XWJB 2PTTA 1WZKA 1W2KT 3VG0H 4G3YL 2YC1B 3SGJC 1KTDB 4YO0B 3GRWL 4NPYB 4PFEA 1RUQH 5SX5H 5JPNB 4GUPA 1ZT7A 3IXTA 4MXQD 2YEZB 4NC0B 5EC1A 3R4DA 3HNVH 5CSGA 2BSTA 3D39E 3KYKH 5I74C 2WUCH 1MHHB 3IDGA 3RDTC 4Z76B 4UAOC 1A14L 3HN3A 4HDIA 3CFCL 4UIMA 1NC2B 5DJ8A 4QGYA 4HD9A 4UOW1 5FK9A 4EI6B 1I9EA 2Z93A 3MBED 1ZS8A 5I1GL 3TZVB 2LFGA 4MA8L 4CJ0A 4ZNCD 1RZKH 1ZKAA 4PS4L 3T2OA 2ZUQB 3BP7B 5FHBH 4GG6E 5C07B 3FO9B 1QOKA 4F7MA 5B38B 5ISZD 2J6EH 3U7YH 4XBGA 1S7QB 5J1AB 4K3JH 4D3CH 4Y2DA 3QWRA 4HC1H 3IFOA 3QWOB 4KVCL 4G9DA 4PP1D 3L1OL 4KKBC 3MOBL 2ICWB 1T7WA 4MA3A 4KTEH 1DN2A 4CW1B 1ZHBA 3RX5A 1VDGA 3CX2A 5HDQH 1RU9H 3KXFB 5HYSB 3FO1A 3LEXB 3CUPB 3WFBL 5K93A 1DANU 3CMGA 1M05A 1BQLH 1MPAL 4OD2A 4PGDB 3MROB 1KG0B 1BJ1J 5FDYA 2ZG2A 1BWWA 3VWKB 5F7UA 1RZJL 3B9KB 5DYOA 1DLFL 1X7QB 5C0AA 4EXKA 3FN0H 4WU5B 5J89A 4AM0B 3BQUA 4P9ML 3VXOA 2OI9B 3V6OC 1GOFA 1FH5L 2R2EB 4HW6A 1AQKH 2W60A 1JE6A 1KB9J 4MYWB 4I77H 5CJXC 3HI5L 5F7MC 4UBDD 5GRWA 1BFVL 1NGYA 5FEBA 4L8BA 1IL1A 1TZGL 3ARSA 3VXSB 4R0LB 4ETYA 5ITBH 4MSWA 3V7MA 3O3EB 1NANH 2UUDK 4L1HA 1EHXA 3HMWL 1C12B 4PRNA 5FYLE 3GSQB 4W4NA 2OCFD 2IQAA 2YZ1A 1MH5A 2ZCLL 3CPLA 4M93C 4RDQF 5F9JB 2QV2A 5I0DA 4LARH 3AU1B 4S1RH 1G7LB 1R3HB 3KPLA 1CT8A 4C56B 4XVTL 1KELL 3G5VB 4UTBL 1OPGL 1R5VB 5JO5B 5C07E 3TA3C 1CICD 1YEGH 1K2DA 4FS0A 5C9KA 4PV8A 2V2TA 3LQAH 3L3JA 4AEIH 4PRIE 1YEEH 2IAMC 5MENE 5I9QC 3AM8A 4Z18A 3D0LB 4XX1E 1C5CH 4ODWB 3DJ9A 4L3CA 5GSVA 4FZ8H 5CP7B 4XPHL 3QHTC 5JTWA 1QSFB 1IC4H 2ADJA 1J8HE 4DKAA 3UPCA 5JXAH 4ZODA 1KLUB 2R56H 2VSDA 3UJIL 4JFFB 5D7IE 4NUJA 3SE4C 4J6RH 3MV9A 3T09A 4NYLB 5D9SA 3LN5A 3H9SD 5DJCB 5FYLD 3P9MA 4BQBA 3ZKMC 3QJFB 1XCQB 4XCNA 5DMIL 3WSQH 1NEZA 5L0QB 3EYFA 4NZJA 4YXHL 4D9LL 4MD4A 1OWRM 1P4BH 4FTVB 4GKZA 2Y6SC 4QTHA 3IVKA 1QSZA 1OP9A 2A0LD 4X9GA 4OLEA 1RAMA 3NFPB 5HGHB 2J6EA 1Q94A 1KF9B 2DLGA 3FFCB 2AK4B 1I1FA 2OSLA 4ODVL 5JQHC 3O6LL 5GSRB 1GIGL 1ZLVH 1AGFB 3VXTB 1FG9C 1HOCA 1I1YB 4LSVL 4OFPA 3WIFB 2I25N 4D8PA 1ZWIB 1UXSA 4HC1A 5K59F 3B6SB 4PRID 3WKML 4MXVF 3TBWB 4RFEB 4G8EA 1KGCE 5CSZA 4GRWH 2NY0C 4HWEL 3KPPB 2BFVL 4CJ1A 5EC2B 3KJ6H 1OAQH 2AJXL 3DVFA 3SO3C 2EIEA 2Y07L 3OJVC 5JDJA 1J8HD 2E6PA 2ZG3A 4RGNB 2L7JA 4JN2A 4NZRL 1KLGB 3OKDA 3EJYD 4KHTL 5I30H 5F7LB 1KFAL 2O5YH 5D1QC 1S7WA 3OR7B 3VFRB 3E2HB 4JZNB 3LKOB 1FBIL 3GMQB 1YEKL 3VFMA 1QFWI 3ZZ1A 3UMTA 3HNTH 1WCBB 1JF1B 4KWUA 1KENL 3IAPA 2VLJD 4M5YL 2JKXA 5EBWB 4JRXB 3H0TA 4ALAH 35C8L 1GGCL 3I6KA 3FQWB 4GW4A 4LCCC 4KGJA 4BFBD 4WI5A 2X4OA 4P23A 4WUUE 3SEPA 3LRSA 3GMOA 4LSSH 4EDXB 1IM9A 3G9AB 4K3HA 3K8LA 5CBAA 1EEQA 3HUJB 3NA9H 1IBGH 1PW3A 3D3VE 3SKOA 2BY3A 3BN9D 5E00A 2IH1A 4FN0A 5TFSH 3CSBA 1KGCD 1DSFL 5JDSA 3OAYK 8CGTA 4R7NB 5ACZA 2E9IA 4LSQH 2AI0L 4PJCE 3IDUA 2B0SL 1HHKA 4J8RB 3TT1L 3B43A 5C0CE 3JV4B 2DS4A 2VL5A 2PR4H 3QQ4A 4I2XA 2DQTL 3BRFA 2D3VA 2APXA 2DWDB 4RFOH 5BO1H 1RK0B 4LNRB 2OZ4H 3HE6D 3FFCE 5C0DB 3RWIA 1PY4A 4OGZA 1K5NA 3QRFM 4WDIA 2QQLL 1MHCB 2RB8A 1KUMA 4U1KA 2CR6A 4I4WA 1NJ9B 4M6MH 2C7UB 3SBWA 4NDMB 1M71A 3M45A 4HHAA 3T77B 4JEGB 4EN3D 4QKXB 3NAAH 3BAEH 5D7JB 4WUUD 3S8WA 5T33H 4TQEL 4GH7B 1DBAH 1BAFL 3QUXB 3O6KL 3CFJB 4P5TB 1NGQH 3QPXH 4NKMA 5SWSE 3D3VD 3LPWA 3OAUH 1AHWA 1S78D 3EJZD 3ROOB 1G0DA 2CD0A 1XR9A 1IEHA 4FOMA 3ULUH 5IW1A 4OCXL 3BO8A 5ADOL 3QFJD 2DJ4A 5IVXB 3MMEA 3L6FA 4Y19A 1YQVH 3O3DA 2DLFH 1G6RH 3FRUB 4L8DB 2PYEE 5H8DA 5C0CD 1KCRH 2IANA 4L9LB 3ZDXE 3FQTA 3C9NA 2ZSVA 3ZTJH 1MVUB 4WI7A 4HKZA 5IOPA 3FRPA 4MXWH 4X7DC 2Z31C 1DDHA 2H3NA 1MCLA 2HT2C 1J0JA 3S4SA 1VB9A 3GNML 5EBMB 2F74B 1F90H 1A4JB 4BSWA 3UDWC 2DTMH 2EE9A 4ZO9A 3WS3A 2NY7H 1A4KA 5DJAB 2DQUL 2APFA 3VFSB 4DWHA 4JKLA 4R96B 1RZFH 3V79C 1D9KC 4XTRC 4F8TA 1KULA 1DBKL 1YC7A 4FQHA 3MPCA 1JV5B 3BDYH 4GRWF 4I5BB 2P43B 5A40E 4LRNL 5DK2B 1GH7A 4R8WH 1I1AD 4LCUB 1MCKA 2XQYK 1IFHH 5SWSD 2CUIA 1CVRA 1OWWA 1EERB 1R5WB 1IAIL 2OJEA 3GK8H 3V0WL 1IKFL 5TDPB 2GFBB 3GSRB 4BFIA 5JMOC 2IADB 3VXRB 4IRJC 4EBQL 4OLZL 4ZPVB 4Y1AA 3HRZA 3MRJB 1KV3A 1QO3A 1MEXL 2CMRH 2PYED 4P57A 4IS6A 4TNVF 4KJWC 2YBRB 1XIWD 4OBSA 4Y5VB 4HWBA 4NZUH 1T83A 3QCTL 3Q3GB 4Y16A 1D5ZB 1AO7E 1FE8H 1GOGA 5MEOA 4QRUB 3VXQB 5JIKA 5HVHC 3UTTA 4WRLA 2C1OB 2VE6B 2PXYB 2CLVB 4F58L 1OAZH 4FP8L 5HI3C 3TV3H 4K8RL 2X1OA 4PV9B 3HZMB 3MUJA 4EIZC 4GRLB 4JREB 2DMKA 1FORL 2X4SA 1ZANH 2Y36L 2GY7B 1EJOL 3T1FA 3KLSA 1AQDA 3VG0L 1RURL 2DJUA 4RZCA 4HMEA 1AGBB 5J57B 2AEWA 4DCQA 3T0AA 4HKXB 1IGIH 3RUGE 3HNVL 3FB7A 4JM2D 4KY1L 3DNKA 4R4FH 2WUCL 3QDJE 4G43A 2OZ4A 1JK8B 1AE6L 3P9LB 1FDLH 3BT2H 4FXGB 4P4KB 3MRRA 2FB4H 3VI3E 3U0PA 4LBEA 3GBNL 4JHAH 3LKRA 1QD0A 1RFDH 3V6BR 2X4TA 5ITFB 4RQQA 2BC4B 1J87A 4MNQE 4OI7A 2SEBA 1RZKL 2GUOB 2CDFB 3TN0B 4GBXB 4OZGB 4P2YA 2J6EL 1VA9A 5IMLB 3BPLC 4G6AD 2YPKA 5F3HA 3K4DA 3VRIB 4F7PA 2P8PA 1N3NA 4HBCL 4MJ2A 1JBJA 1LNUA 1OAUH 5E8NA 4P5MB 4KFZC 5EA0H 1MLBA 3QDGE 1S9XA 2DQJH 4PGEB 4NQDD 5CHNB 3O11B 3DETD 2VZSA 3EFDL 1T5WA 5L2KD 5F1OB 2HVJA 5HDQL 1RU9L 4LLWA 1AGDB 1EA9C 1BGXL 1G6RA 3FB8A 1JNLH 5EZIH 3VXMA 5CKAA 5T3XE 3ULUF 4UT6H 1BQLL 4QRRE 4O2FA 5E6ID 4I3RH 1DTUA 3U46A 4JQVC 3QDJD 5E9DE 3FAXA 5DI8B 3MGOB 5TDOA 1UJ3B 3VFUB 4QXTA 2M2DA 4PJHE 4NCC2 1J7VR 3BGMA 5HI4C 5KANG 1RZ8A 3WE6A 3O0RL 3RWEA 1FAIH 4LSPL 4ZS6D 2X4PB 2JIXA 5IWLA 5SX5K 4RA3A 3ARFA 4PJEB 4OFVA 3QHZH 2DQEH 3BMWA 4MNQD 3TYGH 3P0VH 3GMPA 4JFQA 2VLME 3KLAA 2MKWA 1T5XA 2A73A 3ULSA 3MLTA 2H2SC 3CAFA 3QI9B 4IRSB 4OUUB 1HQ4A 2HT4D 3O41A 3O45A 4KK5D 4OGYH 5ITBL 4K3EH 3EUUA 5ETUA 4N8VG 4KROD 1K8IA 4XC3H 2A9NH 3QDGD 4JFOA 4U1IA 1RIVL 1JF6A 4YZFF 2P5EA 1XT5A 1T4KB 5F21B 5E4EC 5KVMC 4WO4D 2YPVH 1EXUA 2IWGA 1K4CB 1P69B 1T1ZA 2R4SL 3B5TA 1X5FA 4ELMA 1JPGB 1YN6A 4LARL 3HCVA 4XPFH 4JFED 1A6ZA 3O4LA 3EYOA 1W0VB 1B0GA 1FAKT 4S1RL 4WWKA 1Q0YH 2EDXA 2L7UA 5FDWB 3SKUD 4NKOA 4YE4H 4ELMF 4C55A 5E9DD 5HYJA 2C4FT 2A74B 4LLUB 1YEGL 1XF1A 1AXSB 1PYWA 3L7FA 3REWB 5I1CH 3TJHD 1J11A 1SJHB 3LQAL 2NXYB 5TGBA 2ICEA 4RNRA 2D7MA 4WV1B 5MEPA 1C5CL 2P24B 3IFNL 4FZ8L 4KKAD 5FO7B 4JQXA 4ZDHA 3MRMB 2G2RB 4NKIL 5ADPH 1NBYA 3B9AA 1NGXB 3O3UN 3JVGC 5I1JH 1IC4L 4YK4C 1J12A 5DO2C 4R3SA 3JV5A 5JZ7C 2R56L 5LAXB 2ZPKH 1EEZB 3PGFL 4J6RL 4DVBA 2LAGB 4NN6C 4ZXBC 2ENYA 4JAMA 1SJVA 4U6VH 3O6MH 1OAYH 2J8UF 5HDBF 2C3VB 2IPUK 5DK0B 2WBJB 5E24E 5B8CC 3WYRA 4QHLA 3EYQC 5F1IB 5IGXH 5L6YH 3S5LB 5I8CA 3V5HA 1HXYA 4P2RB 3PQYA 3QFDB 3PXHA 2YA1A 2OK0H 1YJDH 2PKDA 4LIQL 3LKPB 3THML 3MRCA 1MCBA 5TDNA 1BHGA 4FQIL 4PRDA 4Q6IC 3HAEH 3PGCA 4OFYD 3L5IA 4QHUB 3RWFA 5BVJB 2X1QA 4YHIB 3MXVH 4N5ED 1YEIH 2FIKA 1TQCB 4P3DA 3GKZA 3ARBD 4L8CA 4LLVA 1KEML 4MJ5A 4YGVA 5I19H 2XA8H 3UPRB 1AI1L 2BRRH 5DFVC 1OM3L 5DJ2A 4YJZL 1PKOA 1CGSH 1RK1A 2FJFB 2WAHA 1IGTB 3BZEB 1E4JA 4Z7NE 4I9WE 3KJ6L 5DUMH 1OAQL 5E4IA 2DQDH 1INDH 4HH8A 5FB8A 3ZDZF 2E7LC 4MJIA 1CBVL 4TSCH 4ZFFA 3GIVA 1MCPH 1HQRA 3SGEH 3HG1D 3VRJB 4Z0XA 3K8KA 1DVFB 1IEAA 2A38A 4LPTA 2O5YL 3BIKB 2FNBA 1UZ8A 1Y18B 3UTPE 3F7YB 4F3FB 4MX7B 3L5WB 3ZT5A 3MV8A 1WFTA 2CRZA 3HNTL 1P7KA 5IB3B 3GJFA 1JL8A 4P5KB 4N8CH 3U36A 4AEHL 1F6LL 2NMSA 4N9GB 3WO4B 4PRHA 4PJ9D 1NUNB 4G8GA 2X9WA 4HWBL 4X4YA 2QL1A 2VIRB 1S3KH 2YA0A 4LU5H 1IAKB 3QNYB 4XAWH 1QFOA 1HILB 4F80A 1AH1A 3VGHA 2BNRE 5F9WC 2PW1A 1EO5A 1IBGL 1S5HB 1FGVH 3MV11 4NNPH 4MA7L 5DA4A 5TFSL 5M7QA 3ROLB 4S1QH 4ETQA 3DYOA 4I9WD 3ARDA 4EQ2A 4AH2B 3TYFB 5E56A 2NY6C 5HBBA 5I1LA 4FG6D 2ADGA 1ZLVK 1U3HD 5FFLA 3JWDH 1H5BA 1JNNH 4MCZB 1CWVA 1I4FA 1E28A 1CTOA 2ENSA 2PR4L 1QYGH 4N0CC 3MRFA 3OJDA 2EEDA 4QRPD 4XH2B 2O61A 4RFOL 2Q76A 2OZ4L 4HK0B 3UTPD 1U8KB 5IMMB 5CZVL 1ES0A 3MV7A 1FYHB 2BNQA 1KYOJ 1CD0A 2DF3A 1XF4B 3VXUB 1JYXA 3IDMA 3WNNA 1YPZA 2EDEA 1CLCA 2GEEA 3DX8B 3VH8A 5C0IB 4FQXD 3FN3A 5HDOA 3NAAL 4WEUD 4UDUA 4AQ1B 2Y23A 1G7HA 3NZ8B 4HH9A 1YPZF 1DBAL 3IDXH 1DUYA 2I9TB 4YHPA 3Q6FB 5EIVA 3FN9A 2BNRD 3KNBA 3P77B 5F7DA 3RY5A 3OAUL 1EEYB 3UTSB 3GIZH 2W0LA 4MD0B 4J3SA 3WLWD 2NLJB 1K6QL 3RY6C 1QR4A 1EUTA 4NN7B 4RMRA 4ZPTB 4Y5YB 2JJUA 1A6PA 3TIEA 3IS1X 3ULUL 1F11B 5T1MA 4QY8A 1JFQH 4FQQB 3ZTNH 3LPFA 5C7XL 1KJMB 5BXFB 1YQVL 3DV4A 3BGFC 1FZMB 2DLFL 2V9RA 1G9MH 4BKLA 1KCRL 3LRHA 3BZDA 3DXAA 4A2MA 3HAEA 4APQC 2O5XH 1CE1L 2OI9C 3REVB 4EZMA 4MXWL 4XWGL 5DJYB 4M43H 1E4XI 4PY8J 3RKDC 1HSAB 2BRQA 3MX0A 1V8HA 3ZO0A 5I8OL 6FABH 4JVWA 2DTML 2D7TL 1ITCA 2NY7L 4RFNB 1XGPA 4HF5L 5BZWB 5D2LA 1MWAB 1RZFL 4JLRA 4PGCA 2I9LB 4MVBC 3UYRH 1MHEA 3QO1B 1OF2A 1MJUH 2VMFA 2BNUB 4N90E 1NCCH 4UMGA 1FCCA 5D2LF 3MRDA 7FABH 3RPIA 4LLQA 4TUJB 2NZ9D 1PSKH 3MACH 3GSUB 1G7QA 5C86A 3N1PC 3Q5TA 4HFUH 4CVUA 1J1OH 3BUYA 2VUYA 3T65A 1MAJA 3OR6B 1J1PL 3SDCD 5ILTH 3HE7A 3IDIB 3RWDA 4MQSB 2L0DA 5ISZB 5DA0B 4ZFGL 3OKLB 4IMLB 3FB5A 5EBLA 1P7QA 4KXZI 1HKLH 1YDPA 5DHYB 1H3UA 2YRZA 4U1SB 4L4JA 1CXEA 1FZOA 2QQQA 1J5OH 4NZUL 5CEXB 1WWCA 3R8BB 4KPHL 4D0CA 3QEQA 5FECA 1R3JB 2HFGH 5GZOC 1DQDH 4R9HA 5CBEB 4U31A 4JZOA 1RUPL 4RA0C 3F7RA 2E8ZA 3GB7B 4AMKH 4OGXH 1G1YA 3F5WB 4DFIA 4P46C 3AAZA 4NO5A 1U8PB 4FQ1L 4HMCA 2IFFH 3QEUB 4HZLB 3FTGA 1JZ6A 1T7VA 1IGIL 3OGCA 1X5AA 2AJSH 2ZCKL 1BF8A 3MC0A 12E8H 1UWXH 2DKUA 1KJ2B 3M1BA 4A6YA 4Y88A 4L4TE 4OM1H 4JFDB 4HGKC 4JFYB 4X0KB 1MFCL 4HKBB 4RSVA 1FDLL 2W9LA 1MIMH 3UCRA 5EUOE 2FYYA 1RFDL 1MJ7L 2K7QA 4FZEL 4GXVH 4QRSA 3L5XH 4Y8DC 2DIBA 4AT6A 4BQ8A 3HC4L 2KZ1B 5HHXH 3BX7C 3SDAD 2IBGA 3AUVA 1II4E 3GSVA 3B3IA 4LLMB 4YDIH 2QADD 3BISA 3PHQA 5DC4B 5BJTA 3KPRA 5F9DC 2X09A 3I75A 2HFTA 4TUOB 4X9BA 5D4QA 2QR0B 4JKWA 4X6DA 3I6LE 1DE4B 3WUZA 4FMFA 1OAUL 1A7QL 2HJFB 5EA0L 1TVBA 5I71B 1CXFA 1NH6A 5LQBH 1FVCB 3DIFA 3GZKA 4UV4H 1TXKA 4QRTB 5IEKA 3EGSA 3T0WA 2RCSH 3CD4A 1U8JA 2CIKB 3E2HC 3PXJA 5EZIL 1JNLL 4ZUWA 1OB1A 4UT6L 2V2XA 3X12A 1LEKB 2F54D 2RAMA 1OTTC 3C60C 5GRUH 5L2JA 3I6GB 1HXMA 4PJGA 1T0MB 3AY4A 4HQQL 2NX5A 4NQEA 4L4TD 4YPGA 2EDKA 3SQBA 3EDKA 1WT5C 1ACYH 2BXYA 5IT2H 3BEVB 1RI8A 3ZYIA 3SGDH 2BOBA 4PJGF 5D6DC 4PRPA 1ODAA 3QHZL 2DQEL 3WEXA 3MRGA 2HLAB 3P0VL 1XF2A 2N7BA 4HFWB 2IPTH 3H9SB 4BM7A 1ONQA 5F1SA 2QJDA 4PYHA 1WAAE 3BFOA 3TBYA 3VXNA 2AJ3A 3QHFL 4OCYH 4PGBB 1GRWA 1CFTB 1DQJA 4OGYL 3H9ZA 4FFZH 4OTXH 3ZDYF 4KH2A 4JRYA 1BFOB 1G9MC 4XC3L 5GRJH 1BIIA 5I73B 2A9NL 2H2PC 5F6HJ 4HLZH 4JDVB 3C5ZA 3EOAB 4RGOH 5DMGC 1B0RB 2HG5B 1X6NA 2YPVL 2EXYC 4P2OC 2RFXA 3L3DB 2NY2B 3O6FC 3L3IA 2UZXB 1ZSDA 1A6AB 4XPFL 3FCTA 5FOBA 3SCMC 3W0WA 4CVXB 2HT3D 1DUZB 3MREB 3BE1H 4J4PA 2NTFA 2CDEA 3NIFF 1Y0LB 5C0AE 1CE6B 1RVFH 4CKVX 4YE4L 1FPTL 2F58H 1TNNA 4UV7H 3UZVB 1V3LA 1I7UB 1ND0A 5I1CL 4U1GB 5D7JC 1U95A 4QLRA 1GGYA 3QUXC 2V17L 5JOFB 3CH8A 5DZOA 1QUNA 4LVHC 2ICCA 1ZHKA 2MHAA 3MUGA 1W8NA 2GY5A 4HUXA 3SDXB 3VFGH 2XI9A 2E27L 2P1YA 1BVKA 4Y2DD 3QWRD 4NWTH 5K9JL 3NBNA 5DS8B 5IHBA 1G0YR 4MWFA 4K7FB 1CGYA 3IGAB 1PLGH 4ZUTB 2NY4D 5DSCB 5I66A 4H0IA 2ZPKL 3KHOA 3U7AA 2QHLA 1R3IH 2VLJB 3RU8L 3GMLB 1OAYL 3GI9H 4Y7MA 1CDYA 5GS1A 1HZHH 2VR9A 2D9QB 1BQHA 5L6YL 4TPRH 3P30L 3MLXH 4V2CB 1H0DB 4ODUB 4P49A 2OK0L 1I7TA 1YJDL 3FZUC 4G6ML 3LQZA 4KRPD 1R3KB 1T1YB 1JHKH 4JG0H 4B7IA 4JY5H 5C0AD 3RA7L 4IIQC 3WLBA 3NH7L 1YEIL 3BQUD 1L7IH 15C8H 1JF5A 1NBZB 2XA8L 2FEDD 3KWWA 2BRRL 3P73B 3EO1A 3BKJL 1MFAH 1CGSL 1GZPB 4Q2ZA 2H1PH 4H26B 2OR9H 3RGVC 4MA1B 5DUML 4WGVB 2DQDL 3MV9E 2IMMA 1FV1A 4MLSA 5MEQA 1A1MA 1RPQA 3E6HA 2WLZA 3UJTH 1AXIB 3HE6B 1MCPL 1OSPL 1ZK9A 3KPSB 4HWUA 4Y4HA 3UBXA 5J6GB 1DL7H 3PDOA 1TPXB 5J13B 5CJOH 1UM6L 4Z7VB 4I0PB 4OSUL 4Y5VC 1PQZA 2R2BB 2W0FB 2VXTH 1W8OA 3LZFH 3EBAA 4LOUD 3VCLB 3ZKQD 1AP2A 3KPQB 3DI2B 1GYAA 4URTB 1BMGA 4YLQT 2AXGA 4RAUA 4XMKL 4N8CL 4ZUSB 4LGSB 5K59E 2WANA 2NW3B 2XFXB 4MXVE 4N8VB 5D2NC 4GRLC 4JKMA 4JREC 3MRIB 1IC5H 2CLRB 3MRLB 1WBZA 5F6HI 4CVWA 2WBWB 4K8RD 5I18L 3QUMH 4FA8A 3BIBX 43C9A 1A2YA 3QFJB 3JUYA 4XAWL 3IXAA 1GPOL 1QLFA 1FGVL 4OIIH 5AUMB 2WV3A 3PDDA 4HUNB 5DRZB 2WIMA 1ZLSL 4Q9RL 2APBA 3MLPA 2DRUA 5C9JB 2P5WE 5GJSH 4MQXC 1RZGA 4WHDA 1D5IH 3MV9D 1EGJH 4OI8A 2Q8BH 1WBXA 3RZCA 3CFDA 3WIHH 1JNNL 4H8WH 4P9HL 1S9YB 4X6EB 3LS4H 1T66C 3HR5A 1C8PA 1YA5A 5ICZB 4RIRB 4A6YL 3LN4B 1CDBA 4YHMH 3RWJA 1UJTA 3TN0C 4X7EC 3MCKA 4YR6A 5DMKB 3VWJA 1IAOA 4OCRH 1D6VH 4Y4FB 4ZAKC 3PIQB 3E3QE 1HHHB 2W65A 2FECI 3UYOD 3MXWL 5E8PA 3GSWA 1I1AB 1H3XA 5ID0B 2OL3B 3FT3B 4C58B 1PD6A 4HIIA 4CADA 3SE8H 1UA6H 1AIFB 3QXDB 5IMKB 5KZCB 2HTLD 4LCYA 4PTUA 4ZFOB 4HUMB 5TH2A 1FFOA 4L29A 3PF2A 1YQ2A 1LP9B 2VISA 3IDXL 4F9PC 5CD3B 3JTSB 4PJ8A 3QNZA 4XHJD 3R06B 3CDYA 4GRMB 3DYPA 3GIZL 2R2HB 5D5MB 5EIQA 2EDLA 5F8QC 2XOTA 4J1UB 5F97E 2FWOA 4PR5A 4M6NH 2ATKA 1HIMH 3KPOB 4DZ8A 3QT2A 3FO0L 1UB5A 2V5MA 3S37H 1GCFA 4PD4J 1CTNA 5DEGA 2YWZA 5L7XH 1CGVA 3IAGC 1KXVC 4D2NA 5B3NA 5C2BL 2PO6A 3TT3H 2O5XL 5K9KB 4ERSH 5E2VH 1WZLA 5LGKA 4M43L 2XQYG 3LH2H 2R0WH 3EKCA 4PJ5A 5KVFH 3QI9C 4IRSC 4F7TA 6FABL 1IM3A 4QYOB 4QNPF 4XMLL 3QUKB 3TWCH 4P23D 4HIHA 4S2SA 1ULVA 2VDMH 4BK5A 4IEFB 2VXUH 1U8IB 3HB3C 3MRQA 2V7HA 4U7SA 3UYRL 3MNZB 4EVNA 4HKJB 4M7JH 1IM9D 2R0KH 1D3CA 3CLEH 1MJUL 1IQDB 1JHLH 4P4RB 1JWUA 3F8UB 4LVNC 1PSKL 4Z8FH 3PWPA 2Z4QB 4KK9D 1YMHA 4PRAB 5EORH 5J9PA 3AMKA 3MV01 4Y19E 5EPMA 4U1JB 3G5YA 5I1IH 4LSDA 4ONHA 2OTUB 5ILTL 4LIQE 1AC6A 4C4KO 2IANE 3RTQB 3TC9A 2GCYB 4OZFH 4NQVA 1QVOB 2OBGA 3K81A 3UDWA 1HKLL 4MS8D 3ARRA 3TH4T 1ORQB 3ZKNC 4G8IB 1J5OL 3O8XC 1CLOL 5E8EA 3ARYA 3MLWH 1NFKA 2VZ1A 3QUMA 3CFEA 4NQDB 4M61B 3TVMA 5GGQH 3VFVB 4JR9H 2QQKH 3O3BB 4GRWE 1W72H 4AIOA 5L2KB 4LPWA 4JPIA 1J0YA 4H25A 5T5FH 1XH3A 3DVIA 3V4PH 3CJJA 1N5YL 1J88A 4OGXL 3UJJH 5EU6B 3LY6A 3I50L 3KS0J 3BRGC 5E6IB 4I48B 4BSVA 1CFNA 4YUEH 4W4OC 1MQ8A 2CRYA 4KU1A 4R4BA 1EGJA 2WBJC 3ORJA 3SKMA 2IFFL 3JTTA 1QSEB 5HY9A 2ZJSL 3UXFA 1WTLA 4BH8A 2O5ZH 3BI9X 2FEEL 3WIHA 4AEEA 1LDPL 1P4LB 3AREB 5SX4I 4JY4B 3S37X 3EFFB 1FIGH 5HHOA 2I07B 3W11C 3VE0A 1ZT1A 2AJSL 4ODXB 1CCZA 4CDHA 4PJFA 5I1EH 2X89A 3RJDA 4IRZH 1IKNA 3V5DB 1WV7T 4YBQC 2DQCL 4Y1AE 4PJDB 3H7LA 3TNMA 2VWEC 4OM1L 1MREH 4Y19D 3OHXB 1H3VA 5F70A 2XTLA 5K9OB 4HUWA 3QDAA 1FO0B 4W70A 2IAND 4PJFF 3DHJA 5IB2B 1MIML 5DUBB 1KTLA 5FCUH 4KZEL 4PRBB 1Z9SA 4HAGA 5ENWB 25C8H 3BVNB 3X3GL 4GXVL 1WBYB 3L5XL 4J3XA 1ZEAH 4UIKH 3OKEB 3UTTE 1NUGA 5HHXL 4G6FD 3BDXA 3EOTH 2IFGA 2IQ9L 4O02L 5JUEL 1K8DA 2WIIA 4YDIL 1FG2A 2GSIB 2W07A 3D18B 1DLHA 3OXRA 4PPTA 5GQBA 1BD2B 5IHLB 4X6CB 5HPOA 1ETZA 1OP3H 1NLDH 3O2WL 5I2IB 2APVA 8FABA 4HIXH 5TPWH 3V6ZB 4JFEB 1IILE 5AG8A 1DN0B 5GHWH 1FFPB 4YHNB 3PV6B 3QXVA 1DVFC 2HFFA 5C09B 4XCFH 4JPVH 5LQBL 4J3VA 2YPLE 1QPPA 2DM3A 3CX5K 1G7MB 4AIZA 3T0EA 2P44B 5GRXG 4OV5A 3V0VB 1R3LB 3SE3A 4OF0A 4X7TB 3RWHA 3SOBL 3GSOA 3A0OA 5F72S 4EDWH 1M7IA 1Z0MA 2CLZA 4X80H 2L4OA 2X4UA 5GRUL 4QRQA 3K7UA 5ESVA 1T0NB 3WO4C 4Y1AD 1X44A 4RMUA 2JB5L 4UDTB 4X4ZA 1WIUA 3EOBB 1ACYL 5IT2L 1EHLL 1AC0A 5ANMB 1MUJA 3KLHD 2H32H 4MAYC 2JJTA 5D1ZC 5DVNA 4Y16D 1ROWA 2YN5A 4ZTOH 3CU1A 3IFPB 5DWUH 3UTTD 4NQUA 2IPTL 4JANB 5A2LH 2UWEB 4Z0BL 2X1PA 5IB5B 1BZ9B 2VH5H 1R24A 2X9XA 2R1YB 1N59A 4QOKB 2ZWLT 4MNGB 4IHOA 4M1DL 4U0RB 4FFZL 1HHJB 4OTXL 1U58B 1WQVT 1U8QA 4Z7UB 4XBEH 2ERJB 2QTEA 5GRJL 5DD0H 2XACC 4HGWA 2D31B 2DDQL 5AZ2H 1D6EB 1I85C 3ZL4L 1MHPH 3VXME 2DQHH 1A8JH 4ZSOE 3L3GA 1OTSC 3P4NA 1JPTL 2N56A 4XP5H 5IV2A 1WF5A 3NCJH 4C4KT 4YX2H 3QUYC 3LQMA 4GAYB 1T7XA 1X5IA 1FJ1B 2ITDB 2NPLX 1U8MB 3PABB 1BLNB 3MJ8A 1KNOB 1T89A 4MMZC 2GAZB 2WUBL 3H9HA 1G7IA 1W72A 5JORB 1A02N 3HS0B 1GGIH 2H45A 4X6CE 2X4NA 2IPUG 4G6JH 1HYSD 2VQ1B 3HG1B 3P4MB 2C9AA 2BMKB 2JCCA 4RRPA 4WEBH 3RIFF 4K94C 1UH2A 2LAAA 2RHEA 5IFHH 4NT6A 4NN7C 1X9QA 5DQJA 3O9WA 2GTZB 3DO7A 3TBTA 5E5MB 2JCCF 1Q9LB 4Y4KA 3UTZB 3C6LB 2GJZB 3AB0C 5FGRA 5IG7A 4G5ZL 3DRTB 5KSBB 3ULUD 3CC5A 3VFNB 4ISVB 4DGIH 2A2QT 3GI9L 4ELME 2Y5EA 1HZHL 3O4LE 3N50A 3VXMD 1QBLL 4X7SH 2ADFL 4PLOB 4F15C 1I9RH 1CIUA 1RIUH 1F8TH 3MLXL 1DANT 2B5IC 4YHZH 1UZ6F 3U6RB 3MFFB 4U3HA 1TQBB 4XVJL 1DQQB 4ODSH 1SJEA 2XKSA 3D9AH 4XNUL 4K71B 1JHKL 4JG0L 1BREA 3EO9H 3QBTB 4MXQC 5FF6B 5GGRA 3T4YA 4LAQH 1KN2L 2VXVH 2JIXD 1P6AB 3CDFA 3MYJA 2ZCHH 3ARFD 2YOCA 4ZG1A 4YEEA 4LGPB 3WS6A 4HUUA 3WJJC 1E4XL 2CKBB 5IROA 5J11B 2A77H 3IDJA 1VEOA 5EO0B 1T2QL 5KOVC 3VFOA 3QZWA 3H7BA 1VADB 3KHQA 1MFAL 4WCYH 1GGBH 4MQ7A 5DD1H 3D39A 4P99A 1OD7A 2J8UE 2H1PL 3MBEC 5HDBE 2OR9L 1OAXH 4U6YB 5HHPA 2YXFA 4QRPB 5D1XB 5GRVL 1IE5A 2DN7A 3GUTA 1QRNB 3DWTA 4I18B 4GS7B 3FT4B 1INQB 1AJ7H 4KZDH 1VACB 4WI2A 1BVLB 2NYYD 2P5ED 2Z92A 3RWCA 4WU7A 2HKFH 1DL7L 4K7PH 1SYVB 2VKWA 4YHOH 1RZ7H 4MQTB 3LIZH 1NGZA 2VXTL 4PP1C 4XC1H 3O4LD 3EHBD 2FL5B 3LZFL 4OF5A 4NM8H 4HBQA 4WWKD 1X4YA 3LKNA 1XFPA 1YEDA 5CWSB 1SEQL 5I1DB 4G9FB 5HYJD 2OR7A 3FRPG 2EYRB 4WW1A 3BH9B 4XAKD 3WL9B 4EI5A 1CGUA 3S4SG 2I60H 3QUML 1U91B 3QEGH 1HKFA 2VZVA 3BP6B 2E7LA 5B21A 3ZDZE 1GHFH 1P4IH 4OCWH 1U8OA 2YR3A 3WUWG 4OIIL 4LKXB 3WHE0 2VERN 2NY5C 3CFKA 4QHKJ 1EV2E 2CH8A 4WJ5A 1CGXA 4MJIE 3G04A 3IF1A 4HCRH 3IJYB 2HKHH 2QSQA 4ZFZB 2B20A 1D5IL 1EGJL 3RL1B 5SV4A 2OTWB 3QQ3A 4OKDA 2VLKE 2EE2A 1YY9D 1IAIM 3WIHL 2AJUH 1EIBA 4XZUB 1LO0H 1ZE3C 3DVGA 2J88H 4HV8B 5JW4Q 5EU4A 4CAGA 3P0YH 3VU2A 3ET9F 2XNAB 3MV8E 2IF7A 1FP5A 4UQ3B 1UQSB 2XWJA 5F89B 3PQYD 4YHML 5IQ9B 4R2GD 2YC1A 4OCRL 1LE9A 1D6VL 5GRVK 1KTDA 4PRHE 4G8GE 5J4MA 4NPYA 1EH9A 5E99L 5JPNA 2OYPA 2F8XC 3C2AL 3F62A 1OGTA 2NY1B 3G5XB 2IMNA 3X13B 5BRZE 3SE8L 4ESKA 4Z76A 1I3GH 3GSNH 1CGTA 3OWEA 2HN7B 4WI9A 4DW2H 2BZDA 4Q7DA 1NC2A 3NACL 1CICC 3LCYA 2XWTB 4EI6A 3DGGB 3QG7H 3CMOH 4L5FH 5A1AA 1MQKH 4XRCB 3TZVA 4KAQH 4XB8A 5EFIB 2D0HA 5F6IB 2OMNA 4PREB 5EG6C 4MJID 1CGWA 4M6NL 5C8JB 1HIML 3FL7A 2X4QA 4NRZB 5C07A 3DVNB 3FO9A 1YY8A 5B38A 2ZUYA 3S37L 1S7QA 5J1AA 5C0ND 5HYEA 3ARPA 4JN1H 3MO1B 5MENA 2F5AH 3QWOA 4ZUVB 3QIUB 1QLEL 1FL5B 1SMAA 3MV8D 5DQDH 5FIEA 3VMPA 3IU3B 2BNQE 4O00A 4WW2B 5GZND 3CVHB 5DVMA 1F4WL 1P1ZB 4UOW0 1E27A 2ICWA 3ARGB 3ECBB 3BXNB 2XRAH 3LH2L 4CW1A 5DJ6B 1YPZE 4PRHD 4G8GD 5HYSA 3LEXA 4EXPX 3CUPA 2D2OA 3P4OB 2JLLA 3JUZA 4CU6A 4PGDA 3WCYA 1QACA 2EIBA 1KG0A 4M7KH 2VDML 4DN3L 3A6OA 1XMWA 5DXWA 2IG2H 3CXHK 4XXCA 4M7JL 2R0KL 3VWKA 2A0LC 5DDHB 1LK3H 3F58L 1JHLL 3B9KA 5T5NF 1X7QA 4DN4L 4DUVA 1L6ZA 3M17B 5D8JH 4Z8FL 4G8FB 1OSZB 2DYPB 3ARDD 3BH8B 4PGJA 3OPZH 3ELAT 4BUGA 3WHXB 1CFQA 4NJ9L 1YYMH 2LABA 2P45B 2VLLB 4Y5XB 3SDAB 1HK6A 4F57L 5JQ6L 3DXAE 5D71H 4U1GC 5DD6A 4BH7B 3ZTJG 1LQSR 3RIAF 3VXSA 4R0LA 3EJYC 3MLWL 1C12A 2YS4A 3MV7D 3BJ91 2BNQD 3F7QA 2VDNH 2C1PB 2Y7QB 3VMOA 3BESR 4JR9L 2QQKL 3S3SA 4F7EA 1W72L 4R26H 5F9JA 2XY1A 4YNYB 5D2LE 1XF3A 2I27N 4YGAB 5DMJB 3V4PL 3W2DL 3H9YA 2W38A 3AU1A 4WENB 4Q9CA 4DKDC 3DMMA 1MCOH 2A6KB 2ORBL 1I8IB 1MCCA 2F53B 1NFDB 3WIIH 5E2UH 2F54B 4NBZB 3HZVA 4YUEL 4HCRA 1R0AH 4C56A 1F2QA 5DJDB 4YQXH 5J1SC 4HAFA 3G5VA 5C1MB 5JO5A 3KR3H 3V4UH 2O5ZL 5J0BA 4OIBA 3RDTB 4U6TA 4UAOB 1W0YT 1FIGL 3CSYB 5BOPA 2MOVA 3SDYL 3F6IA 4PTTB 4CBPA 3FQRB 1IGMH 5I1EL 4PBVC 4RAVA 1EAJA 5IHZB 4JCMA 3BN9C 1MREL 5CP7A 1VGKB 2Z91A 4XNMB 3GHBH 5J6HB 1QSFA 4AENA 4XVUD 2UYLB 3DXAD 3U48A 3QEQE 2G5RA 1KLUA 4PP2B 1G9NC 4JFFA 4GMSH 1S9VB 3B8YA 4ODTH 2PTTB 4UIKL 4NYLA 5FCSH 1JZ4A 5IJKC 4MDJA 1W0WA 4FFYH 4WEMB 4DZBA 3EOTL 2R0ZH 2YD3A 3GSNA 3QJFA 1E6JH 5H35B 4GUPB 3PHSA 1J0ZA 1CD8A 1GXEA 1F58H 1VSCA 2Q1EA 3DUUB 5TJWK 2WQ8A 4HIXL 5TPWL 3HE6C 4LLYB 3BKML 5A2FA 2CIIB 5F1NA 5TE4H 3W9DB 1VKXA 4UIMB 2Z35B 1EX0A 5KS9B 3QISA 5JPMB 1K3ZA 1J0HA 3FFCA 4EN3C 2AK4A 1OCWL 5GSRA 3WIFA 2HAZA 3FQNA 1GC1H 1ZWIA 2VDLL 5IBTH 3B6SA 5CJQH 3TBWA 3HE7D 4G80B 4RFEA 4EDWL 3I3DA 4GAFB 1VCAA 2FBOJ 5D70H 3Q6GH 1X4XA 3JXAA 1S78C 3KPPA 3LS5H 1P7QD 3EJZC 32C2B 5EC2A 2I5YH 2WSKA 4LDLB 3IFOB 4M8VA 3PL6A 3QEQD 5HVGB 5AD0B 5E0QA 4KJPC 1DJSA 1RMFL 5AZEH 2EH8L 5E6YA 1F3DJ 4OF6A 3KPRE 2F53E 3GMNB 5DWUL 1ZGLP 1K4DB 5T1DH 5T1KB 2AXJA 1GAFH 1VFBA 2IH3A 2VH5L 3OR7A 4E0RB 1KB5L 4JZNA 3LKOA 3GMQA 4LRIA 4NZTL 1CR9H 4DOHB 1WCBA 4YXKL 4O51B 1JF1A 5E5RB 3MLUH 2H9GB 5T3XH 1RIHL 4EUPG 5DJZB 5E2WH 4XBEL 4KUCF 5EBWA 4LPVA 2ZUVA 1H9VA 3DX7A 4KRPB 5CINL 1MHPL 2DQHL 2H6PA 4NO2A 5HYQB 4S1SH 4XP5L 2A6IB 3QP3A 3VXOB 4IOFD 2X4RB 4YX2L 4PJGE 1OL0A 2M26A 1OP3K 4EDXA 3TA3B 2NX5E 1I1AC 2E7MA 3HUJA 1HHGB 1MOEA 5KSAA 1SEBB 1DFBL 2EDOA 3RNQB 4YFEA 1G9EA 5I9QB 4R7NA 5IFJA 1NGYB 4PRPE 5D7KE 4Z9KB 3HUJF 4OGAD 4X9HA 1I7ZA 4J8RA 3B5GA 1GGIL 2E5EA 3BEWB 4PRNB 3ZDYE 5DUPH 4MCYB 3JV4A 1FNHA 1SY6H 5LXGH 1CD9B 1MH5B 3CPLB 3KPRD 5IFHL 2DWDA 1XIWC 3I3BA 2HTKD 5CZKA 1RK0A 4LNRA 5CJBA 5C0DA 3HR6A 1CT8B 1OQXA 1FFQA 3CDCA 1NJ9A 1QBMH 1MJ8L 1T7ZA 3NIFE 5JW3H 4NDMA 5BV7B 3GM0A 1K2DB 4PV8B 4X7SL 1AO7A 3T77A 2J4WL 1F8TL 3T3MF 4OLWH 2B4CC 5C0EB 3NZHH 3R1GH 4YHZL 4B5EA 3R0MA 4ODSL 4P2QB 4GJTB 3IETA 4L3CB 4P5TA 5EWIL 3RQ3A 4Q97A 5GSVB 2NX5D 2FRGP 4NQED 3N1MC 3EO9L 4LPCA 4NP4H 4JGMA 4LAQL 4XNZC 1GGTA 4JM2C 3FT2B 4LHJB 3NFSH 3ROOA 3SN6N 4GQ9H 3STZB 5DEFA 4PUBH 4OM0H 2ITCB 4PRPD 5D7KD 3ULVH 4YEFA 1A7RL 2NY0B 3MCG1 2OS7A 5CJ5A 3SQOH 2IJ0C 5IW3A 1CL7I 3FRUA 1FZJB 4U1HA 2Q8AL 3T4AB 3P9MB 3VH8G 5HPMB 1DBBH 3QPQD 3SO3B 1FNLA 4WCYL 7CGTA 4L9LA 2WWMD 4K2UH 1S7RB 4H20H 5IVXF 1PFCA 1C16B 1EK3A 4MD4B 4QHMB 3LN9A 4JRYD 2HMID 4J3WA 5C0RH 3TIDB 1E4KA 1JWMB 1A1OB 1ZGLB 5EBMA 2F74A 4GKZB 3C5ZD 1AJ7L 4KZDL 5FUCC 3IVKB 1JP5A 4G6AC 1A4JA 4OD1H 1FVEA 4ACPA 3IDYB 3OKNB 1FIEA 3VFSA 1Q94B 1RZ7L 4G42B 3LIZL 4TSAL 4R96A 3GDBA 3DPBA 4XC1L 1I1FB 4KJQD 2OSLB 3VXPB 4NM8L 4WFGE 3W0WD 1UXSB 3DETC 4J4PD 1EBPA 5I8KH 4KV5F 4LCCB 4I5BA 4G8EB 5C08B 1A3RH 1RY7B 1SM3H 3HAEG 5CSZB 5DK2A 4LCUA 1BF2A 4G3YH 4NSKB 2A9ML 3C2SA 1R5WA 4M3JA 5E6IC 1P84J 2GFBA 3GSRA 4TVPH 5FO8B 2IADA 3OKDB 4WHYH 4YFLI 3VXRA 4OCWL 2E3VA 1XGYH 4ZPVA 2VDQH 3MRJA 1FVDB 2DD8L 4QRRA 2GW5A 5DLMH 4ZS6C 4HX1A 1ZVSB 5C3LD 4XP4H 2YBRA 4X7CC 4Y5VA 3VFMB 1RUAL 2XPGB 3Q3GA 5MHSE 4S11A 5F7NC 1D5ZA 4PG2C 4QRUA 3VXQA 5I1GH 4MA8H 2C1OA 2AJUL 4KVNH 4LK4A 2JK5B 2VE6A 3H0TB 1LO0L 2PXYA 2CLVA 4JKKA 4PS4H 4PV9A 5CFHA 2HT4C 3P0YL 4GRLA 3MFGB 1S7VB 3BDBA 1BVZA 1OW0A 4P23B 2AJZA 4KROC 1ZHLB 1QFHA 2B7DT 2DL2A 4H5SB 2ATPB 5DHVH 2KQMA 4ORGA 1F02I 1IM9B 1U3YA 2XZCH 3RZWA 5CBAB 5ICXB 2OX5A 4WO4C 1AGBA 1CFBA 1LMKA 3B2UD 3MOBH 2FH8A 1SY6A 1JYVA 2CK2A 5ACZB 3SDDD 1YEHL 1YMMB 5JXEA 2P7TA 4U2YA 1I7RB 1H8OA 1Z5LB 1ZA3B 3LPGA 1I3GL 3KPNB 4UOJA 3WJLA 1MPAH 3RWGA 3RIAK 3MRKB 1JK8A 1WWBX 4GXUN 4DW2L 4WHTA 4FXGA 3WNKA 4P4KA 2UVEA 4I2XB 3QG7L 3STLB 3TJHC 2XTJE 3CMOL 3LKSB 4L5FL 1Q9WA 2GJ6B 2BC4A 1DLFH 5EU7C 5BMFH 2GUOA 3OB0H 2CDFA 4TVSa 4OZHB 3TN0A 1A6UH 4GBXA 4ONGH 4Y4HD 1K5NB 4WDIB 4I4WB 3MRNB 1CFVH 5IW6B 1CU4H 2Z31B 4JN1L 3VRIA 5I75C 2FHCA 1HNFA 5F88B 1U8LB 4OZGF 2F5AL 1MAMH 1S7TB 4IMKA 2ZSWB 1BFVH 2HLFD 4PGEA 5C2UB 5CHNA 1TZGH 1A1NB 4XCEB 4JFXA 4O9HH 1D9KB 3SJVB 1UKQA 4YFDB 3OXSA 2D7QA 1KLFA 4UB0L 1PG7X 1NSNH 2BP3A 2NZIA 3ULVF 2ERJC 1JGLL 1BJMA 3QQ9D 4G7YL 3RBSA 1A3QA 5DI8A 3RVUD 4L8SA 3V7AE 3OZ9H 5EOCJ 1UJ3A 3O3DB 1KPUB 3VFUA 1E6OH 3I3EA 1LK3L 4N5EC 1D5XA 3ARBC 4UTBH 1OPGH 2XTJD 4PJEA 4IRJB 3OPZL 3U9PH 3RX8A 3BIAX 4JJHA 4XHQA 1YYML 2R39A 1RJLB 2N1KA 3RZCD 3PWLB 4M02A 2Q3ZA 4PJEF 4E5XB 2CXKA 3DURB 3QI9A 2F8OA 5BS0B 3WUWB 4BFGA 4QNPE 3HPLB 5HVHB 3VWJD 4FQHB 4LLDB 4PJ5E 4LMQI 3BD4A 3QUZA 3T8XB 4R90H 2BSRB 3UJIH 1UM5H 3BPOC 1T4KA 1G7PA 3X14B 1JWSB 1WJ3A 4HG4K 1T1XA 4WY7L 3K4AA 2YXMA 2OJEB 1W0VA 1Z9MA 4Y89A 3P3YA 5FDWA 2BVQA 3WIIL 5E2UL 1R0AL 2LVCA 1A6WH 4YXHH 4YQXL 5BZDB 1JN6B 4JHWL 4PJ9C 5J1TC 4PJ8D 1T1WB 3HRZB 3PWPE 4O4YH 4LLUA 2G9HB 1QO3B 3V4UL 3EYVB 3TM6A 1AXSA 1XGQB 4MB5A 4ODBD 3REWA 4Z6AT 1SJHA 5IUSA 1KIRB 5DGQA 1TQBC 1IGML 2BDNH 1UB6A 1KJVB 4WV1A 3DOSA 2KQNA 4LQFH 2P24A 1GIGH 2FX7H 5CIPH 2G2RA 1UENA 3KYOB 3GHBL 5DHVA 3WKMH 1NEUA 2PO6D 4PIRF 1L0XA 5LAXA 1EEZA 2BFVH 2CKNA 4FG6C 2DWEB 3CDGB 1GZQA 1AQDB 1U3HC 3W81A 3TH3T 1UEMA 4PG9A 2Y07H 3T04D 1JRHH 2M8XA 1VEMA 4FFYL 4PJ5D 5E08L 2AV1A 2MJWA 5DK0A 2VNCA 1E6JL 4RZCB 2WBJA 3GO1L 3MRHA 1DQML 1FYTE 3STBA 3KJ4C 3NIDF 3NCCB 5F1IA 3FB7B 5DRWB 3S5LA 4I18C 3VFPB 3OQ3B 3QFDA 3UEZA 4WGWB 4MHHG 3LKPA 5TE4L 4C57C 1YEKH 3MLZL 4OBRA 4DEPC 5I16A 5IF0B 1KENH 4QHUA 5HHOE 5BVJA 5L8JB 1PKQB 4LBEB 3EYUH 4YHIA 3PWPD 4M5YH 3LKRB 3WDIA 4LASH 4PJFE 1GGCH 5TE7L 1GC1L 5IBTL 1RHFA 5CJQL 3UPRA 1NAMB 2HT2D 4PJBB 3U83A 4U6XB 2FJFA 1T2XA 5D70L 1BQHG 1IGTA 5FOJA 3BZEA 5ID1B 1MWAH 3LS5L 4LHUB 2D4DA 4TTDD 3WLWC 2XG5A 4N1HB 3MGAA 2JJWA 5KANI 1LNUB 2D4FA 2A83B 5ALCH 3QCVH 3RNKA 2YA2A 1UM4L 2DMBA 4J12A 1S9XB 2ZUUA 4I8DA 4PY7B 2B1AL 3TVMD 3DLQR 3ARQA 3D25B 2DI9A 1T5WB 3C8KB 1JPFB 2NY3D 2HVJB 4HJ0D 3BIKA 5T1DL 1RZJC 3ES6B 3MYZA 1Y18A 5E6ZA 1G6RB 3F7YA 3BN3B 3CK0L 4MX7A 3L5WA 3GGWB 4L3EB 2DQTH 1CR9L 5FUZH 3U46B 3BKCH 4P5KA 5E4EB 5E2WL 1I8KB 2Q7YA 3SGKA 3MZGB 4N9GA 3T0EE 1NQBA 3WE6B 4FQJH 5HHOD 2EH7H 1I1RA 4RMQA 2JIXB 1XR8B 3C5SB 3TO4A 5E2TH 3QO0B 4X8XA 4Z77A 1JTTA 3UBXG 2HRLA 2X89D 3QNYA 2XWBB 1HILA 3G08A 2CUHA 5DGRA 1TZIA 1S5HA 2NZ9C 1AGEB 3S35H 2GK0B 4CU7A 3K2UL 5KG9B 5EBGA 1HQ4B 1T20B 3O41B 3RAJH 5GGTH 1V3JA 4AH2A 3TYFA 3SDCC 5ETUB 5FYKU 4XB7A 5DUPL 4YK4B 2PTUA 5LXGL 4OCXH 2P5EB 5ADOH 5K9QG 1YN7B 1L7TH 2QSVA 4NN6B 1N5AB 1T1ZB 4XH2A 4ZXBB 1PKQE 4KQ3H 3E6FB 1B0GB 4OCLC 1U8KA 5IMMA 5DC9B 4HLZG 5B8CB 2AEPL 1DBML 4NKOB 1XF4A 3VXUA 1K9TA 4CMMB 2VKXA 5DK3A 1QBML 5HYJB 4XI5D 4M1CD 4OZIB 4PJBE 4UU9B 3QG6B 2DIJA 3DX8A 3GNMH 2GT9B 4XMPH 5CIPA 3T0ED 2XT1B 5C0IA 2BVYA 2Q86B 5IESH 4OLWL 4Q6IB 1ZLUH 1LD9B 1V7ML 5MEPB 1QBBA 2BX5A 1I8LA 1C08B 2I9TA 2KKQA 2WP3O 1EEYA 2MTPA 1PX4A 4MD0A 3WXVH 3NFSL 4F9LA 4GQ9L 4Y5YA 5D7LB 3PHOA 4PUBL 4OM0L 4FQQA 5FA3A 3ULVL 2JCCE 4Z7QF 1KJMA 1IAIH 5HD8D 5BXFA 4L9DA 4UT9L 4V1DB 1IKFH 1FZMA 4X5WA 4X4XA 1FSKC 4QHLB 4HWZB 4K2UL 4EBQH 4H20L 4RMSA 3BWAB 5EIIB 4PJ7B 4O2CA 1MEXH 3PQYB 1H3PL 3V7AG 3SDAC 5DJYA 5C0RL 1UZ6E 2QADC 3TCLB 1OT1A 1S5IH 3IDNA 4HJGB 3PGCB 4MDIB 4OD1L 5I1AA 3RWFB 2P48B 4C59B 1F5WA 3S35X 1RHHB 4KTDL 5BZWA 1MWAA 2I9LA 4LLVB 1EO8H 1TNMA 4YGVB 1TETH 3G6DH 1FORH 3QO1A 5I8KL 1X5GA 1XGRB 4O2EB 3NPZB 1A3RL 1SM3L 4L3AA 1EDQA 4PJAE 4EUPB 1FCGA 3GSUA 4ZNEA 4XPGL 2JB6B 2H2SD 1RURH 3EOYG 2GITB 3CNKA 4UQ2A 5IBLD 5F9WB 3OJMB 2VB5A 4TVPL 3OR6A 1U93B 4E41B 4ZFFB 4KY1H 1FC2D 1XGYL 5F7KC 3OKLA 2VDQL 1KCLA 2KDGA 3DUSB 5DLML 1PG7L 3O9WD 2NY6B 3A67L 3F7VB 1AE6H 4XP4L 3IKCA 1BEYH 4S0TD 2VLRB 4YFLF 5CEXA 4MNHB 4L4VB 4Y4KD 1R3JA 1SBBA 3GBNH 1F3RB 4TRPH 4UILL 2LU7A 4W6XB 5FGCB 5D7SL 5CBEA 1SBSL 3U36B 3DHMA 1WZMA 5DURD 4CVZB 3V6FB 1AKJB 4KVNL 5DZLA 3SPVA 2JJSC 2R23B 1QP1A 3QXWA 3CSGA 1QLRB 1LO4L 3GB7A 1KACB 2KBGA 1Q1JH 2EC9U 5EZJB 2AXHA 4GOSA 3ZSSA 1ZHNA 4K23H 2ED8A 4HBCH 1FZKA 4NQCB 2X9YA 5GGTA 1U8PA 2XZCL 1WAAA 1R6VA 2BERA 4JG1L 4N8PA 3QEUA 1P6FA 2GIYA 3QYCA 5IHUL 1QG3A 1WCQA 3HMXA 5MP6L 4HS6B 4KGLA 3EFDH 4ETQB 2NCMA 1WAAF 1Q72L 3I2CH 3ISWA 4MD5A 5JZ7D 2HT3C 3T2PA 1RJZB 1X5XA 4ZOBA 3V9FA 1BGXH 1NCDH 1U8HA 2CXGA 3NOIA 1CDHA 4JFDA 5TF0A 4Z78B 2GSGB 4X0KA 4HKBA 2YWYA 3D39D 4X99B 2VXQH 3W5NA 1CG9B 4LKCB 3MRFB 1WWWX 3OJDB 1DQLH 5FKAB 5DVLA 2O61B 2DJSA 1FNFA 2Q76B 1ORSB 5EUKB 3O0RH 3BGFB 3MLRL 4KDTA 5BMFL 4LSPH 1A6UL 3MV7B 4ONGL 4U1NB 4APQB 4Y2DC 3DUHA 1CFVL 1WGOA 1CU4L 2YKLL 4Q0XH 4TUOA 5HVFB 1QEWB 1YEFH 2P46B 2NY4C 3LEYH 4AIXA 3VH8B 1YECH 1P5VA 2G75A 1L0QA 1MAML 2WQRA 3O4OB 1J10A 2HJFA 3HA0A 3UP1A 2YD2A 2WP3T 1UWGH 5E95B 1FVCA 2ED7A 1XCTA 1SJXA 3KPMB 5DJ0B 4H88H 4O9HL 1TZHB 4QRTA 3D2UA 4YHPB 5DEZA 5C71A 1X5KA 1XGTB 3S96B 4R7DB 5F7DB 4WHCA 4GAGH 1UWEL 4EI5D 3HLAB 1RIVH 3HC0B 1NSNL 2UZIH 3IRPX 1LEKA 4NRXB 2V6HA 4M7LH 2R4SH 4KRPC 3HZKA 2ZNWA 3I6GA 3OZ9L 2P8MB 1U3ZA 1EJ6A 1SHMA 1E6OL 3BQUC 3HAEB 3BEVA 3NMEA 4KMTH 3U9PL 2FEDC 2EEBA 3PV7A 2HLAA 4NM4H 4HFWA 2FGZA 1MCFA 5AEAA 2V9TA 3C08L 3QIBB 3DSFL 3UZQA 1LK2B 3IFNH 3HFMH 4NKIH 5A2JH 4PGCB 5A2KH 1BFOA 3IKKA 3HRPA 3V0AC 2FSEB 1OF2B 4R90L 4JDVA 4JY6B 3KXFE 1UM5L 4OLUL 3OB0K 1B0RA 3PGFH 3GI8H 4LLQB 1EFXB 4HPYH 3QULA 3L3DA 4P46B 4LOUC 2ZUTA 2GI7A 5KAQG 2FATL 4CVXA 3QJHB 2APTA 1DUZA 2BK8A 5IEHB 3MREA 2MNUA 1NGWB 4J2XA 1Y0LA 1A6WL 4U0QB 1CE6A 5BV7C 1NC2D 2X70B 1LO5B 4O4YL 3FB5B 5EBLB 3NGBB 4LIQH 5CD5D 1T80A 3THMH 1MRDL 1P7QB 4K8RC 1I7UA 1ZMYA 4R97C 3TZVD 4FQIH 3GMMB 1Y6NR 4OLVH 3AM8C 3QCUH 1ZGLM 3VGAC 2H26B 5JOFA 2BDNL 5C07D 2BCKA 4LQFL 1EBAA 3SDXA 2X40A 2OL3H 2FX7L 1C1EL 4KDWA 4OZFG 1KEMH 4POYA 5MEND 1AI1H 3VXSE 1OM3H 1P9MA 1WLHA 4K7FA 3CH1B 4P48A 4ZUTA 3SDXF 3CCHA 5IVOA 5GIRB 1A47A 2RQ8A 5DC0A 4JCLA 3L3KB 2LE9A 3GMLA 1JRHL 3P0GB 1CBVH 2P5WA 4YHKH 4GQPH 3W5MA 4NZDA 5C6WH 2XIDA 2NQCA 5EU5B 1H0DA 4XWOD 4C56E 2VDOL 1TVHA 3O2DH 4ODUA 1RZKC 1PX3A 4NOFA 3VWKD 3GM8A 3S36L 2Y9RT 1R3KA 3IDYC 4KKNA 4D0DA 3B9KD 5CCKL 4QF1B 2PW2A 3D87B 5MI0C 1OLLA 1HN1A 3TBSB 9CGTA 3EYUL 4AEHH 2ZOLB 4OQ1A 4LASL 3C60B 3PP4H 1EHAA 2HTLC 4QRSB 4HWBH 2C3GA 4XGZA 2VC2H 1NBZA 1I8MA 1QSFE 3DX9B 2BVUA 4XHJC 4O5LH 3B3IB 4GLRI 4ZQKB 3LOWA 4PJXB 1GZPA 1QSVA 1C5DA 4H26A 1MWAL 4X7FC 4JFFE 2AQ2A 3VXSD 4X6DB 4DTGH 1Q9KB 4MA7H 5ALCL 3QCVL 2X7LB 1PG7W 1ZT4A 3N1GC 3EO0B 3KPSA 4ZOCA 5J3HD 2I24N 3RVVD 5KVEH 5J6GA 2LVEA 1GOHA 4I0PA 5FAAA 5AWNH 1H3WM 3D0VB 3SO5A 1J9CT 2W0FA 5HSFA 3VCLA 3DMMD 4HIJA 4U49A 4FTVE 3B5HA 3QZWG 2GTWB 5F96L 4JJ5B 5FUZL 2FLBT 3BKCL 1F2XK 4Z7VF 4ZUSA 4C56D 4P2OB 4XP6H 1S7UB 2CJUL 1GSMA 1HXMB 3E3QC 2XFXA 3O6FB 3DO3A 2NW3A 4YHLH 4N8VA 1OVZA 3MRIA 5CZVH 2AK4E 2CLRA 3MRLA 4P23C 2ZOKB 3SCMB 4FQJL 2ARJQ 5HDLA 2EH7L 5HJ3B 1LE5B 2BOBB 5E2TL 2HVKB 2ED9A 1A5FH 3HI1B 1LEIB 2DL9A 3TPUB 2EDYA 5C0BB 4ZMAT 3E8UL 1XF2B 2V7NA 5AUMA 4HUVB 3S35L 2YD1A 1WIPA 1C7SA 1QSFD 5DRZA 4KK9C 4MLIA 2EIZB 3TBYB 5B3JF 4QO1A 5HXMA 5C9JA 4RGNE 4KKCD 3MR9B 3TFKD 1RZIB 4DGIL 1NKRA 4LVHB 3BP5A 4JFFD 3RAJL 5GGTL 3CVIH 3F12B 1BPVA 1K6QH 2K1MA 1BIIB 2K3TA 3HMXL 5DQ9B 2NY5L 1S9YA 1UG9A 4FXKA 4X6EA 4MS8C 5C7XH 1OGAB 1L7TL 1KJ2L 2RFXB 1NMAL 3QEHA 4RIRA 3LN4A 3QB7C 1ZSDB 4N5UA 3LQAC 4LEXH 1KJ3H 4KQ3L 5DMKA 4QWWD 1A64A 3W0WB 4Y4FA 1MI5B 4JRXE 2XXMB 1FO0H 3ARXA 4E42B 2NTFB 1CE1H 1HHHA 5HGAB 3SBWC 1MCJA 3MJ7B 4XWGH 5ID0A 2OL3A 4XMPL 3FFCD 3FT3A 4PJXE 1ND0B 2A6JB 2AK4D 1U95B 1YNLH 1AIFA 3QXDA 5IMKA 5I8OH 5IESL 2D7TH 3FOMB 3HUJE 1TITA 4C83B 5E1AB 3UC0H 5GGVH 4HF5H 4Z5RA 1S7SB 3U0TA 4IIQB 1X5YA 5J56B 1AHWC 2XZZA 4YDVB 1LO2H 4JM4H 4YWGH 1VENA 3SKNA 1A6TA 4M62L 5D5MA 3WXVL 4MWFB 1LP9F 2FO4B 4LSRL 2XICA 5J8OA 3PL6D 4RGND 4RISH 4X98B 1K85A 1KOAA 4N68A 4NJAL 3RGVB 5D5MF 3O2DA 1FL6B 3PJSB 1ED3A 1J1PH 1F3JB 4XCYB 2C3WA 2GJJA 4KUCD 1JTPA 3LKQB 3MRPB 1NUDA 4ZFGH 5HGBB 2AERT 5LCVH 2P47B 1IEBA 3PDGA 1NPUA 1I7TB 3T3ME 4GFTB 4KPHH 1S5IL 4OLXL 1BX2B 1MJJA 2VJXA 3QUKA 3NPSB 4RMTA 3SDDB 1RUPH 2P4AB 1T03H 1V7NL 1U8IA 1AR1D 1EO8L 3MNZA 5D2NB 2EDJA 5TF1H 1TETL 3G6DL 4NNXB 5IFAH 3NFNB 1IQDA 3EO1B 1U36A 5KSAD 3RHWF 4XX1G 3RP1A 3T3PF 2OP4H 4Q2ZB 2AW2A 1S8DB 2Z4QA 3QDMB 4FQ1H 1I3RB 4PRAA 5GJTL 5IVXE 2YPLA 2B2XH 1N0XL 4H1LH 4KUZH 5HYSG 1JZ2A 2ZCKH 3MRBB 2O93L 4Y4HB 3RTQA 4OV6F 4PB0H 3U30C 1HSBB 3OKMA 4HLJA 3CU7A 3ZHKA 1ZLUK 4JPKH 1QVOA 3JWNC 5T5NG 2QKIA 3PDOB 3SY0B 1YNTB 3T2QA 3F6LA 5F3BA 1XEDA 3KLHC 3D85B 1MFCH 1T83C 2MFNA 4Y16C 1ORQA 3OL2A 1M7XA 3ZE1E 1BEYL 4G8IA 1KC5H 4TRPL 4GT7A 1A7NH 4M61A 1MJ7H 4U3XA 1Z9OA 4FZEH 3VFVA 2BHYA 5FM8A 3O3BA 4KV5E 3HC4H 2V5TA 5JA8B 4FABH 5INCB 1NCWH 5EB9A 4JHZA 1AO7D 5ESAB 5EU6A 4ZAKB 1ZLWH 1Q1JL 3U9UB 2JELH 1VESA 4I48A 4K23L 2XN9B 1A2YB 4UUJB 3TNNA 4P5TD 1A7QH 1QSEA 5IB4B 1B4RA 1UFUA 4F37F 1P4LA 3AREA 4JY4A 3EFFA 1KCKA 1BJ1H 2I07A 3AS1A 5F7HA 3I2CL 4DKEH 3VXRE 4Z7WB 2VR5A 3V5DA 1HWHB 3B4NA 1NCDL 2Z8RA 1D5BB 4ZSOA 1WBXB 1F13A 1A21A 2WNGA 1FO0A 1P84K 3G6JB 5I1KH 5IB2A 5HHMB 2VXQL 5DUBA 3LD8C 4GKOA 4PJDF 3HR5B 1KN4L 3D69B 4HQQH 4PRBA 4F2MA 1DQLL 1MRCH 5ENWA 3OKEA 1NC4A 1HYSC 4FXLA 3VGFA 2DQIL 4XNYH 2QHRH 1QFWH 1QZ1A 3GJFH 2Q6WB 2ESVB 4RWHA 1FN4A 3ALXA 4NCDA 5D6CA 5E8PB 2GSIA 5HGDB 3D18A 4TNWF 2ARJA 1BD2A 5GGSB 4Q0XL 5F93C 4X6CA 3BPNC 5IB1A 5CEZL 2HFEA 1AD9B 1YEFL 3LEYL 2W0KA 2X2YA 1YECL 1DN0A 3ULUC 1FFPA 3QHFH 4YHNA 4M7ZC 4X4MA 1F6AB 2NW2B 5C09A 1UWGL 4JVPA 4L29B 4X6CF 4PLNC 3WKNA 1RV6X 4KKLD 3PWNA 3VA2C 4PJ8B 1KT2A 4H88L 3VD9A 5EOCL 1G7MA 4YHYB 4GAGL 4HPOL 3QIWA 2LTQC 3V0VA 2F19H 3RRQA 4PR5B 2PYFA 2UZIL 2J5LC 3F7PC 2W9DH 3EDEA 4NNYB 4M7LL 4LVNB 1FRGL 3PE9A 4UT7L 3VXRD 2FCBA 4JVUA 4LPXA 1T0NA 3HZYB 5T3XD 2DAVA 1IMHC 4UDTA 4X5XB 5CUSH 4QRRD 5F7YC 2AXFB 3EOBA 5IWLC 2BVOB 2DQGL 3ARFC 5C6PB 3U2SB 4CNIB 1BOGA 1FPTH 2PO6B 4KMTL 5ANMA 5BW7A 3HI6H 2UVFA 4OZGE 5H37H 2XKNB 3IS0X 3PNWB 3IFPA 4NM4L 3ILQD 4JANA 4NRYB 2UWEA 2PXYD 5IB5A 1BZ9A 2V17H 3O8XB 4GRLD 1WEJH 2R1YA 3G5ZB 1JGVL 4QOKA 4U1MB 1MFEL 3HFML 2E27H 1KPVB 1HYRC 2UWEF 2YD8A 1U58A 3AC0A 2VLMD 4WI4A 3ZT7A 5K9JH 1IRAY 4Z7UA 3JZ7A 3ULVE 1CVSC 1LWRA 5A16B 2J8UA 2NYYC 2D31A 3Q48A 4M6OH 4ZUUB 4H1LA 4M8QB 3GI8L 3ALPA 5INDA 3DBXB 4HPYL 4Z7UF 3RU8H 3EHBC 2FZ3A 1YMHB 5JXED 4WWKC 5CGMA 5SWQB 4LCIL 4M1GH 2VTFA 4GAYA 2ITDA 1FJ1A 4ONHB 5HI5D 1U8MA 3DTXB 5LGJB 3P30H 4Z7OF 1HH9B 4P4KD 4J3OC 4LQ1A 4XVSH 3LSOB 3H8NA 4TUKH 1KNOA 3VFWB 2NTSP 2GAZA 5JHDB 4PJEE 4G6MH 5IIEB 5FUOL 5JORA 4OLVL 4W81A 3HS0A 1J8KA 3QCUL 4IOSD 3RA7H 5ESQB 3TN0D 3FJTA 3NA4A 4GBXD 3NH7H 3CFEB 2EDNA 3P4MA 5BCAA 4JQXC 2ZP0T 4U7MA 3TVMB 2BMKA 5LGHH 2OL3L 2EC8A 5SWZB 5MERA 1O0VA 4S10A 1N7MH 1QFPA 1WFOA 1OHQA 2RJMA 1HH6A 3BKJH 2GTZA 3JWOH 5E5MA 4JZJA 4NFCA 3UTZA 3C6LA 1F6FB 2GJZA 5EDXA 4X5LA 2WINA 3N85L 3DRTA 1YY9C 3CIQA 4TVPE 5KSBA 3ULVD 4R4BB 1BBJB 3JTTB 4BH8B 3TJEH 1ZA6B 4YHKL 1PEWA 5FGSA 1OSPH 2X6MA 4NQSB 5KSBF 4MZ3A 2X05A 3BWUC 2PTVA 2VLKA 1BZ7B 4R2GC 1UM6H 4OSUH 3U6RA 3MFFA 4OJFL 3O2DL 4CDGC 1YYLL 1FNGB 4LSTH 5FF6A 2Q20A 4NUGL 1A7OH 4XMKH 1KTLB 3CVHH 2FR4B 1BM3L 4NO3B 3U1SH 4RGMC 5I15L 3PP4L 2B4CL 4MB3A 5F8RC 1A7PL 2XQBL 4YAQB 2AVGA 2E9BA 5E7FA 2VC2L 5EO0A 5I18H 3Q5YA 5E03A 5I76B 1ERNA 1M4KA 1VADA 4O5LL 1K8DB 5C0JB 5BRZA 4MAYB 1DLHB 5D1ZB 3KYAA 1GPOH 3WBDA 4U6YA 3MZTA 1ETZB 3NIDE 4DTGL 2PETA 5D1XA 1LEGB 1CDJA 1QRNA 1ZLSH 3C09C 4ZOEA 4I18A 4Q9RH 3BKYH 3FT4A 3QUZD 1INQA 2HFFB 3HB3D 1CXLA 1VACA 5C0NC 5KVEL 4TVPD 2K7PA 4FNLH 2EO9A 2V9QA 1SYVA 3FQXA 4JB9L 1KIQB 5FGBA 4P2RE 4K3GA 5AWNL 1XAUA 1NCAH 2R1WB 4P9HH 5BOZG 5GZNC 1S7XA 3RVWD 3BZFB 1WFNA 4A6YH 2CLZB 3KYMB 4XP6L 1B6UA 5I1DA 4G9FA 4YHLL 5GS0H 3GBLA 1NMBL 2VITB 3BH9A 3UTQB 3WL9A 4TOYL 3QUYB 1BBDH 4OFIA 1PAMA 3MXWH 5CP3H 2NXYD 1MUJB 3BP6A 2R0LL 4YC2B 4XP9H 1A5FL 2BSSB 1Y6MR 2PCPB 4WNQB 1M1SA 3LB6D 5L9DH 4JFHE 4LKXA 4KRLB 1R24B 1K3IA 5FM5M 4TNVK 3MGTB 3ARDC 4ZD3L 1FNSL 5F44A 5IKCB 1WISA 1N59B 2HRPL 5FYKL 3IJYA 1TTFA 5KN5B 5LBSH 3CVIL 1CLZL 2OTWA 2XZQH 3RVXD 4OAWB 1H5BC 4OZ4A 2FJHB 1N0LA 3MJGX 4LCWB 4XZUA 5JW5B 3G9VA 1A7BA 2OM5A 4HV8A 2Q3AA 4XXDB 3MCLL 2XNAA 3AB0B 3FO0H 3KDMB 1DEDA 5IV2B 4X8JB 4OZFB 1MNUH 5F89A 1UQSA 5ICYB 3W11D 4LEXL 1KJ3L 1PEZA 1ADQL 4NO0A 4KI5F 3FB6A 5JR1H 2J8HA 3DROB 1NANI 5C2BH 1FO0L 5LG1A 4F15B 1IGFL 3L3HB 1A9BB 2B5IB 1C7TA 5CKGA 3H9HB 4B41A 3G5XA 3O4OC 2OQJB 1YNLL 5EZOL 1QA9B 4XNXL 4XMLH 3UC0L 5GGVL 5KJRL 3PWJA 4N0RA 3L95B 3NIGF 2XWTA 4NT6B 1OAKH 3TO2B 1LO2L 4JM4L 4YWGL 4XRCA 5DF0A 5EFIA 4UNVA 2W0PA 1NCTA 4MJ4A 4Y4KB 5C8JA 4NRZA 3B8SA 5IG7B 4RISL 2EYSA 3DVNA 3MBEB 4FFWC 1JPSL 3LDBC 1YJDC 3CC5B 1A3LH 4DFHA 4XVUC 4LF3B 3MO1A 2Z9TA 4PB9H 2F15A 5D72L 1B2WL 3RVTD 4MGXA 4ZUVA 3QIUA 1FL5A 3UROR 3IU3A 2NNAA 2FLRT 4WW2A 3CVHA 5LCVL 4P2CG 2RR3A 1P1ZA 2WM0A 3VXUE 3ARGA 2E6QA 3OKYA 3ECBA 3BXNA 5IR1B 1NGPH 1U42A 1U8NB 1XZ0A