1F1GA

Crystal structure of yeast cuznsod exposed to nitric oxide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1gA00
1PU0A 1YAZA 2XJKA 3MNDA 4MCNA 1JCVA 1PTZA 1SXZA 3ECUA 3GTTA 2VR8A 4B3EA 2NNXA 3ECWA 1SXAA 1JK9B 3RE0A 2WYTA 2AQSA 3HFFA 1IBFA 1L3NA 3S0PA 1OAJA 2ZKXA 1IBDA 1DSWA 3CQPA 1N19A 4MCMA 5KBLA 1CB4A 2WKOF 1MFMA 1Z9NA 2WZ5A 3F7KA 1SPDA 1P1VA 2ZOWA 1PZSA 3HW7A 1OEZW 2XJLA 3SODB 1E9OB 1OALA 2C9VA 2VR7A 3KM2A 3T5WA 1F1AA 1IBBA 1E9PB 1SOSA 1XSOA 4FF9A 1BA9A 1OZUA 1TO4A 3PU7A 5CU9A 1AZVA 2R27A 3KH4A 1E9OA 1FUNA 1ESOA 3F7LA 3K91A 3MKGA 4U4IA 2AQRA 1E9PA 1YSOA 5KBMA 1JK9A 2K4WA 2AEOA 2WKOA 4BCYA 2WWOA 2WZ0A 2AQTA 2GBVA 1E9QB 1CBJA 4N3TA 1EQWA 3KBFA 1KMGA 1QUPA 1SXNA 3GZOA 2ZKYA 1RK7A 4A7UA 4BD4A 3KH3A 4L05A 1SXCA 2WZ6A 1DO5A 4BCZA 3CQQA 1E9QA 3H2QA 1TO5A 1EJ8A 1SXBA 3GZPA 1HL5A 2AQNA 2AQPA 2AF2A 2ZKWA 1SXSA 1U3NA 2JLPA 4A7GF 1IB5A 2Z7YA 1BZOA 4A7QA 1HL4A 1SRDA 1YAIA 2E46A 1SDAB 4OJAA 1XTLA 3KBEA 2E47A 1SDYA 2JCWA 2C9SA 2C9UA 2WYZA 1IBHA 1F1DA 4A7VA 1UXLA 4N3UA 3GQFA 3H2PA 2Z7ZA 1OZTG 1XTMA 2AQQA 2GBTA 2GBUA 2SODB 3GZQA 2WWNA 4OH2A 2V0AA 2Z7WA 3L9EA 3HOGA 3L9YA 2Z7UA 4A7TA 1COBA 3LTVA 3QQDB 1B4LA 1F1GA 2LU5A 1F18A 1N18A 5KBKA 4A7GA 1Q0EA 3KM1A 1B4TA 4A7SA 1Z9PA 2VR6A 3ECVA 3GTVA 3CE1A 1UXMA 1S4IA 2Q2LA 2APSA 3QQDA
chains in the Genus database with same CATH superfamily
1AO7D 3O4OC 1JPSL 4GMTL 4F2MB 3D05A 4K5OA 2J56A 2BW5A 1I8IA 2C7UB 1MOEA 1YUHB 1QSEE 1F4WH 1IAIM 3HN5A 4M7ZC 3C09B 3GMOB 4RA3A 3AB0B 3F7QA 3ZLQC 2N7SA 3H9HB 3NAAL 4H8QA 4UDTB 5A2LH 1BXUA 5JW4R 1EEZA 4U6HA 4H1LG 1KGJA 1EIBA 1ZIAA 2QDVA 3ESVF 4Z7WE 4FOMA 5IHUH 1R3JB 3TPUA 1DBKL 2AVFA 3G5VA 4K3EL 3MRPB 4K2UL 2IV9A 1NUGA 2DWEA 5I1GL 1UKQA 3DO7B 1IAMA 3WTTA 5DS1A 4WWOA 1KXTA 5SV4A 2M8XA 3F5WB 4AYBA 5DD0H 5HGAA 4FQLH 8PAZA 5HGBA 1ZS8A 5IB5A 3AWGA 3PAUA 5IREA 4YUEL 5E8PA 1SFHA 3UIZA 2Q1EA 1YEFL 3FQRB 1ZE3H 2JKXA 3SGDH 1KT2B 3QWOA 1NH6A 1GCFA 1XZ0A 2A6JB 1WO2A 2ADIA 2EKSA 3I75B 5D2NB 1M1SA 3DJ9A 1T21A 4BH7B 5I26A 1JVOA 3ZKXC 2DWXA 3FHAA 3T3PB 3CZGA 3ZE2E 3EGDA 1A5FH 2AXGB 2WJ5A 1EGJL 1TJIL 1FL3A 3QXDA 2Y72A 5E6IA 4PJ8D 3BYTA 1BFVL 4OIIH 2D4DA 2GFBA 3FCTB 5KSBA 1IL1B 1NC2B 3HR6A 4UIKL 3UYRH 4XN5A 3RWHA 4PRPE 4ORGA 4U1LB 1MIML 4WRLA 4TOYH 3L5XH 2BS71 4LNRA 1MAML 2IPUG 2VXQH 1NBYB 4OH2A 4F8NA 3KCPA 1I1AB 4NHCH 5IVXF 5IB1B 1S9VA 3HOGA 3WJLC 4Y2DD 4O51B 2ZF9A 4RDQF 5KSUA 5IMMB 2VLKE 5IQMA 3QDJB 1NFDE 1EBPA 4Y1AA 4FHJA 3V0WL 4G7YH 2FYVA 4IK7A 3FB6B 5CEZE 3Q8AA 2ZG2A 4IW4C 4WKZB 2E74C 3QO1A 3GXTA 3FT1A 1FVDB 3QHZL 3KWVA 2B9BA 1AGBA 2WNXA 3IN2A 2Y07L 1ES0A 3OKDB 1XAUA 5ACLA 3BVDB 43C9A 4EE2A 1TTRA 5IEKA 1ZT7A 1PZBA 2BOLA 3PGDA 3UJTH 3FOLA 4FEMA 2XXCB 2DRUA 5CWSB 3W11C 3U9PL 4K55A 4PMEA 1T7XA 4UT9L 1ZD6A 2PO6A 2O6DA 3CZKA 4OZHF 5KBLA 4K9EL 2FHFA 1EUUA 2VAAA 4LFHD 5AAWA 2O5ZL 3QUXD 1VZGA 1KXQA 4IBWA 3VA6A 4CA4A 4DN3L 1NICA 3KS0J 2CBTA 5F9OH 2WQVA 1G6RA 3A6CL 2QKIB 5HHOA 2ZXBA 4AWJC 4LHQB 3BFQG 5CN1A 2ALAA 3TH3T 2OMYA 2BHYA 3IDMA 3GBNL 1A6AB 5LBVA 1KF9B 1E3ZA 4JFFA 3JV6B 4YNYB 3B6SB 3FFCE 3ZTDC 4HIXL 3G04A 1OAXL 4UAOB 1B0RB 4HKBB 1PYWA 1HYSD 3ESOA 3QE5A 2MPAH 4EBQL 1S7WB 1UA6H 2F5AL 4G6KL 3UEZA 1JSYA 5C0CE 3LN5A 1DCLA 4ZFQA 3WN6A 3QFDB 3PQYB 4EI5C 2FT8A 4MQXD 4XN4A 2AHIA 3JWDH 4WJG3 5DS8B 2ED7A 2DKMA 4MX7B 3SZ6A 1AHWA 1ZLEA 4PB0L 3QZBA 3GS7A 1HDMA 4KZEL 4B53A 4B41A 2GQHA 2FATL 4JFYA 3CX5J 2O5YH 1KNOA 3NK4A 2FWLB 2F61A 2Y2TA 4OF8A 4D3CH 1QTPA 3FQWA 4CILA 2VIRA 1DEEB 2VDRB 3HPLA 2WV3A 3SPGA 3TBWA 5EH1A 3D25A 3CNKA 3LCYA 4HZLA 4D0CB 3NPSC 4KHTH 5T33H 4Z7QF 4F7PB 2FAUA 3KW8A 5BRZA 3O3BB 5C0BD 1T0NA 5EFIA 5ESVB 2OQJB 4XMPL 2LQRA 1OM9A 1G7QB 2VLRD 1T5XB 3MRCA 3QDAA 3QJZA 4OD2B 1QFUL 5ETUA 3QPKA 4KZDL 5C08A 3OXRB 2X4UA 4JUSA 2HJLA 3D8MA 2HTLC 3ZHKA 5E24E 3LS4L 3WEXA 3P9LA 2VN3A 1ZKAA 2P9RA 5C0RL 2GIYA 2Z31C 4BDVA 3LZLA 1XDTT 4MWFB 4UILL 5FA3A 3O9WA 4QHNA 4F2EA 2Q7AA 4KDWA 4E9WA 1FO0B 4L4VA 4WDIA 3WHXB 4Z0XA 2AXJA 4BKLA 4HP5A 3O6ML 1YEGL 2AQ2A 2GJ6A 2WN2A 1V3LA 4UU9B 3K6DA 1W2KT 3NPSB 1DEDA 3W82A 5D1ZI 5LNEA 1OP5K 3CN1A 4M03A 2IGLA 2WLYA 3IETA 3X1EA 4EUPA 4HOMA 1J9TA 1GCYA 2R29H 4IJ3C 3U4EA 1O9WA 1LWHA 4YR6A 2VWEC 3GMQB 1LWRA 4PRHB 1YPZF 4HC1A 4RA0C 4U6VH 5B7MA 5F7NC 3NTCL 3ZYOA 1CI3M 4PV9A 3M46A 5F3BB 2AEIT 2PXYC 2DI8A 3DX3A 5D7JD 4WHYH 5DJ8B 3E1F1 4LLMB 3UMTA 2Z31B 4KRLB 4XXDA 1R5IB 4QRUA 3G08B 4G8AC 5JORB 1DANU 3PWPB 4DUXA 5DUMH 3BKML 3VXMD 1A1MA 1DBML 1KCVL 2AJZA 2J1XA 3QARA 5GPRA 2A4EA 4NQSA 1F1AA 4AJYV 4TPRL 4OCSH 3MRDB 1R24A 4PRID 3GINA 3UAJD 1M3JA 5DJXA 4UM8B 5KS9F 4KKAC 2EVIA 1ID2A 3EFOB 1A8ZA 1GGCL 2FR4B 2OPCA 4TVPE 2QHRH 5C70A 5TH2B 1GOHA 3RY6C 3ZT5A 1DZ0A 4GG6F 2P8PA 4HGKC 4IJ3B 4HWBA 5DJ2B 3UTTE 2B1AL 1JGLL 3M86A 2Z35A 3QFJD 5BW7C 1JIBA 4IBUA 5IMKB 4MMYB 3AQDA 1DE4B 2VCOA 3MRKA 3SGKA 1QD0A 3ZMEA 3BLPX 2VXQA 4K5LA 2O30A 3QEQE 3F7VB 3FN0H 2IOIA 1DBAH 4MCYA 1JZ4A 2ARWA 3HE6A 4Q9QL 4OLYH 1CE6B 3C6SA 2HX8A 2Y3NA 1U3ZA 3HNVL 3FU5A 5AW2B 3VG0H 3BZFA 1IRAY 1Y0LA 2VYRE 2YAMA 2R69L 2ED9A 4LAQH 2JCCA 3RFZA 3K2MC 2WNKA 3V4VH 3BVVA 1VFAA 4ZXBC 1S7RB 2OJ1A 1SDAB 4GP5B 2QQKH 4GI9A 1BFOB 2WY3B 1C1EL 1H3WM 1U8CA 1BM3L 1BFSA 1IM9A 2EXWD 4WY7L 5HYQB 4UIMA 3UTSE 2F53D 2JVUA 2VLJB 3KPLA 2YMXH 2BNRE 3LDBC 2CA3A 4ZFZA 3VI3E 4FXKC 3OMAB 4QXVA 1EZVY 2JQAA 3AREC 3ZZLA 3D85D 2B39A 1QFWH 3Q9QA 2PWEA 3L3GA 4MS8C 2OA9A 3S36L 1FLRL 3JUZA 5I8EB 5CILL 4UQAA 3FQTB 5MEOA 4HV8A 3EDDA 3NJVA 3CXDH 1TQUA 3GB7A 4NP4H 5DC4B 4AH2A 4UM9A 1JOIA 4FLSA 2VISB 1GC1L 3NFNA 4L8SC 4MMZB 4K94H 4FQXD 4MLSA 2A99A 2Z91A 1C5CH 1PCSA 1Q72H 1Q1JH 4R7NA 2YAQA 3MLSH 4JG5A 5HJDA 2ZF8A 5D1XD 1IBFA 1HQ4A 4LEXL 4PGEB 1G9NH 2XKNA 4R2GC 3DGGA 4UOW0 3U0WH 4FXKB 2A6KA 2MRYA 5AKTA 5C3IA 7PAZA 3K2IA 4YLCA 5FX3A 3SSGA 4R83A 1ZJAA 5CINL 4DKFH 4FABH 1QSEA 1KB5L 3RG1C 2I07B 2GJJA 5DWUH 3LNIA 2XPGB 4L8DB 4QHPA 5ICXB 4Y4KD 3VXOB 4X8XA 4Z5RA 2Z64C 1OALA 4ZOEA 4CU7A 1DBBL 1JGUL 4F92B 1RZIB 3QJVB 3UO8B 2IAAC 5FKPA 4Z7WA 3AGVA 4L8SB 5BXFA 2R0ZH 3GLAA 4HUXA 1EXGA 4Y8DC 1IEBB 3LKPA 5F71A 2BPBA 5F0LB 4M43L 1SM3H 2F74A 1RSFA 2C4FU 1KLGA 3C5SA 4K3JL 3X17A 2RR3A 4FZEL 4I5BA 5KJ4A 4R2GB 1CL7L 5LNDA 4DEWA 4FG6C 3CPUA 5CZXC 2NXZB 4NUJA 5ISZB 4FERA 3ULUE 1WFIA 4L9LC 1O7VA 2Y1VA 4GKSA 4EN3A 2Z34A 1WT5A 1BD2A 4WI5A 4WW2F 5ILTH 2Q3ZA 1P4IL 3RZCC 4NO3B 2ICWJ 4Z0BH 1UM4H 4M3JA 4M9PA 1WS8A 1ZLDA 1M6OA 2APTA 2OR9H 4FYRA 2G5RA 1S9XB 3OKMA 1Q0XH 3MMEA 1SJHB 3NK3A 4NQCE 2OJEA 5EDXA 1WEJH 1FH2A 2VSMB 4OM0H 4QCIB 2VDPB 2YEVB 1F3DJ 3S96B 4ELME 4IHBA 5B39A 5BQ7A 4LKXB 1LVEA 2H1PL 4K7PL 2MFNA 4TVPH 3VFOB 3FBKA 4EVNA 1CD1B 1T0PB 1KJMA 2D9CA 3I6LE 1AC6A 4K9JA 3LN4B 1N0LB 1Z0MA 3WCYA 1A9VA 4BFEA 3CUPA 3V7MA 1EHAA 4L9LB 2OMWA 2P24A 4PRPA 3D18A 1TZGH 2CO2A 4OCXH 1NBQA 2NY1D 3OQ3B 1HZHL 4ONGH 1FFNB 4KWUA 5G4MA 2APXA 5GGSY 5CNHA 5T3XL 2HT4D 3RVTC 5E5UB 3HC3L 4E5XA 5DLLA 2F68X 4X9FA 1OGPA 2RIKA 2YAFA 2VLKA 4OQTL 5FW7A 5EUOF 1NFDA 2D8KA 1S78D 3MKKA 3CVHB 3BAKA 5E9DD 1X7QA 5C1MB 5CBEA 4KY1H 1ZT4A 1JF1B 3C75A 5PAZA 4LLDB 4EIZC 4XB8A 3BP5B 3AQYA 1NPNA 2ERJB 1XHHA 2QELA 2R4RH 4F37F 4F7CA 5I6MA 5IROA 4MCMA 3ZKMD 5I73C 2B59A 2AFNA 3PG2A 4ZO6A 5EWIL 3FT3B 1FV1B 1W72H 4N2MA 3D39D 3SQOH 2EH7L 2HFGL 4PH8A 1DDHA 3B2UC 3LQZA 2UY6B 3S36X 1EDQA 2A3TA 3VD7A 1S9WB 2CSPA 3QCUL 2Y2WA 1UA3A 3HB3D 5C0IA 1UZ6E 2UZXA 2F58L 3IFNH 2GYSA 5B1BB 4PJHE 1N0XH 1YC7A 3PWVA 4I18A 1FC2D 3JYBA 3V4VA 5EHFA 3NGBC 5CP3H 4JPQA 3VD9A 4G8FB 3WN5C 1J12A 1RUQL 4I0KA 1YUKB 4M6OH 4XP5L 5KBMA 4R8WH 5TGBB 4RFOH 1YHPA 1HKLH 3H42H 4P0DA 4RGNC 5DRNB 3FFCA 1MFCH 4X8JA 1NIFA 3REWA 1RCYA 1XXFC 5K5YA 2AJUL 4RMUA 3V4PL 1YQVL 4DKEL 3G5WA 4ODBD 2HG0A 5I73B 1KYOK 5FA4B 4MXWL 3FU7A 5LBSH 4HPHA 3O2VH 3STZA 5HDQL 5T5NG 2JV6A 1XF3B 4N20A 4FXGA 5EV7A 5C0CA 1N59A 5E6RB 3NP4A 2YIHA 5GZOD 4FXLA 3FN3A 3LHPL 4RRPM 4Z7VB 2GIXA 1HFUA 4XMZA 2EE2A 4OR1A 1HN1A 1RHHB 2ZTBA 4MNGE 3RWFB 4ZYKA 2PPEA 3NZ8A 1YY8A 1ETA1 1XIWA 3QQ9C 4FNUA 3U7AA 1YMHA 5MI0C 2Y24A 3BKJL 1RXLA 2B4CC 1UH4A 2WOYA 3KPSE 4LPCA 4OVUA 1JF6A 1T83C 4XP9L 2I9LB 1IMHC 3NGBB 4ONOA 1UB6A 2YGNA 1UZ8A 2Q8BH 4FP8L 1JZEA 2WJ7A 4RGNB 1A22B 4YDMA 2IPUK 1NANI 5F2FA 3P2DA 5F6IB 4JPVH 4RAUA 5L4FA 1RP8A 3B9KA 1HYRC 2AZAA 3RDTD 1AANA 1OZTG 1SYVB 3ARSA 3X1BA 4YXKL 2XX1A 1HHJB 5HHMD 5JDJA 2I9TB 1UD5A 2MJWA 1AO7E 1NA8A 1QLFA 3TF4A 2PCPB 4MAUL 1MDAA 5ERWA 5L0QC 4F7EB 4BFOA 1INDL 1UZGA 4LARL 4YDZA 2B3RA 4IOIB 2EVHA 2EDNA 4HLZG 1HIMH 3PHQB 3KEDA 4ZJ9A 2PPCA 3GDCA 4OAWB 4X80H 2BWQA 3FQYA 3VXRB 2ZAHA 1P4LB 1PU0A 3QIWA 2JKRM 4DTGH 5MI0B 2ZX9A 5F1OB 5FPIA 2UVEA 2NZ1A 3A6BL 3PWNA 5F7HA 4PJXB 2CO4A 4NZRL 5M7QA 1D6EB 3WEBA 1EZUA 3B3IA 4LSUH 5AB1A 1YEEL 4K7PX 4JHBA 2MCMA 2AJSH 2QV2A 2VC2H 3KG5A 1UFUA 1HL9A 4IOFC 5GGRA 4JG1L 4ZUUA 3WNJA 4AIEA 1FYTB 1I3RB 2XT1B 2OXHA 5B4MC 1PVHA 4L2LA 3TT3L 3F7KA 4F57L 3GPSA 1IU1A 3BIKA 4HXBL 2AJXH 4LO9A 1P1VA 4KVCH 1TZ8A 5D1ZB 2J57A 1FP5A 4L3FA 4M02A 4XN1A 3L3IA 4KKCC 3SYPA 3A4FA 4C56B 4D2NA 4WWKB 3WDHA 3UTPD 4UQDA 3FNKA 3RKPA 3TCXA 3QQ3B 2C26A 4FCAA 2FEDC 4EUPG 3QP3A 1G9MC 1N4XL 3VD1A 5H35A 1RIVL 4X7EC 3G5XA 1OM3H 3HC0A 3V0AC 3GSRA 4IRSD 5T3ZD 1JTPA 3UPRA 3IMRA 2WBWB 1F11B 2BNQD 5DJDA 2ISDA 3ARBB 4FCHA 4IK6A 3FSZA 4X6BB 4AV0A 5JIMA 2K78A 3U4AA 1QR1B 5HVWA 1RZ7L 3CFKA 3GNMH 4O2EA 2Y5TA 5EBMB 1U92B 4F20A 4UV7L 4Z7UF 3MRFB 3VW3H 3BVWA 1CK0H 1CDUA 2V2TB 5HYJA 5FO8B 3UTTA 3MBWA 3FTGA 3U82B 4XNQA 3H9SB 2Y1YA 2JJTC 3L95B 1MCWM 4NJAH 4UV4L 4DFIA 2YK1H 2P8LB 2ADGB 4M5ZH 5FB8B 1QA9A 2H41A 1T0OA 3MLVH 2B5IC 3CVBA 4I48A 4KNQA 2Y5EA 3QEQA 3TNMB 1IAOB 5TDOB 2V2XB 3H9YA 1YAIA 1E0OB 3RGBA 3QCVL 4L3CB 3F3HA 4NO0A 4MNQB 4ZMYA 5I5MA 5GRXG 1KTDA 2P52A 1EAJA 1IC7L 2BZCA 5DTFA 2FB4H 2COQA 2YXMA 1M1XA 4GW5A 1B88A 4LPVA 4RMQA 1X5LA 1JRHH 1XGUB 2W65A 4FQJH 4GRMB 2O93L 1REIA 3VXTB 3C87A 1VKXA 3MBXH 3CDGA 1W72A 1G4MA 3DVNB 3UTSA 3VI3A 2BNRA 2HAZA 2YA1A 4GBXA 2AXHA 3BCDA 2CLVB 4XMKL 4GAYB 4UNUA 4CU6A 4O5LH 1P5UA 3GKWL 4XCCH 3TPKA 5KVGH 1KCUL 3P4MA 3ARDA 3PLYA 4Z7AA 3P1VA 4OI7A 1G7JA 1U3HC 2YGVA 4C47A 2J88H 5F1NB 3DMMC 3WIHL 5FK9A 1Q9KA 4OLEA 3FL7A 1MVYA 5I6OA 1SMOA 2XG5A 5FO9B 5CGYC 1SXAA 1T5WB 3IDNA 4AT6A 1P69B 2DQIL 3H1ZA 3GMRA 5CP3A 3W39A 3OKLA 3MRGA 1UYWH 4EKXA 3BMVA 5JOPE 1XGZA 3L4VA 5E6ZA 1HI6B 3QCTH 4GRLC 4AQOA 4PBWD 1FE8H 2IH9A 5DK0B 1AQHA 4KKZA 5F96H 2Z8RA 4LGRB 3AT9A 4HLJA 1UADC 3IRCA 2X7LA 1BEYL 3PXHA 2IAND 3WE6A 2CHZA 5E56A 1RL1A 1XMEB 3NCCB 3VFGH 2GJZB 1MCLA 4OZIF 4N8VA 4X7DC 3W9EA 1XD1A 3FMGL 4M8UA 3J27A 3B7RL 1HHHA 2Q9OA 1XSOA 3BKYL 3IJ9A 2HKFH 5SWSD 2X09A 1CFTB 1XGYL 1U3HB 2LTQC 1JCKA 3FYEB 2ZUWA 3DMMB 3ETBF 3K1DA 2VDQH 4M6ML 4RWHA 1CF8H 1JTTA 1VFBA 4D0DA 3ZRCC 5A16A 4APQC 3DSFH 5FDYA 4WK4B 4AMWA 4Y19B 3MLXH 5F9WB 3LSOB 2G60L 4N2BA 1G1KA 5AG9A 4GKLA 3NG5A 3TVMA 3VG9C 1NCNA 4G8EB 1LP9B 4YEFA 4DN4H 4GSUA 4DVBA 5D4HA 1TTGA 1L9TA 1DQDL 4QGYA 4QO1B 5FYLD 2MCAA 4NKMA 4HJUA 5FM8A 2PYEB 2EILB 4BZYA 3L4UA 4NRXA 3WL9A 3SDAB 1LO3L 4N2EA 5C0BE 3W11D 3D4GA 3T8MA 4FQHA 2YC1A 5B3SB 3O0RH 3WEAA 4QIRA 4MQSB 2VLRE 1BGXL 5DO8A 4WWID 1RULH 3KWWB 5JW3L 1PPIA 3FQXA 2LTQB 3LS5H 1E27A 2PTTA 3GJFK 3ARFC 1BHGA 3II2A 1T2XA 2XN0A 4KRPC 3WTSA 4ANKA 5JLZB 5CN3A 3O2WL 2FO8A 2WINB 1UXLA 4NQCA 3V5DA 1UXSB 4AGPA 4Y1TA 3TESA 5TE6H 4ELMA 2XV2A 5IWLA 1TQSA 2BVPB 2JKJA 1BYOA 4GW4B 4R5VA 4JR9L 3SDXF 3QQ4A 5K9JL 3KL0A 4FADA 2IBBA 2EIDA 4KMTL 3GLEA 1GTFA 1NBZB 4ZDHB 3C60A 2VERA 3KM1A 1EAQA 1U4FA 1Z9PA 5EOTA 5IQ9B 4K4KA 4H8UA 5J1SC 3N5AA 4EI5D 4N9OB 4RX4A 2WLIA 3N1GC 4TNVK 4DEPB 4C83B 4OIFA 1FN4A 1FFTB 5I0XA 1S5IL 1SHWA 1JWSB 4CMHC 4LLYB 2PYFA 1KV3A 3ARFB 2PMZA 4ES9A 3I84A 4TQPA 2QQLL 4AEHH 4KRPB 5F3HA 3SKMB 4Z8FL 1XH3B 3BGMB 4R3SA 3L1EA 4JDEA 1JI2A 2FJFB 2LFEA 3VXME 4F15C 3GYRA 1DN2A 4WO4A 3N9GH 1TEYA 2HZHA 4PRIE 5E2TH 3QR0A 3REVA 4BUQA 5L2JA 2IG2L 4QHLA 3CFCL 1JERA 2JQMA 4UDUA 2DM7A 4E5XG 3AWEA 1F90H 5IHBA 1IE4A 2AK1L 2BFGA 4QXUH 3FU9A 3UTZA 3FRUB 1F3JA 2J1KA 2R2CA 3SHSA 3DXAD 4AK1A 2HTLD 3QFJE 3B2MA 4NZUL 1NFAA 3LRHA 1UKTA 1UD4A 5L8KB 2XRAL 2EAEA 3N0PB 1VEMA 3F58H 4IJTA 4CMHB 1EO8H 3KPNA 4ETQB 2MWCA 3U7WH 1R3HA 1TVDA 2OI9C 1ODAA 3B83A 4PJHA 2O61A 1RLBA 3HJEA 1JZGA 1M6UA 4L1BA 3X13A 1KCLA 3JWNG 3IAPA 5B38B 2Y7OA 1PFCA 1NAKH 3LKRA 3L81A 4JY4A 1D5ZB 1NPUA 1YJDH 5I1LA 5CIPB 1ASPA 3S4SG 1AGDA 1FVEB 1GJIA 2BNUB 2DQGH 3ESUF 3DDGA 1KGYE 1U3NA 2F53E 3BP6B 4ZUWB 1RUAL 4H8WL 4NQDB 4JY6B 4Y88A 1N2RB 2PXYD 4JGMA 2P47B 4OKVA 7FABL 2D7QA 2N7BA 1A4JA 4DP7X 3T77B 4MNGA 4LOUC 3P4NB 3BZEA 4JY5H 1IBGH 1I7ZB 1SYSA 1PGRB 1T22B 4JAMA 2Y4SA 2OI9B 1HEZB 1M4KA 3KPSA 2VDOB 3BQUA 3APDA 4X5XA 3B7TA 3D2UA 1NMAL 1IAKA 1K3IA 3EOBB 5HGDB 3HNSL 4X6DE 4PS4H 5C2UB 1ZVHA 3O3DB 4KKAD 2E6PA 2P8MA 3N85H 3THMH 2PWFA 2R8SH 1GZHA 4G8GD 4LKCB 3HKFA 4X6FB 2NX5E 4XPAH 4LPUA 2XN9D 4QXTA 5D1XE 2VLJD 4E41D 1GS7A 1AO7A 2NTFB 3OXSB 4EIBA 5IMLA 1TF4A 4E36A 4XR8C 1KEGL 4JHWH 4QRTB 4BUHA 2A74C 1IV8A 4ZFOB 4M5SA 3MUGA 2XKUA 3VQMA 1OARL 4PYHA 4ZS7H 3RILA 4H8HA 3U36A 2AV7B 2ZUXA 1ZK5A 2M1KA 4AV5A 4JCWA 1JK9B 3C9NB 3Q2WA 2J6WA 3US9A 1ZANL 3SN6N 4J39A 2QL1A 4DSYA 4L3EE 3FU6A 1FSKC 3ABKB 3KDMA 3F05A 3WSQH 4NWUL 3WNPA 3HG1D 4ZXBD 2ZNXA 5D70H 2EEFA 2FLBT 4FQPA 4QF1A 2YMTA 2MNUA 3OSKA 4D7BA 2J25A 5I1JH 2FX8L 3M07A 4BFIB 1D5RA 2E8YA 4LVNC 5EN2B 4HS6B 1BZQK 3F12A 4KV5F 5JQ6H 1SZNA 4NNPH 2GB2A 2WHVA 3BEWB 3VFWA 4YGVB 2EXSA 1DFBH 2A74B 1KBVA 3ARED 3SJVB 3A67L 2WLHA 1ZDSA 3KPMB 3F7LA 1ESOA 5HTSA 4WSKA 4MS8D 3TV3H 3TXAA 5C97A 2IO5A 2D3LA 1RJYB 1EXHA 2R2BA 4IDJL 5FLVA 3KPOA 2K6WA 2UWEE 4L18A 4M5YL 1MJUL 5EZPA 4DP6X 1QO3A 2AC0A 1S7QA 5TQ0L 3D9AH 4LCYA 3S97C 4KOBA 1KLUA 5DMYA 2ZCLH 4KHXL 3S35L 3CU7A 4P5TB 3HIZA 4F8OA 2EDEA 1A1OA 4TNWK 3E0GA 4H0IA 4HUUA 5J4MA 4N26A 5DZOA 1GOGA 1D5IL 2CZNA 5KVDE 5KANG 4YDIL 3UG3A 1MW2A 4PJ8A 4HKJB 3DVGA 5KBPA 4R2GD 1GRWA 1HXYA 3EOAB 3ESMA 3QULA 5CCJA 4W9ZA 3VD2A 2LGNA 1Z9MA 4HK0A 1BZOA 3QDMB 5EIIA 1N6QL 2BSRB 3FRPA 1VADA 1ZVSA 3ETTA 5FOBA 3TYFB 4YQXL 1FZMB 3EZJB 1BVKB 1EBAA 4FI8A 1DANT 4WNSA 5A2AA 1YCSA 1NFKA 5HYSB 1VFOA 3NJMA 2C9AA 4Y5YC 5I17A 1ACYL 1SDDA 1KTRL 4XI5C 4KY2A 3HFML 3MLTB 1PZ5A 3ARYA 4FG4A 4Y2DA 1QFHA 3OKNA 5FM5M 1ORSA 2GBUA 4HWEL 4KAQH 3RJQB 2NY4C 4OUUA 4UOJA 5E9DE 2A6DA 3CBKB 4ABUA 4XVSH 3MYJB 3LKNA 4O9HH 1DO6A 4RMSA 1MF2L 4MCZA 4S0TD 4FG6D 1AZZC 2EDLA 3MI6A 5CZXD 4AW4A 1KIQA 4PW9A 4W1TA 3QUZC 1KPRA 1CXEA 1UCBL 2XWBB 3D87B 4ONHB 3I2CL 2DQJL 3D39E 4Y4HB 4BWUA 2NNXA 3NZHL 1IT9L 3MRRB 4XNMB 5IQ7L 1RP9A 2JK5A 5EO0B 3GIZL 1CT8A 3BISA 4QGTA 4U6YA 3FT4A 3LQAL 1QQDB 2O6PA 4OI9A 3RZCD 1IBDA 2R2HA 5DRXB 2HWZH 3CG8A 3FJTA 3FUEA 4I87A 1PY4A 4AMKH 4U1IB 2K6ZA 3BAIA 1T1WA 3GSWA 3BVXA 4GXUN 4OT1H 3MREA 1I9JH 1T20B 4Z95H 3FQUA 1N3NA 2P48B 1N7MH 1DBJH 3WKNA 2AAAA 1OSEA 1XBDA 1X9QA 1B9ZA 2NUTB 2YLHA 1ZA6B 2RBLA 3MA7A 4HJJH 4WFGD 3D4CA 3RWGA 3ZDZB 3D3VD 2OAAA 4CC4C 2XJLA 1DR9A 1TVBB 4LEOA 3WD5L 4YHMH 3EH5B 2KI6A 1P4BH 5JOFB 1VB9A 1JNJA 2Z0BA 1TJGL 2VKWA 3F7RA 5BZDA 4PGDA 4MBOA 5K39A 4F3FB 4OGZA 2FIRT 3QUZB 4KPHL 3WIFB 4HYTB 4L4JA 4PJAF 4DF9A 1B0IA 1JFQL 3ISYA 3SPHA 1QSFD 4QTIH 2WLKA 3ZKQD 2EH8L 1W8OA 2VZTA 3T8VA 3DOSA 2XWXA 4R84A 4AEEA 1ZDQA 4K5NA 5EBWA 3RVTD 5K9QG 2SEBB 5C6WH 5D2LB 2XKSA 3UTOA 1ORQB 3KPRB 4N2LA 1JK8A 1J9RA 1KPVA 4HX1B 3GSXA 4AZ8B 3MCLH 1LK2A 1L9OA 4IM8A 1O6VA 3OAZH 4TULH 5I74B 1E4WL 1G87A 1W6WA 2X70B 3DPBB 5MP6L 2E3VA 5DI8B 4A7QA 4PJIB 1QW8A 3S34H 1SRDA 2OCJA 4NQQA 1MZYA 3B2UD 5HHME 3V0HA 4GT0A 3AVEA 5IHUL 1R0AH 2VLRA 2BSTB 5GGVL 2IWEA 4NNXB 2C9SA 4XN7A 1JXGA 4OFPA 3VGEA 5KYYA 4FG2A 2R56H 4O02H 3UBXI 2Y1AA 4TNVF 4HWNA 2BOCA 4JPKL 2NSMA 5AZ2L 4D9QD 5JNYA 4TVUA 1OIOA 4FQLL 4ZSOE 3TURA 2F18A 4XBGA 3S35X 3ZXAC 1KJVA 1UFGA 4HC1L 4MB3A 4CJ0A 1EWHA 4LCUA 5LVEA 1F18A 4MB4A 3SYAA 3B34A 4A7GA 4RGND 4GUQA 1UD6A 3DNKA 4WV1A 1QHQA 4RRPA 5CZVL 2X40A 3TCTA 4J2XA 3ECUA 1YNTB 4F2ME 1FHNA 5FDWB 1L7TH 5AALA 3GSVA 4FL4C 4CGTA 5C0GA 1F42A 4PI0A 2VMCA 4U3SA 2DJMA 3LIZA 3AUWB 3S48A 3VXRD 3L9RB 4J3OC 1JHKH 3UTPE 3SPIA 3QQ9D 4KKNA 2XV0A 1I7RA 1PBYA 1RZPA 1XT5A 2DKSA 4M4RA 4PS7A 3OTTA 4HU2A 3W1ZA 4HWBL 1TU2B 5KUMA 1XBRA 3UYRL 4YSCA 1K5NA 4I2XE 3UC0L 1WZMA 3D09A 4CN4A 3OD3A 5F0PB 4TOYL 3TIDA 1BW8A 3PHOA 1IGIL 5T3ZE 2E7BA 2CKNA 4J12A 2JXMA 2FRGP 4XXWC 3L5XL 5D6CA 1ICTA 2VXQL 3UO1L 1G7MB 5M94B 1EMTH 4MJ5A 4KBPA 4GAGL 3IWUA 5CU9A 2IH3A 3VSQA 4LSPL 1W0WA 4S11A 4OVVA 4JVWA 4U2ZA 1MW0A 4HGMA 2GY5A 4G9DA 2BVUA 4C56D 1PX3A 2WXJA 3QFJA 4IU3A 1IFHL 3U0TA 5DQJA 4B9CA 4Y5VC 1LO0H 2X4SB 5HDBB 3D5OF 5I6LA 3TH2T 1X9RA 3LJ3A 4PJBF 1K4DB 4R4BA 4WJ5B 4HLZH 4PGCB 5F7DA 4S10A 4P2QB 4OCMC 4RSYA 4KVNH 2JIXB 2F7QA 3RL2B 3SD2A 5MEPA 4TLTA 2Y22A 5INDA 3UJTL 2V8MA 3EG9B 4KTGA 2RTTA 4LLWB 1V7NH 1BF8A 3DOHA 1J86A 2DWYA 1DJZA 3T3PE 3MVSA 3ZE1E 5AENA 5JIQA 1MRDL 3NSXA 4IOFD 3UERA 5I1CH 2FNBA 5B4MD 3KEHA 4DGIH 4NC1C 2VDNL 2YKLL 3H9SD 3N41F 3IFPA 4XAKD 1R1CA 5EOCL 3HMXH 3MN8A 4KKCD 5IM7B 4J3WA 1NM9A 5DQDL 3EBIA 1NEZG 3OPZL 3P11L 1BBJA 3D85A 4Y5VB 3IM1A 2FEDD 3KYNA 2Z3FA 3BZDA 2B1HH 1PMYA 3OC5A 4R5TA 1XTMA 2P49B 1ITCA 3ERXA 3RAJH 4HUWB 1T04A 3L9EA 4Q9BA 3Q7JA 4URKA 4OTXH 1BOGA 4UUJA 5DRWB 2J8HA 3K4DA 4WW1B 4BBWA 4N90D 1N18A 4WFHD 4X6DA 4OF5A 1VJSA 1YEJH 3N1QC 4G11A 2WVUA 5DJZB 4FQXA 2HJKB 3FQNB 4XOAA 4JX0A 3AAZA 1T2QH 3WFZA 2NX5A 1NGXB 3FUDA 3GJEB 3GTTA 5D1XA 1CE1H 5BMFH 5E2WH 2O5YL 1KEMH 5EU4B 4D3CL 3TO4C 1D7FA 3V0VA 2IANE 4C58B 4AQZA 2ZKXA 4LSDA 5ABAA 1XH1A 5IW6A 1V10A 4ZUTB 2WK2A 3L1OL 5IB2B 2WIMA 4BZ1H 4RMVA 4KHTL 4XP4H 1UWEH 2PKDA 3IXTB 5C07B 4AK2A 5SWSE 4Y4KA 1O9VA 3HAEB 5K1VA 4L3EA 5GRUH 2A73B 2EYRA 1TNMA 5T5NF 3V6FB 3ZT7A 3QUMH 5BV7H 3KAAA 4P5KA 3DK2A 2O5XH 4V11A 4DQOL 2WD0A 3LH2L 1GTNA 1II4E 1IC4H 1SNRA 1WK0A 2DD8H 1CPUA 2H7WA 1OAKH 3MR9A 3R18A 1Z5LB 5DJCA 2AI0L 2IH1B 4MA3B 4KJYA 5I8CA 5FYLE 1W0VB 5LJYH 1RJZA 4NZJA 2BZ7A 2YD0A 4PJFE 3ZTCC 1G84A 2ZG3A 1KJ2H 4YFEA 2WO4A 2OXGA 1NGWB 2ITFA 3D12B 3KLAA 2C1PB 5J9PB 4NUPA 4AM0B 5JIPA 2MKLC 1U3HD 5D96B 2UWEA 2R0LL 4LF3A 1SQ2N 1WZLA 3ARGB 4Z7OB 3DIFA 3VXSB 2ENQA 5A2KH 3MODH 3BAEH 4KI5F 4U6VL 4ODXA 3NQKA 4RMWA 5CP7A 2YPVH 5E1AB 1HT6A 1JZDC 4HFWB 4GRLD 4NQXA 1S9YB 2Z7YA 3OGCB 4JQXA 2C9PA 3CFBB 1HCYA 5DEFA 4OLWH 1TQWA 3LXUX 1CFVH 3I6KB 2X9XA 2PYED 4Z23A 3X12B 2J55A 5DUML 1A02N 4GW1A 1XGRA 4MXVE 3P4LA 3OR6B 1RU9H 2APVA 2WNGA 3Q43A 4FJZA 1CICA 1RFDL 5FO7B 3K5RA 3AG2B 3ILQC 2CO6B 4ODUA 5CEZL 1ID5I 1EO5A 1DQLH 1KACB 3QIUC 3TJPA 1X5JA 1MPAL 3NH7L 1MJJA 1T4KA 2QHRL 4O2CB 3FONB 5E23A 1RY7B 5BNXD 1O5PA 1LEIB 2W60A 5DHEA 4APQD 1BG1A 2OMUA 1MKFA 2RALA 4K8RL 3FRPG 4A7SA 1NDMB 4PWGA 3PL6C 3DV6B 4JM2C 1GZQB 4QAWA 5E9DA 2C1OB 3IF1B 1XF2B 4QHMB 1UJ3C 3KZ8A 3C5ZC 2DOCA 4NIYE 4X7TA 2X42A 1JF5A 3VFNA 4W4OC 5L2KB 2D03H 4OLYL 5SX5H 4U1KB 1AOHA 2WVVB 1HXMA 1SVZA 4JVUA 3N40F 3S0PA 3B9VA 4G6MH 3D39A 4U7KA 3ZRFC 2IQAB 4WHCA 3V4VL 4ZMVA 4I0CC 4PGBB 2GEQA 5H37H 4Y9EA 1ZLWH 1XGTA 5BZWA 3DXAE 3OKEB 3EFDH 5J1TC 2DZEA 2XN1A 3C8HA 3TASA 4OCYL 3ROOB 1BPLB 1RZGB 1Z3GH 2V33A 4CMMA 3GGWB 3PWPE 4L8BA 1U8QB 1J0JA 1F97A 2R23B 1S5HB 4JJHA 2V17H 4KC3B 1QFWL 4JM2B 1SY6H 5EORL 3SKJL 5L7XL 5I0WA 3VXNB 3ARZA 5FUCC 3E2HC 4LT7A 2K3TA 1UJ3B 1EV2E 4OBRA 3ZHFA 3IU4H 3RGHA 2VLLB 5T5FA 1IC1A 4QOKB 4JRYD 4NP4L 1OSZB 3DUSB 3HR5B 2I26N 5DD5L 4NHUB 5L6YH 1M56B 2NW2A 3GUFA 3WTXA 4N2AA 2VWEE 3AG4B 2BRRL 5IEHA 5JXAL 2R1WB 1Z5HA 2EO7A 3WJMB 5GZOA 3MLSL 2YKKA 3HHSA 3C6LC 3W3BA 2VL5A 1DQJA 2X4NA 3Q13A 4AQEA 5EDSA 1OAQL 4KUCF 1I3UA 4QRFA 1JNNH 1ZAGA 3JVGC 1PLBA 2KPWA 2H32H 1EFXA 3GXFA 4E9SA 4Q4EA 3II3A 1DVUA 3IB4A 1LNUA 3VH8A 4J6RH 1A6VL 2JCCF 5GSVA 4MVBC 4FABL 5EBLA 4A6YH 3R8QA 3R06A 4IGBB 2EUXA 2OMZB 5E9NA 12E8L 3WTYA 4U1NA 2AKRA 2XWRA 5F88A 4JK0D 3SDCB 2FJHB 2WLMA 4NDMB 4G8IA 2BVOB 3RDTA 5A2JH 2XN9E 4R26H 1HQRA 1SN5A 2VLJE 5FUOL 3UZEA 4E41E 2QVTA 5C6PB 2RFXA 4V2CB 4EOWH 3QQNA 2X4TB 4BFJA 2AQQA 5E94B 1RZQA 2V0AA 4XO8A 4MSWA 5LGYA 4XCNA 4LNVA 3D06A 4HIJB 4ZQKA 3T0BA 2YAPA 1F8TL 3BAWA 3KPQB 1DJWA 5IG7A 4ZSOA 5KVMC 2NTSP 2BSDA 3UBXB 3RGVC 2AITA 3PE9A 4F33B 3RVXC 5DZNA 4S2SA 4XNBA 3OVUB 4PJCF 5JYMA 3GRWA 2X53A 3HG1E 5ILTL 4OD1H 1LE9B 3JWNH 3AM8C 2ZPKH 4Z0BL 1SOKA 1UM4L 5HI3C 3D6GA 1HSAB 3G9AB 5I18H 2Z4TA 1J8SA 1R5WB 4F2MA 1WCQA 2YD6A 3U6XA 3SCMB 5JHMA 3MV11 4RGOL 2R0WH 3MOAH 1WEJL 3KLDA 5FGRA 4EAEA 4FKEA 3S3SA 5HVHC 1NCIA 1D5BB 2C7UA 1H15B 1YUHA 2EDDA 3PDGA 4G6AC 3D08A 4LOUD 4TVPL 1Z0NA 2HFEA 4UANA 3H7BB 1OP3H 1IAIL 3CV5A 1A7BA 4MA1C 3R1GH 3TN0D 3FOMB 3H9HA 4TQ8A 4UDTA 3ABGA 3RGVB 2WXPA 3FF7A 3C8KB 4OCXL 5DVKA 1PD1A 1R3JA 2B16A 4D9LH 3MRPA 5DZ9A 1YSOA 3L6FB 3DO7A 2Q7YB 4P9HH 2E75C 5D72H 3VNYA 4BFRA 3EYVA 2OTWB 1BXAA 1M7DB 3F5WA 1Z2KA 3V9FA 3D0VA 3SJVD 3NIGB 4FQ2H 1AACA 3DHUA 1HH9B 35C8H 4BGLA 1QZ1A 2YO3A 4A1RA 2ENPA 3FQRA 4XE5B 2OZ4A 5HVHB 3K81A 3KD4A 3FH8A 5IOPA 4YVNA 2EDMA 2WQUA 4WUUB 3U4BH 3FYIB 1W72L 2Y6SC 3PUCA 3SQOL 3BC9A 1BMZA 3I75A 5ES4B 4X7CC 4PV1C 3SQBB 5J5EA 3Q1EA 1Y6NR 1ZHNB 2KH2B 5E99L 4BH7A 1DQKA 1GGBL 1NSNL 3HG5A 4LCIL 5B1CA 2V5MA 2IC2A 1E4KC 2AXGA 1JPTH 4L1HA 2C9UA 1J1OH 1FFPB 1IGCH 4HBCH 1UOWA 1RZKC 4M56A 1H8NA 4YC2C 4XMWA 3QUHA 1HHKB 3FB8B 5E8NB 1K2DB 3ZQ9A 3EJJX 3BKCL 1N0XL 1A6TB 1WGVA 2K3HA 1FF5A 5K1NA 2NY3C 3UACA 1V5JA 1ACZA 1NC2A 2OYKA 3TNNB 4M6OL 1T7WA 5KJRH 4TUKH 5DHMC 1HKLL 3H42L 2ICEC 3BGFC 4U1LA 5A2IH 5CGTA 3TPUB 3ZDYF 3EH2A 2DWEB 4HHGA 4CSZA 5LBSL 3WFBH 1KXTB 3GC3A 1HZLA 3VTAA 3QPXL 4O51A 5C86A 2V9TA 3B1UA 2ORBH 5HGBB 5IB5B 1TZIA 4ZTEA 4C8XA 4AXWA 1FH5H 3O6KL 4WKZA 4WFGE 4XPTH 5MENB 2YFOA 3Q06A 3D3VE 2JTDA 4DVRH 2Q87A 1OCZB 1S46A 3QWOB 1C5BH 3OKDA 3FT2A 3NESA 2WKOF 3LXCA 3M88A 2IANA 3PGCB 1XV8A 2JTYA 4M9OA 5J8OA 4MTMA 5CWSA 1BJ8A 3T2LA 4Z77B 3QO0B 2Q8BL 5FYKE 3FUIA 3D0LB 1BCIA 4MD4B 2ZAGA 2QQQA 4XCYB 3BGFB 5IJDC 1HX0A 1AC0A 4X4KA 1QSFE 2VZ1A 2WUBH 1WBXB 2C34A 2CGRH 3EGDB 2H32A 4OB5H 3H7LA 5SWSA 4F58H 3QXDB 4XI5D 2ICCA 4OLUH 4IMKC 4JFPB 5D7KD 5AW3B 4Z6AT 4B50A 4HETA 4MQ7B 2QKIA 3DYMA 4U1GB 3G5ZA 4HIEA 3ULUL 2YAOA 1A6ZB 1XXDC 2NY4D 2GUYA 4GB9A 5ID0A 1OD7A 3P40A 4J7RA 4BWTA 1T3FB 2R59A 3O6FC 1AVAA 3QT2A 1A6AA 4X80L 3ZO9A 3ETSA 5IFJB 2AEOA 2N0MA 1FIGH 3JV6A 3VWKB 4YNYA 1R3IH 1RPQA 4DTGL 3VRLF 4TF4A 3DC0A 1B0RA 4FNSA 3QUZD 4PJFA 4HKBA 3GKZA 1AIZA 1AS7A 4X98A 1S7WA 3IJHB 4L05A 4Y1SA 4BWWA 2F9BT 2AJSL 1FNLA 2VC2L 1Z7JA 4Z7VE 3BEVA 1K9TA 4MX7A 2ZKWA 1V3MA 2CUAA 3WTUA 2XQYG 1J10A 3RX9A 4D9QE 5IEKB 1PF3A 5ADOL 4KUZH 2DV6A 1UC6A 4M6AA 3PGDB 4XPGL 3FOLB 3IPFA 1IQWL 3PP3H 1DEEA 4GLRI 1B2WL 2O6EA 4JKWA 3VSTA 4D0CA 1MN4A 1M57B 4RGNE 3BOVA 4F7PA 1Z9SB 1I8MB 3STLA 4AVKA 5J13C 4RBPH 3SOTA 4BH8A 4LSRH 5TPWH 1OM3L 1I1FA 6PAZA 5IUCA 1YEIH 4JPSA 2DL2A 2OQJA 3G6AA 2I32A 4PG9A 3F04A 1D2PA 1G7QA 1T5XA 3NA4A 4OD2A 4OZFH 4UINL 3TEUA 3LKQA 3AROA 2OMYB 3P2BA 3IDMB 3RA7H 3UPAA 5LQBH 1JBJA 2GC4C 5B3NA 1HXKA 1OAYH 2W88A 4U49A 4YDJA 3VW3L 2FX9L 5CLYA 3LQMA 3VXRE 1E6OL 4XO9A 1GS6X 4MWFA 1A21A 1QFWI 1H6UA 2Y6TE 4PJGF 3PWLA 1L9PA 4NJAL 1TLMA 3M7OA 3V9CA 2NY5L 3BT2L 1FO0A 2JI2A 3WHXA 2J1ZA 2HA1A 3MRLB 4PJXE 3TFKC 2VM9A 4KFZC 3TA3C 5DF0A 3PJNA 4UU9A 3MXWL 2J12B 2NR6C 3GK8L 2VDML 4OFKA 1EA9C 1MJ7H 3KL3A 4JANA 3O4LD 1AHWB 3V52H 3ZDXE 3RB7A 4JFYB 2ZXDA 5IQOA 5KOVC 4PRHA 4CNIA 1EHLH 4FQJL 4NQEB 4BKSC 4C56E 5F3BA 3DXAA 2VIRB 3LNGA 5DJ8A 1DUYB 4LLMA 3MBXL 1TCMA 3D25B 4HZLB 2Z31A 4EZJA 3QXTA 4IMLA 3MJ9H 1R5IA 1WH0A 4GQ9H 4WI8A 2R27A 1QACA 2MEJB 5JORA 1P9MC 3PWPA 4PUBL 5GXBB 2L7QA 3CVDA 1OAUH 5EFIB 4XCCL 1A7PL 3MRDA 3OZ9H 1HE8A 4PJ7E 4UM8A 3TA3B 3D2TA 4AL8H 2HJLB 4WWNA 4P2OC 3EFOA 2J88L 4NENB 1T6WA 4IKJA 2COVD 2FR4A 3P9LB 2G9HB 2A1WH 4OIBA 3BP4B 4LPTA 4BDVB 3BXNB 3DRQA 5FA3B 4BK5C 1J18A 3S3BB 4QHNB 4G1EB 5DJ2A 4UTAA 4JO5A 3H9SE 4XAKE 5F3FA 4Q9CA 2H6OA 4MMYA 5IMKA 1DE4A 2F5BL 1N5YH 4X5PA 3TIEA 1JXKA 2GJ6B 3NFSH 4J3OD 4PJ9C 2VM3A 3SO3B 1CFNA 2NY2C 2QZQA 3WS6C 3F7VA 1OT4A 5F6HI 4CVXB 2VM4A 4I0PB 1HL4A 4M1CC 2RB8A 1BMWA 4QRRD 2EDKA 2IPTH 2JIXD 4Y2LA 5E08L 1RD6A 4LHUB 4P2RB 2C3XA 3IETB 4WWPA 1CE6A 1THCA 1XTLA 4MNQE 5JO5B 4KKBC 5KBNC 3HRZB 3MNVB 4I9WD 4PY7B 3P69A 1WWWX 1BJ1J 1CDIA 1A6UH 4N90E 4WFHE 1P7QD 1Y07A 2ZOTA 4O4YH 2NT0A 3RX8A 1G1YA 4EF3A 2VT0A 1BFOA 1NC4B 2H4EA 2ZX5A 3SY6A 2EIKB 5D71L 4YHKL 3RY6A 5HYQA 2OS7A 4NCC2 4QRUB 2BJMH 2EYSA 2VLJA 1ODUA 5B1AB 3MLXL 3VH8G 4E41A 4Z7QB 5EZOL 5KTEH 1A1MB 2AJZB 2ZCKL 3RZWA 5BW7A 2H0JA 1FAIL 4YMPA 1MCIA 2WCPA 2Y5QA 3WNOA 1IAII 5I8EA 5ADPH 2YLKA 1OLZA 1MSPA 1S3KL 3S8GB 4XOCA 2XA8H 3MJWA 1OV8A 2K1MA 2VABA 2ZUYA 2ZQKA 4HUVB 4IBYA 2ALWA 3GI8L 4FKHA 5E4EC 5KSVB 3O0RL 5DZJA 2VISA 1LMIA 4MMZA 3HG1A 4ZXBA 1RULL 2CPCA 1TCRB 5D7LB 1J88A 3MRKB 1ZS2A 4ILDA 2FBJH 4BZ2A 5DSCB 3S8FB 4MCYB 4P3DB 4PGEA 2C5DC 3HE6B 5AVXB 1CXLA 1JZ6A 2ITCA 4AGQA 1OEZW 4NM8L 4FXKA 2O26U 1JGEB 1ZA3A 3BZFB 1J1XH 4P59H 3AREA 1P7BA 3RUGF 4WTZA 1TR7A 3PABB 2I07A 1L0XA 3ZTJG 2XPGA 1LYQA 4L8DA 2KDGA 5ICXA 4FZ8H 3VXOA 3WMQA 4PD4K 1MCOH 1KTKE 1U8CB 1U6AH 3U1QA 1M2VB 1RZIA 4FYTA 5E4EB 2FQEA 5CFHA 4ZFZB 4L8SA 1CVRA 1U2YA 3NUKA 3MRHB 1VCBC 1ERNA 4F5CE 1A7OH 1IEBA 2NY6C 3EH4B 2MOGA 1CBVH 3JWDC 4X9IA 1T1XB 4Z7IA 2DDQH 5KS9B 5EO1B 4V1DB 4AEHL 5MEOB 1SOXA 4WFEE 3TO4D 2PYEE 2B0SL 3GB7B 1U91A 4AH2B 1MFEH 4PJEF 4JO4L 3AQXA 1TO5A 3GBEA 1FNEB 3SE3C 5ISZA 3L5IA 1UWXK 2J21A 4N0YH 2NDGA 3NFNB 2Z1PA 3TL5A 3C12A 3U2JA 1XAKA 3PWUB 1E6JH 3GM8A 4KGJA 2XFGB 4R7NB 1ET8A 1BAFL 3F7PC 1F90L 3L5WB 1BYNA 1OHZA 3Q48A 4QXUL 25C8H 2I5YL 1MZZA 3FTVA 1HNGA 4KTDH 3QJRB 4OI8A 4AKPA 4F7TA 1F4XH 5F7EL 1HEJC 4R97C 1SJHA 1CDGA 2NY6B 4X7FC 4EXPX 1PJWA 3H3PH 4QCIA 3S96A 4JJ5B 4BE5A 4IBSA 2YD1A 3F58L 4I7ZC 1TEFA 1EO8L 3RYMA 3UCQA 5HHQB 2QQNL 2Y69B 5DR5L 5GHWL 3U7WL 1CD1A 3LN4A 1CQYA 1N0LA 3CSYA 5C0EB 3BLBA 4LOFA 4M6NH 4L9LA 1NAKL 1J9SA 4MASA 4OQ1A 5BXFB 5L9DH 2K8MA 1FC1A 3MLRL 1FFNA 3RZCA 3HZMB 2FH8A 4M62H 4Y0GA 3H4HA 1G9MH 1NJ9B 1RZ8B 1KYOJ 4ODVH 5AFAA 3S2CA 3HBZA 2IFGA 3OJMB 3P54A 5EZJB 2PCXA 3TBVB 1QBLH 2DQMA 1JF1A 1A0QH 4NKIH 1OCWH 5AB0A 1JP5A 3D3VA 4LLDA 3F7YB 5L2KD 3EOTH 3CHQA 1VF5C 1ZOXA 3RI5F 2WN3A 4PYGA 5CSGA 3FT3A 4JRYE 1FV1A 4HIHB 1M6OB 2OM5A 3T0EC 2CCVA 4PS4L 1MCHA 4JB9H 3W37A 1KJ3L 3QH3B 3ILQD 4PJ6A 3N85L 3OKMB 4GOSA 2LU7A 3QIUD 1QSFA 1I7TA 2OJEB 4Z3GA 1BREA 1S9WA 1TVHA 3S3JA 5B39B 4OGXH 1BBDH 2BP8B 3G6JF 3DX7A 4O2FB 2G5BA 5BQ7B 2IDTA 2HLEB 4PCTA 3UCRA 1ONQB 4WW2C 1LM8V 2W9LA 2DQDL 3GO1H 3OC8A 4NWTH 1S6NA 1E90A 1K85A 3E38A 3PL6D 3NCWA 4JM2D 1I1YB 4ZS7L 5EZLB 3ATDA 1GW6A 3VFMB 4G8FA 1KN2L 4BQ9A 4YDKH 1MH5B 4AENB 1BAGA 2OMWB 2P24B 1X3DA 4K3GA 5TGBA 3D18B 2FT6A 3C5ZD 2YS4A 5IJVA 2ZP0T 2NNCA 3K80A 5H94B 4WU7B 1MFBH 4PG2C 1DVYA 2P5WD 2EC9U 3JQOB 4MJ6A 15C8H 3AG3B 4HT1L 4YPGB 2J4WL 5FA4A 3DIVA 1XF3A 4GUCA 4KK9C 3T0EB 1KFAH 4PJ5B 1MWOA 3VD0A 4I4WB 1NFDB 5IB4A 3MUY1 4NQDE 4OGQC 3JYCA 5I1JL 4Z7VA 2GHWB 3L4XA 3NJHA 1HCFX 5ICUA 5B8CB 2Z93B 1CCZA 3A4DA 4KRNA 3CBRA 3V8CA 5JQ6L 2HKAA 4F7CB 2B59B 2B2XL 2WOBA 4M7LL 4OCLC 4ABVA 3L08A 2I9LA 5KG9A 1DDHB 3P02A 5CMAB 2K4AA 3AQZA 3ZK0A 2QMKA 4LLQB 3FUKA 1QTYT 3PAYA 3VXPB 2X9ZA 3MNWA 2JKTM 4ZPVB 4WHTB 2HJFB 2P5ED 1L3WA 4JNXA 5C0IB 2ATAA 1A4KB 1SYVA 3D9AL 4W9GC 2UZXB 3SYCA 1HHJA 2I9TA 4JFDD 1WBYB 4MFHA 5E8DL 1EDYA 1JZ5A 2X87A 1URLA 3SY0A 4F7EA 2JB6A 4UTBH 3I3BA 4K94C 3T4AC 2IEPA 2N1KA 3V4VB 1EDHA 3C6LD 3ET9F 4N2HA 3UZQA 3PHQA 3Q3GB 1N10A 5LG1A 5GQBA 2A9NH 3VXRA 4DP5X 4NT6B 1NCAL 2KL6A 2WNWA 3U9WA 5K69A 1P4LA 4N24A 3REWB 1MIEH 3FQ4A 4WNQB 3ULVH 4ZO8A 5BQDA 4U7SA 3TWYA 1X5KA 3CIQA 3EAKA 4Y5XC 1T83A 4MVBD 1AQKL 4PJXA 1Y6KR 3B2VL 5C0CB 1N59B 1D6EA 3U4KA 4PWKA 4MHHI 5EUOB 1AYOA 1YEHH 2P26A 5F70A 1I4FA 4A2DA 4HVBA 1ZPUA 3QZLA 2A7BA 3CU1A 4Z3JA 2VDLL 1FYTA 1I3RA 3NZ8B 4X9YA 1XIWB 2RGSA 2G3XA 3BZ4B 4KAQL 2OZNA 2A4CA 4XH2A 4HWUA 3L2LA 3SJVE 2KKQA 3HS8A 3LNEA 4C56A 1UB6B 2RH0A 4O9HL 3QQ3A 1CXIA 1JD9A 1PG7W 2Y25A 4B97A 4RAUB 5I6PA 2VMEA 4KK6C 1J8HD 3RGVD 3HHMA 3BH8B 4AUJA 4Y5XB 3RVXD 1DLFH 4PJ7A 3MCKA 4OLZH 1WAAE 1MHPL 3ARBA 4QT5B 4YDLC 4X6BA 3ZN6A 4Q6IC 2CUHA 2HWZL 5EBMA 2QADD 3BZ5A 4NOBA 1U92A 5HI3D 1NBVH 3VFPB 5LWYH 5F7MC 4XWOC 5JR1L 1ZTXH 4J3XA 3QI9C 2X2JA 4OT1L 2V2TA 1CR9L 1I9JL 1SXSA 2YARA 4OZGF 1QBAA 3LZFH 5FO8A 5I6KA 1X9UA 3L3DA 3VAEA 3T3MF 3H9SA 3L95A 2W92A 4P3WA 4HJJL 2YBGA 5FB8A 2P8LA 2ADGA 5TE4H 2FJUB 5ACZB 1LO5B 4G6AD 5KEZA 3TNMA 1IAOA 1ZLSH 1VFMA 5TDOA 4N6QA 2WYZA 4YHNA 4K07A 2BRQA 4RMBA 3NN8A 4MNQA 2OXHB 3MXVL 5GS1C 1OW0C 2QGDA 3D07A 4LMQE 5F0JB 4QTIL 3R7QA 4DKDC 4YDLB 4ODHL 4GRMA 1ZGLP 1BQHB 2O6FA 2D7TH 3VD5A 4Q6IB 5GJTL 3O11B 3OZKA 1N12A 1ROCA 1X5AA 3VX0A 5CR1A 2DTML 2YUXA 5L4MA 2IWKA 3FCBA 3ECVA 2PP8A 5TD4A 3GTVA 3EUDA 3QI9B 4FNRA 3DVNA 5AB2A 1FJ1B 2N4IA 5IGXH 3T0AA 1F4YH 2JJTA 4X4ME 2YPLB 1SJEA 1A7QH 2XLLA 4TULL 1KDIA 4FJYA 3RIAK 4N28A 4PTTB 1BVNT 4YHIB 3ZE0F 3WXVH 4G7RB 2QPFA 3CFKB 5F1NA 4B9KC 1JZ2A 2Y6SD 3A5VA 3K6SB 2E8ZA 4NAJA 1AGFA 1AXTL 5FO9A 2OMVB 5D7KE 5GS1B 2PR4L 1INQA 4NBZB 4P23C 4TQHA 4XNQB 4DP4X 2DLIA 3NCYP 1BVNP 1HI6A 3EO1B 3QJHB 2QGEA 2CD0A 3T9WA 3ZDZE 5DK0A 3ULVF 4PN6A 5T1LD 1G9EA 4ZD3H 2DLHA 5I8OH 1IBBA 2WQWA 2WLLA 4ERSH 1HH6B 1MUJA 2OX5B 4A2FA 1E2WA 2NY3D 4XBEH 4LSVL 3TU6A 1KTDB 2L7EA 4K7FB 2GJZA 4P49A 4GW5B 5K1JA 1M1XB 2HKHH 4LL1A 5GS2D 4LSTH 5KVDL 3CC5A 5GS0L 1CFTA 1U3HA 4Y4FD 1NL0L 3VM5A 3HE7D 1MWAH 3DMMA 4KTEL 3MAWA 1W72B 1XSJA 1MNUH 3LIUA 3TZVC 1L7TL 3UTSB 1BJMA 4GBXB 2X6VA 4NSKB 2HPTA 5A1AA 1O7SA 3TS8A 3LSOA 3V5HB 4WTZG 4XVUD 4F5CA 1NFIB 3DUUB 3L7FA 4EJ1C 5AZEH 4IBZA 5TFSH 4G8EA 4FN0A 3KJ6H 1KYFA 5A6LA 1JHKL 1TQBC 4GQZA 2BXYA 3WIIH 3MRQA 4HCFA 4S1DC 3A22A 2Q3XA 4BSVB 4NP9A 2WMPB 1MLCB 1J0KA 2PYEA 4PJIE 4YJZL 1MNNA 1LILA 3SDAA 1MRCH 3IDNB 1NZRA 3ZL4H 3MZGB 5C0FB 3VO0A 4DK5A 5IFAL 3GMRB 3W39B 2E47A 2YBRB 4Y7OC 3CLFH 1AR1C 3NYKA 3WELA 4C54A 3KWWA 4XP6L 5AL0A 3BPCA 4DP2X 3FCUB 5GZNC 3MA9H 3SD5A 4BHUA 1D6VL 4APQA 3FFDB 4I3RH 3GZQA 5JLZA 2OR8A 5AW5B 3WE6B 1T6BX 2WINA 2X38A 3L2NA 1LO0L 2VSDA 4HAFA 3O6FD 5J6GB 4N8VB 3W9EB 1WHPA 1OD9A 2I7OA 1S7UB 1TQBB 2BVPA 2ILLA 4AVHA 4PY8I 2Z65C 1JNLH 5EIQA 3DTXB 1KGCD 1A6WH 2YD2A 1OHQA 2XY1A 3CXHK 3O4LE 5FIEA 4Q8BA 1R46A 3D69A 2AGJL 2PCYA 1V7NL 3P73A 5A16B 2CM6A 4IHOB 3ABLB 1M9WA 4JZOB 4JGNA 2ZAIA 4DUVA 1QKZL 3JZYA 3K74B 4UT9A 2HUEA 1A6PA 5T5FL 4DVBB 1JWSA 1VCAA 4LLYA 1TTCA 4PPTA 3ARFA 2E9BA 2M2DA 3N43B 1DVXA 4UZUA 4G2AA 4BRVA 5JDSB 2IWFA 4UQ3A 1YVLA 1MI5B 4M7KH 3WMPA 4NRXB 3WL9B 4A68A 1RHFA 1FZJB 4IQHA 4JPWH 4FQHB 2YC1B 3WY1A 3DGDA 5MEQB 4FJ6A 3UIYA 2ITDB 3GF8A 5JPMC 1RJLB 1CD9B 2BS9A 4M8QB 4KDVA 4YSQA 4Q0XH 1E27B 4JRYA 4OTXL 1N26A 5CF3A 1F6AB 4OCRH 1YEJL 1UWGH 4JFQA 3D0AA 2VZOA 4NQED 2A6IB 1NCJA 3QBTB 2Q6WB 4NQCB 3WUWA 1X5HA 1XCWA 2I25N 4OZIB 3EGSA 1NCWH 1TYRA 4XCFH 1P6WA 5HDBE 1CE1L 2VC2B 3KLQA 1YYMH 2KLSA 3NJFA 1KEML 1JNHB 3QC5X 3QQ4B 4G3YH 1E30A 3MBEC 4ETQA 2X10A 4R4NC 1CYGA 3P30H 4G1MA 4P2QE 4QRRE 5BO1H 3C2AH 2I27N 1P5VB 3ZQXA 1JYXA 2YUVA 1AFVL 3C60B 2XXMB 4WSGA 4TNEA 2HRGA 1ITBB 1U8LA 4I9WE 3TFKD 4UOW1 4BFKA 3TA3D 1C16A 1CLVA 4XP4L 5AOJA 3OV6A 3TH4T 2NR6D 1YLBB 4FNPA 3F65A 2JLPA 4A38A 2X1WL 3WUZA 5ICZB 4UYPA 3BPOC 1S8DB 2CJ3A 2WKLA 4NYLB 4Y9FA 4HCIA 4TLKA 2XPYA 1B3JA 1FVEA 2XBDA 3INOA 2XWEA 1E4JA 2I60H 1C8PA 3BP6A 4JRXB 5AVVB 4ZUWA 3E6FB 1USQA 4NQDA 4JY6A 1LD9B 3QWRD 3GRWL 2J6EA 5FLUA 5GGTH 2FT7A 4AEIL 5I1DB 1DVFB 2E5EA 3REVB 3T77A 5L2JB 5BZZA 1QABA 3P4NA 1UWYA 1KTLB 3EDEA 2DWTA 1I7ZA 4IKNA 2GEEA 4OJDH 3MCYA 4L5FH 2W9DL 3MBEB 2X9WA 1T22A 3BWSA 4UDUB 1HEZA 4FAAB 3BSZH 4H20H 2JKSA 5BUGA 5HGDA 1BEXA 4Z76B 5I30L 3EJTA 3O3DA 3CVIH 4TNGA 4P2OD 5F1KC 3DX1A 3SDDC 4X6CF 1MW3A 5GGUA 2XIIA 1YAZA 1MEXH 1PTZA 1AZNA 4B3EA 4Z78A 3SDXB 1CU4L 3VI4E 1X5XA 3OXSA 4NC1E 1R3HB 1H6EA 3MRMB 3NRPA 4JFTA 4PJHB 4QRTA 2O61B 4ZFOA 3NJJA 3L4YA 5T3ZL 2ZXGA 3KW7A 2AV7A 5EN3A 4PJ9D 2NY2D 4DGYH 5SWZD 1MWAA 2XWJB 2HVKB 2R83A 3C9NA 4M1CD 4NI6A 1Z9NA 4PHXA 4ZMPA 4JY4B 3GSNA 1AGDB 1RU9L 4KKBD 4HOWA 2WPGA 2FD6H 3GSQB 4KXDA 4GMSL 2X6AA 3VFTB 1CIUA 4YHLL 1DQLL 5HHXH 5TF0A 2AEQL 4AZUA 4OKVB 5HXMA 4QRQA 1OZUA 1X6LA 4BFIA 1KGIA 3EJSA 1X4YA 4MNGB 1WSST 5CUSH 4AIZB 1WWAX 2YWZA 4J2QA 3B4NA 4YGVA 2G5UA 2JJSC 3ME0B 4LRNH 4DPAX 2CHDA 2A74A 3HZKA 3BQUB 3P0VL 4P2AA 3SJVA 3KPMA 3H54A 3RX7A 1EPFA 4P46C 1RJYA 1PSKH 3ISRA 5DZVA 3VDAA 2D03L 4JJOA 2HT3C 4G6ML 4OBSA 4RAVB 4QXTB 2VNCA 1FVCB 3MFGB 1AO7B 5D5ME 5EU3B 3IJEB 5HHVL 3SKOA 5IMLB 2GTWB 1WAAA 1W91A 2ZXQA 5JHLH 3MUGB 1BZ7B 2FTAA 1NCGA 3GEFA 1PG7H 3EFDL 3MNZA 3B9DA 2KUTA 5CKGA 3EDKA 1AG0A 2QSVA 1ASQA 1U8NA 3U7YH 4BELD 4HKJA 5AUMA 2VDQB 4Q2ZA 5D7IF 3EOAA 1GSKA 5GRVK 1SVBA 3BRDA 1F1DA 2BSRA 3KDMB 1DQMH 3IGLA 1BVKA 3IEAA 5F93C 5IESH 2J8UE 4W6WB 5ALCL 1RZJC 3RIAF 4QF1B 4W9FC 5HYSA 1Z66A 4GXVL 1FBIL 4IYKA 2FUQA 3JTTB 2EXTA 4YDVA 3MLTA 5KYNA 2AQ3A 1E43A 2X44D 3INUL 1FGVH 3R0NA 2DLTA 3FXIC 9PCYA 1NLDL 2NY6D 2Q2LA 2BDNL 4XNDA 4KMQA 1M3IA 4U31A 2VXVH 1RK0A 2WVTA 3G6DH 4PJDF 3IE9A 3QGVA 2VR4A 4NC2B 1HKFA 4TRPH 3TBTA 5L2KE 3FU8A 3IDIB 1HWHB 1QO3B 4A37A 3RWEB 3BN9C 2ICES 3TTSA 4X4MA 1S7QB 1PIFA 4Y4HA 3VTTA 2XWBA 2D4FA 4ONHA 5LNGA 4YLBA 1GMEA 5IW1B 2NY0C 3T09A 3MRRA 4XNMA 4GO8A 5EO0A 4XX1E 4ODTH 1QQDA 2CU9A 5DRXA 3EJQA 2XTJC 5FYLL 2VUKA 1UTDA 5FAAA 4XB7A 1JZ8A 3U6RB 3NEEA 4R26L 1QRKA 3DVGB 2PTUA 1HXYB 1KC5H 1KLFA 1T20A 1G0YR 2IAMC 3KVQA 4EOWL 3FO1B 2PF6A 5GRVL 5I0YA 2BHFA 3L1FA 5E1HB 3FB5B 2X6UA 2NUTA 1VADB 3BSGA 2Q20A 2X3CA 2UUDH 3K91A 3NIDE 4DH2A 1QPKA 2EDBA 3MLPA 5LCVH 1XH2A 2HPOA 3QZMA 4DZ8B 2HRPH 5F7LB 5I0DA 4N5EC 5IF0B 5I17B 4CVWA 4Z3HA 3DX2A 4CC0A 3ASOB 1SVCP 4F3FA 3QUZA 3W57A 3WIFA 5HHNB 3K8LA 3MLZH 1DJYA 2NY0B 2MTPA 2VDRL 3CDYA 4OD1L 2CBPA 4OUUB 2LE9A 4W4NA 5DLMH 1J5IA 1R17A 3LVTA 1YJDC 1UM6H 3EBHA 4LCVA 2CAKA 2NY7H 4NO5B 4OV6F 2W81C 2P7TA 3T8XB 5D6DC 3LEYH 3H2QA 3BSZA 4MCZB 5DEGB 5B7EA 2CRZA 3VXQA 3UBFA 4JN1H 4B0MB 3MLUH 3MOAL 2RD0A 3T6VA 4HX1A 4AZ8A 1KPRB 4NOFA 4WTQA 2CGZA 2ESVD 4AC2A 4CC4A 1CGSH 5FUCE 4NERA 2BY0A 4HDIB 1OK8A 3LZNA 3FT4B 3KJ4B 1KZQA 1Q1PA 2FEEL 3TBYB 2R2HB 4YZFE 4YHZH 5DI8A 3WEOA 4PJIA 3QUXB 2CJTA 1EVTC 3AUVA 3B43A 2AEWA 1B4JL 2EEDA 5EOCJ 4PJ5D 3T0ED 1FO0L 2W9EL 2WM0A 4JFDE 1H5BB 3NMEA 3KLHC 2A5UA 1N3NB 3HRPA 1UH2A 4NNXA 4TMPA 3BAYA 2TSAA 3Q6GL 4M4PA 4M8VA 1OOWA 5DQ9B 1DJGA 3TOPA 5DMKA 5C3LD 4HQQH 3U46B 4TN9A 5D72L 5AW7B 1EEUA 3PV6A 5IHZA 3V6OA 1GHFL 3S88L 5D1QC 4LVEA 1E2VA 4PGDB 1V8HA 4E0RA 2IQ9L 1M7XA 4RETB 1X5YA 4NN7C 1H19A 3DX0A 1MQ8A 2MCG1 5I71C 1AI1L 3SO5A 3U4BL 5KUKA 4LVOC 3DOSB 4IU2A 1SUHA 2FGZA 3S2AA 2G2RB 4F8QA 1D9KC 1QBML 1KBGL 5EZIH 3O4LA 1IC5H 3DBXB 4KK9D 4AJVA 3L48A 1Q9WB 1UOKA 4G7VH 5HGGS 4GSQA 2F1EA 4JKKA 3GSXB 1JPTL 2P5PA 3HHRB 1J1OL 3HG3A 5DMGC 3TM6A 5F7WC 4R90H 4LAJH 1J5OL 1TU2A 4ZW7A 4ESKA 3BD4A 1C7TA 1E5ZA 5C0BB 5KJRL 1J8HE 2EIBA 4PLNC 1BA9A 1AQDB 4DO4A 2WXIA 5HBBA 3UXFA 3D4YA 4QHKJ 5I71B 5C0AB 1G7MA 3ZR6A 2WXKA 4LVOB 3BGAA 2IV8A 3CN4A 2GBAA 2K4WA 1D9KB 4W9CC 4LPXA 1FDLL 3OAYH 4JO3L 1WLHA 1BX2B 5GSRA 5G55A 5HP5A 4HLEA 5E2UH 2OCFD 2VSCA 2FQGA 3TGXA 4PRBA 4AYFB 5HY9A 4BSWA 1J1PH 1V55B 4XN9A 5AVTB 1YEKL 5EC1A 1E4XH 2ATPB 4RZCB 2CUMA 4PJAB 4DVRL 4FA7B 4BCZA 1K4DA 4WJ5A 3VGGA 4AX3A 4Z3TA 1FRGH 3U9UB 4P2QA 4QRRA 2JIXA 3RL2A 5MHSD 2ZWSA 3CFDA 1WFJA 4QXWA 3TWCL 2PUQT 4FI6A 2WW8A 3EG9A 4XVTL 4YFLF 4XNYL 4LLWA 4ATTA 4XMLH 1KGXA 5DURB 1HJCA 3CQFA 4XXWA 1P7QA 3AT0A 5B7FA 2CGRL 4U1JB 5F89A 2CHNA 4N0CC 5D7JB 2OTUB 3TYGH 4MB5A 3OGOE 1UA7A 1Z5YD 3T0DA 3IDXH 1XCQA 4N2CA 5EEVA 1BLNB 1OPGL 4LEEA 1CUOA 2BSEA 4M4RB 3HBPA 1B90A 5IM7A 3VXMB 5B38G 1JPFB 4FFZA 3T2NL 4JO2L 4X4ZA 4Y5VA 4AUUA 2I24N 4PRIB 5T1JA 3HN8A 5I15H 4CUCA 3JBG7 3CN0A 5D6CB 1R3IL 4W9DC 4BZ2L 1KIRB 3S8WA 3NCEB 2G9KA 4KK6D 4HUWA 4AKQA 4QJ3B 4NKOB 2IH3B 1URIA 2LFGA 3F84A 4WW1A 2EC9T 3I9IA 2FVNA 3L7EA 3LPPA 4X8CA 2HJKA 3QFJB 1SF3A 4N1HB 4MS6A 4P9MH 3U0TB 2W0FB 2X1PA 3I9GH 4XWOD 1NGXA 2I7SA 2XZCL 3HMWL 3GJEA 3QI9D 4L0PB 3VI4A 4KVPA 5E4AA 1SN0A 2R0KH 5EU4A 5MEPB 1NGPH 4G5AA 2YPLD 1MRFH 3FSWA 3RPIB 1J5DA 1CTMA 3L3OC 4ZUTA 5I16A 1BVOA 3L5HA 5HPMB 2A9AA 3DARA 3QZWG 3H56A 4AVIA 3IXTA 5DYFA 1OTTC 4BQ8A 1OQXA 5CS7A 5TPWL 5JOEA 3I85A 4R6UA 2A73A 2D2CC 5F7FA 3V6FA 2BW4A 4KK5C 5BJTA 3LNDA 1GGTA 4M1DH 4R4FL 2F53B 3IFPB 2UXFA 4U4IA 3L4TA 3SE8L 3VDBA 3RA7L 2W07B 4Y2OA 5LQBL 3LHAA 1Y7VA 3QORC 2GSMB 5FYJU 4FHBD 5HGHA 2NT1A 5IJCC 4PTUB 4HUMB 1Z5LA 2X89D 4JRFA 3WFCH 2IH1A 3KYNB 4FHKA 4MA3A 4GIOA 2CMRL 4HIIA 1O6SB 3KBFA 3P0YH 1T04B 4JFVA 3TO4A 4W9KC 3CLWA 1CIDA 3FAXA 4UUJB 1NGWA 2WIIA 4NC0B 4X6DB 4Q7DA 1FORH 1NOAA 3OM3B 5J9PA 1P7HL 4AM0A 2VDPL 4XOBA 3FDWA 2Y0SA 1MJ7L 2VXUL 3SOBH 3DJTA 3AAZB 4JM4L 3F6LA 3QXVA 1TETH 2P1YA 2CH8A 3MPCA 4ZFGH 3ARGA 3KNBA 1CLZH 2DH2A 1I9IL 4PJBB 1PZDA 5D1XB 5D5MA 3ALXA 1NAMH 3ZRSA 4P23D 1IIIA 1EHLL 4F8TA 5GJSH 5E1AA 3QIBC 4ACTA 5L88H 5IW6B 3BFOA 1S9YA 3KBPA 1R75A 3QHFH 2W0PA 1IBHA 1QYGL 2FX7H 5KN5A 4WEBL 1OQOA 3MJ9L 3ZHDA 3ZR5A 2V4LA 4CW1B 5K59F 2OTPA 4FFVC 1OSPL 3X12A 3KYKL 4Y4KB 3CFQA 1OAUL 4JFXA 1KGCE 3O3UN 2WWNA 3OR6A 3HC4H 5FO7A 5CJ8A 2W94A 2DF3A 2CO6A 3T2PA 1LO2L 2EE3A 3A4EA 1U21A 2XFXB 3IDYC 1F02I 1ZGLA 2VR5A 2WLJA 2PP7A 4F9PC 2EICA 4O2CA 3FONA 5AAWC 4N87A 1LEIA 1D7CA 4BQ6A 3QDGD 4WJKB 1AMYA 1OGSA 5E51A 5F6HJ 4MJJA 3TZVD 2BIPA 2KBGA 1PZAA 1RJZB 5FYKL 1NDMA 2AJYH 4DCQB 1GH7A 1U36A 5IVXE 3ABZA 1HVXA 1H3VA 2C1OA 3IF1A 2WTOA 1BWMA 1JI1A 3FQ1A 3ILPA 3KLAB 3PS6A 4QHMA 4PWEA 4O02B 1O7DC 4S1DD 1JD7A 3CHRA 3KHOA 4KZCA 5L2KA 1CB4A 2OULB 2UWEB 1A7NH 2LU4A 4IBVA 2P42B 2XN2A 6CGTA 2YD5A 3OB0H 1FYHB 1MFDH 1U8OB 4OD3H 2IQAA 1AOZA 2Q3AA 4IRJC 4PGBA 4ODXB 1G7LB 3FTSA 1WIOA 1AR1D 1S78C 4NQEE 2HX7A 3IDYB 2CHXA 1FPTL 2EDTA 2X28A 3QIUA 4NQXB 4POZC 4YZFF 5DUPH 3OKEA 2W95A 2NZIA 3VE0A 1SOSA 2BVQA 5DEFB 5GZND 3ROOA 1RZGA 4LQFH 4OZHE 3GGWA 4XNXH 5HI4C 2BERA 4GW1B 1XGRB 3RWDA 2R23A 3NABH 1KN4H 1S5HA 3PL6A 3TA4D 4TL5A 3T0VA 4JM2A 5HYEA 5LAPA 2FEEI 4KI5C 3VXNA 1JAEA 4ABQA 2V5TA 5ADPL 3TEWA 3JT0A 1UJ3A 4ODUB 5DHYA 3HLAB 3RVWC 1MHCB 3C5ZA 2VLLA 4KK8C 3WNIA 4W4OA 5TDNA 2CLZA 2MIZA 1RZKH 1OSZA 3U1SH 3DUSA 5T3XD 2KS0A 2W60B 4H13C 4NHUA 1NGYB 2OSWA 4XPBH 1J11A 2OMUB 2NNFA 1SXCA 3UDWA 1HINH 4N4YB 4FS0A 1N5AA 2AABH 2R1WA 3V6OC 2AW2A 4PIRF 1TQTA 3WKMH 1FI8C 1XF2A 4U05A 4ZNCD 5GS2H 5FV2A 3IVKB 1NLBH 3TCLB 1RAMA 1J1XL 4P59L 3D39B 1XF5A 3JVFC 4RFEB 2ZCHH 2BVYA 4ZTPL 3RHWK 2F8VA 1QHOA 3GRGA 1LDSA 1IEAB 2OMZA 5CU5A 4NQUA 1A1NB 4AJWA 5I6XC 1EJOH 4FQIL 2FJHA 3HB3B 4NDMA 8FABA 2BVOA 4A7TA 5GGQL 2EIEA 4Z7QE 2B4CL 4JRXD 2CKBH 4J4PC 3O8XC 4PM1A 3PRZA 4ADGA 3KGUA 1Q0EA 1QTSA 4B9JA 2X4TA 4L8CB 1CBVL 3F64A 3C6LA 5CO1A 4C55A 2DDQL 1RURH 3JVGA 2Q8AL 3MBED 5SWZE 4DERA 4EDXB 1LJMA 2XBTA 4R4ND 5DD1H 3Q6FB 1KYDA 4HS8H 5BZXA 3E3QC 2ZYHA 3JV5A 3UBXA 3RE0A 4F33A 5LDSA 1YN7A 2PWHA 5C8JB 5IEHB 3ZSTA 3N91A 5EUKA 1A7RH 1J05B 5F9JA 3SGEI 1LE9A 3H3KA 5D7LE 3H3BC 2VL5B 2X4NB 4AQEB 5I5RA 1E3XA 1ADQH 1YZZA 4BEIA 1HSAA 5JHDB 3QUKB 2WXLA 4M61B 1JE6A 3TEZA 4KTDL 1D7BA 5C9JB 1F4XL 3O8XB 5BV7C 5I1KL 1LNUB 4GRWH 1UKSA 5D7SH 5GSVB 2MHAB 2VR7A 2FYYB 3NPZB 2FK9A 4PGJA 2OKMA 1D5BA 4U1SB 1YPZE 1EH9A 5LKNA 3BRFA 3SGKC 2OYLA 2AKRB 3H7BA 3POCA 1H9VA 1XGPB 4LVHB 2E27L 2NQCA 5B22A 4FE9A 4ALAH 4MDJB 2OW6A 4JMXA 3FOMA 4D0BA 1J8HA 3RGVA 3C5JB 4M6NL 43CAA 4YBHA 3OKOB 4FG0A 1EEQA 3MLWL 1A2YB 3C8KA 3LH9A 2RFXB 5CJOH 3HZVB 2FBOJ 5F1IB 1WYJA 3DX6B 3SDDD 2DJ4A 4AUYA 2FQDA 2XQBH 4UT7H 3QYCA 3AM8A 3L6FA 2XG4B 4LXFA 4B7LA 4FFYH 1G9ML 4IBLT 4XCNB 5FFOA 5KS9E 2RCSH 4NFCA 3OF6D 1GGIL 2OTWA 1M7DA 4NEHB 2EEAA 2ENJA 4E9QA 4ZSOB 2X2IA 3PCYA 2MH4A 3QUMB 4ZODA 5BOJA 5BV7B 3K71B 3MJ8B 5IIEB 1NPJA 1HH9A 1U42A 5EF0A 5I66A 1A0QL 3RJOA 4NKIL 1YG9A 4XPHH 4GG6E 4S2SB 5E03A 2XZAL 2HN7A 3ZL1A 1BQSA 3EOTL 3L4WA 4QKXB 1KBKA 4Q97A 3ZHNA 2XOTA 4PSPA 3QNYB 4XGZB 4L3AA 4X50A 5CD3A 4JB9L 3MQIA 1KY7A 3CGTA 2BK8A 3P0GB 4N5UA 3SQBA 1AGCA 1KJ2B 4E9LA 1ZHNA 3FBQA 3K3QA 4J3OG 1BBDL 3MRBB 2X1XR 1FFPA 4BXVA 3WYRA 1HHKA 3EYFB 3FB8A 2HFEB 1K2DA 5E8NA 3SBQA 3JTBA 4J23A 1A6TA 1MCDA 5I1AB 5DVMA 1U33A 4YDKL 4I2XB 5DJ0B 5EOQL 1UXWB 3TNNA 1XB3A 4P46D 4X5WA 2WYIA 1SEQL 2ZKHL 3M1CA 4IRSB 1MFAL 4QD2E 2W59A 2BNQB 3MNDA 3A47A 1GVIA 3VFVB 5H8DA 1S7VB 2EDXA 2HT3D 4DW2H 3O0LA 4TQEH 4AGNA 3O4OB 2H6UA 3EYVB 5EU7C 3NA9H 3RL1B 4AI7A 1IFRA 3FT9A 1LE5B 3D0VB 4J8RA 1WUNT 3BI9X 2EIMB 2MQ3A 3W5MA 2WZ5A 1YDPA 1E4KA 1DCEA 2UZYB 1ZTMA 2G4EA 5MENA 4FQ1H 4MJ2A 4DO6A 3BDYL 3T04D 4M7ZB 5IOPB 4KO9A 1LDPL 1L5GB 2DMCA 3PGCA 2ATKB 4MMXC 1WTLA 4Z77A 3QO0A 4HJ0C 1JDCA 3L3HB 4LSSL 3D0LA 2AJVL 4MD4A 4XCYA 3FO2B 3US0A 3W38A 4JGUA 2XU9A 2ARJB 3ZE1B 3F62A 4GKOA 1KIPB 1WBXA 5DD3H 1JYWA 3EDJA 4H5SA 2YD7A 4JFPA 4MLIA 4FEIA 4MQ7A 4GRWF 4AQ8C 2D0HA 3V7AG 2X6BA 3HN3A 3I50H 1A6ZA 2CNZA 4NPYA 2FGWH 4FNLL 2G75B 4XC3H 3CHSA 4G71B 3KXFD 2F8IA 1D5XB 1T3FA 1KBWA 3GBLA 3WEMA 4IKLA 1QNIA 4A2MA 1C7SA 1G94A 1I53A 1FL6A 2ESVE 2PABA 4LESA