3HE7D

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
240
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSSTGLDTQYFGPGTRLLVLEDLKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 57
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2009-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7D02
4NKDB 5GGTA 4LSQL 2J5LC 4XZUB 2CIIA 5TDPA 1NDGB 2NY1D 3HUJE 3LPWA 3MOAL 1PKOA 1I75A 4KKBC 1G7IA 3MLTB 4PGBA 4I3GA 5D7IF 4PJ9A 1KV3A 3MOAH 1L7TH 5TQ2H 1QFWL 3R0MA 4A6YB 1T89A 4HZAA 3EOBB 3NCYS 5DT1H 4ZTPH 1JK8A 5HGDA 5HHNA 3HE6B 4KJWD 4PJAE 3BYTA 1G7JA 5J1SC 4MHHI 4RA3A 4M6NH 4G7VH 2FSEB 1UB6B 1KEGH 5F9JA 4K8RH 4TVPH 5F7KC 4UIMB 2BMKB 5D5MB 5HI4D 3BUYB 4Y4KB 1DLHA 5FK9A 3VGDA 4OFIA 4RIRA 1YEEH 5ID0A 1YDPA 5D6CB 3LV3B 3O45B 2D7TL 4KK5C 5HI4C 1K3ZA 4YLQT 3LKPA 5MEOB 2BRQA 4GKSB 4KK8D 5F7LB 2H45A 3Q0HA 5I75B 4LRNL 3L7FB 1IGFL 1TITA 5FGBA 1PQZA 5DC0A 5GZOC 2D4DA 3S5LB 2A6KA 1RAMA 4OV5B 3CNKA 4OFYD 2BSTA 3F7PC 4DKEL 4HC1A 4TQEL 5FV1L 3IDNB 4G6MH 3QEUA 3OAZK 5TQ0H 1CE6A 2K7QA 5F7EH 2Q3ZA 4NN6B 3Q5YA 1MJ8H 5CIPA 4F57L 1YEDB 5FF6B 4OLYL 1HCVA 4OLEA 5E8OA 5EFIA 5KSVA 5CAYB 1JNLL 5I1HH 1HSAA 5FF6A 3BKMH 1OP3H 2E5EA 3NCFB 2MOVA 1ACYH 1TDQA 4MS8C 2AAVA 3ROLB 4LP5A 3VXMA 3GO1L 3QUYB 3KJ6L 4GW1A 3DO7A 2AS5M 4MLIA 5EZLA 5FYLE 4PJBE 5IQ9A 4X4XA 4P2OB 2I26N 5H35A 1LDSA 4JFFA 1BX2A 2XTJB 5TDOA 1DQQA 3MRLB 2LVEA 1FL5B 2BVUA 4KI1A 4JFFB 4P5MB 4V1DD 1RUPH 1IQWH 2H8PA 5LBSH 1S7XA 3NTCL 4X7FC 1WFUA 3MCKB 1IM9A 2XXCB 3KYKH 1OAXH 4I3RH 5BRZE 4QHUB 3WL9A 3RPIB 2X70B 1U92B 3ARSA 3QDGD 3NCCB 1OCWH 5BV7C 5IV2B 3MJ9H 2FO4B 3MMEB 1OOAA 4MA8H 3UJIH 3HCVA 5EZOH 2XQYG 1N0XL 1QD0A 3WEXA 5JXED 1NDGA 1S78D 4PJHE 1ZHKA 5GS1B 3U9UB 4YHOH 3T1WA 4TSCL 4GG6E 4H8WH 1UACL 5FECB 3TBYA 3PL6C 1BBDL 3PWVB 4N90E 4PJIB 2NX5B 5FM4A 3P11H 5B22A 1B4JH 2Y5TA 1LO3H 1MQKL 4M8QA 4K94H 4NDMB 2W1NA 4U1NA 4JM2B 3U7YH 2NX5D 3HE6A 1QA9B 2BK8A 2GSGB 5IBTH 3SJVE 5SWSE 4U1NB 1BM3L 3ISWA 1KIPA 5DK2B 2GFBA 4Z76A 4M6AA 4NJAL 1NGWB 3SDDA 5CINH 4JRYA 4BUGA 5IFAL 4C4KT 4K8RC 1AGDB 1HKFA 2OS7A 5EU6E 1UWGH 4Z7VA 8FABA 1C1EL 3VD9A 3D3VE 4XVSH 1AXSA 3WJJA 3BP7B 1MFNA 3B2UD 4XWOD 4E42B 4QXUL 3W2DL 5I30L 1GHFL 1RVFH 3SE9L 1ZT7B 3D3VB 1NGPH 4HH9A 3G6JF 3TBSA 4AMKH 3DETD 5C0CE 4HEME 4Y2DC 4NZDA 2QL1A 3N50A 1IGYA 5F3BA 5FHBH 4XWOC 2DM4A 1MCQA 1AFVH 1SJHA 1UYWH 4GMTH 3TJEH 1IQDB 3QUXC 5AYUL 1IGYB 5F3BB 5CSGA 12E8H 2FX7H 4ZAKC 1T22A 4DUWA 2VXVL 2NY3D 1EIBA 2R0LL 2RFXA 2VZTA 1RIVL 3I3DA 2C4FU 4MJIA 3WJJC 1S7RA 3OGOE 3SDXF 3V52H 5IMMB 4O5LH 4HULB 4HKBA 5FA3A 5I6XC 2B7DT 3TA3B 4L1DA 1LD9A 1LP9F 3RTQD 3RY5A 1WEJL 4MCYB 2YMXH 2M1KA 5IHUH 4C56D 5B21A 4RA0C 4LSTL 1WC7A 2XICA 3S97C 3GI8H 2V9RA 2NY4D 2O5XL 4X5WA 2XWBB 1N3NA 4Z7NF 5C0EB 5IF0B 3LRGA 1FNHA 1JHTB 1HKLH 2KBGA 3T0VA 2VLME 1ACYL 4XAKE 3BIBX 1JBJA 3P4NA 2IPUG 1G84A 2VLKA 5IF0A 4OCXH 4XI5D 3RUGE 2VH5L 1HH9A 5T3XE 2WBJA 4NC2B 1CGYA 4B41A 3KPRE 3MA9L 4Z7NE 1LEKB 3ILQD 2I60H 3HS0B 3O9WA 2HRLA 3BMVA 2AQ3A 5DUBB 5E2VH 3LOWA 1FJ1A 3MA9H 4M62L 2B1AL 2P5WE 3H42L 4G6JL 5DJ2A 4RNRB 4OJFL 4AYFA 1G9MC 1AR1D 1ORSA 1MPAL 4RNRA 1RI8A 4NQEB 2PETA 4LFHG 1UJ3C 3RL1B 3MRMB 1DQJA 1B2WL 4P9ML 1GPOH 1TPXC 3P0GB 4OD1L 3QDAA 1QP1A 3RWDB 3BW9B 3MRKA 1GGIL 3QIBC 1EAPB 3RWDA 2YBRA 1H3PL 3DVGA 3QZWG 4QNPE 2NY5L 3GKZA 2L7UA 2VQ1A 2FX7L 2R1XB 3QCTH 2OLDA 1ZA6A 2XA8H 3AMLA 4G43B 3OKLB 4WHCA 2VZOA 4KTEH 3CC5B 4NKOA 1CFNA 2H3NA 2UVEA 1VFUA 2GFBB 1N6QH 1JTOA 4KVNH 3T0AA 2YSSA 5D1QB 4XNYH 3RIAF 4C83B 5DGQA 4XNUH 4WI8A 4L8BA 4DTGL 3GRWH 4CMMB 1T7ZA 4RCAA 1FNGA 3BP4A 3L3HA 4WI3A 4AEIH 5IJVB 1CD0A 1CF8H 1ZHLA 1U8PA 2EECA 2YD7A 3O3UN 4NQCA 2YUVA 1OM3H 1QQDB 3OR7A 2XZQL 1QOKA 3CVHH 1VFBB 3MNZA 4BM7A 4Z0BH 4U0RB 2LE9A 3IDUA 3CFDA 5I1LB 5EU7E 3QXVA 3S5LA 3MNZB 4MQXD 1TTGA 2A1WL 4JZNB 1N6UA 2DQCL 1NJ9B 3DWTA 3IRPX 2DIBA 5A2KH 2EXWC 3JTSA 4IOFD 4JHWH 3RQ3A 5D6CA 2FIRT 2VERN 1OW0A 3WN5C 1S7RB 5FA4A 5HHPA 3ZLQC 1LE5A 3TZVD 5J3HD 4BQ9A 1FORL 3KPSE 1RMFH 4UU9A 5KVGH 3QUMH 1LE5B 3KXFE 5DSCB 4P4KA 1CTNA 4I18B 3CVHB 3UROR 4OLUL 4TULH 4Z7VF 1TETH 1ZOXA 1NGZB 5HDBE 2IGFL 4JN1H 3VFWB 2BSTB 3FMGL 2VKWA 1ETZB 4PLOB 1KJVB 5INDB 3UBXG 1LEGA 1IM9D 5EU3A 4EQ3A 5FB8A 4HUWB 4MJ6A 2Z31A 1BX2B 1Q94A 4Y2DA 4N0YL 1MCLA 3P4OA 4OLZH 3WHXA 4DVRH 2MQCA 1MREH 3GI9L 2PO6C 4P4RA 4YHIB 5H94B 3T3ME 1BD2B 3L3IB 1IKFL 5DQDL 1I3GL 4JDVA 1RK1A 2XZQH 2AVGA 5JIKA 3GHBL 3NCJH 3MRRB 1JF1B 1YMME 3H42H 5E2WH 3ARYA 4M62H 4Y8DC 3QHTC 4U1LB 3MRNA 4Y5YA 5IESL 2WIMA 3WS6C 1FDLH 4HLJA 3HHRB 3OTTA 4M5YL 1AY1H 5IESH 3GRWL 3LKQB 1YEJL 2LU4A 4WHTB 1CK0H 1DQQB 3THMH 3DXAB 4PJEE 2AJ3B 4PJ7E 3TIEA 1T03L 2HRPL 3QH3A 3JTTB 5EC1B 3MRJA 2Q76A 1S9VA 3LZFL 1KTKE 4JG1L 2PTVA 2YPLD 2F19H 1PD6A 4CADA 1P2CA 2WUCH 1MHPL 1ED3B 1KENL 1RVFL 2OM5A 5TQ0L 1RZKL 4E41E 1FIGH 2FECL 5GGVY 3JV5A 3H7BA 4JM2A 4PJXF 5FYKL 1QLEH 1DN0B 2P8PB 3SDYL 1OB1A 4YHKH 1NLBH 2N7BA 4NQXB 5A3ID 4HPYL 2NXZD 4WEUD 3BEVA 1W0WB 5ID1A 4XMPH 1XGTB 2F53D 3FZUC 2NXZB 3E6FB 4YXHL 1DDHA 3ET9F 4YEEA 4P2OC 2GIYA 2D4FA 4C56B 1MQKH 2X4UA 4P5TA 3W39A 3HI5L 3RIFK 4X7TB 1JGDB 2W9LA 4FFVC 1QR4A 2NY4B 2XWJA 1XCTB 4P57A 3OJDA 1JWSB 4I2XE 5CD5C 3K8KA 1CQKA 3AS2A 3HI6H 3DUUB 1FPTL 3KYOB 3DSFH 5FOBB 2YKLH 5JW5B 2A6DA 4HC1L 4R0LC 1ZGLB 1XGPB 4MNQA 1MVUB 1A47A 3Q1SH 1HHJB 4GXUN 1H5BC 4PV9A 4HG4K 1EZVY 2OI9B 4DGVH 1WWAX 1ZT7A 1F02I 4KKLD 3MQIA 3CJJA 4NQSA 2E7MA 2ZPKH 3CDGA 4PY7B 5I73B 3FQNB 4HKZA 1OF2B 3BDXA 5CGYC 1PQZB 4OZGF 1SEBB 3QHZH 4HUUA 5C2BL 4FFYH 3VFUB 2F58L 1T80A 3N1GC 3HNTL 3L7EA 6FABH 3GMMB 5I75C 1KJ3L 1OTSC 1NC4D 3QHZL 4JQVA 4AY0A 2V7HA 4OV6F 5D7SL 1UH3A 3ULVE 2X1PA 1ZVYA 5CIPB 5FM8A 4LNVA 4QRRB 3TBWA 5GRUL 1E4WL 1BQLL 4LHJB 4ONGH 1F13A 1ZT4A 4FQLH 4YFEA 2EDRA 2HWZL 4LAQH 5HHOA 2J3SA 3GSUB 2IH3A 5JOFA 1JTTA 1N6VA 5DUBA 4NUGH 3WN5A 4D3CL 1T20B 1VGEL 4YPGA 1BAFL 1JGUH 2E9WA 1VADB 4S2SA 5F70A 3O4OC 3MV8E 1EHLH 4DUVA 4KHXH 1I8IA 5DVLA 5IUSA 4EDWL 2MCG1 1JHLL 3VXTA 4NFBA 3EYVB 4QRQB 2WM0A 5CEZL 5DI8A 1RQ5A 5EPMB 1N8ZA 2Z9TA 2F54B 1UXWA 1SEQL 4WEBL 3RI5F 4APQA 3MOBL 4LPUA 3MRIB 5D2NA 5HY9A 3TO4B 1AFVL 4GMTL 4OFKA 4IM8A 2B1AH 4JHAL 3PWJB 5AG9A 4XMKH 5H35B 3PHSA 1T2QL 1NBVH 5F1OB 3BP5B 3D1MC 3QQ4B 3DUHA 4HFWB 2B2XH 1IEBB 1C7TA 4OBRA 4J4PD 5CGYD 2VXTL 2XZCH 1OWWA 2GITB 4CKVX 5SX5K 2IFFH 3IDYC 4L1HA 1ZS8B 2F74B 2A73B 2P8PA 3FTGA 4U7KA 1KCRH 3N06B 1I1YB 3QIWD 5DJYA 2IBZY 4F58L 1ZTXL 1OT1A 5DTFA 2YWZA 5IGXH 4LASH 4R7DB 4HW6A 4WFHD 5L2JA 2FIKA 2AQ1A 2DTML 4M48L 2QSCL 5DURB 1I7RA 2UZYB 5C0CB 4HK3N 2A6IA 2X41A 3BSZL 3MLRL 1C5BH 3EGSB 3P9LA 1CU4H 1XCQB 3MUHL 2F8VA 1UA6H 3MJ6A 1BFVH 4KUCF 5C0CD 1G6RA 4ZTOL 4RMRA 3PE9A 1XCTA 3RZCC 3VFRA 3VW3L 1QA9A 3MREB 2DICA 4L5FH 1OVZA 4YX2L 3TV3L 2KZ1B 2YPVH 4G9DB 4X83A 5DYOA 3U7AA 1OD7A 1MCBA 4OZIB 2PF6A 1IKNA 1RURH 1BF8A 4JKMA 4Z0XB 1FRGL 2EE6A 4X9HA 4ORGA 3RJDA 3MLVL 4XNZB 2EKSA 2F8XC 5FM5O 1SM3H 2NX5E 4F37F 3JV4A 3SE8H 5I16A 1C16B 4ZUVB 1LO0H 5FYLD 3L6FA 4X5XB 5L2KE 3IS1X 2HKHH 1W72B 4FFYL 2AJZB 2ZUVA 3MGAA 4GW4B 3QEQD 5JDJA 3FONA 4M4RA 2W0FB 3OBAA 4ZO7A 4CW1B 3NFSL 1QVOB 1A4JB 2NY2C 2BSED 2CKBB 3MLUL 4NZTH 3HC3L 3L95B 5T3XD 1E6OH 5F1NB 1T1ZA 1PAMA 3QDGE 2IPKA 4ONHB 3VFOA 2ADIA 1J0JA 1NFDA 4BH8B 3ZE1F 3D6GA 1TQBB 4KJYA 3VXSA 3QBTB 1FYTE 3BN3B 2I07B 3QXDA 3W81A 3PXHA 3T65A 2ICWJ 2WWMC 3FCTB 5TFSL 2FNBA 4PV8B 1AD9B 1YJDH 3FQTB 1FN4B 4RBPH 2YK1H 4S1RH 4PTUB 3TBVA 4BSVA 5K9OB 1I3GH 2OX5A 2JK5B 1F3DJ 4GRWH 5JA9A 5IVXF 3EO0B 5GSVA 7FABL 3DGCR 4M1CC 4ODHH 3ALXA 4MB3A 3L3IA 3MRJB 5I8CB 3O8XA 5JNYB 3CFKA 2EIEA 1NMCB 1O7SA 4PJDB 4F9PC 5MHSE 4P5TC 1U95A 4KC3B 1MAMH 5E70A 2XRAH 1AXTL 3ILQC 2VTFA 4HS8L 1GGUA 3S4SG 5IOPB 2C4XA 1SBSL 3C5ZC 4IHOA 3DVNB 3O6FC 4K7PX 5SWZA 4JPIB 1MIMH 4DCQA 4KMQA 2VL5A 4WRLA 3O4LD 4NN6C 2CIIB 4PFEA 2EDLA 4BSJA 4JDZB 3STZB 3A6OA 2Z8RA 2WUCL 3VFTB 3DV4B 3DVGB 4ENEC 3O0RH 1AR2A 4UTAH 5J4MA 4PS4H 2APFA 3GNML 4UNUA 2ITCB 5CMAB 3QEHB 4MVBD 1R5WA 4X99B 3CSGA 3SO5A 4OI7A 1U3HC 2UWEF 3HMXL 1UZ6E 4PJGB 2ORBH 2CMRL 1CFQB 2CD0A 5KW9L 4JFPA 1HOCA 1AIFB 1BVLA 4M7KL 1C1EH 5C0RH 3OKEA 1D5IL 5IBLC 3FO9B 3PP4L 1L7TL 5TQ2L 3SEPA 4G8FA 3NPZB 3FO1B 3O6LH 1IAII 3GHBH 4PYGA 2Y36L 1IGTB 4X9FA 4P9HH 3MR9A 4WU5B 4PRPA 1VGKA 4QWWC 1IFHL 4QCIA 4D9RD 5C08B 2R2HB 4OZIA 3CK0L 3OZ9L 4O2CB 2HFGL 3O6ML 5DHYA 1MLCA 1R3JB 4Y16A 3S35X 1MHHA 4X6DA 3U48A 1DUZB 3K2UL 2CKNA 1OAYL 4X0KA 2VB5A 1HEZA 1NDMA 5F7MC 1HN1A 3GSXB 2AEWA 2FH8A 2BXYA 1CT8A 2W9DL 4F9LC 2FBJL 5IM7A 3KNBB 3KWWB 4OSUL 3UYOD 4WWKD 4Z7OE 3U2SA 5GZNC 3INUL 1F3RB 4LSDA 4YR6A 3MUJA 1T5XA 3UX9B 4KTYA 3MTRA 1YYMH 2R8SH 5TJWK 1UB5B 1EEZB 1KENH 4XP6L 5IMLB 1CYGA 1NCNA 4XCFL 5JXEC 1ADQH 4JN2A 4KZDL 2MCPH 4P2QE 3G6DH 3EZJB 3RDTA 1PX3A 2NY4C 1I3VA 1EEZA 4WI7A 3D39A 5GRUH 2VXUL 5FGBC 4L8DA 1T83A 4BZ1H 4J1UB 1JZ6A 1MLBB 3MXVH 4YDKH 4J23A 1C5DA 2ED8A 3NPSB 3U4AA 2RR3A 1L9MA 1C5DB 1FPTH 3RKPA 1FL5A 5CEYA 1JNJA 2JCCF 1WLHA 1BOGA 1G9ML 2JB5L 4GQ9L 32C2B 4ZO8A 3EJJX 1ZLVK 5JXEA 1Z3GH 5JNYA 2UZXB 3G6AB 3C60C 4PJGF 4WW1B 5E6IB 3W9EA 1EJOL 4H8WC 2YA2A 3NBNA 1T1XA 5GJSL 1G7HA 2Z4QB 3JZ7A 1F3JB 4L3EE 1EMTL 4JPIA 5DJYB 3RL1A 1QSFA 5E1AA 4I0PC 3WDHA 4PGBB 5JW3L 1QYGH 3MJ8B 5KVFH 3RFZC 1EPFA 2G9HB 2A38A 3CPLB 1P69B 3BPNB 4Y1AE 4XH2B 3GIVB 1FP5A 2C3WA 4HLZH 1JRHL 4L8SC 1BPVA 2IALA 2V5YA 4DZBB 3MLVH 4PGJA 5HGDB 5HHNB 2X1OA 2ICWI 2NY7H 1OAKL 2DQCH 4MAYA 5CJXC 3UPCA 3MV7A 1R3IL 3SOBH 2AJYH 2VDRL 4X7CC 4OT1L 1KEML 5IG7B 2P42B 4U6VL 1FL3B 1GC1C 1NUNB 4PJ9B 1X7QA 1JN6B 2CUIA 2F5BL 3BT2L 2Q6WB 4R7NA 3U0WL 1CFNB 2H3NB 2O5ZH 1OM3L 4K7PH 4I0KA 5AUMA 1P7QB 3CD4A 3MXWL 1G6RH 4L3CA 4EIGB 3DPBA 3H9SB 5D1XD 3X13A 4P9HL 5JHLH 3T2QA 1AO7A 4RMTA 4XBPA 4E41D 3MRPB 1HSBB 3LKNA 4QHNA 4XTRD 3MUGA 1UJ3A 3X13B 4X4ME 1A14L 2GJZA 1TJGH 4MCZB 2GAZB 4NJAH 1MCCA 5J13C 2LFGA 4S0SD 3O6FB 4NQVA 5I1GL 3VDBA 4LSUL 3RVVC 4AQOA 4RFOH 3CSYA 4HIEA 3D9AL 2UWEE 3MPCA 3OGCA 5IQ7H 2NLJA 5ACZB 1YDPB 1YEGL 1CXFA 2ZCHL 1HIML 1G6VK 2PR4H 4MA1B 4DN4L 3X3FH 4U2ZA 4TUJB 3H9SE 3VGFA 3CUPA 3TZVC 1F4YH 3NIGF 4QHMA 5FGCB 3FRUA 3BHBA 12E8L 3CDGB 2O61A 5BO1L 1MRDL 2OTWB 3G04A 3GSQA 4LLMA 1JZ5A 4PPTA 4FQ1H 4P4KB 4RGOH 2BNRA 4OIAA 3TC9A 2BY1A 4X9IA 2NTSP 4HLZG 2DF3A 4JM2F 4P46D 4PJXA 4KKAD 1GPOL 2JJTA 3LRSB 4IRJB 1DL7L 3MRCB 4QYOA 5SWQB 2NY6B 1DQML 1VHPA 4EVNB 4UOW1 3O3DA 3WO4B 4U3CA 5E8EB 3KS0J 5KSAD 3U9PL 4K71B 3V6OE 1HDMA 3HN3A 1U8NA 4YHZL 3RNKB 3QDME 4YFLI 2YEZA 4Z7WB 2OTUB 1XGQB 3GB7B 3E8UH 1HDMB 5EZLB 1JRHI 4UDTB 1YMMB 5T5FH 1AD0A 4KK9C 2WQ8A 4NHCH 2WNGA 1YYLL 1OSZB 1RZJC 2AK4A 2QTEA 3SBWC 2WAHA 5HHVH 2JJSC 4ELMA 4L3EB 2NW2B 5DI8B 4FXKA 3B5HA 2VDML 3FFCD 3L3JA 4KQ4L 1OAQH 3VXPB 4B53A 3HB3C 3HR5B 3ROOB 1AKJA 1XR9A 1A6UL 4EOWH 1T21B 3M1BA 2EYSA 4PJIA 3ORJA 3MV9E 5AG8A 5IOPA 3UYPA 2XI9A 2R1XA 2ESVE 1GZQA 3E0GA 4JFOB 2QADB 5I18H 1KPRA 2Q7YB 1F11A 4R7DA 1A9BB 4AK1A 2FECI 2XFXB 5B8CC 3I02B 1BLNB 3TJHC 5CP3A 3QNYA 4HUVB 1QFPA 5GISH 1NEUA 3WJLA 4LGRB 1U3JA 4ZUUB 5E4EC 1L6XA 1ZSDA 4YWGH 1KT2A 5ILTH 2Y36H 1U8JB 3TBYB 1DVFC 5TE6L 4W70A 3C5SA 4I0PD 1VFBA 1KN2L 3BX7C 1UA6L 4P59L 3AXLA 5I1CL 5F9JB 4Z7UE 4NYLA 1TJIL 3MZGB 4JRYD 2I24N 4O9HH 3CXHK 25C8H 3FQXA 1FYHB 4KGJA 3SBWA 5C07E 3TCLB 1IGJA 1TCRB 4FNLH 4JRYB 4CBPA 3O8XC 4LEXH 4PRPD 5ADPL 2L0DA 2FRGP 3S96B 2BNUA 2FJGA 1TCRA 3F12B 2FEEI 4MX7B 4NQSB 3SDXB 4WV1C 4C59B 4PRIA 3ZHLA 2DLHA 4UB0L 4GW4A 4LHUA 1MCRA 5C7XL 4POZC 4ORZC 5E6ZA 2YPLE 4TYUA 5HYSB 1ZANH 2BVPB 2DLTA 3AREC 4HQQH 3KWWA 3O2WH 3C2AL 4NJ9L 2P47B 3VH8A 2NY0B 4PYHA 5D6DA 5D7LE 5JTWA 4QRRA 1ZGLP 4LKXB 1N64H 4OD3L 3TWCH 5HGGS 3OKNA 4PLKC 2NY0D 1F45A 1RPQA 1H3UA 2VJXA 4ODXB 2AABL 4OKVB 1GL4B 1UWEH 2MSPA 4F3FB 4QHKJ 4MWFA 4LQFH 3B3IB 4WJ5A 5T3ZE 4X9BA 4TSAH 5A2FA 4N5ED 2MPAH 3ULUE 1G7LB 3LN5A 1EFXD 1MI5B 4LCUA 4Z9KB 3VWJA 5CJOL 4ENED 5CWSA 1UWGL 3LKQA 2YUWA 3N9GL 5HVWA 2DQGH 3IDGA 1IC4H 1MI5A 3MZTA 2VLLA 3L5HA 3RI5K 3L5XH 4DUXA 4PJDA 2Q3AA 5DJ2B 3SGJA 3IU3A 4NQDD 3SN6N 3VG9B 4GRWF 4JKKA 4PLJC 4RGND 1H0DB 3D5OF 2R29H 5DLML 3ULVF 2XKSA 4JO2H 2C3VB 1JP5A 5HVHB 5I1DB 2BVQA 4HT1H 3ULUD 3O3AB 1CIUA 4TSBL 5EUOA 4NSKB 3G9AB 3LAFA 2WZPD 2C3HA 4P5TD 5EA0H 1GGBL 4XZUA 5FXCH 3DV4A 4BQ8A 4YDIL 3ZTNL 2DQFA 4ZFOB 3RZWA 3MMEA 5C3TA 4MDJA 3N0PB 5GGVL 2J6EA 4HXBL 2ZNWA 3EJZC 1CXEA 4OLXL 5DVNA 5DFVC 2DIJA 4EIZC 2SEBA 3PWUB 4WIQA 4MDJB 1JYVA 1F4XH 3VFNB 5DK0B 4QXGH 1CD1B 1HOCB 4K9EC 4IJ3B 3A67H 4MAUH 4M93B 3CMOL 1QNZH 3QIBB 4U33A 1PKQB 3MV7B 4L5FL 4G42B 3ARQA 1ZE3C 4KY1L 4ZO6A 1D5MA 2CMRH 5EC2A 4YWGL 1LHZA 5B38G 2VXUH 5F9AC 4FQ2H 3JSSA 4KRMB 3QI9C 1OTUD 3BP6B 3A6CH 4NO0B 5BV7H 2J8UB 5DA4A 3G08B 2P24B 2VAJA 1JPFB 4HIJB 4WFFE 5GIRA 3T4AA 4LQFL 4Z8FL 1I1RA 2GCYA 3C8KA 1AI1H 4X7DC 4QRTB 1CLYH 1EX0A 3SCMD 2DLGA 3WKML 2A83B 1PKQE 4MVBC 1GOFA 2R2BA 4QHLB 3FT3B 4NO3A 1GZPA 1IE5A 3HA0A 2ZCHH 1VENA 2NZIA 2M26A 4LCWA 4PP2B 3WE6A 4WI4A 3QYCA 4U1JA 4JZOA 2I5YL 5IWLA 1S7VA 5EU3B 4G6ML 3S37H 3BEWB 1CE6B 3PV6B 4PJCA 5MENB 3CFBA 2P43B 2MHAA 2X7LB 5T1LD 4JY6A 3AS0A 1XF4A 5MEND 3FB6B 5JLZA 3UBXA 2IPKB 4AEFA 1R3HA 5T1LB 3SKJH 1WZKA 2VDKH 5A40E 1PLGH 4OIBA 5HVFB 4UT9H 1AD0B 1R3HB 2YHGA 3EYUH 5EPMA 2VLRB 3JVGC 1JFQL 4XPFH 2XOTA 1LO2L 2J8OA 4DTGH 5KW9H 1T7YA 1CL7H 1OSPH 2Z31D 3JTTA 4J3SA 3PGFH 5DHVA 3UCRA 4TVPL 3EO9H 2Y4SA 1ZVHA 2OK0L 2Z31B 3FFCE 4OIIH 1D9KA 3QFJB 5CJ8A 4DW2L 2HH0H 5HYFA 2YXFA 4HF5H 2VZ1A 4PJ8D 3X3FL 5DD5H 1GAFH 1CI5A 4MXVF 1C08B 4HDIA 1HQ4A 2A77H 5LAXA 3MRQA 5BQ7A 1EJ6A 2OBGA 2RBLA 3EIFA 4HUXB 4LAJH 1OT2A 1TVHB 2FATL 4XCYB 5E4IA 1G7MB 4U1MB 2B5IB 2NXYB 3ARGB 2Z4QA 4EOWL 5FYJE 2YPVL 1OAYH 4XCYA 2V2XA 5TE7H 2YA0A 3ZKSD 4MXQD 4YHMH 4YIQA 2HP4A 1WFNA 4ZODA 3RWHB 4BFIA 2VDNH 3QFDA 5DJDA 3IJSB 5TH2B 4LLWA 1AGBA 3F7VA 5T1MB 5IW6A 4JANB 1U8JA 3U46A 5LQBH 4YFDB 4KQ3H 4UUJA 3HNSL 4XNUL 4Y4FC 5J6HA 3M8OL 1QFUL 4P23B 1RZ7H 3DMMC 4JKLA 3KG5A 2QSCH 4PJAB 4IDJL 4XWGL 4QKXB 3E8UL 2XKNA 2F15A 4FOMA 5DYOB 1KTDB 3CMGA 5GRXG 2W07A 4RIRB 3O11B 1RJZB 4K3DL 2WWMD 5E5RB 2E9JA 5FAAA 1U8KA 4Z7QF 4QF1B 3AMKA 2GJ6A 2HT3D 3CVIL 4HH9B 3TBSB 5F1SA 1FG2A 4KUZL 3LHPL 4ODWB 4F8TA 1HSBA 1MFBH 3NCMA 4LVOB 5BS0B 1P4IL 2ADJB 3T09A 3DIFA 4WDIB 2X6MA 1QRNE 1RUML 4KKLC 4JFYB 4M61A 1LK2B 2EYTA 1I3RB 1RUMH 1UB6A 4MQSB 2AXFA 4MDIA 2D03H 3OAYH 3ULUL 3W11C 3ZKND 2BNQE 2EYTB 1PFCA 4I13B 4ZFFB 5DD1H 2D7PA 4NKMB 4U1HA 3BQUD 4LRIA 1OTSD 4LDLB 4M00A 1YA5A 4NT6B 1LQSR 3G5XB 5E8OB 5EFIB 3GSQB 4LLMB 2DBLL 4JFDB 4V2CB 1KCLA 4YR6B 3Q5OA 1UYWL 3TJEL 2BNRB 3EOTL 3O2VL 3OKOA 1JZ7A 4L8CA 3AU1B 2EDBA 1DEEA 2BNRD 3BHBB 1SYVA 3RGVD 3QUYA 3RKDD 5DC9B 3TWCL 1OD9A 2KPNA 4YE4L 4QOKE 4OF3A 3CXHJ 3DURA 4J3UA 4G9FE 2IQAB 5GGSY 2HMIC 1ZLUK 2VDPL 3BRFA 3BH9A 5JOFB 1QLFA 2AEQL 2VLKB 5D5MF 1UJTA 5GGVH 3RVVD 5AZEL 4Y4HC 5E9DE 3FZUD 2DI8A 3BMWA 4YNYB 3S35H 1LEKA 1TZIA 4NPYB 5EBWB 2FO1A 4LSTH 1W0VA 3O8XB 1I7ZB 3AB0B 5K59E 3BT2H 3MBXH 3FRPG 4KDTA 1CLZL 1BOGB 4FTVD 3U79A 4N9GA 4PRBA 2FGWL 2BFVH 3QXUA 4MA7H 5DD3H 2G2RA 2V9TA 2HG5A 3MACL 4AEEA 4RGNE 5KSAC 2EE3A 3DVNA 2YEZB 1NCBH 1I85C 2AI0L 2APWA 5HHQA 2CGRH 3RAJL 4S0TD 1DQLL 2FBOJ 4PGEB 1RIHL 5BV7L 4NN5C 1XGYH 4LQ1A 5H2BB 1YNKH 3SQOH 1LVEA 1DE4A 4P3WA 1YNKL 3K4DA 3ROOA 1YNTA 3ILPA 1HWGB 3CDFA 3RY6C 4GKNA 4WCYH 5ACMA 3WO3B 3GIZH 5TGBB 4DN4H 5I1EL 4MAYB 4FP8L 3PABB 3IXAA 5F89B 1A7OL 5BV7B 3CCHB 35C8H 4KRPB 4ZFZB 2J8UE 2PYFA 3G08A 4WFHE 4Y1AB 2GYSA 3MGOB 3I6GA 4JCMA 4PJ8C 4QTIH 3B2VH 3ARFB 4MQXC 1VKXA 4L3CB 4OCXL 3QNXA 3G6JE 3QIBA 5JMRA 3I6GB 3TVMB 4D9RE 3B2VL 1FO0A 1B9ZA 3ZT5A 3OPZH 4Q74A 2BJMH 3P30H 3QNXB 3SGEI 3TVMD 5HBBA 2NXZC 3VFGH 1WAAE 5I8EB 4NYLB 2XTJD 5E0QA 5TE6H 4MA3A 1KXVC 2O26U 2ZOLB 4LARH 4Z77A 4NZJA 1A5FH 5D5MA 4LOUD 3BZEA 5L88H 1KFAL 3UDWC 1I3RA 3OR6B 3TA3C 2A6DB 3WFCH 2AEPH 2XPGA 2DQJH 1KCKA 2AJVL 1T66C 2GY5A 2GK2A 1TQCC 5IMOA 2EE2A 1UCBH 2UUDK 3ALWA 3QDGB 4OCSL 4AZ8A 2FJHA 4LF3B 5HPMA 1MHCB 4NT6A 5DUPL 4PB0L 5T3ZL 4M7LT 4ZUWB 3IVKA 4JO1H 2EDOA 5T1LA 3MYJA 4P2QB 5F72S 1CGUA 3EDKA 2BP3A 2OI9C 4ZUWA 5E5UB 4I3SH 4L9LB 1EERB 3ARGD 2NXYD 4EN3B 3V6BR 3SDCA 1UZ8A 5C09B 4YDLC 3DX7B 4G8GD 4RFNC 4XHJC 4EN3D 1Q94B 4ONFL 1CLCA 2CKBL 3ZDXF 5IR1A 4J6RH 5CEYB 3OQ3B 1HHGA 3GFUA 5C0BE 3UZEA 1A3QA 3AS1A 4XVJL 4IEFB 3TT3L 2AK1L 4LVOC 1T2JA 1JF1A 1ZV5A 4FRWA 4G9FD 2ZG3A 4JFQA 1NEZA 2JK5A 4XVUC 8CGTA 1QFUH 3QXDB 5AYQA 5DA0B 3VXTB 4P2RB 3VXQA 1T5WB 4XPTH 1A3RH 1AGEA 2VAAA 1FAIL 3UTQB 2C3XA 4FFWC 4NZRL 2HLFC 1NLDH 3SE8L 1H3GA 4F37K 3V4VH 4QO1A 2DWDA 5F3HB 5BRZD 1DJSA 1FDLL 1Q9OB 3ILPB 4G6AD 5AYUH 1YEJH 2JB6B 2EDTA 2VZUA 4YDVA 4OGYH 4XBGB 3RL2A 1A6PA 3ZHKA 2C3VA 4O02L 3WIHL 5INCA 4PUBH 1E6JH 2Y6SC 3KLDA 4O51B 4P48A 2A73A 4W4OC 2CK0L 5C1MB 4ZD3L 4KVNL 3BQUB 1IGIH 4CNIB 1N26A 2VL5B 4JO4L 4LSPL 2MQ3A 4ZFZA 4HMCA 3VI4E 4UOW0 4JDZA 5HHMD 2X89A 1I1FB 1OPGL 2X4PB 3S36X 2VDRH 3IDYB 2OJZH 1ZHLB 5ADOL 3EJZD 3GGWB 2PO6B 2W38A 2WUBH 5D2LA 5TFSH 1A4KB 1E27A 4JQIL 2I9TB 4XMPL 4KK6D 4NWTL 1WF5A 2VKXA 1MCWM 5BVPH 2XKNB 3U83A 5JZ7C 4POYA 5EC2B 5L8JB 1A3RL 3TO4C 4KXZI 3O8XD 4KK6C 1K5NB 1L7IH 2W0KA 2XACC 3H3PH 5DJXA 4E0RA 3R8QA 1H3VA 2WBWB 4M5ZL 4N8CL 5CJXA 4LEXL 2E7BA 2VDLL 1P4BH 3NA4A 4MX7A 4QXTA 1T03H 3PV7A 5DR5H 4F80A 3G6DL 4JDTL 1KLFA 1OCWL 4PRIB 2AEIT 2D03L 1UWXH 4YUEL 4LCIL 4PJCF 2VLRE 3SCMC 4ZYKB 2AXJA 4U2YA 4DQOL 4JFXB 3P0YH 3WE6B 2W0FA 1T1WB 2A6JB 2R4SH 4Q6IC 4U1HB 3MBEA 1T5XB 4G8IA 4HS8H 3AFLA 4ZXBD 2ZSVA 3LH2L 1BQUA 1MCFA 2C4FT 2XWTB 3TVMC 3WN5B 3HMWH 2ATKB 2P44B 1A3LH 4AL8H 1NCWL 4P5KB 4Q0XL 4PJCB 1U0QA 3AU1A 1QUNA 4YXLH 2ZUQC 2DAVA 4L8DB 2XA8L 4X6FA 4XCEB 4Q0XH 4Z7WA 4UQ3B 3CVHA 2YD2A 3PDOB 3T77A 5IHZA 5DHXB 1QSFB 5E1AB 2HAZA 4J12A 5I1IL 4OCYL 4OB5H 1H3TA 2NW2A 1WZLA 1TZIB 5DVOA 1DN2A 2G60L 3QB7C 3D0LA 1P9MA 4CADB 3CFJA 5L2KD 3C6LA 1B0RB 2UUDH 3QHFH 1ZVSB 3MRBB 2OQJB 4X4YB 5JIIA 2H8PB 2NY5C 5FHAL 4Q9QL 1J1XL 2V2TA 5DR5L 1A6WH 4K3EL 3ARFC 5A1AA 1VERA 2Y25A 4FQPA 4X4YA 4DGVL 3QFJA 2XG5A 1J1XH 2NPLX 2AJYL 3SY0B 4MJ2A 4QNPF 5I76A 3HAEA 3OZ9H 5D7IE 5IVXE 1U8LB 4P2RE 3PWLB 5HYJE 2AV1A 3ZSSA 4HSQA 3F58L 3WEXB 5DS8A 1MFAL 1BLNA 4H8WL 3ARGA 1PZ5A 3PP4H 1HZHH 5FYKU 2DM2A 3O3EB 4ZNEE 4OCRL 2QR0B 2ZSWB 1L9NA 1WV7T 3H8NA 4C54A 3TFKC 4KRLB 1EEYB 2IALB 4R6UA 3FOMA 3LKOA 2ENYA 3PABA 5ADOH 2KQNA 4ZOCA 1E28B 1HKLL 1YC8A 1ZA6B 5ISZA 5C09D 4GKZA 3HTLX 1VGEH 2EDJA 4XPBH 4Z76B 4EI6B 4G8GB 2Z35A 5EN2A 1JPGB 4LHUD 2VC2L 3SKJL 1G0DA 4U6XA 4S1SL 4XCCH 3P0VL 1AQDA 3WJLC 5KAQG 1U8QB 3DRTA 3ARVA 4GKSA 3QCVH 4A6YA 4RWHA 2AXGA 4NP4L 5JXAL 3CU1A 2EXYD 3O4LA 1N7MH 3ZE0E 4C57C 5BOZG 1H9VA 3THML 2DQJL 2FSEA 1J12A 2VR4A 3SO3C 1SJXA 4RGNC 2R8SL 1CGTA 2J4WL 2W65A 1J5OH 4OFDA 1N5YL 4AMKL 5KN5A 4O2EA 3BIKB 4RWYL 4IIQB 2W0LA 3EYSH 4H5SA 2K9UA 3MLSL 2V5SA 4UOJA 1GVIA 1R3KB 4QT5B 5CZVH 4YHYC 1XMWA 3FL7A 2F53B 3UBXB 3EYVA 4QRQA 4LRNH 1KBGH 5I17A 4XPBL 2YS4A 1IKFH 3OKOB 5DQDH 2OK0H 1UZ8B 4TVSa 1UWXK 3MYZA 4AIZB 1QTYT 4MNHB 4D8PA 1MCKA 5DGRA 4RFNB 7CGTA 1AGFB 1TLKA 3CK0H 4TQEH 3VGGA 5D71H 1C8PA 5E94B 2QQKH 3WIIH 2Y7QA 4XPHL 4YNYA 4HBCL 4ELMF 1KLGA 4KHTH 5C0AB 4JG0L 4QTHA 5EOCL 3FTGB 3VXME 3ZE1E 3L3JB 3UTOA 1S7WA 4ODHL 4PJBA 3T2OA 5B39A 1RJLB 1S3KL 3EOAA 4WW2C 5KSUB 4UB0H 1F2XK 3KXFD 5L88L 3U9UA 4HV8A 3IYLW 3IGAA 5JXAH 1I7RB 3GMRA 5F44A 4Z78B 4WFGD 3VRIB 2P8MB 5F1IB 1ONQA 3O6KL 4GKNB 2BC4A 2HKFH 3EYOA 2XN9B 2HFTA 4NKIL 1WBYA 1QBBA 1H3WM 2HLAB 1MY5A 4MHHG 2VDNL 2A9ML 4HWBL 4N5UA 4PJEF 4XVTL 5IHLB 2VR9A 5DHVH 2VXQL 4JFOA 3CX2A 3KPSD 3UAJD 4JCLA 4ZXBB 4PJHA 4XNYL 3MR9B 1XGTA 1RURL 1LGVA 4PG9A 3RVUC 3IDJA 3HCVB 5J7CC 3L3KA 1D5XA 5BJTA 4YFLF 2KZWA 3TCXA 1D6VL 4HUVA 5I8EA 3EOBA 2V17L 4NNPH 3EO1A 4WFEE 2VIRA 3NIFE 4EDWH 1DUZA 1R24B 5BXFB 1DL7H 4CJ0A 2AXGB 5ALCH 2JCCB 4JB9H 5EOCH 4XB8A 3S6CA 3SJVA 3C08H 5FYLL 1EMTH 5IFJA 4LLDB 2X1QA 2GSGA 4G8EA 4O58L 1OAZL 5D1XC 1AXIB 4JO3H 5EU6A 4Z7VE 3U6RB 3VWJD 1S7SA 4S10A 1FNEA 2CLVA 2NCMA 1IKNC 2EXWD 3HAEG 1FFOB 1YEEL 2WIIA 2WMPA 3H0TB 2DWEB 3IAPA 3RWIA 5TF1H 2F19L 3J8F7 1F4HA 4PD4J 4L4TB 1FCCA 4BQ6A 2PXYB 4GSDL 3RZCA 1N4XH 4NUGL 4I4WA 3ARBB 1NFIA 1MRFH 5F7FA 4FZEH 1QBLH 2MJWA 3H3BC 5C08D 1BECA 2GSIB 3KYMB 3QO0A 2HVJA 4QOKB 4NQTA 3OX8A 3MRGB 1CICD 4MJIE 5EU4A 3UYRH 5FB8B 1UXSA 5LCVL 4NHUA 2P5ED 4FQIH 1I1AA 4YDLB 3RP1A 2XNAA 3P11L 2VE6A 3MODL 5FGSA 4XXCA 4NNXB 4HIIB 1QFWH 1JF6A 2VXSH 4NCDA 4TVPD 2HT2C 2Z93B 2EC8A 3NAAL 1S7QB 2X4NB 5E2UL 1S9KC 3ZHDA 3JWNC 2FWOA 5IJKA 5F21B 1T2QH 4RAVA 3F62A 2H32B 4JPVH 1OP3K 1MRCL 2FYYA 4JR9L 3RUGA 3WIFA 4EUPG 2EIZA 2DQUL 4XPAL 3MC0A 1A6AA 5DWUL 1F58H 4OUUB 3VFNA 4S1SH 1JRHH 3PDGA 3GMRB 1AGEB 1NGYA 2VAAB 1IAIH 2P5WA 1CVRA 1HXYB 5IW1A 5FHBL 4KUZH 2RQ8A 3MNVB 3F58H 3QJHA 5DFVD 1OWRM 1MWAH 5I74C 2FX8H 1QLRB 2YR3A 3BI9X 3IFLL 5CD3B 2HN7B 1FL3A 3ECBB 1RK0B 3ARDD 3UYRL 3RL2B 5C92A 2B8OT 3KPNB 3E3QE 1P7QD 1KTDA 1HQRB 2J88L 5IVOA 3ZSTA 3K46A 2IFGA 5KBNC 5L8LB 2KL6A 3MXVL 4F9PA 4PJFB 2WP3T 1MJ7L 3GSVB 2G60H 3KDMA 3VXUA 5KVEH 4OI8A 4PRHB 1NGQH 2NW3A 1GC1L 3HZYA 5GGUA 2R23A 5CCKH 1UT9A 2VDOL 5FOBA 4R4BB 3FO9A 3P9MB 5IFJB 3GMPA 2DQUH 3BEWA 3K81A 2NLJB 4RX4A 1BZQK 3CAFA 5ACZA 4Z95L 1U3HA 3B9KA 3RVWC 3KR3H 3W5MA 5C0JA 4CUCA 5DMYA 4L29B 2A83A 5ID0B 3BIKA 2P49B 1SJEA 3QJFA 3QUZD 4WTZA 1DVFD 2YRLA 3O2DH 4GRLC 1FVEB 1J10A 5MEOA 2FJHB 4JGMA 3DECA 1BJ1J 1G0XA 3O4LB 2EH8H 1BF2A 2FGWH 3R8BB 5GRJH 1QQDA 2Q1EA 3SDCC 4QXTB 1DTUA 4U6HA 4IMLA 3U0PB 4OV5A 5ECJE 3BZDA 2V2WB 2YZ8A 1LO2H 2GT9A 4YXKH 4JFED 4BSWB 1DBAL 3MRCA 1WGOA 4LU5L 2FL5B 2X42A 4JFXA 5CP7B 1A4JA 1IAIM 5EORH 5EOQL 1INEL 5IR1B 1CDBA 3QUXB 1N2RA 3QEGH 4HS6A 3G6AA 3S3PA 5LKNA 1LEIB 1KJ3H 4CRPA 4OCRH 3KXFA 5DJ8A 5C0BB 4YHYB 5E1HB 5DQJA 1RMFL 5AWNH 5I8KL 1FVDA 1NKRA 3HZKB 1YMMD 3CH1A 1FYTB 3IXTB 4XPGH 5F8QC 3ZYZA 4UT7L 2J88H 1II4E 1B90A 1U9KA 4NGHL 4TRPH 2P4AB 1ZHBB 2B4CH 3HZKA 3Q6GL 4PRDB 5DHVB 2G9HA 4L3ED 2Y06L 3ES6B 3GJEA 2H1PL 4J1UA 3VI3F 1T5WA 1TPXB 4ODSL 1IL1A 1KCUH 1U58A 4BYHA 4HC1H 1CXHA 2HJLB 3RZCD 3UPRA 3G9VA 5IROA 3UJJL 3AY4A 1F58L 4NM4H 1J11A 5L6YL 4POZD 1MH5A 3H7BB 1U3ZA 4R2GB 5JDSB 2A2QT 4GG6F 4MJID 2WLYA 2GITA 5CUSH 4WEBH 1F6AA 2APVA 2V2TB 2ZOKB 2QADD 2YD8A 5B38B 1CLOH 5T1KB 4GS7B 1ZGLM 3PL6B 2E7HA 1A1MB 1RULH 1JPSL 3B6SA 3NIDF 2X2YA 5MP6L 4PJ7A 5T1KD 2EDNA 2DQFB 3CFCH 2D0FA 4KI5C 4AIXA 3SJVD 4KTEL 4XBPB 1EVTC 1HQRA 3BPNC 4P3DB 1IGIL 4U6TA 3R1GL 4XVTH 1WBYB 1M7DB 3MO1B 1I7UB 2ZCLH 1BFVL 1FNFA 1P4LA 2V9QA 3V0VB 1NL0H 1FIGL 2V5RA 1SQ2N 3DVIA 4Y5XB 1BMGA 3MLXL 4JFYA 2YK1L 4S1RL 1FLRL 1JNLH 3AXLB 3U1SH 5IB3A 3DX8A 3BPCA 4XP5H 1ROWA 4LHUG 1VFAB 4M93C 1P9MC 2BY2A 4PG9B 4RAHA 1CVSC 3OR6A 5CILH 3PXJA 4XB7A 5EWIL 1FGNH 5T5NG 1WIPA 3U7YL 2DL9A 5JPMB 3FB5A 4HXAL 5EWIH 3GHEH 3NABH 1C5CL 4W68A 5IJVA 2A77L 1A7QL 1UQSB 1WCBB 1OP5H 2QHLA 1X44A 1OAZH 2PCPA 3GMMA 3RX5A 3ZKXB 4DGYH 1E4XI 1GZPB 5DVKA 1WWBX 3JWDC 5KVFL 3QUML 3KLHC 4YZFE 4U6HB 2AJUH 2XY2A 1P7KA 4MNQE 5HDQH 3ARPA 3ZDZE 3R06A 3WSQH 2F8OA 4OF7A 3UTSA 4I5BB 1FVCB 4HCRH 1MWAB 3A6BH 4EXPX 1W72H 1XIWB 3TA3A 3NOIA 1W0VB 3I3EA 4YGAB 5H37G 3BE1H 2QQLH 5TPWH 4XP4L 3MBEC 2R2EB 3I9GL 1KOAA 1HHIB 4KY1H 2CRZA 4R8WH 1MIEH 3V7MA 2PYED 2ICWA 3EJYD 1AP2B 3OL2A 3ZKMD 3VXMB 1C5BL 2B4CC 4PV8A 3BJ91 1H8NA 2OTWA 2GSIA 1WUNT 4RAVB 1AP2A 4ETYA 1Q0XL 1DEEB 2DJSA 1DANU 3VXMD 1W0YT 3JV6A 1E6JL 1OGAA 2VXQH 2GW5A 1RD6A 5F6IC 1XF2A 4I18C 5J3HC 3ESVF 5D1ZD 4R26L 3ABZA 4O2FA 4DKFH 1NANI 4TOYH 5IFAH 5D1QC 3QDJA 3RA7L 4I9WE 4KVCL 4HFWA 3GSUA 4PRHD 4RGNB 5EU7C 3MX0A 2HFFB 3FT4B 3RA7H 1YJDC 4XNXH 1N5AA 3EFFB 2QV2A 3K74B 2ATPB 3OJ2C 5BMFL 3VFPA 4ZS6D 2IADA 3UAJC 5ESVB 5E8PB 3HUJF 1J8HD 5SV3A 3WUWA 2W9DH 1T1XB 4U0RC 2DQIL 5AD0B 2ESVB 5D2NE 2AV1B 4BFBD 1AHWB 1P4IH 4LCCB 3VFTA 3QUZB 2DKSA 2H9GA 1DBJL 5ITBL 3EOAB 3KPOB 1QRND 3MBED 4P46B 3HB3D 3DTXA 2E8ZA 2FX8L 3FFDA 4JFPB 4ZS7H 4W4OA 1M7IB 3KYKL 4I3RL 1RK0A 3D85D 2HLAA 1F4WH 3RKDC 3WXVH 2XYCA 1TETL 1HXMB 1IGJB 2Q7YA 4FQLL 4IBLT 1G7IB 3U0TA 5C0GA 1IT9H 2DL2A 2VUYA 1DQDL 5E95B 3OHXB 5SWZD 2XFXA 5K33A 2PYFB 4OQTA 1L0XA 3JWDH 3L3KB 4OCWH 4R97B 4J3WA 4UIKL 4XNXL 3GO1H 4R2GC 4Z7VB 2UY6A 1URLA 4X6DF 1YNLL 3MYJB 1LDPL 4E42A 3FN3A 4GQ9H 1SMOA 1WCBA 5A2LH 3I50H 5GRVL 1M05A 4NZRH 4LCWB 3QA3A 2LU7A 4R26H 2JCCA 1UVQA 2VDMH 4KQ4H 3NCYP 1Q0YH 1BP3B 5C2BH 2X10A 3TIDB 1Q38A 5GGTH 1IGML 2B2XL 4LPVA 4WI9A 4YHPB 3ZYIA 5GS0L 1QEWA 3TCLA 4FABL 4LSRL 4X6BA 2DJ4A 1EHNA 3RVUD 3UBXI 4LSVL 3GBNH 1WISA 1ZAGA 1N6QL 5L2KA 2E6PA 3I75A 2F5AL 4X6EB 1AD9A 1NGZA 1BIHA 1VEPA 2F53A 4XP9L 2W92A 3MLYH 1K8DA 1D5ZB 1NC2B 4G5ZH 5JPNA 5CJBA 1HYRC 1I8KA 5I73C 3MFFA 2EKJA 1T1YB 1K8DB 2YUZA 2C7UB 4NO5B 1NC2D 4GRWB 4FQHA 1KC5L 4JZJC 1IL1B 3MJ7B 1MUJA 4YPJA 3PDDA 2BCKA 3W9DB 1UH2A 4JN1L 2X1WL 32C2A 3QDJB 4QGYA 1VPOH 3VXSE 1FYTA 1U8NB 1MCNA 3W0WB 4J3VA 4Z6AT 3FT4A 1FJ1B 1GOHA 4KMTL 4NBZB 5KG9A 3H3PL 2O5YL 5EBMB 2G75B 1FIEA 5EA0L 5IEKB 1JNNH 3WFCL 3HFML 3V5KB 3FN0H 4I77L 4APQB 1Z5LA 1SY6L 3VXQB 5FO8A 1ZLWK 5D8JL 3V5DB 5FOJA 1BQHB 1EJOH 1CDHA 4PJGE 3OWEA 4M5YH 2W59A 1YEHL 4P2OD 1CR9L 1UM5L 1X5KA 4NUJB 2DWDB 5E8NA 4RMQA 3ZE2F 2BY0A 2B0SL 5TGBA 4JFFD 5EB9A 5L8KB 4IS6A 4P23D 4BK5A 4CNIA 5DQ9A 1R5VA 2VDPH 1D9KC 4H0GA 3CFCL 4NO0A 3OB8A 1H8OA 5DD0L 4XC3L 3QFJD 4ZOEA 1F4WL 3T0EA 4BZ1L 3TBTA 1YMHA 1UWEL 3I3BA 4FTVA 5DHYB 4X6CF 4C56A 1U8QA 3FAWA 2ZKHL 1R3IH 3ARFA 3PWUA 4Y16B 4H0IA 1YMHB 4X7TA 4N0YH 43CAA 2N56A 1CL7L 1D7FA 5ESQB 1OTTD 4Y16D 1REIA 4UTBL 1CU4L 3UJJH 5J1AA 3GEWB 4D9QE 1ZXQA 1PSKL 2X4TA 1RUQL 3UTPE 3BWAA 2DQTH 4HWZB 3OKEB 4HF5L 2DQEH 3VFSA 3MGTB 4GBXD 1HIMH 1P7KB 4H1LB 3BWAB 4PRPE 1V8HA 1J0YA 1C5CH 3BZ4A 3ZDYF 4YDJB 3TIDA 2JJWA 1B88A 2MWCA 4ODSH 4WUUA 3DUSB 5DLMH 1DBKH 1NMAL 3ZT7A 3LQAH 4YHPA 3IFNH 5HI5D 3TT1L 2VMFA 4JFDD 4E5XA 4O2CA 2C1OA 2X40A 5BOPA 1JJUA 2CLZA 1MHCA 4M7ZB 4FMFA 3IKCA 2GTWB 3P9WB 2XZAL 3G04B 3UTTD 5I16B 3U0PA 2X4OA 4L4JA 1MOEA 3BD3A 3RGVB 3LS4H 4CVXB 4Z0BL 2YD1A 1LNUA 3HLAB 4PREB 5LQBL 5J1TC 4ZUSB 1K8IA 2OXHA 1W8OA 1PJ9A 5F7EL 3CXDL 4MNGE 1S5HA 4TUOA 1I9IH 1BFTA 4FMKA 3MLXH 1T89C 3FQRB 1XF5B 3C09B 1A02N 5H94A 2CH8A 3BN9C 4OQTH 4D0BA 1G0YR 1NAKH 3MBEB 5DRXB 4HH8A 3DHJA 5KSVB 3MXWH 3T0WA 4HUWA 4MJ6B 2DLIA 2HFFA 4ZD3H 5DRXA 4K55A 2A0LD 5GS1C 3RU8L 1IAOA 3ME0A 4ZO9A 4NO0D 5J0BA 1LK3L 3D39E 2JKXA 4OZFH 5DWUH 5D7IB 2YXMA 4FQ2L 3SDAA 5C0FA 1TNMA 1CBVH 4MS8D 4NO2B 3C2SA 5HHQB 2EYRB 5D93B 4NWUL 4P2OA 4L8SA 1Y6MR 3HRZA 2F9BT 2VXVH 5D7LB 3MLZH 5KTEH 2OQJA 1AHWA 4LCCA 3RUGB 3WIFB 5CIPH 4F33B 4M1GL 4MAYC 5C0IA 2QR0A 3NMEA 3MACH 4J3XA 4F2MB 4P4RB 3U36B 2E6JA 2VSCA 1RZFL 2IADB 2YRPA 3D18B 4MAYD 15C8L 4N0FA 3GM8A 2VLKD 2LU3A 4GRMB 4GKZB 1RZGB 4YDVB 1EZVX 1F11B 1RIUL 3TPUA 3HAEB 5GS0C 3S37X 1X5XA 4PTTB 4XP1H 1VEMA 4Y1AA 4JDTH 4KK5D 4XP1L 1D5XB 5BJTB 2QSVA 5E2VL 3LKOB 4YK4C 1MF2L 3E6FA 2QSQA 4Y5XA 1ZSDB 1DQMH 1ZHNB 2HJKB 2VLRD 4OD2A 3AB0C 4PJFA 1V3JA 3MV7E 43CAB 4PGZA 3SDXE 1KXQE 2XV6B 3LEXA 3RWGA 4A6YH 5CJOH 3ZYOA 3IF1A 5DK2A 3P77B 1RJCA 3VXRE 4TVPE 2ENSA 3NH7H 2DD8H 3LVEA 2UY7A 4M1GH 3BPCB 3RAJH 2BMKA 1QHOA 1NCBL 3DHMA 4JB9L 1UM6H 4NN5B 1UCBL 2AI0H 1Q9WA 2D7TH 4WENB 5JW5A 3VMPA 4X4MA 5JIPA 1BGXL 3W0WD 1A6UH 2OZ4A 1OHQA 1QFWI 1U8KB 2NY2D 5GS2H 3P0YL 4HWBA 4NQCB 1P7HL 5E7FA 2E3VA 3AUVA 4J4PC 1FG2B 4ODWA 2V7HB 1P5VA 2NY2B 4O4YL 1FRGH 4PJXB 2AEPL 4JAMA 1KN4L 3KPMB 1GHFH 4AL8L 5T3ZD 2PTTB 1CGVA 2UWEA 3TN0D 4LGPB 2AKRB 5F7DB 5MHSD 3WNLA 2AEQH 4I8DA 5E9DB 1IC1A 1CD9B 4XRCB 3KNBA 5JW4M 4MD5A 1YEFH 2W65B 4X8JB 5E8EA 1EA9C 1I9IL 4UBDD 5E9DD 3C8DA 3U82B 4I5BA 1OTTC 4Y16C 3UTTE 5JQ6H 4KJPD 3BPOB 2NNAB 1ZEAH 3T08A 1CFSB 4KJYB 3VXSB 2BVYA 4G6FD 1JMZA 4QTIL 2BNRE 5IWLC 3ULVC 5IVNA 3H9HA 1SEBA 1NEZB 3FN9A 3VXSD 4HMEA 4ELMB 2CKBH 3C9NB 1K6QH 3UDWA 1KN2H 2DIAA 4KV5F 1J8HE 5IHZB 1NSNH 5EBLB 3SKNB 3TGXA 3LQMA 4HKXA 1QFWM 3C6SA 5ESAA 1UM6L 5GSRB 1F90L 4IDLA 4S11A 3M07A 5FYLH 4H20H 4B5EA 3MLZL 5CEZD 3OXRA 1EBAA 1VB9A 4NOBA 1KCVL 2R29L 1KPVA 4O58H 3V6OA 4B0MM 4ELKA 1A22B 1QBAA 3G5ZB 4Y4HD 1MNUL 3QDMA 4KMTH 2GQHA 3BO8A 4NUJA 1DFBL 3IXAB 1AQKL 3BWUC 3D18A 3MJ9L 3TJHD 2AK4E 1J0KA 2KDGA 2V7NB 5GJSH 3TM6A 1F3JA 4JREC 1MFCL 1XR8A 1RUKL 5FO8B 4HWEH 3WLBB 2F54A 3FO2A 4CGTA 1NLBL 1UFUA 4PJIE 2X4PA 2JTDA 4TTDD 3NVQA 4OGXH 1WAAF 2PW2A 1NCDL 4O02H 4BFIB 3Q6FA 3S7GA 5GS1A 5E00B 4GG6B 1T7VA 3BP5A 1U91B 5JW4Q 5E2WL 4MZ3A 5DFWH 4BH7A 4YE4H 2Z92B 4JVUA 1QHPA 4QLRA 3RWJA 3F7RA 3BDYL 5IG7A 5BS0E 1QFOA 1PZUB 3SKMB 3OHXA 2W91A 4FTVB 4X7EC 4BZ2H 2QJDA 1T3FA 4L8BB 1MFEH 5DTFB 4AQ1B 5IMOB 2PYEE 2V5TA 1IT9L 3NIGE 5CSBA 3MV8D 1DEDA 4KHTL 4QHNB 4JFEA 5DD5L 5IIEB 5HDQL 3GKWH 3LV3A 3O45A 3D85A 4Q6IB 1XAUA 4J2XA 1UKTA 3EO1B 5EIVA 5HGHA 5CBAB 2OXGA 4H1LH 1XGUB 4Z7UA 2DDQL 3TLRA 3DUUA 1XGYL 1GIGL 1RIHH 3V6FB 3UJTH 4B7IA 2AERT 1KULA 5BVJA 3MREA 3H7LA 1SYSA 4ONFH 2JELL 1DBBL 1MCIA 4L4TA 1CWVA 3QUXA 2JJVA 2OR8A 3KYAA 3I75B 1L6ZA 1FE8H 3IFOA 4GBXA 4CN6A 4XAWH 3FQNA 1A6ZB 1CICC 1ND0A 3QUKA 5EG6C 3A67L 4M6NL 3V7AG 3OKDB 5C0DA 3TN0A 3JV4B 3WS3A 4Y1AD 1Z2KA 2XQBL 2BOCA 4ALAH 4UT6H 2YPLA 5HI3D 5BW7A 3QEQE 4F7CB 5C2UB 4NC1C 5I17B 1S5HB 4TUOB 1RIUH 4M7LH 4M7KH 1FSKC 3T65B 4LRIC 5E6IC 5D7LA 3HKFA 2VITA 5BMFH 4NN7B 5C8JB 4HKXB 1LO3L 3PGCA 4YHIA 3ZKXC 4H88H 4F7TB 2Q86A 1RK1B 5F6HI 3QUMA 4XXDB 4M1DH 4WW1A 5B3JE 4GXUM 4NBYB 2Y9RT 5ETUA 4LVEA 1J05B 1XGQA 5J6GB 5GS2D 5L0QB 5ICZA 2ATPA 3MRMA 4FNLL 3V6ZA 4AM0B 3BQUC 5T5NF 4K3JL 6CGTA 4HJ0D 1FLTX 5GHWL 1YQ2A 4JJHA 3N9GH 5EZJB 5B39B 1G7PA 1K4CB 4R90L 3ULUF 4M6ML 1CDIA 2XTLA 3P4MB 2DQHH 1CXKA 2YC1A 3FO2B 2EEAA 3EHBC 4Y4FA 1OP5K 2Z0BA 4MXQC 1VACA 4UV4H 3KHOA 5KVEL 5LVEA 2ED9A 1K4DB 5GGSB 4P46A 4QHUA 4Y5VC 3LN4B 5DO2C 3FO1A 1GZQB 1TZGH 4OLZL 3QDHA 1M7IA 5J11B 2F54D 5A3IC 2EXYC 3BEVB 4OGAD 2DM3A 2Z35B 4EUPB 3U4EB 3O9WD 4POUB 5I74B 5D2LF 4RQQA 1WWCA 5CSZB 2C3GA 3VXRD 1WTLA 1SJEB 3QJFB 5C0GB 1BVKA 3BP4B 4JFHE 2W60A 4HGWB 1GCFA 1EHXA 4KDTC 5CMAA 2YN5A 1JZ4A 1QRKA 4C83A 1MCOL 5IBUG 3LS5L 1NQBA 2XWJB 2ED7A 4OJFH 5C08E 5EUKA 3QIWA 4CMMA 5IP4A 3HE7D 3QHFL 5A2IH 3QIWB 1LDPH 3LZFH 4JG1H 1OY3B 3BJLA 4Q9QH 1JYNA 4N8PA 1NPUA 1XGUA 3PF2A 4RMUA 4W4NA 4UINL 3QCVL 3FQXB 2IEPA 4LU5H 2XRAL 2XPGB 2H2SC 2HKFL 5KOVC 1CT8B 2GTWA 5LGJA 2A74B 3RBSA 2VQTA 4WO4C 1CXLA 4HS3A 4FQCL 4WWID 4CN1A 4YXLL 4YHML 5D1ZA 1NBQA 4HUUB 3SGDH 1S9YB 1I9RL 2EICA 3LKRB 4XAWL 1FE8L 3BYYA 3N1FC 1HWHB 2LABA 3RGVC 2QQLL 4JN2B 1KYOK 4RZCB 4DVBA 2BVPA 5F88A 5LGKA 4IMKA 2FCBA 3SDCB 4NJ9H 5EO0A 4KPHH 4PJCE 2EZ0C 3VJ6B 5HDBF 2VDQL 5DQJB 3U2SB 1U8OB 2XNAB 3HC4L 1S8DA 1S78C 1XF1A 4UV7L 3QUMB 3ARDA 1QO3A 3MJ9A 5GRWA 3RWFB 1SY6H 4LLAA 1BD2A 1I8LC 5DZNA 4M1DL 4RFEA 4XVUD 3MA7A 1MFDH 5ESVA 1PGRB 2XWBA 4WU7B 3SKNA 2BVOA 4JRXE 3IRZA 5I1KL 3HNVH 3EYUL 4HT1L 3IJYA 2H32A 4P2CG 1WSST 4EJ1C 1PBYA 1M7XA 1CG9B 3TEUA 4F2MA 3RVWD 2Z8WC 4CVUA 4LKCA 2UV3A 9CGTA 3HRZB 5FFLA 4U1GC 4PRID 1A0QH 3V0WL 4K8RD 4MXWL 1QBML 2H2SD 1KNOA 2DS4A 3V0VA 1OARH 1YEFL 4ODUB 1QR1A 1EH9A 2ZCKL 4YO0A 4YHNA 4JJ5B 1S5IL 1OPGH 5JQ6L 3D2UA 2DB8A 3RTQA 1HILA 1KUMA 4G8GA 1MCDA 4MD0A 4LVHC 1RZGA 2CUMA 5A16A 4MGXA 4CL7A 2EH7H 2OL3A 3JUYA 5GRJL 3VWKB 1KBGL 1OGTA 5TDPB 1ZLSL 3GI9H 3W39B 3KVQA 4URTB 5I18L 1GH7A 2NXYC 1KIRB 3ARGC 1I1FA 2V2XB 2QHRL 4ZSOB 2NY3C 3S35L 4H25B 3K80A 4WY7H 4G7VL 3RWHA 1AO7B 4LASL 4MQ7A 5EUKB 4LBEA 1F8TH 3ARDC 3MRFB 5I9QB 1SBBA 4APQC 3F7YB 1BIIA 5DD3L 5CLTA 4P57B 2J4WH 1J5OL 3FB5B 3DLQR 4NQVB 1FZJA 4EI6A 2YD3A 1FFPA 5M7QA 5GRZA 5DEZA 1KLUB 1U6AH 1WBZB 5GPRA 3CSYB 4HIEB 3DV6A 3GMLB 2WLZA 1NJ9A 4U05A 4AG4L 2GJ6E 1LE9B 2WIIB 2ICEA 3I2CH 1MVUA 4PP1C 4TRPL 4JHWL 4HCRA 3PNWB 5TDNA 3HG1B 2ZP0T 4DAGL 4QRRD 4L4TD 3VU2A 2NY0C 3TF7C 1N4XL 3L6FB 1SJVA 2GJZB 4JKPL 4D0DA 1KXTB 5ALBH 4OM1L 3LKPB 3MLPA 3DJ9A 4RDQG 2HYMA 1I1AC 1ZT1A 4JVWA 3GIZL 3ZL4L 4WCYL 1KB5A 1T22B 4UDUB 1F6FB 3L7EB 3GMNA 4QOKD 2BNQA 2IF7A 4FQHB 4NM8H 3VG0L 1BFOB 4KROB 1T0MB 4NPYA 2ERJB 1J87A 1V7ML 1ZWIB 2LTQB 3BZFA 2FL5A 3CFEB 1Q1JH 5MENA 3IDNA 4ODXA 2X4RB 1F3DH 5L9DH 1U8OA 2VZ3A 4FQXC 3LEVH 5T33H 1A64A 3GM0A 1S7QA 2X4NA 2DKMA 2R2EA 2HTLD 3TO4D 3TV3H 2BOCB 1UEMA 3BPOC 4NNYA 3QIWC 2N7AA 5FDWA 4L8CB 3TH2T 4C4KO 5K9KA 1MRCH 1ETZA 3AAZB 5L6YH 5J57B 5D2NB 2IQ9L 4XPAH 3NABL 3IJYB 4WO4D 4Y7MA 2OJEB 3NAAH 1S7XB 3EYOB 2J2ZA 4WO4B 5I1GH 3VFPB 4QXWA 1MPAH 3QQ3B 5EU5A 1Q9OA 2Y7QB 1ITBB 4M5ZH 5KAQF 1U36A 1NGPL 4LSSL 1M4KA 2A9MH 4HWBH 1RZ8A 3OAUH 1UKSA 4ZPVB 1C08A 3BGAA 4GG8B 2QLVB 3MRNB 5DURD 3IJHB 3CFIC 3SPVA 2P5EB 4NQDA 4ZXBC 5T5FL 3WXWL 5D96B 3S34H 4EUPA 2CDEB 3IJHA 2FIKB 2Y6SD 4ODTH 3RUGF 1IEAA 5IV2A 2GK0B 3BKJL 4FXKB 4MZ2A 1EFXA 2IANE 5I66B 5KVDL 3LQAL 1DR9A 3IFNL 1K4DA 1GGBH 3O3EA 1DE4B 1X6LA 3UPAA 2FR4B 4G80B 3QCTL 3MO1A 5T3XL 1A4KA 1E27B 1AGBB 5IW6B 3GSWA 1M05B 3T2NL 3VFRB 1MSPA 4IRZH 2BSRB 4LIQL 4PS4L 3VG0H 2X4TB 4LPWA 4GXVL 4MB4A 5CEZH 4NKOB 4BQCA 3VFSB 4WI5A 1QYGL 2J8UA 3B9DA 3B9KB 1FNEB 1FG9C 3LEVL 1TQBC 4YQXL 5C9KA 1OSPL 1WFTA 3OJMB 1MHPH 2FEDD 1NCAH 5ISZD 4HS3B 1FSKB 1YEGH 5IT2L 3PGDA 1A2YB 1UQSA 1GGCL 1WAAA 3FHAA 2YOCA 4ZS6C 1HCFX 3NZ8B 4KFZC 5KSBA 3C5SB 4CVXA 1I8KB 3MLSH 2FEDC 3F65A 3T3MF 5ICXB 5D5ME 3RWEB 1ZT1B 5FYJH 4MAUL 3BGMB 4PJBF 2JJTC 4OGYL 3EFDH 4Z7QE 4ZMAT 5IMMA 1MCJA 3DX9A 4HG4J 4FQIL 5EOTB 1HHJA 3H9YA 1IC5L 4GLRI 4NKMA 3KPLB 5C0RL 4MD5B 3W82A 1HNFA 4XC1L 4OLXH 4IIQA 2ATKA 4PGDB 3BZFB 3CFEA 2EC9T 1UB5A 1ADQL 4OZGA 4CDHA 4KZDH 3VWJC 4RX4D 5C0BD 5I19L 4LF3A 5DD6B 4OF0A 3IKKA 4OLYH 2VISA 5IBTL 5IW3A 35C8L 4JPKH 1ZHBA 4PRDA 2VLJE 4YHOL 5EOCJ 3TNNB 5DF0A 2I07A 3W0WE 1A6VL 3P3YA 4G3YL 5SV4A 2NR6C 1A6AB 4WNQB 1M6OB 5ENWB 1FAKT 4EDXA 4F33A 3PWNA 1CTOA 1ZT4B 2COQA 3L3OB 5HGBB 5MEPB 4Z95H 2H41A 1IRAY 4EVNA 4PJ5B 5IB5A 4LLQA 3T3PE 2WINA 5ETUB 4GXVH 5DC4B 4KMLB 4KI5D 3PGCB 3K1KC 1LO4H 4IRJD 3T2PA 4R2GD 3MUY1 4PJ5D 1JPTH 1RUAH 2IBGA 5HDLA 4OZ4B 4UDTA 1R5VB 2IBZX 2Z8SA 1G1CA 4K7PY 4MD0B 2AK4B 5EBMA 3DX6B 4NQEE 2SEBB 4LVNC 4OLWH 4I9WD 4FG6D 3KPRD 2X4SB 3LKSA 1OARL 2DLFH 4F7EB 4KRPC 3C8HA 2VDKL 1V3MA 3VI3E 3GGWA 2R56L 3W11D 3ZKNC 3NN8B 2CXGA 1BVLB 3U7WL 3QEHA 4YHKL 1EO7A 1WVZA 2D2OA 4M48H 1X5LA 4GUPB 5TE7L 1RJYA 1JNHB 4FABH 3VRLF 1JN6A 1NCTA 1IC5H 4LHQB 2Q6WA 3HPJA 5F1KC 5JHDE 4OLVH 3ETBF 5BZWB 4WU5A 3OSKA 3QPXL 1A7OH 2XZZA 5DQ9B 4HGWA 1JPGA 3VWKC 1NBYA 2CK0H 2GCYB 3OKLA 5GGRB 2BERA 3FQUA 4E0RB 1KIRA 1Q72L 2EDKA 1KLUA 1WBZA 2DYPA 4KVCH 1KEMH 1RV6X 1FVEA 4OCYH 3BP6A 1WTGT 1H15B 4DVRL 2ICEB 1IC7H 1YUHB 3F7QA 3C60A 4GBXC 1FO0B 2BHUA 2BX5A 4JG0H 1KT2B 4U1IA 5D7JC 1NCAL 3QZWA 4WWKB 5BXFA 3HI6L 1G6RL 3L3HB 1A2YA 4ZOAA 5ALCL 1JHKL 1WIUA 3WDJA 3GSNB 4A2LA 3VGAC 4FQQA 4NO3B 3VXNB 4DJMA 1KB5B 3N85H 3P9MA 1AJ7L 1A1OA 3CFBB 3PQYD 4JM4H 1FZKB 2FB4L 4XP4H 3H2WA 4JZNA 2JJSA 1JGLL 3L3DA 1DP0A 1MFAH 1UGNA 3QULA 4GAFB 3O41B 3M45A 1KB5H 1TENA 1RHHA 2Z91A 5CFHA 5ERWB 4I0PB 2MQ0A 2Q8BH 2R1YB 1A6ZA 2C1OB 3MCLH 1X5ZA 4ZQKB 1HHHB 3ZL4H 4RZCA 4DVBB 2ADIB 3BN9D 2VLRA 4KU1A 2YD6A 2BNQB 2BRRH 1MJ8L 2DJUA 5JORB 4OCMC 1T0MA 1A14H 1JHTA 2C7UA 2CR6A 1EGJL 1S8DB 2OJZL 5DJCA 4WNQA 4XNZC 5I8OL 5IB1A 1JL8A 3MLWL 3PP3K 4WHDA 2YRZA 5IB4A 5DRZB 1RZJH 3UZVB 2IPTL 1X4YA 1T7WA 3TP4A 4Y5YB 4WU7A 5C0AA 5F9DC 2IQ9H 1DUYA 5DRZA 2OR9L 1BJ1H 1FZMB 3T0ED 1J0IA 1J8HB 4NP4H 4LLYB 1QO3B 3P40A 4Z8FH 5ICZB 2OP4H 3U4BL 2AXHA 3FB8B 2KUTA 4X7SL 5IK3B 2AW2A 5CJQL 3N85L 2ESVD 2FBJH 3TBVB 3MRIA 1S9XB 2OJEA 3DSFL 1IM3B 2GHWB 3NTCH 1Z5LB 2R0ZL 2BOBB 1SBSH 5K59F 3VRIA 4XTRC 1EFXB 3FAXA 5D93C 3R1GH 1ODAA 1FAIH 2R0ZH 5FECA 3WBDA 1Q9LA 3RIAK 4Y4FB 3I6KB 1RZ8B 4Y4KC 4HCRL 2F5AH 3BIAX 4HD9A 5IVZA 3D0VA 3SOBL 3T0XA 1OB1B 4NKDA 3I9GH 4DWHA 2P5EA 4NQDB 5C6WH 3ULSB 2BSRA 1X7QB 5IVXA 5TPWL 5EO9B 4QGTA 3FJTA 4PRHE 3CMOH 3IT8D 1NKOA 3ECBA 3O9WC 5T1KA 3HPJB 1EVUA 1JI2A 1MRFL 1TVHA 3BKML 3JWOH 3UP1A 4RISH 3CDCA 2CPCA 1T3FB 2VABB 2B39A 4MD4A 3A0OA 1EEUA 4P5TB 2IAMC 4DFHA 1I4FB 4IRZL 4ZNEA 2DI9A 1PG7X 1FYTD 4OZHA 2EEDA 4XMLH 1R5WB 1IARB 3N1PC 3WS6A 3IFPA 2DQEL 5HHVL 3GMOA 5HVGB 3C5ZB 4M8VA 1JV5B 4ZSOA 4MJ4A 4QF1A 5ISZE 1IGCH 4OAWB 1V3KA 2D31A 4UT6L 3X11B 3EDJA 1RZ7L 3QIBD 1T04B 3RX8A 1R3LB 4LVNB 3WKMH 5D96C 2H32H 1IILE 2CGRL 1U3HB 2RAMA 4MJIB 2E9BA 1WWWX 4YDJA 4S1DC 4L29A 3OGCB 3NIFF 4C58B 3CLFH 1P6FA 1AQDB 5EIIB 1AJ7H 4L4VD 3RWIB 3PJSB 5ACLA 3CVIH 5AAMA 4UNTA 1T2XA 1LO4L 3O4LE 4N8VA 5F6HJ 4K23H 3GRWA 4PY7A 5JZ7D 4UILH 3HG1E 5MP6H 3G5VA 4L9LA 5DD0H 1YYML 4U6YB 4ZFOL 1OGAB 1I9RH 4NC0B 1S7VB 5DJAB 3V5HA 4LSRH 1UXSB 4MLSA 1OGAD 2XTJE 5D7SH 3O3DB 2CKBA 3TO2A 1IZKA 2P46B 1HNGA 1I7ZA 1HH9B 2AJSL 4ZFFA 3SCMB 5FYKH 3GBMH 5IJKC 3LRSA 4LLQB 4LCWD 3WHXB 4LARL 4F3FA 1ZANL 1N5AB 4F57H 4R97C 4X6CB 5D7KD 5FIEA 5I0DA 2CQVA 1YYLH 3PQYA 1YNLH 2ZUWA 5ADPH 1FN4A 3OPZL 4N5EC 5KZCB 3CH1B 2DTSA 4YEFA 1WBXA 4X6CA 4UIKH 1A6WL 1SYVB 1VDGA 4NO2A 1GC1H 3PWPA 1RY7B 4XVJH 2I27N 2FGZA 2VLLB 3DYMA 5FYJU 2H9GB 1FBIH 1N8ZB 4ELKB 1XFPA 5IB2B 1JPTL 1RUAL 2DN7A 2EYSB 3HE7C 1T66D 2GTZB 1XF2B 1YNTB 4JO2L 5F7NC 3R0NA 2O5YH 3HI1B 3QRGH 3SKUD 4QEGA 2DQGL 3PP3H 3QUYD 4Q2ZB 5E7BA 3MNWB 3HPLB 2DMKA 2DMBA 5KS9A 3LRHA 1MIML 1XF3B 3QQ4A 2ZNXA 3BD4A 5BQ7B 5KJRL 5FUOL 4JO1L 4G6KH 5B38A 1IEAB 1BBJA 1S7TB 3MRDA 4XBEH 4KH2A 1W72L 3BQUA 4CVZB 4UTAL 4RQQB 1EXUA 4QRPE 1FHGA 5B4MD 3ARRA 3MRDB 1F8TL 2OL3B 1BZ9A 3EDFA 3RNQB 2YBRB 5I2IB 1Z9SA 3V52L 3E3QC 4XGZA 3QSKB 4MD4B 5IFHH 2FX9H 2PN5A 5ICYB 5D70L 4KUCD 4ODBD 2CIKB 3VCLA 3KLAB 1ZHNA 2HJKA 4OD2B 1P4LB 4ZUUA 4WFED 3QPXH 4GW5B 2BNQD 3TH3T 1G9NL 3TVMA 3MFGB 5J56B 2NQCA 1E4WH 2VDOH 1AC6A 4BH7B 1X4XA 4JKWA 1JZ2A 1YEKL 2M8XA 3HE7A 3CFDB 3V4VL 5I1LA 3S3SA 2D31B 3KYNB 3UTPD 1KCUL 4H1LA 1NCUA 1VFAA 3BP7A 4LSUH 1S7SB 1CIDA 4JFZH 43C9B 1H15A 2J8UF 2HA1A 1FZKA 4TSBH 3FN0L 4I77H 4JM2D 5DJXB 5E03A 5I8OH 3P0VH 3CVHL 1PG7L 2GUOA 2IH1B 3V8CA 4W6YB 3VFVA 5JOPD 3KJ6H 3VDCA 5DDHA 4AT6A 3MCG1 4XNMB 4DKEH 3GSRA 4QY8B 5AEAA 3ARED 2IPUK 2PCPB 1A7PL 1OF2A 2PW1B 3FONB 4IOIA 1ADQA 3DX9B 3KYMA 3VFUA 2DBLH 4F58H 4S1QL 5GJTH 5E4EB 1H3XA 4UILL 3V0AC 3U0WH 3AC0A 1MWAL 1LEGB 3IU4L 2VITB 1A9EA 1KB5L 3D3VD 3FQRA 1JGLH 4IRJC 1T1ZB 3B9AA 2MMXA 3WV0A 1D5BA 2RFXB 4OLUH 4ODVH 4P0DA 3TYGH 5C70A 2XG4A 1QVOA 2IH3B 2E7LC 3TYGL 3KHQA 2YMXL 4KKBD 2QEJA 3IFOB 4GBXB 3TN0C 5LGHH 3MUZ1 4GJTB 2FHFA 3QT2A 4OKVA 5EZIH 3WFEH 5KOMC 1FL6A 2CDGA 2FD6H 2I25N 1YN7A 2CJUH 4MJ5B 1PEZA 4UTBH 1D5IH 4I4WB 1X5AA 4MA1C 4N8CH 3GJEB 1NC2A 5JPNB 4JFZL 5LBSL 5F97E 2G5RA 4DGIL 1H5BB 1EV2E 2EDDA 5GGQH 2A9NL 4X4XB 3DX7A 1H8SA 3HZVB 2LQRA 1NUGA 4UT7H 4NNXA 3KPPA 1U8MB 4Q2ZA 2NY1B 3FB7B 3SDDC 5J13B 1AY1L 5HYSG 1QPXA 3FB8A 5KTEL 1IBGL 5C07D 1KCSH 1ORQA 4YAQA 4JPWL 4OGXL 3S36L 2VXTH 1BWMA 1S9XA 3WUWB 2LVCA 3RY4A 4KZEL 1FO0L 3MLTA 1BVKB 5HTSA 4F7PB 1B0GA 1MAKA 4L4VB 3ZKMC 3IGAB 5JMOC 3B43A 1ZTXH 4TNWK 3ZTJH 1G1YA 1KPUB 1JUFB 3ULVD 5D2LB 3U9PH 2ZJSL 1AIFA 5ESQA 3GMOB 3FOMB 4OFYA 4OT1H 4K2UH 5K9QI 3PHOA 5D2NC 2QQNH 5DMKA 1PYWB 1ZLSH 1ACZA 4ZPTB 5DRNB 3BPLB 1DCLA 4I48B 1FH5H 4ESKA 4GFTB 3QG6A 4A2MA 4FQXD 3H9ZA 5EN2B 1MY7A 3NH7L 1J1OL 2R2HA 1ZMYA 3OAZH 3ZT6A 1YY8B 1NC4A 1L0YA 1IGTA 5GGRA 4YX2H 1UJ3B 3HNVL 1XT5A 4NKQB 2P24A 3OR7B 5CEXB 3IB4A 4KRPD 3CZJA 3VXUE 5FYJD 5TDNB 3C60D 2YUXA 4DGYL 2HFGH 3ZZ1A 4QWWD 3VXNA 5CILL 1WK0A 4ZUVA 4KJPC 5IQ7L 5GZND 4JREB 3VRLE 2PW1A 4HXAH 2AKRA 5F7DA 5BVPL 4PBXA 3V5HB 5F93C 2FHBA 1QLEL 1ZA3A 4O2EB 4CN4A 5FCUH 1VFMA 4J4PA 3SKOB 3BZ4B 1YN6B 3ARWA 1BJMA 4PGCB 4R3SA 4N8VB 3PV6A 3ZDYE 4HUMB 3D69B 3QULB 2ZSVB 4OLWL 1CFSA 2A74A 4N0CC 2L7JA 4LPCA 3T0BA 3W5NA 4U49A 2AABH 3KS0H 4M7ZC 4PGCA 1KIQB 4R3SB 1FC1A 5IHUL 3EJYC 2WBJD 4WGVB 3O81A 3T8XB 4PJ8A 2D7OA 4YHLH 2VISB 3JV6B 3RGVA 4M02A 1IAKB 3RDTB 2W0PA 4U6VH 1LMKA 2C9AA 4QYOB 4LLUB 1U58B 4MA8L 1T1YA 2HMID 2CJUL 5T33L 3LMJH 3K2MC 4CU7A 3WKNA 4EDXB 3TNMA 3LMJL 1JWMA 3S88H 2HH0L 3PUCA 4YPGB 5D7JA 3D48R 1DLFL 4FXLA 4PJ5A 5IB5B 3DXAE 4PJEB 5CCKL 2DD8L 5FV2A 1IM9B 1RZJL 1JHLH 4HEPG 5E2UH 4QTHB 2VLMD 1A7RH 3QNZA 2JF1A 3B6SB 4YBLB 4BZYA 2JIXD 4X80L 2A0LC 5KS9F 4Q9RL 5ANMB 5CWSB 2FH6A 5JR1H 1BREA 3UZQA 2NMSA 3VWKA 2BVOB 4HHAA 2H1PH 2EIZB 4EI5C 3M1BB 4J6RL 1NBVL 2HTKC 2CRIA 1KJMA 2APTA 2PKDA 2YC1B 4YDIH 1WT5A 5I1JH 3HPLA 5GXBB 3D2UB 1JYXA 5F3HA 5EC1A 1KCRL 4KQ3L 3HNSH 3L3GA 1Q9LB 3MRFA 1TNNA 4P23A 3AGVA 2Y23A 1TCMA 3SDAC 2R9HC 3QPQD 4N90D 3U30C 2ZWLT 3L5WA 3D0VB 4P2RD 4MSWB 4OZFA 4PIRF 4UAOB 4TSCH 4RBPK 4Y4HA 2O5ZL 1EHLL 3B8YA 4G5ZL 1QSEE 4Y5YC 5BS0D 4I1NB 1NBZB 2ARWA 2IAMA 4BJLA 3L5XL 3HC4H 4PRNB 4R7NB 3S88L 4TPRH 4GLRH 1XGRB 2JE8A 3WDIA 4ERSL 3NGBC 2VIRB 1INDH 2K3TA 4TNWF 3DIFB 5H8DA 1C16A 1Z9OA 5D7LD 1DANT 4GMSL 4U1IB 1LK2A 1I7TB 1YPZE 1NGQL 2NY3B 4V1DE 1DLHB 2RHEA 4H1LG 4Z77B 4MQTB 3GZKA 3R06B 5JW3H 2W9EH 4OAWA 4XRCA 1CE1L 2ILLA 3RWCB 3CU7A 1ZWIA 2ADFH 2IMMA 5ITFA 4HKBB 5FA3B 1A1NB 5B39G 1FFPB 3F12A 3QIUA 4OZHF 5DO2D 1I9JL 2ZCKH 5ITBH 4R96A 5LGJB 1BFSA 4OF8A 5C7XH 2QSTA 5I1HL 4Y5VB 4U1SB 3EFDL 2DKUA 2R2BB 1X3DA 5EDXA 1XF4B 4OTXH 4NOFA 1UADC 5MERA 1NFIB 2YZ1A 1K9TA 4NKIH 3KJ4B 5KVGL 5D6DC 4D8PB 5TF0A 1N3NB 1B6UA 3D87B 2JJUA 5BW7C 3B4NA 3DOSA 1AGFA 4UI2A 3UTSE 4RMSA 1QZ1A 4NZTL 1I1AB 1T4KA 3DGGB