5IHUL

Crystal structure of bovine fab b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bovine Fab B11 light chain
molecule tags Immune system
source organism Bos taurus
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihuL01
4PJ5A 3BT2L 2CIKA 2COQA 3MUZ1 5HI4C 4LIQL 4BH7A 4M7ZC 5C9JA 4M00A 4OJFH 1WWBX 4XBPB 2CRIA 2R2HA 5E8OA 3QUZB 1F58L 1X9QA 1XF4B 4TRPL 2VE6B 4NOFA 4LCUA 2AEQL 3RWEB 1C5CL 2HFGH 3CDCA 3P0YH 3TN0D 2FR4A 1MCFA 3BO8A 4Y16B 2EXYD 1Q0YH 1U92A 3M17A 5EO0A 1MUJA 5H35B 5JNYA 5IM7A 4CDGC 3TP4A 2UVEA 4X6FB 4BFGA 3DIFB 2UWEA 2HLAA 4LCCB 4JM2B 1CICC 4GS7B 1FLRL 4X5XA 4HS3A 5E94B 3RX8A 2XKUA 3QO1A 3PWLB 2CJUL 4R4ND 2X9YA 2AJZB 3NIDF 4L1HA 5B38B 1RZGB 1FZJA 4AENA 4K7PY 4P5TB 4AL8L 2MQCA 3MRHB 3RUGB 4Z7UF 4MB4A 2V5YA 5ADPL 1CT8A 3UX9B 3MLXL 3QCVH 4L4TE 5KZCD 3X13B 3TGXA 1LO5B 4NQCE 4EKXA 2PYED 5HHVL 4KZEH 3HHRB 4WJ5A 3KWWB 3REVA 4HULB 5BJTA 3V95A 1KF9B 1S9YA 2ZCKL 3K8MA 4PJ5E 2NZ9D 3I75B 4RSVA 4WDIB 1TFHA 5C0CB 3OKOA 3SKMB 2BOCA 1GAFL 4RMTA 5CKGA 5KJRL 5CBEB 3BJ91 1QNZL 3PIQA 5FA4B 2IFGA 3MOBH 3U79A 4NBYB 4H8WH 4C56A 3OSKA 4OD3H 4U3HA 4YE4L 5FM8A 5EFIB 3L6FA 3OX8A 2ICES 4RQQA 3ZE0F 4XTRC 4K8RD 3QNYB 2NYYC 3ZYJA 1Y0LB 4O4YL 2E3VA 4KKNA 3KJ6L 3GSNL 4P3DB 2V2TA 2D31B 4JPVH 4M7LL 4JGUA 1S9XA 3ARQA 4YBQD 3I9GL 2A9MH 4X0KA 3ARWA 1U3HB 5EZIH 3G6JA 5DTFB 2IH3A 3DUUB 1QO3B 2IQ9H 2YEZA 2W9LA 3MRDA 5K59E 5ITBL 3WBDA 2WBJD 4YO0B 2BY3A 2LAAA 3JWOC 2HLFD 2CRYA 4R97C 3SE3C 3TZVC 3SGJC 4Z0BH 1OAYH 1LEIB 2I9TA 2HJFB 1J1XL 1DFBH 2H9GA 3NCBB 4OTXL 4YZFE 5DJZA 2IAMB 3QIWB 5D4QA 2ZUVA 4PJEB 4HG4J 4BQCA 1NCBL 1A7BA 2P5ED 2CUIA 4NNYA 5D7LB 1B4RA 2GTWB 1OD7A 1MCOH 1F13A 2N1KA 4OZ4B 5C0EA 4WWID 5IP4A 3FQRB 4NSKA 4AIXA 5F7WC 3MA7B 4O58L 1D3CA 4X83A 3KYMA 3R4DA 4DVRH 5E1HB 3S5LA 2HKFH 5I0DA 1ZLUK 3NIGE 3W9EB 2QKIB 1T2JA 1TZIA 5E95B 1RZ8B 4LLQA 2D7QA 4POUB 2IQ9L 5C92A 1T1XA 3ZSSA 3REWA 3NCJL 3LRSA 3NGBB 4LVNB 1BQHB 3SDCC 2IANB 3RKPA 1FNSL 4DEPB 2HVKA 4JPIA 3VG9C 1REIA 4FXGA 1T03L 1D5XB 4K3HA 2NR6D 4LEOA 4GUPA 2FB4L 4P46B 5BW7C 3CD4A 1FG2B 1WT5A 2ZG1A 5BS0E 2QHRH 1KG0A 5CSZB 2WLZA 1D5MA 5GRVK 4PRIE 3V52L 3T3ME 1AE6H 4ODHL 2DJSA 2R0LL 4XCEA 4D8PA 2H32A 1FYTA 1UB5A 3HA0A 3MLZH 3P9MB 15C8L 1DBAH 5ESAA 5EBMB 2VZTA 5A43C 5C0JB 4IRZH 1BD2E 4ODXA 4GKNA 4LRIC 2VLRD 1HDMA 1Z3GL 4XBEL 4AIZA 1FCCA 5DEFB 4KROC 2J5LB 1WUNT 1KJVA 5K9JH 2IANE 2FX9L 4J6RL 4GKSB 5CAYB 2XN9B 2DLFH 4YXHH 5DFTA 3DVNB 4I3SH 4U1JA 3OGCB 1VACB 1ZMYA 4L5FH 3WFEL 1JK8A 3GSUA 2SEBA 3PWUA 3NTCL 3GMNB 4NKIL 2D4FA 3KDMB 1JPSL 4W6WB 2Q8BL 3W0WA 2AGJH 4PJ8B 5IR1B 1VFAB 3V6FA 4GW4B 3QUKB 4TSAL 4J8RB 2X1OA 3IJHB 1KIRA 4L9LA 5TDPA 3H0TB 5TH2B 3VU2A 3GSXB 4JQIL 4M7JL 1KLGA 5J1AB 1JZ3A 1QQDA 1JGEB 3X11B 2BDNL 4P9MH 1MHHA 4LLDA 4JDTH 4HWEH 3ARBD 4PRAB 1HH6B 5DJYA 5KJRH 2WIMA 3IDMA 4IRZL 1N5YL 2BOBB 2D0HA 1J88A 1AGFA 3RI5K 4HKJB 3RZCC 5HHOD 4MXWL 3IDXH 3M8OH 4N0FA 3V2AR 2FATH 1BMGA 1YUHA 3GI8H 4OLXH 5F7YC 4JJ5A 4XXCC 2XPGB 5IBTL 2F8VA 5EB9A 1J0JA 4NQSA 1YQ2A 3V7MA 4Y19D 4JY6B 1DQTA 3D0LA 4Z7WF 3BD3A 1K9TA 3P4NA 4F9PA 5ETUA 1KENL 1GZQB 2VDQL 4G5ZH 2VXUL 3EYOB 3DPBA 3ZDXE 5I1EH 1T22A 4PRIB 4OB5L 1JPGA 4ODUA 1ODAA 4XVJL 2D0FA 2ESVA 3EZJB 1FDLL 4GRWE 2BHYA 3V7AE 3W9DA 4JN1L 5FGCB 4RAVB 5JLZA 3I2CL 3QUYC 4PJIE 3FRPA 4Q97A 5ICYA 2W92A 4G6ML 4CUCA 2BVOA 1FBIL 1YN7A 4JY5L 3LS5L 5J3HD 1D9KA 3GMPA 3BVNB 3R06A 5EU4B 4APQD 1BVLA 1C8PA 4PJCF 3CFJB 2EDFA 4UV4H 4QXUL 3S7GA 3FL7A 4UQ3A 4XNQA 3LMJL 3HR5A 3F58L 1UM4H 3RKDD 1QEWA 4JO3H 1YPZA 4R97B 2ADGB 4W6XB 3BUTA 3KYOB 1A3LH 3V4VH 5D1QA 1WAAE 3PL6D 2FH8A 1U36A 3DV6A 3JTSB 4LHUD 1UXSB 1E4XI 2IAND 3LV3B 4ONOA 5IHUL 3RWDB 3S5LG 3GRWL 4KHTH 3UYOD 2GFBA 5L88L 1KB5B 4KMQA 1PJ9A 5FUOL 3QUMH 5D70H 1QBMH 2VQ1A 1OTSD 3MRKA 2XZCL 4AEEA 2QSVA 5MHSD 4PGCB 1CIUA 4NP4H 4K3JL 2KPNA 3ZT7A 4XCNB 4OLZL 5IVXA 3QNZA 3IJSA 3VWKA 4P3CL 5GGUB 1GPOL 3HMXA 3LPGA 4JDZB 3ZTNH 1LO4H 2NXYD 1MAJA 2FO4B 1QYGH 3ZDZF 1MCWM 2BK8A 1MFDH 5C6TH 1G6RL 1Q1JL 3B2UD 2FX9H 3O8XA 5FO8A 1A3LL 4WWKC 3BKCH 4FZEL 5BXFA 1A4JB 1QFUL 3D69B 4FA8A 1EBPA 3DRQA 4R2GD 3MOAL 4RA0C 3EO0A 4FXKA 4EJ1C 1AFVH 3HCVB 3V6BR 1JZ5A 4GRWH 1G7PB 4I0PA 2AAVA 2YMXH 3UTPE 2N7AA 4M3JA 2E27H 2Y36H 4PGJA 1NC2A 4JQIH 4M7JH 4L1DA 4RMUA 1HHIA 1FL6A 1OAQL 1QSEB 3QQ3B 1N0XL 1U8JB 4DKAA 1FZKB 1HOCB 2J5LC 4QHMB 4WI9A 1UCTA 1E6JH 4FZ8H 4LLYB 2HT2D 5CLWA 3ES6A 3FAWA 5DD3L 2FJFB 4N1HB 3MV9A 1OAZL 3CDFA 2DYPD 4Z18A 4CADB 4YWGL 3QXUA 2UUDK 5GS2H 2DLIA 4HS6B 5EORL 4MNGE 3GSQB 4G6JH 4I13B 5FGRA 2VXSH 1VGEH 2CDGB 3MJ9A 4FZEH 2ZJSL 2VDMH 2MOVA 2O5XL 5L8JB 2X9WA 3WV0A 3DX8A 3MO1B 1OSPH 5L9DL 1J7VR 4LSTL 4F57H 2NY3C 2EYTB 5DSCB 1WWAX 2AXJA 2QSCL 2FX8H 2LU4A 4M1GL 3SDAD 4P23C 4FFYL 5FV2A 1OLZA 1OSZB 5DHVB 1K4CA 1NEZA 4XMLL 5ICXA 5DJ2B 1OAKL 3P9LA 4PG2A 4WW2A 1V05A 4TSCL 3CFBB 1F90H 4RX4D 5B3JE 5A2JH 3WL9B 1MAML 4Q6IA 4L4TA 1LILA 5E6IB 3BO8B 1SEBB 4GKOA 2GSGB 4JY5H 1YMMB 5IFAL 3DURA 4JRXA 2F8XC 1J1PL 3LQZB 4Y5YC 5DJ6A 3BZ4A 3QHFL 5I1IL 3L5XH 2EO1A 4JM2A 1BWMA 5HI5D 5DS8B 4TOYH 2FECI 2OXHA 3QO1B 4NNXB 5KVGL 1I7TA 3JWDH 2WP3T 3QHZH 4RGND 5JPMB 3V6OA 5J56B 1CLZL 1IE5A 1MY7A 1Q9OB 3MGTB 2HMID 3NIGF 3SGEH 3VXRD 1KUMA 1MCQA 3FT2A 1J5OL 1WWCA 3HMWH 4H0IA 5MERB 1JWSB 5BRZA 3DUSB 3VFSB 1UEYA 3C5ZA 2FBJL 2VABB 5GGVH 4UTAL 4RNRA 3BWUC 2JKXA 1RZJL 4R0LA 2JK5B 3H7BA 1IC4L 3H42H 1S7XA 5HGHA 5E9DB 4HCRA 3D3VD 4BFBD 3QUMA 3MA9L 1S7WB 4FG6D 3WNPA 3MCLL 2EDLA 1SYSA 1RULL 4RAUB 3Q6FB 3KPNA 4NQDE 2BHZA 4ZQKA 5LJYH 3ZT5A 5HVGB 3LN5B 5DA4A 4OZIA 4U1IB 3VFMB 5FYLL 5IMMB 5EOTA 4CVZA 4RIRB 1A5FH 4PRHB 5D1ZC 1X4XA 1F6FB 2VQTA 5KSAC 2IH3B 2XQYK 3ROLA 4PJIF 1BWWA 1JHLL 1OF2A 1MCLA 1TVDA 6CGTA 4CW1B 2IBGA 1DQLL 4M7ZB 1IM9D 3CJJA 3INUH 1AP2A 2XKNB 5LQBL 3K74B 1OVZA 3O11B 5EUKB 4DGVL 2QEJA 4PJ7F 2NCMA 3V7AG 5FCUH 4D0BB 4WHTA 3X14A 1AO7B 4HAFA 5MP6H 4E41A 5GGSB 4OD2B 5EZOH 2XNAA 4P2RD 3KXFB 3AFLA 1CWVA 5FB8B 1AHWB 4PJEA 3BP7A 1XF4A 3O6LL 5JZ7D 1ES0B 2DRUA 5DR5H 4UOW0 4D9LL 4HLJA 4OT1L 3O9WA 4I4WA 1A6WL 1BQSA 4JM2C 2FR4B 5JIIA 4OZ4A 3BHBB 4MJ4A 1YEJL 4X6BB 4LL9A 4PJGA 2QL1A 2XT1B 1A5FL 1ZS8B 1E28A 5CUSL 1IAIM 5DO2D 4OM0H 2L7UA 3BP4B 1R3LA 5CJ8A 5MEQA 3UTTB 1JZ6A 2VO5A 1RZFH 4Z7VB 5F7DB 1UKSA 1IAOB 1GGBL 4OQTL 1AQDB 1KFAH 2APTA 1DUYA 3FQWA 4U6XB 1G7MB 5TE6H 4NUJB 4UIMA 5GIRA 5CSZA 3F6IA 1MJ8L 1GH7A 1OP9A 3SEPA 3UJIL 2DOCA 2H32B 1CDHA 4ZSOB 2OXGA 1MAMH 1I4FA 3BKYL 4HX1B 4FQXD 5C0JA 1A7QH 4M02A 2F53D 1WZKA 5C0CD 1CE6A 4JRYD 3QA3B 4JG1H 1X5HA 3MLSH 1MCPH 2VDPH 2XG5A 1CGSL 3ULSB 4G6FB 5FM4A 4KJQC 4R96B 5D1XB 2XN9A 4GBXA 4N0UA 1R3JB 1S78D 1TQBC 5DD1L 2QV2A 4CNIA 4P4KC 1S9XB 1U8LB 3VW3L 2NX5E 3UZEA 1BFOB 4JGJA 4NJAH 4S1DD 5IMKA 4IRJC 2IGFH 3N0PB 3WS6A 2MFNA 1Q9LA 2YD1A 2J12B 4Y19A 4QRSB 3KS0H 3QDGB 2HKHL 1OP3H 4PRBB 5HVHC 1T83C 1WWWX 3ROOA 2C3WA 1SVCP 4LLDB 4JZJB 2CDEB 3U0WH 4TULL 4I18A 3QIWA 4FQHB 2V2XA 3VGAC 4X6DA 1T66C 5CGYC 2CXGA 3RU8H 5I1DB 1BZQK 1LEKA 4NNYB 4R8WL 2XZQL 3TNMA 5EOQH 4G43A 2Q8AH 4OAWB 5F1OB 5IGXH 3ZKMD 3DSNA 2ZUWA 1MPAL 3W81A 5KSVB 3GO1L 1D9KC 4MQSB 1D6EB 1RVFH 3FQNA 1N0LA 4MS8D 35C8L 3MA7A 2VLKD 3OJDA 1JZ2A 1NFIB 2C5DC 2P5EE 5CWSA 4LOUC 3O6KH 4MNQB 4XP4H 2A83B 3FFCE 2B0SL 3OHXB 3REWB 3INUL 1AGCA 3PQYA 3C08H 1SJEB 4FQ2H 4R26H 3RTQC 4XZUA 2HVKB 4M5ZL 4BZ2L 3MXVL 3ZDYE 1NCDL 3OWEA 2D7MA 2FH6A 1TNNA 4G6AC 1AD0A 2C3VB 4HIXL 3IU3B 4M1CC 3HZMA 1KG0B 3H9YA 5GGQL 1TXKA 4PGEA 3T2PA 3KPOB 5EU4A 3V0AC 1BVLB 5D93B 4GG8B 1ZHKA 4ZFOB 2VERN 1P9MA 3LEYL 1F8TL 4WWKB 1J8KA 4H26B 2X1XR 3MV01 4XCEB 4PLKD 5IGXL 1ZT7A 1BJ1H 5EUOB 4HUUB 2V9QA 4OGAC 1INEL 3FN3A 5FUZL 4PB0L 1CFSA 1X5LA 3I85A 5ECJE 2A6IA 2JB5L 1A14H 1BAFL 4PJAB 3T0EB 1JPFB 3C6SB 3VFOA 3BKMH 1NSNH 3KPSB 1ZKAA 1F11B 3C60D 3TIDB 2W9EH 3D87B 5IWLA 2WUCL 4XPAH 4UV7L 3PWUB 4IRSC 3WEXA 2V5SA 4XMKL 1J1OH 1PEWA 2J8OA 1HIML 2VDLL 4NFBA 3TCLA 4WIQA 2J4WH 3FRUB 4GG6E 3SJVB 3C9NA 2IPTH 4MGXA 4KK5C 2X7LA 4F7TB 4FP8H 4RFEA 3HG1B 4EI5D 2E8ZA 5HDLA 4JPKL 1F5WA 5L2JB 4OCLC 3ULUC 3K2MC 4ZXBC 3U7YL 2OLDA 4LCWE 1NCCL 4OCWL 4TUKH 1S9WA 1RZIB 1UZ8B 4KRPC 2R0KH 5E5RB 3OKKB 4MMZC 2BC4A 3HC0A 2P24A 1GZPA 4A6YH 4NWTL 5IG7B 4PGDB 4ALAL 4AMKH 3NBNA 2AV1A 1AXSA 1MCSA 4I9WE 2GEEA 1U8KB 2WUCH 4O2FA 2EIDA 3MLWH 3QXWA 1IC5H 1A21A 1Y6NR 2OI9C 1BFVH 2VZSA 5GSRB 4ZO7A 4XVSH 4ZFGH 3AS2A 3EKCA 1CD1B 3GIZH 4ZUVA 4YK4C 4I0PB 1FYTD 5FYJE 4D0DB 2IPTL 1MJJA 4LVNC 3FO1A 3PWNA 1VEPA 1JF5A 4XXDA 4LHJB 3MLUH 3CDGB 4BK5A 4M4RA 3RPIB 4HMEA 4Y2DA 4OKVA 5FK9B 4QGTA 4XI5D 3CX2A 2UZXB 3ES6B 4NT6B 2FJFA 4AEIH 4Q9QH 5H94B 1NAMB 3WJLA 2BMKA 4KJWC 4R8WH 2EDBA 5IVNA 3EO1B 4HG4K 3MRPB 2DS4A 5BMFH 4MLIA 4HT1H 5LGHL 4JJHA 2DQHH 5IQ7L 4JR9L 3HS0A 2DQDH 3VI3E 1T0PB 2AJVL 3F12B 5IESL 1XGYL 2E6JA 4YHIB 3PHOB 1EHLL 2B4CC 4XWGH 3C5ZC 2NY6D 3TO4D 2AXHA 4OGZA 1MWAB 4HKZB 1O7VA 4PD4K 3OV6A 3E6FB 4GBXD 5IMOA 5F6IB 4JZJC 1JMXA 3RIAK 3QDJB 3JTSA 4OCRL 1NC2D 4HIJA 5IVXE 2CK0H 1IGCH 3IXTB 2OJZL 3STZB 2XWJA 2ICEA 4JCMA 4FHBD 3S3SA 4PJEF 1YN6B 1EHAA 4QHKJ 3HC3H 3LEXB 2VL4A 4RWYH 1BOGB 1K8IA 3HAEA 4QTIH 4UQ2B 2ZSVB 3QH3B 4J23A 4FABH 4R90L 3IJSB 3VWKB 1TJIH 3O4LD 3BN9D 3OF6A 4QT5B 4JG0H 1KCVH 3DGGB 4K94L 1T7WA 4MCYA 2F19L 1A47A 5E2UL 5F96L 5FO9A 3GB7A 2VB5A 3CIQA 3F8UB 3PNWB 2EXWC 4OIBA 4HW6A 2F53B 3BD4A 3UPRA 2ATKA 3QIBB 2DQTH 3SKJH 1CVRA 1J0ZA 3SDDD 5ESQA 5I66A 1GGCL 5L2KE 4NN7B 5EC1B 2N56A 4PGZA 5F97E 3UJTL 1G84A 1HNGA 4GRLA 5FKAA 5T1LB 3SE4A 1R3KB 4QRTA 5LGKA 4JLRA 5HBBA 5E5MA 5J7CC 2F5AL 2R0ZH 3OXSA 3RJQB 4FQQA 2G2RA 1XT5A 5GS0L 3IAPA 2QJDA 1F4WL 4JFPA 5D2LE 4HPOH 4QRUB 3O41A 1NCWL 4I3GA 4PJFE 4LCCC 1J8HE 5GGVY 2QSQA 2VLKE 5T1DH 5HY9B 4IRSB 1FAIH 3NCEB 2VZOA 3DV4B 2FSEA 4ZUSA 2F19H 4RIRA 1YZZA 4ETYA 4UT6L 4NZJA 3TBWA 1F4YL 2NY5C 3KYAA 4TQEL 1ZK9A 4LSVH 4Y1AA 5DVKA 4PJ9D 4YEFA 5K9KB 2CLVB 2VSDA 4LU5L 4ZOEA 3SDXF 2ORBL 1XIWC 1EZVY 5E2VL 3MSPA 3RHWF 3WN5C 3U36B 2B1HH 4MZ2A 5DSCA 3FMGL 5ADPH 1DSFH 1YYLH 4OZGB 1CTOA 2OL3A 3MUY1 4OD2A 3G5ZB 4XP1L 5FUCC 4ELMA 4F9LA 1NGQH 1AHWA 5LWYH 4P2QA 1BFSA 4G9DB 3IGAB 4KVNL 3QXVA 2NW2A 2FX7H 1SEQL 2P43B 4L4TB 3BZFA 5KSAD 1U8HA 4EUPB 1P1ZA 1JPST 2AABH 3GJFK 4F7EB 4WGWB 1GHFL 1ZLVK 1OAXH 5AWNH 1TQCC 2B39A 5K93A 4F37F 4I0PC 2YRLA 1F4YH 2GK0A 1GSMA 1JI1A 2YZ8A 1Q0XL 4DTGL 2Z91A 4PTUB 5CBAA 2HT4C 4P23A 4L5FL 3WFEH 5FAAA 2DQHL 2GT9B 3BAEL 5IQ7H 5J12C 1I1RA 1T5XB 3STBA 1GGIH 4P2OB 3QUZD 4XPFH 4LPCA 1WAAF 2VN7A 1T1YB 4LIQH 5GGRA 1ZT4B 1FNLA 1YMMD 4YHLL 1IM9A 2YUWA 1JTTA 1TETH 4NO3A 2XACC 2DQJH 4RBPH 1FYTE 4XBGB 5FYJD 2FHCA 1NGXB 3HE7D 1II4E 2GITA 1IM3B 5C3TA 4BK4A 2JELH 4UBDD 5T33H 4R0LB 2A74B 3ZE1F 5I1LA 1IGTB 3CFCH 5E6YA 3HZYA 1FORL 1X6LA 4QRQB 2B5IB 3I50H 3MBEA 5D7IB 4ZDHB 4RGNC 2CH8A 3B43A 3VXRB 1P5UA 3D3VB 1FE8L 3KPRA 4RMSA 5KSAB 3KPNB 1N59A 1A0QH 1Q9KA 3QDME 3MGOA 3HG1D 1S7QA 4OZIB 3ZYOA 1MELA 4OCNC 2XWBB 3LN4B 2OK0L 4ZYKB 3WO4C 1J8HD 1QHPA 3IS1X 1E6OL 2YD6A 4CVUA 1BLNB 3FT3A 5L7XL 3C8KB 5D7IE 1J87A 4XNZB 1OF2B 1NCUA 4LCIL 4P48A 2CRZA 1UKTA 5EOCH 4ZO9A 1QFOA 1CFQA 3B9DA 5EBLA 4F7PA 1XF5B 1AO7A 1DN0A 4LP5A 4QYOB 1NBYA 4P46C 1WZLA 3I6LE 4LCWD 1PZ5A 5H2BB 2Q76A 3HUJA 3G5YB 1BIIB 3FB5A 2VZUA 4UNUA 4FQJH 1FZMA 1T04B 2OR8A 5GRJH 1EEYB 5GS0H 5D5ME 4OF6A 1CFTA 4OAWA 1TTFA 4LSPL 5D8JH 3HPLA 3QUYA 4PJCB 3T0AA 4RMQA 3HFML 4XNUL 5GS0D 1HINH 4IJ3B 3VI3F 2X1WL 4NBXB 2VXQL 3DTXB 3PWPA 4FMKA 2GJJA 2YRPA 3EFFA 4YHML 4MSWB 3F62A 4KPHH 2EXWD 3H3PH 3PQYB 2DLHA 2ARJQ 4PJHE 4Z7VA 2MHAA 3WMSA 1VDGA 1VFBB 1FNHA 4PD4J 4HWZB 4NC2B 3ZKMC 1DE4A 4U1MB 4L4VA 4ORGA 1RZKH 2C3VA 4XP1H 1CLOL 1AY1H 1FZOA 5A16B 5T5NF 5T5NG 4HJJH 3MRQA 3ILPB 5ALCH 1ZXQA 1AC6A 5HYEA 2AEQH 5T3ZE 5FM5O 4WY7L 1B0GA 3HUJE 4V1DE 2V2WA 1NUGA 1WVZA 4P2RE 3MLRH 5BVPL 5JHLL 5DJDB 4G8EA 4E5XA 1CE6B 2QSTA 1OAXL 1R3IL 2BZDA 4OLYH 3IB4A 4WW1B 3PWVB 1EGJL 5D1XA 5IK3B 3WXWH 7FABL 4F58L 1JF1A 1FLRH 1E4KC 4DTGH 3R0NA 4K7FB 3THML 4G6FD 5IBTH 5SWSB 2VC2L 5HHOB 1T20A 3NAAL 4UT9H 2R23B 4F15C 4XPHL 3VXTA 4V1DB 4C56D 1U8LA 3N9GL 3IVKB 1NFDA 3ARBA 3WEXB 4ERSL 3HG1E 4R6UA 3CVIL 3N1PC 5C09E 1VKXB 3EYQD 4I48B 5TE7H 1DLFH 1RZKL 2BVQA 1INQB 3CCHB 4JFHD 3JWOH 4Q7DA 1G7QA 1YEDA 4FTVB 3L9RB 4OLVL 1RIHH 4EI6A 5IMLB 1DBAL 4HUKB 3T1FA 2ED7A 2XTJE 4BELD 5KSBF 2F54E 2ICCA 2V2XB 2VL5A 4TTDD 3VGFA 1CL7H 2P24B 4L9DA 3QG6B 4XPGH 4QXUH 1MCKA 3B2UC 4U6YA 5DJ8B 3LQAH 1YPZE 3S35X 1ZGLM 5MENA 2BVUA 4I77L 3AM8C 3MV7E 1G7LA 3O2DA 1NAML 3TH3T 3KPMA 3OAYH 5IHLB 1T4KA 2DKUA 3VMOA 2XTJB 4M1CD 2OJEA 2E7LA 4IRJA 1FG9C 1A22B 1G9NL 2OQJA 3FRPG 3HNSL 4ZAKA 1Y18A 4P4KA 1SM3H 2NZIA 1T3FA 3JWOL 2V5TA 1NBQA 2DWEB 5C09A 1CICD 2YWZA 5D1ZD 4CVXA 5GZND 3MV9D 2P5WB 4UBDC 3O6FA 4HUMB 3CSPA 3V5KA 4D9QE 1M6OB 4WV1A 1C1EL 4HXAH 2EKJA 4XAKE 3QEQE 2HRPL 4WO4A 4YHOL 3ULVD 3BZEB 5I76A 3U0PB 2BMKB 1A1OA 1AJ7L 2GTZA 3G08A 3I02B 1LEGB 3PGCB 4NKMB 3M8OL 4C83A 3MBED 3ORJA 3RIFK 3WNNA 1QFHA 1I3UA 5KVGH 1FIGH 2P8MA 5LCVL 1HHKB 1I8MA 1I8KA 4YC2C 5J9PA 2NW3B 4K9EL 3VXNA 1LWRA 2H2PD 4MB3A 1NCAL 1R0AL 3MJ8A 1P6FA 4LKCB 3DO7A 1KENH 4P2RA 3LRGA 3O2VL 2YD2A 4K8RL 4JQXA 4P5MB 3KLAA 3UDWC 2Z4QB 1MFCH 1SVZA 4PFEA 4LCUB 4ZXBD 3IDGA 1JRHL 1G9EA 3KPSD 1NQBA 5L6YH 1YYML 4PREB 1BECA 1TIUA 2I07A 5IVOA 4ENEC 5T1KB 3VH8B 5AD0B 3GMRB 1AY1L 5MEPB 1K2DB 2M26A 4QXGH 1TZHB 3ARPA 4LLUB 4Q6IC 5HGGS 4LCCA 1ROWA 5LGJB 2ADIA 5J13C 5L2JA 1YJDL 3BWAB 4BKLA 3MNWB 1B6DA 5HYQA 1MQ8A 2FGZA 4N0CC 4M7LT 2PTUA 4JRWA 1IAKB 4LNRB 1QACA 4P5TA 1ZHNA 2OM5A 4HJ0C 3HC0B 5CMAB 2IC2A 1NMBH 1CT8B 1CYGA 3STLA 4OUUA 4HUWB 4HMDA 4Y4KA 4JREC 3TFKD 5ESVA 4LFHG 3GHEL 5D9SB 3E2HB 3PP3H 2V7HB 4WGVB 3N9GH 4YHPB 1H8OA 1YYMH 5KTEL 5CBEA 3PJSB 2DKSA 2X4NA 1EMTL 2BNQB 5C08A 4AEHL 1UWGH 1FIEA 3BH8A 4P59H 3WSQL 1FVEA 4HV8B 4ODSH 2Z8SA 2O61B 2X4UB 4JLRB 1MJJB 4PJDF 2NTFA 4PG9A 4Z95L 1U91A 4JFPB 4RQQB 1MAKA 4HD9A 5JXAH 4RMVA 5JIHA 1A7PH 2DF3A 4HK3N 1Y0LA 3OB0H 5ITFA 4JVWA 3O6MH 2FSEB 3VXMB 3K1DA 3L5XL 1CXHA 2HA1A 5C6TL 3V6OE 1BBJB 3TBWB 5EIVA 5F71A 4PY7B 1W72B 2BNRE 5SWQA 1KPUB 4MVBD 5H37H 3SCMA 4DKEH 5C0DB 4X4YA 1KFAL 4BSJA 2APFA 4XX1E 43CAA 5TPWL 3SDAC 2FEDD 4X4ZA 4XI5C 1DVFA 5FO7B 3TO2B 4FFZL 1ONQB 1WTGT 4IMLB 4NN6C 5JORB 1G9NH 2HTKC 2ILLA 4S1RH 4Z7UB 5D7LA 5JXAL 5HPOA 4L8SC 5DJXB 2R1XB 4OLUL 4XCCH 1ACZA 2X6MA 3HZKB 4GRLD 1A7QL 1YN6A 5C0AE 3WXVL 3P77A 5BZDB 1P84J 3WNMA 1L6ZA 2YD9A 4Y5XB 4HPYL 2VDOH 2W38A 2X1QA 2KBGA 1J12A 1IQDB 1M1SA 3DGGA 2VDML 2HN7A 2B1AH 3D5OF 4JPIB 3MYZA 1NJ9A 4RZCB 4HF5H 1UFUA 1KJ2H 4KKLC 2J7LA 5FO9B 5I8EA 1FO0A 4R7DB 3VFGH 2MCG1 4NKDB 1T1YA 4OZGE 3UPRB 5LXGH 1AIFB 4QF1A 3KG5A 3R8QA 2ESVE 5IQ9A 4L8BB 4TYUA 5I66B 4DCQB 3L3JB 8FABB 1IM3A 3KPLB 5J12B 4EDXA 5I1KL 4M62H 3U6RB 4I5BA 4DOHB 4IOSD 4POYA 4UAOC 1NH6A 1DQQB 1P4BH 3RY4A 1ZVHA 3O45B 4KGJA 5E2WL 3KLHC 2G2RB 5DR5L 3HLAB 1FGVH 3K2UL 4NRYA 1F6LL 5DHYB 5FHBH 4PJGE 3NOIA 4HLZG 5HYSB 3UC0H 2PTVA 1KELL 5IVZB 4WO4D 2P4AB 5CP7B 2MNUA 2FD6L 3LZFH 1XCQA 3JUZA 5HHPA 3H9SA 2ZCKH 3JWDL 1WV7T 2D31A 3DWTA 4QRRA 1RUMH 5C0AA 2B1AL 2ZCLL 1MEXH 2EE3A 4DOHE 4LQFL 2GJ6A 3QUYD 4KK6D 3RVWC 1J0YA 5LAXB 3V4PL 5DC4B 4W4OC 3QUKA 3LB6C 3QCUL 5F72S 3AY4A 2XWTA 3DX9A 4YHZL 1RMFL 1UM6L 1NGWB 4NO2A 4DZ8A 1LK3L 2AS5M 4KFZC 5HHQA 3IFNL 1NCDH 4YFEA 4LHUA 1XZ0A 3QO0B 3O8XC 4O02H 3V79C 3IDMB 4XP5L 1CD9B 3IDIA 2PETA 1PY4A 2GQHA 3FOLB 5I30L 4K7PX 2XY2A 2VLLB 3MLYL 3CSYA 4AQ1B 4M8QB 4KTYA 4NRXA 5DMKA 1P9MC 5M95B 3VJ6A 2CSPA 2AJ3A 2R1YB 2YKLL 2XPGA 1BP3B 1E27A 2IMMA 4NSKB 3C5JA 1T21B 5J6HB 3JTTA 5JXEC 4OI8A 4N5ED 1ZA3A 2Y7QA 3D6GA 3MX0A 4K23L 5I1AA 1KN4L 5CKAA 1F2XK 1BBDH 3NFNA 4PRIA 5E5UB 3BZDA 3RTQA 3IETA 2YHGA 1P7QB 2DQFB 1FGNH 5CEZD 3UAJD 2G75B 43C9A 2VMFA 3C2SA 4LPXA 4NYLB 4Y7MA 1CXEA 4RAVA 5JLZB 3VFWA 1J1OL 3VG0H 3S4SB 4ZFZA 1DBJH 5CD5D 4QXTA 4MCZB 1U8NB 2FLRT 2R1WA 5I30H 1T5WB 3OKNB 5C0IB 3TIEB 1NUNB 4NQCB 2DN7A 4NQEB 3NCJH 3AVEA 3QDMA 5DFWH 1VGKA 1CR9L 2Y9RT 4L8DB 2EDDA 1EHXA 1LK2A 3HZYB 1E4JA 1DJSA 3FAXA 1EVTC 2ZOKB 2Y07H 3SO3C 4YR6A 2CQVA 4YDIH 2P48B 1Q9KB 1HILA 5DD6A 2Q7YB 4XT1C 5HHOA 4LLWA 2SEBB 1YQVL 1NFDB 4U6VL 1KJ2L 1OLLA 4KJYB 2K7PA 3FQUA 4CJ1A 4NFCA 1KXTB 2JB6A 3ZLQC 4XP4L 5TDPB 4MJ2A 1QG3A 5F7NC 1NFKA 3GSXA 3PXJA 3E6HB 2FYYA 3TNNB 4GAYA 4KH2A 3RY6A 1AHWC 4M5ZH 2F54B 4OZFA 1QLFB 3QJHA 4W81A 4MXQD 1K8DB 4LLVB 2FO4A 4L29B 4LSSL 1LNUB 3NTCH 2XTLA 3OR6B 4G42B 4HJGA 3L7FB 4H25A 2ITCA 1CGSH 1CFBA 1EEYA 2VKXA 2P5EB 2XXCB 4LVEA 5TGBB 3SO5A 5BMFL 2W65A 1D9KD 3RWCB 4FS0A 3HPLB 4NQED 3L3OA 5ID0B 1JV5B 2AJVH 4Z78A 3KAAA 1P4IL 1FPTL 1AI1L 3QFDA 1FFPA 3U2SB 3RWHA 4JZOA 3GM0A 4JY6A 4CN6A 4HKXB 4DWHA 3GZKA 3NZHL 4LK4A 1QVOB 4LCWB 2E9WA 1A6ZB 4LVHB 3QEUA 4ODUB 1JYWA 3T4YB 3G6AB 1KSRA 1S7UB 3BMWA 5E00A 4O5LL 4GW5A 4CU6A 4OZHF 2QTEA 2FO1A 1IL1B 3P11L 5KSUA 2VDLH 3MFFB 2LQRA 3HI5H 2OSLA 1CD8A 4QHLB 1ZSDA 4Y4KC 1KGCE 5IJVA 5F6HJ 1UXWA 2FZ3A 2MJWA 4YBHA 3U0PA 3KLHD 4G5ZL 5BOZG 4OZFG 4QHUA 2D4DA 3CX5J 4MD4A 4OCSL 1GC1L 1BIHA 2Q8AL 1CK0L 2EICA 3D85D 3TF7C 4FQXA 1K85A 3UTQA 4QHNA 4OGXL 3DGCR 3DETC 3CSGA 1U93B 3B3IA 3WS6C 1U8MB 1FBIH 3PWVA 5HHXL 5I2IB 5DVOA 1JHTB 4JFOA 2D9QB 2OTUA 2XG4A 2XN9D 2XXMB 3GIVB 3WYRA 3SKJL 4KXZI 3UTSD 2YUXA 3DARA 3RY6C 2Z93B 5DRXB 1FGNL 3RGHA 5CEZE 1QKZH 5B39A 5E99L 2MKLC 4MNQD 2QHLA 4TNWK 1AGDA 3PV6B 2WIIB 2VQ1B 1UM4L 4R4BB 2AXGB 2ID5A 4XB8A 3ZMRA 5C0RL 4HZLB 1SBBA 3BE1H 5DQJB 3PGDA 4A6YA 1H0DA 1TZHA 1F4WH 4PV9B 3HRZA 1T0MB 2X4RB 1GC1H 1N6UA 5DQ9B 1KB5H 2ZNWA 4N8CH 3RWIA 4KRPD 5C8JA 4X5WB 3WUWB 1XF2B 1FHGA 1E4KA 4LNRA 5KVMC 4HC1L 4NM4L 3O9WD 3RA7L 1IBGL 4MB5A 1MCPL 2VDPL 3P4OA 5DEZA 5L2KD 4JHBA 4U0RC 1S3KL 2DMCA 3QRGH 3RAJL 4KTDH 2OTWA 2NZ9C 4N90D 4CRPA 2WQ8A 4NNPL 3ZKQD 3LD8B 4PUBH 1WK0A 4JM2F 5HYJA 4S1QH 1T4KB 4HDIB 5L0QB 2D0GA 3FFDA 4Y2DD 1WJ3A 2EDTA 2JK5A 4M7KH 4OIIL 1QSED 2YK1L 2MPAL 1FVEB 4HV8A 3T4AB 3VFRB 1QZ1A 3SCMD 3TBVA 3QXAA 3CFEA 4JO1H 2YPLD 5JOPE 5ISZA 2DDQH 1U8JA 1EAPA 3BEVA 5DWUH 1XGRB 5IB1B 4MA8H 2JE8A 3PV7A 1ITBB 5D96B 3WLBA 4BH8B 4Y1AE 1JF6A 3MRCA 3ZKND 3MV9B 3FB6A 2H8PB 3RU8L 1IGMH 2H41A 4JM2D 5FYKU 2V7NB 1U2HA 4XGZB 4ZS7H 1KCSH 1QSFA 2OP4L 1E4XH 2HTLD 1RVFL 3KYKL 1MCWW 5SWQB 4P2YA 4NQVA 1MH5A 4PJFB 3BD5A 4YHKH 4X4YB 4YNYB 1XCTA 1CDYA 3AUVA 2BRRH 3DO7B 4NOBA 4ZFGL 5GZNC 3D9AL 5HHVH 4KJPD 4KZEL 4OZIF 5D7KE 5FO7A 1A4KB 2B7DT 5AEAA 5GS1B 4F7MB 1QA9A 4ZOCA 1YEGL 1QRNA 1EJOL 32C2B 1IEBA 1S5IL 2J2ZA 3TA3B 1RU9H 1CU4L 5CJXC 4Q6IB 2HG5B 5J13B 1YECL 1KPRA 4HS8L 1V7MH 3NPSC 1A7RL 4BSVB 1U2CA 2CLRA 3SE8L 5F9AC 5C1MB 3BZ4B 1MLBB 3CVHL 4V2CB 2GW5A 4HIHA 3PGFL 2D9CA 3OJVC 4J4PC 4TSBL 4U4BA 4NZUH 4L8SB 1OAKH 1YPZF 3HUJF 1FNFA 2L0DA 1KTKE 3KPTA 3SHSA 1X5GA 1JFQH 5DRWB 1EHNA 2W91A 5F7DA 4JEGB 4AQOA 3RL2B 4F7CA 2A2QT 3ZE2E 4XRCB 4ZD3L 4DQOL 1HH9B 3L3HA 3CXHJ 3MBEC 5HHXH 3STLB 4OFDA 4OV5B 1QD0A 3BKML 4QF1B 1BZ9B 1LO3L 2OMBA 3QHFH 5GIRB 1P6AB 3I6LD 4RNRB 1FNAA 3TJHD 1EJOH 5JA8B 4P2QE 4S1DC 1MIEH 1CTNA 1J1XH 2IALA 3CGTA 3KXFE 1HKLL 5HJ3A 1C12A 4LVOC 1BM3H 3QUMB 3RVUC 2YPVH 4HKBB 4WTXA 2Q6WA 4MDJB 3OKLB 1Z5LB 1U0QA 4LSPH 4RAUA 5A2LH 2CLZB 2GY5A 5HPMB 4HCRH 4K7PL 5ITFB 1A7OH 4JFZL 5BOPA 4PRHE 2W0KA 3WFBL 2PYFA 3HE6D 3K81A 3MYJA 4O9HL 5C9KA 3TBTB 1B0RB 4KI5F 1YNLL 4POZC 3W39A 2KDGA 3VXQA 4DQOH 2H3NB 3X17A 1W72A 3MV8A 1MCDA 2F58H 2P1YA 1MRFH 2G5BB 5EZLB 1HQRA 4QOKA 2PW2B 1NMAH 3EOTH 4YXLH 4KKAD 5CJOH 1C7TA 4M61B 2DMBA 3VCLB 5F9DC 4GAGL 4KHXH 1RJZA 1GRWA 4N68A 4AYFA 4YHLH 4OIIH 1DBMH 4R7NB 1UWEL 2FLBT 4WFGE 4IEFB 3FOLA 2PYEE 1OGAB 4GRWF 3G04A 1SJVA 3VXOA 3BPOC 1MJUL 3QXDB 3OG4B 4MJ6A 3QQNA 3MOBL 3GNMH 5BVPH 2CKBA 4IS6A 2YD8A 3WJLC 2APVA 4BYHA 4OD3L 3SGKC 1JHKL 5JMRA 5I73C 1VA9A 1E28B 3SDDB 2C1OB 4G8FA 3WE6A 4J6RH 5I1HL 3CNKA 5BO1L 4ONHB 4I3SL 3CMGA 1N4XH 2G9HB 2E9IA 4NRZB 5C0CE 43C9B 5EBWA 2NX5B 1N5AA 2OR9L 5I8OH 3KYKH 3WJJA 5F1NA 3BGAA 3VXRE 3GMLA 2ZUQC 2R9HC 1DVFC 3D25A 3Q3GB 1HCVA 1OT2A 3HZVA 2W60B 2ZPKH 2XI9A 3O0RL 3EIFA 4OJFL 3KPOA 3ARVA 5E2TL 5HI3D 5DDHA 4Z7WB 1KN2L 4KVNH 5SX5K 1MLCA 4Z0BL 3UZQA 1VB9A 1I1YA 2JCCE 1C5CH 2HFGL 4GOSA 3UTSB 3L3IB 3JZ7A 1AD9A 1TJGH 5D1XD 3SKNA 2A6JB 3ESVF 5KW9L 2A6IB 4EI5C 2JIXA 1T7VA 1K6QL 4Y5YA 3VD5A 3VGBA 1WZ1L 3MCKB 4QTIL 3RDTC 3OJ2C 3IKCB 4G7YH 5GJSH 4HQQH 1BJ1J 2X4PA 1MI5A 4DGYL 5CEXB 3WNKA 2DJ4A 1I7ZB 1MCRA 4PS4L 2CK2A 3EHBD 5E8NA 5DZOA 2QQKL 4UTBH 3NPSB 4YDJB 5IMKB 1T2XA 4HGWB 3LKQA 2GCYA 4NPYB 5T3ZD 3WIFA 5KVEL 2PXYD 2H6PA 3AAZA 4G7VH 4OB5H 2H2SD 4JG1L 3G5VA 1NUDA 3JV4B 3N1MC 4F7TA 3DX6A 1OM3L 4M48H 4OFYA 2WANA 1BD2B 4U3CA 5T3XL 4J3VA 1XZ0B 3MCG1 2DTML 2CDEA 4X7SH 4XH2B 4B0MM 1K8DA 3P9WB 1X5YA 1BM3L 1MFBH 5B4MC 3I50L 3OKYA 1OQOA 1D5ZA 1FFOB 1IGIH 4LSUH 5HI5C 3QFJE 5IFJA 2Q7NA 1S9VB 1T2QH 4OFYD 4BZ1L 5ANME 5IG7A 3FN9A 4GKZB 4HQQL 4OSUH 3QIBC 4NZRH 5E08L 3KLSA 4K7PH 3VXSD 5AG8A 4D0CB 2AQ3A 1H15B 3GI9H 3O3BB 1EFXD 4DN4L 1HN1A 5AYUH 4R3SA 5CWSB 3EW3B 1NFDE 1QVOA 2DLFL 1A6ZA 1CD1A 3LPFA 4ZUVB 5F1KC 2CUHA 2R0WH 5IWLC 1MFCL 1KGCD 4NFDA 3VXSA 1NMAL 3QWRD 5C0BA 1N3NB 3VDAA 1KIQA 1GOGA 2R15A 4J1UA 2JJSC 4WI4A 3WFHA 1IAIL 1RV6X 2LE9A 3S4SA 4APQA 4R0LC 1U8PB 4QHLA 1ZSDB 1BX2A 1DBML 3Q1SL 2AEPL 3HZMB 5CP3H 1EH9A 1NGQL 2HWZH 4HBQA 3WKNA 2X89D 4BZ1H 4MDIB 4PJBF 3GKWH 1CGTA 5EC2A 1YNTA 3NN8B 5IW6A 2B0SH 4NQDB 1ORSA 1PKQB 3L95B 4UDUB 3VGEA 3LD8C 2OS7A 4FQXB 3K0WA 2YZ1A 4QHNB 3F12A 4Z6AT 3K8KA 5DGRA 4ZFFB 1PG7W 2CKBH 1GHFH 1X5FA 5IB2B 4UZGA 4DN4H 3PHOA 5E8PA 4L3EE 2DD8H 4PP2A 3BJLA 1G9NC 4KK9C 4GXVH 3KPSA 4MAYC 1FL5A 1EIBA 3SE3A 3HN3A 3TIDA 1CDCA 3VWJC 2ARJB 3ILQC 4U7MA 1TPXB 3UZVB 4EN3D 4HWNA 2FHFA 3IDJB 1IC7L 1IAIH 2XWJB 4X4ME 3U30C 1CIDA 1FVCB 4L8CA 1SJHB 3WHXA 1CL7I 3D2UD 3HAEB 2EDOA 2JB5H 4LGPB 2UWEB 2XYCA 4RRPG 2DL9A 1A6TB 3I2CH 1A7PL 1SJXA 3NACL 3D0VA 4Q0XL 5JXEA 4K9EC 4L3EB 1VPOH 4Y5VC 5HVWA 2BNRD 3I84A 3QDGE 4LFHD 1N8ZB 3IDUA 4MCYB 1WEJH 4MQ7A 4XNXL 1SYVB 2BJML 5BW7A 4U1KA 3LHPH 3GB7B 4K8RC 2P5EA 1T1WA 1IGYA 1UM5H 1FE8H 1PQZB 4YJZL 2VDRH 2JJTA 3L3OB 4UNTA 1JV5A 1IEAA 2IPKB 1WIPA 4XC1L 5IEKA 5J11C 1S9YB 3RWHB 2F54D 3CFIC 3I75A 5BCAA 2WBKA 4OV6F 3FFDB 1QSFE 3CFDB 2CR6A 5EU7E 5KVDL 1CDUA 3H3BC 4FFZH 4QRTB 1DLFL 2BFVL 1JWMB 1YJDC 4M9OA 3QIUA 4JKKA 4LDOB 3NA9H 4X9IA 1A6VL 3AREB 4AMKL 3DX7B 2AJUH 4B5EA 3V5HB 4Q74A 3MRCB 2Y6SC 4RA3A 3DV4A 4D9QD 4S1SH 4ODWA 1AGBA 4NQXB 2JJVA 3MV9E 5E6IC 2X4SA 1SY6L 3QUXD 2CLVA 3X3GL 4L3ED 1QSEE 3HS0B 2NYYD 2Y06H 2E8YA 2VLKA 3HE7C 1RK0A 2C7UA 2Y25A 3CK0L 4BH7B 4YQXL 1BGXH 5GISL 1FSKC 2UY7A 2R2HB 3G5XA 4HIJB 2ZSWB 3NCYP 1IEBB 2DQCH 3QCTH 4JRYB 3TVMA 1UZ6E 1UG9A 3KPSE 1AC0A 2VLRE 1U8HB 2N7BA 1P1ZB 2WIIA 4OLWL 3B6SA 2DQDL 5IESH 5EO0B 1P4BL 3OXRB 3VI4E 1RUKL 1ZLSH 4QXWA 5D2LB 4HXAL 1QLRB 2P8LA 3DNKA 3SY0A 5ALCL 4LRIA 2EDEA 5JUEH 4EI5B 4ELME 3HRZB 3P30L 5FYJH 3TV3H 4NJ9L 1RQ5A 2FD6H 1Q9WB 5SV4A 5F93C 2DLGA 2DLEA 3QPXH 5DRWA 2Y06L 3HAEH 4NKOA 4JO3L 4EQ2A 3FOMB 4ONGH 3RFZC 5F9WB 1LO5A 2AP2A 4Y5VA 3DUHA 3FQXB 5MEND 3V8CA 3RVXC 1VEOA 3C6LB 3PDOA 3RIFF 3PWPD 5L2KB 5BJTB 5C0FA 4EN3B 3T08A 2J8HA 3VDBA 4HAGA 4D8PB 4HDIA 3OKOB 1XGQB 2ENSA 4XHQA 2X42A 2FJGB 5EBMA 1EEZA 5JO5A 4KRPB 2AQ1A 4MD0A 3MBEB 4L4JA 5D96C 4EVNA 3SE9H 1HDMB 1MQKH 5IF0B 2RCSL 1U6AH 4FQQB 4IHOA 5EFIA 5LBSL 3UYPA 3AU1A 3F65A 1F90L 5JPNB 3ARBC 3S8WA 3BI9X 3TC9A 2OBGA 5HGDB 3QNYA 5GGRY 4OFIA 4WFHE 5GSVA 2GJ6D 3MLVH 1BZ7B 2IG2H 2BNRB 1VFUA 3LKNB 3DYPA 1CXKA 2E9BA 3VWJB 3S97C 1U3HA 4N1CA 3C60A 5DZNA 5C7XL 5I1JL 1JWUA 3ARGD 5CD3B 4BSWB 4XPGL 5IR1A 3V6FB 4RISL 2EIBA 4EXKA 2R2EA 5EZLA 2X4OB 5DVLA 4F9LC 2VOTA 3O9WC 5D7LD 1CFVH 3MRLA 5CGMA 4QO1A 5BQ7A 2CIKB 5IBLD 4GMTL 4OF8A 2E6QA 3B9KD 4XMPL 3TO4B 3FT4B 5CILL 2CIIB 1FO0H 1A8JH 4Z7OF 2BOBA 4Q58C 4UT7H 1FZMB 1AGFB 1MJ8H 3TM6A 1ZANL 3FZUC 3LQMA 4PV8B 3RWEA 1UWXK 4N0FB 3Q5YA 3TA3A 4C4KT 4KTEH 3BZFB 3D39A 1M7XA 4HH8A 3KPPB 4BSVA 1NUFA 4CMMB 4PY8J 1H3UA 1IC1A 3BIKB 3D3VE 4PJ8C 1M7IA 4U7KA 4DAGL 4NZDA 1P53A 3EOYG 4MA1C 1W2KT 3WE6B 1TCRA 2HLAB 4OM1L 4X5XB 3EYOA 5HYIA 1WBYA 4ESKA 5D5MF 5TDOA 1QFWH 4QOKD 4X9BA 2LVEA 5D71L 3TBYB 4WUUD 3E3QE 4WFHD 1OT1A 1PSKH 1DE4B 4LPWA 1YN7B 3CK0H 1M7DB 1MI5E 2WBJA 3LKPB 4WJ5B 5ICZA 2BCKB 5I16B 1FFRA 1MCJA 1W8OA 2C26A 4WDIA 1KTDB 5FCUL 1I75A 1Q0XH 4PJIA 3C8HA 3ARFC 5FA4A 3L3DB 3HPJA 5JDSA 2VUYA 1G6RB 1RUPL 3S88H 5C0AD 1GGIL 3QDHA 3QWOA 4F80A 1NAKH 2XZQH 3FKUS 5ELIA 5EOQL 1MREL 1A6WH 5F3HB 1JF1B 5D1QB 1WIUA 3TV3L 1Q94B 3JUYA 2D7TL 3WDIA 1ITCA 3LV3A 3P73A 3QJFA 5CINH 5F89B 2XWBA 5I75B 4X0KB 1QRKA 5J11B 4HUXB 5CJXA 4MHHG 2O26U 4QY8B 2FECL 3WIIL 4M6MH 3VD9A 2H6PB 2H3NA 4Q9BA 4XCYB 3RDTB 5I1CH 1SY6A 4P9HL 2IF7A 3G5VB 2FBJH 4XCNA 1YNKH 3X11A 4P5KB 3GBML 2GAZB 1G7QB 2UUDH 5GGUA 2WSKA 4M61A 5F6IC 4PRAA 3VCLA 3ZDXF 4M62L 3P4MA 3AMLA 1DL7H 3C2AH 2J6EA 5DJZB 1KEMH 1MHPL 3T0ED 2Q76B 3T1FB 1L7TH 2WWMD 3G5YA 3B5HA 1J9CT 4FTVD 5JHDE 4NC1C 3W5NA 3UJIH 2NY0D 1G0YR 2W07A 3FO0H 2CGRH 4PRID 3O8XB 4Y5XC 5TQ2L 5MENB 2JCCB 1NL0L 5DLML 2HYMA 1YUHB 3T8XA 4EIZC 4YGVB 3OKEA 3VGDA 4OGXH 3DXAE 3QYCA 5KVFH 5T1MA 3ECBA 4JFFA 3TPUB 1DQJA 1ZV5A 1OOAA 5C7XH 1ZTXL 3SDDA 4O2EB 2OJEB 4XVUC 5JHDB 3SDXE 5TQ0L 1RK1A 1JPGB 1DQLH 3FB7A 3OZ9L 4PY8I 1NCBH 4S2SB 4U1HA 2ZJSH 1N5AB 5MENE 4JFED 4J1UB 5C09B 5IUSA 3PL6A 3WFHB 2RB8A 3R0MA 4YDKH 1UH4A 4KUCD 1ZLVH 1L0YA 1U8PA 3QQ4B 4PP1D 3QISA 4J3OC 4NHCH 5FOBA 1AH1A 4FP8L 5EU6D 2VDNH 4PJXE 4JY4B 1UB5B 4HS6A 2CGRL 1I3RA 5TQ2H 3VRLF 1QBLH 4NZTL 2D03L 1QSFD 3GSOA 2A9NH 1UJ3A 1I8MB 3DX8B 3MO1A 4E5XB 6FABH 3C8DA 1J0HA 3MJ8B 3MCKA 4K2UL 4EUPG 5GGTL 1B0WA 3HE6B 4X99A 3VXPB 4ZMAT 1CG9B 2AK1H 3S9DB 4N9GB 4JZNB 4WW2B 5DI8A 3BGFB 1S7TA 3TYGH 1IT9L 5CLTA 2QBWA 3KDMA 1FJ1B 1A02N 3IDJA 4TVSa 4M7KL 4PREA 4BUGA 4HGWA 1OTTD 1PSKL 3ARGA 2YK1H 2I07B 4LMQI 4W6YB 1YMMA 4KDTC 4HXBH 1INQA 5LXGL 1INDH 4ZAKD 3MODL 5CCKL 1KLGB 5J1AA 1OW0C 5GHWH 4P0DA 1EGJH 3MGAA 7FABH 1RIUH 2P46B 3QNZB 4IRJD 1X7QA 5C09D 4LF3B 4JKLA 3QZWB 3BWAA 4BKLB 3MC0A 2X40A 1OARL 5DS8A 4GAFB 4LLMA 3THMH 3C6LD 4XH2A 1RZJC 5DC0A 3QEGL 4C54A 1U8IA 1IAKA 5JPMA 2VL5B 4IOIA 3VFVB 6FABL 4U1KB 3FT2B 3O3UN 4U6YB 2KH2B 4QRPB 2Y07L 3BRGC 4OUUB 1I3GL 1HEZB 4YUEH 5FYKH 4KDWA 4JR9H 4GT7A 1WFUA 2IPKA 4L3CB 5D7KD 2IPUK 3D0LB 4YXKL 2GSIA 3TH2T 3WFCL 3P0YL 2EYRA 1A3RL 3RGVC 4OCMC 4PJ7A 3NIDE 2O61A 1NMCB 2EEDA 2WINA 5ERWA 1NC2B 3ARTA 2NTFB 4MVBC 1KT2B 1SYSB 1N3NA 2DWEA 4JQXC 5IV2B 3QQ3A 4U1LA 1KJ2B 4YC2B 2ZKHH 1WIOA 4UUJA 3ZYIA 1EXUA 3HTLX 5HD8D 2P44B 4FG6C 3G08B 3I02A 1IFHL 4XNYL 4PJ9C 1T89A 3WCYA 4UQ3B 2LU3A 4NZUL 1ZHLA 2BSED 5C86A 5KAQG 1NL0H 5DLMH 1PKQA 4EN3C 3IU4L 4G8IA 3T2NL 5AG9A 1ZA6B 4S10A 4OZIE 1AXIB 1QEWB 2ADJB 3V4UL 1FPTH 2EDQA 1JTPA 3VWKC 3RZCD 1YPZB 1C16B 5TFSH 2PUQT 4G6MH 4BQ8A 4AG4L 3U46A 5K33A 3ULUE 4P2RB 1YDPA 3BIBX 2NNAB 4Y4FA 3KLAB 1QP1A 2HJKA 4X6EB 1RZFL 4APQC 1L4IA 3VFUA 5INCA 5EIIA 2Q87A 3UJTH 4OD1L 2AJSL 1KB5A 4WI5A 3QUXC 2ZKHL 1A9EA 4HIXH 4X6BA 3ET9F 1NDMA 4RFNC 5LGJA 5JHDD 2YA2A 4LIQE 2ADIB 4ZO6A 4X8JB 2XV6B 4PJCE 3JV0A 3DECA 4PJGF 4L3EA 1I7TB 1K5NA 2XZZA 4PB0H 1FQ9C 1Q9OA 3MGTA 5FYKE 1N64L 3QULA 3FN0L 2QADC 1T1WB 5TF0A 1PD6A 1JRHI 4HT1L 5LGHH 1V3MA 4LCYB 1MRFL 1E4XL 2CO6B 3T77A 2R8SH 3ULVE 2HFEA 4HHAB 4OLZH 5H8DA 4HIIB 5IJKC 4F8TA 5JIKA 1YJDH 2W9DL 5FF6B 2HFFB 5F7MC 2Y6SD 2X4NB 4WI2A 2MQ3A 1OGTA 3MRIB 4GMSH 5I0ZA 1JWMA 1INDL 2OYPA 2Q1EA 2BY2A 5DHYA 1FL6B 3U7AA 4XC3H 3DO3A 2HKHH 1R24B 3RVTD 2IFFH 3N1FC 5F8RC 3O4LB 4L4TD 4X6DE 2DQUH 3B83A 3B8YA 3SQBA 1UGNA 3G9AB 1RZ7L 4OCWH 4TUKL 4EBQH 3LKNA 1A9BA 2H2SC 3A6OA 4KV5E 3MV8D 3VXMA 2XIDA 3ZKXC 1I9RL 4PJ5D 4I0CC 4UILH 5CD3A 1ED3A 3ROLB 2UYLA 3ARFA 2MKWA 4XHJC 4U0QB 3J8F7 2AW2A 5HDBE 1RFDH 2HTLC 3NZ8B 3QI9B 3MZTA 4LEXH 2VLKB 1RK0B 2C7UB 4PUBL 3RY5A 3X14B 2VXTL 2BSRA 4YFDB 2BVYA 3WFCH 2JJUA 43CAB 2EH8H 2IH1A 3KXFA 4G3YH 2V17L 2MWCA 4TUJA 1LO3H 4QKXB 2PO6D 1LP9E 3D1MC 4U2YA 5DVMA 5CFHA 3BXNA 3LKSA 5DK0B 3TNMB 5DC9B 3LN9A 3O9WB 4I4WB 5DJXA 2X05A 2CUMA 2VXSL 4YX2L 1SEBA 1X4YA 4NWUL 5FA3A 1D6EA 2NY2B 2VAAB 3MXWH 1QLEH 5CHNB 3BPNB 4JRXB 4YH6A 5DHXB 3BIKA 4BQ6A 1JL8A 1F97A 3OJDB 4DKEL 2QSCH 4HPOL 2Y7QB 1D5BB 5JOPD 4G7YL 5CGYD 4EI5A 4YHYB 4QGYA 1RY7B 3KS0J 4F33A 1R3LB 4OCSH 4KROB 5MEQB 4R2GC 4HWBA 5TDOB 4XMLH 3OHXA 5KG9B 2G75A 1AGCB 1IQDA 1WFTA 1O5DT 1XEDA 4JO4L 4TSCH 4PS4H 5E2JA 4LHUG 5AZ2L 2VZ3A 3I9GH 3M1BB 3TBYA 2P45B 4NO0B 4OLUH 3KR3L 1C5BH 5I8EB 2FIKB 5L0QC 2BRRL 1BAFH 3B9KA 3OAUH 5B38G 4NUJA 3DUSA 4G3YL 3H9SE 5IHBA 1OM3H 1I3VA 4XX1G 3VRJA 2ICWA 4H88H 3IS0X 1OAYL 3TIEA 4H26A 1NEZG 4NQCA 5B21A 1MHCB 3WJJC 4G80A 1CFNB 2OJZH 3H7BB 3HPJB 4KK9D 1NCNA 1OHQA 4M93B 2P8PB 3NGBC 5IF0A 3HLAA 1JZ8A 4YIQA 1LD9A 3PP4L 4FABL 2NTSP 1C08A 1JPFA 2I24N 3C6SA 1R3JA 4QNPF 1Q94A 1H3TA 2AABL 1HILB 5DD6B 4XNUH 2AJYH 4CNIB 4E41E 4Z8FL 4CVZB 2GJ6B 1BFOA 1IC4H 4QY8A 4J3WA 2ZCHL 1MHEB 4KPHL 4Y19B 1S3KH 3RAJH 3ZKNC 2Q3AA 3DMMA 1FRGL 4HLZH 2FYYB 3D48R 3QFJD 1XH3B 3K2UH 1FGVL 1JGVL 5SX5H 1RULH 1F45A 3HE7B 1FNEB 2GAZA 1QLFA 4UV4L 5AAWA 4LHUB 1BQUA 3MACL 3TZVA 4E41B 1FL3B 2VUOA 5GGSA 4YPGB 4MZ3A 4E42B 1S9WB 3TO4A 3U9PL 3CFKB 4DUXA 2R0LH 3GKWL 5HGBB 5GQBA 5DMKB 3VJ6B 3BQUC 4YGVA 2LVCA 3QNXA 2NXZC 3BHBA 4NO5B 4Z78B 4CL7A 4Z7UE 5CJQL 4CMMA 1E27B 4HUNB 4PJGB 5SWZD 2MTPA 4Q9QL 4K3DL 5L88H 3WXWL 3QDMD 5C0BE 1IGML 2B20A 4O2EA 1DBBL 1G7IA 3LKRB 3NFNB 4X7TA 3RTQB 4ZFOL 1ADQL 1MRCH 1QBBA 3NCMA 4KDTA 2ORBH 3RBGA 2VIRA 5E8DL 3UTTE 4OQ1A 4YXLL 4GW5B 3CDGA 4DJMA 1FAKT 3VFWB 3EJZC 4HBCH 5E6ID 5B8CB 1RAMA 2OSLB 1HI6B 4RDQG 3IDNB 4LCIH 1JNLH 2WNGA 5EH1A 1P7QD 1F02I 1JUFB 4NDMB 1NAMA 2X70B 4WWKA 2NY3D 1YMME 3DBXA 3MRJB 3MRPA 5HGAA 1RIHL 1ZT7B 5EUOA 3PP3K 1DANU 3VD3A 1MWAL 1IZJA 3MXWL 1J18A 3VFTB 4N90E 1CFSB 4HK0A 4FQJL 1T7XA 1GGBH 3OBAA 4OIAA 1U93A 4OQTH 4I9WD 2R56H 3B3IB 3DXAB 1U3HC 2FATL 3CVHH 1WT5C 2R4RH 4GBXB 3NFPB 4JFOB 1ZWIB 1MWAA 4HKZA 2EDKA 4YGAB 4JZNA 4M03A 3P73B 2VDKL 3QJFB 3EHBC 4OCXL 4UNVA 3IXTA 2J3SA 4KJYA 1EERB 2FEDC 4HGMA 2WUBL 4G8GA 3LEXA 3C9NB 3O3DA 4NC0B 3HE6C 4M1DH 1H0DB 5E2TH 1KN2H 1YY8B 1WLHA 2DYPB 2HMIC 3ROOB 3QZWA 2JELL 4KUCF 4GQ9L 3BPOB 5EN2A 4LSRL 3RX5A 5EPMA 3IFPA 1LNUA 4G6KH 2ZZUT 2AKRA 2XFXB 5F1IB 3MRBA 2R56L 4TNWF 5TGBA 3A67H 2X4TB 3QIBD 3EBAA 2JCCA 3GUTB 5EO1A 2ADFL 4PIRF 3HMXH 4FQXC 3G6JF 1I1FB 3MLRL 1Z9MA 3WFDH 3FQNB 5KZCB 4GW1A 3O3EA 4KY1H 1FFNA 1XIWB 3LH2L 4F2MA 4U6HA 2GSIB 1RZKC 1TJHL 25C8L 3ARDB 4NHUA 3WS3A 3V8OA 4F58H 5EUOF 3WO4B 4DUVA 1PFCA 1RK1B 4FNLH 5IT2L 1TPXC 2CMRL 2ITDB 5E2VH 2DQCL 1T66D 5E00B 1JE6A 2Z9TA 4EIGB 4PJAF 4OKVB 2IWGA 5FK9A 3DSFL 2FBOJ 4GAGH 4KHXL 4PJDB 3WLBB 4BH8A 4K3JH 2C1PB 5DRZA 3U9PH 4KRMB 1IVLA 1NBZB 1CGYA 4G6KL 2ZOLB 5I18L 5DD0L 5JA9A 1J5OH 1I9JH 1P2CA 1GPOH 4UAOB 2WZPD 5K9KA 3S96A 3HI6L 4NN7C 4WUKH 2CD0A 1ZA6A 5M94B 1Q0YL 4R26L 5GGVL 1KULA 3BMVA 4YHIA 1QPPA 1ZE3C 1MH5B 1PVHA 4NQEE 3LB6D 2NY2D 2C4FU 5DYOB 4HIEB 3S6CA 3HE6A 4X99B 3VXPA 4PJ9B 3T3PE 3EDJA 5DRXA 1WAAA 1FH5L 3Q6GH 4JB9H 5FDWA 4OFVA 4JFQA 3FTGA 3BP5A 32C2A 2OZ4H 5CEYA 5KOVC 3RL1B 3S35H 1D6VL 3O2DH 5D7JD 3GM8A 4WV1C 5IB3B 1XF3B 4QRRE 2CLRB 4HZLA 2YA1A 2BFVH 4HUVB 4NQDD 1HYRC 4BUHA 4YBLB 4RFEB 2A77H 1RD6A 1TQBB 3NA9L 4QRPD 3LSOB 1A6VH 2NY7L 4PV9A 2J6EH 3Q0HA 5CBAB 3L3GA 3MLVL 3GMMB 1C1EH 1G7JA 5EU7C 4C55A 1SBSL 5BS0B 1S7SB 5FYLD 2P42B 3RUGA 2VISB 1JNJA 3DXAD 1GZPB 4YE4H 3W0WD 1GJIA 4QRPA 4MQTB 3TH4T 3X13A 4YHNB 3LDBC 4G6JL 4RFOH 4LCYA 3TN0A 1UACH 1A0QL 4OKDA 3REVB 2AERT 4XBGA 1U8KA 3QDGD 5HYJB 4AEFA 4P2OD 2A9ML 2HFFA 3LIZL 1YMHB 3F7YA 4ERSH 2A74A 4WU5A 4FQIL 2A6DA 4PGBA 3TBSB 1TTGA 2R0KL 2EEAA 1SHMA 4OF7A 1WTLA 5ERWB 3UTPD 2ZUTA 4AZ8A 3MLTA 3PWNB 4M48L 5IV2A 5J8OA 4ZUWA 2B4CH 1IKNA 5HPMA 1I7UB 4MNGB 5IB1A 2XQYG 1BVKA 4Q2ZB 1HWHB 3QEHB 2I60H 5I15H 3LN4A 1N5YH 4S1QL 1UB6A 3F5WA 1IGIL 3RVWD 1CBVL 4OM1H 2R9HD 4Y1AB 2YEZB 5D72L 2ADFH 4OLXL 2NLJB 5CEZL 5C71A 1MVUA 3TT3H 2DDQL 4X80L 2BSRB 4CAGA 3LIZH 1E4WH 1QHOA 3RIAF 2NXYB 1HHJA 4J2XA 1R5WB 1W0YT 3E6FA 5IMOB 1B6UA 1XR9A 4FNLL 4QEGA 5IT2H 1DDHA 5F7UA 1EEQA 5TDNA 5DK0A 1SM3L 1N2RB 5ACLA 3VRIB 1EK3A 1JGUH 4N0UE 3VFUB 1V3KA 3STZA 3H42L 3QUYB 1EMTH 4PJCA 2XRAH 4MJ6B 5HHOE 4ZNCD 2APXA 3ULUH 1AKJA 3V9FA 2FB4H 5IM7B 3SE9L 1XGYH 5I15L 4PYHA 3MCLH 5IB5B 4HK3J 2ICWI 1J11A 4UDTB 4JRXE 3KNBB 5JW5A 4UQ2A 4G8FB 1DUZB 3MRGB 1UYWH 3IFLL 1F6AA 3RGVA 3N85H 3I6GA 3CUPA 5DK2A 2R69L 5D1XC 3PWLA 1ZGLB 1Y6MR 3O6ML 2IANA 2PO6C 3MJ9H 4AENB 3Q48A 1WF5A 2GJZB 4LPUA 2KZWA 5IIEB 1JZ7A 1MCEA 3Q3GA 4ELKB 2XA8H 2K3TA 4XCFH 5DQDL 1RIVH 3BQUA 1RMFH 3AGVA 4CU7A 3BEWB 1D5MB 8CGTA 5E03A 3GBMH 1MLCB 4H1LB 4ZTOL 4HIIA 2OZ4L 4TSBH 3V6OC 5JQ6H 1EAJA 1FCGA 3P9MA 2P7TA 3L3IA 3O2DL 1BQLL 3PIQB 1P7KB 3TO4C 4M43H 4Z77B 3EDDA 2WAHA 4K94H 1MCNA 3RWGA 1CVSC 5T3ZH 2A6JA 2G5RA 4FFWC 1OAUL 3U7WL 2WW8A 4MDJA 4RGMC 3ULVH 1DTUA 2ZUXA 4QRUA 4H0GA 2Q86B 1R24A 5E70A 4RGOL 1CICA 1RI8A 5KSAA 4JDTL 1MJ7H 5KBNC 4JAMB 4S11A 3GJEA 4N8PA 5TF1L 5EWIL 1J0IA 3MYJB 5D7JB 1OL0A 3S37X 4JO2L 3W0WB 4LPYA 2GCYB 4NPYA 3UBXB 2GJ6E 1BBDL 3MV8B 1S8DA 1Z0NA 4EZMA 3GJFH 3DMMB 3QP3A 4JE4B 1NFDF 3HI1B 5E4EB 3K8LA 5F3BB 5EBLB 1KIUA 5FFLA 4HZAA 2OL3H 1FNEA 1J05A 1YEDB 3TCXA 5F8QC 1FL3A 2DBLL 3UPCA 2H9GB 5IBLC 4AT6B 1KJ3L 4W4OA 2E27L 2Y36L 1T04A 1NBVH 2NW2B 5F7LB 4MA3B 1I85C 4TPRL 4A2MA 5AZEH 1RUPH 3S88L 5D2NB 1G7LB 2G60L 5CHNA 4FZ8L 1E6JL 2V5MA 3GMQA 5FIEA 1NAKL 3PWPB 3P4NB 4DKDC 4R3SB 4XVUD 5DHVH 4ONHA 4OFKA 3LZFL 5DVNA 2AK1L 3BP6A 3H9HA 2NX5A 4GG6A 1KCRL 4UINH 1OSPL 1ZHBA 1W0VB 4P2CG 4KROD 4YZFF 1KIQB 3EDEA 4HWZA 5DMIH 1LE9B 2YPKA 4WW2F 4KJWD 3JV6B 2YD7A 3O6FB 2DBLH 1KTLA 4MAYD 4JVPA 2BERA 3C5SA 4KU1A 1D9KB 3GMPB 5GISH 3DMMD 4DVRL 4K8RH 1JUFA 2V9RA 4NDMA 4UT7L 5AWNL 4Z7WA 1QRND 5HXMA 1FYTB 1BREA 5GRXG 1CFNA 5L6YL 1YY9C 2BX5A 2V2WB 1IGTA 1D5IH 4TULH 3L95A 4UDUA 3OAZH 1HHKA 5F44A 5C07E 1RUKH 1LMKA 1ZLSL 3JV5A 4Y5YB 1DLHA 3BDYL 1YA5A 4ZTPL 2ZP0T 4GKSA 4XVSL 1C08B 4Z76A 4JFHE 1DQML 1JPTL 4AM0A 3MGOB 3OGCA 2YN3A 3G6DL 1F3DH 4TN9A 4YDJA 2LTQC 1U3ZA 3HC4H 3LKQB 4LVOB 1A3RH 3CZJA 1IQWL 3EJYC 3DLQR 4XP6H 1H5BB 3SOBL 1MCIA 2OI9B 3K80A 1EFXA 3S34H 4L8CB 2YD4A 4GAJH 4N0YH 1WZ1H 4ODTH 2AK4A 1RPQA 2VLJE 1HSBA 1L9MA 1U3HD 1ZEAH 2NY4C 2PCPB 5JQ6L 2NR6C 2EYSB 4EI6B 3D2UB 1DBJL 1NBYB 4JHWL 4S0TD 3GSNH 3EDKA 4M43L 4NHCL 3CPLB 1U3JA 4WTWA 1E6OH 4OF5A 2YUVA 4OBSA 1SYVA 3ALXA 1X5KA 2WV3A 5IFJB 1RUQH 5KVEH 1AKJD 1CFTB 2J8UA 4ZTPH 2X4TA 1HKFA 1QSZA 3U48A 3VGHA 1A4JA 5F6HI 4D0CA 1IGJA 4OCYH 5E8EB 2YOCA 3RQ3A 5CIPB 1I9IH 4GFTB 1KEGH 1Z9LA 5I8CA 2P5WD 4WNQA 1G7PA 3EFFB 1T22B 3TA3D 3SQOH 5TJWK 2JF1A 2H1PH 2CDFB 4L9LC 3S34L 3L3KA 2ITDA 4YHZH 4PG9B 3VXSB 4DGVH 1URLA 2Y5TB 1PYWB 5BVJA 1I85A 3IFNH 4XMKH 3DX7A 3HNVH 4G6AD 2P5WA 1NGYB 3DYMA 4U1MA 1MVFA 4PJDA 4D9RE 5ADOH 4HXBL 5GPRA 3AXLB 4WU7A 1AGBB 1GXEA 3O6LH 4WHCA 1OWRM 1BEYH 1PDKA 1OARH 5HGAB 2B2XH 5FHAL 1VSCA 1ORSB 2QQQA 4X4MA 4DZBA 3SN6N 12E8H 3AM8A 2G60H 5DT1L 4ZFFA 2NY0B 2VR4A 3LKOB 2NW3A 3VWKD 3OKDB 2ZUQB 1T03H 5E4EC 5HI4D 4LKCA 2A38A 4Y4HB 3C09C 4ALAH 1ZLUH 1ACYH 3ALPA 1VHPA 3Q1SH 2VDOL 5INDB 5TQ0H 1FL5B 1OSZA 5DHVA 5E9DE 2H1PL 3QB7C 1UXSA 1EGJA 2C3HA 3H9SD 1AE6L 4UINL 5SWSE 3OGOE 4X6CE 5AUMA 3IAGC 2R1XA 2A6KA 3VFGL 5K9QI 2N4IA 3IXAA 4PGCA 5ADOL 1UWXH 3SDXA 2CKBL 4ZAKC 3VH8A 3LQZA 2UWEE 5KSBA 5CGTA 4Y5XA 4RMWA 5GZOC 5K9JL 1A6AA 5CSGA 4BZYA 2WWKO 4Q9RL 2DQUL 2Z31C 3ZE2F 1GL4B 5GS0C 3MNWA 4F9PC 4H20L 1AQKH 1JGLL 3EYUH 3GMMA 5EPMB 5I17B 3VFNB 4MQ7B 3CAFA 1CZ8L 4M6OL 2QADD 3Q2CA 1FO0B 4R7DA 1IFHH 1P4LB 3BT2H 4YHNA 5I1GL 4FFVD 5I74B 5EO1B 5DRNA 2HT2C 3EYQC 1JYXA 3QXTA 2A73A 2VABA 3O6FC 3IFOA 3V4UH 5C0FB 3EO0B 4FXKB 5GRVL 4JHAH 4GW1B 1WC7B 2FL5B 1LGVA 4P3WA 1UCBL 3O4OB 1XR8A 4PJHF 1L6XA 4QNPE 2XKSA 4X9HA 1RHHB 2IADB 3HC4L 5E9DA 4B50A 4IRJB 2MCPL 3TBSA 1DQQA 2X4UA 4XNXH 1RUAL 4P4KB 4NRYB 1HHIB 1UM6H 4HJ0D 4N8VB 1VFOA 1CU4H 5HGDA 5D1QC 4Q9RH 5CP7A 3V5HA 3GSNB 5C0RH 3QEHA 1NAMH 3BAEH 1M6OA 4PJEE 4KVCH 4I2XA 1IGFH 4M6NL 3FCTB 4GXUM 4BA8A 3BZEA 4O2CA 4TVPD 1JWUB 1B2WH 3ARDD 3FQTA 3KVQA 4PY7A 5DFVC 5I1GH 3MOQA 5FYKL 3PQYD 2BVPA 3OAYK 4U1GB 5E2UH 4JN1H 35C8H 2YXFA 5F96H 1O0VA 3UXFA 1NC4A 3GSVB 4WHTB 1UKQA 1X5JA 1MF2H 3QO0A 5BQ7B 5J89A 4K23H 4OM0L 2XNAB 3M45A 1R5WA 3FT4A 1T0NB 4MWFA 2D7OA 5DD3H 2CIIA 3G5XB 2PTTA 2Z4QA 3OF6D 4LAQL 5EORH 3ZE0E 3D39B 2AJ3B 3B6SB 3JWDC 4GSDH 2MPAH 5BZWB 3W2DL 3KJ6H 5E7BA 4MHHI 3DURB 1Z9SA 4LSTH 4F57L 4HUVA 5D2LA 2P8LB 3MNVA 5F9OH 1ZS8A 3KNBA 5EOCJ 2FX8L 4M1GH 1H3GA 4PJHA 5JW5B 1ZA3B 3LSOA 5K59F 2X89A 2IFFL 1F8TH 1IJ9A 3BP4A 5E1AB 3CUPB 2APBA 3AS0A 4Z7QE 3IETB 1RZ7H 4Y88A 1G9MC 5FV1L 5DK3A 4JPWL 5BS0A 4O9HH 5KS9A 4C4KO 4MMXC 4KK8D 2EH7L 5IIEA 1QBML 2XZCH 4LSDA 3UO1H 3QWRA 3FQWB 3SPVA 4LU5H 1OTUD 3VFSA 4MCZA 1PLGL 3C6LA 1JNNL 4KMTH 4LARH 1I8IB 3PDGA 5EU6E 1GCFA 3P30H 2YN5A 4ZSOA 1XAUA 4TOYL 4LAQH 5D5MA 4NJAL 2DL2A 2P7TB 1S7XB 1VERA 3T2OA 5HGHB 4WI3A 5JO5B 3FO2B 3RWGB 3WNOA 3BH8B 1S7WA 1MFDL 5LWYL 1F58H 4TRPH 3D18A 2DTSA 3RGVD 4N0UB 3ARSA 2XICA 1BVKB 3PDDA 1QLEL 1V3LA 1RJYB 3H3PL 4Q2ZA 3S3JA 3H9SB 4KXZH 2EECA 3KJ4B 2FEEL 4GXUN 4RRPA 5EOTB 2NMSA 1UB6B 3VWJA 3LY6A 1LO2H 5SX4H 1A2YB 4ZUTB 3UTZA 3AREC 1BBJA 4A6YL 4Y2OA 1AR1D 4CKVX 3LEVH 3IDYC 1ADQH 1MRCL 5IW1B 1AP2B 2XKNA 1KOAA 2VZVA 1FYHB 4HJJL 4BFIA 3ZDYF 4ZUUB 3GBNL 2F54A 1EDQA 3RZWA 3I6KB 1JMZA 4QTHA 1E0OB 5ISZD 5FEBA 4AH2A 4LBEA 1EA9C 3TWCL 1WITA 1M71B 4I18B 3SDCB 2V5RA 2Z31B 4FQHA 5DJCB 1ONQA 4IMLA 5FB8A 3GK8L 3QI9C 1OAZH 4DN3H 1RUAH 2XQBH 3QIUD 3S37L 4P4KD 5I1DA 3MJ7A 3TT1H 2VLLA 4X5LA 1HXYA 4Z7UA 2AI0L 1HSAB 4JFDE 5D7SL 3QG7H 4X9GA 4RISH 5D1ZA 2YBRB 5ILTL 5ID0A 1W0WA 1T1ZA 3MRFA 1HYSC 2IBZX 3GMQB 1IRAY 1FNGA 4C56E 2W0FA 5EU3A 4JFFB 4DK6A 1K6QH 3KPRE 4HKXA 4LQ1A 4UDTA 3JTTB 3CH1B 3WKML 5MP6L 2FGWL 3B2VL 1Z2KA 1F6AB 3RGVB 1WBYB 3BPNC 5J1TC 5E0QA 3UTTA 3O2WL 3BP6B 4JFDB 4WHYH 4Y4HC 3S4SG 3D85B 3T4YA 1X4ZA 4DVBB 1ZGLA 5C07A 1SJEA 1W0VA 4NQCD 5D2NC 1IAOA 1ND0B 4FN0A 2PR4H 3NABL 1LVEA 4OLVH 1S78C 3EYSH 4JANA 4BJLA 4PR5B 4GLRH 3RP1A 3IU3A 4UIMB 1WICA 2BCKA 4P9HC 5I16A 3N50A 1CL7L 1A1NB 5CJOL 4MXWH 3QG7L 3P4LA 4MD4B 1IGCL 2FEEI 3LQAL 4PJIB 1MI5D 4I5BB 4HX1A 3GSOB 1F3JA 1YECH 2IBZY 1NLBL 4Z77A 4JFYA 3J7HA 1G6RA 5I71C 1N7MH 4B53A 3WDJA 2A1WH 5D2NE 5A3IC 2X9XA 2FGWH 3B2VH 3MUGB 4WCYH 5I2IA 1WBXA 3KPQB 4GJTB 1CG9A 4G8GE 1KCVL 4UOW1 4KY1L 3MLPA 4HFWA 5C0AB 3QSKB 1IBGH 1FJ1A 4KKCC 5D7JA 4LDEB 4NN5C 4NUGH 1LQSR 3ARGB 3FN0H 3PUCA 3NABH 4MJ5B 5LAXA 4R4BA 1Q9LB 3UO1L 3RDTA 1A7NH 3SJVA 4XVTH 4QRSA 4DW2H 2H26A 3UP1A 1GGUA 5CSBA 5HHQB 4MAUH 1G7HA 3QQ9D 1X7QB 1CI5A 1T0MA 5ACMA 1FSKB 3RWIB 5JOFB 1T7ZA 4X5WA 3WUWA 1XF2A 3K4ZA 4O51A 1AO7E 4GG6F 2HT3C 3V52H 2ITCB 4ODHH 2IGFL 4G43B 1YEIL 4WY7H 2VITB 1NCWH 2WLYA 1GIGL 2AV1B 3P3YA 1QR4A 5D2NA 1I1AA 5MEOB 3RPKA 3ULVF 1FFPB 2YC1A 5ALBH 2B8OT 3C5JB 5FXCH 2PO6A 2EC9T 3BRDA 5I19H 2ED9A 3T65A 5GSRA 5I1AB 5D70L 1UVQB 1L7TL 2OCFD 3O8XD 3QEUB 2X09A 1G9ML 4ZS6C 4NP4L 4X7DC 3TBVB 1I1AD 4OCXH 5D6DA 4NYLA 3QPQD 3S35L 3VXUA 1LDPL 2YKLH 4Y2DB 4ODVH 1R5VA 3QFJB 2VLJB 1F3DJ 1UQSB 2AV7A 3D9AH 3SDCD 5FOBB 1U8NA 1EXUB 2R1WB 3AXLA 4WU7B 3FB6B 3EUUA 2H8PA 2XQBL 2BY0A 3S37H 3TT1L 5HHME 3CLFL 3SCMC 2EE6A 2J6EL 4N5EC 4NKQB 2ATPB 3OZ9H 1GIGH 1VPOL 3QDMB 5JW4Q 1CD0A 4BFEA 4XP9H 4PJXB 5CJQH 1C16A 1KYOJ 4NQVB 2NY1D 1U8MA 4Z7NF 4RWHA 4Z5RA 4G8GD 4GQPH 4YR6B 1ULVA 2EKSA 4MJID 4Y4HA 1V8HA 4R90H 3VMNA 4Z76B 4AM0B 5CD5C 5GS1A 1CQKA 1QA9B 2AJXL 5E8DH 1S7TB 3MRRB 4KAQH 5JXED 4M8VA 4Y16A 2VXUH 4JDVB 3MLXH 4Z7WE 3VA6A 2JB6B 3TCLB 3MV7D 5EU5B 4XVJH 3R1GH 1K3IA 2O5ZH 1IAMA 1TVBB 3FZUD 4IDJH 4JKWA 5DQJA 2DQTL 3TJHC 3O0RH 4X6FA 4EUPH 3HG1A 2DQEL 4P4RA 4P57A 5T3XD 4WFGD 3QH3A 3QIUC 2EYSA 4LLMB 5D2LF 2QQLH 1QNZH 3MUJA 1K5NB 1NLBH 3CPLA 1RZIA 1UZ8A 2UZIL 3W11D 3TYGL 4IOIB 1FORH 4U0RB 4U6VH 3MRHA 5DUML 3IRPX 2HWZL 3L7FA 4H25B 4F7CB 4MXVF 3BKJL 3DROB 2ICWJ 5BRZE 3PP4H 4PGDA 1KCKA 2I9LB 1CQYA 1L9NA 3KWWA 3WLWD 3IFOB 1NDGB 1TLKA 3DVGB 1KCLA 5E8EA 1XGUA 5B3JF 3BGMA 5CIPA 5ENWA 1SMAA 3EOAB 1PX4A 2IALB 4M5YL 4POZD 5HJ3B 2DJUA 3V6ZB 2EYRB 4MJIB 3VH8G 4LCWA 1OGTB 4PJDE 2DWDA 4WO4C 2XZAH 5IFAH 4XVTL 4EXPX 3AY4C 4JKPH 3G6AA 1FRGH 3AS1A 1Z5LA 3KLDA 1TTUA 3O41B 4K3EL 2E7CA 2XY1A 3O4OC 4IRSA 4YFLI 1OB1B 2EIZA 4XPBH 3DHMA 4V1DD 4KC3B 5ANMB 3K46A 1CLZH 1OCWL 3MMEB 3QUXA 5H94A 2NY7H 5GRJL 2E7LC 3MQIA 4KI5C 4P3CH 3BH9A 5HSFA 3NCFB 1QO3A 3GIZL 1SEQH 4WUUB 5GXBB 4OQTA 4H8WC 1LO4L 5D8JL 5FGBC 4XTRD 1QSFB 1X44A 1NGZB 4ZNEE 4D2NA 1CGVA 4TUOA 4MJIE 3TYFB 2ADJA 4ZXBA 1YEFH 3DOSA 2GK2A 3OKDA 1PGRB 3U36A 3MR9A 4UMGA 4PB9H 3U46B 1XCTB 4FOMA 2ZUSA 3RWJA 2W0PA 2OTUB 2IH1B 1UACL 4RX4A 5INDA 4ONFH 4G9DA 5HDBF 4XC1H 2VE6A 3LKSB 4XNYH 5KS9E 4XNMA 1MCHA 2VLRA 3X12B 3UC0L 2FDBP 3PL6C 3ZTJG 4KKAC 3T2NH 3ILQD 1JGDB 4XAWL 4ODSL 5JNYB 1L7IL 3UAJC 1MQKL 3MROB 4GO6B 1U6AL 1B3JA 3MNVB 4Z95H 1I7RA 3CX5K 2C1OA 5DD0H 3UTOA 3CLFH 4U2ZA 1TVHA 1Q72L 1RZ8A 4LLQB 2AJUL 4DFIA 5E1AA 1MJ7L 4Y8AA 4MLSA 5T33L 4KGLA <