2OI9B

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSGFASALTFGSGTKVIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oi9B00
3TP4A 3RWHA 4L29A 3SDXB 3P9LA 3HRZB 1BQHA 1JHLL 3GBNH 4POZD 2NR6D 2ITDA 1FVCB 1ITCA 3QG6A 4YO0B 5BRZD 3MOBH 3T0BA 4DFIA 3QI9D 4IRSB 1FLRH 4ZO8A 3S36X 1Q94B 4WI6A 3TZVA 1WICA 5DMKB 5EB9A 2AJUL 4XC1H 2N7AA 1HHKA 4GLRH 5ELIA 4NFBA 4ZUVA 2X4PA 3TYGH 4DEPC 1UVQA 3ECBB 4D0DB 5EOTA 4AK1A 4PJ9C 3ETBF 2VMFA 2R0ZH 1XH3B 2IQAB 4Z7QF 1FPTL 2OQJB 2HFEB 4MNQB 1D5BA 4JKPH 4DCQA 3BMVA 5F97E 2XY1A 1CK0H 5HYJE 4DGIL 1JTPA 2V6HA 3RWFA 3ARUA 3PJSA 1CFSA 4P2OC 3V4VH 3HR5B 1U8QA 3K81A 5I0DA 1KF9B 3ZKXC 1CU4H 4NRZA 3D48R 3HFML 4P3DB 2QQKL 4APQA 5DVMA 1DBJL 4HJGB 4FQIL 1CGWA 3MO1B 4NPYB 5HYJD 4UU9A 1M7DA 3VFPB 1VKXB 5GS0L 3UCRA 1BWMA 1R0AL 5DRZB 3MACL 4FZ8L 4LOUC 4LPTA 4JFHE 4ZOEA 5J1AA 4JPWH 1QFHA 2WQ8A 1IGJA 3LQAC 4U7SA 4RDQG 1I4FB 1QR1A 1CGYA 5A43C 3ARYA 3OPZL 1NGZB 4ZS6C 1LE5B 1RZKH 3CPLB 5IWLC 1G9ML 3ARFD 5D7JC 3NH7L 2DLFL 3DV4A 1JZ5A 4X83A 5CHNA 1PLGL 3CJJA 4KTDH 4WW2C 4JFHD 3VRJB 5I9QC 1Q9LA 4JQVC 2FYYB 2CQVA 3H0TA 2Y36H 4HMDA 4KI5E 1FZKB 2HTLD 4PJGB 4OCNC 3PP4L 4ETQA 3TO2B 4TTGA 2R56H 2XN9A 3K2UH 1L7IL 1V5JA 3VDBA 4LSTL 4BQBA 2ICEB 5EOQL 4ODVH 3SGEH 1UCBH 1WC7B 1FNHA 1RUKL 5D1XB 4KI5D 4XC3L 1M6OA 1W8NA 2ZG1A 2UY6A 5BZDB 4K3JL 1I7TA 2ZUUA 4M3JA 4UDUA 2J5LC 4MB4A 2V5TA 4KGLA 3KPRE 2PN5A 2I5YL 4OZFA 4MAYC 1FNGB 3D39E 4TUJA 2X4RB 3V5HA 2YXMA 4LAJH 4NNPL 1K85A 4QRRA 4WI4A 4EDWL 2QSCL 5KW9L 3RQ3A 2H2SC 4PTUA 1UZ8A 5LQBH 3DYOA 1MFBL 4XNQB 1C5BH 3BQUA 5IVZB 3KPRD 5EC1B 3T2QA 3Q48A 3K4DA 4HD9A 3D39D 3DURA 4MJIE 2O93L 5JZ7D 3FRPA 3MV8B 4IRJC 3ZKMC 1GHFH 3ZT5A 3QXWA 1IT9L 5F44A 5TPWL 5GISH 1A0QL 5E00A 2ARJQ 5IW1A 5B21A 3SCMC 1H3TA 4CDHA 4UDTA 3LQZA 2D3VA 3VGAC 1PG7L 2DQHL 2XZZA 5FFLA 1DBAH 4MJID 4CMHB 2PXYD 4TVPE 2GUOA 4N8VA 2EIZA 5IW6B 1MCPH 2ADGB 3R8QA 3VCLA 3RX8A 1GXEA 2KPNA 3SBWA 1BFSA 5D9SB 3X14A 5J3HD 3QO1B 5IQ9B 3PDOA 4GG6B 4LF3B 1YDPB 3JWOC 1QSFE 5I1HH 3LB6D 1WFTA 2BNQE 4TVPD 4TSBH 1R3KB 4LCWA 3NN8B 1AP2B 1MCQA 1KPVB 1CLOL 3NCEB 3H9YA 4PP2A 2XPGB 4OFYA 1EH9A 1C16B 1IAII 3ARSA 3UYPA 5I15H 5JXAL 2EEDA 1OAQH 1QSFD 4GQ9L 4OLXL 3E3QE 5E7BA 5EU3A 2BNQD 3HZVA 1AIFB 4KUCF 1OP5H 1JE6A 3BPLB 3QUZC 4HPOH 3WFDL 1M7IA 2EH8L 2VABA 3RWIB 5FECB 1FZMB 4XWGH 4MNHA 5T1DH 5E8NB 4XP5L 2WANA 1YEFH 1MLBB 1HXMB 4RMUA 3S96B 1ZSDA 3ULSB 2UZXB 4Y5VA 1HI6B 3X13B 4XPAH 1IAIL 3BP6A 4L5FH 5GGRY 4XP6H 3BRDA 3MFGB 4DN4L 3DX7A 5F7HA 1NCAL 4JVWA 1EFXD 1Q0YH 5HHOB 2FO1A 1OAYL 1V05A 3KPLB 1YN7B 3O6LH 4PREB 2JIXD 1WWAX 3LRGA 1Z2KA 2XYCA 4Z7UB 1I8LC 4O2FA 2DKMA 1A9EA 3MRQA 2O5XL 4JGUA 2P24A 1R3JA 2UZIH 1J12A 3Q0HA 4HKJA 1A3LH 4MVBD 2DTMH 3EYVA 4G8FA 5EU4B 4ERSH 1U58B 2RGSA 4YX2L 5DWUH 5DD1L 3DOSA 4JPKH 4XPTH 1C1EL 1T03H 5HGHB 1YJDL 3F8UB 2W0FB 1HH9B 1WITA 2CIKB 2NXYD 4PJ8A 4P23A 5FO8A 3MPCA 2P48B 2CXKA 5L9DL 2CLVB 4QRPE 1FQ9C 4Y7MA 4LPCA 4EI5D 5CCKH 4HWEL 1INEL 1SQ2N 1WSST 2CMRH 1FL3A 1VHPA 1W0WB 1LHZA 4LSVH 5FF6A 5F9DC 5J7CC 4MD5B 3SGJA 3BHBA 4IDJH 5CILL 1EA9C 4XMPH 3E6FB 3WKNA 3EYQD 3J8F7 3SDCB 4NO2A 3BSZH 4OCWL 4QRPD 1NUNB 1T66D 2DF3A 3TZVC 2MPAH 1N64H 1SBSH 4G8EB 3MLTA 3BYYA 3BIAX 3RWEA 4PJCB 4RRPA 2QQLH 5J06A 2Z31C 3ISWA 2DQFA 2IQ9H 3LEXA 1FVEA 3UC0H 3SGDI 4OLYH 3GIZL 5C09E 4H88H 5F9WB 5I1CH 2AAVA 4GW1A 4MQXC 1CXEA 1NBVL 35C8L 4QXGL 4DZ8A 5BQ7A 1GYAA 1RHHB 1W8OA 3RWDB 4X4YA 2JJSA 3WE6A 4J8RA 2AEPL 3C2AL 4RZCB 4RWYL 3HC0A 5HDOA 1J8HB 2X1XR 5C09D 1BIIB 2HVJA 2NY2B 3FN0L 4X4XA 4IIQA 4POYA 3D0LB 5E1AB 4NM4H 1K9TA 1ACYH 4PJHA 5MHSE 1QFUL 1U8OB 3RGVC 2VLME 4F57H 5FCSH 2OSLA 4X9FA 4FTVB 3D0VB 1TVHB 2ARJB 1LO3L 1NEZB 1S3KL 3BGMB 4NIKB 3W2DH 5I19L 4LKXA 2F53E 2FO4A 5MHSD 1NAKH 1ZS8A 4H25B 2N1KA 3MLYL 3GSRB 1AGBA 1OT1A 2VLMD 5DI8B 2DQDH 1JK8A 1SJEB 4JY6A 3HA0A 3QWRA 3O6FA 1GPOH 4XZUB 1DEEB 1N5AA 4LCUB 1MY5A 3S34H 4JFFA 4NRYB 3NAAL 4O4YH 4CADA 3P9MA 1CS6A 4PJEB 2F53D 4KKNA 3VA6A 4YGVB 4YUEL 5DQ9A 4ZTPL 4K3EH 1KIUA 4KUZH 1QFPA 4WU5A 4NP4H 1D5IH 5TE4H 1ADQH 2B39A 1F2XK 1X5GA 5D6CA 1AGDB 3GRWL 5JW5A 3JTSA 3ARDA 1B0WA 5JXEA 1WZ1H 1U8LA 1FYHB 4F7PA 1JF1B 1KG0A 4HUUA 5EOCJ 5E6ZA 1DSFH 2FWOB 5SX5H 4K8RD 1CFQA 3L95B 1JNLH 3VFTA 2FX9H 5DEFA 5FUCC 3IAQA 2C3GA 5I74B 1QQDA 1CE1L 2HVKA 3AAZB 2VKWA 5F9OH 1FFNA 2ZCHH 1K3ZA 4OM0H 2GK0B 1JUFB 4NNXA 1BOGA 4Y88A 1LO5A 5D7LE 3TN0A 2V7HA 3WUWB 5IM7A 2DQTH 4MA7L 5EO9A 5HI3C 3VXNA 4NYLB 3U30C 4YE4H 5DFTA 2ADJA 1FZOA 4H20L 4HH9B 1KJ2H 3MMEA 3ALPA 5DK0A 3FT4A 3IDJB 1AQDA 1JGLH 3QIBD 4OZGF 3WS3B 2A0LC 3L5HA 5D71L 5D7LD 1KJ2B 4GS7B 1QFWM 1DQTA 1QTYT 2B1HL 4HC1H 4N68A 2Q7YB 4X6EA 3OJMB 4PGDA 1BF2A 4ZSOB 5EOCL 2IH3A 2VR4A 1XGYH 2GJ6B 4NJAH 2XZCH 3B3IA 1NMCC 3MUJA 5DVKA 3TJEH 1KXVC 4QHMA 3VFVB 1VB9A 4K23H 3MBXL 1VA9A 5K59F 2OJEB 4HJ0C 3IJYA 2XKUA 4HFWA 5HI5D 1SJXA 3NABH 5IKCA 2UWEA 3LQAL 3WN5B 3QH3A 3WBDA 2YD4A 5F7DA 5KN5A 1LVEA 4R7NA 2FB4L 5B39B 2ADFL 4FQQA 1MQ8A 3BZFB 2NY5H 5E2VH 3I6LE 5IESL 1GGBH 4XBGB 3GUTB 5EU6A 1F3JB 5TGBB 5IUSA 1DBML 1VGEL 3D9AH 3G6JB 1DN2A 1IM9D 4LVOC 4JJ5A 1EIBA 3BKML 5C07E 5AZ2L 3FB7B 1ETZB 3I6LD 3NCCB 3O3DB 2WLZA 3S37X 3QXDA 4KWUA 5CD5C 2R15A 1UM5L 1T22B 3H7BA 4OZ4A 4B53A 4BSJA 1N0XH 5JNYB 4PJBE 4IS6A 4P5MA 3U7WL 3OX8A 4DVRH 4YPGA 4HFUL 3BYTA 4JHAL 4KJQD 5C07D 4LVHC 1A6ZB 2K9UA 3MRNB 4P46B 3GHEL 1FIGL 5B38B 4Z7OF 3GNMH 2XNAA 4M5YH 1CZ8L 1K2DB 1UJ3B 3LN5B 1EEYA 2VLJE 5J6HB 4G9FB 3TBVB 3ZT7A 4ZG1A 1JWMA 1TIUA 3UAJC 4L9LA 5C8JB 2AVGA 3C5ZD 2A74B 5I73B 4PRBA 2QEJA 1EHAA 3FONB 4RISH 4BKLB 2PCPB 4OF7A 2IADB 2XT1B 2VLJD 3FB5B 1KJVA 3LIZL 1U3HD 3QB7C 5E8DL 1PD6A 1ED3B 5C0GA 1YY9C 1LMKA 3KLAB 3V8OA 4G6KL 4RA3A 5LCVL 4ZQKB 1Q72L 3LS5L 3QI9B 2XTLA 4ZPTA 2ZSVA 3G5YA 3U9PH 4HJJL 4HLZG 1EGJH 1N6VA 1H3VA 4HAGA 4X7TB 4ENED 2BY0A 2HT4C 5C08E 3MUGB 3JWOL 4KJPC 2VDNL 4UIKL 3CU7A 4Z5RA 3LKPA 4I3SH 1VFOA 4XCNB 3P4LA 4X6BA 1MFNA 4PJXF 5DYOA 3GI9H 1DL7L 3QJHA 4QTIL 5LGJA 3HZYA 4X98A 4LSRL 4YHOL 5C08D 1JV5B 3U46B 2HN7A 2NW2A 4N0CC 4BH8B 1U8JB 1BBDL 3OAYH 2CUMA 2GCYB 4N0UE 2A6JA 1OT2A 3BJLA 1DVFD 4IM8A 2IPKA 1IMHC 2EDOA 4XP9H 2P7TA 5D2NA 5I76A 1DN0B 4NO0A 2ZKHH 5HYSA 2WQRA 4LLVA 1FO0H 5FGSA 4WUKH 2ICES 4JO1H 4XVTH 4MXWL 1FO0B 3U79A 3QHFL 2OZ4L 3P11L 1FORH 5L2JA 4YDKL 3V0VB 1DBBH 3P0YL 4U6VH 1MJ7H 1KCVH 1V7NL 3DETD 1NFIA 3HAEG 1IGIL 4R2GC 1YNKH 2VDLH 5J12C 3O2DL 4PJDF 2AI0H 2BSED 2AJZA 1PEZA 3OSKA 2CK0H 2FRGP 1TQCC 2LQRA 1D6VL 1G1CA 4Q2ZA 3QIUA 3JWNC 1A4JA 2BHUA 3IGAA 3IDIB 3IS0X 2C3XA 3S98A 5JQ6L 3RVUC 3HE7D 4GAGH 4Y0GA 1EHNA 3KNBA 4ZD3L 1IC1A 2R2BA 4HZAA 3UX9B 3RVWC 3QXAB 1V8HA 2A6DA 5DC0A 1LO4L 5EBLA 1OAZH 1D9KD 1XCQA 4LSQL 5LXGL 1T1WA 5SWZA 1MIEL 3SKNA 4HIEB 3ARDC 4YBQD 1B4RA 3EHBD 3W11C 5IJKC 5FKAB 1TPXB 3MLZL 1UT9A 4A6YH 3RDTD 2XQYK 4OLWL 3WFHB 5CLWA 2VN4A 4PYHA 2B2XH 1NFDA 5BVJB 2OR8A 4A6YB 3D39B 4EOWH 1JNHA 1RV6X 4UV4H 4EDXA 3VGEA 4UMGA 2F5BH 1UWEL 4WTXA 4JO2H 1SMOA 3DSFH 1QLEH 2FHBA 1NAMA 4PP1C 4UAOB 3Q6GL 4QYOA 5B4MC 5JIIA 4S2SB 3PWNB 3IJHA 5K9JL 4FQ1L 3TN0C 4Y5YB 1K5NB 4MJIB 5D1ZA 3RVTC 3DRTB 3BFOA 3X3FH 1LEKB 4LSSL 4JZNA 5J57B 3VD7A 3QULA 1KT2B 2CO7B 2W0LA 3OF6A 1AQKL 1S9KC 2AK4A 4PJAA 4H8WH 2NYYC 4LNVA 3VXUE 4QT5B 4XVSH 2R2HB 3RNKA 2AJXL 4M8QB 3AREB 3B8SA 4XCYB 2KDGA 2QHLA 3IS1X 2FEDC 2J3SA 1BVLB 4I77L 4XCCH 5FGBA 4EIZC 3WFBH 5LKNA 3O6ML 5FHAL 3C8KB 3WIHA 1I8MB 3VXUD 2BNQB 3MRPA 4TOYH 2VZSA 1GOFA 3B2VL 4HW6A 1MCLA 4OFIA 4KRPC 4PY8J 5D7IE 4MLIA 4LAQH 4HQQH 4R9HA 3SHSA 3N1FC 5T3ZH 5DD5H 5IHUH 4KHTL 4JGMA 4UILL 1NGQL 3QNZB 1F45A 1YEHH 4A2LA 2LABA 4IJ3B 3B9KB 4M61A 3EGSA 1CFVH 1OAKL 4PY8I 1T0MB 5EC2A 1S9VA 3TIDB 5I0ZA 4KQ4H 4KVCL 1OGAB 2WP3T 1NUGA 3MRCB 4RAVA 4FQLL 4HCRH 3BKCH 3NIDF 5DD3H 1MLCA 5D2LB 4KK6C 3MLRL 4L4VB 3IFOA 2PR4L 2UVEA 2GITA 4Z6AT 3HLAA 1I1YA 4HGKC 2NY0C 5E2UL 5K93A 4YHNB 3WFCH 5F1NB 1T20B 1CBVH 5AYUH 3C6LC 3RRQA 1CIDA 1ZVSB 1YNTA 4M4RA 3LEYL 3QEQE 2H3NB 4R97C 5HVHB 5DJAA 1F4AA 1GIGL 2YA0A 2R0LL 5C86A 1YEGL 1KBGH 2B5IB 4L9LC 4WNQB 1WZKA 4WRLA 5ADPH 4BFGA 3T3PE 3DGGA 3KPSE 4FABH 1KCSH 4FHBD 1SYVB 4HIIA 5F88B 4YHMH 3QYCA 2OR9L 5L88L 1B0GA 3QEQD 3F12A 5C3TA 1H0DB 1BZ9A 2VZ3A 4RFOH 3HI1A 3LCYA 3N1QC 3BRFA 1YEIL 3KPSD 3U0PA 3RUGE 4BELD 1AD9B 2EDTA 5I8CB 3TNNB 4EKXA 2DIAA 2P8LB 3LSOB 3FOLB 5TFSL 5HYFA 2AJYL 1KUMA 4F9LA 4CU7A 3UBXG 3FO9B 4ZFOA 4HIJB 3NGBB 3ILQC 3PWUB 5F7NC 2QKIB 2CJUL 4C59B 4GKSA 5KS9F 3V7MA 2NY1D 4LSPL 4WUUE 3Q1SL 1H8NA 4NZTL 5B8CB 3MRDB 4QHUA 2BOCB 2A83A 4AYFA 4L8DB 1CGSL 2P4AB 2FLBT 2R23B 3D69A 2G60L 4XNUL 5ICYA 4MA3A 3DYPA 3RKDC 5E99H 5I1IH 2BXYA 3T77A 4OLEA 4WUUD 3VXPA 4MA8H 5GSVB 3UXFA 1KCKA 4LU5L 1OM3L 5FB8A 5D96C 4ZXBC 1BD2A 4JFQA 3JWDL 1T1XB 1MCSA 2X6MA 1D5MA 3DVIA 2CGRH 4BQ9A 2J88H 1NGXB 5C0FA 2Y07L 3QWOB 2IAMA 4QHNA 4J23A 1KOAA 5IGXH 1N4XH 4LLWA 3N0PB 2CRMA 3HCVA 3W39B 1PG7X 2NZIA 3CFJA 5DSCB 1RPQA 2EDNA 2LFGA 4Q6IB 1C5DA 3EDJA 1J88A 3MRGA 4C56E 4Z78A 3S3PA 5C0EB 5EIVA 3C2SA 1EFXA 4OB5L 1WK0A 1FFPB 2AJVH 1MCOH 5ITFA 1WFUA 4Z0BL 5MERB 5FA3B 3NH7H 1YPZA 5GS2D 1ZVYA 4E41B 4XPHH 1YECL 4C56D 1MREL 1QBAA 2DM4A 2B8OT 1Q9WA 3QG7H 3OKEA 3S5LA 1CDJA 1EAPB 1ZANL 4TTDC 4CNIA 4K7PY 3F58L 3PGCA 2WUCH 4C58B 3ARBD 5CGMA 3P4OA 2X4SB 5EU7E 5D5MA 4JDZB 5IBLD 4YWGL 1KCLA 1KLUA 4PV9B 3ZDYE 1HHJB 3UTZA 2DLGA 4JHBA 1VGKA 1VDGA 1FFQA 4GUPA 1J05B 1MIML 1PKQE 5TDOA 5I66A 1J87A 5JPMA 2VLRE 2HJFB 2FECI 4MJ2A 3S3JA 3AC0A 2F9BT 2H2PD 3IFLL 5I2IB 3DVNA 3TNMB 2EC8A 3IFPB 4GAYB 4L3EB 3DI3B 4I9WE 1XGPB 4Y4HA 5DC9B 2A6IB 3MV01 1MHEB 1VESA 3MYJA 5DR5L 5KG9A 3N9GL 3ZKSD 3OR6B 3OXRA 3EOAA 4O51A 1IGMH 2VLRD 2C1PB 5ICZA 2B7DT 2DMKA 4U1KB 1UB6B 5ENWB 3VRLE 5D1ZC 4I9WD 2FJGA 4QOKA 3WNLA 4I2XE 4F8QA 2IALB 5GGTA 2Q6WA 5TPWH 2FECL 1AXTH 1A0QH 1RZGB 5C7XH 4Q0XL 2M8XA 5C0BE 2JJWA 1MPAL 3C5SA 3R1GH 3L3JB 1N26A 4M03A 5IBTL 1YQ2A 4U6YA 2DQHH 4OD3L 1UXWB 5EO0A 3DBXB 1FC2D 4KHXH 5CGYC 2C3VA 3LKQB 2EE3A 3I6KA 2OL3L 4HSQA 4XMKH 4KKAD 3EFFA 25C8L 4X6DA 5C0BD 2WWMD 4LPVA 3BE1H 4M6OL 3VFWA 2QV2A 4ORZC 4JM4L 1RZ7L 5D1QB 4C4KT 4XNXH 1QLFB 2UV3A 4JDTH 4KKBC 3EZ8A 1HHHB 2JB6B 1YEDB 4JRYE 4KPHH 1Q0XL 3HPLA 2BJML 3QZWB 4DKEH 5HGDB 2ILLA 1OAXH 3GMRB 3I75A 3CK0L 5D4QA 1J1XH 2JCCE 4U1HA 1CFTA 1CXHA 1MCJA 2D0HA 4OSUL 4R8WL 2HMID 1X5XA 2KL6A 1KTDA 5C2BL 4FFVC 4JRYD 4P9HH 4QRSA 2IANE 2DJ4A 2VQTA 1IEHA 4Y2OA 1HYSC 2J2ZA 4OZHE 4G7YL 4HUWB 5GS1C 1S7QB 3IU3B 1RULL 4Z77A 2VJXA 4ZODA 3MRMB 4L8CB 1S7SA 1IAIH 3KLSA 1MCIA 3CFDB 1YYLH 3WDIA 2CDEA 3STLA 5HHNA 3ROOB 4DFHA 3SE4A 3SKOB 5FA4B 3GHBL 4KXZI 1W72A 3WIIL 2IAND 5SX4I 9CGTA 1NCAH 4RIRB 5C07B 1TTGA 5HPMB 4X99B 5EZJA 3W81A 2AV7A 4P2RA 4TVSa 5JW3L 4JB9H 1MVFA 5HGAA 3VXSE 5IEKA 5IR1A 3P40A 5FHBL 2VL5B 5KVEH 5EA0H 1FV1A 4WFEE 1A1MA 4HUKB 4L8SA 1HDMB 1UFUA 1CICA 3QUYC 1JZ4A 4X9HA 2P8PB 3VXSD 5A3ID 4EN3D 4JRXA 4XAWH 3OJDA 1E4XL 4OJFL 4HS6A 1FVDA 4WFED 1YEEL 1FH5L 4RGMC 3QNYB 5FCUH 1U8KB 3BN9C 4YFDB 5BXFA 4HWEH 2Q76B 1TTUA 3E2HC 2RQ8A 3FN3A 1I8KA 5IIEA 1SY6H 2ZUYA 5FYJE 3VWJA 1GGCL 2EE6A 1M05A 4AM0B 4GAJH 2X05A 3EO9L 4MSWB 1IQDA 1BFOA 5E2WL 4XB7A 3QIBA 5CLTA 4H1LH 2FD6H 4YIQB 2H41A 3QUMH 1HSBA 2IBBA 2X70B 4BZ1H 2PYFA 1JI1A 4I5BA 4Z7VF 2FHFA 5FYJD 1YC7A 4H1LB 4Z7WF 2EKSA 2V7NB 2YPVL 1YNLL 3NIFE 4PJFA 1R24B 4PJHF 4NC2B 5DJDB 4UT9L 4K55A 3X11A 4DZBA 4G6JH 1XEDA 5A2IH 2J4WL 4TYUA 1QEWA 4HZLB 2FJHB 3RVVD 4LCCB 3K0WA 5JA9A 1B2WL 5E56A 3O11B 1DVFB 4LCIH 2J8UA 1XZ0B 5E5MA 4HUXA 4Y2DA 1AC0A 3MRHB 4ZDHB 2ZCLL 2WBJA 1MNUL 5F21B 3OQ3B 5DUMH 3LKSA 5E2JA 4HEME 5E7FA 3SKJL 1MHHA 4N0UB 3X17A 4S1DD 3VI4E 3SGDH 1ES0B 1P84K 2H6PA 2YKLL 3DIFB 4HWNA 4WW1A 4EBQL 3U2SB 1BFVL 4YDIL 3EFDL 3TO4D 2HLFC 4Y5XC 1NKRA 1HEZA 1QFUH 1FL5A 2GK2A 2FBJH 3REWA 4M1DH 4ZUWB 1PSKH 4HDIA 4NBZB 1JN6A 2V9RA 4YDJA 2AJSL 1MCWW 3WXWH 5TF1L 3DVGB 4U6XA 5E8EB 2R2CA 1OB1A 3MA7A 3MREA 3ZSTA 4PY7B 4Y4FD 1A6VL 2DMCA 1SEBB 5SWSE 3TBTA 4EIGB 1MI5A 3EJZD 1TQBB 3SDXA 4MXVE 5C71A 4RAUB 4PJBA 5GRVL 4Y89A 1NDMA 4YO0A 1BAFL 5DMYA 1WEJL 1JFQH 2QADC 3MLXH 4GQPH 3SOBL 4JPIB 4MCYB 2VQUA 1A6TB 3D3VE 3DX6B 5CEYA 43C9A 5SWSD 3IVKB 4KQ3L 3EKCA 4NZRH 3MJGX 4M6NL 3VXTB 2V17H 5D7SL 43CAB 2VLJA 3MLSL 1MCWM 1DBKH 4TSAL 5ADOL 5CD3B 5DZOA 4PRIB 3U4EB 3S8WA 1QHPA 5DHVH 3O9WD 1XH3A 2IQAA 3OGOE 3D3VD 3TA3C 3HE6D 2OQJA 4MNQA 1IL1A 1J0ZA 1A9BB 5DHVB 1KFAL 1R5IB 4FQ2L 1CLZL 1A22B 2AK1L 2EDEA 4PIRF 1YEKL 1UH2A 5HHXL 3HR5A 3NFNB 1CDUA 4X7EC 4UTBH 5AZEH 4P3DA 1W2KT 1TENA 4HJGA 2D03H 1CE1H 4DKFL 2VO5A 3MO1A 1KACB 4NPYA 3OAZH 2ESVB 3ILPA 3VFPA 1VKXA 1QRNB 4KK8C 2LV4A 5DRZA 2HFFB 3MFFB 4LHUD 4R26H 2LVEA 3TIEB 4UV7L 4AT6B 5C9JB 1X7QA 1U91A 2FL5B 1I4FA 1GC1H 1RUQL 2UWEF 3GSUB 3HUJE 1ZAGA 3MNZB 4DEPB 1NGZA 4UOW0 1H5BC 3VXME 3CPLA 3LS4L 4KTYA 4F7TB 4H20H 2VXQL 2GTWA 3KXFE 4KDWA 3PNWB 4OUUB 2D0GA 5D71H 5DDHB 3SDAD 3BP4B 3D2UD 3NACL 4U1NB 5KSBF 3IDMB 5EOCH 3TO2A 3VXMD 4X7FC 2XG5A 1EEUA 2C1OB 3KXFD 3SQOH 2Q87A 3WEXB 1UH3A 1U8IA 1G9EA 1WC7A 2Z0BA 5D1XA 3DMMB 4PB9L 1LO0L 4NCC2 3ZKND 1OSZB 4AH2B 3JXAA 1DUZB 5KSAC 3S3SA 2G9HA 1HSAB 4RMQA 4WV1A 5DRXB 3F6LA 1FNGA 5AD0B 5JHLL 2IBGA 3KJ4C 3KYKH 5DHXB 1P4IH 2X4RA 2EXYC 5FOBB 5D7JB 5KBNC 1JF6A 4I18C 5I9QB 4CN6A 1X5HA 5L2KB 5EWIL 3OG4B 1M4KA 5IF0B 3C60B 4XNQA 5DA0B 5IVZA 1ZEAL 4ZAKD 4GKOA 4ZUSB 1I1RA 2YPLB 1D9KA 3GSNH 4FN0A 3H9ZA 2WIIB 3MV8A 3QO0B 5A16B 5E5UB 3OKNA 4WEBH 1MCNA 4RMSA 4S1QH 3BDBA 3W9DB 4JM2B 2PF6A 3AMLA 4P5TD 2AABH 1TJGH 2WWKT 1DANT 2VYRE 1NSNH 3T2NL 1A02N 2VR5A 4NHCL 2ADGA 4NO5A 3DECA 4MAYB 1T80A 1MF2H 4RGNC 3OHXB 2GJJA 3QO1A 5IQ9A 5JDSB 4OZIF 4GG6A 5MP6H 1A8JH 1QKZH 3O3AB 4K7PL 5GGUB 2QSVA 3NBNA 2R39A 2IG2L 3MUY1 1R3KA 3GK8H 4G7VH 1DQML 3NN8A 1AP2A 3LIZH 1EEQA 3O3EA 1H8OA 3WCYA 4QCIB 4AMKL 2XPGA 3QDJA 3FO1A 1C16A 4GMTH 1A7RH 4GG8B 5L7XH 2OI9B 2EC9U 5JOFA 3SCMB 1DZBA 2NY1B 2CO6B 5EN2B 3VGAB 5DRWB 3GMOA 1G9NC 3V0WL 4X80L 1JPFA 2ZOKB 5E8NA 2ICWJ 1MLBA 1TCRA 1IAKA 4UIKH 3MBEA 2BSRB 4LDLB 3MJ9H 3ULSA 3FCTA 3UJTH 1PDKA 3X13A 2X7LB 2AERT 2GAZB 3NCJL 3PL6B 4LSRH 2XZQH 5E24E 3CVHH 2DRUA 4TUOB 2ICWI 5HHOA 4JE4B 1UYWH 3MGOB 4OFDA 3KPLA 3ESVF 3O0RL 1BBDH 4PREA 5IB4B 1GGIL 5JR1L 3CVHB 3H2WA 5E6YA 1P5UA 1T7ZA 1A7OH 4OCRL 1H8SA 4I8DA 4GKZA 2X09A 1TJHL 1JYVA 2EH7H 1GAFL 5DHYB 1YEJL 5D72L 3FOMB 3H3BC 5ANME 3O6KH 3VG0L 1PKOA 3RHWF 1NC4A 1I3UA 5HGHA 4RA0C 1I1AD 5GS2H 5GGSB 4PRAB 3EYOB 4LRIA 2OZ4H 2OK0L 1JGUH 3QRGH 2CIKA 1W0VB 3K7UA 1SM3L 3FT2A 3L9RB 5T1KD 1C12A 2EYRB 5E2TH 4OGXL 4C56B 4XNYL 4M9PA 2CLVA 3BVNA 4FFZL 4W81A 1X6LA 2WINB 1AD0A 2YA1A 3UJIH 3I3DA 1TVDA 5E6IC 1QBLL 2LAGB 5JQ6H 3MRRA 3M1BB 5FO7B 3FT3B 4KDVA 1L6XA 3OKLB 3SDCA 3WUWG 3B43A 2YR3A 4IRSC 3QUKA 5IB3A 5I18L 3MXWH 4RMVA 3EZJB 5DT1L 3WSQL 1MCRA 1MHPH 3WD5H 1FGVH 5T33L 4O2EA 3HC3H 2LTQC 2COQA 3TCXA 5GGRB 3WFEL 2MQ3A 2XWTB 3DXAB 3K4AA 2W0KA 3C6SB 2J1KA 1PKQB 4GOSA 1MFAH 3SDDC 4U0RC 2CUIA 5MEPB 1RHHA 3RWDA 5KVDL 1I9IL 1H3XA 5EO1A 3B9EA 5C0NC 2NY4D 4JG0H 1KELL 1BIIA 4NC1E 2Q86B 3L1OL 5HYSG 2JB5L 1OTSC 1HQRB 3SJVB 3TT1L 5DGQA 5K9JH 4OAWA 4FQ1H 5E1AA 3H42L 3ZE0E 1SJHA 1TLKA 4GRWE 1U8OA 3BGFB 1MEXH 3A6BH 1DFBL 4N5ED 5KZCD 3T1WA 4QO1A 3LQMA 6FABH 4FTVA 4ODUA 1TVHA 4R90L 3FQWB 4FG6D 2ARJA 2BMKA 1RZKC 3O45A 1NEZA 3G04A 1KIPA 8FABB 3DX9B 3H3KA 3G9AB 4H25A 3IDXL 5J11C 3GSRA 5DI8A 2ZNWA 2F19L 2B0SH 5JOEA 2HKFL 2VXTH 1SJEA 4F7MA 3MCKA 3NPSB 1JPST 4UI2A 4XZUA 1DEEA 2IGFL 4LCUA 3V6BR 4XX1E 4ZS7H 3O6MH 5FHAH 4NRYA 5F7MC 3FZUC 4PJEA 5B38G 2JELH 5TQ0L 3GJEB 1MRDL 3B2VH 5BO1H 3OXSB 1G7IB 1T7YA 1IC5H 4KI5F 3OL2A 4WHCA 3BISA 1G7LA 3RPIA 1KENL 3LKNA 4UIMB 3K3QA 3RGVB 4N1EA 2VDRL 3ARZA 5T1LB 3TPUB 1ADQA 2V5RA 5TE7L 2NZ9C 5L0QB 5E08L 3MA9L 2VSDA 3LV3B 2XFXB 1JF1A 1YMMB 5TQ2H 1S7UA 2VAAB 2X4UB 1LP9B 3P0VH 2D7PA 1GZQB 4RMWA 2FWOA 3WJLA 4JZJA 4I13B 4M1CC 4X6CE 2HH0H 1UWGH 2L0DA 3L95A 2BC4B 3BDYH 3MLRH 2XZAL 2VLKE 5BMFL 1CD1B 4X5WB 4O58H 2YD5A 2R69L 4YHKL 3DSNA 4LMQI 2GK0A 1JUFA 4WWKB 4CMHC 3T1FB 4FNLL 2YSSB 2KBGA 3RBSA 1HQ4B 3CXDH 4F7EB 4LARH 4CVUA 2NY3D 4PJ7E 4G5ZH 2VLKD 1GIGH 1EPFA 2VDQL 3UBXI 1JZ3A 4U6HA 3FB8B 1UADC 5E8PB 4HH9A 3VWKA 3WV0A 1K6QL 3S7GA 4AEHL 1KCRL 1AFVH 5ISZB 1FAIH 2OR9H 2HWZH 3SY0B 4ZSOA 5JDJA 5BCAA 3VXRE 1RIHH 2GJ6A 1IC7L 3S4SA 3PQYB 1P84J 4G42B 1DEDA 4G6MH 3BW9A 3UROR 2OJEA 5DK2B 1A1NA 4FQXA 2W92A 3WN5A 5HHMB 5FYJH 2QQNH 3V9FA 1WAAA 5C3LD 2DIJA 4Z95H 3BO8A 2DQUL 5B39A 1BF8A 3VXRD 4OQTL 1AXIB 3B83A 1HWGB 3BZFA 5EZIL 2PO6C 3WS6C 3U30B 2RFXB 1MFEH 2CH8A 3GUTA 1F3JA 1BQSA 3G5ZB 1KTLB 3H6JA 4YFLF 5IB2A 4PLKD 2R8SL 3Q1SH 5EORH 1VFBB 3G6JA 2CIIB 1IVLA 4G6FD 4OD1L 3ZTNL 1QNZL 3TLRA 4CW1B 1MHCB 2P1YA 1ZHNB 3EUUA 3O3DA 5KVGH 1MCFA 4HIXL 5E9DE 2DB8A 1T22A 1NMCB 1CWVA 3I50H 5EZLB 2YUZA 2R0WL 4FQCH 5JNYA 4QWWC 4TPRH 1K3IA 1CXLA 2H26B 4WTWA 2MKLC 1A6ZA 3I2CH 2VE6B 3MRNA 5ESQB 3K4ZA 5E9DD 4YBLC 4P46A 4ZNEE 1IGFH 3UZEA 5J6GA 1K2DA 1UJ3A 3LN5A 4WO4D 4NUGH 1HILB 3V7AE 3TBVA 3B2UC 2P42B 4P4KA 2AEQH 2ARWA 3AU1B 4D9LH 3EAKA 1A6UH 3FONA 4BKLA 1ZA6A 2IADA 2DYPD 3FB5A 1LDSA 1WIOA 4BH7A 2YUXA 1DCLA 4JEGB 4I0PD 4PRHE 5B3JE 5D6DA 3ARGA 1J0HA 32C2B 4F37F 3KLAA 5I1JL 1UM6L 3WDJA 4ZQKA 4X4MA 4EJ1C 3G6DL 5ETUB 1N3NA 4PUBL 2A77L 1IBGH 4LVHB 1II4E 4EQ2A 2Y7QB 1PG7W 2KUTA 4QY8B 3F58H 4JR9H 3BD3A 4PRHD 4XBEH 1ZLUK 3UTSB 1LD9B 3P73A 4NGHL 4X7TA 1A4KB 2PYEE 4J6RH 3KG5A 1LDPL 5L8JB 3MUGA 1EGJA 4UUJB 4M48H 4L4JA 4I48A 4U4BA 4RFEB 3VE0A 4XCNA 4GW4A 3OKKB 2FSEB 3FRUB 4OCYL 1F4HA 3O4LB 3MLPA 3MRFB 1Q1JH 3BGAA 2CLRB 2PYED 3DROB 1TDQA 3M45A 2C7UB 3U46A 5AEAA 3QCTH 2V9TA 2ZJSH 4BH8A 4Y16D 4PJ9D 3ZTJH 5BS0E 2RR3A 1LO2H 2NY2C 2D7OA 3A6CL 3IAGC 1KULA 4PG2A 4S1SH 4M7JH 3UPRB 4X6DF 4PJXE 1G9NL 1VERA 3IDNB 5HJ3A 4MCZB 2CD0A 1DN0A 4NKOB 2R9HC 4J4PA 3AXLB 1U8MB 2F58H 4LIQL 4G9DB 4P2OD 2MQ0A 4YHPB 5EIQA 4BZ2H 5BS0D 4P59L 5HGBB 3TV3H 5BZWB 1OP9A 1FO0A 1TMCB 3HHRB 2YMXL 1FNAA 15C8L 4NQXB 4N90E 4G8GB 3P9WB 4L4TE 5MEOB 4NM8L 4XBPB 1AJ7H 4UNVA 5I1AB 1I9RL 1XF3B 5DC4B 3C09B 3VXMB 3KPMA 1OARL 4J3TA 2OL3B 3KR3H 3KXFB 4ZS6D 4GXVH 4HHAB 1QYGH 3NVQA 4N90D 2JJTC 2GKIA 5H94B 4L4TD 3ARTA 3TO4A 3B8YA 1A3QA 3RHWK 4AEEA 3WO4C 5CWSB 2BJMH 2VQ1B 1JHTB 4CVXA 2W38A 5MEQB 4YC2B 3SE8H 2A9NL 1RZJH 4GRLA 5CINL 1FL6A 5JPNB 1JBJA 2FATH 3WYRA 1OW0A 3MOQA 1I7RB 1RIUH 3V6OA 1XGTB 4K3DH 2QSTA 4R2GB 3HNVL 3RZCD 5J12B 2Y72A 3P4NB 4ZAKB 3WJLC 4H0GA 3TVMB 5BVJA 4U3HA 4PGBB 4O5LH 3NCBB 2R29H 1J18A 4CBPA 5H2BA 4XB8A 5I74C 1YZZA 3MOBL 3CFCH 4R7DB 4V1DB 3GHBH 5K9QI 3OKDB 4S2SA 3PWNA 4HS3B 3QUXD 2OS7A 3LH2L 3DUSA 5F6IB 5I30H 3W0WB 1WCBB 4XC1L 4Y5YA 4D2NA 1ZHBB 1EEZB 1LEKA 3TYGL 4ZUTA 1S9YB 5CJQH 3B9DA 4HK3J 4ELKA 2W9LA 4IRJD 4GW5B 5FHBH 3TF7C 2R0ZL 2E9JA 1BMGA 4DJMA 2DLIA 3FFDB 4JKPL 4KGJA 5EPMB 2HRPH 2WBKA 3QFJA 1CK0L 4QT5A 1FN4A 4GS7C 3F6IA 2DJSA 4KXZH 3AREA 4MNGB 2Y5EA 5SX4H 4YZFE 1V3JA 3V4VL 1MCEA 1BVLA 1CU4L 5ESVB 4JPVL 4LMQE 3C8KA 4LHUA 2YD9A 5JHDE 3G08A 3LMJH 4BFIA 1FYTE 2PW2A 2OYPA 3VRIB 1I9EA 4Q9QH 1KB5A 3FHAA 5F1OB 5B3NA 1AGFB 1D6EB 1GGCH 4JFDE 5DD0H 2GHWB 4HKZA 1KJMA 4QKXB 1IEAB 1RZKL 1A6WL 1P7QB 1OTUC 4BQ8A 5JHDD 3QNZA 4NO3A 2NY5C 1SYSB 3UO1H 1FYTD 3SDAA 5K9OA 3D2UA 3B9KA 4KTDL 4Y4KC 3CVIH 3QUZD 2Y36L 3TIDA 2BVPA 4JFDD 1YNLH 1CFNB 4BYHA 2R56L 4EUPG 3FAWA 3K2UL 3O8XB 2P8MA 1L0YA 2GW5A 5TE6H 4EQ3A 3NPZB 5D2LA 3MQIA 4I0CC 4ODVL 4L4VA 1ZLVH 1UCBL 1IARB 2X40A 4HCRA 4PGEB 2YA2A 1WTLA 3F7VB 4ODWB 3ES6A 3SQBA 1MWAA 4YHNA 4XXDA 4KRPB 4PV8B 1T20A 3TYFB 4XPBH 1U2CA 1A21A 1UB5B 4R4FH 1I85C 3LPFA 3T09A 2DM7A 4MYWB 5E5RB 4OFVA 6CGTA 4LSUH 4PJBF 3ZE2E 4WNQA 2BVUA 5T1KB 2X1OA 3OGCA 3CLEH 1T89C 4RBPK 5LQBL 5F88A 4M9OA 5HHPA 2APBA 5IBUB 4CKVX 4LPUA 4WI9A 1XF4B 2BVQB 3QISA 4POZC 2NR6C 4MA1B 4NWUH 2PW1B 1CDIA 3QHZH 1GHFL 4P5TA 4N1HB 3C08H 5BW7C 1RK0A 3GSXB 5LBSH 3BEVB 3QI9C 4HGWB 1QA9A 5H37G 5GISL 2NY0B 1AD9A 5I8CA 1R3IH 3TNNA 1Z5LA 1K8DA 2P8LA 3FOLA 1DBAL 3SE3C 3C6LB 3BEWB 4WCYH 1MCPL 4OCMC 3IRPX 1B0RA 5DJZB 4R97B 4ZFZB 2H32H 3FO9A 5FUOH 4JFXA 3T0AA 1CLYH 2H32B 2IBZY 2XV6B 5I1HL 3MRDA 2BOCA 3TZVD 3A67H 4L8DA 4TSBL 4TSAH 3R4DA 3V5DA 5HD8C 2FEEI 5ITBH 2GSGB 3LVEA 3EOTH 3UJJH 5IMLB 5I15L 4HWBH 1XF5B 1EBPA 1OAQL 1YQVL 4FQ2H 3DGCR 2ADIB 2G5BB 1AR2A 1NC2A 1BJ1J 3T08A 5HHXH 1EV2E 1F13A 3BZ4B 1RJZA 3OB8A 1NGXA 4XWGL 3LAFA 3QWOA 1CGVA 5T1DL 5GPRA 1NDGB 4LGRB 3W39A 3ARFC 5DSCA 5E1HB 5J9PB 3IETA 4GRWH 5C0CE 4Q6IA 4P48A 4JFYB 4XPAL 1WZMA 4L5FL 4A2MA 4XVUD 1BLNB 1CQYA 4XP6L 1RUQH 1OHQA 3FN9A 1I1CA 1Q0YL 3T0EB 3ZDXE 4Z18A 4K7PX 4X8JB 2BFVH 3MRIB 3O6LL 4OQ1A 2XN9E 5C0CD 4IMKA 4E41A 4KI5C 1KGCE 1MCKA 2UZIL 3DYMA 3CUPB 1JRHI 1A3LL 5CJXA 2DTML 1JWUB 5AAMA 3MV9B 3BUTA 4U1JB 4ERSL 1I1AA 1WWWX 5DWUL 1B3JA 4XPTL 4JPKL 1PZ5B 1T03L 2XN9D 2X4SA 1AO7A 4U31A 2ATKB 4ZTOH 4JDZA 1O7SA 4PB9H 1KGCD 1P2CB 1LO0H 2YUWA 3G5VB 4PV9A 1OF2B 4WFFE 2E8YA 5DMGC 1KEGH 1PQZB 2UYLB 2Y5TA 3ARXA 4QRRE 3B6SB 3VFNB 2HJFA 5CCKL 4F37K 1FZJB 3TNMA 1CD0A 3NZHL 1G6RH 3IFPA 2VLLB 4GAYA 4L3EA 4X5LA 4LSVL 5JZ7C 1XGPA 1HXYB 3BIKB 4IDJL 4WFFD 4XMPL 2E27H 5EWIH 3EYUH 4M4PA 4UAOC 3BSZL 4QRRD 4WIQA 3JV4B 3FQUB 4HUMB 1A7PH 2C1PA 5DFVD 4U1KA 3H9SB 3BQUD 5ENWA 1N59B 1N64L 1SBSL 2PXYC 2QQLL 5F8RC 3IB4A 4LASH 4OF0A 4EXPX 5IFAH 1MH5B 2IQ9L 3UC0L 4PTTB 1RZGA 1WT5C 4OLYL 3HMXH 2VZUA 4H88L 4N0RA 1UXWA 4FQPA 1WBXB 3JVGA 3LB6C 4XMLH 1CL7I 2JJUA 2P5WB 3VH8G 3AREC 3FO2B 4WJ5B 4H8WC 1ZT1B 4LCWE 3U9UB 1BVKB 5DJ6B 1VFUA 3X3GH 1PX4A 3SKMB 2X1WL 2BY3A 1LWRA 2F54B 4PFEA 5D1QA 2IG2H 2W9DH 3KYOB 1VPOH 4DVBA 1RU9H 3VXQB 1HHHA 1UKSA 4LCWD 2JB6A 4NM4L 1ACYL 2BCKB 1WJ3A 5I1LB 5I71C 3D85B 4F57L 5HBBA 4OFYD 3QZWA 3DV6B 4GMSH 3WNMA 3L3HA 3GMRA 4JQIH 3T8XA 1KPUB 4OZGB 4IJ3C 1A5FH 2ZG3A 4ODSH 3W2DL 2F5AL 3R0MA 2WBWB 1HKLH 5IG7B 1FLTX 3ELAT 5D7IF 4R96A 4R6UA 2DQDL 3HNTH 4HUWA 1GPOL 1X5YA 3IU3A 4KKLC 3MV7B 3BESR 3MRMA 3S34L 3KPQB 4O4YL 1F11B 3VGFA 3ROOA 3SKOA 5FA4A 3GSVB 3O2VH 1VEPA 4RIRA 4JY5H 2IFGA 4K3EL 2HRLA 3EOYG 1D5IL 5TE4L 4U1LA 1XGRB 1XGUB 1KNOB 2NXYC 1TJHH 1Z9LA 5EU5A 2VL5A 2FCBA 1YEJH 1PVHA 3TH4T 5KVFH 1HDMA 2D7QA 5GZOD 3HAEH 2P8PA 5F6HI 1HZHH 4K7FB 3BH9A 3HAEB 2FX9L 1ONQB 2Z8SA 2BNRB 2FLRT 3EYQC 4PJ8D 4XNYH 4P23D 1AHWC 2ICWB 3BP7B 5I1EH 3JV5A 3T3PF 3KS0J 1K4CB 1T66C 1U8KA 4LLDB 4KDTC 5F9OL 2ZCHL 1EDQA 2Q76A 1F4YH 3RTQA 4OM0L 2DL9A 4YXHL 1JPGA 2J7LA 2VLKA 3MJ8B 2DQTL 1GZPB 4KFZC 5CP7B 2NNAB 4AENB 4FA8A 3NGBC 4MSWA 4UT6H 4PRPB 3ZYIA 1UEMA 4F7CA 4BK4A 4XP4H 3RY6C 1KJ2L 4YIQA 3RUGF 5DQDL 2X70A 5B8CC 5BOZG 4LQ1A 4PJ7A 2EXWD 4H1LA 4HC1L 2CDFB 4M5ZH 5IT2H 2V7NA 4AEIH 4LCYB 3RI5F 2NXZD 1R24A 1E28A 1XGYL 4NJAL 2XZCL 2DS4A 1TZGL 4FP8H 2HT4D 4GXUN 5IOPB 4K3GA 4K23L 4RGMB 5KJRH 1HINH 4LCCA 1QBMH 3NABL 2IMMA 3VXRA 1U8NA 1XZ0A 1B6UA 4JZOB 3QDMB 1I1FA 4URTB 4AIXA 4S0TD 1KPRA 3P0GB 4ZDHA 3L5XH 2I25N 4PJHE 4O9HH 2NY5L 5BS0B 5E2VL 3U36B 3L1OH 1GGBL 1MJ8H 4N0CD 2E7MA 3DIFA 3U2SA 4PJXB 3HTLX 2OXHA 1MUJB 4DAGH 1AE6H 3V52H 4NQCB 4ZUWA 1SHMA 5IHBA 1G6VK 1IKNC 4XTRD 4DGVL 5I16B 3DVGA 5E8EA 5I17A 5FUZH 3CH1B 1N0XL 3T4AA 4EVNA 5J89A 4DVRL 2F19H 4PR5B 4FFWC 3SPVB 1SEBA 4WO4A 4CGTA 1PAMA 3QWRD 1PYWB 3T0WA 3WLWD 3O6FD 3ZYJA 1GGUA 3GNML 4FQHB 1A7QH 1TJIH 3BH8A 4QXUL 2CDGA 4JPIA 4MCYA 3DX6A 1P53A 1T5XB 1HOCB 1I9JH 3VXTA 1IQWH 4Y5XB 1ZXQA 4PJDB 3FJTA 2DYPA 3TWCH 1MOEA 3KWWA 2EDFA 4RISL 2V5MA 1OCWH 4OI9A 1BREA 1ZT7A 2VDRH 4JREB 3U4EA 2OTWA 4K8RC 4WEMB 4X5XA 2YD6A 2X9WA 3UP1A 2ZUVA 4Q6YA 3ARDD 4LFHD 3CDCA 5DHVA 3ZDYF 5FM4A 1DDHB 1R5IA 2XKNB 2IWGA 4DK3A 4PRHA 3U9PL 2R4SH 3QUXB 3NFNA 1QUNA 3V6ZB 4U7MA 1Z6JT 3HZMA 2G75B 2I24N 2XZAH 5TDPA 1RZ8B 1KLGB 2QADB 3T65B 5F9JB 2R69H 2ESVA 3IDYB 4I3SL 1QRNA 2HFFA 4LP4A 1U8HB 4AT6A 3AS3A 5C9JA 3GI9L 4GRMA 3VRLF 3CC5B 3NCYS 3TN0D 1UQSB 4ISVA 4W6WB 1JGDB 1K6QH 3CZFA 5IVXE 3PNWA 2HAZA 3M8OH 1RJLA 5HPOA 4OUUA 5HI5C 3MRKB 4P3CH 3BP4A 4F9PC 3MNWB 2K1MA 3DPBA 4XP9L 2IJ0C 3U82B 2D9CA 4LGSB 2ZKHL 4P2OA 3IDMA 5HVWA 2UWEE 4MHHI 2DD8L 3QQ3B 2EICA 2C1OA 4CMMB 5MENB 1P4LB 4WUKL 2FEDD 1XIWB 4I4WB 3L6FB 4KZEL 5K9KB 4JO1L 4XVTL 2C9AA 4IHOA 3TBSB 3DMMA 1FORL 1X5ZA 1CGUA 3MJ7B 4KVNH 5IB5A 5DO2C 1DBBL 1OSZA 4AH2A 1DUZA 2DQUH 4U6VL 1KCVL 3UBXB 1N5YH 1YNKL 2VDLL 3RWCB 2EDBA 5GIRA 7FABL 1CCZA 4P4RB 5E94B 2AI0L 3FTGB 4P9HC 2CK0L 5AD0A 5IV2B 2D4DA 5IWLA 3GB7B 3PHOA 1INQB 5D7JA 1NCWH 4WW2A 2ZP0T 4JQVA 2JCCF 5L2KA 4N9GB 5IF0A 4OD1H 3QDGB 4GAGL 2XICA 1HHIB 3ZTNH 4KJQC 4HGMA 4OLUH 3BP5A 1ZTXH 2Q8BH 2YPLA 5FGRA 2WIIA 2DAVA 4OZHF 2YN5A 1DQJA 1OAZL 1KTKE 1Y6KR 4NT6B 3W9DA 2G2RB 4JM2A 2AXGB 3KPNB 4KK6D 4G80B 1JP5A 3C5ZC 5KSAB 4KI1A 5DFWH 4A6YL 1A7NH 1QFWI 3ARWA 4W68A 5IP4A 3PWJB 3GI8H 2B2XL 4MAYA 4XCFH 1U3HC 5CJBA 3IDUA 1ITBB 1F6FB 3WL9B 2CKBH 3OKOA 3OHXA 5HGGS 5HYIA 5LGHL 5JDSA 1EO5A 4UV4L 4I18B 2F5BL 3KAAA 1RK1A 4JO2L 3DSFL 3O3AA 2CKBB 3LKOA 4G8IB 1OVZA 3FFCB 1C7SA 1T6WA 5C0AB 4FXKB 1ZA3B 4ODXB 4KK5D 3VG9C 4QCIA 5FYLE 4L29B 2X4QA 4IRJA 5F7YC 3TT3H 1G7JB 3P77A 1IEBA 3QG6B 4GG8A 3G6DH 4D0BA 4JANB 4YFLI 3SCMA 4LPXA 5FEBA 4H8WL 5EN2A 1T0PB 4XVSL 5FYLD 4LEXH 2ZOKA 5DRNB 4PRDB 4RGNB 4ZUVB 2BSRA 2WW8A 1E4WH 1UVQB 4JCLA 4NKDB 3ZSSA 1CTNA 5EOTB 1S78D 4XCCL 3WFBL 2V2TB 3MLVH 4H0IA 4LCCC 2QR0A 1DVFC 2GAZA 4PLNC 4TOYL 3PL6A 4LNRB 3Q3GB 4QRUB 4TUOA 5ID0B 3MGOA 5D2NE 1AR1D 1Z9SA 3PJSB 1LNUB 3U7YH 3QEGH 5IB4A 4HQQL 3ZZ1A 4Q9RL 4YLQT 3CVHA 4RCAA 5DD5L 5T3ZL 1UXSB 3RKDD 4OI8A 2QSQA 1WBYA 3FQXB 4APQB 5KS9B 4GBXB 1EXUB 3VFOB 3CXHK 2ICCA 1KCUH 5DD6B 4D8PB 5EFIB 1YEHL 2XG4A 4ONFH 5FYKE 1HIMH 1M7DB 2DKSA 5GHWH 5DEGA 2QHRH 5DHYA 1CFVL 3BPCB 3DETC 4OKVA 3D25B 2ZOLB 3MGTB 4NO0D 5T1MB 3ET9F 5JMRA 3DUHA 3GKWH 4KQ4L 5GGSA 1NKOA 3EYOA 4ZNCD 1QR1B 5JLZA 1W0VA 3BKCL 2DLEA 5FYKD 3VI4F 5ACLA 3SO5A 2OZ4A 4U1GB 1RY7B 1Y0LB 3DV4B 3HE7C 5CHNB 3BPOB 1RZIA 2EIBA 4UB0H 2WINA 2VUOA 4HWUA 4M93C 3L3KA 4PRNB 3WFCL 1NMAH 2CRYA 3G6AB 5AYUL 3O2DA 2A2QT 1K8IB 2XN9B 3M1BA 1X5KA 3FT3A 3GJFB 1I8LA 5FXCH 5C0JA 3OKLA 3MRJB 3QIUD 5SV4A 3RX5A 5ERWA 1KBGL 3KDMB 2EDWA 3EHBC 5SWZE 4WTZG 2X1PA 1M6OB 4HUVA 4M8VA 3F7QA 4FABL 1KCSL 2YHGA 3CNKA 4OZFH 4YHML 4MXVF 4UDUB 1LGVA 1NUFA 3ALWA 4NFDA 1NFDE 4PLJD 4OZFB 4RFOL 4M7LT 4TUJB 5SWZD 5GGRA 3DXAA 2ED8A 3SGKC 3UTTB 1AKJB 4XXCA 1XR8B 1BEYH 5MEPA 1MAMH 1UZ8B 4N5UA 1EVTC 5E6IB 2BXZA 4MDIA 3PHQB 4KJWD 4OGYH 4V2BA 4L9DA 4QNPE 5IMMB 2Q86A 4KV5E 4UQ3B 1HQRA 4IMLB 3SJVA 4P3WA 4AQ1B 3LH2H 2HJKB 3RI5K 2AK4E 4PJAE 1YUHA 4UDTB 3LQZB 3O81A 2Z31A 2V2XB 5D1ZD 2BSSB 2EIZB 3TJHD 3VCLB 1GC1C 5E99L 5I1IL 2LTQB 2YBRB 3OF6D 4GSDH 4KMTH 1EO8H 2R1XA 3AB0B 4MA8L 3L3IA 2AK4D 4OT1H 2VXSH 2UUDK 3SDDB 4U0RB 1RSFA 5A2JH 5CGYD 3HUJF 2CGRL 2J88L 4LLQA 4JPVH 2X89A 2DWEA 4G6AD 4IOFC 5IGXL 1N4XL 3DMMC 3GJEA 5EBWA 5F71A 1LEGA 1ORSB 1S7WB 3OXSA 1J0KA 5DK3A 5EU3B 4J3VA 5TDNB 3HZVB 5A2KH 4QLRA 3OMZA 4H26A 1CDCA 5T5FH 3QIWB 3RGVA 2AJVL 1MCOL 2NX5B 1A6WH 1UWXK 3RL2B 5DUBB 5C0CA 4MNHB 3I02A 5T1LA 3BX7C 3FB6B 3AS2A 3TPUA 1JZ7A 4WVRA 4LQFH 4XPHL 5EZOH 4Y5VB 3L3DB 2XFXA 2V5YA 3C60C 1YMMA 5J11B 1JMXA 3QG7L 3BP6B 2X4UA 1LP9A 4FFVD 1GZQA 1N0LA 1BOYA 2H8PA 4RSVA 2WUCL 1RIVH 3WLBB 4JM2C 5INDB 4GXUM 2L7JA 4X5WA 4O2FB 3RA7H 1H3PH 4CN4A 1R3JB 4WWKA 4HKJB 2YSSA 3PHSA 4WENB 4K8RL 4OF3A 5CJOH 1CF8H 3K74B 4G8FB 1ZGLB 4IOIB 2AV1A 2IH1B 4BSWA 2W9EH 4F7EA 2G5RA 2EDXA 3FB8A 1H3GA 1NJ9B 4NRXB 1I7UB 4PJ8B 4P23B 2AW2A 5HYQB 1D5XA 5ISZA 1IGML 3HG1B 3QUYD 1X44A 1FJ1B 3ZTJG 1OTTD 3PQYA 4PGJA 3FQTA 4G42A 4S0SD 5FF6B 4P2QB 5FM5O 1ACZA 3BHBB 4JN1H 2BVTA 3ULVE 3KHOA 1AXTL 2OI9C 5C7XL 4NO2B 2P46B 3R1GL 1ZV5A 3V4UH 2NY1C 2ZSWA 3EDFA 3BN9D 4QGTA 1NUDA 4KHXL 3MLTB 3K8MA 4XMKL 2VB5A 4JFEE 4F58H 3ULVD 5GGSY 2DQFB 3G5ZA 1KTLA 3LEXB 2AKRB 3F5WB 3BE1L 4WHTB 4N0FA 4CL7A 1RJCA 2Q7NA 3PL6C 4XNXL 4CW1A 1MHCA 4K2UH 2OTPA 4JDTL 1ZHNA 1URLA 4JFED 3V4PH 1BD2E 4KPHL 4DZ8B 2ITCB 3EJYD 4X4YB 3ULUE 4J8RB 1L6ZA 1JGEB 1GOGA 1YQVH 4DKEL 1OAXL 1ZK9A 2HVJB 1J1XL 2H26A 4Z7VB 5KSUB 3KYNB 4X4XB 4IIQB 2VE6A 1BD2D 4Z7WB 3QQ9C 3O3UN 4MJ6A 4P9HL 3VMNA 1P1ZB 4PJHB 2PO6B 1IAOA 4KMLB 4KK9D 3ULUD 5DS8B 3TBWA 2IAMD 5FM5M 2VRAA 1UZ6E 1IZJA 3BWAB 1RD6A 1G0DA 2FIRT 4U3XA 4XNMA 3MJ6A 4JG1H 1YPZE 1YYLL 1T4KA 2DMBA 5IROC 1OAUH 5H8DA 7CGTA 1AGBB 3HZKA 4JY6B 3ARBC 4U33A 1XR9A 2Z8VC 2XIDA 5A40E 4JB9L 1NFKA 3O6FB 1NLBH 1N5AB 1DQDL 4JFFB 4LKCB 5D5ME 5ETUA 4CADB 1HCFX 5KVEL 2GTZB 5EA0L 1BJ1H 2A9ML 1T7VA 4UQ2B 2ORBH 1XF1A 4YAQB 4YBLB 3UTSA 2D7TH 1LD9A 2NW3B 3BUYA 2H2PC 1A4KA 5F3BA 5T3XE 2AQ2A 2HT2D 3TFKC 3OKMA 4XAWL 3BKJH 3LDBC 5FK9A 1RVFH 4NOFA 5JW5B 4J3SA 1OD9A 4RFEA 3ZHLA 3OKKA 2FSEA 3FRUA 4XXCC 5FCUL 2PTUA 3O4LA 1U8LB 3MRFA 3QPXH 2CLRA 5T3XD 3DROA 3NZHH 1KG0B 4HUUB 1JRHH 2C7UA 1SY6L 3RY5A 4U0QB 4Y4HD 1CFQB 4QOKE 5CZXD 3WHXB 4GAJL 1J1OH 3C5JA 3TA3D 5E95B 1EVUA 1NBQA 3UPRA 4U49A 1L7TH 3PXHA 4MCZA 2HVKB 2FD6L 3QUML 1FFNB 4BZ1L 2E6JA 3OG6B 4BUGA 3R0NA 4ZFFB 3AXLA 5DJYA 3VMPA 3MRLB 4LSDA 3BGFC 4G9DA 4NNXB 1BOGB 4YHPA 3V0AC 1LO5B 2AXFB 4QEGA 4QOKD 2XTJE 2V7HB 4LRNH 5BZWA 3EW3B 3EYSL 5EO9B 2WWMC 3VXNB 5LJYH 4G6JL 4X6DE 2BX5A 1SEQH 4JKKA 1MQKH 1RUAH 4LK4A 3D87B 4XBPA 3ZE0F 1AQDB 4LCIL 2DQGH 4RMRA 5I1AA 2Y6SC 3NPSC 4GRWF 2XTJD 1ZLWK 2FHCA 3E0GA 2OL3A 3STBA 1LE9B 2BRRH 5DUML 3VFGH 2DLTA 4P2CG 5H94A 3B3IB 1F8TH 2RCSL 3SE9H 3H9HB 2EDYA 4QHMB 1U6AH 1X5AA 5IKCB 2HMIC 3QRFM 2UWEB 3UDWC 5CWSA 1LK3H 2E5EA 2VQ1A 2FBJL 1IKFL 4RMTA 2L4OA 4P99A 1CL7H 1L4IA 4M1DL 5MEQA 1PSKL 3KGRA 1C08B 3O2WH 1UKQA 2R4RH 4N1CA 2OJZH 5E8OB 5IBUG 5GSRB 1U95B 3WXWL 2APVA 2YOCA 5EU6B 1I7RA 5L0QC 2F5AH 3OJ2C 3P4MB 4NN6B 5KSBB 1FG2A 3V6FB 5FGCB 4MS8D 3TVMA 3MCLH 1NCDL 3OB0K 3IJSB 3KLDA 3NFPB 4P2RE 2AXHA 4UZGA 3DNKA 4OZ4B 4V1DA 3MLXL 1JFQL 4NQTA 3OKDA 5F70A 3IAPA 4JFOB 4HS3A 4OGAD 4NZRL 4WWKC 4NDMA 2V17L 3WO4B 1IGYA 3AM8C 1ZHBA 1EEZA 4P2RD 4X6CF 1DBKL 1V7MH 1S9YA 1B88A 1TVBA 4EN3C 2C3WA 1Z9OA 2XNAB 4GW5A 5GJSH 1EEYB 2XQYG 3WJJC 2VTFA 4JRXE 1U3ZA 4YK4C 4BSVA 1OWWA 2A73A 2BHYA 5IJKA 5EPMA 5BJTB 1OSPH 4B41A 2BK8A 1Q9KB 2AGJH 4PRBB 4H0HB 4MNGA 1CICD 4Z76B 5EUKA 2JK5B 4PJ7F 4UTBL 1KJVB 5ESVA 4JRXD 3CXHJ 4R4ND 2SEBB 5AZEL 3FMGH 2Q8AH 1HYRC 1JVKA 3OZ9H 3T4YB 2YZ1A 2D03L 5C0GB 3M17B 2OTUB 4WI5A 1U3JA 5FYLH 4DW2H 4YXHH 1HK6A 4ZPTB 2VIRB 3VRIA 4R26L 1ZLUH 1ZLSL 3STZB 4U1SA 3HC4L 1AGFA 1D6EA 1GC1L 4NUJB 2KKQA 4RQQB 4OZIB 1FFOB 3VWJD 1CLCA 1P7QA 1PGRB 1DANU 1SYSA 4PJFE 12E8H 4LIQE 5DQDH 2YRLA 4QRQA 4MMXC 4XPFL 3T0XA 3RVVC 1BQLH 3MUHL 2M1KA 2VDKH 2RHEA 1HH6A 5DYOB 2ID5A 2H9GB 3IXAB 5IVXA 2J8UE 3HZYB 4JO4H 3QCUH 5DURB 3O8XA 1TZGH 2Z35A 4JDVB 3SQOL 1OPGH 3CFBB 2D31A 2NW2B 2APFA 4S1DC 2ZUXA 1IRAY 4XX1G 3F7VA 2MMXA 3KS0H 4TN9A 5GRUH 3PWPB 4ZPVB 2P7TB 1FSKC 5D2NB 3TYFA 1DE4B 4NO0B 4YFEA 5HYSB 1UB5A 4LLVB 4Y2DD 5J8OA 5FYKH 4C54A 1J1PH 4PJ5B 1T2JA 2WBJD 4YXLL 3S6CA 2VWEE 3KYKL 1P4IL 4ZO6A 3CFKB 3EDDA 4Y4KB 5CJ5A 5SWQB 1X4XA 1UENA 2DBLH 1NFIB 2MFNA 1XF4A 1EJOH 4NOBA 2BVQA 1G84A 3GSNL 1X5JA 4DGVH 3V79C 3VFRB 1MI5E 2K3TA 2PW1A 3SDXE 2EDDA 1G7MB 2J6EH 1R5VB 4WEBL 4S1QL 4YEFA 5J56B 2W60A 4Q2ZB 3GSXA 1A4JB 3IGAB 2BNUB 1CD8A 2AABL 1TJGL 1NSNL 1WCQA 1C7TA 3NFSH 2L7UA 3MYZA 2IBZX 3MLWH 4W4OC 1MI5D 3C6LA 3BEWA 5CEZE 4ONOA 2A6DB 3CX2A 5DJZA 4ZFZA 5KOMC 5B3JF 4QXUH 1MF2L 4QRTA 5EBLB 3O9WC 1XCQB 1PY4A 1WWCA 3CDGA 3HE6C 5C6WH 2B1AH 5MP6L 2H32A 3SKNB 1QKZL 3GM0A 4MNQE 3AY4C 5CEZD 1JNNH 1F6LL 3GK8L 4G7VL 1IGCH 3ZL4H 4KZDH 3TGXA 2AXJA 4MQ7B 3C8HA 4WFHE 1GOHA 2ZUSA 4OUOA 1NAMH 3E8UH 5BRZB 1XF5A 2YWYA 4GMTL 4NQEA 1CGTA 1A7RL 4MNQD 5L7XL 2PNDA 5JUEH 4HWBA 4QYOB 3MODH 1J5OH 3BZ4A 5ALBL 4WFHD 2DQIH 2GIYA 3CSBA 4X0KA 2KH2B 1NDGA 2XACC 2I60H 3JSSA 2F8XC 3MJ9L 4FMKA 3UJTL 5FO9B 3UTQA 3QULB 2ZPKH 4JFYA 4AQOA 2F8VA 2OXGA 2AK4B 1BLNA 4PJAB 5HHQA 1N6QH 4WHYH 2XZQL 4Q74A 3C09C 3CVHL 2NY6D 5CZKA 4MJ5B 1AGEB 1UYWL 3RP1A 3SO3B 2BVOA 3WIHH 5E70A 5GRJL 1RUMH 1A7OL 1VADB 3QEHA 5HYJB 1N8ZB 2VISB 1BBJA 4NNYB 3U1SH 3QPQD 4ZXBA 3EYFB 3N85H 3ZKNC 2EH7L 3CUPA 2DD8H 4WW2F 4BA8A 1JWUA 1A7BA 3MV9A 4MDJB 4U1JA 1NGPH 3ARRA 3HS0B 3O6KL 5EUOA 4KZEH 4YC2C 3RWGA 2ATKA 3DX8A 1JGUL 3HPJB 2WP3O 3QRGL 3ARFB 1P2CA 1KTRL 3PGFL 1RZJC 5D1XD 3V7AG 2CKNA 2HA1A 1PQZA 5E2TL 4M61B 3VDCA 3B6SA 5DVLA 7FABH 3JV6B 3QDHA 4XWOD 4RNRB 3UJIL 5ACZB 1R5WB 4ZAKC 3TVMC 1FZJA 5C0RH 2R2EB 1HXYA 3BIKA 4OV5B 4RAVB 4PBWD 1VFAB 4DOHE 1IC4L 2X4OB 4LL9A 5DMIH 3MV8E 2ED9A 3LN9A 3F7RA 2EDKA 1GJIA 3UTPE 2NZ9D 2CLZB 3JV4A 3FQUA 1MSPA 4M7KH 3MXWL 1T83C 4OF5A 1CT8B 2GITB 1UG9A 3HLAB 5F6IC 1I1YB 3H9SA 2O61B 2EC9T 5LWYH 1P7KB 1MHPL 4M3KB 1MH5A 3WD5L 1FGVL 1OGTB 2VC2H 4YR6B 5I1KH 3MV8D 3U6RA 2E9WA 1Z9MA 4PTTA 2Y06H 3SKUD 1YNTB 3UTPD 3CFEA 4M62H 3HC3L 1JPSH 2N4IA 4RBPH 5DJAB 3PXJA 3QT2A 4GG6E 1OD7A 3EO1B 3U83A 2P5WA 3DGGB 3FO2A 3KPRB 4WJ5A 1MFAL 1ZT1A 4HIIB 1UJTA 4WGVB 5DJ6A 5LGHH 1S7TB 3TH3T 3VXOA 1B0GB 3F12B 3LD8B 4JG0L 3QDJE 4E5XB 1BZ9B 3I6GA 2IFFH 1G1YA 2QLVB 2Z8WC 4JHWL 3MZTA 5JO5B 3D5OF 1JIBA 2X4TB 5IMKB 3TBYA 5I1LA 2PXYB 1F58L 3D85A 4XH2B 4YZFF 5L6YH 3ULVH 4HKXB 4ODTH 5IHZB 1MRFH 1MEXL 3A6BL 3LZFH 1QFWH 2DBJA 3S35H 4DTGL 3QDJD 3DI2B 3DV6A 2W07A 3GO1H 5J4MA 1D5ZA 1RUPH 1KPUA 6FABL 4TVPH 4OZGA 4ZFOB 1SBBA 1U3YA 3SEPA 4NZDA 4YQXH 4GKSB 3F7YA 4C83A 4U6TA 5C0IB 2AP2A 1S8DA 4FQJH 2B0SL 4O02H 4QHUB 2VXTL 3O8XC 1U41A 4G43B 5HHOE 3MBED 3Q6FA 3KPOB 3MV7A 1JWSB 2NTFB 4ZS7L 5ICYB 1QSFB 1F11A 2JELL 5BO1L 4PG9B 3VXPB 4NKIH 3X12B 5FB8B 1IC5L 5C6TL 3ULUH 5I71B 5HHOD 4Q9RH 2HJLB 3EOBB 1D5MB 1XGRA 5C0DA 4X4ZA 1XGUA 3QSKB 5HVFB 1S7VA 4HK0B 3NA9L 5EBMB 4LLWB 4QXTB 3HI6H 4Y19A 3R06A 2X1QA 5CSGA 4Z78B 5TQ2L 3MRGB 3CDFA 4YHIA 1QSEA 1YYMH 3P0VL 1EFXB 1EHLH 3KVQA 1QLRB 5GS1A 1NC4D 4MB3A 3T2OA 2K7QA 4MA1C 3EO0B 3AFLA 2JIXB 2HH0L 1UWGL 5EH1A 4XT1C 3HAEA 4ZUUA 3BDYL 5DJ8A 3ZE2F 2ICWA 1R6VA 4OF6A 1K4CA 1XT5A 3OR7B 4LLDA 4O58L 1JYWA 3RAJL 5A1AA 1T1ZA 3PABB 3ROLB 3MJ8A 5ESAA 3NTCL 3CXDL 4PJCE 5CP7A 2NNAA 4LARL 4AENA 4G5ZL 2NXYB 4PRPA 2BRQA 5F96H 3SDCD 1RI8A 2ERJB 5T3XH 4I3RH 1AFVL 4EI5B 3QUYA 1FAIL 3JV0A 5F1IA 2CDFA 1GGYA 2HWZL 5D7KD 4FRWA 2VUYA 4LCYA 4K71B 5GGQL 5HI4D 4S10A 1GL4B 1RIHL 2QL1A 2Y1VA 1VACB 4G6ML 1AHWB 1WTGT 5KG9B 2XWJB 4QRPB 3ZYZA 4S1RH 1VSCA 2DJUA 2E8ZA 4B50A 3ZMRA 5FYJL 2QQNL 4JZOA 4O51B 3QDMA 4R3SB 4Z95L 5ICZB 3RKPA 3VFMB 1F6AB 3RJDA 5GGTH 3PWLB 3DO7A 4HV8B 1QD0A 4N5EC 2FJGB 5GGVH 3GEWB 4QOKB 3U36A 4NC1C 1MFEL 2RB8A 2Q6WB 2NY2D 4CVWA 1HNGA 4FTVE 3CLFH 2VOTA 5JORB 5EORL 4L3CB 1TXKA 1HN1A 3C5SB 1CDHA 4JFEA 4LHQB 4NQCA 1S5IH 2IPTH 3E6HA 3T0EC 1BFTA 2EO9A 2C3VB 5KVGL 3I6KB 5ID1A 3ESUF 3U48A 3I50L 4FTVD 5C09B 4X6DB 4FQCL 3VFWB 5LAXB 5INCB 3P30H 4TPRL 5K33A 4PJEE 4PR5A 3SPVA 3DHMA 3OAUH 3I2CL 1WUNT 3B9AA 3PUCA 1ODAA 1L0XA 2E7LC 1IGFL 2X4NA 3ZDXF 2X5PA 4NUGL 3LRHA 2YEZB 1PZUB 4LLMA 4F33B 2XA8H 1KXQE 5DJCA 1JGVH 3L3GB 2AEQL 3I75B 4J7RA 4UNTA 4D9LL 3WHE1 4Y5XA 4PJDA 1A6UL 1CFTB 4E42A 4L3AA 5DLMH 4X9BA 2P5EA 3W5MA 4OI7A 3VFSA 5FKPA 3S88H 4EUPH 4MMZC 2ATPB 2W1NA 2F53B 4Z77B 3WNOA 1BQHG 2XKNA 4EUPB 2CDEB 1IBGL 3M07A 3IDGB 5BV7C 1NL0H 4JR9L 3O4OB 4XBEL 2G75A 1CVSC 2AV7B 3L7FA 4NN5B 1FCCA 4P2RB 2MHAB 1RZ8A 4HS8H 4J6RL 3UYRH 2A6KB 1KLGA 4NQDA 1JZ2A 3T65A 4M48L 5F9JA 2PTTB 1U0QA 5IR1B 4K8RH 3OAZK 4FXGB 4ZOCA 5HVGB 4UINH 1OLZA 4HIHA 1Q1JL 3CC5A 1UQSA 1E4KA 4OIIH 4NBYB 1JGDA 5J1TC 4ZSOE 3QCTL 3TA3A 4JRXB 2Z91B 3MOAH 2ZJSL 2GJ6E 3HB3C 4MD4B 3OJDB 1LO2L 3VWKD 4HS6B 4OTXH 4J3UA 3BZEA 3MRKA 4S1SL 4M7JL 4ELMA 1ULVA 1AGCA 3MNWA 5H37H 5BXFB 2APXA 1F4WH 2GSIB 4XGZA 1WAAE 2B4CH 2F58L 1P4LA 5MENA 2HG5B 4BZ2L 1G7HB 1T7WA 1XIWA 2GJ6D 3L6FA 5IIEB 5K9KA 3TV3L 1R3LA 3VWJB 3RWJA 1N7MH 1RFDH 3TBSA 4JQXA 4PLKC 4NWTH 3MJ7A 1IQDB 3LPWA 2I9LB 1Z3GH 4FQXD 5J1SC 1P4BH 3QIBB 4Y1AA 3HN3A 1X3DA 5D7LB 3UBXA 1FNEB 1BZQK 1V3KA 3WDHA 2EZ0D 3G6JE 1AJ7L 1PX3A 4NFCA 4I5BB 3BAEH 4P4RA 3FTGA 1H5BA 4GJTB 4OQTA 2EKSB 5E4IA 3L5JA 4JVUA 3KR3L 3NIGE 3HNSH 5E4EB 4LLUA 4GXVL 1OTUD 1QYGL 3X11B 4KC3B 1ZT4B 4N9GA 3QDGA 4N8CH 4NBXB 3GMNB 2XXMB 4PJIA 1MAKA 2Z4QB 1FFRA 5E5MB 3BXNB 3T3ME 3SE8L 4JVPA 3RU8H 4NT6A 1RZJL 2G2RA 1A6AA 2AXGA 2FATL 3KPNA 1V3LA 4G80A 3VD5A 2EDLA 3JUZA 1RIUL 1QO3B 5KSAA 4UNUA 4LVEA 4OZFG 4K3DL 1IM9B 1N6UA 3CCHB 3PWJA 4EI6B 4P46D 4P57A 4I0PC 3DLQR 4O5LL 2R29L 3ORJA 3JBG7 4AG4H 5HDBE 4I18A 2LU3A 4P4KD 3CFCL 4G8IA 3FFCA 4K07A 4ZFGH 1T2QH 2H1PH 1OB1B 3MREB 5C0AA 2BY1A 3FRPG 4JLRB 5KANI 2M26A 2YZ8A 4X4ME 5I1GH 1BJMA 5I30L 4U05A 3TBTB 5CSZB 1MI5B 2Z93B 1H15B 1R3HB 5IK3B 4MWFB 1DQDH 4PJBB 4MD0B 1WFOA 3ARGD 5CJQL 1G7JA 1NDMB 3G5XB 4JANA 5I8KH 4N8VG 5CEZH 3C5ZB 2A9MH 3THMH 2HRPL 5CEYB 43C9B 4DGYL 1CR9H 1KN2L 1WF5A 4KTEH 1F3DJ 5DRNA 3AGVA 2VLJB 4PRDA 1IGTA 1U3HB 1L9NA 3U4BH 5IFJA 2C4FT 4NKDA 4ALAH 4Y16C 4AIOA 2V2TA 1K4DA 5K9QG 2FGWH 4YHZH 4QTHA 2JF1A 3LMJL 1IL1B 3PV7A 2VAJA 4LNRA 2EDQA 3Q3GA 4QRUA 3VG9B 2XRAL 1C5CH 5ID0A 4Q9QL 3CMOH 1KIQA 1LNUA 4HX1B 5HD8D 4WU7B 5DD0L 3B9VA 4PGCB 1S9WB 2OCFD 1HHGA 4LBEA 5J13B 1UXSA 3FQXA 3DUUB 5KS9A 1S7XB 2MOVA 1EXUA 3FQNB 4GBXA 5DD6A 3VFOA 4D8PA 5EFIA 1S9XA 3UO1L 1E27B 2RJMA 3ILPB 1KB9K 3BPCA 3CVIL 3D25A 2ZOLA 3MGTA 2IEPA 5T1MA 2FIKB 1EX0A 4J4PD 3QUMB 4I3GA 1X7QB 1QPXA 1U91B 2NY6B 5C08B 4M1GH 3EYSH 3TM6A 5TE6L 4JY4B 4ORGB 3VH8B 1ND0B 2NLJA 2GTWB 1YN6B 5GZND 2VH5H 3NCMA 4M43L 1Y0LA 1DLFH 3GIVB 2VXVL 1NANI 5LVEA 5CUSL 4PRNA 1J0IA 4WFGE 1TNMA 3G6AA 1O5DT 1A6PA 4KKCC 4XPBL 1MCCA 5CIPH 4R4FL 1K8IA 4Q97A 3GJFA 2RCSH 3IXTB 4RX4D 4XP1H 4IRZH 3MRJA 5CIPB 4LSUL 1U8IB 3KDMA 4WFGD 3CLEL 4P9MH 1IKFH 3FO0L 3V6OE 3RZCC 3KLHC 4U1IA 3S36H 2G9HB 3IRZA 4JREC 4WV1B 3CD4A 4NWUL 3MUZ1 4GRLD 2BZDA 5FV1L 1NCCL 3LPGA 3QHZL 3C08L 4R4BB 3HE7B 2F74A 3CDYA 3UTTA 5LBSL 1AKJA 4YGAB 4JFZH 5DMGD 1XR8A 1FDLH 4D9RE 1R3IL 1NCDH 2I07B 3QUXC 4M93B 5E6IA 2WWKO 3GMQB 3HRZA 4HULB 3P2TA 1FVCA 3MROB 4WCYL 3PHQA 4MLSA 1D9KB 2NPLX 4MX7B 4DOHB 2YWZA 3PDGA 5IMMA 3OKNB 1AI1H 5FUOL 3IDYC 4UQ3A 4IRSA 2BSTB 4RRPG 4DQOH 3IT8D 1CLYL 1Q94A 4IMLA 4D9RD 5CMAB 5DMKA 2HJKA 3GMLB 3RDTB 1F4XL 3A67L 1HKFA 3QFJE 5M94B 5GXBB 3ECBA 2V2XA 4D0DA 1E4KC 2BSSA 4X7SH 5ITBL 2P47B 3QAZB 4NO5B 2HFEA 3EOTL 2YBRA 3UJJL 4HWBL 4D94A 2DM2A 4YXKH 3QFJD 3SDDA 3ARED 5DJ0B 2O26U 2UVFA 3O3EB 1XIWC 1U42A 2APTA 3QDJB 3FO1B 5IVXF 5HY9B 4JQXC 3UYOD 1ORSA 3GMMB 1S7WA 1Y18B 3C8DA 3RVXD 2GY7B 4I1NB 5TDNA 1ZLSH 3HC4H 1NLDL 5T3ZE 5JOFB 3QCVL 4M6AA 3QIWA 2BOBB 3U7AA 2AQ3A 3GMOB 1TNNA 1A3RH 1NCTA 2NX5A 1LE5A 4NQVB 1JPFB 3RL2A 5DUBA 3PV6B 1UGNA 1OGAE 5HYEA 3FB6A 1NH6A 1TCRB 1IAKB 2BFVL 2P49B 3MBEB 3PF2A 3VRJA 4XPFH 2FYYA 3FCTB 2FH8A 3VXUB 5T3ZD 1FGNL 3L3DA 3B4NA 3B9KD 5CS7A 5D2LE 1FZKA 1NGWB 1RURL 4L4VE 4PJGA 3CSYB 1OGAD 4N0YH 5HDLA 2ICEA 2LU4A 3WLBA 4MB5A 1LK2B 4KKLD 5I8EB 5INDA 1J8KA 3K46A 4ZTOL 2E7BA 3ZE1F 5BZDA 4L4VD 4KRMB 4PGZA 5DJXB 4GKZB 1KEGL 5D7IB 1U2HA 1ZGLA 4IOIA 2IH1A 4LFHG 4YXLH 4O2CB 5GQBA 1G6RL 1NC4B 4DWHA 1NJ9A 4GH7B 4NRXA 1I7UA 2E27L 3I3BA 3FT2B 4ONHB 5HYQA 3EYUL 5BV7L 1RMFH 1C12B 3WKMH 4NQSB 5EC1A 3HG1A 1A7PL 3BVNB 5DUPH 1AD0B 1FJ1A 5ILTH 4POUB 4NZUH 4LASL 5IFAL 4TUKL 3CH8A 4KROD 3GSNB 4P2QA 3LRSB 3MRRB 1IE5A 1EFQA 3WNNA 1BGXH 3RJQB 3HMXL 4HF5H 3RIAK 3QUKB 1QVOB 5IB3B 4XMLL 5IW6A 1KYOK 2EYSB 3RZWA 1RJYB 3QEQB 5D9SA 4DK6A 4O2EB 2AKRA 3F5WA 4LF3A 2Z8RA 1YDPA 3IKCB 3X3GL 4WHTA 1B4JH 3KPSB 3K80A 3KPPB 2W9DL 2BVEA 1A14H 3IF1B 1KPVA 4OCSH 1VPOL 1RU9L 3LHPL 3B5GA 4OLZH 5AWNH 2VDOH 2ITCA 1JGEA 1IFHH 3IFNL 4MGXA 4GMSL 1HE7A 5EO1B 4APQC 3QEUB 4GBXC 3PIQB 4JQIL 3ARQA 3RUGB 1AIFA 4HXAH 1W0YT 5KSUA 4Z7VA 1A5FL 3KYNA 1FRGH 3RWIA 5ALBH 4NQUA 1NC2D 4ODSL 5AG9A 4Z7WA 2DWDB 5FECA 4XVUC 1HKLL 2E3VA 1FZMA 3D6GA 1AC6A 4OAWB 1P1ZA 5TH2B 2PO6A 1MFDH 3WS6A 2DI8A 1SJHB 2HTKD 3HNTL 1HXMA 4KY1H 3S96A 1TETH 2Y9RT 5DS8A 1CG9B 5CZVH 3BWAA 1HI6A 2KZ1B 5EUOF 2YD2A 2C26A 4WUUB 4ODUB 4U1GC 3K2MC 2UUDH 1A2YB 3BPOC 2BMKB 3O45B 1L0QA 4E41E 2PKDA 4CDGC 3O2VL 3G04B 4Q9BA 1KIPB 2WZPD 5GS0D 4QHKJ 1G7PB 4JY5L 2BDNH 3CIQA 1NBYB 2FX7H 1YN7A 4F7MB 1X4YA 3MCKB 4F3FB 5GRJH 3SN6N 4Z7UA 4MAUH 4YDLC 1DLHB 4E41D 1AO7E 4ONGH 4LKCA 5GJTH 4QHKI 4CU8A 2GTZA 5EU4A 1U58A 4UQ2A 1H9VA 4YAQA 1KJ3H 4FFWD 5KVFL 1UWXH 2NW3A 3KYMB 1G7LB 3RPIB 3GMPB 3BZDA 4IDLA 3LKNB 1HZHL 2W0FA 4NHUB 1HH9A 1P9MA 1AO7D 3PGFH 1XMWA 4L3EE 2WV3A 4RGOH 2Q3AA 2IMNA 5M7QA 2C4XA 5I1EL 3MLUH 4R0LB 2ZUTA 5DFVC 1F4YL 1S7UB 1W0WA 3BQUC 2FR4B 4MD5A 3ARBB 3C9NB 1IC4H 4JZJB 4L3ED 3E6FA 3I9GL 1NFDF 3WHXA 2XA3A 4UT6L 4XP4L 2HFGH 4G8EA 1EK3A 4PJCA 4ZFFA 3MRLA 4MJ4A 4XHJC 4M5ZL 5IT2L 4AEIL 2AXFA 1F97A 3TEUA 3CFIC 2VKXA 3SBWC 3KPTA 3LDBB 4QNPF 1JYNA 4DKAA 4FP8L 3L7EB 4F15B 4KV5F 4U6HB 3VFUB 2OBGA 3AB0C 3VWKB 2VZ1A 3GBMH 5KJRL 1HINL 2J8HA 4U3CA 5ABDE 1QBML 2VLRB 2AEWA 2DQJL 4PJAF 1O0VA 3UPAA 5F7EL 4JN2B 4JFPB 4RZCA 4XI5D 1LE9A 5CBAB 3BJ91 3L5XL 4O9HL 1UA6H 4HXBH 1J8HA 1Q38A 3S4SB 2VZOA 4ZO9A 3FAXA 1MJ8L 4Q7DA 4E0RB 3H9HA 4UBDC 3QJFB 4JHWH 3BW9B 5IMOB 4G3YH 3ZHKA 5D1QD 3D0LA 1F2QA 1A1NB 4FQXB 1F58H 4DAGL 1AE6L 4TSCH 1GRWA 2GYSA 3QIWC 3V52L 4I2XB 4DTGH