3QG7L

Structural basis for ligand recognition and discrimination of a quorum quenching antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVLTQTPLSLPVSLGDQASISCRSSQRLVHSNGNIYLHWFLQKPGQSPKLLIYKLSSRFSGVPDRFSGSGSGTDFTLKISRVESEDLGIYYCSQTTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP4-24H11 Antibody Heavy Chain
publication title Structural Basis for Ligand Recognition and Discrimination of a Quorum-quenching Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qg7L01
1NAMB 1HI6A 3AU1A 2BNQB 2OTUB 1QHPA 1I3VA 2I9TA 4DGIL 5H2BB 4E0RA 1NGPH 1T0MA 4OLXH 2AJXL 5M94B 2ESVD 4YO0B 1JPTL 3DMMA 4F7CB 4F2MB 3MUZ1 1VACB 1FBIH 1KB5B 4PRHD 1AD0B 2J8UB 5MEQA 4MS8D 3NIFF 3CX2A 4JQVC 1H5BC 5DRWB 4PJHA 1E4KC 5MI0C 4YXKL 5IHLB 4ZOEA 5DA0B 3DGCR 5J06A 1G9MC 3E2HB 3D85D 4J7RA 1X5YA 3C8KB 5HGGS 3MBEC 2P24A 1HHHA 3UO1L 1JHKL 5HVWA 1OGAD 5KSBF 5DEFA 1RURH 2DQGL 4FZ8H 1MIMH 1V3JA 3D25B 4KU1A 2VL5A 4V2BA 2VLKA 2YXFA 3QEQE 3NACH 2AXFB 5E4EB 3WHXA 4KUCF 4BZYA 1RJLB 4ZUUB 4LMQI 4RGNE 5T3XE 4XZUB 2NXZC 3LKPA 5CD5D 4ODHH 4S1SL 2PETA 5C0DA 3UMTA 3SEPA 5DVLA 5C2UB 2G9HB 43C9B 3MLRH 2V5YA 2FYYB 4LLWB 4YK4C 1CI5A 4G9DA 3VXRB 4JVUA 1F4WH 4IRZH 1MCPL 2ZUYA 4PGJA 5CAYB 3CVHH 4YBLC 4KK6C 4U7SA 2ARWA 3DXAD 2IAMA 4IRJD 5C0RH 5FUZL 2YMXH 4QHMA 2QV2A 3KWWB 3QIWD 3U0WH 4QRQA 5D8JH 4WW2C 1MFEL 1CVRA 1CD1A 1MFDH 4RIRB 4DFHA 1TPXC 4YPGA 5EU6E 1CFNB 4NM4L 3NZHL 4FQJL 4X6FB 6FABH 2BVOB 5JQ6H 1QA9A 2VC2H 1ULVA 3GSOB 4LSPH 5DZLA 2ICWB 2CLRA 4PJXE 5J13C 3UTTA 5C0AA 1CK0L 4HLZG 5DD3L 3TBVB 2OJEA 5IWLA 3T0XA 1RZGA 3HC4H 4HIXH 4ZO7A 4OGYL 4OZGF 5HGBA 5IB1B 1N2RB 1A3LH 2L7JA 4K3DH 4S2SA 3HLAB 1Y6KR 2B5IC 3QQ9C 3ARED 5E2UL 2E6PA 5I74C 4LEOA 3M17B 1UKQA 4PR5A 3PWPD 1QYGH 4X0KA 2PYFA 3QHFL 3VA6A 3U7AA 1T20A 3AM8C 4QO1A 4H26A 2X1WL 2YA2A 3LKOB 4R7NA 1I7ZA 3BQUA 2PNDA 2YD7A 5IFAL 4FTVD 1PQZB 4XP4H 1XIWC 1I9JL 3O3EA 4EDWH 4U2YA 5DJYB 4M7ZB 2VDML 3MLZH 2C3XA 4EI5C 3DVFA 1MQKL 2CJUL 1P84J 3MRCA 4ZMAT 3P0YH 4DUWA 1MPAL 4DOHB 1XF1A 1JK8A 4G6AD 5DYOB 5IOPB 4AIOA 1T66C 3IKCB 4AEEA 1HHGB 2GITA 5D72L 3KYNA 3UBXI 4ZNEE 4M1CD 3MNZA 4HBCH 3VXMD 4NBXB 4LOUD 1A9BB 4GUPB 5T1KD 3CFJB 3CIQA 4QRRE 1VPOL 2VXUL 4IIQB 5INDA 2A6IA 2HJLB 4Z7VE 3U36A 2HJFA 3Q0HA 3MUJA 4RGOL 3T09A 3WD5H 4GMTH 2GY5A 4QHNB 5F7WC 4CADB 5DD0L 1NC4B 1KBGL 1FLRH 5MP6L 5CGYD 4UTBH 5E6ID 1EHXA 1KB9J 1YEIH 1JGLL 3CDCA 5ID0A 1YC7A 2EIBA 1EMTL 4M03A 3WSQL 5IVOA 2QQNH 1NMBH 4PJBB 3QDGB 5LGKA 1YY8B 3IAPA 4LLAA 1H3PL 4QF1B 4TTDD 5EU4B 1Z5LB 1FJ1B 4L4VB 1EO8L 3FN3A 5KSAA 7FABL 2R9HD 4WDIB 3IAGC 2VL4A 2NNAA 3P4MB 2F5BL 4JFEB 3WV0A 1FYHB 4P2OD 1UT9A 2BNUA 1AFVH 1JTPA 4G8IA 1J1PH 4CJ1A 1WBYA 5HVFB 3Q3GA 1RZ8B 4QRTA 2I27N 3S5LA 4ORGA 5AD0B 4R4FH 4HUUB 4UT6H 2NY3C 1MFCH 4R7DA 5EUOA 1AI1L 4CU8A 3D2UD 3EO9L 4JFZL 1IGTA 5DQJB 4U0QB 2GFBB 3GRWA 4XVSL 3MLXH 4BM7A 4PJGA 1NDGA 5I8OH 2ZKHH 2R8SH 3NFSH 4ZG1A 3SDXB 4MJ4A 3ZE1F 2CO6B 4PRAA 5FK9A 1NBQA 1NL0L 2UZYB 2PCPB 3BESR 3C6LD 5DHYB 1A1MA 3VI4F 4IHOA 2VABA 1ZWIA 4J23A 3BH9A 2YPKB 4YQXL 3UZVB 5HVHC 3L95A 4GRWB 3FQXB 4UOW1 4XRCB 3RVXD 4FXGA 2XZAH 4NKIL 4X9BA 2DM4A 4NZUL 4FQXB 3HAEA 1J0ZA 2VDLL 4GQ9L 3SE3C 4ZPTA 4IDJL 1RIHL 3IJHB 2DQJL 2VZVA 4NC1E 1OAKH 2JB6A 5JW5B 2VQUA 3IDYC 2K9UA 2VAAA 2V9QA 3FONB 3BH8A 4PJIE 4JN1L 2DM7A 4OT1H 3KGRA 1JGDA 1ZSDA 1ZS8B 3BUTA 1G6VK 2VH5H 1JWMA 2ATPB 4X8JB 2VN4A 3Q5OA 1YEJH 4PUBL 4YFLI 4LSDA 1JNNH 1VA9A 2XWTB 3QCUH 3H9HA 5I1KH 2WWMD 3K4DA 3D0VA 3RWCB 1P6FA 4U0RB 4MNGA 1UWGL 5FOBB 3HS0B 5HGHB 32C2B 3PWJA 1Y0LB 3BSZH 1P2CB 3MRQB 1GZQA 3MNVA 2HJKB 4TVPE 4CU7A 2B7DT 2DKSA 3WIFA 2FHCA 4C55A 5F89A 1TIUA 3OGCA 3G6AA 4I0CC 4ZSOA 3V4PL 2X05A 4X80H 3GSUB 1LO4L 4XCEA 1NUNB 4W4NA 5FGCE 4G42A 3SQOL 1G7QB 2OL3A 4JFED 2WIMA 5I19L 1YJDH 2HWZH 1FGNL 2DDQH 3DNKA 4R4BA 4RMTA 3HCVB 1Q0YH 3MRMA 1CDUA 5CZXC 1MI5D 5FUCE 1JF1B 3WN5A 5ESQA 3L5XL 3ARDB 1BQSA 3LKQB 4XCNB 3LKNA 1JGEB 4I5BA 4DQOH 4PJ8B 4HGKC 5EOCL 1ROWA 2FLRT 1T0PB 1CCZA 3TNMA 1VKXA 1S7UA 2HKFL 3RUGA 4X83A 1HWHB 1VENA 1YPZA 1B9ZA 1CGTA 5F96L 2RJMA 1DQDL 5D70H 5KVGL 2X4RB 4L8SB 2AJYL 2A2QT 2NY6C 5F1IA 2BVYA 4YEEA 2X2YA 2BHZA 2XWJB 4R26L 2DLFH 1RZIA 5EN2B 3DUSB 3DBXA 2A6JA 3J7HA 5JPNB 3T04D 2P8PB 1MJJA 2E27H 4FQXD 1W0WB 4ONHB 5DUBA 5EOCJ 1XR9A 5DR5L 3SCMB 3LN9A 1MFAL 1HQRB 4QGTA 2RFXB 1B0GA 4K9EL 2GJ6D 4ZAKA 5GJSH 1YYML 4NQSA 5I0DA 1YY9D 3PABA 5D1XD 5C0AD 4RQQA 5L2KE 4I48B 2EH8L 4X9FA 3H42L 5MERB 3ARBA 2VDOL 4L4TD 3EDJA 3F6IA 2H8PB 3SOBL 3QNZB 4JDVB 3T0BA 1EXUA 2I25N 4K9EC 4N90E 4LQFL 4UT9H 3EFDL 3P11L 1NBVH 3P3YA 3PHQA 3BIKA 2BNRD 4HK0A 5E00B 3GSVB 3ZKMD 5BJTA 4HHAA 4OGZA 4CGTA 2VZUA 4WU7A 2WBJB 4UTAL 1B0WA 4TULH 4WFGD 4WHYG 2EE2A 5EO9B 3H8NA 1S7VA 2ZUTA 1I1RA 1RUAH 1R6VA 5DJ2B 1MHCA 2IH1B 1HHKB 2RAMA 1YEEL 4MCZA 2CO7B 4ZTPL 4TSBL 3NA4A 1BVLB 2DWEA 4RA3A 3WMSA 1V3LA 4I2XB 1T1XB 3C60A 1F5WA 4QXTB 3RL2A 4DW2H 2KDGA 2G60H 2NLJB 5IIEA 3VFMA 1U3ZA 1A2YA 4LGRB 2YRZA 12E8L 1K4DA 1SJVA 3BUYB 4R96B 1YEDB 2GUOA 3NTCL 2EH7L 4F58L 4DTGL 4PLJD 3GMLA 4OCSL 2AEQL 3DV6B 1ZHKB 2C4FU 4GRLC 4K71B 4I3SH 5EUKB 1DZBA 5CP7A 1F4YH 1ONQA 1G0DA 2LFGA 3GSNH 4UBDC 3QAZC 4JO2L 3GK8H 1QFPA 4PJ8D 1IC7H 1WISA 4K7PH 4J3VA 5D1ZC 5DK2A 1JP5A 4C59B 3OKDB 2ZCLH 1DLFH 4MD0B 4RAUB 5TJWK 1B4JH 5DZNA 3VRLF 3ZL4L 2X44D 4Y5VC 4BK5A 4HG4J 4JY5H 3M45A 4HMDA 3SE4A 4GAFB 5GGSA 4JFFE 1D9KC 1BX2A 1PJ9A 2MQ0A 3MOAL 4KJPD 5C86A 1I9IL 4HFUL 4DK3A 2IFFH 3UTOA 1JWSB 5F1NA 3DO3A 4LSRL 3SN6N 1XGTA 1XH3B 3QXWA 4PB9H 4YXLL 4BSVA 4LLYB 1AHWC 4Q6IB 2YK1L 3EO1A 4HGWA 5DRXA 2EO9A 3FFCA 3TIDB 1OOAA 3RZCA 3I50H 5FGBA 1BOGA 1FZMB 5F21B 3QA3B 1IMHC 1MF2L 4V1DD 5ACZA 5TE7L 5I1GH 3DYOA 4JGMA 3QIUA 4JPWH 3S3JA 2NX5E 3MYJA 5H94B 1DL7L 3SDCA 3TH3T 2KBGA 3DSFL 1N4XL 5KSAD 4KH2A 3EZJB 3SJVB 5DUML 3RAJH 4ZUTA 1HNGA 5E1HB 2R29L 1I8MA 1Z9LA 3QEUB 3RL1A 1LO5B 3GI8H 5I15H 2GJZA 3L3DB 4UT7H 1TZGL 3NFPA 4JHZA 4OI7A 3RGVA 2P5WE 1I1YA 3H0TA 4NC2B 4EN3A 1JN6B 4XT1C 1W72A 4JQIL 2FRGP 4HH8A 4OM0L 1J10A 4LSTH 1XGUA 1EHLH 3G5ZB 5I1IH 1ZT7A 1C7SA 3CSBA 3PGFH 3WKNA 3C5SB 1WFOA 1A7PL 2BCKA 3EYVA 3O41A 5E08H 43CAB 4C54A 2IF7A 3OKNA 3E3QE 2Y25A 5EIIA 4LCWD 5EFIA 1U95A 1FSKB 3PL6A 2VRAA 5CJXC 4O5LL 5CZVH 5IBTL 3T1WA 5DI8A 4K8RH 2DRUA 3CPLB 1I3RA 3O9WD 1TITA 4PJ7F 4P3DA 4Y5XC 3VXUB 3V5HB 3VFOA 1BEYL 2YPLE 4WFED 4FFWD 3SKNB 2ED7A 5T5NG 2BRRH 3CMGA 5FO9A 4HS3B 1WIUA 3KYAA 1PKQE 4I9WE 5EZIH 3TH4T 3BP7A 3SGDI 4YHZH 3KS0J 4LRNH 1HNFA 3CVIL 4JKLA 3N06B 2Y4SA 2OZ4L 3FO1B 1CXKA 1O5DT 4PG9B 2Q7YA 4KKCD 3M1BB 2EDWA 1S3KH 4P57A 1A6VH 5F72S 1UA6L 1P5UA 4JFDD 3O45A 3BO8B 3FT2A 4U6HB 1AGCA 3O4LE 2GCYA 3M8OH 5CBAB 1PX3A 1AE6H 3FRPG 3P0VH 1R5VA 5DJ0A 1A7NH 5FYKU 3QWOB 3TCXA 2X4TA 3MV8D 1IC4L 3VFPB 2VLRD 4GBXB 2ICWI 5SX5H 5C3LD 3KPMA 3MRPB 4NKQB 3BWAA 3MCKA 2DBJA 3WE6B 4PJDA 3UPAA 4AYFA 4ERSH 3BPOB 1MCFA 5HGAA 1MAKA 3TN0D 3FJTA 4FQLL 1WCBA 4KVCH 4Z7WF 1IAOA 1WFNA 3ARXA 5F9JB 3RI5F 1D6EB 1X4ZA 1OWRM 5CIPB 3SJVD 4F7EA 1AR2A 1N5AA 1EJOH 1JZ4A 2Z4QA 3O3AB 1FFOB 5BS0B 1B2WH 5T1LB 4HUXB 3PHOA 5EU7E 3QQ3B 4JAMB 4DWHA 4FFZL 3ULUC 1RFDL 4JPIA 2P5EB 4PTTA 4XNQA 5I8EB 5D7JC 4BK4A 4MZ2A 5DO2D 4OCWL 3MLWH 1JNHA 1XGYL 4KDWA 4XBEL 2HN7A 4HMEA 4OZFA 1A6WH 4LLDB 3F12A 4XP1L 2QHRL 1QSFE 4HWBL 3K80A 4PGCA 5FIEA 1JWUB 3L3HB 5EO0B 2AGJL 4JZJC 1AIFA 4Y8DC 5KSBE 2UWEA 1HH9A 4HIEB 4OLUL 5IJKA 2OQJB 4GKSA 4OCXH 2WIIB 4MAUL 3W39B 4L8BB 3L7EB 3B2VL 1EO5A 1IBGH 2EDHA 2I9LB 5J1TC 3G08A 3QUMH 2IANA 1QBLH 4NQDE 1HOCA 3VXUD 1Y6NR 4BZ2H 2R2BB 4U1JB 2AJ3B 5F9OH 4LASH 4D0BA 2EXWD 5GZOD 1U8QB 2M8XA 3B9VA 4G8FA 3WFCH 1HXYB 1SM3H 2VOTA 2VZ3A 3MXVH 1F3RB 1Q9LB 2F8VA 3LKSB 5HY9B 3LN4B 4N8VA 4PJ5A 1WIPA 2J2ZA 3A0OA 2ZUQB 1EAPA 5CGMA 3BHBB 4Z76B 3IFPA 5DJDB 4UQ3A 2X7LB 1G0XA 2YN5A 4JFOA 2NZ9C 5C07B 1CBVL 2EDJA 2HVKA 3WNNA 1KN2H 1TJGL 1KJ2L 3D0LA 5ESAA 4TVPL 1UH2A 4GXVL 2ZG1A 1UWXK 4ZTOL 2HFTA 1E4XL 3NN8A 4DEPC 4ELKB 2P1YA 3E8UL 1XGQA 5KS9E 1MSPA 2MFNA 3ZTJH 4M4PA 1C12A 2VSCA 1G7HB 1PKOA 1IL1A 5D2NA 4MDJB 3Q2CA 2BHUA 2X9YA 4GAGH 3O2DA 1OAQH 4P46D 5E4IA 2Y5TB 1U8PB 1P4LB 4L9LB 1MWAH 1XCQA 4MNQA 3MBXH 4LHUD 2GQHA 3V6OA 4P49A 4E41D 5EDXA 3PQYD 3VWJA 3HFMH 3G6JA 1CLYH 5KANI 1KCRL 4DFIA 2YUXA 5D2LE 2R0ZH 3KXFA 5DMGC 4OZGE 4RMVA 5FYJE 2WBKA 4MVBD 3B6SB 3BX7C 2DJSA 5GGTH 1FG2B 5HHXH 1U92B 4WWKA 4XX1G 5C0FA 2JB5H 4G6JL 2NMSA 2XACC 2VWEC 9CGTA 4ELMA 1A7OL 5ISZA 1FVDA 4MD5A 2FEEL 3FO0L 3BD3A 5D71H 3VG0L 5LCVH 4WWID 4HUWA 2ENSA 4GG6B 4GW5A 5BXFA 4YHNB 5JXAH 4HIIB 1GHFH 1K2DB 3DVGA 4JJ5B 4PP1D 4J1UA 5C08A 4OCMC 3K0WA 5DWUH 4AEIL 5E1AB 1NBZB 2IGFH 1KPRA 3AY4C 1MAMH 4YGVA 3T2NL 2DD8L 5JTWA 4Z7WB 4TUOA 4Z7OF 1YN7A 4PV8B 4OZIA 1P84K 2H32B 5IEHA 3U30B 5C0IB 1Q9WB 1GGCH 3OPZL 3MA7A 2Z9TA 3HE7D 1CL7I 4LLQA 1II4E 1CQKA 3G5YB 1G9MH 4HK3N 1UQSA 2VNCA 2X4PA 5HYIA 2VITA 3ZDYE 1S9YB 1JFQH 3MV9D 3O81A 1YDPB 4C56A 4YDKL 2PYEE 3RVWC 4NRZB 1OTUD 1QSED 3BXNA 4Y5YA 5HI5C 4HX1A 5SWSB 4GXUN 1AXSA 3UO1H 1XF4A 4JM2F 5B8CA 1JTTA 2E9WA 1VADA 4XNMB 5J4MA 1PEWA 1MRCH 4NSKB 3VG9C 5JLZB 2D3VA 3AS0A 2PW1A 4D0CA 5TPWH 4MCYB 3Q5YA 1S7XA 3JV4B 1KB9K 3QI9A 4NNPL 3IB4A 5I71C 1I9RH 1N6UA 5AAWA 1UZ6F 1IARB 1EO7A 3LD8B 4M1DL 4CN1A 1AO7A 3V4VH 4YJZL 4GW4A 3T3ME 5IMMA 1JI2A 2OYPA 1J0YA 1U8MA 3CK0L 5L6YH 2XNAB 5D6DC 4PGDB 3QUKA 3HI6H 4YBHA 5HPMB 2GTZA 3BE1L 2O5ZH 4ZPVB 5IV2A 2X4QB 3PL6D 3VFWB 1HIMH 3BGFC 1PX4A 4I77L 1IEAA 1MFEH 4U6TA 4PJFF 4AMKL 4KQ4L 4MAYC 1JZ2A 4JN2B 4I4WB 2F15A 1FPTL 3MR9B 4N8PA 5KZCD 5K9JL 2OR9L 3HI5H 5GJTL 4YNYB 3VU2A 2FO4B 3O6FD 3HUJF 1QLFB 3O8XA 1EA9C 1PFCA 4KJYB 3FT4B 3OWEA 5HYQA 3UJTH 3UXFA 2F58H 1WZ1L 3WNMA 3GMMB 5TE4L 1J05B 1CU4H 3QEQA 1YMMB 4CVWA 3NPSB 3LRGA 4PRPD 2I5YH 1CXHA 1YYLL 3BEVA 2N1KA 1KPUB 1U42A 1BD2D 3LQZA 5ICZA 3RX8A 4XC1L 5E5MA 2DQTL 1I4FB 3LPGA 2D0HA 3RWHA 4Z7NE 5CINL 3I2CL 4EUPA 1S7RA 2I24N 35C8H 1UWEH 4QNPE 5C8JA 2VDNL 4H8WL 5KVDH 4WO4B 5A2KH 3S98A 3E2HC 2P43B 1Q38A 3HZKB 4KMLB 3OHXA 3L6FA 4G8GE 4OIAA 1GSMA 2AXGB 3SKMA 4GAJH 1KENL 5EBMA 1N8ZA 2DICA 1UVQB 2JJTC 4DGYL 4MJ6B 5CILH 5C0BA 2WNGA 1NAKH 2CMRL 5D7SH 1I9JH 1CICB 3BW9A 5E4EC 1BIIA 4AK1A 1NLBL 2APVA 5FYJH 5F8QC 2FECL 1DDHA 1MQKH 2NY5L 2ORBL 1F13A 3EJZC 5EU6A 1TZIA 4WU5B 2SEBB 1C16B 5J8OA 4X6BB 4LLUB 3TPUB 1TQCB 2F74A 4MJ5A 2XN9D 4RMWA 5L88H 2LVCA 2C1PB 3OJDB 4LOUC 3DVIA 1H0DB 2NY7L 4HIHA 1CF8L 2WWKO 1NC2D 1JHLL 3LEVL 3MLVL 4HKJA 1UM5H 1NGQL 4R9HA 2CDGA 3QDHA 5HHMD 3VGBA 3CSYA 2AV1B 1LMKA 3H9SD 4O02H 2VXUH 3T65B 1IAII 5HDBF 1UXWB 5D7LE 3SDYL 1A3RL 5I17B 1DQMH 1MIEL 2V5MA 4Y4KB 2UVFA 5IT2L 3MLUL 4RGOH 1QQDA 2V5TA 3MOQA 3QO1B 3PJSB 4JRXA 5B38G 3FO9A 1KSRA 5EO1A 8FABA 4LNVA 2BY2A 1KLUB 1JGLH 5J7CC 2C3WA 2DJUA 2X70A 1TJHL 2DWDA 1EMTH 1X3DA 4NZJA 3ULSB 5F88A 3TNNA 3HN3A 3TYFB 2YD3A 5FUOL 4H5SA 1D5XB 1F4AA 4HJJH 4LMQE 3D6GA 3LS5L 1YMMD 3QXDB 1LE9B 4F7MA 4G7VL 1HK6A 4JPKH 1BGXH 1OGTB 3CFDB 2AK4E 1X5HA 2APTA 3CSPA 4RSVA 5H37G 3VWKA 4MJID 4KKNA 3B5TA 3TBSA 1A9EA 3MACL 4CNIA 4AQ1B 4ZNEA 1DBJL 1N26A 4WO4D 4DUVA 1NFIA 4ODBD 3U7WL 4D9RD 5EZOH 1N5YL 2APFA 5HDLA 3Q6GL 5AZEH 5AZ2H 2DTMH 3BP4B 4M7ZC 4QRRA 3T0DA 1WICA 3BKML 1DBMH 3HUJB 1CLZH 4Z7VA 5MEPB 3VH8B 1AKJA 1CICD 2E7BA 5EIQA 4K23H 1J18A 1F90H 4PJHF 5FA3B 1YZZA 2Q20A 1JGUH 3U83A 3KXFD 5F9WB 3SDDC 1KCVL 1S5HA 4EIZC 2OZ4A 3D39D 4OCYL 3O6LH 1CFVL 4I0KA 4NNYB 3MCG1 1CFQB 4K3HA 4Z5RB 3I9GH 4NJ9H 3MFGB 2W91A 1M7IA 2IPKA 4N8CL 3D87B 1L7TL 3T4AB 3L3KB 3VXSB 5KTEL 4P4RA 4UINH 4WEUD 3S97C 2H45A 4GQ9H 4Y1AA 4LFHD 3QFJE 1P7QB 1YMHB 1AGDA 2W65B 4IIQC 1VFBB 3MRKB 4NRXB 4NNXA 2XT1B 2JCCE 2OTPA 3ARWA 3GMQA 3LKRA 5EU5A 1PLGL 4OLWH 3MMEB 2XQYG 3DRTB 5CEYA 3QH3B 1QZ1A 4WUUE 5BZDA 3HR6A 3ZHKA 3QJFA 5D5MB 2DLGA 2WWMC 3AB0B 2W0FA 3P9MA 1BBDL 4ODWA 3D69A 1TFHA 4NGHH 4HAGA 1E27B 4APQD 2H2SD 4P9MH 2R15A 1UC6A 4X7SH 4NO2A 1VGEL 1QLRB 1UWGH 5E94A 3A6CH 4LPTA 4K07A 4MHHI 3UZQA 4TSAL 3HR5A 5I1HL 2W38A 2ZCHL 3WFDL 1K3IA 3IFOB 4I0PA 2PW2B 2R2EA 4OFVA 2ARJB 3FAXA 4G9FE 3BRFA 4HG4K 4J4PA 2E8YA 2JK5A 2ADJA 3D18B 3VRLE 3GHEH 4RRPG 1CD8A 1T6WA 2ADGB 2IH3A 1ETZA 1U6AH 1FH5L 1LO4H 5DRZA 4Z18A 2VXSH 3EHBD 4BFEA 1C08A 5D7IB 3EO0B 3SQOH 1ZEAL 3O3DB 4HXBL 4QYOA 4F15B 4ALAL 4HWBA 1XF2B 5EZJB 4KK5C 3OF6D 3MRJA 1WQVT 4NT6B 4UDTA 2XYCA 2WUCH 3GHBH 2J4WL 3LV3A 2FBJL 4Q2ZB 4R8WL 3QRFM 2AEPL 1RUPH 2DIJA 1RZ7L 3L5XH 5HYJD 3QUXB 4ZYKB 1KTLB 1OB1A 4UQ2A 5KN5B 2V7NB 3VGAB 1OP3K 1BBJA 1ED3B 2OK0H 4PP2A 3AC0A 5JUEL 2YUVA 2CPCA 4OLZH 1HQ4B 3QWQB 3W0WE 1U8HA 5ADPH 5F96H 3OR7B 2EKSB 3EGSB 4E5XA 3LMJH 5HHQA 4RMQA 3CDFA 4G80B 2DLIA 5A3IC 3LQAL 3HA0A 4KWUA 5LGHL 1WBZA 4Z7UA 3T0EB 1T83A 3SKOB 2CIIA 1VFMA 1DTUA 4LRIC 4EJ1C 3DHJA 3R1GH 4IRSA 1YY9C 1E28A 4FQQB 5DR5H 2A77L 1HI6B 3KLSA 4LF3A 4WI6A 3QXVA 4K9EH 1DVFA 1YEFL 4XBPA 2HP4A 3SKJL 4E0RB 3HG1E 4OCNC 1T0MB 2QLVB 3LZFL 3QZWB 4PTUA 3DMMB 4FQCL 4QHKJ 1RZFL 4H1LA 3RQ3A 3EOTL 3SOBH 4DVBA 1K6QH 5MEQB 4MA8L 3PXJA 1NMCB 4BUGA 4ZUWA 4NQUA 5E8EB 5DJCB 4U0RC 4XP9H 4Y4HC 1ZA6B 1T2JA 2Q8BH 1N64L 1IEBB 5C2BH 5FCSH 1XEDA 1VFUA 4PYGA 1ZHLB 1ZLWH 3OKEA 1GCFA 2IBZY 5L2JB 2C7UA 1HHHB 1KC5L 3Q1SL 5DEFB 3CCHA 2CIKA 3K8KA 2VL5B 3G04B 1OTSD 2VLKB 4XPGH 4ZTPH 2HT3C 4KKBC 3WHXB 1MHPL 1KJMA 1AGBA 3BDYH 2FJHB 5DD5L 4JB9H 2PXYA 3LKPB 4LVNB 4WI8A 3E6FA 2E7CA 5B21A 5CUSH 4KZEL 4X4XB 4ZS7L 3ROOA 3ULUE 5C0DB 5I76A 4L4JA 4GH7B 1SBSL 4JG1H 4PJEB 4PLJC 4Q9RH 4YHKH 3WLWD 4G7YH 4LSUL 3RVVD 1J88A 1RIUH 1S78D 1T22A 5EU6D 1ITBB 4G9DB 3VH8G 2EH7H 1WGOA 5JO5A 3ARDC 3TVMC 4OM1L 4QOKE 2DTSA 4X98B 4PJ8C 3CH1A 1QFUL 5L2KA 5E9DE 2IAMB 1R3KB 3U82B 5EZLA 3QUXD 1B0RB 3F62A 4QHMB 5F7KC 3X14A 5KVMC 5LKNA 3QPQD 4MXVE 5IB5A 1EPFA 1CD1B 5DRNA 4KJPC 1A8JH 4J3WA 4DAGL 1ZANL 2DQHL 3MRBB 1X5GA 4L8SC 5EUOF 4YPGB 3IXTA 3ULVE 5AAMA 5T3ZL 3QULA 1JNLH 1QA9B 4NKOA 4NP4L 3STBA 1FL6B 3RP1A 4PJGF 2WMPA 3UTTB 2JTDA 4MLIA 2YSSB 3RU8H 3QG7L 2ATKA 3SCMC 4LSRH 1I7RA 3QIBA 1RZGB 2E3VA 2L4OA 2O26U 4MQXD 3RFZC 1CE1L 1QO3A 3H2WA 3ILQD 2P8MA 4JQXA 4X7TA 1GGYA 2W9DL 3OB8A 5D96C 5HGBB 2P47B 3GBNL 5JIKA 3WL9B 1ZHNB 5HI3D 1LEIA 4S2SB 4BFGA 4EI6B 1M7DA 5DC0A 4LEOB 1OAUL 4S11A 1R3JA 4QXWA 1INDL 1AY1L 5CHNA 3MREA 1I7UB 2HLFD 1S5IL 4WRLA 2WBJC 1QPPA 5T5FH 4OZ4B 1Q8MA 4R7NB 1I7ZB 1H3TA 2EDLA 3BQUB 4HULB 5K9OA 4K7FB 2FX9H 2R29H 5I1EL 3QCVH 3DPBA 4O51A 1Q0XL 4MQSB 4DKFL 2CKBH 1FC1A 4RBPH 3WXVL 1MAJA 4JQIH 5HYSA 1A4JA 4P2RE 2FATH 3MCLH 1FP5A 2C3VA 3F7PC 4OSUH 1UH4A 1HXMA 3T2PA 4PYHA 2Q8AH 1TXKA 4EDXB 1N6QL 2FWOB 3B3IA 4Y4FA 2F19H 4K71C 1VEOA 1MY5A 5JNYA 2GITB 4WI9A 3U1SH 2QEJA 3MNZB 4LPWA 2X89A 3EOBA 3BEWB 2J88H 1D6VL 3NCBB 1J87A 5A2IH 1A6ZA 1DUYB 4P5KB 4I3RL 5INDB 2NX5A 2HJFB 4X6CF 5CD3A 4JE4B 2ESVE 3WDHA 5J1AB 4G3YH 2DM2A 5DJXA 4LPXA 5IJVA 1UJ3A 2IBGA 4PRHE 3CVIH 5B3NA 5MHSD 3FB7B 5C0GA 3WUWG 1MQ8A 3HMXH 3IDMB 2IFGA 1CDYA 4OZHB 2D4DA 1A14H 4LPVA 3NABH 5IROC 3GGWA 4HWNA 2VLJE 2HTKD 4XGZA 3ZYIA 2PO6A 5FECA 4M6NL 1TVHA 1R3IL 4OLYL 3LS4H 3RUGF 4Q6IC 2K1MA 4H0HB 1DE4B 1YPZF 4X5XA 4Z7QF 3ARFA 4PJCF 1OGAE 3ARGA 2BX5A 4FQHB 1MWAA 4L9DA 2Z35B 1U8IA 3P4OA 5BRZE 4OB5L 4P23A 3BI9X 2P7TA 4KQ3H 2NNAB 1T4KA 4PRID 3X3GH 1F3DH 4HWZA 4LBEA 2BNUB 2X6MA 4G8IB 2NY0B 4J4PD 1WBYB 1I1AA 3Q3GB 3ULUH 3S5LB 2CLVB 4L8DB 5CJ5A 1RHFA 5GGTA 4ONFL 1T1ZA 1MNUL 3MJGX 2UV3A 1IGTB 4XNUL 3SE9H 1RUML 5IMKA 1NANI 2YZ8A 5I1CL 5DO2C 2K3TA 1NDGB 3T4YA 4JO4L 4PRNA 4FFZH 1QFWL 1PKQA 5F6HJ 2X1QA 5IGXH 1RUKH 4FNLH 2XKUA 3CMOH 3DYMA 3HPJA 1C5DA 1CDHA 3BN9D 3DURA 4NO3A 2VABB 2HFFA 1OTTD 1I1CA 1U2CA 2NY4B 5HJ3B 3VDBA 4ZD3L 2W9EL 2VJXA 4HQQH 4QHUA 3C08L 3L95B 4KTDH 5E8NA 2D7QA 3TCLA 4AL8L 1FSKC 3BMWA 4UNTA 4WI5A 4JQVA 1PW3A 5T1DL 4FXGB 3O4LA 3MUHL 4ZFOL 1JCKA 3EYQC 5JDSA 2HG5B 3L9RB 3HAEB 1JGVH 4NQED 3I3EA 5DD1L 4LL9A 5JORA 4ODVH 4S10A 5EWIL 4BH8A 4D8PB 2R69H 2Y72A 2FX8H 3MBEA 3ZDZE 1R5WA 5ETUB 5GZOC 1NGYA 3VI3F 1AXTH 2BNQE 3BH8B 4EVNB 3PIQB 4GO6B 2VDKL 1JGDB 1U2HA 3SE8L 5SX5K 2UY7A 4ENED 1I1FB 4AT6B 5GHWL 4CW1A 3PWPE 3RKDC 4MX7A 2EXYD 1K8IA 5FHBH 4S1QL 1C1EL 2HFEA 1KTKE 2J8UE 3DX6A 3MUGA 2AQ2A 2AP2A 5KVFL 3LDBB 4KV5F 1CBVH 5IQ7H 3QJHA 3UYRH 4OJFL 4FTVE 1NFKA 4XI5D 1LNUA 3T77A 4KZDH 4GBXC 4Y2DB 4NQXA 1N0XL 1A6UH 4HKZA 3HZYA 3V7MA 5F89B 4TTGA 1U8LA 3LEYL 4GKZA 3E8UH 4KKLC 4ZSOB 3CLEH 1OD7A 4A2LA 2FNBA 4NQTA 4BZ1H 4IS6A 2ZUSA 3JWDC 3BPOC 4WGVB 5ADOL 1NFDB 3BP5A 1NCDL 5HXMA 4FQ2H 4QKXB 4XCEB 1K85A 4G42B 2OL3B 3FQUB 2V9RA 2Z93A 2ADFL 2AERT 5D1QD 3CXHJ 4HJGB 3BISA 5I8CB 2MNUA 4ZQKA 2NY0D 5KSBA 1OLLA 4M93B 3MLTA 4R4BB 1DEEA 1KTDA 4X5WA 5JW4R 3WN5B 1GC1L 5ESQB 2DBLL 4K8RD 1NGZA 3EYSL 2EEDA 2DQDH 4OCLC 1QG3A 3KLDA 4NQDA 3VXRE 3LKNB 3NCCB 2MSPA 1PSKH 3VXME 1TZHA 3NCMA 1VKXB 5IG7A 3RUGB 1ITCA 3QHZL 4IOIA 3O0RL 1IQWL 2AQ3A 4LSQL 4CN6A 2IADA 1SVZA 3L3JA 1JPST 3IFNL 1OARL 4HLZH 3V0WL 5JOFA 5F1IB 4Z8FH 4N90D 3WFBL 3OKOB 4LSSH 4NO0B 1MVUA 1CDJA 4AEIH 1D5ZB 1XR9B 3B8SA 4WGWB 4YX2H 1YN6B 3DTXA 1B0GB 3L1OL 3VGDA 3BYTA 5CLTA 3QQNA 5KS9A 4KC3B 3ALPA 4ZAKB 4QHLA 4PJAB 3PABB 4HS6A 1GL4B 1ZT4A 1FO0L 5E5UB 5LQBL 3P9LB 4JG0H 1RK0A 3LRSA 4ZXBA 4U6XA 3V8OA 1EXUB 2ZUQC 3DX9A 1BFVL 3QUZB 4HWEL 1OTUC 1U8OA 4A6YH 1WT5A 1YEGH 3PHQB 3BIKB 1QNZL 5BJTB 2R0LH 4NO5A 4WU7B 1J8HD 5D2LA 5JR1H 4NJAH 4OZGA 5HD8C 5F7EL 1NBYA 5INCB 1X5KA 2IBBA 3B9KA 1MHCB 1IQDA 5L9DL 4MCZB 3SGKC 2RBLA 2VLLB 1LDPL 2A1WH 2P45B 3S88L 4Y2DD 3IU3A 1XCTA 4ZS6D 5GSVB 2DWEB 4TYUA 2HT2D 4NZDA 5MEOA 3VFNA 2KKQA 1Z2KA 3QPXH 4L9LC 3S5LG 4AM0B 3GJFA 4OFYA 4IMKC 2D7TL 1RZKL 2KPNA 4DK6A 2GSIA 2KH2B 2R1YA 1S9WA 3SBWA 2GUOB 4JFFD 1AXIB 2FIKA 4XC3L 4WY7L 5TDPB 2NW2B 3GMLB 1WC7B 3GI9L 3MLYH 3D9AL 2FHBA 1U91A 2BSSA 1ONQB 2YWYA 3HNVL 5DF0A 1FL5B 4PJDF 1XF5B 3U4AA 3F7QA 4FN0A 2HFGH 1Y18A 3V0VA 4ODUA 2LTQB 1JJUA 1F6FB 4D0DA 4OF7A 5DK2B 2DI7A 1KCUH 1LP9F 1KJVA 1YQVL 5A2JH 5I66A 1NAMH 2CK2A 3HAEG 4GKNA 4KJWD 2PYEA 5GGSB 1BX2B 1JPFA 5GJTH 5DDHA 5B3JF 3RKPA 5F1NB 4P4KD 4ZUSA 3BPCB 2XOTA 4RWYL 5DVKA 3STZA 1XGTB 1IT9H 5C1MB 1KUMA 3VXTB 2FR4A 1V7ML 4RFEA 2YUWA 3U30C 5JXED 1F6LL 2H1PH 3EO1B 5ANMA 1OAXL 4Q9CA 4PJBE 4OV5A 1G7LA 3FFCB 5ALCL 3RZCB 1A6TA 1KIRA 1F2QA 4JFYB 2P5WD 3BJLA 2KQMA 1DFBH 4LHQB 1UB5B 5CINH 4ORZC 3QIUB 1AD9B 2YN3A 1VGKB 3I2CH 3MRFA 1ZLSL 4PJ9D 3WNKA 3BKYL 2V17L 1WCQA 3SDCB 2FZ3B 3RTQB 3SGJC 1XR8A 1SY6L 5JPMA 4X6DE 1OCWL 4TN9A 4YUEH 4JFEE 4HS8H 4ZUTB 5CJOL 4QGYA 4R2GB 1S7WB 2X40A 1ZKAA 1YNKL 3TT1L 1XGRA 3RL1B 2Z31A 1CDGA 1OSPL 5IB2A 4Q0XL 2GJZB 3MA9H 1MI5E 5EH1A 5CSZA 2CUMA 3SE3A 3RGVB 4RDQG 1M1SA 1WWBX 3S34H 2G5BA 3FB6A 4WFHE 4EKXA 4Y16C 4EN3B 3JTSB 3VFUA 2P49B 1D5IL 2ORBH 5K33A 2YPLD 4M6OL 3SDXE 3ARQA 4B5EA 2I60L 1IGYB 2BCKB 1EGJH 5H35A 3OKNB 3KNBB 1ZT1A 4FQIL 2B5IB 5LWYL 5EFIB 1U95B 4FZEH 5I74B 2Y07H 3GIZH 5E2JA 1NQBA 4GRWE 1EVUA 4S0SD 1CF8H 2EYRB 5DI8B 1K4CA 1ZVYA 3NIDF 1VERA 1N3NA 3O4LD 2I07B 1OWWA 2GJ6E 1FAIH 4E42B 2OSLA 3GEWB 4HUVA 3TIEA 4S1RL 5FO9B 3PDDA 1KXVC 2AJZB 1KT2B 3BP7B 4M00A 5E6ZA 2GSGB 4L4TE 2RHEA 2FGZA 2DAVA 4G8GA 1J86A 4BQBA 3NFNA 1UEYA 3C2AL 4XVJH 4EI5B 4F9LA 2BNRE 4B50A 1RJZA 4OGXH 4HC1H 1IGIL 3O45B 4KRPB 4M7KH 2GCYB 4WFGE 2NXZD 3U79A 4X5LA 2WINA 4ELMF 2EDFA 3NPSC 1JRHL 5DJ0B 2D31A 3DGGA 1RZJL 3EOYG 5K9QG 1U3HB 3CUPA 4XNYH 1T3FA 4G7VH 3MLSL 3KPMB 4TRPH 1SEQL 1DANT 1F02I 3QNXA 4Z95L 5BV7L 3V4UH 4OIIL 4WO4C 3WKML 1WCBB 4KK6D 4AG4L 1LD9A 3RTQD 3MACH 1FL3A 1MH5A 4KTEL 1N5AB 2FDBP 2V6HA 3O6ML 2Z4QB 1QSFD 4R2GD 3I6GA 3T0AA 3U6RA 3GJFK 1NCTA 2YA1A 3B9EA 1NJ9A 3QDJB 5D7LA 1UFUA 4JPIB 4PTTB 4YHOH 2XTJB 2YPVL 4JLRA 2H3NA 1RULH 3MV7B 5DT1H 1FDLL 5JQHC 4YDLB 1CN4A 1FQ9C 1NCNA 2HN7B 3F58L 1TQCC 5BZWA 2NXYC 2MHAA 1IC5H 3F12B 5LGJA 1AIFB 1YNLH 3QQ9D 5DQ9A 1T7ZA 2UWEB 1F45A 1HWGB 5I18H 1FVEB 5ENWA 5C9JB 3RGHA 2AK4A 1UM4L 2DYPB 1HOCB 1CGSL 4Y4KC 4JM2C 2I26N 3PWVB 3GSXA 1CZ8L 2D7NA 3OSKA 1N6VA 4W6YB 3QYCA 2D4FA 4V1DE 1WAAF 1EEZA 1XIWD 4PJ5B 4M1GL 5FO7A 3S4SA 2EDOA 1JPGA 3IFPB 4UQ3B 1BBDH 4NHUA 1QLEL 3N9GH 1QFHA 4UOW0 5CEZE 4E9LA 1SEBA 3PNWA 2HVKB 2XXCB 4EI5D 4MSWA 3VD7A 1JBJA 3SY0A 4OQTH 3D0LB 5DUPH 3U4BH 1A6PA 2XWBA 3QXAA 4X8XA 3GIVB 2X4SA 4O4YL 3MRNA 1XGQB 2CRZA 4C83B 4UU9A 5FYJD 4PBXA 1U3HD 3VFSA 4N0YL 2CKNA 5TQ0L 1T66D 4GSDH 4NHCL 4F57L 4JO3L 4JZOA 1NCUA 1A22B 5KVEL 1XCQB 3GB7B 4MNQB 1A02N 4I2XE 5IW6B 4ZFOA 3TO2B 4NUJA 1I8IA 4DKDC 3QWRA 5F9AC 1HEZA 3G6JB 3QFJA 4TUJB 4ODXA 2C3GA 2WP3T 1I85C 5KW9L 5E99L 1A6AB 2A9ML 2NZIA 3PGCB 1G7PA 1RVFH 3GO1H 4WWKB 3REVA 5C0FB 3QDJD 5F9WC 1IKFH 1AHWA 3WIHL 4ELMB 1LO3H 1P6AB 1UM6H 2X4OA 4WFEE 5TGBA 5ISZB 1FVDB 4MD5B 1L6XA 4X6EA 1OP5H 4U1NA 3MV7D 1BZ9A 1KF9B 5GRJL 1NEZG 1ZK9A 5BXFB 4N5EC 5J0BA 3IDNA 1T6VN 5D9SA 1GOFA 2ZZUT 2XY2A 2PYED 3IDJA 2VLMD 2HLAA 4TQEL 3KPRD 2B0SL 2X4UB 1P4IH 1YN7B 2BSTA 2J7LA 3FB8A 4G9FA 4JPVH 4KUZH 4OZIB 5ITBH 4YPJA 1MHEA 2RB8A 4PJXF 4UUJA 1S9XA 3MV8E 2BC4B 2DYPD 4FQCH 1B90A 4B53A 1I3GL 4P9HC 3AB0C 3O2VH 2NY3D 2XV6B 1UQSB 3UBXA 3EOTH 2LV4A 2X4PB 4MA8H 2FGWL 2VITB 1ZVSA 3F7VA 3A6BL 2ICWJ 5A2FA 2ITCB 4X9GA 4X7CC 1FGVH 4W70A 2CKBA 2F5AL 3BXNB 1MJ8H 5J9PA 3HNTH 1BQLL 5GGRB 1VFAB 3FO2A 3SJVE 4HPYL 1F11A 3VDAA 2L7UA 2ADIB 3QBTB 5B8CB 3JVGC 5IEKA 1OAYL 2FX7L 3AXLA 4PRBB 2MQ3A 4ZO9A 1T1WA 1LQSR 4XB8A 2AI0L 2PF6A 4ISVA 4MA7H 4D0CB 3W0WA 4NDMA 3MRRA 1S7XB 5DD5H 4J3SA 3ZT7A 3QEGL 3QI9B 3P30L 4F15C 1T5XA 5F7MC 1P7KA 3RVVC 3TM6A 5EU3A 1QKZL 3ALXA 1AO7B 5J12B 4XTRC 2K7QA 5KSUB 5IMMB 3MJ9L 1IGFH 3X12B 1UENA 3JWNC 1U8MB 5IHUL 5HHVL 1ACZA 3QUXC 4JFXA 4OM1H 3QUKB 1C5BH 3REWA 3TBTB 4PJCE 2GTZB 3VGAC 4MJ2A 3T1FA 1Q1JL 1QFUH 5CSBA 1A0QH 1S7TA 4YXHH 2EC9U 5IV2B 4FABL 5EOTA 4OZFG 4ZFZA 3GBML 4DN4H 5CEXA 3HMXA 3TGXA 1DR9A 4MB3A 4LCYA 3FRUB 4XMPH 3VXUE 2ZPKH 3IETB 4M6MH 1ADQH 1MUJA 3UPCA 2QQLH 1MCJA 4O2EB 4OFKA 3T0EC 1IAKA 4XWGL 4HJ0C 4EQ3A 5T3ZH 4L29A 1DQLH 3PUCA 1CGXA 3O8XB 1HCFX 2GAZA 4Z7VF 2V2TA 1A1OA 3HE6B 3SDAB 3BFOA 5HI3C 2DB8A 4JY6A 5CEZH 3BD4A 3QEQB 1F8TL 1KGCD 1MEXL 3LB6C 3DMMC 4RGNB 1QR1B 4N8VG 3LRHA 4UILH 3BEVB 4I1NB 4WI2A 4Z0BL 5ICZB 5E5MB 4JHWL 3OAUL 1OAUH 1LEGB 2HLFC 4UV4H 2A74A 1NMCC 4EUPB 1ZLUH 5GGVY 1S7RB 1ES0A 4XNZB 1T0NA 5C71A 3QAZB 1INQA 4KMTL 1KCKA 3VRIA 2IEPA 4QOKA 1BOYA 3L6FB 3U9PH 2DQUH 3DX8A 3SKMB 4E41E 4XMKH 2LE9A 3PQYE 3QDMA 2XRAH 2BMKB 4XCFL 4Y88A 4JZJA 3K8MA 2V5RA 5C0BB 2VQ1A 2VERN 1WUNT 1MFNA 3TBYB 3CFCL 3BW9B 5BO1L 3VFGL 3VCLA 5BS0E 4L3CB 4RNRA 1M6OA 2RR3A 3C5ZB 2NY6D 5B38A 4LVNC 2OJZL 1DDHB 4QRUA 1G1CA 4OF6A 1TZIB 1RD6A 5BOPA 2P5EE 5KSVA 4KK9C 1MJUH 3PDOA 2EIZA 5I9QB 4DUXA 3DWTA 3LPFA 4QXUL 3QQ4B 2F74B 4MJ5B 2ZUUA 5J6GA 4XBGA 5E8DL 4DN3H 2E7HA 4KI5C 4HIHB 5DSCB 1RJYA 3H3KA 2IAMC 3NOIA 3DO7A 2EE3A 3S37H 4PY7A 5EC1A 2X5PA 3CSYB 2ZOKA 3MRLB 3O2WH 2JJSA 1RK1A 4EOWH 2UUDK 3WO4C 1H15A 3CXHK 4B7IA 1CGYA 2VDPH 3LEXA 4JRXB 5KAQF 3LN5A 3FO9B 4I8DA 2AK4D 2B4CC 5TDOA 2VXQH 5EO1B 3ZDXE 1DBBH 3L3OA 5CGTA 8FABB 3EIFA 4YLQT 2F54B 4JO1L 3V7AG 4PJIF 5IWLC 2X70B 4KVNL 2BY3A 1E6OL 5F1OB 1SJHA 1FLTX 3TNNB 1ODAA 3LHPL 4TUKL 4UNUA 3HE6D 5CJQL 1FNGA 1QSEE 3SDAD 4M62L 1R3IH 4OLYH 5C07E 3EOAA 5GGQL 4H5SB 4WIQA 4F7MB 4P2RA 3DI2B 1RMFH 1J1OL 3MGOB 4KDTA 4PD4J 3ECBA 1FIGL 3HRPA 2HAZA 3RNKB 1KOAA 1T04A 1JZ8A 4JKPL 4GRLD 5L0QB 5F71A 3VWKB 4QTIH 5TH2B 4PREA 1D5BB 2EICA 1A9EB 3BQUC 2A6KB 3PWLB 3MRDB 4CNIB 1BVKA 4UBDD 1IGCL 3H9ZA 1KJ3L 1NFIB 3MRGA 5KBNC 1YECH 5D1ZD 4K55A 4ONFH 4WJ5B 2DI9A 1JI1A 4QRRB 5E8PB 1QP1A 1MRDH 4GAYA 1D9KD 1G7JB 3CFEB 2ARJQ 2ESVA 3JV0A 1BMGA 4CU6A 1JF6A 3S9DB 1LO0H 2GTWA 1B4RA 4PRHA 3EFFA 4XVTL 1KG0A 3UJIL 1S5HB 1ACYL 2IG2H 3CXDH 3HNSL 5TQ2H 4WUUD 1A4KA 1NCAL 4FMFA 1UCBH 5LAXA 2VLJA 3WYRA 4FXKA 3C5JB 5FF6A 4A2MA 1M7IB 2IPKB 3D85A 4U2ZA 1UYWL 4WTZA 4GG6E 4M43L 1OVZA 4N9OB 4OFDA 4Y1AB 4J6RL 4WV1A 2GW5A 1OGAA 4K7PX 1MJ7L 2FH6A 4XPTL 4F3FA 1AGDB 1NEUA 1CIUA 1CWVA 2RCSL 1MCIA 3DV4A 1A7QH 1FCGA 3FOMB 2EYTB 5L8KB 3GMQB 2YXMA 3LKRB 4HEPG 1KIQA 4PRPE 3BT2H 5EU5B 4BFBD 2VDKH 3R06A 2EXYC 5CEYB 1BD2E 1EX0A 3J8F7 5E2WH 4FG6C 2W0FB 3FAWA 3V5DA 1WZMA 3P9MB 4ODTH 4Z78A 5GISL 5EORH 4S1QH 3D69B 1C1EH 2VR9A 4Y19B 1JZ5A 1L7IL 1CDIA 2QSCH 5KVFH 2HRPH 4NO2B 2NTFB 3HPLA 3MO1A 1TQBC 3JWDH 1F6AA 5JHLL 1NPUA 5IW1A 4OJFH 3T8XA 1DQTA 4IRJA 4KRLB 1X4YA 5D6DA 4EUPG 4I0PB 4DVRL 4HD9A 2R2EB 3ARVA 2ITDA 3QR2A 3OXSA 1UACH 2IPUK 1Q9OA 2JK5B 5CIPH 3QUYB 1KNOA 1LP9E 2ADJB 3M07A 5IFJA 4ZDHB 1DN0A 3PP3H 2EO1A 2IH3B 2M2DA 5B39A 1ETZB 3GRWL 5HPOA 2CSPA 1NCDH 2NY0C 3NAAL 1C08B 5D4QA 3U46A 5C0JB 2Y6SC 4TSCH 3HI1A 3BZFA 5CJBA 4YR6B 2ADFH 5FYLL 3RWGB 4U1KB 5D7KD 1XGPB 4UDTB 5T33H 4YDIH 2B8OT 3LV3B 1IAIL 2BOBA 4K94C 3I85A 5IQ9B 2AJUL 3BGMA 1EFXB 1NAMA 2IPTL 4B41A 4KY1L 2BNQA 2BVPB 4LVEA 4U7KA 4FRWA 1MLCB 5HHME 5H2BA 4JZNA 2GHWB 1BBJB 2ZG2A 4ZO8A 3WXWL 1A7RL 4YDVB 2OXGA 3H9SE 3PWPA 3ZE2F 4F2MA 3HG1D 1VACA 2YBRA 3V9FA 3BPNC 2NY4C 3UTSB 3WHE1 3BOVA 4BKLB 4D2NA 1KB5A 1KELH 1U8HB 3PHSA 3JWOC 4ETYA 5SWQB 3ROLA 3IFNH 4DEPB 4LDEB 1LEKB 1KEGH 1KEML 3QB7C 3MX0A 4Z7UB 1FVCA 3GSRA 5F1KC 2CIIB 4FTVA 1J0JA 3U7YL 1KJ2B 1NSNH 1GZPA 1OPGL 1RU9L 3ZTNH 1E28B 3ARZA 3EYFA 3IFLH 5TE6H 3L1OH 2OI9B 1DVFB 4V2CB 1R0AL 4XBPB 2VDRH 3D3VD 4M8VA 1DBKL 4QTHA 4Q9QH 2DIBA 1OP9A 4RMSA 3QO0A 1HSBB 4PTUB 1MCDA 1Q9KA 1FO0H 1YMME 2DKMA 4H1LB 5FGCB 5LQBH 4ZUUA 1Z3GL 2VISB 3KPSD 3PV6A 1WFTA 3B9AA 3LDBC 2E8ZA 2A0LC 4R90L 2G9HA 43C9A 2FEDD 5EA0L 5D7JD 3RA7H 1KIPA 3L5WB 5F7EH 4R6UA 1LHZA 3OKEB 3P2TA 2KZ1B 5FAAA 2C7UB 4D9RE 4Y2DC 4FP8L 3VXMA 3FT3A 4U1SA 4ZS6C 5T1KA 3CCHB 3ARRA 2GJJA 3OMZA 4HV8B 4QOKD 3VRJA 1YEHL 5DURB 5MENB 1GRWA 4OKVB 1GPOL 5IVZB 3WIHA 1NKOA 1KJMB 1AGBB 3KWWA 5E9DD 2F53B 2PXYB 4O58L 3QUYD 4M8QB 5FA4B 2AJVL 1FYTB 1BAFH 2DS4A 2DQCH 3I84A 3ROOB 1E6JL 4RIRA 1X5XA 2HH0L 1CFNA 1DN2A 4M93C 2LAGB 3NH7L 3OZ9H 2BVOA 3IS1X 1AR1C 1IFHL 4XPFH 3GSOA 5M95B 3HZVB 2ICWA 2CDFB 3WN5C 2G2RB 4KHTL 5JO5B 3WS3A 1JHTB 3GI9H 5DXWA 1JF5A 3OTTA 3TBVA 3VXNA 4P59L 5FKAB 4OBSA 3WJJA 1LO2H 5L2KB 4UZGA 5GS0C 1OL0A 5EZLB 1EFXD 4BFIA 1WTLA 1FORH 3WO3B 1VHPA 3LH2H 1ZVHA 3HMWL 4LAQL 5DRNB 1WVZA 2NZ9D 1PG7H 3CFBA 3DX7A 3RWEA 5CCKH 3M17A 3UCRA 3FHAA 3UTSD 3BYYA 4IOFD 4XP5H 2H32H 3IXTB 2F8OA 3RNQA 3FB5A 3S96A 4NBZB 5AG8A 3QULB 1BP3B 2B2XL 3HC3H 4ONOA 3EW3B 4F7PA 4U6VL 1IGJA 3D2UA 3NA9H 1I7RB 5JZ7C 3QIBB 5I71B 4ZAKC 3BKJL 4XPBH 2P8MB 4X7TB 1EERB 1HCVA 1QFOA 3WIIH 5DJZA 5DJYA 5I1JH 3ARBC 1DEDA 1HDMA 1PZ5B 1ZLVH 1HKLH 5H37H 1F97A 2D03H 2Z91B 3C6LA 4ODSH 3QUZC 2R1WB 4UB0L 2XZQL 3KPQB 2AAVA 1MCEA 5CHNB 5AYUL 2MJWA 4L3ED 5DMGD 1RQ5A 3MREB 5JW3L 1B6DA 1EEYA 1QBML 2DM3A 3BZEB 4PV9A 4AEHL 4DGVL 5J3HC 3AAZA 5FB8A 1G6RL 5DYOA 5CJOH 2XZCH 5K9OB 1H9VA 3INUL 4MAYB 3IKCA 1YNKH 2ZUXA 4JM4H 2R4SL 3TT1H 1HHGA 1QACA 1TETL 4KTYA 4YDJA 1MRFL 1J7VR 1FRGL 2NW3A 4NBYB 1FNHA 1MFBL 3MROA 4HF5L 3L3IB 3VGEA 1A9BA 2NR6C 4GUPA 5HYJE 3CFJA 3RJDA 5DMJB 3TJEL 1GVIA 1MCHA 3FQWB 4IIQA 3WUWA 4G6FB 5HYSB 1WAAE 1A4JB 2HJLA 3W9EB 3CGTA 4M5YL 2C3VB 1QVOA 2V2XB 2EKJA 1Q72L 2BJMH 4M6OH 3QFDA 2XA8H 1FYTD 2Z0BA 5CS7A 5KAQG 4CADA 3UZEA 3B3IB 1J1XL 4FQIH 1MCOH 2J5LB 2H2PC 5LWYH 3CNKA 2BVTA 5JNYB 2APWA 4MB4A 4NWTH 3ARYA 2A73B 2VXTL 2AKRA 7CGTA 2MQCA 4YE4L 3VXSE 4PJBA 3NCJH 1YY8A 2MCPL 3CFIC 2VLJD 5DGRA 4GMSL 4BQ6A 4WW2F 1CFBA 2LTQC 1I9EA 1Z5LA 2ZJSL 1U9KA 4D94A 3JV6B 4NFDA 4DKEH 3RWDA 3RVWD 4X7DC 4WDIA 3SE4C 4JDZB 3CU1A 5IFHH 1J0KA 5HI5D 2VR5A 5DJXB 5DEGA 4X6DA 5BRZD 5CP3A 1KN4H 1AQKL 4JFEA 4AY0A 4XHJC 2VIRA 5HDQL 1SJEB 4K2UH 5C0GB 1C5CH 4Z0XB 3GKZA 5D5ME 3PG2A 1T1YA 2JIXB 4G5ZH 1J5OH 4YHML 4OD1H 2MCG1 1MI5A 1IGIH 2PO6B 2Y06L 1TVHB 4CJ0A 1NANH 3GJEA 4H1LG 5DQJA 3G5XB 3RZCC 4X5XB 5FGBC 3FN0L 3C09C 4ZOCA 5IR1A 2ZG3A 3MXWH 3THML 3SDXA 2OTWA 2MPAL 3QIUC 2Q76A 3OAZH 4U1HB 3MLSH 2DQIL 3OB0K 4P23B 1JPSL 4OF0A 1W0VB 1GGBL 4WEBL 3UTPD 3SDCC 1T4KB 2PCPA 5DHYA 3RTQC 3ILPA 5IF0B 2YKLL 3EKCA 1ZA3A 3IDXL 4HWZB 4LBEB 1W72L 1I1AB 4R2GC 3U9UA 5KS9F 1WWAX 2APXA 4HCRH 5D7IE 3ETBF 5GQBA 4F33A 4KTEH 4FQXA 4R3SA 4QEGA 4MAYD 3RGVC 5IMKB 2GJ6A 3R0MA 3PGDB 4EN3C 4YHLH 3IDIA 4JJHA 4PRNB 5D1XA 5I8KL 4L1DA 4OF5A 5JW5A 4HDIB 2W07A 3L3GA 3WS6A 4L4TA 2B1AL 3QISA 4KHXL 3VXQA 1C5DB 5A43C 4FS0A 5D2LF 1T80A 3D5OF 3DURB 1LK3L 1ZS8A 2HFFB 2BNQD 5FM8A 5GRYA 5ILTL 1R5IA 4QHUB 1T2QL 2BNRA 5E8NB 3EYUH 5JDSB 4LEXL 4M7LL 1UZ8B 1U8JB 2A9NH 5FOBA 5FHAH 5ALBL 5HGHA 5C09B 2Y7QA 3IKKA 3DUUB 2FL5B 1R5WB 1AH1A 2EDEA 1NGYB 1CLOL 2EDNA 4XVUC 4M02A 1G9NL 4H20H 2R0KH 3GSUA 4NCC2 4HT1L 3GMOA 4MX7B 1K8IB 4M1GH 2M1KA 5E2TH 2R2HB 2HFEB 1CGVA 3PWNA 3DX6B 1FNSL 4XWOC 1G9NC 2OLDA 1G7IB 3KLAA 2J8HA 4KRPC 3ZLQC 1NCCH 2AJSH 3SDDB 2JIXD 1W2KT 2YRPA 3QJHB 3EJZD 5DFWH 4HPOH 1JF1A 1GAFL 4YHPA 1QRNB 3ZDYF 1U3HC 4BH7A 3LKQA 3MOBL 5IESL 3KJ6L 4O4YH 3GKWH 4PJ8A 4GKZB 5GS2D 3ZYJA 3VXRD 1F3JA 1TMCB 1LVEA 5BCAA 4N0YH 1NLDL 3BP5B 3LQMA 4LCIH 2OX5A 2FBOJ 2NTSP 4WHCA 4HMCA 3BP6B 2CGRH 2WUBH 4O2FA 1HSAA 4LSVL 4NZRL 1FHGA 5KSBB 4ZQKB 5E03A 3O6KH 1NGXA 4F37F 3V6ZB 5FYKE 5DJ8A 1RY7B 1DEEB 4PJEE 1KTDB 3DUSA 2P8PA 3CLFH 1W0WA 5HYSG 2J6EH 4NQDB 1ADQA 4BJLA 3T3MF 5C6TL 4R97B 5GGVH 2XTJC 1NGPL 1OAZH 4OLXL 5M7QA 1QOKA 4BA8A 1YNTA 4V1DA 5IG7B 4I48A 4XCYA 4YDLC 1MCCA 5MERA 1FBIL 4IOIB 4N0UE 5TFSL 2H8PA 4IJ3B 3L3JB 2XKSA 4PIRF 2DLEA 1SHMA 2X1PA 2ZNWA 1SJXA 1T2XA 5DQDH 5MHSE 2R56H 3OAYK 1RIVH 5C6PB 1XZ0A 4M9PA 2JJVA 5I1DA 5IJKC 3IGAA 1MVUB 2VMFA 1JUFB 1ORQA 3BAEL 2WAHA 1TENA 5IW3A 4P9HH 2FD6L 1MREH 1PEZA 5IB4B 3DTXB 3RDTB 3STLA 1HHKA 3A6OA 1RURL 5C09D 5DVOA 4FZ8L 1MIML 3UAJC 4QHLB 2Q86A 3T08A 4HS6B 4PS4H 3NACL 2BSRA 1X5LA 6CGTA 4NRYB 1AJ7H 1RK0B 3LRSB 4XNXH 1EBAA 4I2XA 4ODHL 5E24E 1IAMA 3ZTJG 2FGWH 1U8OB 4PRIE 1FZJB 4JRWA 4LCWA 1R3HA 4NO5B 5IHZA 1UH3A 1KCSH 1YEDA 2VKXA 4OZGB 1NBYB 3O2DL 4Z7NF 1F4WL 3UYPA 4IRZL 3K3QA 3B9KB 3DV6A 1ZHKA 2VZ1A 1WITA 3SDDD 3F5WA 3O9WA 3CVHL 4QNPF 3OKLA 5C0RL 2YMXL 4DKAA 4P99A 3NGBB 5D2NC 3IU3B 1XCTB 3U0WL 5FXCH 5E7BA 3D1MC 5MEOB 3UJJH 3OKDA 4HXAH 1RPQA 3GJFB 4JHBA 4KAQH 1MFDL 3P30H 3V6OC 1WBXA 4NCC1 4DZ8A 4WUKH 1I7TA 6FABL 2UZIH 5JQ6L 2VC2L 2GSIB 4LSPL 1S9WB 4H0GA 5C6WH 2FIKB 4UV7L 4LVOC 4JFDA 1K8DA 4PRDA 4QY8A 3TZVB 1ZMYA 5HHVH 4C4KT 4LKXB 3HC4L 4PD4K 1JYVA 1NC4D 2YRLA 4NQEE 4HIXL 4BQ9A 4KUCD 4WWKC 3MV8A 3KHOA 3VGFA 5K59E 2Z8SA 4Y4HB 2VLRA 1A3LL 4K3DL 4Q6IA 4FABH 2CUIA 3V0VB 2FB4H 4ODUB 1FZMA 5GGUB 4D0DB 1JZ6A 2BVEA 1CD9B 3DYPA 3QDGD 3KDMA 4G6KH 1KJVB 2DQEH 1YQ2A 4XH2A 1JMXA 3TN0A 5BVPH 5H94A 4ESKA 2MMXA 1JPFB 1MCNA 4L4VD 5DDHB 3B83A 1LK2B 5CWSA 3DIFA 2PKDA 3SJVA 2YD4A 3ORJA 2Z92A 1RHHB 5C7XH 3KPPB 1VFOA 4XP4L 3STZB 4RFEB 4OZHE 1NCBH 2VZOA 4X6CA 1LO5A 2XI9A 3U2SB 2DMKA 5ANMB 1GGTA 4OV5B 3TO4B 3ZKXB 1I8KA 1CQYA 4KK5D 3TVMB 4JHWH 4JFHD 4WFHD 1F58H 3FQTA 4KFZC 3FQNB 1E4XI 3MJ7A 1HILA 3FHQA 5DD6A 4QT5B 5DHVB 1XR8B 5JPMB 1HINH 4KMTH 2AVGA 2CR3A 4ZUVB 5LXGL 1WWCA 3TBWB 4PJCA 4FHBD 5AEAA 5IKCA 5B8CC 2Z31B 5CJ8A 3N50A 5IB2B 5FYKH 3DETD 4HBCL 1P9MC 5CSZB 5HGDA 1KLGA 5F7YC 1ZTXH 2G5BB 3VXUA 3H3PH 5HHOB 2VAJA 5A3ID 3LY6A 3SKNA 3QI9C 3VFUB 4C57C 3W11C 1NUGA 3WD5L 3IRZA 5J12C 3UC0L 5DJ6A 5A1AA 5D96B 1FLRL 2HKHH 4UTBL 5H35B 3FO1A 1M71B 1ZT1B 4J3TA 1YEIL 5IMOA 3M1BA 4JFPA 5DMYA 2FEEI 4OTXH 3CC5A 1NMBL 3BO8A 4U6HA 3TZVD 1CTNA 1K4CB 2Y36H 4M5ZH 4HIJA 2HVJA 1GIGH 1N3NB 1T7YA 2B4CH 3QWOA 5GRUH 5SWZB 2OSLB 4Y4HD 4LDLB 3VFPA 4HUVB 2AXHA 3TT3L 4EBQH 3MRPA 4P46A 4OLVH 3WE6A 3ME0A 4LIQH 3P4NA 4LHUA 5DMKA 5T3XL 1FFPB 3O8XC 3ARTA 4E41A 1G6RA 3CSGA 3PQYA 2JCCF 3HE6C 5LJYH 3SDAC 1FFRA 2D7PA 3C9NB 2HT3D 4KKBD 4R4FL 4UT6L 5F9JA 1MFCL 1RUQH 1J8HE 5E0QA 2G5RA 4FFYH 4TUKH 4X4YB 2WINB 3O3AA 1FFOA 5BS0A 3MLXL 4HUXA 4RGNC 1A3QA 3DGGB 5I8OL 2ZKHL 2R8SL 3ZE2E 1J1OH 1T3FB 4XMLH 3K2UL 4CDGC 2VDQH 4XNZC 1PYWB 2HA1A 3K1KC 3QNXB 3TWCH 3ARDD 3TVMD 2DL9A 4ZSOE 3TA3B 3ES6A 2CXGA 4NYLA 1KPVA 3P0GB 1P4BL 3KYKH 4JREC 1Z9OA 1NFDE 4NQVA 1MH5B 2XZAL 1KJ3H 1M4KA 4LARH 1OW0C 1JWUA 3L3HA 4BYHA 1E4WH 1T5WB 3I6GB 5IBLC 5DFVC 4HIEA 3N1FC 2KUTA 2WIIA 1NJ9B 3C5ZC 4L8BA 2Q87A 3GNMH 5D7LB 1OAKL 3I3BA 2NY2B 3HE7A 4EIGB 4JLRB 4K3JH 5HHOD 1Z9SA 4KPHL 3WFEH 4OT1L 2AJ3A 3SCMD 5I9QC 1CE6A 3S36H 5CKGA 5GS1A 5C0CB 3C6SB 1YEJL 4NZTH 3WJLA 1WEJH 2MHAB 3MV9A 1BM3H 3HNSH 5TF1H 5T3ZD 4Z76A 3QCUL 3S3SA 5GGRY 1DBAH 4Q9BA 1JL8A 3O4OB 1IM9B 5DFTA 4U1LB 1QSEA 4M61A 5DQ9B 5ABDE 1FNEA 5C07A 1HN1A 4J6RH 3BSZL 5CEZD 3BWUC 3MFFA 1EEUA 3ARSA 5ENWB 3N85H 3T0WA 4NQCB 4XHQA 1KFAH 5F3BA 1B6UA 15C8H 1L6ZA 2WBJD 4ELKA 4HH9A 3GSXB 5SWZD 4X80L 1CGWA 4PJAE 3OX8A 5ERWB 4LCUB 1N7ML 3TP4A 1Z6JT 1EEZB 2BXZA 3S4SB 2Y5TA 1U8PA 1P4LA 4L9LA 5GISH 1YJDL 1OSZA 2HWZL 3U4EB 4U49A 4IMKA 5L8JB 4MSWB 3RPIB 1Q0YL 4W6WB 3T2OA 2XWBB 5B4MD 5IK3B 3TEUA 1N0LA 5IBUG 2X4SB 4XAWH 4JHAH 4DQOL 4RWHA 4UU9B 3P77A 1FG2A 1NEZA 4XP6H 1U92A 5L0QC 3VWKC 2W59A 5JIIA 4JDTH 5AWNH 4K94H 3MNWA 1CGUA 4LU5H 5D70L 3W2DH 4EXPX 1TJIH 3JTTB 4GG6A 3EJYC 3O6FA 4ZFOB 4NUJB 1I8IB 4YHNA 2FECI 3L5JA 5FYLH 5ID1B 3DSNA 4JJ5A 2DLFL 1HEZB 4N9GB 3RJQB 3QFJB 4ODXB 4YHIB 1NBZA 1CR9H 2E27L 3ULUF 5F6IB 3HRZA 5I30L 1U3JA 4Y8AA 1FFQA 5DLMH 4CVXA 3JWOH 4PV8A 4P2QB 5B22A 5GJSL 1CS6A 4KY1H 1G7PB 2YEZB 4PRPA 2H32A 3AS3A 4MXWH 1BD2A 5C0IA 1Q9WA 2COQA 1VEMA 3HAEH 4KROB 1Q94A 5TGBB 2EE9A 4U1NB 1FZOB 2BOCA 3TJHC 5C0CD 2FH8A 1EK3A 1NBVL 2OBGA 4JR9H 3ZZ1A 3IDNB 1YDPA 2C26A 5LG1A 3QCTH 1PY9A 3BPLB 5H8DA 5L7XH 4YFLF 4MXVF 4TULL 3NZ8A 5D9SB 2H26A 1IM9D 3RVUC 3WUZA 2W9LA 1RUAL 3IDJB 3O3BA 4YGAB 2NCMA 1INEH 2BSTB 3FB8B 4QRPB 1AC0A 3ULVF 1LP9A 2BHYA 4NQCD 4XNMA 3IDUA 4UUJB 1S9XB 3WFZA 4Q97A 4MYWB 2CD0A 1Z3GH 3JV4A 3UBXB 3S7GA 4DW2L 2FEDC 2G60L 3F7VB 2XN9A 1R3LB 5FKPA 2VZSA 4GFTB 2DMBA 5EA0H 1V3MA 3I75B 3SPVA 4UIMA 5J9PB 1NC2A 2XKNB 1J9CT 4I3SL 3FO2B 1F4YL 1Z0MA 2B1HH 4I0PC 4PGDA 1EFQA 4NN5B 2OL3H 1BWMA 5IMLA 3CDYA 4U6YA 3Q5TA 3S35H 3GSNL 3H9SA 3QUYC 5HHPB 3GK8L 2UYLA 4ISVB 2B20A 1KLFA 1KYOJ 1IC7L 4MXQC 4K7PL 4NDMB 3EYQD 1CDCA 2ZCLL 1B4JL 4NKDB 1T5XB 1LILA 1P7KB 2AW2A 2QKIA 1E6JH 4I4WA 4JY5L 4U3XA 5EU3B 3SHSA 4DCQA 4F8QA 3MR9A 5ITFA 1U58B 2R23A 5GS0H 3NH7H 5I0ZA 2IFFL 2Y5EA 3BKCH 2FO4A 3UYOD 1QLFA 3FT4A 3CU7A 1J05A 4TOYH 2EIDA 3REWB 4PB9L 4P59H 1YEKL 3HZMA 3RKDD 1YMMA 3IU4H 4UAOB 3OBAA 1FO0B 2BFVH 3BVNB 3FFDA 4CMHB 4KRNA 2R39A 4IOFC 2MWCA 2R2CA 2WK2A 4G43B 1EZVY 1A47A 1OF2B 4KROD 5I1GL 1DSFH 1MUJB 1I8LA 1A5FH 4LLVB 4R0LB 4MJIA 2NYYC 1V7NH 1IAKB 2FJGA 1T83C 3ISWA 4GBXD 4L29B 4WO4A 2H6PA 3IXAB 2GAZB 3RAJL 4IDLA 1A1OB 4IRSC 4KKLD 3HZKA 3L5IA 4PJ7B 3IJSB 2AXGA 1AP2A 4P3CH 1BZ7A 3SGEH 1UVQA 1DVFC 1S8DA 2BDNH 2OI9C 3CVHA 5F97E 1BECA 3BN3B 3GI8L 5I15L 4UT7L 2YD6A 4QRPD 1CICA 5I2IB 4OD3H 2O5XH 2VXVH 3S4SG 1HHJA 5CSGA 4NN7C 4LSTL 4HCRA 4LP4A 5EOQL 5BS0D 2OP4H 5T1LD 1GGIH 1EHLL 1DQJA 5I1IL 2XZQH 3D39A 1MLBA 2SEBA 1C16A 1T0NB 3U48A 4X6BA 3TPUA 5L8LB 1INQB 5E08L 2P5ED 3VRIB 4ZFGH 4AEHH 3VE0A 4DGVH 2AXJA 2R4RH 1CLCA 2OR7A 5CZVL 3QDMB 3INUH 4ZOBA 4PGZA 4K8RL 1TETH 1URLA 2VQ1B 1XMWA 3K46A 1OHQA 3VCLB 4QCIA 3VXOA 2OMBA 1M6OB 4IM8A 2AV1A 3IYLW 5B38B 2PXYC 3T65A 1IJ9A 3PWUA 4CVZA 2BRRL 3WEXA 3QDJE 3QHTC 5KSVB 4Y4KA 2VE6A 5JA8B 5EZIL 5TDNB 1Q72H 2EIZB 4POZC 4DGIH 4YHZL 4LRNL 4H88L 4AH2A 4HUKB 3MV7E 2AJXH 4QWWC 1QSVA 1JPTH 4APQA 4WI4A 5J6GB 4XBGB 1G7MB 4U33A 5TF0A 1RJYB 3ULSA 2VXTH 3DO7B 3M8OL 5HI4C 4U1IB 4PY7B 3P0VL 5DEZA 4YXKH 2VLME 1A7NL 2UWEE 3KPRE 2B39A 3MLPA 4LP5A 3WNPA 1PG7W 3DECA 5C07D 1RK1B 1JHKH 2E6JA 5HD8D 3CFDA 1ZLVK 2DQGH 2CLZB 4ERSL 4P5MA 3LEXB 4GOSA 3OR6A 3LN5B 5TDOB 3L3OB 3ZDZF 5IUSA 5DMIL 5GIRB 4KVCL 4Y16B 5F7FA 2OM5A 3OF6A 3QIBC 4YHMH 1SJHB 1EJOL 4UDUB 2ZWLT 4S1SH 4JQXC 2Y06H 3VW3L 1B2WL 2ICCA 5HYJA 3GMNB 3UTZB 3EOAB 4OIBA 3RIFF 3Q6FB 3UBXG 1CXEA 1WAAA 2J8UF 2EYSA 2NY1C 5MEPA 4MA3A 3ZKNC 1MCPH 3THMH 1JIBA 4CRPA 2XPGA 3MLWL 4CVUA 2QQQA 4L5FL 3Q48A 2DQIH 1KULA 4K3EL 1T21A 5FUZH 1A6WL 1M05A 2YKLH 5JHDB 4PREB 5ICXA 3VJ6B 1PDKA 4NNYA 1R24B 2AQ1A 3PP4L 4RX4D 5LBSL 4Z5RA 2HT4C 4LAJH 3T4AA 3L3KA 5K9KB 4UIKL 3IJYB 1RAMA 4JCLA 4NM4H 3NZHH 4MB5A 4TPRL 4FQJH 4OCXL 3WFHA 1UKTA 3G6JE 1X6NA 1P7QA 1YMHA 4GAYB 4X99A 2ICEB 2D7MA 1IBGL 2W65A 5HDOA 4F8TA 1VFBA 3MRKA 5I8KH 3JXAA 3QUML 1CK0H 4L8CB 1QBLL 4NRXA 5DD3H 1EIBA 3CH8A 1UB6B 1V5JA 3H7BB 5F9OL 4PRHB 3EFFB 4LASL 2B1AH 4IOSD 3WFCL 1SM3L 3QH3A 3MXVL 4OGYH 3MZTA 2WZPD 5D5MA 4OI9A 3MJ8A 2O61A 1OT2A 5ISZE 2J5LC 1A4KB 5E2UH 4I18A 4FXKB 4O9HL 2ZUWA 1ZHBA 3D85B 4LEXH 5F8RC 2C1OA 2D9QB 4WV1B 3QHFH 1OGAB 1EH9A 1JVKA 2MOVA 4OBRA 4F3FB 2P48B 5CZKA 4GG8B 5DC4B 1KGCE 2PW2A 5IFAH 3HTLX 4OZIE 1KIQB 1G9NH 5SWSD 3D18A 5D6CA 5BV7B 4GAGL 4H8WC 3L7FA 1WTGT 4XCCL 4Y89A 1OAQL 4LLMB 2FJFB 3V0AC 2VDMH 3OAZK 3WBDA 5D7IA 1MWAL 4ZOAA 3EO0A 3MBXL 3O3DA 1FFNA 2CJUH 3CD4A 1XF2A 2PO6C 4Y16D 2X9XA 3HFML 1CLYL 3RWJA 1CT8A 2GT9B 1NDMB 4PJXA 3G6DL 1F6AB 1MPAH 2R0ZL 5IW1B 4ZNCD 3T8XB 3DXAB 2Q6WA 2NXYB 4IRJB 3QUXA 3ESVF 3MOBH 1PBYA 2NY5C 2IQAB 3QIWB 5GGTL 2ITDB 3MRHB 5HHXL 3OXSB 4P23C 4KK8C 1Q9OB 2JB5L 5D72H 3NMEA 1KNOB 1ED3A 3JV5A 1SYVB 2IPUG 1HH6A 3E3QC 3MZGB 4JGUA 4EQ2A 3U46B 5D71L 4HKXA 1I1AC 5GSRA 5LCVL 1VPOH 4YHYB 3BZFB 4I3GA 1VB9A 4LSVH 5JXAL 5JHDD 4NZRH 4N0CC 4JM2B 2H41A 1AO7E 3SKOA 5DWUL 5DJAA 1X9QA 4CBPA 2IGFL 5DD0H 2BOBB 3IVKB 3IT8D 1KBGH 2X4NB 3GZKA 5MP6H 5F7HA 5JOEA 1QEWA 2JLLA 5FGRA 5C3TA 5C6TH 2JELL 1D5MA 3NCYP 1EEQA 1OQXA 4JZNB 1AGFB 3AREB 1GGCL 3FQRB 3WSQH 3QZWA 3E1F1 3GMPB 3PWPB 2YBRB 4GQPH 1G9ML 1H3PH 5TFSH 5F1SA 5FO8B 4X9HA 3KYMB 2FSEA 3S8WA 3ROLB 4RGMB 1JFQL 2YD1A 1EO8H 7FABH 5E8EA 5DJCA 1FVCB 2V2WA 1ZA6A 3GSRB 4BELD 2EDBA 1MY7A 4FTVB 1IEBA 1GZPB 2F5BH 1FE8L 4M3KB 1ZHLA 3BAEH 5FM4A 4D9LL 3EYFB 5L2JA 2FD6H 3H7LA 4JY4B 4PJFB 3I02A 5EPMB 5HSFA 2XY1A 4QTHB 1MRCL 3G04A 3QO0B 1Q9KB 1AI1H 4JFZH 3EO9H 2H9GA 5FV2A 5TPWL 1YUHB 2FJHA 4XVSH 2AV7A 4EEEA 5F7DA 2JJUA 1I9RL 3KJ4B 3PV6B 5ICYA 4X4XA 3ZT5A 4Q7DA 3V4VL 3BZ4A 4PJBF 4PJEA 1FN4A 3DROA 3FN9A 5EU7C 3ZE0E 1NL0H 1KIPB 3LPWA 2X09A 5L6YL 5F6HI 3O2DH 4YQXH 3SO3B 2OR8A 3VXMB 3HI6L 3FT3B 4U1SB 4X98A 5F7UA 5T1KB 2O5ZL 3VRJB 2NXYD 4X6DF 1R3KA 4NKIH 2P8LB 1PD6A 4NZUH 4N0UA 1B0RA 5C0BE 3EAKA 1HIML 5A16A 2VDLH 4R4ND 5DTFB 4IDJH 1RIHH 2DQJH 5J6HA 5EC2B 3MRBA 5IHBA 4DZBA 3HI5L 2X10A 1QFWI 5E6IB 4JN1H 3HC0A 1FL6A 1HYRC 3H3BC 8CGTA 4Y4KD 4JM2D 4UV7H 1QD0A 3FKUS 3UJTL 3WS3B 2F58L 2YSSA 3CZFA 4LCCB 3SDXF 1CU4L 3VXNB 4PUBH 1IC1A 4R97C 1AQDA 1QUNA 1VDGA 1HKFA 4BFIB 1O7SA 2W0KA 2FLBT 2I5YL 3WL9A 1ZHNA 3IRPX 2QR0A 4EI6A 3AMKA 2IBZX 2ILLA 4GRWF 1CYGA 3QG6B 1X6LA 4IJ3C 3CFBB 3DX7B 3RWEB 1TVBA 4PRIA 4P2OB 4WTZG 1TNMA 3OJMB 35C8L 1UWEL 3F8UB 1S7SB 3RNQB 3FB5B 3S96B 4KGJA 4JRYB 1I7UA 1IGML 2A6DB 4RZCA 2LU3A 5KVDL 3V4PH 4MDIA 4OZ4A 1ORSB 1T7XA 1N59A 4JRXE 4F7PB 3GMRA 3GSWA 4HKBA 1IGJB 3D2UB 4GAJL 3RDTC 4K7FA 3AS1A 2F54E 3T3PF 1DQQA 5CILL 1KCLA 5I19H 3H6JA 1NAKL 5D7SL 3GSNA 1FGNH 5DJZB 4GKOA 5KJRL 1HDMB 2N7AA 5FYJL 1K5NA 3KPNB 1CG9A 5GPRA 4ZXBC 3U0TB 4JANA 3C6LB 4RCAA 1X44A 4PJIA 1WT5C 2E7LA 4W4OC 4W6XB 5EOCH 1K9TA 3PE9A 1X5FA 5EBGA 1EEYB 1EV2E 4PV9B 4EDXA 2HKFH 1Y6MR 2FWOA 3AAZB 5FB8B 5L88L 5LXGH 3GUTB 5FM5O 3B9KC 3DETC 4NQEA 2CRMA 4P5TB 2XZZA 3TH2T 3GBLA 5C0NC 1DCLA 1DQDH 3UTQA 4YDJB 5D7KE 2FO1A 2BERA 5KVGH 1H3GA 1UM5L 2NW3B 2AJYH 4LPUA 5B39G 3MROB 3TFKC 3NGBC 3BEWA 2ZUVA 4R26H 4G8EA 2VB5A 4JKWA 1BQHA 3VXSD 4N5ED 4O02L 4D3CL 3RWFA 3WUWB 1DUYA 4P5KA 3AU1B 1MFAH 1DQML 2BSED 3U0PA 1QVOB 2I9TB 5J1AA 1P7QD 3QFDB 3LQAC 1YYMH 3UC0H 3SBWC 2EH8H 3H42H 1T89A 3FB7A 1SVCP 3ZYZA 3DI3B 4YWGL 2VDOH 3IDMA 3TZVC 2CQVA 3B2UD 4OZHA 4WW1A 4Q58C 5J11B 2E9IA 2AKRB 4YZFE 4PJHB 4LQFH 1IM3A 3LSOA 3EFDH 3P11H 4HJJL 4PY8I 1DE4A 4Y1AE 4UTAH 4FQHA 3B5HA 4JPKL 3D3VE 2P24B 2WLYA 3RWDB 1BGXL 2Z35A 5T5NF 1GYAA 1KIUA 1YEEH 3TT3H 5DEGB 3RBSA 4X6DB 1S7QA 4XXCA 3X11A 2N56A 4AZ8A 2VIRB 4TSBH 5T3XH 3KPSE 5D1QA 5C9KA 5AYQA 1H3XA 4JRYD 1T1YB 2QTEA 1OT1A 2CLVA 4L8DA 5EZOL 1MI5B 3RVTC 4EUPH 1ZGLA 4Y19E 1X4XA 5AZEL 5AZ2L 2DTML 3GJEB 1DBML 1CLZL 12E8H 3TO4C 3ZKXC 3NTCH 4F58H 4XTRD 5IR1B 4DTGH 4OCSH 4K23L 2AEQH 1F90L 2OTWB 2Q76B 1JGUL 3K2UH 4M3JA 2VUYA 3ILPB 4JO2H 1ZA3B 5E5RB 3GM8A 3JBG7 3O6LL 1RI8A 4QRQB 5HJ3A 1KXQE 1P4BH 3U9UB 3I9GL 4NJ9L 5JIPA 3RY5A 2Z31C 1CXLA 3ZL4H 4F33B 1LDSA 2HG5A 4UINL 3L9RA 3WO4B 4R3SB 4F9PA 1MELA 4P5TD 2QADC 3MOAH 1OP3H 2GJ6B 1I9IH 4HFUH 4D8PA 2CLRB 3IDIB 5D1XB 5C0AB 3T0ED 1P1ZA 4HJ0D 5ETUA 2OJEB 3L3GB 4L4TB 4EVNA 4OLWL 3PIQA 4KPHH 3VXQB 4YXLH 4RAVA 1I1FA 2GYSA 2YK1H 3O11A 1UCTA 4AT6A 1R5IB 2BNRB 3KHQA 1E0OB 3UTSE 1MF2H 3LB6D 4NGHL 1J8HA 3DMMD 4PR5B 5TE7H 4P9ML 4MWFA 4X0KB 3JZ7A 1QSZA 4PLKD 4X7SL 2PYFB 3WNLA 3A6CL 1DL7H 4Z7UE 1T20B 2MTPA 2Y7QB 1KYOK 3DSFH 4H26B 1N4XH 1QTYT 5DUMH 4Y2DA 3V6FA 3GHEL 3O3EB 4U1GB 4ZFFA 1TZGH 1U6AL 1N7MH 1NFDA 2VXSL 3GMOB 5HYEA 1UJTA 2VLKD 3FCTA 4F9LC 3FQUA 1MHHA 4L3EE 1F42A 3PWNB 3IAQA 4OM0H 1DANU 3MRCB 4JFFA 2FIRT 4HJGA 5E70A 5B4MC 3KLAB 5I8CA 1DJSA 1F00I 1B3JA 4HUNB 1NCWL 1L9MA 2WUCL 3GHBL 5IVXE 1QFWM 3RY6A 1A7PH 1RUPL 1BFSA 2VWEE 4KK9D 1JK8B 4YHPB 5FYKD 4FMKA 2YD5A 4BH7B 1Z0NA 5JDJA 3KS0H 3QUMA 5JA9A 1LE5A 3KYNB 4O5LH 2OK0L 5IBTH 1F3JB 1IKNA 3TA3C 3VXPA 3K74B 4OLZL 5JOPD 5MENE 4KI5D 1LWRA 1MOEA 4OGAD 5ADPL 2IAMD 2F53E 3R4DA 1BEYH 1S9VA 1HSAB 3LMJL 4O2FB 2A6IB 3U36B 5EG6C 1FYTE 1G9EA 5D93B 2PN5A 1NGXB 3JUYA 4P4KA 2X1XR 4S1DC 5DJ8B 5I16A 3OKOA 2XICA 3C2SA 4NO0A 3R1GL 1JYNA 1D5ZA