1F1GA

Crystal structure of yeast cuznsod exposed to nitric oxide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1gA00
1EQWA 2WYTA 4L05A 4BD4A 2Z7YA 1FUNA 1L3NA 1SXAA 1IB5A 2VR6A 4B3EA 4A7TA 2VR7A 3ECWA 1SDYA 3KM1A 2ZKXA 1XTMA 1KMGA 1SDAB 1E9OB 3L9YA 3CQPA 1TO5A 3KH3A 4A7UA 1E9PA 2C9UA 3PU7A 1IBFA 2E46A 3SODB 2ZOWA 1OALA 1YSOA 2NNXA 2WWNA 3KH4A 2ZKWA 5CU9A 1YAZA 3F7LA 3CQQA 1XTLA 2V0AA 2ZKYA 3HFFA 1HL5A 1PU0A 2JCWA 1JK9B 2WWOA 1U3NA 1IBHA 1BZOA 3LTVA 4BCZA 1E9OA 1SXZA 3GTVA 1SXNA 3MKGA 1E9PB 2WYZA 4N3UA 2WZ0A 3HOGA 1N18A 2JLPA 3KM2A 3GTTA 1SPDA 2AQTA 1N19A 1Q0EA 1SOSA 3ECUA 1Z9NA 1B4TA 1OEZW 3QQDA 4FF9A 2Z7WA 2C9VA 2GBUA 2C9SA 3RE0A 1IBBA 1OZUA 4OJAA 3GZOA 2AF2A 4N3TA 4MCNA 3T5WA 1JK9A 4A7QA 2K4WA 1TO4A 2VR8A 2AEOA 2GBVA 3KBFA 1CBJA 1P1VA 3S0PA 1PTZA 1B4LA 1OZTG 2WZ6A 4OH2A 1F1DA 3F7KA 2AQSA 3K91A 4MCMA 1SRDA 1E9QB 2AQPA 1ESOA 1SXCA 1SXBA 2AQNA 2GBTA 3HW7A 3H2QA 2APSA 1E9QA 3KBEA 3ECVA 4A7VA 5KBMA 1F1AA 1AZVA 1Z9PA 3L9EA 1MFMA 1S4IA 1F18A 1OAJA 3H2PA 5KBLA 1XSOA 1DSWA 2LU5A 2XJLA 3MNDA 4BCYA 2E47A 3GQFA 3GZQA 4U4IA 4A7GA 1BA9A 1EJ8A 2AQQA 5KBKA 4A7SA 1CB4A 1JCVA 2Z7ZA 2WKOF 1HL4A 4A7GF 1SXSA 1PZSA 1IBDA 2R27A 3GZPA 2WKOA 1QUPA 1UXMA 1RK7A 3QQDB 1COBA 2Z7UA 2XJKA 1UXLA 1YAIA 2Q2LA 2AQRA 1F1GA 1DO5A 2WZ5A 2SODB 3CE1A
chains in the Genus database with same CATH superfamily
1JPFA 3WN6A 1HL9A 4ALAL 4C47A 4AJ0A 3O0RH 5KSVA 4DP5X 3L5XL 4G6FD 1P4IL 3KDPB 4PGZA 4UV4H 4B9CA 3RIKA 2K8MA 5H2BA 3QYNA 4W9DC 1Q94B 2GSGA 3HE6C 1YEIH 1BZ7A 2V9QA 1EDHA 1EJFA 3NP3A 4I3SH 4G83A 2NR6D 4RGMC 3MRIA 3NPZB 5EEWA 4FI6A 4YDKH 4XPFH 3UEZA 3G08B 1ZEAH 2MSPA 1EERB 5IQ7H 5B39A 4X9HA 4TTDC 5EFIB 2MEJB 3O0LA 2Q7YA 3BO8B 5I16A 4YHZH 3VSQA 1S78D 3O2DH 1CLVA 1M4KA 2PP7A 1UH3A 1RK0A 1FORL 2GT9B 4LLUA 3QIBA 5IHHA 2K0RA 3HZVB 3VFUB 4WCYL 1B0WA 2G9KA 1AGEA 2DV6A 3Q2CA 2WP3T 1I9JH 5J5EA 3PP4H 1TYEB 4NPKA 4XNQA 1HN1A 4WGVB 4CADB 4FABH 1P7BA 4X4ME 5FGBC 4OJYA 4P2QE 1AKJB 1IRAY 3DYPA 3UO8B 3GXFA 4XVOA 2GEQA 2XBDA 1AZRA 2PTTA 3VI4A 1OM3L 2VDKH 1VCAA 2XZQL 4AQAA 4ZW5A 5DJAB 2VH5H 4YFLI 5EU6D 2YKLL 4HEMA 2IOIA 3BVNB 4UDTB 1HHKA 1OSZB 4DP6X 2H32A 4I77L 1QEWA 3S35L 5B7FA 4XCNB 1P7KA 1WZKA 5DO8A 1EV2E 4NFBA 4LCCA 4NKDA 4RISL 3EOBB 5TK2A 4ZPTA 2VXQL 1MJ8H 4GFXA 5ECGA 4B6ZA 4U1HA 2O26U 1PLGL 4ONGH 3ZKSD 3NJXA 4XMTA 4NN5C 3RFRA 1MIEH 4WHYH 2VDNH 5IMMB 1AGDB 5LBSA 4BE5A 5KVFL 5AW4B 4HHWA 3W56A 2PR9A 4JO2H 1MW0A 1N64L 3KLQA 4LRNL 4UM8B 5D93C 4KUZL 5HHNB 1B4JL 1F18A 1OTUC 4P07A 3ZKXC 3QA3A 1J5OH 1UQSA 4JFYB 3WIIH 5EDSA 3GMRB 3KEHA 2AGJH 1BA9A 3IKCA 3VXSB 2YOCA 5IB4B 3M88A 3UCRA 2R0ZH 3ZDZB 5ICZB 5IT2L 5AW6B 3IDIA 3MREA 2E0PA 1E6OL 4U4BA 4OAWB 2FX8H 1X9RA 2CUHA 4IJ3B 1X4YA 5F3FA 2Z7UA 4HJUA 5DS2A 2TRYA 3AT9A 4N2MA 2OTUB 2DL2A 2VLJD 5CBEA 3SE8H 4JPWL 3BUDA 3ZE1E 5KS9E 1FFNB 1JGEA 3QXAA 3TVMD 3BQVA 1G0XA 4KK9D 1WA1X 5CJOH 3BIKA 3F83A 2RGSA 2XOTA 4YHIA 3KPQB 4PJGA 1FCGA 2GEEA 1MFEH 4FG0A 3OAUL 4X6CF 5H94B 2AI0L 2XLLA 4PJGF 4ZS6C 2VSMB 5GRUH 4ZMYA 1JBJA 3FQUA 4I3RL 3P4OA 3LXAA 2JCCB 5C0IB 1FL3B 1E6JL 3LEVH 4OM0H 3QS3A 4NZUH 4P2OD 1J86A 1IEAA 3EBIA 1A66A 3G7TA 1WBXA 1N26A 3W9EB 1E65A 1H0DA 1KLGA 5GZNA 3SDAA 1AD0A 4Y2DB 1AGFA 1P4BL 1Q9OA 4XBGB 5I19L 4XWOD 5GGVY 2V5YA 2KH2B 2D7QA 4JJ5A 4WSKA 5D7IE 1FORH 4L37B 4Z3FA 1P5UA 3H4HA 5BRQA 3S88L 1Z0MA 3FSAA 3FO9A 3QNYA 5T1MA 4Z3TA 4JFQA 2QSCL 5FYKE 2EXYD 3DTXB 4PRAB 1C5CL 5B7MA 1V05A 3ARGD 3GMPB 3MGOA 4FN0A 1FG2A 3VWKB 3LQAC 1LD9A 2PWDA 3MLTA 2F1BA 4QRFA 1TVHA 5K9QG 1AFVL 3UTTB 1N8OE 3DJ9A 3CDYA 2VAAB 5CHNB 1CF1A 5KYYB 3BH8A 1QSZA 2UWEB 2AKRA 1JZ8A 3CVIL 2YKLH 1D6VL 3W3BA 5EOCL 4A2GA 4KAQH 2V2XB 4M43H 1IO4C 2XWBB 1KG0B 2BZCA 3L5WA 3PHAA 3OG4B 2AQNA 3NJGA 2VCOA 1FN4A 5I76B 5BZZA 2VITA 4A7VA 4OZHA 5IG7B 3UP6A 1KPUA 1KCSL 2B1OA 4L4VB 2NX5A 1HXYA 3ZHFA 3UDWA 4JFEB 4P2RD 2ZKMX 2X1PA 2X6AA 4RMBA 1HSAB 2QR0B 5DRNB 5B1BB 1MAML 5FYLH 3BMWA 3VD5A 3H42H 2ZIDA 4PY7B 3UDWC 3BEWA 1NBCA 2PKDA 4M7KH 2EKJA 4MSWB 4PSPA 4HU8A 5FEBA 4GUPA 3LZQA 1COBA 1DVZA 3MXWH 1QLRA 1ZVNA 2FATL 3HBGA 4PP1C 2NUTA 1BYNA 2R0ZL 5IT2H 3RVVD 3KWUA 3VXPA 3RJQB 4OCRL 4H25B 3GSNL 1N2RB 1L0PA 3AWEA 4WK4B 1WCQA 4F2FA 5E2VL 3KNBB 3EGSA 1BMZA 3RWHA 3Q8AA 3FFDB 4M7LT 4BA0A 2OR7A 4G70B 2CXGA 3EBHA 1ZXQA 2IFFL 4H44C 2YWZA 4Q0XL 5D4JA 1NCJA 3QR0A 4O00A 5IK3A 1Q9LB 4OY9A 2XV0A 3ESUF 3DPBB 1OSPL 4YBQD 3EKCA 1ID2A 3U1SL 2BNQA 2P52A 2ZAGA 3V6BR 2X4TB 2ZKWA 3WS6C 3CDCA 4XBPA 4Y1TA 4NOFA 3BHBB 4YSAA 5GRUL 3GI9H 3L6FB 3MV9A 2R4RL 1FH5L 5B39B 3L16A 5JTWA 1I8UA 2Z31D 3IBEA 3DRTB 4PV8B 1V10A 2XQ0A 2DQCL 3BP5A 1WEJH 4MWFB 1YEDA 3KLHD 1L9TA 1UEYA 3PFQA 5DEFB 3SD5A 3INUH 3FO2B 1ORQA 1UUNA 2UZIL 3THML 4JGUA 4AIEA 3NABH 4YR6A 3H0TA 5I1IH 1L9OA 3DX6B 3T3PE 5JIDA 5CILL 3KGSA 2CHXA 4U2YA 1J8HE 2GVYA 3WFDL 2GJZB 1IVTA 2C9VA 3P3SA 5DT1L 2JKTM 5HHXL 1W9XA 4NN5B 5EF2A 2WQVA 1OSEA 1QHOA 4F24A 5E8PA 1KEMH 5AYUH 5T1JA 1P7QA 2OS7A 4MBRA 1CFVL 3HLAA 3VE0B 2B14A 4XO3A 2AJ3B 5C92A 5HGHA 3X12A 1G9EA 5DJXB 1CI3M 1RMFL 1VFBB 2EE2A 1CTMA 2FL5B 4HLZH 2M1KA 4N2LA 3R06B 4TVPL 5SWSD 5D6DC 1QVOA 2JB5L 2Z65C 5CLWA 1UM6H 5T1LA 5CJ5A 2APSA 1N6UA 3AXLB 2ENSA 2ICWJ 3EYFB 4EOWL 3VGDA 1UA7A 3BAJA 2X6BA 5TFSL 1CDCA 5EEXA 5FYJU 3U0TB 4AW7A 5IMMA 3FQ4A 3S37L 3LZRA 4QOKD 4FQ2L 3F6IA 2ATAA 2VXSH 4XXWC 3JSSA 4XMKL 1NBVL 3JTTB 3OVUB 4Q2ZB 5E4IA 5EC1A 5LXGH 3FZUD 2YPVL 4Q4EA 3NH7L 5DUML 2Q7AA 2MQ3A 4OAWA 5EO1A 3UTQA 3DIDA 3FQXA 4M48L 3S3DB 3VRIA 1LO0L 4N8VB 3WKML 5AVRB 1YMME 2NPLX 5DVNA 2V7HB 5EU5A 3GXUB 5C08A 4NZDA 3VFSA 2NXYC 2W8CA 1ZPUA 3Q13A 3W0WA 4M5ZH 4RGMB 3HZ3A 2LVEA 3DSNA 1MI5D 4NRZB 3ZVVA 3APNA 2CA4A 3KW8A 4XR8C 4Y7MA 4QRRB 3CTTA 5D7LD 1QI4A 3B7SA 4FQQA 1D5XA 2CHNA 3QWNA 4L8BA 2E6PA 4PJ9B 3JVGA 1DCLA 1WBZB 4QRRE 3P3YA 5I5MA 3K6OA 4FCHA 4RZCA 2IF7A 4GSQA 2VN4A 1XGYH 3L3IA 5JUEL 2CRMA 5DZLA 3HMXH 1QYGH 4R0LC 4F57L 4F8TA 1HZLA 4F37F 5EBLB 3MV9E 2WWOA 3KYKH 3KYMA 1S78C 4QF1A 3L2NA 5IM7A 3OAZK 4HYTB 3C08L 3KCWA 3SB3A 3BWAA 3KR3H 4EZLA 4YHLH 2O72A 4KKLC 3AXHA 4YLBA 4AXWB 4HIXL 4PJAA 4IGBD 3ZTNH 3MSPA 2ZX6A 5EEZA 2R4RH 5DD5H 1FH5H 1BAFH 5FOBB 3LMJL 2Q7NA 1SPDA 5KVGL 4OZIA 4GRLC 3D85D 1H19A 2FJFA 4KX7A 1LWHA 3CDGA 2QFRA 4OI8A 3LHPL 1NDMB 1MNUL 1JN6A 3RWIB 1DZ0A 2NW2A 3BP6A 1GGBL 3GK8L 4L0PB 2XXGA 1A7RL 1OT1A 3QQ4B 1LMKA 2H1XA 2PPEA 1NUFA 2RACA 1HCFX 2HJKA 3WFDH 4N28A 5F1OB 5E9DA 3VW3L 3QCTH 4H1LA 1I8MB 4D8PB 3W38A 3L48A 1R75A 1EO5A 4JO1H 5FYLD 1BJ1J 3W0WD 3LEXB 2WJ7A 2VXTL 2AXHA 2YLHA 2DBLH 3QUML 3H7BA 3IMSA 1DBKL 3MRCA 5C6TH 2XWBA 3L5WB 3BYYA 1T22B 2ZCKH 1KULA 1P6WA 4LLYA 2LU3A 1KZQA 1QI5A 3NT0A 3UJTH 3IAPA 2OKMA 3VGHA 3FULA 3T3ME 3VFOB 4DPCX 3UTTD 1URLA 4P5KA 2PUQT 4XC1L 4KRPB 4FFZA 3WE6B 4XPHL 5MEQB 3O8XB 1CB4A 2UX6A 4GW1A 2VDOH 1D9KC 3S37H 3KPNB 5HGDA 1ZVSA 12E8L 4M7JH 2BIPA 4M5YL 3B2UD 4JPVH 2AEQH 1KTJA 2VXSL 3SGEH 2X2IA 2KZWA 3FO9B 3BZFA 3IJHA 3B5GA 3AUVA 2NUTB 4OBSA 2ED9A 5I1EH 1QFWH 2P5WB 2EUXA 3MXVH 2WXKA 4JJ5B 4JFQB 4WAFA 1BZ8A 4HH8A 1JS4A 5D1XC 1EO7A 4MNHB 2HFTA 3WJJA 2JIXA 1R3LA 3QHFH 2P5EB 4RWHA 3S3PA 1TO5A 2X4SA 4GG8B 2NZ1A 4KZCA 3QFJA 4ZW7A 2R2CA 3HG1A 5GGSA 3BD5A 5E8EB 4H2CA 2Y7QA 2YO3A 1JWUA 4H0GA 4H13C 4NQXB 3HE7C 1AHKA 3S98A 3KPOB 3VVWA 1AOZA 4WI8A 1CXFA 2H3XC 4I0CC 1I3RB 2XZCL 2VN6A 2Z34A 3D48R 3FQUB 4YPGA 5C71A 3VXRE 5JDJA 5JUEH 1B9ZA 2NY3B 4LE8A 4EXPX 4EZKA 3AZUA 1FZJB 1C7SA 3LKRA 3SQOH 5AW2B 4LQ1A 4U0RB 5B21A 3L1EA 2JQMA 3ASWA 3C08H 2VABB 1PG7L 5C0AE 4KQ3H 4HD9A 3GXNA 4JHWL 5C0ND 2P7TA 3CZLA 2ADJB 1BQRA 4JZJB 3ATAA 3FFCB 5CJQL 4E68A 4MJ6B 3P4MB 3PUCA 3VH8G 3WEXA 4LXFA 1FIGL 5EBMA 4FABL 5C7XL 4YN3A 3RIAK 3HZKB 2VIRB 2HJFB 1EAOA 4LGPB 4XNZB 1DN2A 4JM2D 3RNQB 1JNHB 3AS2A 2WQUA 3O3AA 4HOXA 3B2UC 4X7SH 5K93A 1ZLVK 4P5TB 3H9ZA 3FU8A 5GZOC 1MJUH 2NUPB 4N9GA 1JGUL 1XGPB 3GXTA 5F7LB 3OB8A 3UADA 1OE2A 3DPBA 3MRQB 4F8QA 5EU6E 3T8VA 4J3WA 3D0VA 3N85L 1I9IH 3FRUA 1SFHA 3QNXA 1QWNA 2NZ9D 2OMTA 2X4TA 5BOZG 5JHMA 3VGAB 4DKDC 2LR4A 3EFFA 1NC2B 3VXTB 3ML9A 1ZT4B 5FA4A 5HDWA 5TDPA 1WBYB 2DBLL 3QUMH 5DZPA 2VRKA 2ZSWA 4HGMA 2MHAB 4M93C 2WCPA 2ZCKL 3FB5A 2D7NA 1YCSA 3TFKD 1GTNA 1DP0A 3OKNB 5FO9A 1SN5A 3TYFB 2GJ6E 5IMKA 3V0GA 1NGZA 4P2QD 5AOKA 3K6SB 3U2SB 2AGJL 1U8QB 3QH3B 4W9JC 4PHZA 4GAGL 4GAJL 3UTTE 2B0SL 5GJTL 2ODHA 2VDOL 2DI8A 5IVXF 4JFDE 3G9VA 3SE3A 4XXDB 2H9GB 4HJJH 1TVDA 2HAZA 1YEDB 2V33A 4D0CA 3DX6A 3H3KA 3EG9B 4JN2A 5I26A 8CGTA 3D3VD 3LJ3A 4BK8A 4JPWH 3WIAA 5FHAL 4NJ9H 1RZQA 2ZCLH 4FTVE 1G9ML 2J2ZB 3P2DA 5E0FA 4BE6A 3GIZL 5T3ZH 4U2ZA 4PS3A 2Y1AA 2BCKA 1VIWA 5F7HA 1V3KA 3LNGA 1CDHA 4I5BB 4P0DA 3FU6A 3H55A 1KIRB 2VRAA 2QDWA 4BXVA 2O5YL 2IDCA 1UOVA 3O2VH 4R96B 2AABH 3AS0A 3UTZB 4OBRA 1HI6B 3SSGA 4JKPH 3EYVA 1KY6A 1KV3A 4JBSA 2A6IA 2PPFA 3L3JA 2ZNWA 5DD6B 2JQZA 4BXSV 4ELME 1A0QL 3NSJA 1MLCA 3WHE1 2A5UA 4I4WB 2CJ3A 3SDAD 1A6AB 2HUEA 4RFOH 3TH4T 1GMIA 3QUMB 5K39B 5KYXA 1FV1B 3HI6L 3DX0A 5IQOA 3IM1A 4U6VH 3UBFA 4JFEE 4QNPF 4PGJA 3TTSA 2I60H 3ZZSA 1RUAL 3SBRA 2F54E 5IB1A 1J9RA 3H0TB 3HS9A 3IJ9A 4NCDA 3TBYA 1DLHA 3EDDA 5DJ8B 5EUKB 1RVFH 2P1YA 2D73A 2WXMA 3X1GA 1G1KA 4MAUH 4AVKA 4IGBB 4XVSL 3I6GB 4FFYH 1WAPA 2JSFA 1AG6A 3VFRB 3GJFH 4HIEA 5C0FA 1QSFD 4ZFZA 4FZ8H 2BSBA 4K7FB 5E6SB 1W80A 1YPZE 4JDVA 4AYID 5IUCA 5L7XL 3DGGB 1ZY9A 2R0WL 32C2A 4GMTH 2DMBA 4N6RA 1TTCA 2DMGA 2J21A 4KZ0A 2ALWA 1NCDL 3OLIA 3L5XH 3X12B 5HGHB 2ALAA 3MLZL 2ZXBA 4RFEB 1S5HB 3KPSE 5DJZA 3N85H 4JRXE 2C7UB 4MD5B 4G7QB 5C0CE 3KBHE 4X6BB 1O6VA 4IRSC 3ULUE 1DBJL 3A4AA 4XPFL 1BD2B 2DS4A 4LDCA 4J3OG 1IZKA 2CDGB 3OKKB 1DJXA 1RK7A 1O5PA 3FS9A 5HYIA 3HUJA 5HHOE 1IJ9A 1DN0A 4BKSC 3DO3A 5KVMC 4JVPA 5ERWA 4X7EC 3VSUA 3C5ZC 1Z32X 3UG5A 2EEAA 5IROA 1JZIA 1JK8A 4LSRH 1FGVH 3I74A 4PG2C 4CMHC 2FATH 2JCCE 3MLXL 1LLAA 3RQ3A 1GC1L 15C8H 4RMQA 4J5VA 3CC5A 2OSLB 4YIQB 5E9DD 2CALA 4MMYB 4MDRA 1YZZA 1XCTA 1ZV2A 3O4LB 4G1MA 5E2VH 4KVCL 4XNAA 2XN2A 3LQZA 5KG9A 1NCBH 4GLRI 4LVOC 1C5BL 3GIZH 4LVOB 2P5WD 3OPUA 3T77A 5KS9B 4EIBA 3ES6A 2V5RA 5LKNA 2ZWKA 1CDBA 1NTDA 2OCJA 3X17A 5JHLL 3TX4A 2CO3A 3MBED 1YG9A 3CFQA 4UT9L 4K7PX 2EQDA 4P5SA 4FLOA 3HRZB 4O9HL 1S7VA 1PZUB 1XEDA 2XNAA 1ZSHA 2Q8AH 1E27A 4W1TA 1KYDA 1LEIB 3D1MC 3ISWA 3DI2B 4N4YB 5AW5B 1FL5B 3D08A 1FF5A 2QADD 2R69L 3ULSB 4R84A 3ARXA 2J1YA 2FX7L 4XODA 3O2WH 4MXQD 4NEHB 2F6AA 1MQ8A 1KZYA 3PIQA 2OMVA 3JTSB 4C58B 1B4JH 1NIBA 4B5ZA 4FC3E 3A6CL 5EZLA 2VE6A 3DO4A 2PPCA 3VXOB 4EI6B 2CJTA 3MBXL 3N1GC 1KIUB 1NZRA 2CIIB 4GKZA 4I87A 4MDJA 4F8NA 3NGBB 5D7LA 4N2CA 3N9GH 2PWFA 1RZKC 4PJ7F 4K3GA 4KDTC 3N40P 2NY5H 4M3JA 4GXVL 2OP4H 2ARJQ 1KJ2A 4CUCA 1NGXB 3LN5B 2UZPA 1MWAH 2X4SB 3S2AA 4R9HA 3KPSB 3KPOA 2F54B 4PLOB 4QY8A 3QJSB 5FYKH 4HKZA 2A0LD 4GJTB 4TS6A 2YAPA 4IBVA 4RMVA 2W91A 2BXZA 1XGQA 3LNIA 4UUJA 3TN0C 4GMTL 2EUWA 3GQFA 4QHLB 1CL7I 3IJYA 4PJ5D 4M7LH 3ZZLA 1ZIBA 4OFIA 2MOVA 3V5KA 5FAAA 4ODXA 1U58A 3G04B 3I02A 3D39E 4LBEA 4A55A 2F9BT 5I0VA 1T0MA 1HQ4B 1JXFA 1JHTB 3NQKA 1SY6A 2D31A 3TYFA 4UV7H 1BM3L 1LWJA 4FFVC 3T1FA 4JRXB 3RAJL 3B3BA 4G9FB 2P7TB 3GSWA 2ZKXA 4Z7UA 1BEXA 3CMOH 5D7KE 1CXHA 3GIVA 3TZVD 3WKMH 3WO4B 4DVBA 3IDGB 5F8QC 4WJ5B 5KYNA 1EMTH 3TA3A 2GYSA 4HWBH 4P2QB 1P7QD 3PJSB 1SUJA 5K59E 4KY1L 3T4AC 1T3FB 3AT8A 3MOBH 2YPVA 1E90A 15C8L 4I5BA 2XIBA 2QGDA 4K3JH 2DLHA 4Q58C 3DBXA 5J3HD 2WTPA 1JGLL 4WEUD 5E2TL 4G8GE 3PAUA 5IVZA 2ID5A 4KROD 3QE5A 3WELA 1HOEA 2WVSA 2H32B 4F7EB 4N68A 4XN7A 4PBWD 1IC1A 4PVLA 1AO7D 4AG4H 4TNWK 1C5BH 2R83A 5IF0B 4X9YA 1P0SE 1UM5H 4FYTA 2CO1A 3BZDA 3NCFB 3C6SA 4HV8A 3ZMNA 2CSPA 2A1WH 1JWSB 7TAAA 3FQ1A 1BSIA 2LABA 2IGFH 1JZ6A 4MMXA 2CJUL 1J0HA 2D4DA 5J9PA 4RLDA 1AGEB 1BAFL 1NGZB 3T4AA 4BH7B 1WF5A 3LMJH 2O5NA 2VABA 1MI5E 1CYXA 3OKNA 2XPZA 4LP4A 2D2OA 1NQBA 5KTEH 4PP1D 1JK9A 3E7JA 4ZQKB 3CZEA 3GNML 5FM5O 2P43B 4N2DA 2NY4B 4PQXA 3A6CH 4XOAA 1OGTB 5AVXB 3IFPB 4R2GB 1U92B 2V17H 3FHEA 4QIRA 3MXWL 3HG3A 5ADPL 3QJHB 4IU3B 3K4DA 2EIEA 1KIQA 3J07A 5LGYA 2J73A 2VZVA 4M3HA 2CU9A 3J27A 4A6YH 2KZKA 4Q6IA 1WZMA 5I17B 5AVVB 3MRQA 3QJVB 2E74C 2X2HA 4G8AC 2XKSA 3MROA 3QIWC 4BQ9A 3TN0A 1OSPH 2EVHA 3BP4B 3U1SH 1X7QA 2L7QA 2F58L 4WHCA 3BH9A 2APVA 1ZK5A 2PW2B 2QDVA 2KPWA 3QUMA 2QZ5A 1TTFA 5KYXB 1A6AA 3K71A 4XGZB 12E8H 1A5FL 2DEYX 3OKKA 3T0EC 3QDGE 4HS3B 5L2JB 1I4FB 4EAEA 1YEJL 4PI0A 1DUYB 4UINL 5AL0A 3SDXE 5IP4A 1I53A 2FIRT 3FAXA 3NN8A 2YPLE 2ZCHL 4LLUB 5LO7A 3LH8A 4LARH 4PJFF 3FB7A 3KYNA 4IBSA 3KH3A 3ZE1F 1IC4H 1WD9A 4PM1A 3NEEA 3RAJH 1BX2A 3GBDA 1V7NH 4MA7H 4Y4FB 4QTFA 4EXKA 1B6UA 2OZ4H 4DFIA 1QFHA 2QADB 1WT5A 5T3XD 4K7FA 2WWNA 1EMTL 5LWYL 2HUHA 3LDBC 4HIEB 1I7ZB 4HWBL 1KEGH 2QQKH 32C2B 1SJVA 2XKUA 5GGRY 2V0AA 1B9KA 2BVYA 4IGBA 4TYUA 5H94A 4JDVB 1XFPA 2AK4B 1HHKB 1BZOA 1OSZA 1PKQE 5DHVA 3KPMB 1CFVH 2IBBA 5DJAA 3FTUA 1NKRA 4OLEA 3L17A 1TJMA 3AUWB 2BWDA 2OMWA 4BZ2L 3HC0B 2NDGA 3CN4A 2NX5E 1DSFH 2XTJE 3LRGA 2X4RB 2VZUA 5AZ2L 1FVEA 3OHXC 3NTCL 2RQ8A 5JOPE 3CFJA 4QO1B 4EOWH 2H1PH 4GO9A 3MLUH 4LVNC 5CFAA 1KCVL 1LEGA 4JZNB 4GUOA 4O51A 1WJ3A 3WEOA 4FQ2H 2KERA 1J8RA 2G60L 3IE4A 2AQ3A 2QPSA 4X9IA 3T6QC 1MW1A 2WOBA 1G6RL 2CBQA 3VI3B 4EQ2A 4QHNB 1G7JA 1EAPB 2DAVA 3EUUA 1KJ2H 1XIWB 1QRNE 1QHQA 5AWNL 4WI5A 4H8PA 4QRPE 4JZOA 3GNMH 4GRMB 1XCTB 1K5NA 4G1MB 4GFTB 4L8SA 5KSAC 3ARFD 1MF2H 1YEGL 4ECNA 4OGZA 4UI2A 1LK3L 4EZMA 3D4ZA 4QRUA 2J25A 1CIDA 4HUVB 4X6DE 3CVHB 1OY3B 2ICEC 4QD2E 4OQTL 5ICXB 1JI2A 3LXUX 4F7TA 5J1SC 2WINA 3DX7B 4Y4FC 3BE1L 4CGTA 4NRYA 1U2HA 4TF4A 1QQDB 4X8JB 3REVA 1GVIA 1HL8A 3U7YH 3MCKB 5EZOL 5D2LB 3FCSA 4PR5B 4TQPA 1XBRA 1UXLA 2VO5A 1QWUA 1WAEA 2NY7H 4QHMA 1E8YA 2CDGA 2EDFA 5D70L 4NO0B 3KR3L 3BKYH 3BP5B 4HKJB 3HI5H 3P11L 1FBIL 3FO2A 3TH2T 5E94B 4YQXL 1KBVA 2IQ9H 4HJJL 2Z4TA 5IWLA 1YEJH 2WQXA 3N40F 4IRJC 2K4AA 5E8NB 3FTXA 3B7UX 3OMZA 2JELL 4ZOEA 2K7PA 3OKLB 2W65B 3O9WA 2BVPA 4Q14A 3UYRH 1UENA 3VGBA 3BRFA 3SHSA 2ZCLL 2FT6A 2F1AA 3DIFB 5JPMC 2VDKL 1WFJA 4PN6A 3LN5A 2X1OA 3LHAA 4PB0H 4MA7L 2DQUL 3Q2WA 4U1KB 4GG6E 4GO6B 2JCWA 8FABA 4G59C 2XQYK 4NQEA 1N59B 1KEGL 4KDWA 3PWPE 5LCVA 2JKJA 3OXRB 2XVLA 4EN3B 1QLEB 5FHBH 4B9YA 5GIRA 1WIUA 3FH5A 3PF2A 5TE4L 5E9NA 1RPUA 4DIXA 1OO2A 2DEXX 1HTYA 3G5ZB 4R2GD 5DD3L 1T20A 2ZP9A 3OKDA 2YD4A 2Y6TE 4NQVB 2ZP0T 4UT6L 4LIQL 4X4XA 5LVEA 3K74B 4GT7A 1FJ1B 2SEBA 2IPKB 4MWFA 2DF3A 3D4GA 4M9OA 2WQAA 4M7ZB 1SF5A 5EUOF 2HLAB 4NUGL 4R26L 3UXFA 3KLAA 1USZA 2QR0A 1AY1L 2NR6A 1RZGB 3GGWB 3G3LA 5EC1B 2FHCA 4LSUL 4BSJA 2BHZA 3QISA 4UT7L 2NZIA 4HIJB 3UEQA 4HC1L 1HDMA 4JPVL 5LAXB 2W92A 4HIIB 4N0FA 3STBA 4X6FA 3VI4E 3T6VA 4U33A 2R2HB 2VLMD 3TJHD 1KIQB 3DO7A 4DUWA 4P2QA 5SX4I 2D0HA 4XNMB 5C0DA 2VT0A 1G6VK 3IDGA 2AJ3A 1W6LA 4JO4L 3ORJA 4Z7OF 3RWHB 1INEL 4NDMA 5I75B 4HDIB 3KL5A 2FL5A 4L8BB 1F11B 1KCRH 4F33B 5F1NA 1NCDH 3QRFM 5BRZB 2XA8H 5D1XA 4YZWA 4DPRA 1BECA 1KY7A 4GKOA 3RWJA 3VE0A 2WY3B 1V54B 3WS3A 4GG6A 2DQHL 1Q1PA 4OCWH 2VZTA 1NINA 4J3TA 2AJZA 2ATKA 1YVLA 4OQTH 3SPVA 1X5HA 3O4OB 2HB0A 4C56A 1NKGA 3B1UA 3EDEA 3SKNA 3SPGA 3T08A 4XXCA 3BH9B 2HT4D 1T0MB 1CD1A 2B5IB 3CGTA 5JW3L 2ESVB 3B2VH 4M02A 2ZUXA 5KBPA 1JWSA 2ZOKB 4EKXA 4FL4B 4GQ9L 5DEFA 1AS6A 1CFNA 3Q2NA 1PJWA 5IEKB 4Y89A 4CN1A 4KQ3L 2EINB 2BNRE 2YAHA 2BH0A 4K4KA 1F90L 4PJEB 1FBIH 5E08H 3Q6FB 1CZ8H 4P5RA 5T3XL 4FNSA 2NY0D 1A6VL 1A9BB 2R23B 5DRZA 3IVKB 3HCVA 4DSYA 4BH8B 1PZ2A 5F89B 5DC0A 3R4RA 4RZCB 1I8MA 2VZOA 1H9DA 3IDXH 3F64A 4AYFB 5I0DA 4TSBH 2EYTA 5AAMA 5FX3A 3KDMA 3JWOH 4KGLA 3WKPA 1LE9A 5DJ2A 2ZYHA 1DJSA 1FNSL 5GRYA 3ROOB 3DHJA 3IJ8A 3ZTJG 2IH9A 2VQTA 3FC8A 2ITCA 1A6ZA 3GM8A 3HG1D 3CFJB 4QO1A 4LPVA 3DX1A 1N7ML 3ECBA 4PJAB 3IDYB 3MBEC 1J1XH 1F4AA 3MAWA 1KOAA 4Z7VA 5FOBA 1GMEA 3EFOA 4NC1E 3VYOA 3QXDA 4LIQH 4J3OF 5FKAB 1TJHH 1H3TA 3T0AA 1Z66A 4HS6A 2UXTA 3CVHL 1URZA 2EIBA 1RK1A 4PRIE 2HG5A 5CN2A 1ORSB 4FQXC 2VLJA 4NQSA 3MBXH 4P3CH 2XPGB 5C0JA 5JOFB 1FC1A 1S7WB 2NLJB 3APDA 3IN2A 2XQYG 5ENWA 1HE7A 1DBMH 4D8PA 4DETA 1MFBL 5DD1L 5TDOB 4YDIL 3QCUH 3CFKB 5C07E 3U0WL 4IDJH 3TNMB 2F08A 1MWAL 1G9MH 3CPLA 3S48A 4PJXE 3SDYH 5C09B 3E6FA 3FL7A 1F58H 2DWEA 3X13A 4YDLB 3DSNB 1K4CA 4XN1A 5IKCB 2NY1B 3VRJA 4ELKB 5E99H 2VMEA 4QRQA 2UWEE 2EYRB 2XHNA 4PTTB 3AADB 4KKCD 4FTVB 1IGYA 1IGIH 1JNLH 1ET7A 2NQDA 2EIMB 3U0PA 4V1DE 4PFEA 1LEGB 1U3HA 1OGSA 5LQBH 5JPMA 4DPBX 3TT3H 4HJ1A 3U46A 3GJEA 3WJMA 2FX9L 1NFDF 1GIGL 1OP5K 1DJGA 1G9HA 4X5LA 4N2BA 1JRHL 5AOIA 4O2EB 2DD8L 4UBDD 2DM4A 4BJLA 4JPQA 1MIMH 3Q05A 2YD1A 2Y3AA 3BJ91 1BM7A 4POZD 2XA3A 1J1PL 4U6VL 4GS7C 2FECL 3F2LA 2J56A 4I0PC 2E5EA 4NUJB 5C6PB 3BSZH 7PCYA 1Y18A 4MQ7B 4CAGA 3G5WA 4GG8A 3QUKA 2YD2A 1IBHA 1BQKA 4FG4A 1R3LB 3EYSL 2V6HA 3P0GB 3T09A 4BFIB 1NCCL 3U48A 3BP6B 4UNTA 4KFMA 3BGFB 3QFJB 3ZRCC 3PFUA 2XIIA 1KTCA 1R5VA 4OW6A 4CSTA 3STZB 1QABA 1KUMA 5ACLA 5CP7A 1SHWA 5FOJA 1SLUA 3MLRH 3EDFA 3KPRE 4IRSD 3WY3A 4RMTA 3EJQA 5KVEH 2OMWB 3SO5A 4PBVC 2EIDA 2XY1A 1FZMA 4NRYB 2WUCL 1BBJA 3UABA 1U8IA 1B88A 1TCRB 2H2SD 5CBAA 2XVKA 4KTGA 1CGWA 4DN4L 1JZ2A 3JWDH 1RLBA 2QELA 4K9EL 5L2KA 1G5AA 2BXYA 4LNVA 4XMKH 2ZF8A 2AEOA 1IKNC 1OARL 3CD4A 3EGXB 5DQ9A 4N2OA 5DSCA 5C08D 5KSBE 4CMMA 3AU1A 3FTWA 5LNGA 2ZD0A 4ZS6D 3RI5K 1NOAA 1TETH 1J8KA 4HKBB 3G6DH 2VDLL 4XPBL 5E8NA 4I18B 2UZYA 3FTVA 2XWRA 2A6DA 3GXMA 2O6FA 3AVEA 1S7XA 4P4KA 4XVJH 4YBLB 3VXMB 4NZJA 4OJEH 4BV1A 3ILQD 5I15L 3HR5A 1I9EA 4ORZC 2MWCA 3IGLA 3QQ3B 3D34A 1ZLWH 1ZA6A 3ZHLA 3RGVC 2YS4A 2Y7LA 2Z7ZA 4OFDA 1VGEL 1OPOA 4RAVB 2AVFA 3IGAB 4Y4KA 5T1LD 3ETBF 1NCBL 1RKRA 2PO6B 4PRNA 4XHJC 4K7PL 4J3XA 1X9UA 4NKMA 3ILDA 4Y4FD 5SWSA 2RHEA 2W59A 3VFTB 1F58L 4G9DB 3FQ2A 4HJGA 1ZS8A 1KPRA 4GI9A 4NO3B 4ZAKB 5CHNA 4NBYB 3PDDA 1JVKA 4EN3A 3QUGA 4ZO9A 3RDJA 2Q10A 2D03L 5J11B 4HGKC 2P8PA 5D1QE 3U1PA 3L1FA 1RK0B 3O45B 2FYYB 2R69H 3QRBA 2EDKA 4OCSL 3B2MA 1NBZB 3K6FA 2RBLA 2E46A 3BKJH 3EBAA 1EFXA 3PABA 4HJTA 3UOAB 1OSYA 5B4MD 3ZL2A 3T0EA 2KLTA 5CU9A 4S1QH 3MACL 4HIJA 2J4WH 3UZEA 3DO7B 3OKOA 3VFWA 5CCHE 1J87A 1YY9D 4K0OA 4Z7NB 4AYDC 1WZAA 1QLFB 3DETC 3EZ8A 4KPHL 1E5BA 2XIDA 4KTEL 1E8XA 1PAZA 2P5WE 2NYYD 2P5ED 3BMVA 4JN2B 2Z3FA 4N3UA 5DHXB 1YMHA 4FA6A 43CAB 3BVNA 1YLBB 4UDTA 2VXTH 4TLTA 2C1PB 2YA1A 3C5JB 5D9SA 1NAMA 2NXZB 3FN0H 4AQAB 5CCJA 1TXKA 3MN8A 5K1NA 4EN3C 5SWZE 4OF7A 4Z7WE 5ESQB 5DJ6B 2ATPA 3B8YA 4R8WL 3AGVA 2ORBL 4G7YH 2H4EA 2YEQA 3B5HA 2EECA 1P9MC 2OZNA 4QLWA 3BLBA 2AJZB 3F6LA 4PW4A 4X6BA 1D7FA 1MWAB 5F88A 3WEMA 3WS3B 3IRCA 3BW9A 1A47A 3B9VA 5HHNA 4A2DA 4XHJD 2F74A 2UZXB 3CHSA 4Y19D 2AC0A 1KB5H 5DK0A 3SYOA 4G6AC 1HKLH 3GMRA 4Q9QH 4LLVA 3DECA 4F2ME 5HVFB 5FW8A 4FLQA 1PL3A 3TGXA 3QWRD 5C0JB 2XWEA 4PJXA 2EDOA 3PJLA 2G3NA 1A4KA 4I1PA 1JHLH 3P4LA 5HJGA 3U2JA 3MXVL 3HJ0A 5LAXA 3S5YA 4BUQA 4JO3H 1HSBB 2R2HA 5ALCH 2QLVB 4HOMA 4BZ1A 2ZUQC 3BQUD 5CS7A 1TZHA 4KKPA 5EUKA 2BW4A 2DI7A 4X7DC 5GQBA 3BUTA 5EEUA 1W0YT 1NMAL 4ZT1A 4GW5A 3PYCA 4X80H 1R3IL 2CDEB 4K5OA 3O41B 4R7DB 3GDCA 1KENL 4NI6A 4CC4A 2YPLB 2AQ1A 3WNKA 4MLSA 1K4DA 4X0KA 1BOGB 4LSVH 5FGCB 2GABA 2WLLA 4YGAB 2CCVA 2ZKHL 4ESKA 2R9HC 3CE1A 2R7EB 3HE6B 5D5MA 3WTYA 4PTTA 1EJOL 1F4YL 2A74B 2V5SA 1EO8L 3GT6A 3VX1A 3QULA 1H6EA 2Z1KA 2L7UA 3WO3B 1DO6A 1V3MA 1K8DA 1VENA 5F96L 1AC6A 4U6XB 1C7TA 4Z7WB 2ICCA 3BKYL 3MRMB 3PWNA 1NCAH 1NFDE 1X5AA 2C4FU 2E76C 3M6DA 4HAGA 4LPTA 3VFPB 5E2WL 3W9EA 3X3GL 2HG5B 1L6ZA 2E9GA 1OK8A 3MV01 5IGXH 3WFHA 4NZTH 3ZW3A 3O4LA 1B4RA 1EUTA 2ED7A 4PJ8C 2QGCA 4ZUTB 2VKXA 5DUBA 2AV1A 4PJIA 4IOFC 4QRRD 3L3HB 4S1QL 2J4WL 4LSPH 5E00A 5GZND 5BUPA 3VFGH 1LHZA 3OHXB 4PJ9D 1IC5H 3V0VA 4IQHA 4QRPB 5T5NG 3SPJA 3HOGA 1S7UA 1PD1A 4ZW8A 4YE4L 1ZPLA 1U8OB 3RPIA 5L0QB 1QLEH 4PJAF 2OULB 4DO4A 1E28B 4G3YL 2R0LL 3NJIA 3C60A 3CZFA 3OHMB 3MRHB 3CX5J 3GSQA 4ZTPH 3LYRA 3AROA 1BDYA 5DJ2B 1SN0A 3AM8C 5E5UB 2AK4E 5TE4H 2FO1A 2OQJA 3L4XA 3E6HA 2PWEA 4HS8H 1S7VB 4N2HA 1SFDA 2XWTB 3ZDXE 1EHAA 2EDYA 2ZPKL 2A6JB 4K8RH 4JFFA 1B0RA 4AIXA 4RSVA 1F8TH 2R15A 1HXYB 4Y8DC 1Q38A 2HJLA 1KLGB 3QVAA 5DRNA 2IADB 1I82A 3OX8A 1IEAB 4AL8H 3F62A 5F6HI 4N1HB 5D1XE 2CIKA 1EXUA 2EEFA 1AMYA 2F2HA 3TWCL 4M4RB 4UT7H 2HX8A 1ORSA 1HKLL 2OYMA 1J9SA 4Q9QL 2X1XR 1XF3A 5DC2A 2UZYB 3D87B 2XPGA 2IANE 5KZCD 1FSKB 3SJVD 2OSLA 2X0VA 4WW2B 5AKSA 2AJVL 3STLA 4OV5A 4TUKH 5JO5B 2H0JA 4YAQB 3MOQA 3UG4A 3ZKMD 5CLXA 2DQTH 5F0MB 4F58L 1FO0L 2VAAA 2L04A 3E9UA 2CKBB 3CN1A 1NFIB 3LZPA 3MQIA 4UQCA 2PO6A 3NJNA 3MV7A 2IDTA 1NUDA 5FUCC 2KC0A 1X9LA 2AQ2A 5L9DH 4BEIA 5DFAA 1R3IH 3KPLB 4CVZA 4G8EB 5IHZB 5DCCA 4QRQB 1UT1A 2AZAA 5E70A 1I3GH 2EDHA 4LCCC 2JJTC 4PJ9C 1FCCA 5DC4B 3EJYD 4LVHB 1U6AH 4JFSA 3P2TA 5B39G 1KPUB 1TENA 5TF1L 3UAJC 1CBVH 1A4AA 3ARDD 3S35X 3BRGC 4NQCA 4EIZC 2V3DA 3JZYA 4JFDA 3L1OH 2QSQA 2FJUB 1DEDA 1OGPA 1WBXB 2I60L 1NFAA 1G0DA 3II2A 4AK2A 4MA3B 4CMMB 3GS4A 5AAWA 2EEXA 1G94A 1H5BC 3LDBB 3OKOB 4IOSA 3IDJA 1HH6B 1JK9B 3SDDC 3MR9B 4I88A 2A9MH 3N6YA 1NDGB 3UBXG 4WJ5A 4GP8B 5B1AB 2WZ0A 2MTPA 3BEVB 1NL0L 2HVKB 4LSDA 3BUIA 3H9SD 1S7TA 3SPHA 3ZGHA 3DK0A 3SKMA 5ITBH 3WMSA 5E6IC 4JDEB 2DQDH 3VFGL 3KNBA 1CI5A 3AJ7A 5H35B 4UTCA 1MF2L 1YECH 1DQML 1ASQA 3E1F1 4RNRA 3E0GA 1HHJB 3APMA 1PZBA 2WV3A 4OGXH 3VFTA 3QYMA 4MJIA 5B1JA 1UADC 1RD6A 1VEMA 4OJDH 4Y4KB 3IPBA 1HHIB 1UG9A 3UZVA 1XGQB 2EILB 5DVMA 3R19A 3NCBB 5JA9A 1U8MA 2Y5QA 4ZS7L 2DJSA 2GC4C 5TGBA 4EUPA 3CVHH 5E4EB 4TVPD 4Q97A 2W0LA 1ZK9A 3HE7D 4X6DA 1KTBA 5JDSB 1M53A 5LGKA 2WLIA 2ZYIA 1S7SA 3QJFA 5GHWH 3PY9A 1BEYL 2MMXA 3KWXA 3N1QC 4FXLA 3H2PA 4I2XE 2E9IA 1R6VA 3UAJD 3TWCH 5FGCE 5D7JA 4WTZA 5LXVA 1BZEA 4GW4A 5ANHA 4BWWA 6PAZA 1FNEB 1U8LA 3AQDA 5FUCE 1I7UB 3N06B 2N7SA 3RKPA 4IDJL 1CF8L 1P7QB 2P26A 4KK5C 1TZIA 3GJFK 5ACZA 3IGUA 1CMOA 1YN7B 2N7BA 1P84K 3II1A 3KPSD 3F05A 4DGUA 2WXNA 1U91A 1CLCA 2D2CC 2F7OA 2VISA 4NNXB 5DHDA 1FO0H 1X7TA 3OKYA 4LL9A 2FJGA 4O9HH 5JHDE 1YMHB 5DVKA 4L3EA 1JNLL 4NKOB 3K2MC 2C3VA 3IE9A 4H40A 4ZQTA 5AW3B 5F7EH 4Y2DD 1CQYA 3KYMB 4DERA 4K2UH 3VWJA 4HT1L 1M3IA 5D5ME 1QP1A 4XVTH 3U7WL 5BS0B 4KK8C 3QZWA 5D71H 3SE3C 3DMMA 4AKQA 2N59A 1GAFH 3KMDA 5HHVL 3V6FA 2HRPL 3MRMA 3T0WA 2I5YH 3BW9B 1ZD6A 3OJDA 4K5NA 5HDRA 3NYKA 4AUUA 4IBWA 3QG6B 2B3RA 3B7RL 4UBDC 4PWIA 4ZSOB 4UTAA 1QBAA 4JHVA 4HMCA 3OF6A 5JQIB 5JQ6H 2YMXH 3RL2A 3CHQA 4GXVH 3G6JF 2OP4L 3QUZD 3WKNA 5EU5B 1ULVA 1XD0A 5E5MA 3W81A 1AJ7H 3SYCA 2YPLA 4JM0A 1S7UB 1CE6A 4K7PY 1WSST 5DRWB 3GSQB 4KZEH 4MS8D 4U0QB 1J05A 3SCMC 3NDZE 3QARA 1BZ9B 5ITBL 1NAMB 3H9HA 3R1GL 3QXUA 2DQDL 4X0KB 4HCRL 3NCXA 1MCRA 1X5YA 2VUKA 5GGRB 1Q9KA 3FJTA 1S9KC 1G9MC 3BP4A 4WW2F 3VFOA 1G7PA 4LCUB 1GOFA 1W2KT 3NSDA 3LIUA 1FO0B 2N56A 2VJ8A 4EPSA 1NANH 3A67H 4A38A 4Z76A 2FE0A 4OFYA 1BQSA 2GY5A 1E3XA 4E9SA 5F7WC 4LPYA 4Y16B 2AJUL 3IPFA 1DQDL 3SDXA 4KHTL 2PXYD 3LZLA 1ZGLA 3DHMA 5DK0B 3IDYC 5HYFA 3PWUA 2IGTA 2CIKB 1B2WH 4NC1C 1SUHA 4H1LG 4QHNA 1WZLA 4R97C 4RRPG 4DKTA 4LIQE 2W9EL 4NWUL 5CJXA 1U3YA 1WZ1L 3AS3A 4B9FA 3VRIB 2CR0A 4J4PC 2JJSA 4F7KA 2WXJA 2HJKB 1KN2H 2ZWZA 2WLZA 1I7TA 1LJMA 4MMZB 2E7LC 1INQB 2W94A 4PV9B 4JVUA 2ENYA 3OR6B 2FNWA 1F6FB 2UYLA 4IK6A 4R7DA 1SNRA 3OHXA 3V0VB 1W91A 2AK4D 3SJVB 3RGVD 4BDVB 1JF6A 2Y06L 4AEEA 3O6ML 3BP7A 4FNPA 5DHVB 3HG2A 1I1AB 4DP8X 2QKIC 4MKMA 4UYQA 4FAAB 4NP4H 2X7LB 7CGTA 1M6OB 5C08E 1C08A 5DXWA 4YMPA 1MAKA 2BWQA 2CJUH 3ARZA 4JFFE 1VDGA 1DANT 4QF1B 2B5IC 1SMAA 5DWUH 3W2DH 3QK0A 5ABAA 2A9NH 3AMKA 4BZYA 3NOIA 5GGQL 4CSPA 1V55B 2QVMA 4MZRA 5EBMB 3E3QC 1A22B 3PV6B 3WTVA 1OCWH 5DVOA 3I9GL 5DUPH 5E94A 4IHOB 1Y0LB 4WK0B 1BQHA 1VF5C 2BFGA 3QBTB 4BCXA 1S7QB 4MNHA 4HEPG 1PGRB 3JQOB 4OF5A 4HFUH 3S8GB 4JK0D 2IAAC 2E9WA 2Y5EA 3SKMB 4MD0B 1B3JA 5I6KA 4XNXL 2HVKA 1ZHKA 4ORGB 3DXAE 2WCGA 1UT9A 1E4XH 4QRPA 4YHOH 4ZUUB 4XOBA 3WFCH 1NCNA 1F02I 3DETD 1QRNA 4WFFD 1NPUA 1W8NA 4JQXA 4FX5A 4UTAH 1AR2A 2D3VA 2ZG3A 2XX1A 3MJ6A 3RX9A 4QRUB 3MGTB 3CVHA 4LLYB 4KO5A 3FF8A 5T1KA 1V3LA 2OMXB 1YDPB 4WEBL 2EH8H 1E9QA 1NC4A 3OMIB 3WNOA 5KBMA 1IC7H 1UB6B 3V4LA 1FE8H 4KK6C 2WWMC 3DWTA 4HKJA 4J3SA 5K5YA 1YN6B 2W9DL 3H54A 2DD8H 5IEKA 4FL4C 3X3FL 2BSTB 4KHTH 1FRGL 2AQQA 4FGMA 5CZRA 3M1CA 4GYBA 3BZFB 3S9DB 3KBPA 5EEVA 4L3CA 1TQCC 4JG1L 2YEZB 4QXVA 3HE7B 4Z5RB 1A3LL 3HZKA 3VUAA 4J2QA 4JO5A 2IDQA 3TV3H 4YAQA 1A1NA 1T66D 5BRZA 4CU6A 1VESA 4NNPL 1G9NL 3HUJF 2C4XA 2EICA 4ODHL 4OLWL 8PAZA 4K71C 4HLEA 1AQKH 4KXCA 3QJRB 1JZJA 3BQUB 5E1GA 3VXUD 2LT9A 2DWSA 2L0DA 2XZAL 3EFFB 3UC0H 4XVUD 4XMPL 3I50H 4RMUA 2FWOB 4ANWA 3QNXB 3RI5F 3CQFA 2X4OA 4P4KC 3NTCH 4GLRH 4JE4B 4ZXBC 1ZDQA 3MKKA 4X9FA 4E9LA 4V1DA 4Z7NF 5D7LE 5FA4B 5TDPB 1UACH 1MRCL 4PG9A 2IANB 4RA3A 4PWHA 1NUNB 4GBXA 1Q4NX 1B0GA 1T7YA 4OLUH 5KBDA 2H6OA 3OD3A 1C12A 1HHIA 3FT9A 3JWDL 4NO0D 1NCAL 4PJ7B 1OHQA 3RL1A 1NAML 3LQAL 4EKJA 3K46A 4AKPA 2W0FB 3FQRA 2AEWA 4ISVA 4QRSA 4X8XA 5A2AA 3MJ8A 1DJHA 3L95B 5AZEL 2A9NL 4MXVF 1GYWA 1U42A 4N8CH 5ALBH 3W5MA 4QKTA 2WP3O 1AKJA 1R19A 3CFBA 2BFVH 1JJUA 4MAYC 5K9JH 5MENB 1CDGA 5IB1B 5MEPA 3Q44A 5E5MB 4AY0A 3F6JA 5HXMA 2K7QA 4R7XA 1XB8A 3PWJA 3U2IA 3IB4A 3DV4A 1YEKH 4OZFB 3BEVA 4J27A 5I15H 1ADQH 1AKPA 2CMRL 2PPDA 4LEEA 3LKSA 4JMNA 3FOLB 1YN7A 3OPZH 1BV8A 3BGMA 3NA9H 3QUXA 4B27A 5F89A 5EZPA 3FDWA 1ZSDA 1E4XL 2NZ9C 3HS0A 3OL2A 4KRPD 4UOW0 1PW3A 4B9IA 3VD1A 5EBGA 4DZBA 3JV6B 2LAAA 4HS8L 5DQJA 2V4LA 1XGUB 3E9TA 1KWGA 3U7YL 1ZKAA 5F1NB 1AYRA 3MJWA 4TPRL 1SEBA 4R7NB 4R96A 1BFVL 2DRUA 1EX0A 1PNCA 4IBZA 3NMEA 3ATDA 1ZA3A 4UM8A 3VWKD 3ZBMA 5HI5C 1KCUL 2JCCA 1NBQA 3DMMB 4D9LH 3VVVA 5D70H 5CMAA 3MRDA 5HYJA 1ZGLB 2WN2A 1IAOA 1NJ9A 2CCLA 2B8OT 4IDLA 1WISA 2ESVA 4FOMA 4JPKH 3LS4L 4K9JA 3QI9A 4R4ND 4WEBH 4EUPB 4XVUC 2EH8L 4NAQA 4YQXH 1S9WB 3BD3A 5DZAA 2VLKA 4WW2C 3D69A 1F3DH 2GITA 4HCFA 4P9HH 4ZW3A 1Y07A 1DN0B 4Z18A 1K6QH 3CU1A 5DYFA 3DMMC 1D9KB 3S36L 2R27A 1JMZA 4HH9B 2G5BB 3X3FH 2DQJL 5T1MB 2XTJC 4PGCA 4ZO8A 2OMZA 4DKEH 1SJEA 1KJVA 4AC4A 3REWB 1AC0A 1OAZH 1TITA 3N1FC 5FDWB 3TNNA 2F7PA 4HPOH 5INDB 4UQ2B 3ECWA 2WC7A 3KXFB 4KVPA 3K3QA 4PJGE 1PZ5B 1KXQA 4MB3A 1IM9A 1UZ8B 5F7DA 3GPEA 2WOYA 4Z7UF 4LKXB 1AZCA 2R29L 4OCLC 4GXFA 4G6JL 1IVLA 2OX5B 4XMVA 1O6TA 3T77B 3TA4D 4PJFA 5KS9A 2X4UA 1GKOA 4BSWB 3CIQA 4UT6H 1VGKB 4AH2B 1OL0A 3RHWK 1FO0A 4KXBA 4CRPA 1HZHH 2GW5A 3IETA 3O6KL 4NJAL 1CE1L 5TF1H 1CFBA 2ZXDA 4CVWA 5JIPA 2XWJB 1FN4B 2FWSA 3EOBA 1AGDA 5JW5B 5GRJH 3ZGIA 5FKAA 4DNLA 3A6OA 3CXDH 4YO0B 2VLRD 3FT1A 5HTSA 3OGOE 4CBZA 5F6IC 3AQXA 1P1ZA 2OK0L 4JS7A 4GRLB 1JK8B 1U3ZA 1ZT7B 3LKPA 4UQ3A 3FRPG 5DDHB 5FYKD 4QEGA 3VXOA 3WFBL 5HYQA 1NFDB 1U21A 1T2QL 1PKOA 3BPOC 4DEPC 4UOJA 1UA6L 3HKZA 4OLVL 2HFEA 2VJXA 3WTUA 4Z7QE 2WN3A 4W9KC 3GHBL 4IRZA 4NQDA 2YZ1A 5CAYB 3DTXA 4PRAA 3MLWH 4HP5A 1DLFH 4GAAA 3EH1A 1JZFA 4GI8A 4DOHB 25C8L 4ZMTA 2G4EA 4Y9FA 3QIWB 4BIKA 3L4ZA 4FS0A 3S6CA 4DGVH 2CMRH 3JV4A 4NPYB 3HFMH 5ADOH 5C09D 5I0ZA 3FFCE 3WXWL 2YAEA 4W6XB 4ZRGA 4OLZH 3GEWB 3IJYB 4FXTA 2J6EA 2WVVA 2H6PB 1SRDA 4PJXF 2DIBA 1CUOA 4NX0A 5HJ3B 2KHAA 2V2XA 6PCYA 4MA1B 5INCB 2HKFL 2PMZA 2DWTA 4U7MA 4TPRH 4ZZFA 5DMIL 3KS0J 1IX2A 4ALAC 1LEKB 3SEPA 2D7TL 4HA1A 1ICTA 2LU7A 4ZOCA 2V7NB 1TQVA 4ODUB 1DR9A 2MJWA 2VDNB 3B9EA 3HZYB 3OTTA 4OSUL 3B9DA 4JRYE 3O6FA 1EZLA 1FZOB 1RJYB 4C59B 2M8XA 5IV2A 2OMVB 3JTSA 3CH1B 1UWXK 4FFZL 2Y5TB 1IGCL 2K9UA 1XXDC 2QVFB 5JNYA 4H25A 5TPWH 2E56A 4L1HA 5IGXL 4MX7A 2DKUA 2VUYA 2WXIA 4M6NL 3EO0A 1NC2D 2GHWB 1QRKA 1BVLA 3EJZD 5E23A 2H1LM 2FD6H 3M86A 4YSSA 2YEZA 1QR4A 5IEHB 2NTFB 4OF6A 1E4KA 4JFUA 4L0ZA 1XTMA 1IGFH 3HR5B 2ED6A 3FQNB 1FNFA 4KJPD 4JJHA 4QY8B 4J39A 3MRGB 3OR7A 3QB7C 4FQJL 4KK5D 4XCEB 4YDVA 4EDWH 4UUJB 4ZXBB 2CK2A 5EF3A 4ZFOB 4YZFF 3O3EB 4UB0H 1F13A 4HKZB 2NQCA 3OWRA 1N7MH 4PG9B 4ABWA 1KXVC 5C97A 1G7IA 3MV9B 5FYKU 2APBA 4GEIA 2W0KA 4HMDA 4K07A 5C0BA 3S5ZA 4ATTA 1C1EL 3TBVB 4U1JB 1MVUB 2Y9RT 3FTZA 2NR6C 2BP0B 3FU7A 3L9BA 4YDJB 5E6RB 3PABB 3EGXA 5IREA 3D51A 1HWHB 4DEWA 1DQJB 4JRXA 4NIKB 2MPAH 5A2FA 4XMLH 1NGWA 1LYQA 3ZT5A 2BNRA 2CJSA 4H8QA 3PCYA 4O02L 4DVBB 3V4UH 2CPUA 2R1WB 4EDXB 5MENA 4YR6B 1PNDA 4ZODA 5KANG 1CGSL 1OEZW 4UZUA 5EZJB 5DI8B 3L4WA 1RIVL 4TVSa 6FABH 3P3RA 4WW1A 2V2WB 1ACYL 3RJOA 3RE0A 2ADGA 1A14L 3F3HA 4Z5RA 4GRWF 2XT1B 4LNRA 3I6LE 3CFMA 3A5VA 1BIIA 4HZAA 2J8UB 1NCOA 2V3FA 5ANMB 4QYOA 1A7NH 4UQAA 1E4KC 3DBXB 3K1DA 3QFJE 3ULVC 2F54A 5DRXB 1BD2E 2YPKB 1CD8A 3WXVL 3VCLA 3WY4A 4UNUA 3GRWA 4GOSA 3LH2L 3KBEA 4IRJA 4KVNL 5DEZA 3L3IB 1OOWA 2YHGA 4NBZB 1I3GL 1V8HA 5A2BA 4MXVE 1MELA 5K69A 3NK4A 4ZAKD 3L5HA 2YGQA 4KH9A 3DVNB 4AQEB 3NFSH 5JIMA 1Q0YL 2HLFC 3RGVB 3DDGA 2YUZA 2VQ1B 1BGXL 3FU3A 3QJUB 3ESVF 3W5NA 2D31B 1P4LA 3CWGA 4B7LA 2XXCB 3T4AB 4BH7A 3DOHA 1QI3A 1BCIA 1EEZA 2XWXA 1YJDH 4HS3A 4LASH 5EUOB 2Q87A 4RRPM 3BSZL 4X5XA 1HQRA 2Z92A 3T2LA 5GGTH 5JXEC 3BGAA 2YD9A 4KTDL 3TPUB 1H15A 2OMZB 1XO8A 2EVJA 3WO4C 3BKCH 1E2ZA 2G5BA 1YNKH 1KN2L 3ZMRA 1T66C 1SQ2N 2CDEA 4AI7A 4XMWA 2BSSB 1KMGA 5IB5A 1KB3A 5BQ7B 1FAKT 3D05A 1KGUA 1KJ3L 2QJDA 1NL0H 1XCQA 4DP0X 2NY6D 1BD2D 1NCUA 2LU4A 2BRRH 3H2WA 2Y2YA 3KAAA 1YC8A 1IGFL 5IVZB 2Y7MA 5DC9B 1YECL 5E9DE 3IWVA 1SEBB 3S96A 1AGCA 2FBRA 3L7EA 4HOZA 2X6CA 1VPOL 1T22A 2WXOA 4OGXL 1SLWA 5DJ0A 3WG7B 3PQYB 5C3LD 2A6JA 4YUEH 2IMMA 1BPLB 1CU4L 2WMPB 1LO3L 3CSPA 4M29A 1XGUA 3LIZL 5BUGA 4RMWA 1C1EH 1PF3A 3P40A 4Z3JA 1I4FA 1WGVA 5F88B 2B7DT 1TETL 1CXKA 3PP3H 5I6XB 2CO4A 1T5XB 1O7VA 2B4CL 1XZ0B 3D39D 4HJ0D 5HSFA 1NDMA 1J0IA 1XF5B 4UQEA 4W9HC 5EO1B 3HMWH 3AAZA 5DDHA 5GHWL 3HNVH 1RL1A 3WLBA 1KJVB 1E2WA 3ULUH 2IPTH 3V4UL 3MBEB 1Z5LB 5DUBB 1PYWA 2GITB 4DP4X 4DN3L 3UTQB 2EVFA 4YL4A 1D9KA 2FUTA 5IUSA 3L3HA 2VMFA 5E00B 2JF1A 1CF8H 2ZXQA 3CCHA 4QT5B 2FO4B 3KPMA 2LLNA 4POYA 3MA9H 1JIBA 1QACA 2HA1A 1KPVB 5DFWH 3PHQB 4HLZG 3TIEB 5JLZA 4XN5A 5E8EA 3RZCA 4BSWA 4JLRB 1ZCRA 3WFEH 5I17A 5AENA 2AAVA 5F1KC 4XBEL 4IMLA 1IIIA 4FNRA 4XO5A 4G8FB 1E7VA 3WGUB 5CD5C 1NGPL 2G5RA 2HJLB 4FERA 4PW3A 2I07B 3PAVA 1B0RB 1GYCA 4WEMB 4N6QA 3LH2H 4KVNH 1VACA 2A74A 1T1ZB 4CSZA 4WO4D 4U4IA 4A7GA 3MJ9L 4R5TA 3VI3F 3BKJL 3QEQA 4XNYL 1YEEL 4LGRB 3Q6GH 5BZWB 3O4LE 3GMMB 4GQRA 4O51B 3C5ZB 3QHTC 3CH1A 5J13B 1A7PL 2BVTA 1BGXH 5D2NB 2HFEB 2J1WA 3GBEA 5IZ7A 1FZOA 1MCLA 1RJYA 2IAND 3MRKB 2H8PA 3GHEL 3JV0A 5MERB 1HH9A 4GS7B 2Y5TA 1RP9A 1C16A 1YJDL 2OMUA 3C9NB 2HPTA 3RFZB 4GRLA 1A3LH 1PDKA 3TJEH 2WWKT 3QPXL 4OIFA 5JQ6L 4LPCA 3BD4A 1IGMH 2CLRA 4S11A 8FABB 4D94A 1QKZH 5D2NC 4OF8A 5IFHH 1AQKL 3PU7A 3D06A 2JKRM 4XN9A 4HBCL 2BCMA 1L9PA 4DQOL 2YRPA 2DTML 4H1LB 3EYUH 3VXUE 3VFMB 2OX5A 3NFNB 4N0UA 4HCRH 2H6PA 4M3KB 1Z7JA 1DVTA 3D39A 3K4ZA 4FE9A 3EO1B 1HXKA 4RGNC 4RSYA 5CGBA 4OTXH 3TZVB 4D9QE 4WSGA 1CVRA 4F7MA 4JFDB 5I9QB 1FWXA 3RPKA 3GD1C 1YPZB 1RZFL 4LCIH 4G2AA 3SDDB 1SVBA 4ZXBD 3C5XA 1NLDH 1X5KA 1N5AA 3D4YA 5BV7B 2AHIA 1KF9B 5KVGE 3RVUC 3GRGA 1VA9A 5FO2A 4DGYH 4ZNEA 1IT9H 3T3MF 2Q76A 3NCYS 4N5EC 3MA7A 4OZFH 1O6SA 3WEXB 1HU8A 4NO0A 1A3QA 3QH3A 1GJIA 1CFTA 5JNYB 1N6QL 1NGWB 4TNWF 5ALBL 4F2MA 4RRPA 1QFWM 4PW9A 5IV2B 5J6HB 2BFVL 2VQUA 2R1WA 4EDXA 5AKVA 3I9IA 2IAMC 3D09A 3HZYA 4LLMB 4GW4B 4L5FE 3WDIA 1ERNA 4WW2A 2NSMA 2ZWLT 4X50A 3DTUB 2FSDA 1KN4H 1ZANL 4CKQA 5I71B 5FUZL 2BNQE 3X14A 1CCZA 3GB7B 3CVDA 5IIEA 4ETQB 3ETBJ 4JRWA 3OPZL 4NQEB 4UU9A 4XNMA 3MUJA 1XCWA 2E7MA 1BFOA 4JW3A 2Y1ZA 4U1KA 4XC3H 1GY2A 4XNUH 1ESOA 5GGSB 2GI7A 4PGDB 3I3EA 3QCVL 3QUYA 4AV4A 4XCEA 3M1BA 3QZPA 2OZ4A 3MA9L 4ENEC 4TRPH 1HESA 1U8MB 3LSOB 1UHVA 1WFMA 1PX4A 5AB1A 5D6DA 2E6JA 2WXFA 3IT8D 1X44A 4PLJD 4PJAE 3TPKA 4MCZB 4W9EC 1QO3A 1X5GA 3WTXA 4JAMA 1MHEA 3GSXB 5D2LE 3TO4A 4CJ1A 4WJG3 3CZSA 1F2XK 2IPKA 3QUYD 2OTWB 4I0PA 4H8WC 2DLFL 3HNTH 4N0UE 4F9LA 3CZNA 5DWUL 4ANXA 3K6SA 4LPWA 2GTQA 3K2KA 5D5MF 1WTLA 2IH3A 2JI2A 2FEEI 2AQRA 2DI9A 4IJTA 4PIRF 3D3VE 3F7KA 4XP6H 4IRJD 4XNQB 4BSVB 1H3PH 5DQDH 3VDCA 2YGOA 2W9LA 5ECJE 1ITCA 2WXLA 1U93A 2Z31B 5C0DB 1NDGA 1Y6KR 3L9YA 3PGDB 1U3HC 4TM9A 5F0JB 5HGBB 4KO6A 1IAII 4XT1C 4W9IC 5HPMB 1XGZA 3P9MB 4JQXC 4HDIA 4TQEH 2ZJSH 5DA4A 4TVPE 3IRZA 2IVFC 4MJ4A 1YYCA 4ZTPL 3AWFA 4JKWA 4EEEA 4J6RH 4N2IA 5SX5H 1A9VA 4QYOB 3KVQA 1YAZA 4L4TE 4BQ8A 4ZXBA 4MFHA 5IMOB 3PWPB 2YPKA 3RTQD 5ICYA 1AGCB 4U1HB 3ROLA 4Y2LA 3DYMA 2BNRD 1PZ3A 2KL6A 2AXGB 2CKNA 2ITDB 3EYUL 3QXTA 3BPCB 2IDFA 3FTYA 3VWJB 3C8KA 1IKFH 4P23A 1IGTB 2BX5A 4TVUA 5FA3A 4IIZA 3QXDB 1CL7H 1FV1A 1KV7A 2QZQA 5JPNA 1N18A 3ULVF 1B0IA 4ODWA 4X5RA 3HI1A 1YEHL 3B3IA 1CD1B 1CR9H 1IC7L 2ITEA 1GCFA 5E7FA 1E5AA 2GHZA 2WIIA 4JZJC 4O4YH 4P48A 5MP6H 2R4SH 2TAAA 1DBBH 3QZMA 1YA5A 1RUKH 3FH8A 4K3DL 2N0KA 3SE4A 1XZ0A 3DRQA 3HZVA 3E2HB 1U8QA 1N6QH 4BINA 1P84J 3T65A 3RL2B 4XMXA 4GRLD 2Q8BL 4H0LC 5L2KE 4ZFFA 1AZZC 2DQGH 5J57B 2XX0A 3SGDI 4OH2A 4QCIA 1M2VB 3CPLB 5DO2D 3V9EA 5C2UB 5KJRL 2JCCF 3CHRA 3TV3L 1GGIL 3D18B 4F5CE 4JLRA 4F7CA 3VXRB 3EXJA 3KPRA 1R47A 5J1AB 3WNPA 1K2DA 1ID5I 4QOKE 3KPQA 3BVWA 4PJGB 1ZWIA 4IMLB 4C83B 2G9HA 2QGBA 4ZPTB 5FCUH 3ZUCA 2P8MA 1U6AL 3X11B 3VCLB 1Q9KB 1WITA 1PIGA 4XCFL 4HXAL 3I50L 2NYYC 3LN4A 3LN9A 2ICEB 3JWNC 3ZZ1A 1CBVL 4OIAA 4PWEA 3UTOA 4F15B 1B6DA 1BG1A 1TZGL 2DMKA 2GI0A 4PYHA 3WLWC 5C0AD 1MRCH 3ECBB 1YYML 4HS6B 2Z64C 3A3YB 2QVTA 1Y7VA 1UFUA 5FUOL 4GG6F 4C4KO 3H6AA 4CGUB 1YAIA 1R3JA 5DURD 3LEYL 5IQ7L 2A9ML 4IOIA 2EE3A 5DD0L 3P4NB 5DK2B 3MREB 5TPWL 5IJKC 3IS0X 4HUKB 3GKWH 1KB5A 2CWRA 3P69A 3TYGH 5IB4A 3NAAH 4JCWA 4JM2F 4IHOA 3V7MA 1J0YA 4QNPE 5IB2B 4L8DB 5BV7L 4X4MA 3IDNA 1RUPH 1IBFA 4MQ7A 1CS6A 3CFCH 3HCVB 4BELD 2BSRA 1T5WB 1QBML 3LPFA 1D2PA 1KPVA 5JIQA 3OBAA 2G30A 2K3HA 2A99A 2AXFB 3ES6B 4WWNA 4EN2A 4YX2H 3MJGX 2UWEA 2NY3C 3DNKA 3PAZA 1MCDA 2GJ6A 2RA1A 2X70B 3ZZQA 4KJYB 1MI5B 4MVBD 5B3SB 2EKSA 4E9QA 3EFDL 3LZFH 1U8IB 4G6KH 4MJJA 3MRLB 1GSMA 4LMQI 2O1AA 1EFQA 2OXHA 1WHOA 5DEGB 4P46A 4I3SL 3WD5H 2ZT9C 3GTTA 5EG6C 2E3VA 4JREC 3FRPA 1Z9NA 3ME0A 4JUSA 4QWWC 4B9KC 1UYWH 3FT3B 2J71A 4HIQA 4PJDE 2PCPB 4JPKL 1INDL 1BD2A 1QG3A 4PY7A 4S1RH 1U2CA 1BQHB 2OL3H 5F7MC 1TYRA 4S1SH 1CGSH 4MSWA 4MCNA 5IESH 1LGVA 4CNIA 3PV6A 1WPCA 2R4SL 3TOPA 4UTBH 1UZ6F 3TURA 5F9JA 4M1CC 5F7AA 3HB3C 3S36H 3NZHL 4PGEA 2WB1A 4AUYA 5JMOC 5FLVA 1YY8B 1FLRL 3QQ3A 2XICA 1TSHA 1YUKB 2QHLA 2YGVA 3CFIC 3HG0A 4UZSA 1P7HL 1QX1A 3LRHA 3CBRA 2F8IA 3CHPA 1ZV5A 3P30L 1WS7A 4MMYA 5C0AA 2NNCA 3KPSA 4AGLA 3DGDA 4BDVA 4PGDA 1GOGA 2W38A 3KVDD 5F7EL 4A1RA 1T1XB 3HUJE 3ISRA 3U6XA 2G4GA 4ZAKA 2CUAA 4FYRA 2BVQB 3JT0A 3H3BC 3QP3A 2KBGA 1YO4A 3VFVB 3GPSA 1KLUA 3NSXA 1O7DE 5A1AA 2M2DA 2BNUB 5JHBA 3SCMA 3KPRD 3D0LB 2HYMA 1QUPA 4WU7A 1U3HB 1Z0NA 1UXWA 3MV8E 2HRPH 4PP2B 2PXYB 2I5YL 2IH3B 4G5ZL 2WZ5A 2HCZX 2NY0B 1EHXA 4MVBC 1R17A 3L81A 1KCKA 1E50A 1YYMH 3NBNA 1M1SA 3ALWA 2VXVL 3PL6D 1ZTXL 1CLOL 5ILTH 3FO1A 4QJ3B 1O6SB 3KS0H 1N64H 4LRNH 3OB0K 1YNLH 3OKEB 4XBGA 3HMXA 4KTDH 5GIRB 2UXFA 4KOCA 2FRGP 1NCHA 1S3RA 4NYLA 3BPNC 4RQQA 1AAJA 4TUJB 4L9DA 1KSRA 2QKIB 5DHYB 1UA6H 3A22A 1AJ7L 3IGFA 4BUGA 1H9VA 4FI8A 2WZPD 4AT6B 3NAAL 4KZEL 5D6CB 1QLFA 4IEFB 4JPIA 4HJSA 4HK3J 5B3NA 4NOBA 4JHUA 3TONA 2XVBA 5DJXA 5FPIA 3QR2A 3ZE2B 5HGGS 3OLEA 2OV0A 2HH0H 2IMNA 2K45A 2MNUA 4G42B 3RWEA 4WI2A 5C0BD 2IWFA 3D5OF 3I2CH 3L9RA 5EV7A 4P5MA 3BZEA 4F27A 3FTSA 4DP2X 2AI0H 2ICWB 4XP9H 1N19A 5IVNA 5AAWC 4K3HA 5J1TC 1JHTA 4K8RC 4X7TA 1F4XL 4N5ED 1GW6A 1DQVA 5F9OH 1MVYA 3OMNB 5EO0A 3HI1B 1U8PB 1JTPA 3NACH 2W9EH 1ORQB 3GZKA 1WZ1H 3K2UH 5SWQA 2BSTA 3BVTA 4XB8A 1PJ9A 1O0VA 4KZDL 3ILEA 1TNNA 3HBQA 4KO9A 4FQHA 4FFZH 4XE0A 1TIUA 5ABZA 3ISYA 5PAZA 4MAYB 1BG9A 4P3DB 3SDXF 1HEZB 3FFCD 3ZMEA 5B22A 1FG9C 4YSOA 1M1XA 1HEHC 2FD6L 2NCEA 3ZHKA 4UU9B 4K5LA 2QV4A 3T0XA 5DQJB 3WJJC 3BVXA 1JZ7A 1A7QH 3D18A 2NSXA 4A67A 3K8LA 2IFGA 3BSZA 4JM2B 3V6ZA 3K0WA 4Z6AT 1VFBA 4OB5H 3MRBA 3QUXB 2Q1EA 2GSIA 2FTAA 1JZDC 1M7DB 5HI4C 3DUUB 4NBXB 3BCFA 2E8YA 5I82A 1KGWA 1BPVA 1W0WA 3ZDYE 3L3GA 2IOMA 3HG5A 3CLWA 1M05A 1FP5A 4UDUA 1SF3A 1CD9B 1II4E 3C8DA 3EJUA 3HHSB 3NK3A 3RVXC 2PTUA 4LBAA 3W1ZA 2WXGA 2WO2B 4H4NA 4JAMB 1O75A 3AS1A 2C9XA 1EQWA 3Q1SL 3QPKA 1G4RA 2HFFB 3GYRA 5IW3A 5K9OB 4PJFE 2V9TA 2WBJC 3ZUNC 1NCTA 1N5YH 3BPLC 1B90A 1PQZB 2WD0A 4RIRB 4G8GB 1YQVH 5JR1H 1U41A 3GHEH 1U3JA 2CLVB 5FR3A 1CLOH 1LK2B 2BP5M 4MNGB 3C5ZD 4XP5H 1KBGH 4D0BA 3A6BH 4UOZA 4YHOL 3BDYL 3KH4A 2VGLM 3X1NA 4JX0A 3VXRA 5IFHL 1BMGA 4IYKA 1EK3A 1A14H 3Q9PA 4HUWA 4MD4A 4UTAL 3QIWA 1JZGA 4MGXA 5F7DB 1EZVX 2WSDA 5F3HB 5PCYA 2HVJB 3DX8A 2F68X 2AJXL 4ONOA 1SXNA 3RVTC 4PJ9A 3UC2A 4WDIA 1T5KA 4OGAC 4FULA 1QSEA 3WOVA 1UJ3A 4Y1AA 1DQTA 5LLIC 3VMPA 3KD4A 3MCKA 1RZFH 4G72B 4LCIL 5DU7A 2A83B 5FA3B 4ZSOE 2OL3A 4B3EA 1IE4A 5D93B 4AXWA 1ACXA 1KFGA 4D2NA 5A2IH 2VDRH 4ODWB 2ZQKA 5ISZE 4PCYA 4UTBA 4DEUA 1S9WA 2GG1A 4NHUB 3WFHB 4K3EH 3VGEA 1MLBB 2V9RA 3FK3A 2ZX5A 5IBTH 3WEAA 1FZKA 5KVDL 4I9XA 1OAUH 5B7EA 2K6YA 3QDJA 2JFCA 5C8JB 5HVHB 5ES4B 1A64A 3INUL 4IRSB 5GISL 4JNXA 1Q0XL 2R69A 4NRXB 1U8JA 1IQWL 1UOLA 3PGFH 1LP9F 3RURA 4ZDHB 4R4NC 2KQMA 5HDQH 3WUWA 3QEQD 4QCIB 1AO7E 2F7IA 2VLKD 2VC2H 1AG0A 4BHUA 4TNEA 2XZAH 4OIIL 4P46C 1OAXL 1A6TA 3BVDB 3LEXA 3WHXB 3KXFD 3MNVA 4AEIL 4PRHB 3II3A 4GT0A 4D9RD 3LOWA 3L2MA 5C9JB 1QSFB 1PZ5A 3JV4B 4NPYA 5D2LA 3OC5A 2EO7A 4NPJA 5IHZA 4L29A 5AUMA 5D5MB 2V2TA 4YDLC 3OKDB 4NQVA 1RZ7L 2A6KB 3LKOB 4YZFE 3C60C 2PXYA 4OM1H 2WLNA 1Z5YD 4PR5A 1NAMH 2H26B 3LQAH 2G3XA 2OXHB 3CH8A 1FJ1A 5TD4A 3FT3A 4TNVK 3VNYA 5KBNC 1RIHL 4DFHA 3MRLA 4KNSA 1YRKA 3KPNA 5HGDB 5TFSH 3S5LG 5DEGA 1WICA 4APQD 3OXSA 2BNRB 1LMIA 1XAUA 1XF4B 3BOVA 3ARBA 3MR9A 2HTLD 4OZIE 4PJ8A 2GTZA 4PS4L 5JIHA 4M4RA 3OZKA 4Z7QF 1NCWH 3GC3A 2K6ZA 5IHUL 3HMWL 1U33A 2NNXA 1ADQL 5D6CA 1AKJD 4PGEB 4IKLA 1MCOH 2BSDA 2VN3A 3DA0A 3EJPA 1ZAGA 4LMQE 4TQEL 3LQMA 3IDNB 5HHQB 1WCBB 2DM2A 4YDVB 5FF6A 4IEFA 4LOFA 3GI8H 3P0YH 3ET9F 4GSRA 2COVD 2Y0SA 4HUXA 2R0KL 1OGAB 3BFWA 4N0RA 4P9MH 4J3VA 1G87A 4GBXD 2IV9A 4XCCH 1S9XA 3U4AA 2D3JA 2BDNL 4KXZI 3KLHC 4BFNA 3V0HA 3ZY7A 1EZVY 3QPQD 3T3MB 4X4XB 1DVUA 3GMNB 4RX4A 1CL7L 1AIFA 1TQBC 3HAEH 3O6LH 1YEHH 4YPGB 5EMYA 1YPZF 1S9YA 5BO0D 4KO7A 3VXUA 4ODUA 1ZHBA 2AMUA 1DQJA 3VWJD 3SCMB 5JQHC 1UJTA 5D55A 3U25A 5E8DH 3VJ6B 1FFPA 2QGEA 1IU1A 1JI1A 3QZWG 3ZKQD 4HIXH 4KRNA 3UTSA 1DFXA 1F1DA 1F4WH 1S7SB 2AQSA 3I9PA 3JZ7A 3QJFB 4HKXA 5AOJA 4YXKL 5FECB 2O5ZH 4V11A 2VSKB 1FYTD 4WO0A 1KCBA 1HEZA 1XF3B 4L1BA 4AENB 1RUMH 1KNOA 1WTGT 2PP9A 4M1DL 4U1LA 5CSGA 1ZRUA 4JPIB 2A73A 1FNGA 4HPOL 4OLYH 5KVDH 1OAUL 4Y2OA 4F91B 3ULUF 2Z0UA 1QNZL 4M7ZC 3T2NL 4XI5C 3IBOA 2QKIA 4PRPE 1I1YB 3PGFL 5DHYA 5F0PB 1SBSL 2P9RA 1Q72L 1A7RH 2DB8A 4Y19B 1SOXA 3D25A 2VC2L 2DYPB 4PBDA 3QCTL 5JOPD 1A6WH 3ATFA 1MCQA 4HXAH 4Y9BA 2DTMH 2OR8A 2BY2A 1IFGA 1PY9A 2F54D 1LDSA 2K6WA 3IMTA 4N1CA 4AOFA 3IMWA 4OCXH 1JERA 4XP4L 4YLQT 3RVUD 4WNJA 4MMZC 4Y5VA 4MB4A 1PSKH 3DVNA 4JO2L 3TH3T 2MHAA 4AQEA 5FYJE 2EDWA 2FQFA 3Q5TA 2DDQH 4U1NA 1T04B 3KLSA 3FU7B 1DUZA 1LP9E 2P24A 4NN7B 2HMID 5LG6A 2LOEA 1TOXA 3GBNL 3MMEA 4QRPD 4AV5A 4Y5YA 2OYKA 1A9BA 3SPCA 3ZU8A 2VDOB 3VG0H 1F5WA 1TMQA 4U1MB 4J1UA 4JRXD 3ZQ9A 4L1DA 1SYSB 5I1EL 2HJFA 2HT3C 4P23C 1XCQB 4JDZA 4LCWB 3H9SA 3TO4C 1I85C 1WFIA 2VO8A 3V7AE 2BSCA 3L3DA 2XDHA 4NNYB 2FJGB 1BIIB 3Q7JA 1SM3L 5H35A 2AMGA 4B95C 3RWGA 5FDYA 2C3VB 5H2BB 1BZ9A 4WI0B 3QCVH 4Z7OE 3LZFL 1GGYA 3CK0H 3FU9A 2R8SH 4X98B 1J9QA 1M05B 4KK9C 1J0KA 1DL7H 5JORB 3JVFC 1R0AH 4E2OA 1A6ZB 1QFUL 4YGVA 3GLAA 3UCQA 4Y4KC 1GPOH 1AP2B 1V5JA 3QUYC 4BQBA 4DP9X 4N25A 1O7SA 4BHUI 3KJ4C 4I48A 3RGVA 1R1CA 2WLYA 3ARDA 4JFYA 2R29A 4FFWD 3N41B 5BZWA 2MTAA 4ZMZA 3QAZB 1CBJA 5I19H 5KVDE 5ID1A 5EFIA 1SLXA 4H8WL 4YXHL 4PVMA 3RX5A 4P2OC 4S1SL 1U8KA 3DJTA 1RXLA 3QJXA 5C0CD 5DMGC 3JWDC 5I73C 3W9DB 3N3EA 4GRWH 1U3HD 4CL7A 3DKHA 2VM4A 1E3ZA 2O5XH 4F9LC 3CC5B 3PDOA 1ZE3H 3BUPA 1S7WA 5LCVH 4MYWB 3CCHB 4QT5A 2O5ZL 5F9AC 3VFRA 4FNQA 1J8HB 1R3HB 1FIGH 2W0PA 5C7XH 4BCYA 1XHHA 4OZHE 1HILA 4WVRA 3QRLA 4OZ4B 5LGHL 2FO4A 3UO1H 2EXYC 5C0FB 2WXQA 2XCMC 4PV9A 3V4PA 1BXXA 1FYHB 3SJVA 2Y7NA 1OAQH 3FTGA 3LAFA 4FTDA 2P44B 1SOQA 2PF6A 4L9LA 4RBPH 1MREL 4WI4A 2I25N 4MNQE 4WKZB 3LKOA 4WFHE 1IGYB 1YEIL 3X1BA 2EXWC 3F65A 3ROOA 3QG7L 5GRWA 1NPJA 1AH1A 1E30A 1U9KA 4U6HA 4WDIB 3GMMA 4R4BA 3SIKA 2VR7A 3M8OH 4DGIH 3RWDA 4JHBA 4HG4J 3BFQG 2ENQA 5CIPA 4EI5B 4G5ZH 4NT6B 5DVPA 2ZUQB 3QQNA 5I1CL 1CN4A 4OKDA 2J5WA 4LZKA 1MLCB 4G6ML 3BSHA 5FYLL 1DDHB 4WUUA 1AGFB 1Q9OB 1VERA 2H2PC 4O4YL 3F8UB 1Q9WA 3P77B 1H8OA 2X3BA 3SKOB 4P4KB 1U8JB 3QUZA 5CSBA 1PIFA 4PLKC 3PJNA 4NHUA 4EUPH 2X53A 2CK0H 3ATEA 3WEBA 2P45B 3UJJL 5DJ8A 1YMMB 4Z7AA 2PPAA 5DZ9A 2Q8BH 2YRLA 1FZKB 1PG7X 2J8UF 5AAMC 1U95A 1BF2A 4J23A 1QRNB 3I6GA 4MBOA 4GRWB 3WJLA 5F1IA 5B1JC 4ORGA 4HJ0C 5I1LB 1AXTL 5D1QC 5GJSL 3FUIA 2Y36L 5D1QB 2XZQH 5D7IA 5T33H 3EUDA 4GIPD 5H37G 4TTGA 1SOSA 3OZ9L 1FZMB 5FGBA 5SWSB 1JGEB 3QXAB 4JFVA 1ZLUK 2XTJD 3CPUA 4L5FL 1MDAA 4B50A 1YPZA 4ELKA 5ISZA 1CTOA 3D30A 3TCTA 4AW4A 5L4JA 4XCFH 5C9JA 4JG0H 1YJDC 2O5YH 3GI9L 3SDCD 1HQ4A 2VKWA 4FXGC 5BUAA 2BZ7A 1R0AL 2DKMA 4Q56A 1TO4A 1LO5B 1PX8A 1RZJC 3TO4B 2I07A 3KBFA 2NX5B 3MRJB 3QGVA 4LLAA 4MJIE 2CRIA 4LASL 3T1WA