3HE7D

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
240
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSSTGLDTQYFGPGTRLLVLEDLKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
total genus 57
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2009-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7D02
3NFNA 4YHIA 4C57C 1KBGH 5I6XC 1O7VA 4PJXA 3IS1X 4J4PD 1GIGL 1JTOA 5L0QB 3HMXA 1WUNT 2YKLH 3QXDB 4QRQA 5CGTA 3KLHC 1FFPB 1TDQA 2C1PA 4AEHL 1HKFA 5TF1H 5CEZH 4NRXA 3SEPA 1KXQE 1R5WA 3MJ6A 4M48L 4Y4KA 1ROWA 5ISZA 3UZQA 4JFOA 4BJLA 3ZE2F 3WL9B 5CIPB 1EFXD 3LPWA 1KTLA 1T0MA 1UEMA 2HFGH 4WWKA 3FONB 1BOYA 2PTUA 4PP1D 3IDNA 2BNUA 3MOAL 3V6FA 3WD5H 4PGJA 3LV3A 5D6CA 4MHHI 5F21B 1F6AB 4AQ1B 3STBA 2AJXL 1MI5E 3BX7C 2HFEA 3QEGH 4RISL 3MLYL 1AY1H 4GRMA 4TULL 3EOTH 3BGMA 3SY0A 1I1FB 2FJFB 5D1QD 3BP7A 4KXZI 2X4UA 4BZ1H 2XICA 4LLYA 4NKMA 2FECI 4PRIE 3QCVH 2WUCH 2XN9E 2A74A 2DD8H 4CVXA 4DOHE 1Y6MR 3L3JA 4PRDB 5F7HA 2M8XA 4HFWA 3VGDA 1I3GL 1K8DA 1W72A 3KPPA 2NNAA 5DHVB 1EEYA 3NAAL 1MFBL 3MLRH 3F65A 5F9AC 1S7TA 2Q8AL 2IAMD 3LAFA 1XGRB 4DTGH 3ULVD 4LEOB 1C12B 2FGWL 3BH9B 4H88H 4UOW0 2B2XH 5SX5K 2IBZX 2VDQL 4KJPC 4HBQA 3HZKA 3SHSA 3O6LL 1U8PB 3V9FA 3JWDL 4BKLB 4PJXF 1P6FA 2XYCA 3MUY1 3B8SA 1CLYH 5IESL 1KJVA 1CD0A 3HC4H 4YBLC 2SEBA 3VWKC 1Z5LB 4ZPTB 1UJTA 1CD9B 1CXHA 3WNOA 1NCUA 1Y6NR 4PRIB 1HQ4B 2XN9B 1KJ3H 4KV5E 5HI4D 1QVOB 5JR1L 4M5YL 3BKJL 1FIGL 3LKSA 5BJTA 1AHWC 2ESVA 4IRJC 3ARPA 3WXVH 3JZ7A 4OI8A 1BD2D 3B9DA 2MMXA 1B90A 3V8OA 1LGVA 4I0PB 1GVIA 5KVGL 4F2MA 3RIFK 2YPLA 4FMKA 4OIAA 2DL9A 3CUPB 1Q94A 5EBMA 5D8JL 5E8PA 3VGFA 5JNYB 5ID0B 2VDNH 2KKQA 4LASL 1T4KA 2AJVL 3HAEG 1WT5A 3AC0A 4O00A 4U6YA 4HLZH 2PW2A 1LO0H 3V5KB 1XCTA 5T3XL 1WBYB 2Y5TA 1AQDA 2R2BB 4QTHA 5I19H 2B1AH 5ALBL 4K94H 3DMMB 3L3GA 1R3IH 4PY8J 43CAA 2XQYK 2QTEA 3RVTC 3SKOB 5EBLA 4R7DA 3SJVE 5IMKA 1ZA6B 5GGVL 2OYPA 1IM9B 4V2BA 5EU4B 1F58L 1BJ8A 5FM5O 1T20A 4P2QE 4NKQB 3EYVB 4ZYKA 4L3ED 4OLVH 1VFAB 5B39B 2EDQA 4XVUC 3RWHA 1I9IH 1XGQA 2FRGP 3KGRA 1A7PL 3D3VD 4P4KB 5BV7L 2XACC 5DJYA 3C5ZD 4LSTH 1CE6A 1I1AB 3WLBA 4S1RL 2VDML 3C09C 3MACL 1WITA 4L9LB 4UDTA 1TPXC 4M7JH 1OP3H 4JQVA 4QY8A 5K9OB 2OK0H 4TTDD 4OM1H 3PGCB 1R3KA 1PLGH 2Z8WC 1MHCB 4QOKA 3HI5H 3OJVC 3I6GB 4B53A 1S9VB 1U2HA 3PDGA 4L5FL 2W59A 2NY1B 1X5GA 2UZXB 3NIFF 5MI0C 1GZQB 1HH6B 2LABA 3BAEH 4Z8FH 1CICD 4HUNB 4P2RB 2XFXA 3EFDL 2E5EA 4B7IA 4N68A 5MEPB 5JA9A 4OQTH 3T4YA 5IW6B 1T7WA 1N5AA 2Y1VA 2H8PB 1VFBA 3B8YA 4QXTB 2V9RA 4D3CH 1F90L 4BZ2H 1LNUA 5IHLB 1ADQL 1YN7A 1RUAL 1EA9C 3SDAA 4HFUL 3C6SA 1AGDB 1T04B 2GK0A 3WJLA 4G8GB 1V3KA 2EICA 1QUNA 4HF5H 3K8KA 1JP5A 4AT6A 1RMFL 1OSZB 1R6VA 4S1SH 5ESQB 4XGZA 1N8ZA 3CVHL 5DA4A 3L3IA 4WFFD 4BH7A 1MJJB 4KMTH 4QHMA 2HMIC 1AGFA 5DJ0A 3QIBB 5IVNA 1UXSB 3ARBC 4M6OL 2CKBH 5KSVB 4PLOB 4D9RE 3BT2L 2HJLB 1GOGA 4HKBA 1G1CA 4XPTL 4NRYB 5C0GA 3QI9C 1T66D 5I74B 1MIML 3PV6A 3WFEH 4F33B 1Y18A 5EU7E 3NCEB 2Q20A 4W81A 1B4JH 4WHTB 4Y2DD 3H7BA 4YBHA 2PXYB 3M17B 4JGJA 1Q8MA 3S7GA 4I77L 1I1YA 3IDIA 4OLEA 5D2LA 4NQCA 3MLXL 5F7EL 3G6DL 5IJVB 1WV7T 2VZ3A 3AGVA 3VRIA 1IL1B 1U6AL 2XA8H 1NC2A 1MNUL 3O45A 4RAUA 3ULSA 1IKFL 1QRND 1DN0B 3FT3A 4OF3A 5CINH 4K7PX 5C0DB 3BW9B 2Z93B 3QDMA 4J6RH 4J4PC 4CW1B 4M02A 4Z7OF 3NFPA 2X9WA 3RTQC 3K7UA 1QFWI 5E8EB 1J1PH 4BFIB 1QA9A 3A6OA 3CMOL 4LRIA 1U41A 2Z31D 2M26A 3QR2A 4P46D 4Y88A 3BPNB 3QIUD 2P8LA 5IT2H 3PQYD 1FNGB 4U1SB 2AJUH 4JANB 5IM7A 4PJ9B 3U36A 4L3CA 3HMWL 1I9JH 4FQPA 2LTQB 4C58B 2OR9H 2F8OA 2VDKH 4ODXA 2AJZB 5DJAB 2ICEB 2OJZL 2VMFA 1YEFL 5E5RB 4AL8H 3P9LB 4P57A 1ZEAL 3VGEA 5GGRA 5IFAH 4G6JL 6CGTA 1LD9A 4AENB 3SCMB 3GKWH 3UBXG 5JW4M 3D39A 1GH7A 1UWGH 4KKLC 3RWDA 4H1LH 2EIBA 1FL3A 3RNKA 4RMRA 3QO0A 4PRHA 2CDFA 5HPOA 5L9DH 2JE8A 3ZT5A 3T0WA 3HS0B 4XNZB 1GIGH 2WP3T 3UO1L 4KKCC 3DV4B 3OX8B 2Y6SC 1JWUB 1ZLVH 3VFVA 2AK4D 3X11B 1M71B 5GGTA 4AEHH 4WHYG 4Z7VF 2YD1A 4M48H 5I75C 3O2WL 1BLNB 1U0QA 4YUEL 4YDLC 4HSQA 3OAYH 5CD3A 1K4DB 5K59F 3QWRD 1UGNA 3VDAA 2IMMA 5D2LF 4ZNEE 1HHIA 1T3FB 1W0WA 3NGBC 3QDGE 1J18A 1MQ8A 4YHOL 1BBJB 5F70A 5FB8B 4Q9RL 1NL0L 3N1FC 3W82A 5IG7A 4ZOEA 2X4OA 4EXPX 2AJXH 1V5JA 3KS0H 4OUUA 3BEWB 3BP5A 4RISH 3KLSA 3RAJL 3NZ8B 2YS4A 3MLYH 3R0NA 3AFLA 2H3NB 3LN5A 3P11L 4OZ4A 1T21A 5JHDD 4CN6A 4PLKC 1A7RL 5T1MA 5DZNA 3T1FA 3NACH 1A4JB 3VWJB 1ND0B 4PLNC 4XRCA 4JFEE 1TQCB 3BZFA 4AK1A 1MLBA 3O6ML 4RX4A 1I3GH 2ADFL 2J8HA 3O2DL 5EOTB 2WV3A 3BEVB 2JJTA 3NAAH 5DWUL 1MFBH 1ES0A 4XXCC 3ES6A 1TIUA 5JLZB 3P30L 2EDRA 5EBGA 5E08L 3MRBB 1CXLA 1EFXA 2Q8AH 3T2NL 3D85D 5L8LB 4QXUL 2FGWH 4LLMB 3MNZA 1J05A 1ZA3A 4DKAA 5GS2H 1ZLUH 3PG2A 2VDQH 3QDGB 2FX7L 3PWPE 1P5VA 4HMDA 2RQ8A 3MV7B 2NY3C 3O6LH 3GIVB 2NY4C 4LKXA 3FO2A 4XCYA 3ECBA 3JWDH 4LNRB 4EIZC 3E3QE 3ARGA 3ARZA 1DANT 2JJSA 3DROB 2DWEA 5IESH 1CIDA 5C0BD 4Y8DC 5KS9A 4XNXL 3QUMA 3KR3L 1KIPA 1S7XB 3DETC 4JFFE 4NC1C 3L1OL 2YD3A 2HLFC 2W38A 2IALB 4YDIL 4B0MM 1MREL 1IJ9A 3HC0A 5CJOL 5IVXF 5JR1H 1CT8A 4M5YH 3UTQA 1FIGH 5F1NB 4TUOA 1IZJA 5C0AE 4TSBL 3HCVA 1G9MC 4UUJA 1F6FB 2FX8L 5ICZA 4X6CE 4YO0B 1H3TA 5FECB 2WUBL 5EFIA 3C5ZC 5KVGH 1BMGA 2WM0A 5B22A 5JW4N 5IMLA 1DANU 1FYTA 3VXOA 5D8JH 1OB1B 4MA3A 4NHUA 2IAMA 4GBXD 4QLRA 4LASH 4J2XA 2AJVH 1CTOA 4KVNL 3RGVC 1DBBL 1JYVA 3DTXB 5L7XL 1SJEB 5MEOA 5GRXG 5C9JA 3GSQB 2FEDD 3PWPB 2DMBA 1NFDB 5TDOA 2P7TA 5DMIL 2CLVA 4RGOL 2P5EE 5ALBH 2ZOLB 1G6RB 2HJFB 1MCIA 3TZVB 4V1DD 5CIPH 4P3DA 2DJ4A 3BQUB 1F58H 4CNIA 4RRPA 4A6YL 4GG6F 4WFGE 2IC2A 3BYTA 2DM7A 2Q7NA 3VA6A 1G1YA 1S5IL 4A2LA 2FDBP 3AS1A 3MREB 4PJDA 4HX1A 3T0XA 3LMJH 1W0VB 4ZO8A 1BD2A 3C9NB 1A7PH 4LCWA 5BV7H 1KYOK 1JL8A 2GEEA 2WIMA 4HKJA 3GK8L 2P44B 3C08L 1UZ8A 4S1RH 5I1AB 3HG1E 4HV8A 2VDMH 1VPOL 3MACH 4H8WL 5D7IB 5SWZB 1P4LB 3FZUC 1T6WA 1GOFA 1WZLA 3GMMB 1FVEB 1T1YA 2VLME 1YNTA 1I8MA 4KRPC 4L4JA 4UV4L 2G5BA 2VABB 4LSSL 1FC2D 2CO6B 1HILB 3BVNB 4L5FH 2ADIA 5DVNA 2P5EB 1RUML 3T04D 1C5BL 3EFDH 3O6FC 1JHKL 5HVWA 4HWZA 3GI8L 5D93C 1DSFH 1JUFB 2O61A 5I1DB 2W9EL 4X7SL 3ILQD 2J88L 4Z9KB 1F90H 1FSKB 4NO0D 1ADQH 4L3EA 5CP7A 4JLRB 1RUAH 3MOBL 1JF5A 4HFUH 3QAZB 2GTWB 3D9AL 5F6IB 2VISA 3RWFA 5IB5B 3UYRL 1FNEB 4NHCL 4PJ5D 3SQOL 5AYQA 3MJGX 3D3VA 4OLYL 1MCWW 1KJ2L 1HHKA 2X4PA 1SY6H 3KNBB 5E94A 5CZXD 2V5YA 3GSUB 4JZOB 4NO2A 4EN3B 3EOYG 1OTSC 2BVQA 3CVHH 2ATPB 4PGCA 4J1UB 1FNSL 1X6LA 3IETB 4YHNA 3X13A 2GTZA 3KHOA 4ZQKB 2C4FT 5GSVB 1J5OH 3EW3B 4ZO9A 5IB3A 3RJQB 4M6OH 3IRPX 1KCRL 1CXIA 3FT2A 2OQJA 3BT2H 5DUBB 4CAGA 4X6EA 4ZD3L 1CICA 1H8OA 3WJJA 4HAFA 4X6BB 4XPTH 3FQWB 2FB4H 4Y4HB 4OZFH 3VGAC 1FYHB 1MIMH 4XHQA 4WO4B 4PBVC 4H0IA 4M4PA 3FQTA 5DK3A 3ZKND 2EDNA 4TQEL 3IYLW 4M1CD 1OW0C 4I77H 4JAMA 3SGDI 4NUJB 4QXWA 1QSZA 1XF3B 3HUJB 5F7EH 2HLAA 3G6DH 4U6XB 2C4FU 2FNBA 3U9PH 2IANE 4D0BB 5FM4A 3KYKL 1XCQB 2A9NL 2W60B 1U6AH 3G5YB 1AO7D 1OAKL 1MNUH 3CLFL 4HDIB 4JY6A 4K8RL 5D6DC 1S78D 3QNXA 3VXNB 2IEPA 5BVJB 1ZANL 2AK1H 3IJSB 3VXMB 3FFDA 2HJKA 4RGMB 5DEGA 1U93A 3TO4D 5GS0D 1EJ6A 2LU4A 4QNPF 4KH2A 5HHOD 1PFCA 2D31A 1X7QA 5K9JL 3QUKB 4MWFA 4Y1AE 4X4YB 5FUCC 3CFBA 1EGJA 4GOSA 3CLEL 5E2TL 3VFPB 1IC4L 5JXAL 3GMOA 3HMWH 5I6XB 3BE1L 4Z7UA 4R8WL 5E6IC 1NFKA 4P4RB 1YEFH 2ZSWA 1ZEAH 1L0QA 1LEKA 4U1MA 4G6JH 2XPGA 1LP9E 1A21A 1HI6B 3OB8A 4HIEB 1AJ7H 5D1XD 1WISA 5C2BL 1R5VB 5HYJB 2IANB 5ALCL 4OQTA 2Q7YA 3ARFC 3OWEA 4JG0L 3VD9A 3QPXL 4I0CC 5AAMA 1QRNA 4CRPA 3FAXA 3K74B 3VI3F 1BX2B 1RU9L 1XR8B 4ONFL 3PL6C 3UO1H 3T0EE 2G60L 4XAWL 1KN2L 2OI9C 2VLRD 1FN4A 1HDMB 4AIOA 2Z31A 5ETUA 3UAJD 1FZJB 3QIUA 3EYOA 4HC1L 2DQEL 3PQYA 4U1KB 2WZPD 1S9XB 5DMGC 3O2WH 2BOCB 4YUEH 3SQBA 4F57L 1ZHLB 1X5FA 2XWTB 5GGUA 2DN7A 3HPLB 4KDWA 3SDCC 3CFJB 4ZPVB 2DM3A 4H0HB 4QO1A 4MCYA 4YHOH 1Q9KB 1TLKA 4Q9RH 1MCDA 4KJYB 2R69L 2DM2A 2AVGA 2CKBA 3ARVA 3RAJH 3LIZL 3CH8A 1GJIA 1JWMB 3P11H 5INDB 5JXEC 4FTVD 1T89A 3AUVA 3MZGB 3P2TA 4GRLD 1S7VB 4X9GA 1A7RH 4X4XB 4UQ3A 5C08A 4WEMB 3ZTJG 1MFAL 3GSOA 2P5WE 4ZO7A 3T0EB 4GXVL 1DUZB 4HXBL 2RIKA 4PV9B 3H0TA 2JIXD 3O6MH 1P2CA 4YHLL 4KAQL 4HS6A 3O2DH 2CRZA 1A7NL 3TBYA 3BISA 1GPOL 4Z7UF 3ZSTA 3FOMB 1RIUL 5DWUH 2G75B 4YBLB 3VWKB 43C9B 1FCCA 1WF5A 1XR9A 5E08H 3T2NH 4LLVB 4WTXA 5JZ7C 4QXUH 1N7ML 5F7NC 4GBXC 4QHLB 2R0WL 3O8XA 2YZ1A 4PGDA 3DIFB 4QRPA 2FX7H 1AHWB 1EUTA 3RUGE 4IRJB 5C7XL 1HXYB 2W65A 4IDLA 1IC5L 4JGUA 4XNXH 5C07B 4U0QB 5T3ZD 3KR3H 2PYEA 5C8JB 3P4MA 5MHSD 2O5YL 1A6VL 2X09A 3L1OH 1YN6A 1UACL 3FB7A 4K9EL 3FFCD 2BNRD 3MNWA 4YDIH 1MREH 4PJBE 4R4BA 5CJOH 4L4VE 3QA3B 2P5WB 5CJQL 3QDHA 4JVUA 3UXFA 4EEEA 2E7LC 5J6GB 4TSBH 1N0LA 4JHWL 2FX8H 4Z18A 1YEJL 2IPKA 4G42B 4OIBA 4CU7A 4Z5RB 2WUBH 3VFNA 4NGHL 1SEBB 4H1LA 2MHAB 3EGSA 1SJVA 3KYNA 4MJIA 5DJ6A 3W9DB 1EEZA 3WDHA 2A6KB 5EOQL 3VD5A 4JPKL 1NCAL 3AB0C 4YH6A 4MJ2A 2UWEB 2AGJL 3GBLA 3ROLA 4PJ7A 1DBBH 4JKPL 5L7XH 5IB2A 5DF0A 1YY8B 3AS3A 3RUGB 3OJMB 4DEPC 3OKEA 5DMIH 1BOGB 4NQVA 4RGOH 1LEIB 3M1BA 5ADOL 2A6DB 5C0BA 3RDTD 3U1SL 4JB9L 3C09B 2XWBB 1N6UA 4OFYD 5ECJE 4U3CA 5MENA 5HDBE 1TPXB 3QCTL 1U92A 5FGBC 4KDVA 4MLSA 5HPMA 5JW4Q 3QUZC 1S5IH 4PJBB 4L4VB 2YC1B 2OTUA 3O9WA 4XBPA 1MEXL 5TQ2L 5DR5L 2AAVA 3VD4A 4F7MA 2PTTA 1OCWL 3CVIL 3GK8H 4GAJL 2BMKA 3C08H 4C55A 5IOPA 1BFTA 3EZ8A 1LEGB 1VPOH 3DPBA 1TVBB 4JFHD 4ODVL 4H8WH 3MV8A 1CVSC 1G84A 5GXBB 4BK4A 4MMXC 3O3DB 2B1HL 4O5LL 1XT5A 1GC1L 2VQ1A 4FZEL 1F97A 5GIRB 4L8SA 4FQJL 4HUUA 3DGGA 4LSSH 4NN5C 1PSKL 1XH3B 2ZG2A 2VXTL 4OZGE 1A1NB 3DX6A 5L2KE 3OKMB 1RUMH 2YUXA 3KWWB 3X3GL 2BVPB 4QHUA 4Y4KC 1C5BH 3AAZB 2Z4QA 4KHTL 3G9AB 1JHKH 1AGEB 2C3WA 3GI8H 4PB9L 4RNRA 3ZDZE 5EC1A 1KF9B 1T0NB 1WBXB 1NUNB 1QYGL 2W9EH 2FBJL 5A16B 3QZWA 4X7SH 5IEHA 1NKOA 2J88H 4F7PB 1R3HA 5C0IB 4F3FB 3MRHA 4NQSB 5I76A 3GIZH 5DURD 3BJ91 1S7UA 2GSGB 3H9HB 3D9AH 3ARBB 3BIBX 3TO2B 2O93L 4NHCH 4MDIA 4M8QA 5C0CE 1GOHA 2FO4A 1KJ2H 2FHCA 3BIAX 3DVGA 4Y19A 4XAKD 1DP0A 3B2UD 4PJ7F 1JGDA 5K93A 3K1DA 4NKOA 3QI9B 4O2CB 3OJDB 4I2XE 4AM0A 4GAYA 1CFTA 1FP5A 2JLLA 2YUZA 4E9LA 1IVLA 2P46B 4OZHE 5DVLA 5CD5C 1FNSH 3MUGB 2NX5E 4F37K 2JJWA 1RZIA 1UCTA 3TPUA 1HZHH 1G7LA 4JDVA 1DDHB 2CK0H 2D7PA 1BVKB 1SYVB 4OZGB 1KCRH 3DVFA 5L2KB 4ZODA 2R2EB 3RVXC 3EJYC 5EUOF 4ZD3H 1NDGB 3H3PH 5D72H 3T8XA 1EBAA 4E0RA 4Z0XA 3U0TA 2Y06L 2ICCA 4ZUSB 4MQ7B 5B8CA 1MFDH 4Z7WE 3RTQB 2X1QA 1ZVSA 1T1XA 3QWOA 4TQEH 1A02N 2GUOA 3WHXB 5T5NF 3PWNA 5F3BB 3V6ZB 4PJ5A 3O4LE 1TITA 2BY1A 3TVMC 1G6RH 3KYKH 3AS0A 2A9NH 3MRRB 2V5RA 4YIQA 1IAOA 2WNGA 1OAKH 1JGVL 4G8EA 1FO0A 1G0YR 1QP1A 2DQUL 4I2XB 4JM2D 4MXQD 4YGVA 3WNPA 4K8RH 1CFQB 4OZHB 1D5BA 4WI3A 3OXSB 1ZANH 3MSPA 4NO5B 2UZYB 2NX5B 4BFGA 3KHQA 3V5DA 1PAMA 4O51A 4R9HA 5DQ9A 2MKWA 3HRZA 2H1PH 5K9JH 1DFBH 3DURB 1Q9LA 3CLEH 5E2TH 5C09D 1IC4H 4ENED 5A43C 3F62A 5JXAH 4UAOC 3BE1H 3DVNB 2P1YA 4R8WH 5A3IC 1DR9A 1E6OH 5AYUH 1E0OB 3DXAD 3W81A 3ZKSD 1MWAB 1IC1A 1T7YA 3MV01 4LGSB 4H5SA 3BRDA 2NZIA 4ORGB 1BJMA 1G7QB 4OLZL 5CEYA 1MHHA 2B4CC 1SBBA 1A7QL 1X5YA 5C2BH 2E6PA 3O4LB 3TV3L 3OL2A 5ALCH 3TJHC 4YDLB 3ZE1E 4NM8L 3VCLA 4JG0H 1AO7A 2GW5A 1RZFH 3QPXH 3N1MC 2BRQA 2VQUA 3GMLA 4HK3N 4FS0A 1A9EA 2EKJA 3G6JA 4MQTB 4OFIA 4PJFA 1RU9H 5JW5A 3CCHB 4ONFH 3BH8B 1J0KA 4MD0A 4PJAE 1BEYL 3NGBB 5HYEA 2G60H 4XAWH 1MCRA 3MCLL 5GJTL 5INCB 2XWJA 3O11A 4XWGL 3HE7D 4J3TA 2FYYA 5F6HI 4QHKI 1MI5A 4P5TD 3TO4A 4HC1H 2DQEH 2YUWA 3TN0A 3LQAC 1OP9A 3Q5YA 1IQWL 3C2AL 3I84A 3RQ3A 1RHHB 3KYMB 1CXKA 1EHXA 2F54D 3LKNA 5CSBA 2P49B 3IU3B 2R2HB 2PO6A 1U8LA 1N59A 4F9LA 3QP3A 2JB5L 2UUDH 2C7UB 3JV6A 2NW3A 2R69H 2VE6A 4HWBA 2BHYA 3PXHA 3LIZH 4LKCA 1CFNA 1E28A 3F7YA 1VGKA 3FCTB 2EIDA 3LS5L 3EHBD 1QSEA 4JY4A 1IZKA 4ZFOA 4WNQB 2IPUK 3UTSD 3NOIA 2J8UE 2ZKHL 1D9KC 2V2WA 3MRFA 1CL7L 3NBNA 2DL2A 5KSAD 3F7QA 3VXRB 4KI1A 3MRMA 4PJAB 2XTJD 3MJ7B 4GXVH 4MDJB 4MJ5A 4FQHB 4HXBH 2VXUL 3SDAC 5TH2B 1E4XI 1YC7A 1TTFA 4KK8D 2ZUQC 1JV5B 3ARRA 2NY4B 4JFZL 4YHLH 2EECA 4KAQH 5EZJB 3WJLC 3MBED 1A7NH 2BHZA 1GPOH 4NQTA 1AI1L 4X6DA 1JHLL 4Y2OA 1MCCA 4LLWA 5I18L 4LCCC 2X6MA 4R6UA 3PDOA 4FQIH 4JHBA 3GRWA 2NXYD 4FG6D 3MLSL 3QWQB 4RDQG 1KGCD 2EXYC 3IS0X 2R2CA 1N7MH 1AGBA 4IRZL 5EZIL 5BS0D 2R0WH 3BKCL 3TBTB 3OV6A 4MVBD 5C7XH 1OGTA 5JMOC 5HYQB 5DFTA 1BGXL 3CAFA 3ALWA 4NNYB 1EIBA 1IC5H 4N0RA 4OIIL 3CNKA 1HCVA 3QFDB 1JNLL 1K8IA 2O5YH 1A6VH 1MCBA 1UACH 4K9EH 1SJHB 4G9DB 3RGVB 1X44A 5CJQH 3PDDA 1L6ZA 2UY7A 1MWAL 4Q74A 1NGWB 3QUXD 1BZ9A 5J3HD 1UXWB 1KG0A 3MJ8B 3PHSA 4WUUE 4FMFA 4XP6L 4ZUWA 3VW3L 5E00B 1HH9B 4JHWH 4NYLB 1YEJH 1K4CB 4KVCL 4M03A 3ULUE 3U9UB 5HHQB 4NGHH 1EFQA 4U1HB 4PJIE 1J0IA 1JGLL 4GKZB 2EDEA 3GSNL 5EOQH 2BVUA 1B0GB 3MV9A 2CGRL 3WNKA 1JZ4A 4JPKH 4WGVB 1NCAH 3OXRA 1K85A 2VC2L 5EZLB 2AGJH 3BN9C 4I0KA 4QCIA 4JKPH 3TYGL 3K4AA 2GJ6E 4LRIC 2OS7A 4PRPA 1RZGB 4AEFA 4LP5A 5ADOH 1IBGL 4BSVA 4ODUB 2X2YA 1K9TA 4QRRD 4F9PA 4JB9H 2ARWA 1YEIL 4D0CB 2IPTL 4NQDE 1QLFB 2MFNA 3D18A 3QCTH 3EO1A 3FFCA 4PJ8D 3HR5B 2AXFB 1NMAL 4KRPB 4ETQA 3WN5C 1MEXH 5TQ2H 2PN5A 4P2OB 5M94B 5DR5H 1U36A 1BPVA 4WUUB 3BUYA 4IMKA 5DQDL 1HK6A 1SYSA 1R3LB 1EX0A 1OCWH 2KH2B 1II4E 3CVIH 4PJIB 3O6FB 3A6CL 4GAJH 2ERJC 3HE6B 5JIPA 3TBVA 3LKRA 5D93B 3U7YL 2QHRL 4RGND 4M9PA 4BSJA 4ODVH 5TJWK 4PRBB 1U3HD 2B1HH 3UMTA 2VAAB 1F4YL 5JW4R 2F8XC 3RNQA 1BJ1J 2LQRA 4O5LH 1GC1H 3EJJX 4FZEH 4HHAA 4WUKL 2B8OT 4FQJH 2GQHA 4DGIH 3OKLA 4HJJL 3CSBA 1PSKH 2Q86A 2VXTH 5CJ5A 2AS5M 3O2DA 4UBDC 5IUSA 3X3GH 2BY0A 1KCLA 4JRXB 3L3OB 4KHTH 4RA0C 1DBKL 4PB9H 2NY6B 1NC4A 5L6YL 4NQDB 4ZXBC 5SX5H 4DW2L 5FFLA 1QYGH 3RY6C 2FBJH 5CZVL 3REVB 5E9DA 3BO8B 1AQKL 1PQZB 3WFDL 3U2SA 3RWGA 5HYSG 2DLGA 1C5DA 3L3KA 3BPCB 1DVFB 1G9ML 4BQCA 4G7VL 5J1AA 4R3SB 4WW1A 5HYFA 3WIFB 4GS7C 2X7LB 2V7HB 4X7EC 3LHPL 4F7TB 2QQNL 1NGYA 2AV1A 4M7KL 3VGAB 1KENL 1K2DA 3RZCB 5CFHA 2LV4A 1IT9L 5EIVA 3T65A 4D0DB 2JK5A 3ARDD 5IROA 3JWOL 1WTGT 4PYHA 1WCQA 4HUXB 3UTOA 4KUCD 5LGJA 1L4IA 5D7KD 2Y06H 4KWUA 5EU6D 4ESKA 1UCBL 3QEHB 3TPKA 3E1F1 4LVHC 5C0EB 4AJ0A 2AV7A 1ZHKB 1KC5L 2FJGB 3BWAA 4KU1A 3S36X 4JO3L 2MNUA 1URLA 1WLHA 4JPVL 3WUWB 4M43L 4LCYA 5EU3A 1CR9H 1ONQA 2KL6A 3ARGC 5B3JE 1L7TH 4EZMA 3PP4L 4ELKB 5KAQF 1JGVH 3A6BH 1F11B 1LE5A 2ZWLT 4N8VA 1OD9A 5E6IB 4HEPG 4A6YA 4NM4L 3S37L 1AGCA 1XZ0B 3PJSA 2BSRB 2R1WA 1UFUA 2VLKD 4RMWA 5E1HB 5KSBE 5EDXA 3OZ9L 1HQRA 4ZDHA 5I17B 3ULUL 1PVHA 2HVJB 5EWIL 3CXHK 3S9DB 3QIWB 3ARFB 3D0VB 5FKAA 2XY1A 3K3QA 4LMQI 4Y7MA 3V5HA 4AMKL 1A2YB 1J8HA 5F89A 3DV6B 1MJ7L 1BHGA 3PL6B 3KPTA 5ESVB 1JPSL 2FJHA 2OI9B 4GXUM 2B39A 5T33L 5L8KB 5D7JA 3IJHA 3Q3GA 3X14B 2OZ4L 4OLZH 4DCQA 2PR4H 2HKHL 1A7QH 1JN6A 3ZKMD 4XWOD 1A6TA 3MPCA 1G7HA 4FQXD 3TV3H 4OV5B 3J8F7 4NM8H 4IHOB 5DRWA 5IFJB 1KPUB 4LEXL 3L6FB 2OXGA 3OHXA 1WAAE 3VFMB 1BEYH 4ZO6A 3D25B 3Q6FA 4PIRF 3MCLH 4ZUTA 2ATKB 2GITB 2A6IB 3GSRB 4AH2B 4XWGH 5DDHA 4KK8C 4NPYA 1KIRB 2VQTA 5KSBB 4FXKA 1IARB 3EKCA 5D1ZB 4Y8AA 3NCYP 1KJ2A 5EUKB 4YK4C 4NKDB 5IBUG 3C2AH 5TPWL 5C09A 1QFPA 3BN3B 5L8JB 1HSAB 3CFDB 1ZHNB 4HIHB 3D69A 2DIAA 3RL1B 2ZUXA 5DEFB 4QT5B 1K5NB 5I15L 2JB5H 4HUKB 2YD8A 4IIQB 2J2ZA 2N7BA 4ALAL 5HHNA 2GAZA 4XZUB 2Z91B 4XCNA 1T1ZB 4C4KO 5GZOC 3FTGA 3HC3L 4LL9A 2MQCA 3KPQB 3HNTL 3IDGB 4JPWL 1PEZA 3LS5H 3IAGC 1BFVL 3DWTA 4X7TA 4L4TE 2FD6L 1NGZA 4XP4L 3RVUD 2EE9A 1DUYA 2Q6WB 5D7LD 2FR4B 2Q76A 8FABA 4M5ZL 4PBWD 3HE7A 3PWUA 4QRTA 1EZVY 3CFIC 5LKNA 4NDMB 4HWUA 3EFFA 4HH9B 2ENSA 5KZCD 1U8HA 4P5TA 3RI5F 1HHHB 3BKYL 2A0LD 1JHLH 5I18H 3QUYD 3MRIB 5CSGA 1FL6A 2VLJD 1OGAB 1QPXA 3MLSH 2OP4L 3HZMB 4IRZH 3QO1A 2V5TA 4P23A 5CLTA 1EMTL 5EZIH 3BKCH 3BFOA 3MA9L 3LKPA 4R26H 1A3RL 1FRGL 3FOLB 3GSXB 3MV11 3Q1SH 4KQ3H 5F1KC 5C0AA 4JFXB 1J9CT 3S5LB 3QNZA 1EO5A 1BGXH 1YMMD 1YEDB 1BQUA 2CQVA 5C92A 2NLJA 3O3UN 5IW1B 3KPSD 3MRGB 4OIIH 1CG9A 5DK0B 3AB0B 1JNLH 4X9IA 1YY9D 1MCKA 4X98B 4PJXE 2EDOA 4OLWL 4AIZA 1KN4L 3UTSA 4L4TB 3W0WD 3RVVD 3BIKA 4RCAA 3ISWA 1FFRA 3F58H 1MWAH 5GS2D 3ROOB 5E24E 1J8KA 4HS3B 4DEPB 3VW3H 3VXTA 4D9QD 3UTZA 1U58B 2C3VB 4DFHA 4GXUN 4HGKC 1CGYA 4K94C 1JGLH 4X7CC 5ISZE 1DQTA 1IGTA 3FQXB 2VR5A 5ID1B 2MCG1 2CGRH 1GAFL 5DJ2A 5FCSH 2VC2H 1R24A 4PP2B 4S2SA 4M6NL 5DHYB 5HY9A 2ZOKB 5CHNA 3CH1B 1P53A 2FL5A 4PG2C 1DLHB 3DUSB 4NNPH 3CU1A 3TYGH 3BPLC 4KK9D 4R96A 3GSVB 2IMNA 3LRHA 3WS6A 1JWSB 1FG2A 4PS4L 2G2RB 1IBGH 4P3WA 4QYOA 2GKIA 1QFWL 1KPRB 1A4KA 4OCNC 1YEIH 1MFCL 3UJTL 3HG1A 2IPTH 4LFHD 4OCYL 3NFNB 4LCUA 4YHIB 3GJEA 3QPQD 5EZOL 4PJXB 1MRDL 2HTLC 2ZSVA 4C54A 3GJFB 1NMAH 2VZVA 1UYWH 1C16A 1OTUC 4NN5B 3QUXA 5I1CL 5T1DL 2F5BL 5DQDH 2BVTA 4XI5D 1R5WB 1F4XH 5GS1A 4Y4KB 4BSWA 5IBTL 3A6CH 1KLFA 5ISZB 3W2DL 1JMXA 4JFOB 1NKRA 3U7YH 2QHRH 1N3NA 1T0MB 1MY5A 3KJ4B 4X6CF 1F4YH 3FQRA 4G7YL 2XKNB 5SWSE 3VFTA 2FATL 3IDNB 2BNUB 3V6FB 2EYRA 4WUKH 5DO2C 3P0VL 3JUZA 3LV3B 5D6CB 5F9OL 4NRZA 4HJJH 12E8L 2HFEB 3OG6B 3CIQA 3V52L 4WJ5A 3BGMB 4I4WA 5HGGS 4QRRA 3BP7B 1DBKH 2XV6B 2C3HA 1IRAY 2WBJC 5L6YH 4DW2H 5CZVH 1JK8A 2E8YA 5IKCA 2F74A 1AQKH 3GSWA 3WFDH 4PJ8A 1HKLL 2EH8L 4CVXB 2ESVE 1G9MH 1MHPL 4G7VH 4HFWB 4NC0B 5TE6L 1RFDL 1XIWA 1K8DB 1DQJA 1W72B 3KPPB 2LVCA 3ARYA 3BD3A 1T89C 3LHPH 2QQNH 4LARL 1UWXK 2YPLE 2FSEA 3UPCA 3WFHB 5IV2A 1S7WA 4M7KH 1S7TB 1S9YA 1KENH 5A2IH 4WDIA 4BQ6A 3SDDC 3EO9L 1VEOA 4TRPL 4A2MA 3V0VA 2E6QA 3K0WA 4WRLA 3HZKB 3OKOA 4KXZH 3JWOH 5FDWA 3OKDA 1NUDA 4X5LA 2OL3A 4LHUG 2YPKB 3TVMB 3VGBA 1KJVB 4DUWA 4HGWA 3PWJB 4JEGB 2SEBB 2W9LA 5KOMC 3G5XA 5IGXL 3WCYA 4PRID 5F8QC 1UCBH 2XN9D 4O2EA 4L8CA 3O8XC 1KC5H 4S0TD 1CFSA 3LKSB 5D9SA 4JO3H 2ESVB 4FXLA 3NCBB 4JPVH 3VGGA 3JTTB 4IS6A 4M43H 3TIDA 1KCKA 4XBEH 2N4IA 3LVEA 1VADA 3PP4H 4F2MB 1DZBA 4HKXA 3PIQA 2YPLB 4JDTL 1IEBA 2AEQL 3PGDA 5EBMB 5KW9L 1I9RL 1AXSA 4NM4H 1HNGA 3TFKC 3HMXL 3S37H 4IMLA 1WSST 2EIZA 1QEWA 1G9EA 1F3JA 1QG3A 4QOKE 2A9ML 4U6YB 2PW2B 2QQQA 1XCTB 4NNXA 4WI8A 3OZ9H 1PKOA 2Y5TB 4QTHB 1KFAL 3ULUH 1X5JA 2AP2A 2OMBA 3DMMD 3MC0A 4B41A 1DTUA 1NLBL 3TIEA 4HEME 5EBLB 4R7DB 1P7KA 1QPPA 5EOCL 4NFBA 5IMKB 2FGZA 2WWMC 2I24N 1IM9D 1O7SA 1CDGA 4AMKH 3D2UD 4Y16D 3UTTA 3EYFA 1MJ7H 4OUOA 4JY5L 1L9MA 1JPSH 2DYPB 3QT2A 4JO1L 1A1MA 5AWNL 1AIFA 2BSSA 5T33H 3RWHB 3NFSL 1AR1C 1NFIA 4P4KD 3L5WB 2HKHH 4HWEL 4U6TA 5DJYB 1AD0A 1CE6B 1I1AD 3C8KA 3WLBB 2QR0A 4KZDL 1QSFA 1S9WA 1KTRL 3IFOA 4PREB 1MCFA 2WINA 5H8DA 1R3KB 3VFRB 3O9WC 4QOKB 2VLKA 5B21A 1UM5L 5E1AB 1PG7L 1UC6A 1VACA 3SOBH 2NY1D 3EJZC 4P2RD 2XFXB 3QUYC 3T4YB 5HI3C 5TPWH 3WS3A 3L5JA 1VFBB 4MNHA 3BDXA 4B5EA 1LNUB 2Z8RA 4L8SC 5I15H 1RZJC 2HWZH 4OCRL 1YN7B 4CDGC 3SDAB 4OFDA 5EULV 2EZ0D 5D2LE 2ZUQB 2HKFL 3B5TA 4NQCE 4APQC 5IWLC 4EI5C 1D7FA 5DJXA 1CLZL 3NCFB 2H6PA 4G8GD 1GL4B 3ILPA 5H35A 3LD8C 4Y5YC 3HC3H 4FQXA 4LCCB 3HNTH 3AREA 4XGZB 1CF8L 4JPWH 3S6CA 1N8ZB 1BFVH 3P77A 4KROC 3PWVA 3QDME 1LP9F 3L3IB 2FD6H 3QH3A 4XP4H 2PW1A 4BH7B 1K6QL 1ZWIA 2P8MA 4Q9QL 4QHMB 1AGFB 1D5MB 5BZWB 5DJ0B 3U0WL 4M5ZH 1E4JA 3U7AA 1KCUL 3O81A 4MD4A 5D2NA 1W8NA 3JWDC 3BKYH 4LVEA 5IF0B 4HKBB 2A6JA 1J10A 2CLRA 2WWKO 2VZOA 5C0GB 5HVHC 5FYLD 4YWGL 2PNDA 2OP4H 3PV6B 2VO5A 5FA4A 4HJ0D 5FYKE 4PYGA 1NMBL 1MF2L 4GQ9L 4TVPD 3WNNA 3H7BB 5HGDA 2RGSA 1A3RH 1QTYT 1FRGH 2PXYD 4RBPK 1MCHA 1N64L 1I1YB 3IDIB 5EC2A 5D2LB 3D39E 4NQCB 4N0UA 2A83B 3GGWB 5F71A 3MR9A 3VRIB 3Q6GH 3W11D 3RPKA 5E8DL 1NC2B 4PRHE 3O45B 4IOFD 4LSQL 4OTXL 2FEEI 3G04B 3FT3B 5HHXL 1REIA 4OLWH 3MROB 3C2SA 1KN4H 2GK2A 3QDMB 3WKML 3PXJA 3NFPB 4WIQA 2YSSA 1KELL 3OPZL 1DEDA 4O02L 1QA9B 5HGHA 1OM3L 5ADPH 4RMUA 2JELL 4G80A 3VD7A 1BP3B 2P8LB 4HULB 2H32H 4D9RD 2AEPL 2DI8A 3IVKA 2AEIT 5FF6B 1LE9A 4LDOB 4ZS7L 4L3CB 1GAFH 1Q9OB 4TUKL 1DBAL 2X4QB 4M6NH 4JQIH 3S4SG 3RIFF 3GDBA 4BQ9A 3MGOB 1KXTB 3EUUA 3KDMA 4P57B 1IGFL 2GIYA 4LSDA 1PG7W 5I1EL 3NCCB 2NCMA 1LD9B 3SCMD 3D39B 4NOFA 1TJHH 3RWDB 5BV7C 4PS4H 1CN4A 4N1CA 5DYOA 3B4NA 1FL3B 1QFWH 3RNKB 3NABL 3QO0B 5DEZA 3UJTH 1MFCH 2IFFL 4PRHB 2CDFB 4OCYH 3RUGF 3MRQA 5EZOH 1MRDH 2O5XL 3GBNL 3W0WA 2KDGA 3SE4A 5IVOA 5BXFA 4HUVA 4TOYH 1F13A 3N06B 4RA3A 3VFVB 1QR1A 1WFUA 1QFOA 5T1DH 4HJGB 2F5BH 3H9SA 4P9HL 3QQ9C 5IVXB 3EOAA 3G5ZA 5IBTH 3W2DH 5AZEH 1X5LA 5EIQA 3D48R 4IOIA 1ZHBA 3ARWA 2R29L 5DJ8A 5B39G 2VL5A 1HHIB 4G7YH 2FATH 1MVUB 1RJYA 4M1GL 1L0YA 3P0VH 5F9OH 5IG7B 12E8H 2X4OB 4OUUB 5SV3A 2FWOA 3BP5B 4GS7B 3QDJD 2P8PA 4Z7QE 5HI5C 3LN5B 4UU9A 3V52H 3TN0C 5C0CA 5KS9E 4NQXA 4OZ4B 3VH8A 1F3RB 1T21B 2DQHL 4GW1B 3PABB 5BO1L 2PYFA 4LRNL 5T1MB 2CLZA 1HXMA 4NZRL 4ONHB 3T1FB 3WO4B 4PD4K 2PO6C 3VWJD 1HKLH 2EC8A 2EH8H 4F9LC 5HHPB 4XRCB 1IKNC 2XKSA 4TNWK 3FRPA 3BZFB 1MLBB 5LVEA 3HLAB 4OSUL 5GGQH 5TE6H 2X4SA 1RFDH 1JCKA 4MD5A 5HDBF 3I9GL 1N4XL 5EO9A 5KANG 2AQ1A 1PZ5B 4I0PC 4GUPA 4LARH 1NJ9A 3ES6B 5GRJH 4Z0BL 2HFTA 5IJKA 3W9EA 4PV8A 3EO9H 2NR6D 4Z7WA 1A7BA 3MNZB 2YD9A 4WVRA 1J05B 1ZA3B 3QDGD 4JN1L 5I30L 3MV7D 5CZKA 1F6AA 4KI5F 3MRNB 3CZJA 3C5SA 4LKXB 3FO2B 3C6LC 2ID5A 4XNUL 3ARGB 2DWEB 4Q97A 2LVEA 2X44D 1I1FA 1TJGL 3QUMB 2FJFA 2LU7A 1TETL 1KIPB 1QLRA 2X1XR 2ZG3A 3GSNA 2YWZA 5F3HA 3CXDL 5C0ND 3MO1B 5FYKL 2MOVA 3WSQL 3THML 4KRNA 4R2GC 4OZGF 3OQ3B 4PJDE 3E2HB 5KVFL 1CT8B 3UTQB 2UY6A 4KUZL 1JPFA 1YQ2A 4GKOA 3HCVB 4PRDA 1BD2E 4YPGA 4MAYC 4UUJB 3ZDZF 5DD3L 1GHFL 4P4KC 1JFQL 5EFIB 1UENA 5A1AA 5FOJA 3GUTB 2DLFH 2YEZB 2P42B 4JDTH 1H15A 4LHQB 5IMLB 2AEQH 3OKNA 5KAQG 3V4VH 1FYTB 1Z2KA 3VXOB 5KW9H 4K07A 1I9RH 4NHUB 1YEEL 1XGRA 2LFGA 3O3BA 3HMXH 1M4KA 4LEOA 4WY7L 1CDYA 4MNQB 5C9JB 3PWPD 3QXWA 5IK3B 4POYA 4OCXL 5TDOB 3JSSA 1U8PA 2RHEA 4GJTB 1BBDL 2CLVB 1KFAH 3ZLQC 1BQLH 1NLBH 3NCJH 3RVWD 3TZVD 5EOCH 4P3DB 4ZFZB 3BQUD 5DQJA 2DIBA 2Q8BL 4CNIB 1EH9A 3VFGH 4FP8L 2DQGH 1RAMA 4JY5H 1JNNL 4HX1B 4L3EE 3IFLL 5AWNH 3LZFL 3NFSH 1HYSC 4CBPA 3D3VE 4L29B 4NC2B 4TTGA 4LCWB 3PE9A 4HWEH 3KPNA 5J89A 4JG1L 4Z7WF 1A1OA 1UZ8B 4YK4B 4U3HA 4HV8B 4F9PC 1JGEB 2NY0C 5SWZD 1IGML 4OGAC 1RIVL 1T1YB 1YNTB 1I8MB 4XX1G 2G5BB 2NXZC 3V5KA 1SMAA 1UM5H 1PG7H 3DO7A 1I7TB 3QIBC 3KPLA 2ADIB 1W72H 3CXHJ 2ADJA 2W07A 2CR3A 2FZ3A 4HWZB 3SKOA 5ABDE 1UJ3C 5C0RL 3EAKA 4YEFA 2EDLA 5D96C 1IM9A 1KLGA 2WQRA 1LVEA 5I74C 3D2UA 3EYQD 1FZOA 4Y16A 3N9GH 2J8UA 3TCLA 2GSIA 3B9AA 4L3EB 4OCRH 2RB8A 1VFAA 4UILL 5CP7B 5I8OL 2HKFH 1XF5A 2VISB 3RWFB 1CLZH 2JCCA 3MXWL 4JZJA 4QRUB 1RJZA 1HHKB 4FFZL 2X4PB 1IQDA 3WEXA 1RK1A 4WEBL 2R1XA 3PGFL 5E94B 4NO2B 4EN3D 5J7CC 2DQDL 3FO0L 5DMKA 4PGCB 4WFFE 4OFVA 3EIFA 3VXPA 2K7PA 1C1EL 1K6QH 3PGCA 5DUML 4Q9QH 1C08A 3FN9A 1S9VA 3ZE1F 3U0WH 4M00A 1F4WL 1KCUH 3BPNC 1F4HA 3FT2B 3V6BR 2OQJB 4X6EB 1CICB 4P2RA 4MB4A 4U6VH 4AQOA 4FFVD 4ZAKA 1PD6A 4PJAF 4Y4HD 4PJ9C 4YWGH 1MSPA 3LSOA 4Z7UE 3KJ6L 4WO4D 3ULVL 1NMBH 1MF2H 4JHZA 5EU7C 4GQ9H 3FQTB 3HB3C 2D4FA 1UH2A 5L88L 3OF6A 1FFNA 4PRNA 4WW2A 4JAMB 1N64H 3MRLA 5GRVK 2H2PC 5IROC 4MB3A 2HLAB 3EYSH 5C0JA 3VFSA 2L4OA 1O5DT 1F4AA 1TCMA 5E8DH 3STLA 1LK3L 1QRNE 2D7OA 2DLTA 4LSQH 4OTXH 1X4XA 3G08A 4LOUC 2ARJB 1IEAA 3JTSA 2BP3A 4JY6B 4PY7A 5BCAA 3WKMH 1FHGA 3WV0A 3QNXB 2WLZA 3QB7C 3DRQB 3SBWA 1NBVL 2HG5B 1KELH 3OPZH 1H9VA 4O02H 3BPLB 1OM3H 4Q6IA 3MMEA 2GJ6A 2QKIA 3VXMD 2MCPH 2JELH 2R4SL 3QHZH 2OZ4A 3B6SB 3PQYE 1U93B 5DEGB 4DGVL 5C70A 2ILLA 2HJLA 4HCRA 2AEPH 2D31B 2J8UF 4YBQD 1X7QB 2CJUL 3CFBB 1FGNL 3HZYA 1TJIL 2Y07L 3GMOB 1G6VK 4J3WA 4TUKH 5JPNA 1DBAH 4XCEA 4Z7UB 1EHAA 5DC4B 2JCCF 3KLHD 2PXYA 1LEKB 3IFPB 1IGFH 3M17A 5LWYL 1U8NA 4NZDA 5I1EH 3WBDA 2XPGB 1A6WL 2BERA 1OAQH 1T5WA 3QQ3A 4XCCH 4HG4K 1SVZA 5HYJD 3PF2A 2IAND 4KDTC 2Q7YB 3NABH 2IFFH 1WK0A 1QRNB 2AJYL 4H8WC 1E4WL 5C08E 4YHPA 1SVCP 2N1KA 1RV6X 2O5XH 1A7OL 3GBNH 4BFIA 2BNQA 1FN4B 5E2JA 3MJ9A 3LDBC 4TSAL 4YAQA 3QQNA 1YZZA 5ETUB 3JWNC 5D7JC 1EXUA 4P9HH 2A73A 3EYOB 4CMHB 4I5BA 3Q2CA 1ULVA 3H6JA 4JANA 4MS8C 4LP4A 4WW2F 1H3UA 5LAXB 2R29H 3TM6A 1OSPL 3VRLE 2ICEA 3ULUF 4NCDA 1UVQA 2RJMA 3P9LA 4QRPE 4M1GH 4MCYB 5J0BA 3FHQA 2YD2A 2R9HD 2CKBB 4GKNB 2V2TA 1Y6KR 5JDSA 2PYEE 2DQHH 4G3YL 5DJCA 2DS4A 1J0JA 5BO1H 1KB9K 1YYLL 4LRNH 4UQ3B 4BFBD 5GS3A 5C08B 4NZRH 1J87A 5ICYA 1MCEA 1NGQL 4W70A 4F8QA 3GSOB 4NJAL 4XVJL 4X99A 4KJPD 1XGPA 3H0TB 1TNMA 4NQEA 1P2CB 2G9HA 3B9EA 4OSUH 1KTDA 4HS6B 4OCSL 2ZUUA 2D7NA 3KPOB 3ALXA 1N4XH 3I9GH 4YHKL 1BLNA 4MJIE 3VWKD 4OM0L 4LU5L 1XR9B 3ZE0E 3QFJA 4P9ML 2ZUYA 4OQ1A 2BC4A 4JFDA 4DKEL 2YR3A 3V4PL 1ZMYA 1WIUA 4PJ7E 3O8XB 2EDBA 1TZGL 5J11C 5E5MB 3P4NA 3RBSA 1CGSL 4PGDB 3HZVB 4QRPB 1I8IA 4JN1H 3S88H 1BBJA 3T3PF 5I30H 4IRJD 3HKFA 3BXNA 2W65B 5EG6C 1I8LC 3QDJA 1J12A 2H32A 5C0BE 3E3QC 4ZG1A 3JUYA 5C07D 1EGJL 1TETH 5MENE 2PYEB 2VXVL 3P4MB 2EO9A 3WDJA 3CXDH 4W6YB 1E4XL 5E4IA 1IMHC 5DJDB 3FB7B 1INEL 4UMGA 5FYKH 3WSQH 2UZIL 3THMH 1T0PB 1JPST 1Q1JL 3MNWB 4K8RC 4P23C 4YGAB 2APFA 2F58L 1ZGLB 1A4JA 3VWJA 5KVFH 3WHE1 4KUZH 2FX9L 4X9BA 5BMFL 2VDOL 4I18A 2IPKB 1CL7I 4M62L 5DD3H 1P9MC 2V7NA 1JFQH 3U7WL 4H1LB 3EGSB 3D0LA 3KYNB 3RVTD 4G43B 4NZTH 4MJIB 5DJ6B 1EEZB 5JLZA 5TE4L 2MTPA 3MV8E 1T6VN 3ZT6A 5MP6H 4G9FA 2LE9A 4LLMA 4WY7H 3ROLB 4PG9B 4PJ7B 5IB2B 2E8ZA 5J8OA 4XVUD 5HHMB 1YECL 3EOBA 3QJHA 3UTPD 4OCXH 3MV7A 1ZLWK 4CVZA 5FO8A 5GRZA 3OKEB 1RHFA 4N0FB 3NTCL 1BBDH 4NQVB 4HPOH 3M1BB 1PZUB 4KTDL 5C0BB 1NBZA 5DSCA 3TWCL 5MENB 4IEFB 1F6LL 2Q8BH 1U92B 3EYQC 4FP8H 1V3JA 5EUOB 5HPMB 1UG9A 4L4VD 1JNNH 2OTUB 3O9WB 4XBPB 5F1NA 3IFLH 3FAWA 4C56A 3B9KA 4ZSOA 3ORJA 1NCNA 4BH8A 1P7QD 5F6IC 4LMQE 5DGRA 4F7MB 1EAPA 4Y5XC 5FECA 4Y19E 4KMLB 3WS6C 4FNLL 4JG1H 5IOPB 3CC5B 4R97C 1PX4A 5F44A 3BP6B 3MV8B 2ED7A 1IGMH 1SHMA 5EBWB 1AR2A 1RIVH 2EXWD 2CDGB 4OKVA 1L9NA 1JZ8A 5BZDA 1E6JL 3LKOA 4L8SB 3S35L 5B3JF 1OT2A 1SJEA 4HUUB 2WANA 3DGGB 4ISVB 4APQB 5FGSA 1NFDA 3FB8B 4EI5B 1JNHA 1CD1B 3KXFD 3P4OB 3LD8B 3PV7A 4Y5YB 5GS1C 1U8IA 1R0AL 3C8DA 3KLAA 2Z4QB 3TH2T 3BD4A 5ACZB 1VEPA 4K7FB 4RNRB 4HLJA 5C0RH 1OVZA 5EC1B 1TZIB 3STZA 4IRSA 3QZWB 4KK6C 5KSBF 1R3HB 4FOMA 3MRHB 3VXUA 3VG9C 5I76B 1VENA 2HMID 1HIML 4UILH 1S7UB 2D7MA 5I8OH 1W0VA 5T3XE 2VR9A 3BZDA 4S1DC 3ARBD 4XNMA 4PJ5E 2O5ZL 2VXSH 4MDIB 1MUJB 3MXWH 1RJLB 3KS0J 3WIHL 4RSVA 4M8QB 4ODTL 2FO4B 1F8TL 3DVGB 4Y19B 1SBSL 4PJEA 4WEBH 3ZYZA 3PGFH 5HVHB 4NKOB 1BFOA 3QI9D 1JE6A 2WMPA 4AM0B 5BRZA 2DQDH 3FO0H 5SWZA 1P4LA 1CFTB 2ADGA 4JRYB 5CBEB 4UIKL 1B3JA 1FVEA 2D2OA 1C1EH 4WHCA 1MRCL 5DUMH 3TNNA 1CXFA 2AQ3A 1RZIB 3TPUB 2XNAA 1KJMB 1G7LB 4JDVB 1JPTL 1F4WH 4WHDA 1XIWC 4WV1A 3A67L 3N1PC 1XF2A 1FFQA 3OR6A 1WAAF 4PRAA 1H3XA 1CGVA 3T8XB 1QQDA 5CEXA 4EUPA 4JCLA 4Z0XB 4LVOB 3U0TB 5I1DA 3KJ6H 1AD9A 5B8CB 3ULVH 4K9EC 3EO0A 3RTQD 2HRPL 1MQKL 1NAMA 1T1XB 3R06B 3QWOB 5L88H 2P4AB 4QWWC 5D5MA 3AM8A 4LLQA 1WZMA 4KKBC 2GUOB 3PWNB 2H41A 1OPGL 1QNZL 5DI8A 5A2LH 1BQHG 1AO7E 4LQ1A 1HNFA 2ZNWA 1IAOB 4NP4L 4YIQB 3S96A 1LK3H 4G8EB 1FO0B 3KPRD 4XP9L 4MSWA 5ITBH 3G6JE 4PJFE 4YGVB 3LKQB 3JV4A 1D5BB 3Q0HA 1JF1A 2C5DC 4M7ZC 1NBVH 2E9BA 4U05A 4JCMA 3V5DB 4S1QL 3BJLA 4WGWB 1U3YA 2R4SH 4O51B 1AC0A 4QF1B 4ZUUB 4KKLD 4DGVH 4WU7A 3HRZB 5BV7B 3P3YA 1QSVA 2BY2A 4FFWC 1RZ7L 4PJGE 1Q9LB 2CJUH 1FGNH 1TJIH 2Y07H 2I60L 4JRWA 4N5EC 4UTAH 4O9HH 3LEXA 4KKCD 2Y6SD 4UT9L 1RZJL 5TF0A 4BUGA 5E8OA 4WTZG 5LWYH 5J9PA 4P48A 4H5SB 4GKSA 2R9HC 1BREA 5DUPL 1A6WH 3TA3A 5CEYB 1N26A 2HN7A 5DFVC 3DX8A 3O4LD 3MLWL 5DJZA 4PBXA 3VCLB 2ITCA 1QSEE 2A38A 1D5ZA 2AJYH 3GMLB 5KSUA 1Z3GL 4HDIA 1E4WH 1A9EB 4PJFB 5DHXB 4XT1C 2XG5A 5JW5B 2DAVA 1A7OH 3WYRA 4MD0B 1YYML 3VXNA 2XQBL 4WI9A 4KKNA 4NUGL 1GC1C 5GGSA 5SWSA 3T0EC 5JOPE 2Z35A 5KANI 3O11B 3VI4E 4TSAH 3VXMA 2FYYB 3IAPA 2DQTL 1M7IA 1MI5B 2NTSP 4X6DE 1H5BA 3TN0B 4CVWA 2JKXA 4L3AA 5AZ2L 1F00I 3IFNL 4DUXA 4X4YA 1RUKL 3SKJL 5FAAA 3VFPA 4RFNC 4PLKD 3AU1B 5D5MF 1S3KL 4LBEA 1OSPH 3CVHB 4MCZA 1H3WM 2PO6B 1H8SA 1U8LB 1N59B 4DOHB 3GB7A 3BHBA 1IILE 4KGLA 1T22A 3JV6B 3MA7A 3S4SB 3T0AA 4EQ3A 2NW3B 1HI6A 2E27H 4JPIB 3QHFL 3IDUA 2NQCA 3U4EA 3GO1H 2AJSL 1GGTA 4LKCB 5B38B 3VD3A 5HYJA 1OT1A 5ACLA 3F7YB 1VGKB 4G3YH 2BVYA 5HD8C 4UQ2A 2EDHA 2Y9RT 5H94A 1QSEB 1YYLH 4JY4B 4OZFB 4ZFOB 3TBSA 1C8PA 2ZCHL 3EDDA 1NGQH 3MRFB 1NGPL 1MRFL 1TCRB 2D03L 3EDFA 3ETBF 5D71L 3VXRD 1J11A 4MJ5B 4L8BA 4JFQA 4OF5A 1ETZA 2NY3D 4OGYL 2RAMA 1S5HA 2NY4D 2VYRE 4OCSH 1FZJA 3C6LB 1CXEA 1U8JA 3RWJA 5CMAB 2BFVL 4LLWB 3PDOB 3DETD 3MV9E 4OM0H 1FO0L 1FLRL 3AREC 4LU5H 4CMMA 1ZHLA 1X3DA 4P9MH 2XWTA 3DSFL 3FHAA 2HLFD 3U6RB 15C8L 4DKEH 3AVEA 4R2GB 1AGBB 4ZOAA 3V4PH 2BDNL 1MIEL 2UYLA 2CKNA 5DZOA 1TZGH 1CGSH 4ZPVA 3ZHLA 1Q9KA 3PHQA 4PRPE 1BWWA 3TH4T 4KJYA 4MAYB 2DJSA 2R39A 4F37F 1MAML 5J1TC 3MRKA 1EGJH 1S7VA 2VXVH 3B5GA 1NBQA 5MHSE 5DRXB 4PD4J 4E42A 1E4XH 1INEH 3FFCE 2UZIH 1Q1JH 5T1LA 1S9KC 3RGVD 2BZDA 1G7PA 5BMFH 1BZ9B 1KG0B 4IOSD 2VDOH 4ZUWB 1FJ1A 3P0YL 4J3VA 5IMOA 3CFCL 4M62H 1ZSDA 2D7TL 3U7WH 4WI4A 3RGHA 3DJ9A 3FB5B 3MV9B 5TE4H 3SJVB 1OWWA 4DKDC 3OXRB 1INQA 3BPOB 3E6HA 2EXWC 4P2QB 5FDYA 2CIIB 2JJUA 4QCIB 3ZKQD 4J3SA 1AHWA 4K3DL 1YECH 1W0YT 2Y7QA 4YE4L 3MGTA 4PRPB 4MQSB 5DS8A 3NTCH 5GS0L 3LQMA 2X40A 4KTDH 4BSVB 3RY5A 5C07A 2VITB 2V5MA 5IW3A 3D18B 2NY0B 3IDYC 5FO7B 3FZUD 3FO1A 1PY4A 5E9DE 3EO1B 3FFCB 4YR6A 5E2UL 3LQZA 3IU4L 4FXGB 4KRPD 4C83A 4ETQB 4AEEA 2NXZB 1AKJB 3BZEB 5J6GA 2BY3A 8CGTA 4WUUD 4HWBL 5TGBA 2N56A 2DDQL 1SYSB 3DUHA 1P4BL 2K9UA 4FNLH 4XPHH 3O6FD 3TBVB 3LKRB 3UJJH 1UJ3B 4ELMA 3MLZL 1U2CA 3MFFA 4Y5VA 4KI5C 5D96B 5F8RC 3RFZC 4ZFOL 1RK0A 1ACYL 1JYNA 4UNUA 3QRFM 2IFGA 2UWEA 4RZCA 5E2WL 3RNQB 4XC1L 3SE4C 1E6JH 1OQOA 3BD5A 5GRYA 1KB5L 1QBML 3S35H 3C8HA 4XB8A 3OKLB 4UINL 1UWXH 4K3JL 5JUEH 5D4QA 1V7ML 5SWQA 1RJCA 1R0AH 1N2RB 4JRXD 2QV2A 3GRWL 3P4LA 3WFCL 3O41B 1NC4B 3P0GB 4NQDD 2CRMA 1OTSD 4QHNA 4RFEB 5E9DB 3U2SB 1XGYL 3RWGB 5JW3L 1C5DB 1VGEL 3L3KB 1NANI 3W39B 3K2MC 1HIMH 1JHTA 3ZTNL 1MCQA 2IBGA 1P7QA 3CX5K 1SEQL 2O5ZH 4UOJA 4ODTH 1F8TH 4XAKE 5DD0L 1GGIL 1NGYB 1SBSH 1A6AA 2EKSA 2AV1B 2NYYC 3GHEL 1LEGA 4NBYB 4HIJA 4JQXC 4NZJA 3OGCB 2YRLA 1K2DB 4O4YL 4UIKH 4YXHL 5F9JA 3T65B 1MRCH 5F7UA 5L2JA 2DQFA 4LIQE 5GRWA 1T1WA 4FQQB 4Y4FA 1XH3A 1JPTH 1NGXB 3HAEA 3OKMA 3KXFA 3A67H 5JO5A 2EEDA 3KWWA 2AKRA 4KK5C 5LGJB 1A14L 1B0RA 5F9DC 1TXKA 2EO1A 4OAWB 1J8HE 1ZT7A 5LQBL 5IR1B 5IJKC 5B3NA 4K7PL 4F7PA 1D6VL 4F3FA 1NDMA 4UOW1 1MQKH 1A6PA 3BWAB 4EJ1C 2GSGA 4ELMF 3H9HA 3TO2A 4V2CB 2X89D 1OPGH 1QNZH 4LCYB 3LB6C 5EU3B 5EO0B 1OARL 5T3ZL 1VSCA 2I27N 4NP4H 3MLTA 3GM0A 4PR5A 4P5MA 1MCNA 35C8L 3QI9A 3OJDA 3O3EA 3SGJC 1LE5B 4N8VB 2E7CA 1I7ZA 5E6ID 4A6YB 4HUWA 3T0VA 1QFUL 1AGCB 4OCWL 3PJSB 2R1WB 3RKDC 3MOAH 3V7AG 3C60C 4S1QH 3QG6A 4F7CA 4ZDHB 4GLRH 2R2EA 4MHHG 2GI7A 4TULH 4M93C 1FVDA 3FT4A 1RZ7H 3ARFD 5FKAB 5C09E 4TVSa 3V5HB 2I60H 1WZ1L 3QCUL 1J8HB 3GMRA 4HIIB 4WFEE 5F89B 4ZUSA 4J4PA 3PL6D 3RL2A 3RTQA 1WC7A 1AH1A 1U91A 2FJHB 4UT9H 1RZJH 1BF2A 2QSQA 3LDBB 4U1GC 3BZ4A 5D7JB 3IJHB 3Q3GB 5DUPH 4DCQB 1ZS8A 1M05B 1JN6B 2H26A 5DMGD 1A6TB 1G7HB 1I4FB 3MLWH 1T83A 3MRRA 1AP2A 1WVZA 5DRWB 1MY7A 3KPRA 3QXAB 1Z3GH 5HHVL 2EYSB 3M8OL 3OHXB 3SDCD 3HPJB 1YYMH 2KZ1B 2XQBH 1LDSA 4M7LT 3Q6FB 1TTGA 4ZUTB 5DT1L 3AROA 5AAWA 3BWUC 5DDHB 1EHLL 4NPYB 4FXKB 2DQTH 3DI3B 3GHBL 5JXED 4AEIL 1F2XK 1KJ2B 4I48B 5AZ2H 3VXQA 4HWNA 4M9OA 3IFNH 5D1QA 1RUKH 3I2CL 3SKJH 2KZWA 2F54E 2EE6A 1S3KH 1QHPA 1U8QA 1VHPA 5E56A 5HSFA 1Z0MA 1S7QA 3ARXA 3D69B 5ILTL 5TQ0L 3BKJH 5DC9B 1JF6A 4JFEB 3IF1A 4ORGA 4KZEL 2X9XA 2GAZB 1FFOA 2HTKC 1G7QA 3BMWA 4XCNB 2AJSH 3FTGB 5MERB 4KJQC 1OAUL 2ED8A 1NEZB 4XMKL 1H0DA 1ZVYA 2VIRA 4GMSL 4LNVA 1U8KA 3HNSL 3NIGF 1OLZA 4EQ2A 5JZ7D 1KT2A 3UTSE 5J1SC 4RBPH 2ZCHH 4TPRL 1NGPH 1NGZB 1MRFH 5GRVL 2D03H 5J11B 5D71H 1DUYB 4LPUA 4TUJB 5E03A 1DQML 4DZBB 3MRPA 2Q76B 8FABB 5T3XH 4OGYH 3PWUB 4QRTB 3JWOC 4F7EA 3EFFB 4JZJC 3IDJB 2BFVH 2W0FA 2MPAL 2F15A 1FL6B 1FLRH 1FO0H 2ITDA 4JFFB 1OGAD 3KYMA 5GGVH 4LHJB 2I26N 3DSFH 3VFOA 1KGCE 15C8H 4P23B 2R2HA 2BDNH 2XI9A 3WXWL 4NO3A 3MRCA 1J0ZA 1JRHL 3SGEI 4I3RL 4LIQL 1ZT1A 5BQ7B 5C0AB 1DJSA 2W91A 1MVFA 2MJWA 3QNZB 4PTTB 4X6CB 4HQQL 1Y0LB 3N1QC 1UADC 1MAMH 2NLJB 4XXCA 3FQNA 3EBAA 1S8DB 4ZAKC 1CG9B 3UBXA 5GQBA 4AIZB 3ZDYE 3UTSB 3NN8B 3L7EA 4L4TD 4GQPH 2Q3AA 3BIKB 3VXRA 2IH1A 5KN5B 2GT9A 4Z7QF 1UM4L 2X4NB 3QBTB 5KS9F 4WW2C 3HNVL 3U46A 4P2OC 5TH2A 1EO8L 1C7SA 3P0YH 5GRUL 2VZUA 3R4DA 2VERN 3CFCH 5SV4A 5EPMA 3H42L 2EDFA 1KPVB 2D7TH 3ULUC 3HE6C 1IGTB 1J7VR 4GW5A 2YA1A 1EVUA 4JFYA 1R24B 4S2SB 2LU3A 1WICA 2BOBA 4DGYL 1WIPA 5HY9B 3QUZD 4K3EL 5CHNB 3WUWG 2FL5B 5ERWA 4TYUA 1BVZA 5CKGA 3SBWC 5FIEA 2JJVA 4X83A 1YDPB 3MYJB 1TVHB 4K3DH 4Q6IC 4YE4H 4Q2ZA 4R96B 2FEEL 4Y5XB 5GS0H 1WFNA 1FG2B 2F19L 3O0RL 3C5ZA 4NNYA 4QYOB 3ULVF 1DBJL 4QRRE 1RMFH 1A4KB 4YXKL 4R97B 3HG1B 2PETA 3QFDA 2NY6C 4LCUB 2BX5A 3GJEB 2R4RL 4X5WA 2ZSVB 5B4MC 4OJFL 5E2UH 2DBJA 3RGVA 1C16B 1RURL 2NTFA 1DVFC 4OGXL 1HOCA 3QUXB 3MJ8A 1KSRA 4HWBH 3ZHDA 4GRWH 3RZWA 2DDQH 1K4CA 4QGYA 1AXTL 5GS1B 5HHQA 5CGYC 1J1XL 4Y4KD 4BSWB 1P4BH 5ISZD 4PJDF 4GKZA 5JOEA 3IT8D 3MLZH 4RGNE 1N3NB 2VRAA 1ACYH 1A3QA 4PGBA 3RZCC 4EVNA 5E2WH 3FQRB 4XC1H 3VFTB 3VG9B 1MCWM 1KB5H 1QBMH 3V2AR 1F5WA 4NRZB 1RZGA 1JVKA 3MLXH 4UINH 4K3JH 2X05A 4KKAC 1V7MH 5FHAL 2DBLL 2F53D 4WJ5B 4X7DC 1CVRA 1QO3B 3ELAT 4QRRB 5DC0A 3GRWH 1FVCA 1BIIB 4D0CA 3WFCH 1IKFH 1QLFA 2DLIA 1JK8B 3Q5TA 1ZXQA 2BSTB 5IKCB 2F74B 4ODSL 3GSWB 5CD5D 2YRZA 1XGYH 4PJ8B 1JTPA 2AXFA 5JW3H 1VGEH 3OKKA 5CAYB 2E9IA 3QJFB 3CMOH 4P0DA 3ZTNH 2BVOB 1ZK9A 2VWEC 2F8VA 1SEQH 1XIWB 5TF1L 1DQJB 3RVXD 3UX9B 3EJYD 5DD0H 2NY2C 1CCZA 1GGIH 1UZ6F 5TDPA 2FSEB 3GHEH 5IV2B 3MBXL 1S9YB 5DK2B 3G6AA 4WDIB 3UZEA 1PYWA 4O4YH 4DK6A 4YXHH 2VAAA 2OJZH 4Y2DA 4XXDA 3V0VB 4PGZA 3OKOB 4Y89A 1RPQA 2FBOJ 5FDWB 3OKDB 4L1HA 3RKPA 2I9TA 4ZOBA 2JF1A 3TVMD 1YC8A 4JRXA 4HGWB 4W4OC 1A14H 1RUQL 3QIWC 3LPFA 4MXWL 2DKSA 3G5XB 4OF6A 5EU6E 5LQBH 3UTTE 4B7LA 4K7PH 4O2EB 1PQZA 4L8CB 2BSED 1D6VH 1ZT4B 1FORL 4M7ZB 3PNWB 1CFSB 4ACPA 2B20A 2YBRB 4IS6B 4P46A 5F1IB 4M6AA 4YC2C 5E6YA 4JO4L 3TIDB 3MX0A 5EU5A 5A2KH 1NAKL 2X7LA 1OARH 1VADB 4ZOCA 4Y1AB 1VKXA 2YPLD 1G9NL 35C8H 1IEBB 1QSFE 3MNVA 1AXSB 2DQIL 2VB5A 1QFUH 5ACMA 1RUPL 5A3ID 3S5LG 4IMLB 1I3RA 2EIZB 1QEWB 2WK2A 4OCWH 7CGTA 1F3JB 4EXKA 2VLKE 5FUOL 4NNXB 1IE5A 1OW0A 1NL0H 5FXCH 1LP9B 2VLLA 4I18C 5EN2B 3QQ4A 5ENWB 1ITBB 1NUFA 5D1ZC 3MRJA 1CLYL 2HT3C 3D87B 3TJHD 3TIEB 5FYJD 1MLCB 1WZ1H 3QCUH 3UTTB 4N90D 1G7IA 4GAGL 3MZTA 2RR3A 2DYPD 4YNYA 2OLDA 1JZ2A 5GHWL 3F5WA 2YPVL 1A1MB 2DI9A 2CRYA 2FHBA 1AIFB 4IIQC 1PJ9A 1TZHA 2P43B 2AK4A 3TT3L 5AD0A 2VXQL 1JBJA 1NFIB 2ADFH 3I75A 2BK8A 3C8KB 2QR0B 3MRDB 4O2FA 5I0ZA 3P30H 4RFNB 1OP5K 3QWRA 1QSFB 1S9WB 5HHVH 3IFOB 5E6IA 1BQHB 3M8OH 1E4KC 2WINB 5IIEA 4Q7DA 4WU5A 3MUZ1 4U31A 4QOKD 2VLKB 2EDTA 4X8JA 3B9KC 5DT1H 3Q48A 5IHZA 1VACB 2R1YA 2APWA 1EHLH 5D2NE 1NSNL 5I17A 3WIHA 3GHBH 4UI2A 1R3IL 3VJ6A 1RZKL 1FDLL 5JHDA 1ZGLP 1OOAA 3I2CH 4J3UA 3RP1A 1P84K 3WS3B 4U1IA 2J7LA 3SKMA 2IQAA 1D9KD 1HINL 5HDLA 1HEZA 5ILTH 5TQ0H 3FQUA 3SDAD 3IGAB 1X5AA 3O3AA 4N0UE 2V9QA 4KZEH 2I07A 4POUB 1NPUA 2OL3L 4YDJA 2H6PB 5GSRA 3ILPB 1E27A 5H35B 5ICXA 1MELA 1OAUH 1BAFL 1UA6L 4I3SL 4Q9CA 2IG2L 1XF4B 4HKZA 1V3LA 3AREB 3I6KA 4CADA 4XMKH 3FKUS 4EDXA 1KPUA 3HNSH 3P77B 2EXYD 3D85A 4IRSC 3FL7A 3TBWA 5T5FL 4TPRH 3QH3B 3VFWA 2OK0L 2KUTA 4BQBA 3SDCA 4KVNH 1ZWIB 2P8MB 4BA8A 5CS7A 4JREC 2ATKA 2A2QT 2A6IA 4AH2A 4TN9A 4POZD 4LLUA 1SQ2N 1YUHA 4MD4B 2DM4A 4QKXB 5D2NB 5JXEA 5I8EA 1GGCL 2A6JB 5C9KA 2MPAH 2WBWB 2CLRB 1IM3B 1IGJA 3IDMA 4N5UA 1JZ3A 1UKSA 2G5RA 3HI1B 4X0KA 5FA4B 4A6YH 1MH5B 5E4EC 3WXWH 4EBQL 3BP4A 4HIHA 32C2B 5HGDB 3RWEA 5SX4I 4UIMA 1JRHH 3NIDF 5DEFA 5DRNB 1K5NA 3OAUL 4I3RH 4LIQH 2ZUTA 5EC2B 4NQCD 4N0UB 2DMKA 1T1ZA 4HF5L 3VRLF 1NC2D 3OSKA 4G8FA 4KI5E 3KPQA 4MZ3A 4WI2A 2D0GA 2XY2A 4XTRC 5I16A 1WBZA 3F12A 5CWSA 4GBXA 3W0WE 5IBLC 3BN9D 1HHJA 2YSSB 1UM4H 4UV4H 4YDVA 1GYAA 3HNVH 1V05A 3AM8C 1EO8H 3H9SE 5M7QA 4D9QE 1KACB 5GRUH 2CH8A 3IJYA 4HH9A 2UUDK 3UROR 2CMRL 3IVKB 3MRIA 2CK2A 1VFOA 3GMPA 4V1DA 1LE9B 3IDYB 1OGAA 1WQVT 3OG4B 3TLRA 3PWLB 4DGYH 4K3EH 3KJ4C 4DVBA 4WWKC 5AG8A 3KDMB 5H2BA 2E7LA 3MOBH 2GCYB 5HDQL 3UYRH 3D39D 5D7SL 4JJ5A 3SQOH 3ZE0F 4OLYH 3T2OA 3SDXE 3O0RH 1DBJH 5DYOB 2XA8L 5DRZB 4YHYC 4MX7A 4YXKH 1OTTC 4PRHD 4LLDB 5DK0A 1ORSA 1NUGA 3MRQB 2R0ZL 2R4RH 4J6RL 5IHUL 2VN4A 4OJFH 4XBGA 3T0BA 1TNNA 4L9DA 5BXFB 4R90L 4HUVB 1RURH 4JN2A 4OGXH 1QR1B 1JPGB 2DMCA 3H9SB 3TA3C 1U58A 2C3VA 4MQXC 4UBDD 5H37G 3S97C 5I71B 1AXTH 1J1XH 3EOAB 3G5ZB 1NBYA 4OBRA 3U0PA 5DD6A 5ID1A 1EEUA 4IOIB 4ZXBD 1ZHBB 3CFEA 1DE4B 3H8NA 5F96L 4N0CC 5FGBA 4G6AC 2VL5B 3QUZA 3UBXI 1RJYB 4NO0A 1U95A 3E6FB 5FGRA 1H3PL 2FWOB 3A0OA 1VESA 2P8PB 5FHAH 2J8OA 1H5BC 1JWSA 3MUJA 5C0CB 2G2RA 4NQXB 3VH8B 2PCPA 1S7SA 4F58L 1INDL 4MA1C 5TDNB 1IAIM 3CLFH 2YHGA 3QYCA 2PYFB 4RFOL 3C5JB 2CLZB 1HXMB 3GEWB 4OD2A 4ODSH 3GJFA 1FGVL 4GG8B 4X80L 5EA0L 4RX4D 3BUTA 5CSZA 4UTBL 5C3LD 5HJ3A 2X4SB 3TGXA 4MD5B 5EO9B 5CJBA 4GUPB 5JDJA 1NJ9B 4R4FL 2DTML 1BZ7A 3C87A 2Y23A 1U3ZA 2R0KL 3MBXH 4H20L 3VGHA 5I0DA 4PLJC 3W9EB 1ZE3C 1G7JB 4K3HA 3L3HA 4PV8B 3B83A 3T77A 4ZUVA 4Z7WB 2XKNA 4NWTL 2R8SL 4P59L 1WT5C 4JVPA 1FNAA 1L6XA 1Q72L 3C5SB 1ORQA 2IPUG 4RAVA 4DJMA 5DVMA 3ARGD 5ESAA 2F53A 3L95A 2ICES 4BFEA 1RUQH 1QLRB 3NPZB 5JORA 3GSNB 2OR7A 2IH3A 5F3HB 5FA3A 4MXWH 5KG9A 3TNMA 5JMRA 1RULL 3VRJB 2Y4SA 1CQKA 1DEEA 3NACL 1ZLWH 3ME0A 1FORH 3QULA 3CX5J 1JPFB 1KN2H 4R4NC 3C60B 3HFML 4YPGB 5IVZA 1WZKA 4JO4H 4YJZL 1NAKH 3LN4A 5HHOA 3ZYIA 4M93B 2WP3O 1CGWA 4F57H 3RWCA 1G9NH 4PJGA 1H15B 2EDDA 4R7NA 4UT7L 3WFHA 4CGTA 3OKNB 1FYTD 1MFEL 3I6LE 1WFOA 2Z8SA 2DQIH 5ANMA 4JQVC 1CYGA 1RUPH 3O3BB 3RHWK 4MNQD 2QADC 5FUOH 4NFDA 4U1GB 3REWA 3QXVA 1I7UA 4JFPA 2J6EA 5CEZD 5D1XA 2YPKA 4CN1A 3TVMA 3V0WL 3PWJA 4ONOA 1YA5A 4WWID 4E41D 5DQJB 3SKNA 1M7DA 4NJ9L 4U1LA 3FB6A 4JDZA 2H2SC 2W0KA 2HT4C 4GAGH 1MFAH 1VB9A 5GHWH 1JNJA 2YPVH 4KJWC 4KRMB 1KB5A 2VLRA 2VN7A 3MTRA 3AXLA 3TT3H 2VXQH 3JTTA 2JCCE 4P9HC 4LCWD 3RBGA 3VXSD 3P9MB 3KPNB 5J57B 2FO1A 1RIUH 3IXAB 1A1OB 2CDEA 2YD4A 2ZG1A 2X4TA 1I7RA 1YJDL 3MLPA 4PB0L 3RPIA 4ZFFA 4ZTOL 2M2DA 1MOEA 1ACZA 4YFDB 3WKNA 1YMHA 3WE6A 3DO7B 2C3GA 2OTWB 4POZC 3KPLB 3V7MA 1D5IL 1NSNH 3G6JF 4PJFF 5GZOD 4P2RE 2ADJB 3NH7L 4FTVA 4U1JA 1RZKH 2IJ0C 2V9TA 2FZ3B 1FDLH 4GRLA 4K2UL 3SPVA 1EAJA 4Y5VC 4ZTPL 4N0YL 1KLGB 3D2UB 5C0FB 1FZOB 2IADA 1IAMA 4Y16B 1SMOA 3AS2A 3LH2L 1HINH 2J8UB 2AABL 3TCLB 3WFBL 4Z77A 2DYPA 2GSIB 4DQOL 3CSPA 3LMJL 5IB1B 3IXTA 2XT1B 2ZNXA 2I9LB 2JIXA 2YD6A 4PJGF 4LAQL 1UKTA 1XF5B 2C1OA 3T08A 4YZFE 4G8GE 2OL3H 3T3ME 2JCCB 3L5WA 4JZJB 3NCYS 1RJZB 1WWCA 1IQDB 1BAFH 3WEXB 1RK1B 1UA6H 4I3SH 2R1XB 2IG2H 3QXTA 2D4DA 2IBZY 1T2XA 5JPMB 3OR7A 1MCSA 5DMKB 4PREA 4N8CL 4GRWF 5T5FH 3G9VA 3VXPB 2CXGA 1RSFA 1SM3L 4OCMC 1JYWA 1C08B 4WFHD 4X5XB 3VFRA 3VMNA 5E1AA 5GGVY 4G6KL 4G6FB 4BUHA 2QQLL 4X9HA 4BK5A 4TNWF 1GGCH 5A2JH 4XHJC 1FZMA 4ZAKB 3U1SH 5FYLE 1BZQK 3IRZA 3DX7A 1DSFL 4PGEA 3LSOB 4ODWA 3VI4F 5GJSL 1D9KA 2BNRA 4TVPE 1I8KB 3V8CA 4EBQH 3MCKA 3P9WB 2XZZA 4X6DF 3WLWC 1FFNB 3OAUH 4PRNB 4WW2B 4XMLL 4OF7A 3MRLB 4Y4FC 3VFUB 1LK2A 4E5XA 4W4NA 5C0JB 1H3VA 3VFSB 4LCCA 3T3PE 1SY6L 5CJXA 1DCLA 1WEJL 2P24A 1A6ZA 1N5YL 4HBCL 3STLB 2EDJA 3G08B 4ZS6D 1IEAB 4GFTB 3JTSB 4OD1L 4PY7B 1RVFL 3N0PB 2BNQE 5I1KL 3DRTB 1D5MA 5BZWA 4Q6IB 3MMEB 2GJ6B 1J5OL 2QKIB 5E7BA 2NZ9C 1A3LL 2CMRH 1OD7A 3RDTA 5IF0A 2FB4L 3HZYB 4OFYA 3WNMA 3L9RA 3O4OC 5JPNB 2HTLD 4XCEB 1Q0YL 4YDKL 4Z7VA 5HVFB 1OTUD 1F45A 1U8NB 3TP4A 1KULA 2VWEE 4HK0A 5GZNC 3VE0B 1KYOJ 4DWHA 5HDQH 3QNYA 4XX1E 5D7SH 4HIXL 2A83A 1T5WB 3QQ3B 3GGWA 3U9PL 3SE9L 2HT2C 3K1KC 4N9GB 5C6TL 1P1ZB 4W68A 4XVTL 3G04A 2QSCL 4HS8L 3GKZA 4LF3A 5I66B 2R0ZH 3MROA 4YHPB 4LCIL 4ERSL 5IHUH 3WO4C 2AW2A 3NPSC 3F7RA 2K3TA 3R1GL 5I2IA 2YD7A 2AK1L 2QQKL 4DAGL 4R90H 5DO2D 2BNQB 2V5SA 5FK9B 4NQEE 4YAQB 1H3GA 4YX2L 4AIXA 1EXUB 2V17L 4ZMAT 2A73B 5BOPA 2CPCA 2GHWB 4S10A 2JJTC 4I5BB 4RRPG 3T2PA 1T83C 5FF6A 1U8MA 2WBJD 1D5XA 3QFJE 3FRUA 2RFXB 1G7MA 1Q9OA 4GLRI 4JFDE 4ODBD 5F96H 2X4QA 2YK1L 3MGOA 1UVQB 4PP1C 5IMMB 5F93C 3WN5A 2X1OA 5I1LA 3ZL4L 1OHQA 1R5IB 2EIEA 1C5CL 1AJ7L 1H3PH 2V2TB 3QDJE 1CDJA 5JDSB 1FNHA 2NY2B 2JJSC 4F58H 1HSBB 1INDH 5D1QC 4PJCA 5DJCB 2AJ3A 3DHJA 2DQUH 4RFOH 5FOBA 5ICYB 5C08D 3X12B 3SDDD 3L5XL 3E2HC 5D70L 1FGVH 4M61A 4X99B 4CN4A 1X4YA 1XGPB 4X80H 3H9YA 4NQEB 5EA0H 4JZNB 2G9HB 4UTBH 2VTFA 4HJGA 1J0YA 1KTDB 1OF2A 5IVXA 4GH7B 1FNLA 4KQ4L 1IAKA 4P99A 1KLUA 4R4FH 2DTMH 2EYTA 3ABZA 3V79C 2R0KH 1EZVX 2XZCL 4ZXBA 3QFJB 3DOSA 4H20H 1O0VA 3RY6A 2BC4B 4JFDB 4DZ8B 2IAMC 4G9FE 4Y0GA 2OXHA 3ULVC 5C86A 3O8XD 3P4NB 4NWTH 2R8SH 1MVUA 4P59H 4QRPD 5A2FA 1I8IB 3S36L 3MV7E 2OSLA 3BXNB 3IKKA 4PTUB 1Q72H 4YC2B 1LO2L 3GBML 4K7PY 3QDJB 4HCRL 2H32B 4U1NA 5J06A 2PYED 5FYLL 4GW1A 4KC3B 3PABA 2Z92A 5T1KD 5I8KL 1RULH 3VMOA 4JM2A 1QBAA 3TFKD 4ONHA 5HI4C 4TVPL 2AXGA 1FLTX 3OGOE 4C56E 4ZSOE 5GJTH 5HHPA 4P5KA 5F7DB 2VSCA 3HFMH 3HLAA 4I18B 4GG6A 2V7NB 4EDWL 3QEQD 3D0LB 1PZ5A 4MJID 4HZLA 3DBXA 1IQWH 3BSZL 4UT7H 4RDQF 2WWMD 1X4ZA 5F9WC 5MEQA 1MFEH 4HLZG 4OI7A 3TJEL 4HD9A 3VMPA 3K4DA 4G9FB 3CSYA 3OJ2C 3DXAA 3MJ9L 5HHMD 2EEBA 3EOBB 1NFDE 3QJHB 4JKMA 4MB5A 1BECA 4PJCF 4CVZB 5FO8B 1ZKAA 1AR1D 1HHGB 3MRNA 1GRWA 4OFKA 1WCBA 2AERT 3TYFA 5EIIA 3V0WH 1Q0XL 1CGUA 1NBZB 3WO3B 4PJHA 2DQJL 5DSCB 5MEND 4LHUD