5IHUL

Crystal structure of bovine fab b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bovine Fab B11 light chain
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihuL01
4TUOB 3QIUA 4HC1L 4CNIB 5EO1A 1MWAA 2E9BA 5DS8B 1J8HA 3K46A 5E8OA 3LQMA 1IFHL 1S7SB 4Q6IC 3JWOH 4UUJB 4JANA 3QFJA 1TZIA 4C56E 5EOCL 4QWWC 4M7KL 4GW1B 1URLA 1CDIA 1XF3B 5GSVA 3G6AA 4G6KL 4E41E 2YUWA 4F7TB 4F7PB 3D0VB 4LPCA 3DXAD 1ZT4A 2DQCL 3WE6B 3QDAA 1P1ZA 1HYSD 4IOIA 2I9TB 1RZ7H 4XB7A 4NUJB 5IESH 4N0UA 5ID0A 4HKJB 4QKXB 2OSLB 3I02A 5I1GH 2HLFD 2FJHA 2EKSA 4O4YL 5DQDH 4HIEB 1JGDB 3KPQA 3TPUB 5MERA 1JYWA 1ZT1A 2NY2D 3NCYS 3T0ED 1OAQL 3GSOA 1JWMB 3GDBA 5DHVB 4DW2L 4ONOA 4DAGL 1Q0YL 4U2ZA 1KXTB 4CVZA 3QO1B 1T2JA 4GW5B 3S4SA 2XY1A 1TPXC 2EICA 1JGLH 1KIRB 4XMLH 1NAMH 1RJZA 1QLFB 3F7RA 1WBYA 4EJ1C 5EDXA 5EOQH 3U4EB 1WK0A 3IFPA 4TN9A 1ZHKB 5J1SC 3FB7A 1R3HA 3ILPA 1I7ZA 2YK1H 1X5FA 3QEQD 5IVXE 2XWJB 5E6IC 1R3JB 5IVOA 1MCJA 4XHJD 4MAYB 2IPUK 4X6DB 5IF0B 3S35L 1PQZB 4BQ9A 4ONGH 4FFZH 3ULVL 4LSTL 4XNZB 5JNYB 1G7JA 3TT3H 2F5BL 5KVMC 4L9DA 5E6IA 1QFWI 3LKSA 3W2DH 1V3LA 1DQML 2IG2H 3NH7H 4PGBB 5IB3A 3P9LB 1FV1B 4YBQC 4JO3L 4PRHD 1LMKA 4NKOB 1YY9D 3EYUL 1ZGLM 2AVGA 3FB8A 4H8WL 3HS0A 1KBGH 2ARJQ 4G6FD 3QA3B 1JPTH 4R90H 4CVWA 2FJGA 5ETUA 2VZTA 2H8PB 1Z0NA 2IAMB 3RWJA 5BS0B 4PR5B 2NXZC 4KKBC 1YUHA 4YHNA 2VLLA 3ZE2F 1YNLL 2XXCB 2FX7L 2GTWA 3JUZA 5CBEA 1IFHH 3UTTA 1A9EB 5K9KB 5E2VL 4XCYB 1NC4B 3VXTB 5EOCH 2XKNA 2Y06L 4M7KH 2BY2A 5GGVL 5D93B 4Y4KB 3P77A 4G6MH 5ANMA 4G6KH 5KVDL 4EBQL 5C0EB 4JDZA 5DSCA 3FT4A 4AT6A 1SJEA 4QXUL 4P46C 4PJHF 4PGEA 4UTAH 4G9DA 4FZ8H 1FFPB 4WHTB 2YR3A 3F7YB 2DQCH 2DQGH 2EDOA 4DQOL 2B7DT 4DN3H 2W0FA 1WIUA 3EIFA 4YEEA 1ZLUH 1CFTB 3BW9B 3BX7C 1XF4B 3VWJC 4D8PB 4R7NA 3DX6B 4P46A 3UTSD 1L0QA 1FE8L 3DLQR 3RIAF 2AXJA 1T66D 5EU6B 1R3KB 3VWJA 3ARWA 1OAQH 1K4DA 5HGHA 3E2HB 1GOHA 4Z7UB 5CEYA 1EEYA 2ADFL 2W59A 3ZKXC 1TTUA 1Q0YH 1RK0A 1W2KT 2VZVA 1W0VA 2P8PB 3QEGH 1NCDH 3QUMA 4FZEL 2FHBA 4W68A 2OTWA 3NFNB 5IHUL 4KJQD 3NTCL 3F7PC 4WY7H 1VFOA 2AK1L 4MHHI 4DZ8B 4Y8DC 1G7IA 2N7AA 1KJVB 5CSZB 4B0MM 3D0LA 4ELMF 1P7KB 5H94A 3WIHL 1U6AL 3H3BC 3ZYOA 2YPLE 4LHUB 2Q3AA 1JPGB 3MUJA 5I6XC 1JGVL 1SBBA 4JFQB 3S35H 1UT9A 1YEEH 3D3VE 1FFNB 4KJPC 2EC8A 5E70A 2F53A 4Z7VF 2BJML 3FQNA 5LGHH 3IETA 5I1DB 1Q94A 2XQYG 3LKOB 4GW4B 1V7ML 2KBGA 2EIZB 4Y19E 5GS2D 1TNNA 3RHWF 2GSGB 2MSPA 4JO3H 2ZOLB 4RNRA 4E5XA 3ULUF 3EYUH 2VLRE 4X0KB 1CFBA 3C9NA 1IAKA 4A6YA 2AV7A 3QUKA 3ZDYE 2HFFB 2A83A 3G04A 5J11C 3BQUC 4PJXE 3OKNB 3C5ZD 4IBLT 2IMMA 3C6LD 3VFNA 1UG9A 1YNLH 1H3XA 1ZEAL 1AD9B 2GT9B 3IFNL 3UPAA 4I3RL 4EI5C 3BQUA 3BGFB 1MJ8L 3RTQD 4Z7OE 4EDXA 2PTUA 4DCQA 3CDFA 5SX5K 1CICD 1HNGA 1FRGL 5ICYB 1HHHB 3B4NA 5CHNB 5JQ6H 1QVOA 5GQBA 3T1FA 4EI5A 3NIGF 1HDMB 3STBA 1ZLWH 3HUJF 2GY7B 3MRFA 4JO4L 4DQOH 2AS5M 1VACB 5D1XB 4FFVC 4XH2B 4O58L 2EDXA 3ZYZA 1FE8H 2JCCB 1XEDA 4PP2B 4QRQA 4QRPB 1H3PH 3P73A 2IADB 2Y5EA 4PJ7B 4PJEE 1S7QA 2XV6B 2NX5E 2YKLL 4PLOB 4FS0A 2BSSA 1QRNE 4FTVB 4XVSL 2C3VA 3BZFA 3MRLB 1LO0H 2Y7QB 1JHLL 2ADFH 2CKBB 2VJXA 3DRQA 3KPSB 4U4BA 4X4XB 5KZCD 3JZ7A 5EBLA 2O5YL 5IWLC 1C7SA 3BZEB 1INQA 2WZPD 2UY6A 3HMXH 4QCIB 3DVGA 1NFDE 2AK1H 2YHGA 3PHOB 5HI5D 3UBXB 4M8QB 4IDJL 4H5SA 5IWLA 3GHBL 1SVCP 1RJYB 3S7GA 4NM8L 3MV9E 4N5EC 3WEXA 3WIHH 2R1YA 2C3XA 4YLQT 4JZNA 2DLTA 3NCYP 4HUWA 4CAGA 2YD1A 5FA3B 3L9RB 4XXCC 2X1PA 4LMQI 4WUUD 1T1YA 3IU3A 5D96B 5HJ3B 3BIKA 1NAKL 5DYOB 2D03H 3OR6A 5BQ7A 3GSQB 4R3SA 3ZT5A 5TF1L 1IJ9A 4W6XB 2BJMH 2XTJE 4XXCA 4I2XB 4PREB 1V7MH 3RA7L 4WO4B 3VFVB 1TVHA 4FQ2H 3QR2A 4LVHB 4NQVB 4KI5D 1HHGB 1IILE 2E8ZA 4XC1L 3PQYA 3RFZC 3MRQA 2G2RB 4MLSA 4YHKL 4QGTA 1YN6A 4YXKL 5A3IC 2VIRA 5GS1C 3C08H 1Q9LB 1MVUB 2JJVA 1VGEL 1BQLL 1RUKL 4K9EL 5MEPB 1GVIA 1YMMB 4WI9A 1HXYB 3KPPB 4MS8C 3V6FB 4KRPB 4XC3L 2A6IA 2DJUA 4LLDB 3WYRA 1ZEAH 5GS1A 3IFNH 1A1OB 1O7SA 2AK4A 4GRLB 3PP3K 1VFAA 5HDQH 3C6SB 2IANE 3GMPA 3MO1A 3HE7C 1DQQA 4L8CB 1FRGH 1Q72H 1CD0A 2ZUYA 4EI6B 2K3TA 4YEFA 3SDXE 1OP5K 5L0QC 4JO4H 1XGQA 3ZMRA 1QR1B 1RIVL 3HE7A 1CF8H 3VXSD 3PE9A 4L3CB 4WFED 1FVCA 2FECI 4JFEA 4HV8A 4O58H 4ZDHB 3KPNA 5HHQB 2P24B 3DSNA 4AENA 2WINA 2WNGA 3IDUA 5C70A 3AC0A 2DQFA 2VSCA 3FZUC 2YKLH 3L5XL 2NLJB 35C8L 4JG1L 2FSEA 1A2YB 3PL6C 3TBSA 5FFLA 1UJ3B 4FNLL 1JHLH 2QQLL 1AC6A 3QULA 2UZYB 3QNXA 4LHQB 2DB8A 4KROC 5I75C 5IVZA 1HEZA 3GRWH 4MJ5B 2DIJA 4JHWL 3PL6A 4ESKA 1JZ6A 4QXTB 5K59F 3SJVB 3I9GL 5JOFB 4HG4K 4NM8H 3WUWG 1NKRA 3LN5A 4HT1L 3GBML 5TE4H 4GMTH 1MEXL 1MQKL 2IEPA 3ES6A 3BUYB 1XF2A 3G6DL 1YDPA 4OUUA 4Y4FD 3IS0X 4LDOB 4YHZH 1NANI 4HEPG 1OD9A 5AZ2L 5E9DE 2LAAA 5J6HB 3DSFL 2DWDB 1ORSA 5E7BA 1ZHLA 1I8LA 2Z4QA 3GSVB 3VRJB 1NCWL 3R8QA 5IMMA 1LK3L 4QRRE 2AJVL 2YXMA 5E8PB 1I1RA 4Z7WA 4F3FA 4PRIE 2VAAB 4XC1H 3W9EA 4KKLC 3MCLL 4P2RA 3T4YA 1A8JH 2VR5A 3KHOA 3LQAL 1T20A 1KN2L 4BH7A 2B0SL 4MVBC 5I19L 3FN9A 3FT2B 3UTQA 5I1HH 1VGEH 1BQLH 1I1FB 1RUKH 1WWWX 4OLVL 3DX9A 1I1AB 1W72H 3WO4B 1HH9A 3PHQB 1T22A 3RVVD 4QY8A 4PJFA 5DD6B 4D0BB 2VR9A 4HSQA 5EU7C 4PJIE 1Q8MA 4PG2C 3BDYL 3DHMA 1J12A 4HJJL 4PLNC 2P5WD 1DDHA 5BO1L 1J1XH 2H6PA 3QDGE 1JGUL 4R2GC 2ED7A 2ARJA 2AXHA 4IOSD 2VUOA 2X4RB 4OKVA 4PG2A 3VD9A 3FMGL 1ZVYA 2I25N 3QQ3B 5IMLB 5GGRA 5DJYB 1TZGH 4KK5C 4YHYC 4N9GB 1EO5A 1RIVH 3ISWA 5BZWB 2P8LB 4MXVF 3MA7B 3PGDA 4WI5A 4G42A 3X3FH 1DQLH 2GJ6B 1BQSA 1RURH 1A6ZA 3WKML 3B2VH 3NIFE 4YGVA 2H32H 1ZS8B 3WO3B 5DJCB 3BRDA 3EFDH 4YBHA 3O45A 4JG1H 4MX7A 2VUYA 3VXRE 4JRYD 1N5YL 5CIPA 2HKFH 2DQEH 2UUDH 3ALWA 5KSUA 3ARBC 5HDLA 3GMMB 1QACA 3I9GH 1E4XI 1U8JA 2EDYA 4Z9KB 1FC2D 4WCYL 3H7BA 5EUOB 1M05A 4M7ZC 4P3DA 1I9JL 1MQKH 3G6DH 1EFXB 4QOKB 4IJ3B 3X17A 5IB2B 1QHOA 2F54B 4HKBA 3ARBA 4M62H 5D6CB 2P49B 5F7NC 3RWFA 3S37H 3L3OA 3ALXA 4HH9A 1U3HB 3DSFH 1I1YA 1ZMYA 5MEND 5CZVL 5HGGS 4KTYA 4JVPA 4X4ME 3OKMA 2R0LH 5F3BB 32C2B 4QYOA 1LK3H 4X9GA 1AP2B 4LLUA 3WFHB 1I85C 4JPIA 4KUCF 3QEHA 4WDIA 3VGHA 3CFKA 3PIQB 5FO9B 3L3JB 2J4WH 1AQDB 1O5DT 2R0WL 3SY0B 3V52L 4CNIA 3QPXL 1WIOA 3K3QA 1I85A 1DBAH 1KN2H 2FH8A 3ARYA 3TBYA 2B0SH 5I19H 1XGTB 5EUKB 5CCKL 3Q2CA 3ZDXE 4HS6B 1TZHA 2E9IA 3B5HA 3TA3B 1WSST 4OLVH 1FVDB 2B5IB 4ODSH 4PPTA 2EEAA 3QNZB 5C0BA 1H9VA 5D9SA 3GSRB 5EA0L 4GW1A 4DKAA 3TN0C 4M5YL 3SE8L 5KG9B 1NC2B 1AY1H 2P5EB 1CDGA 4F7TA 4F7PA 1RK1B 3BPCA 2FGZA 3JTTA 3HCVB 5JHDE 3C8HA 5BO1H 3QWRD 1JGUH 5CEZD 1XCQB 4QHUB 3I6GB 3TN0A 2Y4SA 3FMGH 2AXGB 1F02I 1KIQA 1T83C 4V1DE 4NUJA 3VD3A 4P2QD 1FAIL 4NP4L 3MRKA 3IDGA 5HYIA 2P1YA 5C07B 4YH6A 3VGAC 2CDFB 1CFSA 1T83A 5C0RH 1AI1H 1EH9A 1MJ7L 3WKMH 3GSWB 3VCLB 4DK6A 3ARDC 2J12B 1OAKL 3GO1H 1RFDH 4Y2DB 5CZXC 2XQBH 3MGOB 1ZA6B 1FAKT 1DL7L 2UY7A 5FO8A 4ZD3H 3HNVL 2R69H 4NJAL 3ZDZF 1KIRA 1KB5L 1OB1B 1T7WA 3ARDA 4RWHA 4WUKL 1EEZB 1UZ6F 1N5YH 2GW5A 5D8JH 3U7AA 4S1DD 1CT8B 4PJ8D 2V17L 4BELD 4WI4A 1ZHKA 3VFGH 3V0VA 15C8L 2R15A 3DMMB 4M02A 2AQ1A 1JRHI 4S1QL 1CGXA 1OHQA 1CQYA 4G7VL 2BNRD 3VD5A 5E99L 1I9JH 1TJHL 2VISA 1VB9A 5IF0A 4XVTL 5C0AB 3HG1D 5E5MB 3MLVH 5FYJE 4OCXH 3CZJA 3GBNH 1LK2B 2DQTH 1R24A 2GSIB 3CK0L 2ZPKH 5ITBH 4ISVB 5FOBB 2VLME 3QEQE 4MQSB 1TQCB 2Q8AH 4Q9QH 2H26B 3HE6C 3WN5C 2AV1B 4W6YB 3F7VB 5F3HA 2YA1A 4OV5A 1P4IH 4N8VB 1MHHA 3K4ZA 5AZEL 2ZUSA 2C1PB 4ZO7A 2CK2A 4JHAL 5I1LA 3HE6A 1MCKA 1RY7B 3QA3A 3WN5A 3HMWL 4POUB 4CDHA 1IQDB 2B4CL 2LV4A 4OLWH 2F8XC 2CIKB 2R0WH 3V52H 3CDGB 1VHPA 4LOUC 4BQ6A 4H26B 5I66B 5CCKH 4PLKC 5I9QB 5T3ZD 3VXUB 1T1XB 5K9KA 4MCZB 4GAYB 3KPRB 4XCYA 3D2UB 1J8HE 1T4KB 3AROA 3SE8H 1AQKH 2VMFA 1GJIA 2BVUA 1RZIB 4PRPA 3QG7L 2DD8H 1HHKB 4N0RA 5DJDB 3RPKA 4AL8L 1U93B 5HYFA 5I16B 4MXQC 3T2NL 5F7EL 5E8NB 4OF0A 1UC6A 1A6AB 2J6EL 1LO3L 2Z35A 2XIDA 2O61A 1ZKAA 1A7QL 2VXUH 4G8EB 4PY7B 1HK6A 4HJGB 3QG6A 4BFEA 3EJZC 1P84J 4GLRI 5A16A 2GK2A 3I3BA 3SDAB 1MFCH 2CH8A 4N0UE 2I5YL 5LVEA 3KLHD 4FMKA 5L8KB 3PABA 3P9MB 1MJ7H 3DETD 4J1UB 1ERNA 1AIFA 3C2AH 4Z7UA 1OAKH 2DIAA 5DFWH 3P9WB 4K7PY 4YX2L 4OZGA 2P8PA 4LCUA 2EDEA 1ZLVH 1DL7H 4GT7A 3VFRB 2LE9A 4M1GL 4XCFH 3WL9B 2QQKH 4X99B 4NSKB 2GJZA 1KJVA 5CSZA 4G8IB 4X7TA 1JI1A 5DXWA 2BVEA 4ZFFA 4WJ5B 4HKZA 1S7TB 5FUZL 4MAYD 3RIAK 8FABB 4S1QH 4G7VH 2YUXA 4Z78B 1PGRB 3IDXL 5HHOD 1JN6B 4NO5A 3B3IB 4JFQA 4XVTH 2J88L 1CDUA 1MRCL 3VH8A 4KC3B 1SY6H 5D5MF 5ADOL 1HQ4B 1TTFA 4TVPH 1OTTD 3TWCL 5IFHH 2XWTA 1G9MC 5I1DA 4GW4A 5I0DA 3TYFA 1U8QB 2UYLB 3LDBB 1DVFB 3BZ4B 1DFBL 3S9DB 4FQXB 2WK2A 4GRWB 1FNGA 6FABH 1X9QA 5AZEH 1QFHA 1T7YA 3OKDB 5ITFB 5DJ2A 2IAMD 5BS0D 5DD1L 3MRGB 4X4ZA 1PX3A 5IROC 4P2CG 4JRXA 5EBGA 1WFTA 5LCVL 4EDWL 4JJHA 3MGTA 1UCBL 4LSVH 5A2IH 1OGAD 43CAA 1NC4D 5GGRY 3W82A 4UIMB 3GJFK 2QR0B 3MLWL 5IROA 1MHPL 2R56L 2CDEB 2W9EH 4Y4KD 1DEEB 1EO8H 4DOHB 1N26A 3PWJB 3I85A 4PGJA 3SPVA 4X6CA 2F15A 5H2BB 3WFCH 2K1MA 4ZS6D 3UTTE 4U1NB 3TESA 2PXYB 3KXFA 4L5FL 3RHWK 5GS0H 2G5BA 3I84A 3REWB 4AL8H 2X7LA 5ANME 2X4UB 4PV9B 4PJAA 5C08B 3CU7A 3MBXL 3T2NH 4LCWB 4JEGB 5CS7A 3TC9A 3NFPA 2J6EH 1F3JB 1LO3H 5H37H 3VJ6A 2BCKA 1P7QD 3BPLB 5CLTA 2JCCA 3PXHA 4YZFE 5EU6D 3SCMB 1AGBB 1A3LH 4QRPA 1INDL 3ARVA 4HUUA 4POZD 3UTOA 4Y1AB 4MNGE 1C16B 1WFNA 3MNVB 5FYKU 1IC7L 4AEIH 3MRPA 3OSKA 2WMPA 2VDQH 4X4XA 2X4QB 3DV4B 2ADGA 1FG2B 4WRLA 4MA8H 1Z6JT 3KJ4C 1PLGH 1BFVL 3QCUL 5J56B 5JMRA 1N8ZB 4M1GH 4MCYB 4JAMA 4K94L 4WW1B 3K1DA 2A0LC 4P48A 5L9DH 1BMGA 4F80A 4NRXB 4LHUD 5D96C 5CD5D 2IBZX 5C9JA 5FUZH 2GI7A 4OGXH 4H1LH 2D4DA 4ODHL 3HAEH 4XPTL 3QI9B 4GKNB 3V5HB 2OL3L 3L9RA 4U0RB 1N2RA 1E6JH 1IEAB 4WO4C 1KNOA 4WENB 1J1OL 4PS4L 4XWOC 5ADOH 2VLKB 4UTBH 1RUAL 3KDMB 5J12C 5EULV 1EO7A 3TBTA 2HT3D 2DQDL 1D5ZA 3RGVB 1BIHA 1UACH 3NIDF 4WO4A 2A6KB 4JFDB 4HGKC 4ZUUB 3NCCB 4WUUE 4LP5A 4NQVA 1DFBH 4YUEH 3S34H 3DGGA 2HRLA 3LD8C 7FABH 5JHLL 1D6EA 1WT5C 2X9XA 4L3EB 1G6VK 4MNQB 3SKNA 3QHTC 2OJEB 2XKUA 3MJGX 2X89A 4KRPC 3T0EC 5DD1H 5B3JF 4FXGB 3DJ9A 2XN9A 3HI1A 1XGYL 2DLHA 2NZIA 3G5ZA 5LCVH 5DVLA 5GRUL 5DK2B 1WT5A 1L6ZA 3PGCA 3B2UC 3E3QC 2FLBT 3CAFA 4LLDA 1BX2B 2VN7A 2R56H 3WDJA 2R4RL 1SEBB 4GXUM 2ZOKA 5T5NF 4KH2A 3FL7A 3LIZL 3C6SA 3X3GH 1I3GL 5F89B 4GMSL 5F7MC 3KYAA 5GRJL 4PJCE 3WXWL 1KCKA 3SO3B 4U1GB 3N9GL 5J1AA 1Q0XH 1CXHA 4WWID 5DMKB 5GGUA 5CP3A 1J87A 5D1XD 3MX0A 1KTRL 3DTXB 1QR1A 2HMID 4GG6B 3P0YL 5IQ9B 1J0HA 4QRUB 4LIQE 1B0GA 4NRZA 3C2SA 3HC0A 1X5LA 1MIML 2BP3A 3L5WB 2ITDB 4LASL 4CU8A 4X6EA 1YEFL 3QIWB 5CJQL 5BVPL 1SMOA 5KSBF 4FTVD 1QSEB 5HD8D 2SEBB 4KXZH 5FCUL 3O6FD 3KPSD 4JY5L 3WD5L 4HIJA 3TO2B 1OGTB 1I4FA 1HI6B 1IGML 3GI8L 2CPCA 2V2TA 1OP9A 5HI3C 5IFAH 3LZFL 3QCUH 4HS8L 3VXPB 1BZ7B 3C8KB 5C3LD 2ADJB 4KTEL 1CQKA 4QXTA 3OB0H 3W0WB 2PETA 4Z7QF 4GQ9L 3SJVA 2VLJB 2VC2H 4HWZA 4Y0GA 5EIVA 4AQ1B 1OARH 2Z8RA 2FWOA 4PY8J 2HT4D 5EC2B 3T0DA 1INEL 1GOGA 3EAKA 2R2HB 1D5BA 4JPKL 4OUOA 3S3PA 3MJ9L 4PS4H 1IC1A 2NY6B 4UDUB 1JZ3A 5FM8A 3KYOB 2W9LA 1FZOA 3WFZA 4QF1A 2R4SH 2A74B 2RAMA 2DQDH 5HYSA 3MLSL 4TSBH 2BHYA 2ICWA 2DQIL 4NZUL 2HRPL 1JYVA 4PTUB 1IGJB 5JHLH 1H5BB 1I1AC 3UJTH 1OQXA 4JFFA 3D25B 2LU7A 1IAIH 5AD0A 1YMMD 2P46B 1UB6B 1WCBB 1P4LA 1O7VA 1I8KA 1I1AA 3ZE0F 1EGJA 1C08A 5I15H 4GRLD 3SE9L 4GXVL 5D72L 1M7XA 1F6AB 2AI0L 5ALCL 4ZAKC 4XRCA 3QAZC 1HN1A 4GMSH 4PJGB 4HUNB 1KJMA 1MCWW 4UV4H 2MPAL 3W9DA 3B8YA 2X4RA 2VB5A 2AK4E 1KIUA 1DE4A 1K6QL 2ENYA 4LCIH 1T0PB 4ZAKA 4CUCA 3CMGA 4RCAA 2E6QA 4M4RA 1JMXA 3OKKB 4BH8A 4IRJC 2MKLC 1C8PA 3QFDB 3MRBB 1YEFH 1K8DB 5BVPH 2GJ6A 3ARFD 4GOSA 2XG5A 4M6OL 1ZS8A 5DZNA 5FCUH 2MQ0A 4IRJA 4CU7A 5DJCA 3LSOA 1AXTH 1E27A 1DEDA 3EYQC 5F88B 1RJCA 1YPZE 4I48B 1IGMH 4LKCB 1T03L 1M71B 3EZJB 1MVFA 1SM3L 1CTNA 1MFBL 5I8OL 1R3LA 1KPRA 4ZOEA 5D6DC 2GAZA 4IJ3C 5ILTH 4LNRB 5JIIA 1ZGLB 4GQ9H 3VFUA 1L4IA 1P9MC 2NW2B 5E1AB 4FHBD 4GAJH 3V9FA 1NGXA 5D6DA 1KYOJ 4KMQA 4QOKA 3V95A 5DFVC 1F4WL 2F54A 4UILL 3VW3L 3BD4A 4URTB 2Z8VC 4TRPL 1P9MA 4KK8C 4LVEA 1R5VB 4CW1A 4PJBA 1NEUA 2DDQH 25C8H 4Z0XA 4BQCA 1QFOA 4OZHB 2ZP0T 1CLZL 1C7TA 4OM1L 3NPSC 2BOBA 1FORL 4Q7DA 1AP2A 3WFHA 5TE6L 1XR9B 3FQWA 3T4AB 4NUGL 3JWDH 5DRXB 1LO4H 4NZUH 3TA3C 5FYJL 1BQHA 4AIZA 4NQEB 3P0VH 1R0AH 3MREA 5MENE 3VFSA 4FQLH 1BZQK 1UWEL 3BN9D 2ZJSL 4JRWA 5GZOD 1LP9A 5EUKA 3H7LA 1GPOH 4NC1C 1JZ2A 3U4BH 3TA3A 3WLBA 4P2RE 1CCZA 5FA4A 1BJ1J 4OLZL 1CGVA 2BK8A 1BBJA 4BZ1L 2XTLA 1CE6B 4GXVH 2Q86B 2P5EA 3O8XB 2FX8L 3ZZ1A 4F15B 1HINL 4BJLA 1M1SA 1A14H 1GGCH 1KCUL 5EZIL 5FYLD 1J1PH 2DM3A 4ZO6A 5DD0L 3IJHA 5MEQA 1MWAL 4JLRB 1KJ2A 1WGOA 4JFYA 2FBJL 4YNYB 4OD2A 4GRMB 2UWEB 2NY7L 3WNNA 3FO2B 4RAVB 4N0FA 3LPWA 5EU7E 4M7LT 4OFPA 5D7LB 4ELKA 5C07A 3GIVB 4CRPA 4NO3B 4Z6AT 1UH4A 2MKWA 4RMWA 5ISZB 1CE1H 1B0WA 3CFBB 5EU5A 5FM5M 1UVQB 3ZT7A 3RY5A 5DMIH 5DJ0A 1ZA6A 3E6FB 1A21A 4RWYH 5FKPB 1MFBH 4APQB 3VXQB 5I8OH 3M8OL 1AXIB 1JHKL 3RVUC 4H25A 1U8NA 4YHPB 1S7XB 2D7NA 3ME0A 4YXLH 3G6JA 4MA3B 3RUGF 1S8DB 5ENWA 3LOWA 1EFXD 3QHZH 1NH6A 4CJ0A 5C0JA 1TQCC 4NO2B 3TM6A 3GMLB 4L4TB 2VDPH 5FHBH 1U3HD 1ORQB 1FNAA 3QUYC 1BVZA 5DQJA 3EO0A 3O2WH 4TRPH 2GSIA 2WIIB 3LKPB 1OTSC 5B8CC 4XT1C 1G9EA 1CLZH 5T1KB 3QUYA 5GIRB 3DIFB 1CTOA 1FL5A 5B8CA 4C56B 1OD7A 3QIBC 5JW4M 4PBWD 1UXWB 5CP7A 1IQDA 4UDTB 4E41B 3VXSA 1K2DB 2BSTA 4DN4H 1UWEH 1IQWL 1KCRL 1VFBB 2ZJSH 3QIBA 2C4FU 5DHYB 3W11C 5K9JL 5J89A 4RQQA 1MCRA 4X6FA 1NC2D 4XAKE 1H3TA 2B8OT 2AXFB 4FFYL 2DYPD 4OFYD 2QQNL 4QTIH 1NCAH 1RMFH 2FL5A 2FX8H 2H3NA 3VFOA 5C0BE 3UYOD 1ZLUK 1CN4A 1U93A 1B6UA 5BV7H 4JFXB 1GHFH 4R4NC 1ITBB 5D7IF 1AGEA 5I16A 4G8GA 4OT1H 3RWCB 5I73C 3CVIL 3EOBA 5E8NA 3CX5J 1EMTH 2HN7B 5EO9A 4QRTA 3EHBD 5IFJB 4NQXB 4ZUVA 3VDCA 3CH1A 1QQDA 3AB0B 5I76B 3GB7A 3TVMC 5AAWA 1OAZL 3T1WA 4JM2F 5KSAB 2O5ZH 4YHML 2DIBA 4Y2DD 3V0WL 3RKDC 4B50A 1AHWB 4ONFL 4DUVA 5C2BH 5IVXB 2YN3A 3TO4D 3TVMA 1YN7B 3QJHA 1X7QA 5GRVL 1OF2B 5AUMB 1XGRA 3BH8B 3LKNB 1FFRA 3V5KB 3SGEH 2HVJB 1HHIA 3WL9A 2VDNL 4X99A 1Q1JL 3Q1SL 1KXQE 4F37F 2AW2A 1FZJA 3DMMD 1JHKH 5C71A 2L0DA 1MIEL 3LQZB 3NCBB 1ZGLP 3MRNA 4WU5B 1VKXB 4MD4A 4Y7MA 3BGMA 1BJMA 1R3IH 5C0AD 4Z5RA 3ARZA 4Z76B 1MRFL 1JVKA 1JN6A 5EU4B 3MNZB 4P5KB 2OZ4H 3FAXA 1A3RH 1HQ4A 3ZDYF 4XNUL 3QUML 5IKCA 3DI3B 4LLWA 5I8CB 3ARUA 1NCBL 4X6DE 4UT6L 1ONQA 1BBDL 4PJXF 3S5LA 1A7NH 4KUCD 4BSJA 2WP3O 1OTUD 4UT9L 2PR4L 4M93B 3FFDB 1NGPL 4RDQG 5CBAB 4YXHH 4X7FC 5C0DA 2F5AL 5JXED 2A9NL 1A1MB 1BF8A 3IRZA 4Z7OF 1JPFB 5JPNA 1CZ8L 3MRGA 4MSWB 1SJHB 2YD2A 1FNHA 3ALPA 5IB1B 3VXUD 3OKOA 3GMQA 1IQWH 3WDIA 3OPZH 3KPRD 4LQ1A 1GGIH 2FRGP 3D2UD 2X41A 1VERA 4NQDD 2QR0A 4WV1C 3PJSB 1ETZA 2CDEA 3BEVB 2OJZH 4XGZA 3ECBA 2R2BA 1FL6B 3CX2A 3PWJA 2D31B 4FFYH 1DP0A 3ELAT 1KB5B 1JWSA 1GSMA 3K4DA 5IBLD 3AREB 5IP4A 4XZUB 1ZLWK 4U1NA 4WV1A 5CKGA 5GS2H 3VH8G 4PJEF 2EDTA 1S5HA 3OL2A 4A6YL 1MF2L 5BJTA 3MYJB 2PW2A 1ZHBA 2X4UA 3NAAH 1CFQB 1T1WA 1C5DB 2ZSWA 2HJFB 3B83A 4PY8I 2NNAB 4BM7A 3CVIH 4PRPE 5CILH 4W6WB 1F3JA 1MH5A 1NGQH 3SDAD 2Y1VA 4BYHA 4ZPVA 5JO5A 3SCMA 5INDB 3QQ9C 4LGSB 1I9RL 1OAZH 1LQSR 3EDEA 5C6PB 3DPBA 1NGZA 3WV0A 4JFHE 4TSAL 4N90E 3V0WH 3QUZC 4ONFH 1KTKE 4LIQL 2X4QA 2IJ0C 5C0FA 3H9HA 2EZ0C 3BO8A 1WBXA 2IPTL 3H2WA 3QUZA 4Z7UE 3D3VB 1Q1JH 2J8UB 5JIKA 3Q1SH 4OZGE 3L1OL 4WW1A 4ODTL 3KPLB 1MIEH 4FFWC 4Y5VC 1JHTA 2QLVB 3GMRA 4R96A 5DK0B 1EHAA 3CLEL 4AM0B 2V9TA 4GG8A 1YNTA 5CINL 5BVJB 4PRNA 4UOW1 3V5HA 1A6UH 2D0GA 2VLRB 1BD2D 3PG2A 3UX9B 5JLZA 4K2UL 4NKDA 4AQOA 3BI9X 4XNUH 3QRGL 3KDMA 2B1AL 2H2PD 1KEGH 1F8TL 1NCBH 3HPLA 1N7ML 4UT6H 1BBDH 4FQXD 1GAFL 2X4SA 1MI5B 2A6KA 3I6LE 4EN3C 1KELL 2PR4H 4NZRL 1A0QL 1ZT7B 4KK6C 3DV6B 2OI9B 5FK9B 3SOBH 3D6GA 5HGAB 4L3EA 3T8XB 1UB5B 2A9NH 4ZS7L 1UGNA 3QB7C 2YBRB 2DLGA 3ZE1F 1CZ8H 4ZTOH 1F11A 1QBBA 3LB6D 2VZ1A 4FXGA 4EN3A 4ALAL 4EIGB 1BZ9A 4ZFOA 4JY4A 5JIHA 2GTZB 3QHFL 5HHMB 4G3YL 1NJ9B 1EEUA 1RULH 2KKQA 4XNYL 3SDXF 4P5MB 4J7RA 5JORA 1CLOL 1MCEA 5ESVB 4HWEH 2BNQA 1A47A 4MMZC 1HWHB 4S11A 5CGYD 5KS9A 5IQ7H 3SO3C 4OZIB 4M9OA 4JRXE 1A6TB 4U1GC 5DUBA 1GZQA 4K8RC 3TCLB 2W1NA 5IR1A 4YHLL 2PXYD 5I1CL 4OGAD 1MAKA 4Z0BH 2CLRA 5DRNA 5C08D 5DMKA 4LCWD 3BAEL 3VRLE 1QRNB 4X6CE 5GZND 2WWMD 3X14B 3KYMA 3JUYA 5B38A 4QRUA 4NN6C 4P4KC 4QHNB 4K23L 3ULVD 3NCJL 2BRRL 3FOMA 3L5WA 4Y1AD 4WFGD 3BKCL 5FDYA 5IW1B 4WU7B 4NZTH 2V2XB 2B39A 2D7OA 3OKLA 3FCTA 4ZODA 1NFDB 1HSBB 1QSEA 1I9RH 1YEJL 4P4KA 3O4OB 3MV9B 4OQTA 2JCCE 5JDJA 4YIQA 2I60L 3CSGA 4QRPE 1W8NA 3TO2A 4JJ5B 1HI6A 3MRDA 5IBUG 5F9WC 2JIXB 4FTVE 3VXPA 3GKWL 3MBEB 3K74B 2IPTH 3C8KA 2ED8A 3L3HB 2CK0L 3KPSE 4H88L 5SWQB 3FO1A 3C60B 3W0WA 4ODTH 2YD5A 2VLJA 3UPCA 1RZGB 2XTJB 1IGTA 2ZWLT 3QI9D 1L0XA 4X7EC 1U0QA 3LS4H 3RX7A 3D9AH 1F2XK 2XT1B 4NO0B 4RDQF 4KVCL 4BFIA 4PV8A 2R2HA 4CMMA 2VLKD 2WUCH 4PGCB 3U6RA 4K2UH 4DGYH 4XX1G 5ADPL 4DEPC 4Q9RL 3RGVD 2OTUA 4JFDD 1NGYB 5L8JB 3MLXH 2A74A 4LARL 5FKAB 1O0VA 1TIUA 1KELH 4MNQD 4NZRH 1A0QH 2NY4B 4X9IA 1ROWA 5LBSH 4PJIF 4CMHB 4GUPB 4HUKB 3D25A 4Q0XH 1U36A 4K7PL 5E8EA 3EJJX 3QQNA 5I71B 2CSPA 1WCBA 3A6OA 3EBAA 3O3EA 4NN7C 4ALAH 4ZTPH 2ZSVB 3HC3L 4X9FA 1XGUB 3QWOB 4G3YH 5HBBA 3TYGL 2EDBA 2PCPB 3BOVA 1S7WA 4U1LB 4XNYH 1ZLSL 1XR8A 2DLIA 5JOPE 2XN9E 3MZGB 2WANA 4MJIB 5EB9A 2DL2A 1MCPL 4YHLH 5HDBE 1MCFA 3VRIB 3VDAA 5HPMB 5I1CH 1RUPH 4X5LA 4KU1A 5CEXB 1OAYL 4NCDA 2WUBH 4M1DL 3NIFF 5ICXB 1B3JA 2NY1B 1KENH 3E3QE 4LSRH 3FRUA 5D7JB 3QIWD 2OL3B 5L2KA 4HUXA 4K23H 2AJZA 3NCJH 2X4NB 3MTRA 4OSUL 3HZKB 1EXUB 5DA0B 3WFBH 1DTUA 5HXMA 1K8DA 4YAQA 3DI2B 1NEZB 1IAMA 3Q6GL 5GRZA 4HIHA 3CSBA 3W5MA 1AO7D 4JZJC 3RAJL 4JO1H 4OGYL 2I60H 4LRNL 1REIA 4I48A 4KHTL 5FYJU 2BERA 1MLCB 2APFA 4D0CB 5IVNA 1M71A 2OBGA 1MHCB 2CUIA 2UUDK 1GIGL 4GBXB 2JB5L 1EFQA 2VRAA 3QO0A 3GKWH 5E9DB 3V4PH 4Z77A 4JZJA 2VKWA 4GS7C 1B0RA 1QR4A 3O3DB 4NWUL 1ZGLA 3U9UB 4JN2A 4FQQB 4P3CL 4PD4K 1PKQA 5E1AA 3TBVB 5FDWB 4RGOH 3PP4H 4YDLB 4G9FD 4PRIB 4HCRL 1E4JA 2DQJH 3UJIL 3SJVE 4HMEA 2NY6D 1UZ8B 5BZDB 5JW5B 1JE6A 3Q0HA 3QZWG 1CDHA 3EYOB 1X4XA 4OZHA 1OM3L 3MV7A 1TITA 5KW9L 2BSRB 1M6OB 2G75A 1P4BL 2ITCB 4XP6H 4PG9A 3BWAA 4NNYB 1BLNB 4NDMB 5E4EB 4NQEA 1H3GA 1VPOL 2EDJA 4FQCL 3TT1L 4QGYA 3KR3L 3V5DB 2GQHA 3OAUH 2ERJC 1S3KL 4G7YL 4WFFE 3U36B 3DROA 4JFFE 2HTLD 4U1SA 5J3HC 1TJGL 3CVHH 4U0QB 3TYGH 3DX7B 3R4DA 4XCEB 4PP1D 1UKSA 1ZLSH 1BFTA 3CFCL 4JN1L 3EZ8A 1CE6A 2X40A 5FECB 3GNML 2ILLA 3FQUB 5F6HI 1YEHL 1NQBA 1GZPA 4HHAB 4XPBH 5LAXA 1U92A 3OJDB 3CFEA 3FQTB 1FO0H 4UNUA 2PN5A 3DRTA 5CD5C 1HHJB 5D71L 5T1LA 3P30L 1J86A 4HZLA 4HJ0C 2B1HL 3RNQB 1RZJH 3U1SL 1TDQA 5IBTL 4TVSa 4YQXL 4JKWA 4GRMA 1NLDL 5I74C 3QUXD 4RAVA 2YXFA 4IEFB 3NACH 4F8QA 4OSUH 3QDJB 4LVNB 4M6ML 3CDCA 4NO3A 1FCGA 1HILB 2JLLA 5F7HA 1NGWA 1LEIA 5DC0A 2AJXL 3Q6GH 5IHZB 5FYKD 4IDLA 1JZ5A 5D70L 2IPUG 4MD0B 3GI9L 4BFGA 3F5WB 4S0SD 2GJ6E 1D9KC 1WBZB 1S9YA 4OGYH 3RZCB 1S9WB 1ZA3B 2OYPA 4XPAL 1T21A 3Q5YA 4APQA 1QLRA 1H15B 5CEZH 4OFVA 1GIGH 3GUTB 4WGVB 2AGJL 2JB5H 4XAWL 4WNQB 1PYWA 4KY1H 1D9KA 1UEMA 2ZG1A 3WFEL 5DJZB 1UQSA 4QT5A 2V5MA 4KXZI 3WBDA 1VCAA 4P3CH 1UWGH 3QXAB 3G08A 4QXGL 4XBEL 1KFAH 4PJ9D 3GHEL 4L4TA 2ZCHL 3JV4B 4HCRH 3V6ZB 1AE6L 1C1EH 1MJJB 3U46A 4QOKE 4K3EL 1D6VL 1U95A 4NZJA 4PJHA 2F54E 2YD3A 4PYHA 1OM3H 2BDNH 4RAUB 1RZFH 1U58B 5T1KA 3HTLX 3VFPA 5KW9H 3DIFA 5CIPH 4PJBE 3CGTA 2AEPH 4HK0B 3F58H 1MUJB 1DLHA 1U3ZA 4PRDB 3TNMB 2V2WB 4HZAA 3U7WH 4OIIL 1KYOK 1VPOH 5JHDB 2DQHL 1WUNT 3M17A 3SDYL 3IU4L 1N3NB 2DM4A 4DGVL 1S3KH 1DANT 3MRHB 2D7QA 4DJMA 2AEQH 3U7YL 2O5XH 1KXVC 1EVUA 3IDYB 3O8XD 3TH3T 2Z9TA 1LP9E 1AGCB 1B6DA 4KAQH 3T2PA 2NY0B 5FB8A 4D9LL 1CXIA 3PGFH 4D0DB 4JR9L 4B5EA 4Y8AA 1BVKB 4ODUA 1G7PB 1IAII 5EFIA 3N85L 4ELMA 5M94B 3RL1B 5D71H 3VWKB 1N59A 4X7SH 3TIDA 5ESAA 4JM4H 2P5EE 4X5XB 4Y5YB 5CJOL 2HFEA 5IBTH 2HN7A 3IF1A 4YQXH 5D7LD 5DLML 5IFJA 1AKJA 1V7NH 1ZHNB 2CUMA 4U6XA 1QUNA 5ISZD 4L8DB 4N1CA 3GJFA 2E3VA 4M6MH 3IKCB 4HPOH 5IB5A 4LAQL 5T3ZH 5JZ7D 3ULUC 2JK5A 2GKIA 2AJXH 4AK1A 4Z7VA 3MV11 4GKSA 4HIXL 4JFZL 4P9ML 5C07E 5AYUL 3BSZH 2VDRH 3D85B 4ZO8A 3SKJH 3D39B 3LEYH 2EXYD 4PRAB 4WHDA 1OF2A 3OWEA 5AUMA 2IH1B 4O2FB 4H0IA 1Y18B 3EO1B 4AJ0A 1B2WL 2DMKA 3DARA 1MAML 1YEDA 4LSPL 2AGJH 1G6RA 3I6KB 3LQZA 4XAWH 1CL7L 3C09C 4QHKJ 2YPVL 3NFSH 4CVUA 5IGXL 5KVEH 3AGVA 4EXPX 2EDNA 5HSFA 5HHVL 4XBEH 1I3VA 3S96A 3GHEH 3L7EA 5DHVH 5F1IB 3MNZA 5BRZA 4HKXB 3T3PE 4OD3H 3P4LA 5D1ZD 1S7UB 4QHMA 4BZ2L 4K3EH 5HHXL 4LSUL 3MUY1 4RIRB 4Z7NF 4C56D 3HUJA 3QIUB 5CBAA 5EO1B 1MWAB 4R4FH 3B8SA 1ZSDA 4KUZH 4E41D 4L4JA 1J8HB 1A1MA 2C7UA 1LO5B 4NKMA 4N5UA 5E8OB 4OF3A 4MMXC 2HTKD 5JDSA 3BJ91 4TTGA 1SJHA 2ICEA 4RGMC 4JANB 1QKZH 5JPMB 4AMKL 3QFJB 4CADA 1TZIB 3BP6A 3SDYH 1FP5A 3ETBF 3OB8A 4MQXD 3V2AR 5GSVB 3G6AB 5GRXG 1IGCL 2FDBP 4NN5B 3U7YH 2JB6A 3PJSA 4Q6IB 1YEKH 2LTQC 4M43L 1ZT4B 3AFLA 3LVEA 1OCWH 3DO7A 3C5JB 4YDIL 2NZ9D 3HZVA 4XCCL 1IC5L 2MHAA 1L7IH 4K3JL 5D1QC 3VXUE 5CGMA 4D9LH 4IHOA 4XZUA 1C12B 4IOIB 4I0PC 4WEUD 2F58L 3WHXA 4N0UB 4O02H 5ID0B 1G9ML 4PBVC 3I02B 3VG9C 3MR9A 2FJHB 2VDMH 2EKSB 1C5DA 5D1QA 3CZFA 1HOCA 1CFNA 2HLAB 4I0PA 4OB5L 4OJFL 3KPQB 5MERB 1ZT1B 5SWZA 3GSOB 1BOGB 5KSAD 4G8GE 4TULH 3REVA 4P9HH 2CQVA 3PWUA 4CVZB 5TE7L 4LAQH 3GKZA 2H41A 1MPAL 5FHAH 1JUFB 1CR9L 1F6LL 1RJZB 1WBYB 2YEZA 2JJUA 1BM3L 3IFPB 3U0WH 5MP6L 1EJ6A 1G9NH 5F96L 3L3KA 3IRPX 3FB7B 1R3HB 3ILPB 4ZPTB 1I7ZB 1MFNA 1MRDH 3CX5K 4AG4H 5GZOC 2J8UA 5FXCH 4LSPH 1OP3H 1IL1A 3IXAA 5DD3L 4LCCC 4ONHB 5C6WH 1CL7H 1FDLL 2G9HA 4XCNA 5CJBA 3ZTJH 1G7JB 2NTFB 3CMOL 3IDIA 1FIGL 5EPMA 1KB9J 3MACL 5EZOL 5HHVH 3LKSB 2HJLA 4LCCA 2BVYA 5IB3B 3FONA 1QLEL 1EAPB 1Z0MA 3T77B 1DSFL 5FAAA 3B9EA 4BZ2H 4QRSA 3GK8H 2HT2C 1MREL 2E7MA 4KI5F 2FJGB 1MI5A 5ETUB 3UCRA 1ZT7A 3RWJB 3MA9H 3LKQB 5FK9A 2YRPA 3T8XA 1YUHB 3RVTD 4YHNB 5IMKA 2VLLB 5DD5L 2YBRA 5IT2L 3VDBA 2GTWB 5CBEB 1EHLH 3VXMA 4GRWE 4FG6D 4RGNB 4PJCF 3OZ9L 5J13C 2VL5B 4P59H 2DLEA 4ZG1A 3MRRA 2NXZB 2P42B 3P77B 5ANMB 2CMRH 2PYEA 4JDZB 5DSCB 3FT4B 4WW2F 4AT6B 1SJEB 1ZVSB 4K3GA 4PGEB 4G9DB 4M43H 4F7CA 3A6CL 3ARED 5CJ8A 3TCLA 4KJWC 2OQJA 2O93L 4XCCH 5CD3A 2W0FB 4K3JH 1IM3A 3N0PB 4DOHE 4R7NB 2BMKA 3MFFA 3P3YA 2VR4A 1YZZA 2DRUA 5MI0B 2N56A 4OB5H 3VWJB 3SBWC 3DOSA 3R06A 5E03A 1RAMA 4RMSA 5J06A 3RIFF 2JELH 2V2XA 5HGHB 2Y9RT 3CCHA 5C08E 5ALBH 5CEYB 1RK0B 5BOZG 1W0VB 4UINH 3OTTA 3QUMB 1KC5L 4KZDH 5HY9A 5D2NC 5TE7H 3SBWA 1CIDA 5I30L 2OTWB 2YPLD 1TLKA 4IOFD 3RU8L 5IG7A 4ZYKA 1A3QA 3MBEC 4S10A 3A0OA 1CR9H 5F7YC 1JNLH 3ZKXB 4Y5XC 3D0LB 1BM3H 4U7SA 2X42A 3UAJD 5D2NA 3D3VD 5H94B 2JIXA 4FXKA 5FOJA 2BVQA 3MBEA 5IUSA 4EQ3A 1UM6L 3H9SA 4Y19D 4Y5XA 3MOAL 3VGGA 1CGWA 4U3XA 4P4RA 1RZKC 3E8UH 4F9LC 2VLRD 4AYFA 5EH1A 2F53B 5T33H 1EPFA 2W65A 3MACH 5I6XB 5EZOH 3IETB 1Q94B 1BP3B 2CGRL 3CPLA 4F9LA 2CKBH 1OLLA 1F3DJ 2FZ3B 4RNRB 5B39A 1K85A 4E5XB 4M7LH 4CMHC 2EH7L 3C9NB 1IAKB 2UZIL 4A6YB 2AV7B 1A6VH 1MREH 4XNXL 3QUKB 3GMNA 4OCLC 4JB9H 5FKAA 4K3DL 3BZDA 4JKPL 1MCOL 2A83B 3G04B 1CWVA 1LO2L 4LLMB 1UWXK 3QPQC 3EJYD 3VFNB 5HHMD 2ORBH 5J11B 2Y36L 3BPOC 3BQUB 3GSXA 1XGUA 3OZ9H 3QWOA 4MHHG 3TO4C 1P6AB 4L3EE 5TDPA 4MNQE 4DCQB 1QBML 3FN0L 1CGSL 1KG0A 1OAXL 4U3CA 1QVOB 3BUTA 1OT1A 4EI5B 3TZVC 4AEFA 3MRFB 5I1AA 2Y5TA 5KS9E 2NX5D 4BQBA 1QRND 4RX4A 1IKFL 2R1WA 3TZVA 4BKLA 1CDYA 3UC0L 4G8FA 4LDLB 1QRKA 4QRQB 2AJSH 3P73B 3QXTA 4UBDD 1YPZF 2IGFH 3JVGC 4Y4HC 1I9IL 2BSSB 2A1WL 4XVUD 3HZKA 1EGJL 2YOCA 3BZFB 3CC5A 4GG6E 3DRQB 3MV9D 1T04A 5EBLB 4EOWL 1KC5H 3JVGA 4Y4HA 1INQB 3RU8H 3DVGB 4S1RL 2VZSA 4O51A 1QSEE 1MLCA 4D0CA 4H5SB 1OL0A 2EDDA 3WEXB 3FOLB 2VWEC 3MLYH 2R1YB 4XP9L 3C60D 4EUPG 4M48L 1M7IB 1QA9A 4JZNB 5D7SH 2XTJD 4HUWB 1XFPA 1UM6H 1AH1A 3EYSH 4MAUL 3MOAH 2X1XR 4NO0D 4ODVH 5IJKC 4FQQA 1T1YB 2DLFH 3IU3B 3BIKB 3ZYIA 2RR3A 3MUGA 3OR6B 3H42H 2R0KH 1BOYA 5BQ7B 3W0WE 1QPXA 3S97C 2DAVA 4GAGL 2VLJE 5DJXA 1QO3B 5IJKA 2W9DH 1TJIL 4IRSD 5BZDA 1NAMA 5C0CA 2KPNA 1YYLH 1TVHB 3EYOA 2LAGB 4DVRL 3PQYB 3MRQB 1NL0L 2NY4D 2BSRA 4Y16C 1YN6B 4XNXH 2VIRB 3QWQB 1M4KA 4OCSH 1S9VA 4JKPH 4NNYA 2IAND 1LO2H 4UV7L 2ZUUA 4PTTA 4DTGH 1E6OL 1G84A 1OW0C 2CXGA 4Y16A 1QFPA 4RBPH 1DLFL 2A6IB 5GS1B 4JPWL 5CAYB 1LE5A 3MLTA 3V4UH 2HH0L 1BEYL 2YMXL 3QDMA 1X5GA 3S88L 2ZG3A 1VFAB 5F1NA 3DX7A 3VU2A 3MO1B 4MJID 3WUWA 1DQQB 1OAXH 4P23C 1MLBA 4EZMA 2MCPH 2R23A 3FQUA 3WLWD 3BP7A 5KAQF 4PUBH 1XGQB 2FB4H 3FQTA 4L1DA 1IGIL 3ZKQD 2GK0B 1J0YA 1FVCB 2NY1D 3N1MC 4JFEB 4P23A 4P5TC 3NBNA 2CDGA 4LVNC 1QZ1A 3KPNB 4XI5D 5D7JD 5L0QB 3R0NA 4AENB 4PJGE 3DVFA 43C9A 2VXSH 4P5TA 2X1WL 1I9IH 2VDLL 5T3XD 1EGJH 1PG7L 2FSEB 2GJJA 3VFTB 3TBSB 1D3CA 4YO0A 1BD2A 3C8DA 3FT3A 5L2KE 3ZTJG 3EYFB 3QNXB 1MJUH 4LSSL 4HFWB 2WW8A 4L4VB 5IVZB 1HEZB 3H3KA 3R1GL 2EE2A 3F5WA 2VXTL 1WBZA 3PL6B 2W92A 1QSFA 4GBXD 5E9DD 3PDOB 4KK9C 1F2QA 1KJ2L 5FYLH 2Z0BA 3LN5B 5KSVA 5FYKE 5I75B 1XF2B 1YDPB 4WNQA 4NPYA 4XPGL 4OUUB 4JDTL 1XIWC 3IDNA 4QRRD 3KLAA 2OXGA 4MAUH 5E5UB 1IBGL 5E00B 4PRID 4U49A 3QXAA 1ORSB 5DJAA 3G5XA 1VENA 4NBXB 2RIKA 4EKXA 4LEXL 2VDKH 2Z4QB 3NZHH 1XIWA 4G80B 3WMSA 5TPWH 5IMMB 1PKQE 1QP1A 4LHUG 3RWDA 5HI4C 2L4OA 4Z7WB 3KVQA 4F3FB 5IJVA 1D5MA 5FGBC 5GGSA 4LMQE 1RUML 5GHWL 1MY5A 3W9EB 2E9JA 1F4XH 3BXNA 1NL0H 4P2RB 3T4YB 4OZFH 2R29H 4OQ1A 2ZG2A 3RRQA 1T20B 1T0NA 1OLZA 2H2SC 3KPTA 4BH7B 1PZ5A 4OZHE 3UTQB 1QG3A 4PRDA 4KVNH 2V2WA 5FGBA 5C0IA 2AJ3A 3MV7E 1RIHL 3DX9B 3B5GA 4XPFH 5DUPL 1QFWM 2IH3B 2XKSA 1HH9B 1T22B 4QY8B 4XNMA 4PJFB 1OWRM 3U2SA 3IXTA 4JPWH 3CIQA 2HH0H 1BEYH 4NQEE 4RRPA 5I1KL 3H3PH 5KBNC 1WZ1L 1U8KA 2ESVB 1DDHB 1DUZA 4OBSA 5E08L 4NOBA 2H6PB 2VL4A 2ARJB 2NMSA 1AGCA 4OZ4A 1MHEA 1RHHA 5ERWA 4ETQA 3QSKB 4OKVB 5KJRH 1FSKC 3CXDH 4D0DA 3BHBA 4TTDC 3L3IA 4XBGA 5GGRB 4HDIA 4R2GB 4U2YA 3OXSA 4TPRL 4PFEA 1EHXA 1MFEL 2CIIB 4KHXL 2X4PA 3VG0L 4G42B 3V7AG 3QDJD 3EOTH 4YHYB 1ZHNA 1A6ZB 3ZKMC 1JZ7A 1GGYA 1JTPA 1FJ1A 1G7HB 5JW4Q 1LVEA 3O45B 2MQ3A 1PG7H 4MX7B 5EU3A 2IMNA 4LSSH 3RZCD 4MDIA 5IHBA 4N0CC 4X9BA 3P11H 1FQ9C 3T0XA 4DKEL 2IH1A 4F33A 3HA0A 3EO1A 5KSUB 3N1QC 2EDHA 2AP2A 1J7VR 3L3DA 3H7BB 2DI8A 1JPSL 1M05B 1XCTA 4P3DB 4RZCA 2XY2A 2F19L 4X6DF 4HKBB 3ARBB 3RWFB 3VA6A 3L3OB 4HH9B 1IBGH 3UBXG 4M7ZB 3TJHC 3O3BA 2QV2A 2Y6SC 3VMPA 3V79C 1ED3A 3BKMH 5F1IA 1EA9C 2R8SH 2VYRE 1NMBH 2GFBB 3HMXA 4KWUA 3ZE2E 3MOBL 4HWBA 4QYOB 4P49A 3A67H 1S7UA 4JPIB 3IFLL 3SQOH 1G0YR 3B9VA 2FJFB 3QEHB 4L4TE 4WDIB 3UTZA 2FIKB 2GITA 1WJ3A 4ETYA 3CFKB 5GHWH 1CXEA 3DVNA 1LDPH 1RIUH 5T5FH 1GXEA 4MGXA 1HE7A 3TBYB 1C5BL 4PJHE 2V9QA 1LO5A 1U8IB 2QSCL 5LGJB 5JHDD 1TZHB 4NN5C 3VMOA 5E94A 4DZBB 2LVEA 5DUPH 4KPHL 4KKAD 4C58B 4F7MA 4JVUA 4F7EA 5JPMA 5C0BB 2ZUWA 5D9SB 3ZL4L 3ILQD 5GXBB 3RVWC 2G60L 5HHNA 4V1DD 5I1KH 1NDGA 1NBVH 3BPCB 4Q6IA 3JTTB 4NKIL 1KCSL 3C5JA 3GIZH 3TN0B 4YDJB 2X1OA 4IRZH 2WBWB 4U6HA 4HIIA 1C12A 3VWKD 1KIQB 3BEWB 1JWUA 5TFSL 1DR9A 2PO6C 3NN8A 2XA8H 3MRKB 4JGJA 3IDGB 4TPRH 1CFSB 4KHXH 2HLAA 3PXJA 3VG0H 1S5IH 2E6JA 5B4MD 4ELME 3OG6B 1PEZA 1BOGA 4FQHA 2PO6A 5F9JA 3S98A 1EBPA 1CS6A 1CXFA 3VGAB 4Z7UF 1S78D 4TOYH 1IEHA 1RU9L 2ADIA 5FO8B 3D85D 5GRVK 1JUFA 3MLUH 3ARDB 1MFAL 4LKXA 2ZKHL 5GJSL 5C0GB 1WISA 2Q20A 3Q6FA 2BY1A 3CFJA 1FGNL 5FYJD 1B4JH 4DKEH 5FCSH 4OFIA 5CGTA 3V0VB 2YN5A 2I07A 4ZPTA 2VLMD 4JFOA 5DMGD 2AABL 4ONHA 2VISB 2AJYL 2NR6C 3BKYL 1EHNA 1IEBB 2NTFA 1AC0A 3MNWA 5E7FA 3X11A 4PLJD 1R24B 5TH2B 1FLRL 1DBKL 4PJ5B 5F3HB 4OV5B 2COQA 1MHHB 2WIMA 1EAPA 3VI3F 3GRWA 4NQCA 3T77A 4WGWB 5I1LB 2E7HA 4U1KA 1UM5L 3NA9H 2GCYA 3HE6B 3QIUD 3T2QA 3WN5B 5BRZE 5M95B 4R26L 1ACZA 5HYJA 2DBLH 1J8HD 1FL3A 2Y07L 4RGNC 4HC1H 1UA6L 3LKQA 3BKJL 4X7CC 1A02N 3NIGE 3M07A 3U79A 2OK0L 3HUJE 1GGUA 4KV5E 1WAAF 2ZUXA 4KPHH 2VL5A 5KSBA 5HHPA 2WLYA 2W07A 3RDTC 4P57A 3VRLF 2G60H 4X6CF 2D2OA 4ORZC 4QWWD 3W5NA 3HLAA 1QFWL 1ZVSA 4PRPB 1VEMA 4NKIH 1Z3GL 4HXBL 3GZKA 4JQXC 3RDTA 1GRWA 3RNKB 4LLYB 1KF9B 3STLA 5BMFL 4GRWH 5MI0C 3B9KC 2QSVA 3VFWA 2O61B 2Y25A 2Z35B 5TFSH 1V3KA 4GKZB 4OTXL 3QG6B 4LLAA 3BN3B 1Q9OB 2JCCF 2WBJC 4JQXA 5A16B 4YDKL 4O4YH 3T0AA 2FEDC 4PJ9C 4ZFOL 1W72A 1OOAA 2KQMA 3B9KA 3BD3A 3PABB 4PJ7F 2R9HC 4MNHA 2ZUQC 3L95A 5ACZA 4HX1A 3PWNA 4X80L 1NLBL 5EORL 1AIFB 2WBJA 4DW2H 4DAGH 4YE4L 2F74A 4OZGB 4J8RA 4DUXA 1MCDA 5DJ6A 4XMPL 3PWVA 4LCUB 3FN3A 3V6BR 2E9WA 2HYMA 2ZZUT 2IBBA 1PSKL 4HF5L 1HXMA 2YC1A 2GJZB 4QXWA 2X2YA 4XBPA 4RISL 2A38A 4X7TB 4J3OC 4K8RL 1FGNH 1I8MA 4ZFFB 4HKZB 1T2QL 2FLRT 4LK4A 1YC7A 4BK5A 1H8NA 4NO5B 5EBMA 4A2LA 5E6ID 1LWRA 1VESA 3VH8B 4YFLF 3ULVH 4LSTH 4OZFG 2H32A 5TQ2L 3RIFK 2J8UE 2DQUL 2F5BH 3AU1A 1PDKA 1IM9A 2XWTB 2BY0A 1N0XL 4OQTL 5HYQA 2DOCA 4EVNA 5IK3A 3TYFB 1DQMH 5I8EA 2FZ3A 3KJ6L 4RFNC 2XG4A 1RD6A 1FNGB 4ODXA 1RUQL 1CU4L 3FO0L 4OCMC 4YBQD 4H8WH 1ZV5A 2ICWJ 1T2XA 4AEHL 5DJ2B 3RX5A 5EIIB 3G5VA 1CLCA 5CFHA 1U91A 5IV2B 2OP4L 4NQTA 4JRXB 1UA6H 5FO7A 1I8IB 4LLMA 4CKVX 2XPGB 3BKJH 4NCC1 5EIQA 3UTTD 5DDHA 3CLFL 1KTDB 3MGTB 43CAB 1MI5E 3UEZA 3EFFA 3MUZ1 2NXZD 3QRFM 1KB9K 2FX7H 1G7QA 4KKBD 4NWTL 4CBPA 1LEKB 5E2VH 1ND0A 3WS6C 2CXKA 4NRYA 5D2LB 1VDGA 3SPVB 2Y06H 4ZFGL 4X6CB 5GGVH 4ERSL 4EBQH 5KVDH 4D9QE 4JPVL 3VXME 3KXFB 3WJJC 5HHME 4QXUH 5DC4B 2G5BB 1EBAA 1Z3GH 4OF6A 3WS6A 4UOJA 4KKCC 2X7LB 1BREA 2BVOB 3E0GA 4P46D 5GISL 3LS5L 4PJAB 3RL2A 4NYLB 4OZIE 5BMFH 5DUML 3WJJA 3NFPB 1TMCB 3VJ6B 2BCKB 3D69B 3FFCA 5B39G 4IS6A 5FM4A 3VWJD 4JREB 3DUSA 4HUUB 2EE9A 5I1IL 2BVTA 1JCKA 3MRPB 2D7PA 5B22A 3P4NB 2HJKA 1NLBH 5EORH 2NY3B 3BDBA 2ADGB 3X13A 4FZEH 1GC1L 2EDKA 5IHUH 2PW1A 3NTCH 4I4WA 3K2UL 1UXSA 4M3JA 4JAMB 4RISH 3QJFA 3EO9L 3KJ4B 3FOLA 2Z31C 1AR2A 1U6AH 5C9JB 1T7ZA 1M7IA 2VH5L 2P8MA 4PBXA 2D7MA 2OLDA 1LE9B 5DGRA 3LPFA 1JGVH 1N2RB 2F53D 4LRIC 2Z31A 1E4WL 1KNOB 3U48A 4TUJB 2DQUH 4M1CC 3H9SE 5DJ8A 3GBLA 2BHZA 3TBTB 1QO3A 4KJPD 1D5ZB 5FYKL 3DXAB 4LRIA 1JP5A 4UIKL 5D7KE 1V3MA 3DGGB 3RWEA 1D6EB 5J12B 1QBLL 1CU4H 3FO0H 3SKNB 5CJ5A 2FD6L 4AEHH 1CL7I 3ZKNC 2XZCL 1C5CL 2WM0A 4NNPL 2C1OA 2XN9B 1DBBL 3HI1B 5J9PA 3LD8B 3G5ZB 2UV3A 3PGCB 3K81A 3BJLA 3BQUD 4LF3B 1CGUA 1TETL 3T0EB 5GS3A 4ODBD 1HKFA 1JV5A 3TH4T 4NWTH 4ORGA 3J7HA 2VNCA 4I3RH 4NKQB 3RVXC 4PRBA 1MJ8H 2CJUL 4U1JA 3O81A 4JQIL 2ZOKB 3KYKL 3OF6A 4ZFGH 4LPYA 4EI5D 4ERSH 1CDJA 2QQQA 1A6WL 2J7LA 4UNVA 3DYOA 4JPVH 4NFCA 2D4FA 4C4KT 5J1AB 3MODL 5EWIL 5GGUB 4KQ4L 4MDJB 4U1MA 5GGTA 1V8HA 5GISH 3LS5H 1EV2E 2GK0A 1B0GB 5C0NC 3HNSL 5DUMH 4NRZB 3HC0B 4JKMA 4MJIE 4X6EB 3RUGA 3I50L 4FFVD 4J3UA 5TJWK 5EC1B 2ZNWA 2A73A 3A6BL 5DT1L 4XVSH 3F12A 3VFTA 4HIJB 1I4FB 1BWMA 5T1MA 2V2TB 2O5YH 3EYFA 1GC1H 4PRHB 4HFWA 4L4VA 1WV7T 5T3XE 1HQRA 4IDJH 3LHPL 3MXVL 4FQIL 3GHBH 1ACYL 3PDOA 4HWZB 4M03A 3U30C 4FG6C 3EO9H 5EUOF 3LH2L 2FWOB 4N5ED 2VE6A 1LEGA 2DS4A 1D5BB 5E00A 1NAKH 1E4WH 3Q48A 4M7JL 1XF5B 5TF1H 4G80A 2ZUTA 1FZOB 3LV3B 4QF1B 2VWEE 5HYSB 1A7RL 5FYKH 5E2UL 3RA7H 4FN0A 3PQYD 2ICWB 2A6JA 1G7MA 2EYTA 2WBKA 3Q3GA 3U0PA 4RMRA 3RWHA 3JXAA 4KGLA 3LEVL 1ZTXL 3EW3B 5D7IA 4JFFB 2W0PA 2FD6H 3P2TA 4YHKH 5AD0B 5C0CE 2BC4A 4YXKH 2XZCH 1C5CH 4JM2C 2FGWL 3BDXA 1P4LB 3DYMA 3WNMA 4K9EH 4HAFA 1I8KB 1NCCL 3RJDA 5A3ID 4HGWA 3JTSA 2Q76A 4LCYA 2IH3A 1JGEB 4NJ9L 1YECL 1C08B 1SY6A 3E6HA 2HKHL 2AK4D 4IOFC 4B53A 4XC3H 4JM2A 2A9ML 5I8KL 4MS8D 4HMDA 4X9HA 2CJUH 4JQIH 3ZHLA 4XRCB 2ESVA 3KYKH 5L2JA 1KJMB 2NXYC 1AGFB 3W9DB 3UBXI 2XZQL 4I5BB 1DE4B 4HQQL 3QDME 3TPKA 3HE7D 4OGZA 1JK8A 1P53A 4ZAKB 4JFED 3B5TA 3QAZB 5DR5L 1PFCA 4IIQC 1P2CA 4BH8B 2AQ3A 1J05A 3WHE1 5E2JA 2CIIA 1JZ8A 3I50H 4YFLI 4WWKC 4OBRA 5DEFA 1F6FB 5GS0C 1CBVL 4KDVA 4IIQA 5EBWA 4IRJB 1PBYA 1SVZA 3NMEA 1FC1A 1G7HA 3L5XH 3LSOB 1E27B 4FA8A 35C8H 3ROOB 4WWKA 3FZUD 1N64L 4PJDA 4LBEA 4FNLH 5EO0B 3O4LA 1YJDL 3ARGC 2QQLH 2V5SA 4U1HA 3PL6D 3QDJE 4DKDC 1R3LB 1KPRB 1MNUL 4OI7A 3LRGA 4JHWH 2GAZB 5DWUL 4RRPG 3QCTL 4G5ZL 1K4CA 4KROD 1LILA 5JR1L 4LQFL 2J6EA 3ARGA 4FQIH 3VFUB 4WTZG 1ACYH 4J4PC 3WS3A 1YEIL 4HT1H 3GBMH 2EC9T 1MEXH 2A77L 1NGXB 1NDMA 1QSFE 3PDDA 3P4MA 1UYWL 2J3SA 1OSZA 4TSCL 1N6QL 2DBJA 2RBLA 4J4PA 5AZ2H 5AEAA 4CW1B 4PJBB 2EDQA 4Z0XB 1PJ9A 3KNBA 2FR4A 1BQUA 2PTVA 5C1MB 2BOBB 1NCWH 2GFBA 3F62A 1IARB 1L7TL 2VZUA 4YHIA 3KGRA 2AJVH 1U8LA 3FQWB 3ULUL 2FJFA 3N06B 1HSAA 3HB3C 4P2RD 2FIKA 3RI5K 3MYZA 2LABA 1BQHB 3L5JA 3NPSB 4AIZB 2NTSP 1ZTXH 3MCLH 3MREB 3VFSB 1G6RL 4H1LA 3WIFB 3LQAH 3RY4A 4KKLD 2BVPB 3MRCA 1E4XL 1FPTL 1LP9B 1U8IA 5LGJA 4YPJA 2X70B 3HPJB 4C57C 4O9HL 3WLBB 3LRSA 4DZBA 3L6FA 4MVBD 5FA4B 1S7VA 2HKHH 3IJYB 1BBJB 3SDCC 4ENEC 1I1CA 1NMCC 2EYSB 2Z8WC 3BDYH 2X5PA 4HJJH 1KIPA 4YBLB 5E56A 2EIEA 2GEEA 1U8OA 3SDCA 1A22B 1OQOA 2C26A 4YDJA 2XZQH 3UXFA 1YQ2A 3IJHB 4HQQH 5MEQB 4R2GD 3KPMA 3QEUA 1T1ZA 4U33A 1KJ2B 4JFYB 3BEWA 4OIBA 2EXWC 2XWBA 5F7LB 4OD2B 1YEGL 1CLYL 5DR5H 2MWCA 4L9LC 4AH2A 2Q6WA 4N0FB 4UQ2A 1J11A 3M1BB 3OXRA 5B3NA 5A1AA 4ELKB 2JE8A 4KK5D 3ZTNL 3AAZA 4JFPA 3UO1L 5DZOA 2VERN 4L9LA 1U42A 4IRSC 1XZ0A 5EU5B 1CBVH 2HVKB 2V5TA 5DJ0B 1DN0A 4IRSA 4OF5A 4HS3B 4P2OC 1A6PA 1EK3A 1YJDH 2Q7YA 1MCQA 5CUSL 5C0GA 3VXOB 3D87B 3FB6B 3O9WC 4H25B 1JF5A 1U8NB 2APTA 3G6JB 3QCTH 3I2CL 1OP3K 5JR1H 4P2OA 2AEIT 5ENWB 5F7KC 1WIPA 3CUPA 3I75A 3D39E 4WCYH 3VXNB 3KS0J 1YEIH 2XZAL 3OR7A 3ARBD 5C0JB 1FGVL 3O9WA 5EOTA 2A77H 3HZMA 3MV8A 1I7RB 1IEBA 5IEHA 1UYWH 3HR6A 4TSCH 4L8SC 5DQJB 3EO0B 5TH2A 2B2XL 1I3RA 3MUHL 4PGZA 3Q5TA 5C09A 4ZOAA 1CGYA 4PJ5A 5CZVH 2ZCLL 5LKNA 3QUYB 4L8SA 2W0KA 3RWGB 4GRWF 1FL5B 4OM0L 4U6YB 5B8CB 5TDOA 4DVBA 5CP7B 2LFGA 4HPYL 1FIEA 1OVZA 4TNWK 4XAKD 5L7XL 3MRJA 3VXSB 5EG6C 4HG4J 4AZ8A 2BSTB 3QPXH 4OCNC 4XP4L 2FYYB 5HVGB 2FO4B 3QIBB 1L9MA 5DRWA 2ARWA 1JRHL 1FFOA 5DTFA 2JJSC 5C0BD 1E4KC 4O9HH 4MWFB 5LXGL 4RQQB 1A7PL 4X6FB 2NW3A 5SWSA 5EA0H 2YD7A 5J6GA 3U4AA 4M5YH 4K7PX 4D9RE 3TEUA 4YK4C 2JJSA 1E4KA 2A6DA 2FL5B 3D18A 3BT2L 2H3NB 3VFOB 3TN0D 3QFJE 3QP3A 1N4XL 4G43B 2Z92A 1AXSA 4PB9L 3DURA 1A7OL 1AGEB 4YHOL 3DYPA 3DECA 1EZVX 4G8GB 1X5HA 3RNKA 4BUGA 3EOBB 4LLYA 1E28A 3G5YA 5EO9B 4QRTB 4I18C 1CLYH 4UQ3A 1FZKB 4HLJA 5T5NG 4ZUVB 4GKZA 3CH1B 5C8JB 1FAIH 4NP4H 1QQDB 1Q9OA 3KYNA 3GB7B 1OPGL 1WZLA 3ULVF 5I73B 3ZTNH 2J8HA 4XMKL 3DGCR 3UO1H 4OI9A 1ADQL 4I18A 1IGFL 1BJ1H 4I0CC 1I7UA 4R4BB 5E24E 1JFQL 2NYYC 1KACB 1RSFA 2VQ1A 3TVMB 4HLZH 3QJHB 1X7QB 2FCBA 4FXLA 1M7DA 1XGRB 3ARDD 3U9PL 3HNVH 1LD9A 4NJAH 1HHIB 5CZXD 1KB5H 4LGPB 2OMNA 1AR1C 4WUKH 4BFBD 1A1NA 1FZJB 1EZVY 3IDMA 4ZUTA 1T7VA 4TQEL 2C4XA 1F4YL 2V17H 2XNAA 3ESVF 3I2CH 15C8H 3MRNB 12E8L 2X4TA 4MD4B 5FF6B 3ESUF 4JO2L 3BGMB 4Z5RB 4ZXBC 1KEML 2XZAH 1A5FL 5E99H 1FGVH 1FVEA 1TJHH 3QDGA 1SBSL 5I17B 1A4JB 5LQBL 3O11A 1X4YA 5KOVC 3CK0H 5IKCB 4OD1L 4LLWB 5DF0A 3VGFA 4ZXBA 5B3JE 3BMWA 2LVCA 3H0TA 4R0LC 1ONQB 3S5LB 2P5WB 4K71B 3S36L 5CWSA 3QYCA 3WSQL 2G5RA 3HE6D 3QXDA 5C0DB 4JHAH 5IOPA 3PWPA 4R0LA 1QPPA 2AQ2A 4NZDA 2LU3A 3HMWH 5EIIA 5JPNB 4HPYH 2B4CH 1UKQA 1PKOA 2M1KA 5IV2A 1I8IA 1KSRA 5ID1A 2XPGA 3OKOB 3GMQB 4HK3N 1KTDA 2QSTA 3BP4A 2CR6A 3LN4A 4M5ZL 3U0TA 3VXRA 4LOUD 3WIIL 2W60B 5LXGH 5DO2C 1ETZB 1LEKA 2APVA 1EJOL 4XGZB 3ECBB 2R2BB 5F6IC 3JWDC 4RMVA 2EIDA 5D2LA 1RZKL 4KZEL 4PRPD 1JWSB 1YNKL 2IQ9L 1F4AA 4RGNE 4WV1B 4JQVC 3QG7H 2Z91A 5T1DL 3AY4C 1N4XH 1S5HB 4JRYB 4XP1L 1KLGA 2D0HA 5BJTB 2PW2B 1ZHBB 2BVOA 4JREC 2VKXA 5JXAL 4QLRA 1T1WB 2ZSWB 3OAZK 5F7EH 4JFHD 4QNPE 4NYLA 4GG6F 2IALA 4N90D 3ARXA 4JQVA 1MH5B 4MXQD 3HRZA 1A7QH 3AY4A 3D69A 1KGCE 4ZPVB 5JO5B 3BRGC 1CDBA 2YS4A 4W4OC 2QEJA 2EE3A 4KDWA 4X4MA 5C7XL 2NY3C 1FYTA 3EJZD 2I5YH 2E7CA 1NGZB 4QO1A 3QXWA 4NQSA 1ADQH 5K9QG 1IGFH 2CR3A 2YD6A 3SDDC 3P4NA 4XWGL 3N1PC 3WXVL 3MJ7A 5LWYL 4W4OA 2M26A 4Y88A 4YX2H 5C0FB 3FHAA 3H9HB 3O2VL 3BO8B 2QADC 1WBXB 5DQ9A 3N1GC 5ESQA 2OS7A 3SDDA 5F7DB 1U8PA 3QCVL 1LNUA 3QUZB 4KRLB 4F2MA 3RQ3A 1JHTB 1F4YH 3GMRB 4G6JL 4R96B 3MSPA 1CIUA 1JJUA 4GG8B 1YNTB 3X12A 4PRNB 4NBZB 2P43B 4JO2H 4HBCL 1KEMH 1LE9A 1A5FH 3IDXH 3I6LD 1D5IL 4Y5VB 3T08A 5JLZB 2J88H 2Z93B 4NKDB 1MRCH 5LQBH 1OSPL 3SKOB 4TUJA 1J0IA 5T3XL 3QH3A 1T3FA 1HYSC 2R1XA 3TWCH 1CDCA 1ULVA 3HPLB 3V8CA 3S36H 3DXAA 2X4SB 3ZE0E 4MA1C 2HA1A 2B20A 3FQRB 3WSQH 2C3WA 2F53E 2HLFC 1RZ7L 5IESL 5JIPA 3S3SA 2FIRT 4JRXD 3TFKD 1F3RB 2NY2C 5DQDL 1F11B 4EN3B 4E0RB 4ZFOB 1BZ9B 4JY4B 2JTDA 3CSPA 4RBPK 4EDWH 1ZXQA 1I7TA 1UCBH 5JORB 4LF3A 5KS9B 2BNQB 2P45B 3T0EA 1KLUA 2FEEI 3MLWH 1MHPH 5DUBB 1GZQB 3HRPA 1DUYA 5IR1B 3KXFD 1JGLL 1NAML 4KZEH 3O6LL 2FO1A 5FEBA 1YA5A 1N0LA 4PJGF 4L5FH 2CKNA 2CLRB 5DRNB 3NCFB 5T1DH 4XP1H 3WCYA 4MDJA 4XHJC 3KYMB 2YK1L 5B38B 3MBXH 5MHSD 3QEQA 4QRPD 1NUNB 2YSSA 3FOMB 4ONGL 4FFZL 3OKLB 3FCTB 4QEGA 3O2DL 4LGRB 1INDH 5EC1A 5C7XH 4NN6B 1X6NA 3KPOB 3T09A 4P4KB 3ORJA 4NC0B 1IC7H 3W2DL 2DL9A 1YY9C 2IG2L 1H0DA 5BV7C 3FFCE 4JZOA 4YIQB 3TIEA 1Y0LA 5B21A 2AKRA 2YPKA 4KMLB 3WXVH 1R5IA 3MRDB 1H8SA 3ARTA 2CO6B 3GMOA 4CVXA 4LVOC 2R2EA 1BFOA 1WWCA 2HP4A 4PRHA 1BFVH 1KBGL 2NY5C 1JPTL 4R90L 4KQ3L 1CXLA 3R0MA 3PV7A 1JZ4A 3FO1B 4K94H 4K7FA 4E9LA 1T5XB 5F9WB 1IGTB 2ZUVA 4G6JH 3QXUA 3T0WA 1D5XA 2A0LD 1ZOXA 5HYEA 1X5YA 4ODHH 4XPTH 1SHMA 1S7RA 2OL3H 4HBCH 4BFIB 4HUVB 4PV8B 1NKOA 2ED9A 1D5IH 4CMMB 3WNLA 3JSSA 1N5AA 3U6RB 4G6ML 5KANG 1OSPH 1J1OH 1XF5A 5E5RB 5T3XH 4UTAL 3F6LA 4WO4D 1RUAH 1NSNL 4FZ8L 2OTUB 4OZHF 2DQGL 4XWOD 3LV3A 1A9BA 5DC9B 3KAAA 4DN3L 4DEPB 3T65A 2X89D 2YZ1A 5A2FA 1X3DA 1T66C 5JOPD 2XN9D 1FH5L 3UTSA 5E8EB 1UWXH 3ZO0A 1NBZA 1EEQA 3O3EB 1YC8A 1CD1A 1SYSA 1XGYH 3PQYE 4KRPD 5GRUH 4YC2C 1JGEA 1S7WB 4MA7L 3UZQA 1JBJA 1XR8B 4X8JA 2BOCA 2OZ4A 3INUL 1IAOA 4KJQC 3O3AB 1UM4L 3PUCA 3QEGL 1NCDL 4EUPB 2N7BA 2E8YA 1KT2A 4NN7B 3B2UD 3FQXB 2R4RH 3ZYJA 4WY7L 3LIZH 1I3GH 3O6LH 5GRJH 2VABB 3WXWH 1AGFA 1KPUB 4S0TD 1EX0A 4I5BA 1OWWA 3CSYA 3N9GH 4W81A 2Q7NA 4HLZG 5IHLB 3FRUB 3P0YH 2UWEF 5ICZB 5L2KB 2MCG1 2DWEA 4HUXB 2AJZB 3QZWA 1MIMH 2VZOA 1YEEL 5A40E 3DUUA 4LASH 5DRZA 4NHUA 3IFOA 4YAQB 4ZFZA 5HHOB 5CJQH 1MAJA 3O2DH 3O41A 4JFEE 4HIHB 5LGHL 1X5JA 1PW3A 3RUGE 4JY5H 3ROOA 2DM2A 3WD5H 3GSUA 3GI8H 5EO0A 4KJYB 5FGRA 1SEQL 2RQ8A 3BH9B 3LZFH 4HS8H 4MZ3A 3QO0B 4S2SA 5SV3A 3C5ZC 3SJVD 4Z77B 4JZJB 4KQ3H 5HI3D 3C6LC 4F57L 4KTEH 1CVSC 3SN6N 1B0RB 3LPGA 1FN4B 2ID5A 4JN2B 4L4VE 4H0GA 1PKQB 3RTQC 3C5ZA 2D9QB 5DFTA 3C6LA 1FBIL 1OGAB 4GS7B 2IQAB 1CICC 1INEH 3UTPE 4JPKH 1HCFX 3MJ9H 4I3SL 3RTQA 1ZWIA 5JQ6L 5JUEL 4BSWB 4HEME 4B7LA 1NSNH 1CICA 3MV7B 4ACPA 3KLDA 3MLSH 2G75B 1EERB 4KFZC 4FQJL 3EOAA 4RMQA 4Z18A 4WFFD 5I1EL 4MNGA 2DQIH 4M4PA 3K8MA 4JFFD 3BWAB 4PG9B 2HRPH 3QNYB 2W38A 4BQ8A 5DEZA 3MOQA 2D7TL 3SGKC 2EDFA 3V0AC 1FH5H 1H3PL 4Z7WE 3WIFA 1I1AD 1P7QB 1DBJL 2BVPA 4MB4A 5HGBB 2E7LC 2X70A 3HPJA 3G9AB 2BSED 1OT2A 3DROB 4YBLC 5D7IE 5KN5A 4U1SB 1TVBA 3OKEA 3SGKA 1LO0L 4MA7H 3IJYA 3INUH 2KZ1B 5H37G 1A4KA 1UM4H 3SE9H 5DURB 2XA3A 2ERJB 4JVWA 2E7LA 2KQNA 5D72H 2EYSA 2VAJA 5IM7B 3HMXL 4DGIL 2CLVA 2XICA 4HWBL 5LAXB 1GZPB 5HI5C 2AI0H 5ALCH 4DWHA 1U92B 5F70A 3IVKA 3CFEB 4PJFE 5F8QC 3DRTB 4ZAKD 3LMJL 5IMOA 2MPAH 5T1LB 4TVPE 1AD0A 4HZLB 1K6QH 2ESVE 5EZJA 5ABDE 4PB0L 2APXA 2GUOA 4O2EA 3M1BA 2GJ6D 1FNEA 4NT6A 1FZMA 4WEMB 5GRWA 2D03L 3JV6A 5A2LH 2V7HA 2MTPA 1LEIB 1NGWB 4RA0C 4IRJD 4WUUA 5I74B 5H35A 4F8TA 4Q97A 1XH3A 4JCLA 4ZUWA 4M6OH 2HVKA 4H1LG 1HZHL 4KI5C 3HAEG 5IVXF 1UH3A 3UPRA 1KCVL 4FQ2L 4J12A 1U2HA 3PF2A 1F00I 1S9YB 2FH6A 4HS3A 1T03H 3STZA 1T21B 1NFIB 1SM3H 3WUZA 3EYQD 1BIIA 1QLRB 1SEQH 4P2YA 3VXOA 3FB6A 3C08L 4PJDE 1PYWB 4LPUA 1D9KB 4F57H 3O4LE 1SQ2N 1QEWA 1UQSB 1BWWA 4QOKD 4QT5B 3TNNA 5I1JL 2F54D 3VXNA 3G08B 4WW2C 4WI2A 4PJCA 4JGMA 4HGMA 1F4WH 4UILH 1FBIH 1I7RA 3VW3H 1CI5A 3J8F7 5HDQL 5DFVD 4LLQA 4YWGL 4M61A 3U46B 4I3SH 4WW2A 1Q72L 1U95B 4PJHB 5JUEH 4B7IA 4KK8D 2VSDA 5K9OA 4OM1H 3RJQB 3SKMA 1FORH 5I2IB 1KPVA 4X6BA 5HGDA 3VFPB 3RWGA 4KV5F 5TE6H 1DCLA 4U6YA 1CF8L 4FQJH 4NUGH 2YD8A 3OMZA 5I1EH 1DLHB 3IT8D 1RZ8A 4X4YA 5FYJH 4E42B 1WLHA 2D7TH 3P4OA 1H3WM 3M17B 3TF7C 3TA3D 2FYYA 2FO4A 3PDGA 1DBJH 1HCVA 4WI6A 3PWLA 3SGJC 4MWFA 3MROA 1BVLB 3BYYA 4OLZH 2P5ED 3O6FB 4BZ1H 1F90L 2R0ZL 4ZQKA 2BXZA 2EO1A 4BSVB 2ZNXA 4UNTA 4DGIH 5FB8B 4HWBH 3SGJA 3GRWL 3MCKA 4ODUB 3CFDB 1X5ZA 5LG1A 3D5OF 1HINH 2FHCA 3VE0A 4TNVF 5EFIB 4ELMB 4G43A 1KCUH 1N59B 3LMJH 5EZIH 3TIDB 5ESAB 1U8HA 5DD0H 5TE4L 2HFEB 4GMTL 4Y4FC 1MWAH 3IF1B 2FBJH 1AGDA 5C07D 4PB0H 1AKJB 1FZKA 2NY7H 5C8JA 1G7LB 4YHZL 4U6XB 5CMAA 1S9XA 3GJFB 4Y4FA 4OCRL 4LEOA 5IB5B 2KDGA 2JK5B 4Z7VB 2YUZA 3NA4A 4R4BA 4GKSB 3ULSA 2WV3A 9CGTA 1HZHH 5DEGA 2I27N 3EYVA 3RWIB 1KCVH 3VFMB 1GGTA 4IMLA 1K9TA 2CRMA 2CLZA 1NEZG 5EN2B 1YEDB 2J8UF 3M8OH 1G6RB 1VADB 2GY5A 5I1HL 2OMBA 3RVVC 3RVUD 1GGBL 1W72L 5FF6A 5I1JH 2Q8BL 3L7FA 4MQTB 3H6JA 2D0FA 2ICES 3DX8A 4K71C 3S96B 3C09B 3L7EB 3MRIB 5I17A 1A4JA 1WC7A 5BRZB 5GJTL 5IB4A 3ZE1E 3OQ3B 1J1XL 4YWGH 4QHMB 3QUYD 3MV8E 4MD5A 2P5WA 2XI9A 1OTSD 1NUGA 4PGDB 3EGSA 3HUJB 1QFUL 5K9QI 5C09E 1TZGL 1ZSDB 3AUVA 1DBML 3IDJA 3IYLW 2C7UB 4PJ5E 3W39A 4NKMB 5JDSB 2IC2A 1JNHB 5FUOL 3QIBD 5FUCC 2ICEB 2LQRA 2MNUA 1ZE3C 3X3FL 5EZLA 1DQLL 3HR5B 4CADB 3BP6B 1RURL 1YPZA 1SMAA 1KCRH 3B2VL 2ZCKL 3B6SA 5INCA 2W60A 5K9JH 3EFDL 3ARFB 2JB6B 4UZGA 4RGMB 4OZIF 2I9LA 3W11D 3DO7B 1F90H 1JMZA 2R0ZH 3HZVB 2MHAB