5IUCA

Crystal structure of the gspb siglec domain with sialyl t antigen bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'DTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVVRWLYSNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Platelet binding protein GspB
molecule tags Sugar binding protein
source organism Streptococcus gordonii
publication title A structural model for binding of the serine-rich repeat adhesin GspB to host carbohydrate receptors.
pubmed doi rcsb
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iucA00
3QC6X 5IUCA 3QC5X
chains in the Genus database with same CATH superfamily
3D50A 3PFUA 3K8MA 4N8PA 2HJKA 2GAZB 2X4TB 3P3YA 4OZHE 3VM5A 5CNHA 3D4YA 2OAAA 4TKWA 5F89B 1ET8A 4UQEA 3EDFA 3C2AH 3QUHA 1PZ3A 4FFWC 1IFHH 5IVXF 5DFVC 5AZ2L 4FXKB 3OHXB 3CLEL 4I1RA 3LKSB 4YHYC 4BRVA 3WCYA 3VFWB 1YCSA 1BZ7A 1T04B 3HS8A 3NFPB 1S9XB 1IM9A 4PTTB 4HULB 4XI5D 5KJ7E 1TUPA 3FSZA 1MJ7H 3QPXL 4ZUUA 1JFQH 5TH2A 4YDKH 4L37A 1I7RB 2VGLM 1W0WA 5DHVB 1BF2A 5C1MB 4XN9A 4PJEF 4AC4A 1CDBA 3IU4H 3RDTC 1ZD6A 5ICXB 43C9B 5IHZA 2ZWZA 4N20A 4UQ2B 4BZ1A 3ZDZB 5DGRA 3F7QA 3Q2NA 4XPBH 2A9ML 1MJJA 4PVBA 3AAZB 3WY1A 2WD0A 3H6AA 3T0WA 4X7TB 2NY1D 5KSAD 4ZOBA 2NNCA 3OZ9L 1U6AL 1LP9B 5F0JB 3BX7C 3KYOA 1B4JH 1YY8B 2IH8A 4X7SH 4X9IA 4HLEA 2DQGH 4BH7A 3VD0A 1HCFX 2HT3D 1IC7L 3VX1A 4P07A 3E2HB 4ZFOL 4PREB 2ZAHA 3MGOA 1G0YR 3DX1A 5LQBH 5AOJA 3B9KC 1IKOP 5GZND 5CZVL 2HFFB 2VUKA 5C08D 2CH8A 3QUMH 2ALAA 5DK2B 2OBGA 3UGUA 4YSTA 1X4ZA 1A6VH 1XL4A 2CRZA 4DGVL 3V0JA 1TF4A 3T3PE 4IOIA 2B1AH 2BNRB 5M95B 5DJZA 1Q9LB 4XP9L 4JHZA 5JQIB 2ZXBA 4ADGA 2JKNA 1JHTA 2WTPA 3SD2A 4F93B 4J3WA 4L1LA 3G5YA 2ED8A 1HINL 2XZCH 1C5BH 3HZVA 4LVHC 2QHLA 3FQYA 4HHAA 3BIKB 2VM4A 2PYEE 1AAJA 2ZXGA 4S10A 1U0QA 1D5BA 2D7MA 4KVNH 1HKLL 5AYQA 1RPQA 4CGUB 1O7SA 1S78D 5ES4B 4NPYA 1Z5LB 4JG0H 1NLDL 4PJDE 3ETBJ 1X4YA 3O3AB 2NX5E 4MQ7B 4P3CL 5F88B 2N0MA 4HJUA 5EBMB 2XQYG 5EUOE 3IJYA 1YJDL 4JM2A 1IAIM 5C0EA 4MD4A 1CCZA 2A77H 3PABB 4JCWA 3WNMA 4BCXA 3I74A 5AVQB 1BF8A 1E30A 3PAYA 4LSUL 1CDIA 3WJLC 1KIRA 1AD0A 1CPUA 1KB5A 4U05A 3SGJA 4EZKA 4X7SL 4Y2OB 4JFYA 3VGAB 4DVBA 1YN7A 1MQ8A 3SE8L 2WLZA 3UTTE 1CTMA 2UZYB 4WWKA 3KL5A 3OZ9H 1QUNB 4X7CC 1SHSA 2HRHA 4KUZL 3BPCB 1H6FA 3FT0A 4LEEA 3QA3B 4G7YH 1S7UB 5KVEH 3B1UA 4Y4FD 2CJUL 1FFPB 3V0HA 1QABA 2CG9X 4KUCF 3KBPA 3RA7L 5ELIA 4JL1A 3ECUA 5D7JC 1S3KH 2OULB 5EFIA 4LP5A 1CFVL 2NY0B 3U30B 3N1GC 5JIMA 3MREA 1VESA 1BA9A 4QNPE 3L3JA 1H6UA 1JWMB 1TCMA 1B0WA 1OGAB 2H32H 2PPAA 4I2XB 3ZZLA 4AGQA 2XZQH 3K4DA 4GXVL 4XBPA 5LGJB 3EDEA 4G43A 5CJBA 4FCAA 1N12A 4U6HA 3QCVH 3UTPE 4AXWA 4H0HB 2ZX7A 3VD7A 1EFXA 2YOCA 2OW6A 4P46B 5AVXB 1WBYA 2JKSA 3GNMH 3UTSA 4P06A 4AVIA 1JZ7A 1ZT7B 3IGLA 1OTTC 4YDLB 4K9JA 5F1IA 2QPEB 3FU9A 2F9BT 2VIRA 2PP9A 5CEXA 4PJGA 4M4RB 1J10A 4YHOH 1KZQA 2A4EA 4JREC 3CQQA 4MAYA 4OM0H 3V4PB 4UAOB 4APQA 1UEMA 2NLJB 3D39A 5FUCC 3RWGB 3VRIB 5GS0C 3TZVB 4LOEA 3E8UH 4Y5VC 1Q1JH 2FNBA 5E5LA 3S88H 1GOGA 1TKWB 1WFJA 3AVEA 3BRFA 3S5YA 2FCBA 4HEME 4ZFOB 2NSXA 3CN2A 4Y4FB 5HVFB 2LU7A 4X50A 1R3HB 3OKLB 2IJ0C 1GGBH 1MCBA 2XG5A 3B3IB 4IDLA 3QUZC 1YN6B 3NN8A 1AIFA 2AV7A 2DB8A 2JELH 3MRNB 2LU4A 4U1HB 4LCVA 4UBDD 5T5NF 1JI2A 3GJFB 4XCFH 2AGJL 5F3BA 1ILUA 3L3OA 2E6PA 4NQVA 3FFDB 3WEXB 4JQIA 1FN4A 3IF1B 1CICD 3RFZB 3NABH 4HAFA 4L4TD 1Y6MR 5DR5H 1MHEB 5SWZB 4FTVA 5ANMA 2PXYB 5F7EL 4P48A 1UD3A 1REIA 2BERA 2YKLH 3K80A 4G7QB 3KYMA 4TOYL 4X8CA 3MRCB 5DK3A 1OHQA 1HXYB 4JFTA 4BKLA 5M94B 5EF2A 2J8OA 5F3FA 3T6XA 1U92B 4ORGB 3QI9A 1GZQB 3D3VE 1Z9PA 2YAHA 4NHUB 2A6JA 1W9XA 4C4KO 2WM0A 1JK9B 2P5EA 2PWEA 4MMXA 1XIWA 4W6WB 3ALWA 3ARRA 2F19L 1MH5A 4K4KA 2VQTA 1TOXA 4DOHB 4IGBB 5FF6A 2HRLA 2AJUL 1CQKA 3NFNA 5CGYC 3VFVA 3GSWA 2UXGA 4NM4L 3X11A 5IV2B 5TF1L 3DDGA 4ODWA 2LLNA 1JNNL 4PLJC 1FYTB 5EU6E 4YE0A 1N2RA 4URKA 2AEPH 1KCRH 4F5CE 3KW8A 1H0DB 3A67L 4MB3A 4OM1L 5I6NA 1ZRUA 2QR0B 5C07A 7TAAA 2DLEA 1ZA6A 3O41B 2IOIA 1XGQB 4ONOA 4ODVL 4ZMYA 4WHTB 1JE6A 4R7DA 1L0PA 4ES9A 4DAGL 1DZBA 3LDBB 1TCRB 2J71A 1WGOA 3CDYA 2Y36L 4ZTOH 4AJVA 3D8MA 4ZUTB 3S88L 4O00A 3Q3GB 5H37G 1N59B 4NQCD 2E4TA 1S7XA 5ESAA 2BP0B 3B3BA 4L8SC 5D7IB 3LJ3A 5GS1B 4F58H 3GSQB 1DSFH 3N85L 1EGJH 1RZKL 5JXEC 2WSPA 2J1XA 3QRLA 4XC1H 5CHNB 3WG7B 1FIEA 2XNAA 4D3CH 3BXNB 1CZ8H 5ID1B 2L4OA 1BIIB 1HNFA 3RLSA 3IFPA 5GS3A 3FQXA 5IBUG 4BA8A 6FABH 1EFXB 5JA8B 2BW5A 5HHQB 4YL4A 3TP4A 1TENA 1ET5A 1HL9A 3HE6D 3QUKB 3UDWC 4BK5A 1P7HL 1UENA 1PG7X 2P5WA 3CU1A 1I4FA 4X8GA 4DVRL 3PDGA 1SBSH 3JV4B 2PNDA 5D1XC 2IALB 4JRYA 2CGRH 1YO4A 3NCCB 3HN5A 2NY3C 4P2QB 4X9YA 1CU4L 3UJTL 3FTUA 3NABL 1RIHH 1OT4A 4TULH 1WBXB 5ADOH 3VQLA 1LDPH 3DROA 1D5ZB 4YGVB 2EH8H 4YDJA 4N8VB 1E4JA 2G2NA 1J9TA 2VLKD 5IROC 1FL6B 2OFQA 2FX7L 1PX3A 3IFOA 1XTMA 5MEQB 3SOTA 4JMXA 3FBQA 4H8HA 2XWBB 1BVLA 2HFTA 4HDIB 3HMXA 4ZT1A 3UTSE 5E0FA 5LJYH 2JB5L 3KJ6L 3TJEL 5LB1A 3GMQA 2WUBL 1ZTXL 1OTUC 4K94H 2PYEA 4XVJL 4DP0X 2A3TA 4K0OA 4RZKA 5TF0A 1D5IL 3QJFA 2GTQA 2IC2A 2Z9TA 3LTVA 4N2GA 5EF0A 5CN2A 3QIUD 4PB0L 3BPOC 2HJLB 3IPEA 1EBAA 5JHLH 3HG1D 1UZGA 1TIUA 4G8FB 4MCNA 5BXFB 1U8HA 3H7LA 3O3BB 4TSBL 4YBQC 1F3DJ 5D7LA 3SDCA 3VO0A 5C2UB 1D7CA 2X38A 3LQZA 3HVNA 1FDLH 1NGWB 5JIPA 4I9XA 4IBZA 4JJ5B 4XPTL 5CD5C 2N1KA 4UTAH 2BVQB 1CVRA 5AW5B 2EDMA 3QIUB 4YHMH 2CNYA 2G2RB 4YDMA 3F12B 1SJHA 3ULUC 4HIEB 2OMTB 3G6AA 2NSQA 2QHRH 2WVVA 3OJDB 1WITA 4BQBA 3L5HA 2P5EE 1FV1B 2XVGA 2AJYH 5I5IA 4N2HA 4P5SA 1G9NC 3RKPA 4EN3A 4F8OA 1KJVB 2QQLL 2RGSA 2FIKA 2BIQA 1A9BA 1VADA 4JKWA 3RVUC 3QR2A 3MODL 1AQDB 5DZLA 4JX0A 1A6ZA 2J20A 4TNWF 1J1XH 3CZLA 3BKCL 4OIFA 5JORA 2OMNA 3M1CA 2F8OA 5E8EB 3ATFA 5TK2A 4E9WA 4Z8FH 5I1AA 2C4XA 3CE1A 5BV7L 5MP6L 1N67A 3QRFM 5F2FA 4Z77B 4OIIH 5E2VL 2E0PA 4EUPH 3WXWH 1JJUA 1G1YA 2AXGA 2N1TE 1KN2L 1JGDA 2NUTB 1F41A 1CFSB 1DVYA 1HEZB 2UZXB 5DT1H 4GYBA 5FYLE 3T04D 2JKTM 4G80B 4HMEA 4OI9A 4J3OF 2XX0A 3QT2A 1JUFA 5KVMC 3U9UB 1YEEL 2BNUA 1OP5K 1E7VA 2VMCA 3L4CA 1M3JA 2LR4A 4QHUB 1OAZH 1DANT 3L1GA 2IAMD 1CL7H 4L4VD 4UTAA 5BRZB 3LSOA 1E5UI 1SN2A 3C6EA 4AYGA 3KLLA 4XMKH 1OOAA 3GSOA 3DMMA 4JFFA 5ETUB 1XF3A 3B9VA 3LAFA 3MO1B 4DN3H 1KV3A 3KH3A 4YDZA 2YA1A 3ARDC 2H2SD 3DTXA 2WWKT 1PY9A 1RZPA 4EOWH 2LFGA 2WO2B 5A2JH 3LN5A 1BJ8A 2FATH 4KX9A 4TUUA 2FYYB 3VG0H 5IMMA 1JYNA 1FL5A 3QIWD 2AQPA 2ZKXA 2VUOA 4TLTA 2VZ1A 2DWDA 2ZSWB 5E7BA 4BFRA 4YHLL 2BDNL 3OR7A 3NCYS 1D9KD 4AG4L 4AZ8B 3EYVA 3UDWA 1KGJA 4J8RB 4P57B 3ECVA 2VT0A 3ARBA 4WTWA 5DJ8B 4JO2L 1HJBC 4FABH 2HG5A 1EWHA 2OR7A 4L5FE 3NDZE 3RVTC 3DURA 5EBGA 4XCNB 3MV7E 5DD1H 4MZ2A 4ZMWA 5EWIL 1I1RA 1AKJB 1ZAGA 4HIIB 3HC0B 3SIKA 3V6OA 2RAMA 1MCFA 3KYKL 2R0KL 3LKPA 3QQ3B 3SDDB 3CZFB 5E5RB 1PW3A 5EHFA 3BGAA 4JKNA 1KGXA 4DAGH 4YHML 1PG7L 3HZKA 1RY7B 2X9YA 3MJ9L 4CVWA 5AUMA 3BT2L 5DJXB 1HL4A 1YEJL 3VTTA 1EAPB 4ANUA 2B4CC 5KVGH 2FGWL 35C8H 3IJSA 3U4EA 4W4OC 2OI9B 3EH3B 3RIAF 5FM8A 1UD5A 3OMIB 4CVUA 5J56B 1GGIL 2IAMC 4U1SA 4CMHB 3CSYA 3E8VA 4GAYB 2Y6TE 2JKRM 3FOLA 1UZ6E 3U79A 2BVOA 1BSIA 2ETWA 3FT2A 1NCOA 2XVKA 4HYTB 3CVHA 2Y5QA 3LNDA 3GHBL 3RUGE 5GZNA 4HT1H 4JFWA 3L08A 4EO5A 4EIGB 2LFEA 4OZFH 4OCRL 3W11D 1CG9A 3RNKB 3FFCB 3JWOH 4JM2B 3STBA 5JHDB 3PV6A 2JJVA 4QYAA 1MZYA 1I9RH 3QULB 3T2NL 1AHWB 3DIFB 1PX4A 4TSAL 1BOGB 3HIZA 3OLIA 4X0KA 3S35L 3QXDB 1I9IH 3NSXA 3ZR5A 4EZLA 5GPRA 1N6QL 2QKSA 4HJ1A 2OMXA 1PFCA 4LCWD 4RMTA 3CFBB 3IKKA 4PHZA 2W07A 2XWTA 5JW4R 5HHOE 1G9MH 4YO0B 2DEWX 2Y7OA 4NKOA 3W3BA 3ML8A 3HAEH 4DGUA 4KK9C 4XWGL 1JPSH 2NNRA 1IJNA 3BSZA 3MROA 4RGNB 5ESQB 1DLHA 1GH7A 1E9QB 3G5VA 4DP8X 5KZCD 4HK0A 1EFXD 3WENA 1QVOA 4W9IC 3WAKA 3G5XB 2YGNA 5I24A 5K39A 4TQEL 3H9SA 4AIXA 5ICYA 3SSGA 1GMIA 2NYKA 4IMKC 2GSGA 1BEYH 1MFDL 2YEZB 4M8QA 4PRHA 3U2SA 1WWCA 2EEFA 3ZT7A 2DKSA 3NAAH 4QCIA 1SBBA 1X5AA 4EE2A 4GUOA 1WUZA 5EZLB 2YD3A 2DEXX 1XXDC 1KCUL 3S37X 3BVNB 4ONHB 2VB5A 5KYYA 5F6IC 2Q0ZX 5JLZB 3U2JA 2WAHA 3L5XH 1OV8A 3T77B 1K4CB 3PWUA 5E4EB 4UV4H 5CEZH 2CKNA 4W81A 4PJHB 1FFNB 3SJVB 2CDGB 5FYKU 2R8SH 1SF5A 4GSDH 4M48L 3EFDH 2V3FA 4NM4H 2CBTA 4JO2H 4FC3E 1U8NB 2QGDA 3HG2A 4ZUSA 3IRPX 4PRNA 4XBGA 2A6DB 2BSTA 2H6OA 2MNUA 4QRTA 3HC4H 2GUOB 1PD6A 4UBDC 2BW4A 2ITDB 2W81C 2ZIDA 3LIUA 4BQ9A 2Y7MA 4LQ1A 2B1HH 3DUSB 2VDNB 3SBRA 5K9KA 3ES6B 4P3WA 1FL5B 4FFYH 4YVUA 4ZYKA 5KJ4A 4XNQA 4JQXC 5J12B 5F0PB 1OCWH 2XN9E 3QVAA 2FTAA 4IDJH 4Q9QH 2YQ3A 3FO9B 2FJGA 3RIKA 4KI5F 3AREA 3BI9X 3BUDA 3QORB 3A47A 5I30L 2GJ6A 4NQVB 3VSVA 1CXEA 2JCCA 5F7EH 1GHFL 2WB1A 3TCTA 5KANG 4FEMA 1K2DA 4P5TD 2P8MB 1LK2B 2O5YH 2GTZB 3QFJD 3ZMEA 2I27N 2P46B 3QQ3A 1BPVA 3VG9C 1HJCA 2DQDH 4AQ1C 1WV7T 2X70A 1MDAA 3HZKB 1XB3A 2VZOA 5CLZA 3M1OA 4HBCL 2BY2A 1F1GA 4OLEA 3RILA 3WXWL 4D0BB 1TNNA 2WLKA 1NBZA 2EYSA 3HE6A 1IBBA 1PY0A 2WZ0A 4I85A 4WI5A 4BFKA 1OSPH 2A7BA 2V4LA 5B8CB 2YQGA 3D2UA 5KVDL 2X4UA 1A6AA 4OJFL 1WICA 4OFYD 4MJIB 4OM0L 1AOZA 1RZJH 3F85A 1HC1A 4HALA 2AI0H 4KJYA 3O4LB 2CHDA 4HAKA 3CZSA 1TYRA 4M6ML 4JFHE 4GBXC 4XHQA 1LYQA 3RNQA 4LRNH 5I75B 4N8VG 3WEMA 2HRGA 5HJDA 1IKFH 2YD7A 3CX5K 3WGUB 5J9PA 3GXTA 1GGBL 3KDPB 4TLKA 2ZICA 1CLYL 1KLFB 3MRGA 2RJMA 1BVKA 3RHWF 2JKWA 5C0BB 3T09A 3WIIL 1PZCA 5EF3A 5JZ7C 1EEZB 4GAGH 2H1XA 3CD4A 1THCA 2R4RL 5FO9A 1IL1A 5GS0L 2CRYA 5H35A 2B39A 2KMWA 1ZLWK 2NXZD 4LCYB 5AZEH 2ICWI 1CDHA 2YOAA 1MCWM 1RK1B 5F1SA 1EJ6A 3NZUA 4HPHA 3WNKA 5C0FB 2EDTA 3K4AA 3KPRD 3BP5B 3GS4A 3F8UB 2IXQB 2P80D 1CXLA 4UU9A 5HI3D 2AS5M 1SY6A 1ICTA 3OGCB 4YAQA 2V2TB 4ENED 2DQTH 2M83A 2KZWA 3MXWL 3T65A 1N26A 1BZ9A 2J2ZB 2NCEA 3ME0A 1KWGA 4ALAC 3PU7A 3ARED 2XRAL 2YEZA 4PRHB 5E4OA 3ARQA 2TSAA 3RZCB 1DBJL 2JQZA 1AACA 5B38A 1O6SB 3R1GL 2A6KB 4PVNA 1I1AD 3ZHLA 1OPGH 1JG9A 4JFFD 4UB0H 4P5KB 4WJ5B 3QNYB 4RMWA 3DX8A 4HZ1A 2A6IA 3O3AA 1C5DA 5EU5B 4P4KD 5BZDB 2EDFA 2WLHA 2CGZA 1INQB 4NQEB 5IW1A 3O81A 1IO4C 4LSRL 3MC0A 3E3QE 1Y6KR 3T3MB 3PGDA 4K9EH 1YYLL 4JFYB 4DVBB 3ALXA 1MLBA 3TIEA 4TVPH 3T2PA 3VXOB 4LCCC 3LMJL 4ATTA 5HYJB 4HCGA 4GG6A 5C0CE 1KYOJ 4OJEH 5C0ND 5E51A 4NP4L 3ZGIA 1OF2A 4NZDA 3ZE2B 1M9WA 1V3LA 1KIUA 1MPAH 2XIIA 5LXGH 4JE0A 5HI4D 4FHBD 2PWFA 4L9LB 3GKWL 1FH5L 4HQQL 1H3UA 4DP5X 4U7MA 1L9OA 1YJDH 3QFDB 1E8XA 2CJTA 4Y16B 2FX9L 3WYRA 4RAVB 5TE6H 3HLKA 2AAAA 5HYQB 1CZ8L 1AVAA 1WPCA 1FZMB 2F1AA 4A1RA 4NNXA 2V9UA 4X2UA 3ULVD 4JRYD 2F7OA 4JQXA 1CD9B 3UTTA 4BFIB 2VR8A 2DIJA 3JWNH 4JM4H 3VYNA 1EDHA 4HV8B 4YFDB 3P4LA 4PJ5E 3MGTB 5GSVB 4XB7A 5FFOA 5I1JH 3BKYH 3VFOA 3U7YH 4JFDE 3L45A 1IUZA 3QIBB 4FXGB 3KPLA 1S7QB 3P2BA 4TNEA 4FFZL 4NO3B 3OGOE 2ROXA 2E74C 2FLRT 2Q8BH 5JPMC 4WO4D 5FYJD 1A64A 1QWUA 1WRFA 3CX2A 3QUZA 5I74C 5TQ2H 2I60L 3MV7D 5I0XA 3A67H 2ZKMX 1D5ZA 1XF5A 4P9HH 4JFDB 4PREA 5D96C 4OI7A 3AG3B 1JRHI 1LO2H 4AEEA 1LO4H 1Q4NX 2D0HA 3H0TA 4HUUB 1WFUA 1ZGLM 4AEFA 1MSPA 1PLCA 4FG4A 1EEUA 2ITCB 3HMWH 5ABZA 2V9TA 2BNRD 3MOBL 4LKCA 1LWJA 3UAEA 1LILA 4IBTA 3FRPA 5TE4H 5BNXD 2UY7A 3CMOH 4ZXBC 1IGML 1NM9A 4KFZC 4XPHH 3IBEA 1U6AH 1U8OA 1I9EA 3NPSC 3FQ1A 4PG9B 4FRWA 3OD3A 5D7EA 4YX2L 1RP8A 3T0EC 2WXKA 3H9SD 2E56A 3FCTB 2QQNL 5I1IH 1E40A 2OL3H 4BZ1L 3LB6C 2HRPL 4ZOEA 2YUZA 1K8IA 3VH8A 1KSRA 4FLQA 4JFZH 3FU0A 4NPKA 5F7KC 4X4MA 4IEFB 4F7PA 1BEXA 4QRUB 3SGJC 3ILDA 4UQ3B 2VW4A 5HHME 4EN3D 1SJXA 3OC5A 4OCXL 4JZOB 2RTTA 2GHWB 1Z1WA 4GQRA 3FU6A 1OK0A 2Z31B 4Y9FA 4UOZA 1E6JH 2JE8A 3JWDL 3TIDB 2DY2A 2NYYD 3GK8H 3QYCA 3EJPA 1RH8A 4M93C 4HPYL 3EJTA 2EIBA 4FQQB 3EXJA 1A6UH 4KKCD 3BKCH 3IT8D 1VEMA 3ARBB 2X40A 5C0RH 4NJ9H 5L6YL 1T66C 5F7YC 3W2DL 3W38A 1XGUB 2WY3B 4IRJB 5T8IA 3EFOB 3U48A 3P4MA 3OXRA 3Q44A 5BS0E 2EC8A 4Q97A 4KXAA 4FGMA 3L54A 1DUYB 2HAZA 2ZG1A 3MYJB 2E27H 3O11B 5EZPA 5GGSY 4GJTB 4KDVA 5GRVK 5LBSH 3VTAA 2CWRA 4DW2L 3VG0L 2IPKB 5I16A 1VCBC 2O5ZL 3CH1A 3OF6D 1R1CA 3H42H 3FCBA 2C3WA 1NFIA 4OD2A 1SXCA 3FUHA 3NFPA 2GBAA 4AT6A 3TN0C 4TUJA 4AZUA 5IB5A 4CA4A 1U3HB 2YXVA 3REVA 1T03H 1AFVH 3N3EA 3C6SA 1S3KL 1BQUA 1RZGA 3SPVA 3V0VA 3MO1A 1OSZB 3K6SA 1HFUA 5HGBA 3GKWH 2ATKA 2X3AA 5TQ0H 3V9FA 2VYRE 1J05B 3K91A 3VSTA 4F57H 5TPWL 2KBGA 2F53B 1MN4A 1URIA 3EGDB 4PCTA 3OC8A 4UM8A 3STLA 3EYSH 3GSNA 4NO3A 4NI6A 4AQ8C 3DECA 1D9KA 4LOUC 5F7FA 1E28B 4PRPA 1A7RL 3CFDA 4PB9H 4D8PA 1QPKA 4J3VA 4G7RB 3E1F1 1U91B 5DHMC 4R4FL 1I8KB 1CFNA 1S7TA 4WFGD 2MKLC 2J8UF 4J8RA 4P57A 4XBEL 4PHXA 3N06B 5I1GH 2UUDH 3R0NA 2HP4A 3KPMA 4N2CA 2DYPA 5D2LE 2X2JA 5T5FL 1PBYA 3RUGB 2WBJA 1C12A 4HEPG 3P4NA 1L7TH 4DNLA 5EZOH 3SPHA 1IFRA 4AQZA 3W37A 1YMMA 1F86A 2I07B 4K94C 4MZRA 3N2JA 1K5WA 4R5XA 5AL8A 4LKCB 3UJTH 4HSAC 1M7IB 2ADJB 5IM7A 2V7HA 1J5CA 3BE1H 5CIPH 3DO7B 5F96H 1BFVL 1E9PB 5EC1A 3UXFA 3KVPA 3QUMB 3R8BB 4QGTA 3DJ9A 1IV8A 3G5ZB 1RUPL 5IF0B 4K5OA 4X99A 1E50A 3DSFL 1HL5A 3QG6B 4PJ9D 5LGHH 1OAQL 3QBTB 4OLYL 1NCCL 4H0IA 2CDGA 3A6CH 5KYXB 2YBRA 5AD0B 4IW4C 1KPUB 4X9BA 5EC2A 4HOMA 3BKJL 4QHKI 5INCA 2R1YB 4HWZA 2WVVB 3OJDA 4OCYL 3CVHH 4EVNB 4K3DH 1MZZA 3OAZK 4YHKH 3QJXA 4R26L 1KBGL 4N26A 2EEAA 5A16B 1MHHA 3DI2B 5JZ7D 5E2WL 3PFQA 4HJJH 3KWVA 4ZTOL 2JB5H 2K7QA 1I1YB 2WXIA 3KJ6H 3N41B 4LP4A 2EDLA 2MNWA 4U1LB 5I8EB 3VFMA 3VNYA 1YNTA 4J4PC 1AZRA 3VD5A 2MCPL 5I71B 3VUAA 1JERA 1FFTB 1T1WA 2JTYA 3TYFA 4OT1L 3KWUA 5A7BA 2I85A 4HK0B 4X6DF 3GJFH 1S4IA 2FT6A 3APMA 1S9XA 2Z4TA 1U3NA 4ZMZA 3FT3B 1SJEB 3FL7A 4J6IA 1GYWA 4M1CD 3VW3L 1H3PL 4O51B 3QQDA 3G04A 5DD5L 5KSAB 1BECA 4K5LA 3VVVA 5HI5C 2CGRL 3R7RA 3IDGA 1LO0H 4TVPE 4TRPH 3RGVD 4KRPB 3AS0A 4D9LL 5J8OA 5HHPB 2APTA 1ZV2A 3IDXL 5FLVA 4QHUA 4XTRC 3KWWA 1JGLH 2CO3A 3PWVB 2B59A 1RIUH 3PAUA 3JTTA 4HIHA 4AXWB 4DK3A 4B9IA 1ZVHA 1UZ8A 2ZZUT 4NPJA 4FXTA 1WQVT 32C2B 4JMNA 4BE6A 1OGAA 1UA6L 5EBWB 4FQLL 1NLDH 1FNGB 1CIUA 1J1OH 2V6HA 1UOLA 1QNIA 3HC4L 1A4CA 3QH3A 1FWXA 1A5FH 4FFYL 2CCWA 4NQCE 4U6TA 1NFDB 3UO1H 2FD6H 3UIYA 1TFHA 5AWNH 3C5SB 1OXYA 5JO5B 3PWJA 4KXZH 3MGOB 3UAJC 2YXWA 1I53A 3JYBA 3OAYK 3KE0A 3TX4A 4NERA 5KBDA 2NY6B 4XPGL 3MRRB 2VMJA 3OR6B 3F00A 1T22A 4DPCX 5ILTL 3X14B 3BVWA 5DUMH 4APQB 4EBQH 4D8OA 2ADIA 2BNRA 1N7ML 4QO1A 3MRNA 3NGBB 4TSCH 3K0YA 2AEQH 1BEYL 3ZRSA 4QEGA 1CD0A 5L4IA 4E9QA 4AMKL 3D2TA 5D7LD 5D1ZB 1MQKH 3X1GA 3BP6A 3U36A 1KLGA 1NMCC 2Z7ZA 1OZTG 2P7TB 1MFEL 2EDXA 3BGMA 4JZJA 4N6RA 5TQ2L 1J5HA 1UWYA 2IBGA 4NO0B 3T65B 3FTSA 1W0YT 4PYHA 2E6JA 2WSDA 2H8PB 3QFJB 1D5BB 5D7LB 4K3EL 3PWNA 4WW2B 3ULSB 4NIKB 5SV3A 2G3NA 3H8NA 3PAVA 3MRKA 1WAEA 5JIKA 4QTIH 3AITA 2K9FB 5DHEA 3LRSB 2VXQL 1CBJA 1BXVA 4JVWA 2MCAA 2I69A 5CJ5A 3AQDA 4MASA 4JZNA 1ZHNB 4UUJB 1DDHA 5TDNB 2EIDA 3RWJA 5ITBH 1YEHH 1NSNH 2DM4A 5ESVB 1H5BB 4Y1AD 1AI1L 2IQAB 5IW6A 3V0EA 4XPHL 3IFLH 3QUXA 5EG6C 1OM9A 1R4XA 4P23A 3FO2B 4NWTH 1LP9F 4K8RL 3B6SA 2YJLA 1YA5A 4XO8A 3WE1A 5BJTA 4I2XE 3VRJB 1U93B 4KRMB 5AYUL 3P2DA 4D9LH 3S8WA 2WXQA 4Q0XH 2A99A 3T4AC 5G2NA 3QA3A 3ZYIA 2DQHH 2BO0A 1WZAA 5C0CD 2PCPB 4AYBA 2XA8L 5IVNA 1PZ5B 4G8GD 2ICWA 3FYEB 4NQDE 2GAZA 3KPQB 5KOVC 1XZWA 5HYQA 4OQTA 5FA3A 1BD2E 2XTJB 4F7CA 3IS1X 4YSPA 2YPLD 4E9LA 2KQNA 1UXSB 3GMRA 2X6MA 1R3IH 2PTTB 3TA3A 2AMUA 3A23A 4GY4A 4G1EA 1BQHA 3OKKA 4GKZA 3BISA 4G6ML 4P4KA 3VFWA 1HN1A 1FNAA 1KTLA 4RIRA 5IG7A 2XNAB 1LWHA 2ZX5A 2R2HA 2XWEA 2K8MA 3GHPA 3VFNB 3T6ZA 4YE4H 2HUHA 4L1TA 4PJ5D 5BOJA 5BVJB 3KYNA 4PRHE 1NA8A 1MJUL 1W0WB 5DHVA 1H19A 5LGJA 5DMIL 2CKBL 2DD8H 3HFMH 3QUKA 3MQIA 4OZGA 5D2LA 4GG6E 1ODAA 1QASA 4FQLH 3SQRA 1BD2B 1F58L 4ODTH 1WSST 3TBSB 2KL6A 3X17A 1ZHLB 3O6FC 1P6AB 4BA0A 3V79C 2B0SL 4O2FA 3OKLA 4AZ8A 1JDCA 2FX8H 3KLQA 3VAEA 3HI6L 5FM5M 4GP5B 3NN8B 4ILDA 3BLKA 4L4TE 3QORA 2NR6C 2JK5A 3NH7L 4XTRD 4UANA 5H4ZA 3QG7L 1ECYA 4LVNC 3QIWB 4LPVA 2ZUXA 3I2CH 4B9FA 1L3WA 1A5FL 1YC8A 4M61A 4GBXD 5ANMB 1K6QL 4Q52A 3NCJH 2YPKA 4FQ1L 2BNRE 4MDJB 3W5MA 1OAJA 1UURA 4ZTPH 3MNDA 1JMZA 4KKAD 1C5CH 4UMSA 2WXPA 2XY1A 1PZUB 1P5UA 3FZUD 4GNKB 1CVSC 2IFFH 4M02A 5E6SB 1E0OB 4OLZH 4XNMA 5IJVB 2UX7A 1CURA 4XBEH 2PF6A 3BH9A 3L3HA 4ZO7A 1HL8A 1SF3A 4YSRA 3S4SB 1Z5HA 2B3RA 4YSEA 4J6RH 4KROB 1NBYA 1OB0A 4JCLA 5HYJD 4N5ED 5JHMA 3K6IA 5E99H 5AVYB 2CIIB 2QELA 2XPGA 3O4LA 3VW3H 3PYCA 3P0VH 4XO4A 1IIIA 1XBDA 3N50A 4CN6A 2AF2A 1HINH 3TF4A 3UYRL 1S7VA 5CN1A 3LS4H 4KZEH 5K33A 2V2WA 3QPXH 1BOGA 1JXDA 4F8TA 5HJ3B 4MLSA 3T3MF 4PI2A 2G75A 3QNZA 2G60H 3PWPB 2L7UA 5DA0B 2NYZA 3B6SB 4FQCH 4M56A 4H8WC 5K59E 1U8MA 2YJQA 5AKRA 3X3FH 2I5YL 5I8KH 1EAJA 2ZWLT 8PAZA 2LAGB 3KM2A 5EEWA 3DX9B 5F9WB 1DJYA 1PVHA 1NWOA 2X1WL 4QXGL 1ZTXH 2P52A 2XOTA 4W9EC 5AW6B 3S4SG 1DQQB 3Q1SL 5E4IA 5LGYA 4FQIH 2XETA 3PNWA 4HA1A 1UM5H 3Q1EA 4E68A 2G3MA 3ZQXA 3GEWB 4LCUB 5DHDA 2QSTA 4L37B 4OGZA 4OJFH 4YEEA 1D5XA 2XJLA 1NUNB 4L4TA 2OJEB 5FGCB 1A6UL 5IB5B 5D2NB 4BSWA 3GMRB 3MNZB 2XKNB 1BHGA 3KBHE 1JPTL 5AVZB 1BVNP 2AQ2A 3DV6B 3IDMB 3KPSB 4Y1SA 1P84K 4KK6D 3N1MC 4B9JA 4Z3TA 4LSPH 5CAYB 4G6AD 1NC4A 3LIZA 1AQHA 3E38A 2OSLB 4M4RA 5ETUA 4FA8A 1WIUA 5AB1A 3U7AA 4CC0A 1FVCA 4NZTL 2A6DA 2BSTB 4MLIA 4OF5A 2VLMD 4O2CA 4MXWL 2O5YL 2Q7YA 1LVEA 3FQWA 4F1SA 4P46A 4APQD 2CGYA 2OMVB 3ZL4L 3QDGB 1MFAL 2H45A 5GRXG 5C8JA 3P54A 3QZMA 1TJXA 4YK4B 5K1JA 1IM3A 5IHUH 5AOZA 1KN2H 3K8KA 1QQDB 1N5YH 1IU1A 1NOFA 3NJFA 3QDMD 1P4LA 4PJDA 5LDSA 3O4LE 2MOVA 3LVTA 1N68A 3HZYB 4JN1H 3QHTC 3SD5A 3UZQA 3DURB 2FUQA 4Q4EA 4QOKA 4JCMA 2X0WA 4HIJB 1QYGL 3GXMA 5FGRA 5E2UH 3UAJA 3HE6C 2J12B 3RRQA 5CZXC 4AIOA 3GIZL 4XC1L 4FP8L 1JV2B 1G4MA 3MA9L 5I0DA 3VNZA 4F37K 3MV9B 4XN5A 2YD4A 4BXVA 1M57B 1G7LB 2E9WA 2B3IA 4QRRA 5HVHB 3VXMD 2WMPB 2Y5TA 1CB4A 1O7DC 2GUYA 3UJIL 3KS0J 5C0DA 1HZKA 3FZUC 4RAUA 3Q0HA 1MCDA 5L0QB 3ARYA 1ACYL 3SODB 5FM5O 1F42A 3F05A 1KN4L 3SDCD 3O6KH 5GSRB 4PGDA 3IGKA 3P9LB 4L4VB 1JSYA 1OAXH 4UTCA 2J5WA 1T21A 4B53A 2HLEB 5EZIL 1U91A 1BJ1H 1NEZA 1MFUA 3I6KA 4GT7A 4OM1H 4FEIA 2X7LA 4LSTH 5DQJB 4LLVA 4OFPA 5E8NB 3DNKA 4FFZH 2X5PA 3GSNH 3LQZB 4UIMB 3DK2A 1RJYB 1ZANH 4HLZG 4HKBB 2HTLC 1RZFL 3ZRFC 1KENH 2W80C 2W1NA 3BQUD 5FV1L 4F3FB 5BW7C 4NAMA 3D09A 3DGGB 3WDIA 2YO3A 3X3GH 2Y7QA 3E9TA 2CBPA 4AQAB 4FQ2L 4HHWA 5I6MA 2EXYC 4MWFA 3ZYOA 4G5ZL 4GW4A 1H6TA 1MUJB 3EDDA 3OKMA 4BINA 1TCRA 3MROB 4JPVL 4NQSB 3FT3A 2D9QB 1KJ3H 4Y2DD 3W82A 2BCKA 3TBCA 4CVXB 5FGBA 3SBWC 1N59A 2O5XL 1JV5A 1AQDA 3I3EA 2WVSA 4DJMA 1V7NL 3NH7H 1I7ZB 3VQ1C 3OGCA 4YAQB 2K6WA 4QRQB 1X7QB 4K7FB 4O02A 4LRIC 2WHVA 2X3CA 1MRFH 3LKSA 4M5TA 4Y8AA 3CFCH 3LZFH 4A67A 3CBKB 2YPLA 2BNQA 3RTQB 4NOFA 4OZIA 4NSKB 5AVWB 3KNBB 1XMEB 3P73B 3PUCA 1A7BA 4Z3FA 5A6MA 1U41A 4HWZB 4IMLA 4V33A 3ARUA 1FZJA 5DSCA 6PAZA 5IB2A 1TVHA 2DMHA 4XVUC 2Z31A 3BKMH 5CHNA 1S7RB 4FNPA 2XFXB 4J2QA 4Y89A 3W9DA 1FGNH 3CXDH 4QRTB 3C8DA 4DP4X 2EVHA 3C5JA 5T1MB 1OTSD 5I1KH 1X7TA 4IOFC 1M2OA 3LCYA 4LLYB 3HR6A 4BRJA 3GIVB 3N5AA 5CP7B 5FKAB 1BD2D 4HIXL 1IARB 4ZPVB 3VXUB 1MOEA 1L9PA 1R3IL 4XBGB 1F6LL 2D3VA 4J7RA 3P2TA 4WTZG 1DEEB 5GGRB 2P5WB 3VD9A 2L0DA 2GJ6D 3ZGHA 4PU2A 2CA3A 1UYWL 4L1DA 5D70H 4E5XB 4OQTL 4IOIB 3GJFA 4OF6A 1WE5A 4AMWA 3QUYA 4R5TA 5HHPA 2ZE0A 2GTZA 4LHQB 3K2UH 1BMZA 3HZMB 1EH9A 1MY5A 2Y4SA 3RL2B 3BUBA 3D85A 1WZMA 2FH8A 5HGHB 4IOSA 3KYMB 1AGBA 1YEFH 2AJVH 2JI2A 2X4OB 3MRDA 4B9KC 5T1JA 1EEYA 2WO3B 4A66A 4A7QA 1CC3A 2RMNA 1NL0H 1GC1C 1KJ2H 2HWZH 3ZLQC 3U0WH 1OW0C 2OL3B 4QHNB 3N42B 1T7ZA 1G6RB 2BIMA 1WWBX 4V1DA 1BBJB 4JG1L 4U3SB 1JGEA 4A7UA 4PB0H 1FZKA 2CMRL 1RZJL 4OCWL 4H8WL 3VU2A 3P9LA 4L4VA 3WHXA 1A7OL 2VJ0A 4PWIA 1LK3L 4WHCA 5A2BA 5L9DH 4GRWH 4NDMB 1CFNB 1S7TB 4V1DD 3S9DB 3F5WB 4APXA 1HZHL 1BFOA 3TBYA 4M62L 4NQDD 3FO2A 5FUOH 3V0DA 3NG5A 4KK5C 1L9NA 3FAWA 2FO1A 3ELAT 1W8NA 2RCSH 1ILSA 3LQAL 4N9OB 3PQYB 5T3ZH 4AY0A 5FUCE 4GG6F 3TVMB 5IBTL 2VMDA 4WI0B 4MD4B 3WFBH 4HUVB 1KTRL 4R4NC 4AMKH 5ADOL 2RQEA 1VSCA 2K70A 3NIGB 1RJZB 1TTRA 3O3EA 2VDLH 1SN0A 4UINH 1ACCA 1RXLA 4RISH 3P4OB 4XXDA 4L0ZA 5IGXH 4PJ5A 2E4FA 4DK5A 1YUHA 4DVRH 5ESAB 2H8PA 1HEZA 2UZXA 4BIKA 2V2TA 5B3SB 1OCWL 4PGBA 1XXFC 1SXZA 3APNA 5BOZG 1D6EA 1X6NA 1MJ8L 3HE7A 1BW8A 1E9QA 3G5VB 3S5LG 3LKNA 5CP3A 5GHWL 3QQXA 2JLLA 3EGXB 4NQTA 5EFIB 5CEZE 1F00I 3FYIB 3FQRB 2CBQA 2AK1H 5CINH 2KPWA 5BO1L 1QBBA 4XP1H 4WZ9A 1BVNT 1AS7A 4JY5H 2WTOA 3ASNB 3HPLA 5B7EA 2O6CA 1K8DB 4HX1B 3VQ2C 2CJ3A 2J4WL 4ZFGL 1PFOA 2NNXA 1I4FB 3MV8D 3D4GA 4B96A 2MPVA 1RIUL 3DX2A 1BVZA 2PW1B 3WJJA 4G8IB 1COBA 1HILA 2VOTA 4JR9H 3HG1E 1EHNA 4XN2A 5DJYB 1R33A 2NY7H 5I1HL 5ICZB 1YYML 5CP7A 5FKAA 1THAA 2R1WB 4N0FB 1NM4A 4JRXB 5LVEA 1UWGH 4YZFE 4WSGA 3IKCA 4L05A 3C5ZA 4H1LB 4M6MH 3NCYP 4HZAA 4J8QA 3KPPB 3KH4A 5HYIA 3FQUB 3MUGB 5CFHA 2X1QA 5D5ME 1GHFH 5JDSB 2Z34A 1TO5A 2ED7A 1UJ3B 1A8JH 5IB1A 4QPEA 5EUOF 2A9NL 3CFEB 3O0RL 2WNGA 3ESVF 3EADA 3KXFB 3QJHB 4J3UA 2QT6A 4YOKA 4CDGC 1IBYA 1MHEA 2X6VA 3L4YA 2I32A 3ARFC 2D03L 3KGRA 5E8OB 3VDBA 4N68A 5FM4A 1BZ8A 4A63A 3CIAA 4U49A 3QZWA 1SLVA 1WBZA 2AXFB 3O6FA 1BLNA 4I18A 4BUGA 2A83A 4M8RA 4GUPB 5EU4B 4DZBA 3KWXA 5E9DD 1CBVL 2WW8A 1XVSA 3I6LD 4GOSA 4M43L 2HXAA 4R3SA 3BAWA 5LDUA 2EVJA 1Q8MA 4R0LC 4GP8B 2E46A 1JZ8A 2CM6A 2ZG3A 1JGEB 1HT6A 1U8CA 2WIIB 1DFXA 4OJDH 1YPZB 4XXWA 1WF5A 4XN8A 5F6HI 3BQUB 3ZX1A 5I26A 1A3QA 1A1MB 1MH5B 3RZCD 1R19A 3OPZH 1Y18A 5ACLA 5EUKB 1Q9KA 4AKOA 1QFUL 3WS6C 4PJGF 1YEWA 2LABA 2RALA 3M7OA 2FRGP 1P4IH 1EZVX 4JZJC 1DVFC 1MCPL 1A3RH 1G7HA 1HH6B 1XF5B 3NCFB 5DUPL 3BE1L 1PU0A 3WHE0 2XV3A 4BGDA 2NW3B 3MLTB 1CG9B 3MJ9H 1MFDH 1KB9J 5C0BE 4XXCC 5LG1A 4PSPA 3OAWA 4LPXA 1G7MA 2D7TL 4OB5L 3RVVC 1TU2A 1KCRL 4OGYL 4IK6A 4FP8H 5HGDA 2G0KA 1XD1A 3TO4C 4Y1TA 3OQ3B 4P2RE 1TVDA 2AJ3B 2C7UA 5DRXA 5FWQA 4HW6A 3S36H 4NQEE 4PJIF 2WC7A 4ODUB 2Y22A 3C60B 3KZ8A 3EJRA 4NUGL 5H35B 3RVWC 1JPSL 4C55A 4EKXA 4KXZI 2WNXA 5D4QA 3LEVL 2OXHB 2CIKB 3BN9D 4C56A 2AJZA 5LQBL 2V9RA 2DQJH 1HQRA 3AABA 3WELA 3MACL 3KEHA 1G1CA 5K69A 4N24A 3O8XB 2W92A 3PIQA 3OB0H 2GSMB 1IQDB 2XG4B 5A6LA 3BP5A 3ZSSA 5EH1A 2YMXH 4QY8A 5KJRL 5CD5D 3H7BB 4OCXH 4HKZA 5IBUB 4HLJA 5F70A 4HVBA 2C9UA 1WAAF 1CLZH 3D0LB 4FD0A 3EOTH 4IBSA 3VXOA 3AXLB 4XN7A 4ODWB 3JUYA 3ARSA 3QDJE 1NCNA 3AUVA 4KKLD 5DMJB 1EZVY 1VA9A 2SEBA 5IP4A 3COOA 1LO2L 2G3XA 3BCDA 5L4FA 1FFNA 3KGUA 3JZYA 3I6LE 2C9XA 2DV6A 2VCOA 2VDMB 5I6LA 4JFXA 3TYFB 4ODXB 4YBLC 1KOAA 4LESA 3BVUA 1MJ7L 2I60H 5TGBA 3BZDA 1MY7A 3QR0A 2MQ3A 3T2NH 1MFCH 1U8JA 4DO5A 1ZSDA 1SRDA 2E86A 2VMEA 4LSQH 3IKCB 1FAKT 4ECNA 2X4RA 2ENQA 1CYXA 3Q1SH 3Q7JA 2CXKA 2F2HA 4F7TB 4G6KL 2E7MA 4G8AC 1T89A 1YLBB 2BP0A 4Y1AE 1X4XA 3VACA 1IC5L 2VXTL 4BFIA 3CVHL 4XWOC 4EDWL 3SYCA 4PRIA 5AUMB 2NXYB 4OD2B 5EORH 4TQPA 3NK4A 4JM4L 2NDGA 4CSPA 3KWWB 4H5SA 4OGYH 4F9PA 3B2XA 4Z76A 3OJMB 4M7LH 3U0PB 3K6SB 2A83B 1FZOB 4TPRH 5FA4A 3G6DH 1M2VA 5I0ZA 2QQKH 1NMBL 3C6SB 2XXCB 1WISA 1HE7A 1MELA 5IEHA 1WT5A 2X4NB 1E4WL 4XNXH 4K07A 4TS6A 4XMKL 4TVPD 4EDXA 1NDTA 1P7QA 4GQQA 3E7JA 4I18C 4OGAC 4QRPA 3RNQB 1IBGH 3DETC 2YSSB 3V9EA 2YGQA 3WU1A 1QLRA 1VF5C 1FF5A 1IVLA 3ERXA 3CBJB 1OW0A 5AW9B 2YGPA 1H8NA 1T83A 4NCDA 1YNTF 4X80H 3LV3A 4RA3A 1CBVH 4H40A 1D5IH 1B0GB 4GAJL 4P05A 4ACPA 4G82A 3KAAA 4FKHA 1PQZA 1I1CA 1RUKH 3MLRL 4TTDC 2VN7A 1BOYA 2UYLA 3QWNA 4S1SL 2OZ4H 3MLUH 1XGRA 1YQVL 3US9A 3QK0A 4QRQA 2ZXWB 3RPBA 2ADJA 1A7OH 4GRMA 5CD3A 4NC0B 4IBVA 1XGQA 3O6MH 3TTSA 3ZQ9A 5IVXB 2PTVA 4HC1H 1GC1L 1IAIH 2N7AA 1OAYH 1OGAE 1UVQA 2A9MH 4LE8A 3F58H 4O9HH 4XOCA 2F7QA 3BLBA 3EJSA 1CMOA 1T5XB 2GK2A 3H3KA 2GTWB 1SMAA 3GTNA 2X9ZA 4PRIE 4KK9D 1UFUA 4L3ED 4WWKC 4ZO8A 2NDFA 1N0LA 3K6NA 4NO5B 4RESB 5EOCH 2C8NA 4KKPA 1J8SA 3GUFA 1HH9B 1V55B 2OXGA 1DHKA 4XNUL 2YBRB 3IGAB 4XN1A 5DZJA 5EIQA 4A2LA 2ID5A 2XRAH 3GIVA 1MF2L 3ZDYF 1A25A 2VQ1B 4P9ML 3S6CA 1KBWA 5DVMA 1R3JA 1VIWA 4P3DA 5M7QA 2PR4H 4FS0A 4KMTH 1PAZA 1YNTB 4L1HA 5DTFB 1R0AH 1OPOA 2I9TA 4KQ0A 5IJBC 5L2KB 1AP2A 4A6YL 4XAWL 3A4FA 1OARL 3JV4A 4J4PD 3B7UX 5IKCB 3NIGF 1XCWA 2ZWYA 2FJGB 3FT9A 2WCGA 4TNFA 1DN0B 2L7EA 4P4KC 3WO4C 3AWFA 1RD6A 2GABA 3KPQA 4WI8A 2Y6SC 3QPKA 3P9MB 5I1KL 3CH1B 4TPRL 3LHAA 3WIIH 3BWUF 2YPLB 3QDMA 4PCYA 3DO3A 4DN4H 2Y07H 4JQIH 4AH2B 4AX3A 1O0VA 3NBNA 1MCJA 4R2GB 1ZVSB 2NY1C 3OHXA 3B3IA 2EVIA 4NX0A 3GSRA 3OMAB 5E4AA 1QLEH 3GS0A 3HRZB 3PHQA 3FH5A 3U4EB 3CZFA 4LFHD 3JWNG 4HMCA 1TVHB 4XVSH 1NFAA 3L3GA 1AR1B 3O45B 4LNVA 1L4IA 3BZ4A 3IXTB 4L18A 5FDYA 4ANXA 1RFDL 3ILQC 3VA2C 1MFVA 4LSVH 1NC4D 4BFJA 3OAUL 4WUKH 4IIZA 3D0AA 3K2MC 3DV4B 1AR1D 2R29H 5JHDA 8FABA 4O2FB 1GZQA 3CHQA 4PG2C 4YHIB 3EYVB 3MXWH 3SO3B 2XU9A 3S37L 2XYCA 2TRYA 1VGEL 1M6OA 3OKEA 4JG1H 1X5JA 3RNKA 4AEIH 4LXFA 1JPFA 3SDCC 3GUTB 5MI0C 5ADPH 5BCAA 1D7DA 4MSWA 3QI9C 2FZ3B 1JRHH 2WINB 4F8LA 1NCHA 4WV1A 1U3JA 1Z0MA 2DMCA 2VDQH 4JGJA 2R69L 3GB7B 1CWVA 3HKZA 1NFKA 1TQTA 3H85A 1U8OB 5DRNA 1KXTA 3GXPA 1Z9SA 5E9DA 3AB0B 5F7WC 5AKTA 1NMAH 3IJSB 2NUPB 1IC4L 4OKDA 1HQ4A 1BBJA 2VR7A 3MACH 5ACZB 4PJCA 2EKSB 4UQ9A 2DTMH 4N1EA 5I1DB 3EFFA 3QEGL 2VN6A 3LKQA 3CVBA 5D7HA 3RWEA 3V52L 5KYYB 1UM6L 4F2MA 4ZZKA 1IGCL 4Q9CA 3BH8B 3B9EA 3RURA 3UYPA 3FN9A 4PLJD 4QCIB 1KV7A 4CDHA 4NN7B 3RWJB 3RYMA 3I6GA 3SPJA 4HF5H 3FFCD 1F45A 1RL1A 2Q76B 3LRSA 3WDJA 1NCIA 1AHWA 3DIFA 4JQVA 4F7PB 1XAKA 4NQQA 3DKHA 1INDH 4YPJA 4XAKD 3FQXB 5CF3A 2H2SC 5DVLA 4UZSA 2E7CA 2IG2H 3II3A 2GQHA 3MLVL 4IGBA 2E8YA 5FF6B 3ILEA 3OSKA 4J23A 3UCRA 5E1GA 1QRNA 3IU3B 4FZ8L 1AOHA 4JFEE 3GTTA 3W0WD 1RURL 3BD4A 3PABA 4Z9KB 5I30H 3A4DA 2W38A 2QDWA 3UBHA 4WEUD 1QLFA 4X5RA 2OL3L 1X7QA 3DMMC 1HOCB 1X5LA 2P8PA 4Q9QL 4IKIA 2HKHH 3KXFA 4FYQA 2EDNA 4PW9A 2D31B 3OXSB 4X6EB 3W0WA 3WTXA 1PKQE 1YEKH 2BJML 1I7RA 3BGFB 1FL6A 2AZAA 3K72B 3MA7A 1IEHA 4BFOA 3CMOL 3IJ9A 1CGVA 2COQA 3QUZD 4NYLA 3HC0A 4NBYB 4QJ3B 1QNZH 2X53A 3QHFH 3D39D 3VFOB 3HRZA 2PW2B 5GGQH 3Q05A 4JFOA 3SPGA 4QRRE 4R26H 3HN8A 4JRLA 3RIFF 1CFMA 5KYNA 4MNHA 4GSDL 3TVMD 3PL6C 1UASA 1DQJB 1JGVL 2XCMC 4KHTL 5T1MA 3GXUB 2IDQA 4NUJA 3UTZA 2EO1A 3FO0L 5DO2D 1UWGL 1XGYL 4PWHA 32C2A 1KCUH 1KJ2L 3U0WL 1NDGA 5DZNA 3RAJH 3ZTNL 5DXWA 3DSFH 5DD3L 4Z7WA 5HHVH 2ZUSA 1B0RA 8FABB 4PJGB 4KPHH 5T3XE 2FJHA 5AAMC 5FO7A 4MB4A 3F62A 3W11C 4OFYA 3FB7A 4RGOH 4PGJA 1NCWL 3S96B 5FO9B 1Y1UA 5I18H 2Y0SA 4P04A 4Q58C 1FIGL 4W9GC 4A6YH 5JHAA 4WI9A 3ZT6A 3GPSA 2BSDA 4OTXL 2LU3A 2CJUH 2ENSA 5BV7B 3CH8A 3WLBB 3WSQH 1KCWA 2JK5B 3IFOB 2ZOLA 2W9EL 1JF1A 2J55A 1T0NB 1B3IA 3CUPA 5F97E 1EEYB 1MF2H 2AXFA 1QFWL 2CRMA 1KXTB 1MXDA 4A2FA 3REWA 4F1ZA 3CCHB 4UNTA 4MDJA 3ME0B 1RZIA 2XTSA 3VQMA 3I9GL 3QJVB 4H7VA 3NJMA 4Y4HB 1UD4A 3G5XA 1EERB 3PHOA 5SX5H 3ZUNC 2LHAA 5IM7B 3D25A 4TTGA 1VLXA 4L23A 5TD4A 3WFCH 1JCKA 2GFBA 4XHJC 5FK9A 1BZ9B 2EC9U 1HSBB 3H3PH 2DL9A 1UKQA 3HCVB 2YQBA 4K5PA 2HFEA 1U8IB 5E00A 5G5DB 5BZDA 4PGZA 4GSXA 2OSWA 2Z7UA 5DURB 3MPCA 3VRLE 1UB5A 2BRQA 3UTSD 4EIZC 2OMUA 2VISA 4FJZA 5BVPL 1YYLH 3L1FA 4N2KA 5TQ0L 1ANUA 3GI9H 4H8VA 3VFMB 1ZHNA 2YAFA 1U8KB 1K5NB 2X05A 1YZZA 3CC1A 2ZWSA 3BD5A 1NDMA 4CBPA 4B27A 2Q8AH 4LIQH 1AKPA 3UJJL 3GLAA 4M62H 5INDB 4M5YL 1Z2KA 4HGMA 5E03A 1N10A 4W9FC 4N0YH 3KDMA 5AVVB 1CF8H 3ROLA 1KJVA 4WUUA 3BEVB 4G9FA 4PJ5B 3ZHNA 2C9RA 1MCRA 3TEXA 2MCPH 3ISYA 2VSKB 1SM3H 2P42B 5C0JB 1DQQA 2APBA 2P5WE 4LCIH 4BCYA 5D70L 3MLWH 3WN5B 2IF7A 1A2YB 1MKFA 5DUJA 1MIMH 3K74B 1MNUH 3UMNA 1A9EB 3V7AE 1BBDL 4YHLH 2HVJB 2J1YA 1UZ6F 4MNGA 4NB7A 4P2RB 4ELKA 5AG8A 2WXOA 3AREB 4TUJB 1N5AA 1TZIB 5I18L 4TLUA 3NA9L 5J3HD 4OCYH 2FSEA 2A9CA 2E75C 2XFGB 1HK6A 1AXTH 1I8UA 1HHGA 1JGDB 2NUTA 3EO9L 1YY9D 4NRXB 3Q2VA 5B7FA 3JV6B 3HI1B 4KPHL 3NJVA 4YLBA 3BVTA 1G6RL 2O30A 2ORBH 5T1DH 2Y1AA 3GSNB 1CDJA 1Q94A 3ARGB 3JTSB 4N0UB 1EAPA 1G7IB 3DX7A 3IDNB 1IAKB 4M6OH 4WFHE 5KAQF 2FECI 2K3HA 2BX5A 2OSLA 2UUDK 4I0PC 4ZMOA 1CR9H 2R1WA 4PPTA 4M5ZL 4Y4KD 5D5MF 5TGBB 3VWJC 1IE4A 3SDAC 1MLCB 3MHZA 4DTGL 2OZNA 4YDNA 3H3PL 5DT1L 2WVTA 2CNZA 3FT2B 3Q8BA 3N9GL 2MMXA 3LPOA 3CXFA 1CTOA 1LEIB 3GWJA 5HJBA 3SYAA 3FU7A 4OIIL 1XH3A 3L9YA 5E2VH 5LCVH 4JANA 4LSQL 4X8JA 2XQBL 5KYWA 1CGUA 4QKTA 1CLCA 2ITEA 1FCGA 4RMRA 5F3BB 2R56H 1WBXA 3QULA 3NP3A 1DQIA 3QUYB 1F4YH 4B60A 4PRBB 5AW0B 4KDWA 4ES8A 1QBAA 2OTPA 2E59A 2D0GA 2FSDA 4RWHA 5DJDB 1P5UB 3VXRD 3AZUA 2JIXA 1BVKB 2ENPA 2WWOA 4KZCA 2VAJA 4Z76B 2J44A 1DLFH 1KYUA 1ZVNA 3CV5A 5HYJE 5DYOB 3DOHA 5F7MC 4ZW5A 2BSRA 1X5GA 1IGYB 4YH6A 3EJYD 1JK8A 3FUMA 4PD4K 2R27A 2A1WH 1CLZL 2NTFB 1C08A 4MMXC 4Y9BA 5IB3B 4R3SB 5AB9A 1T0OA 2FBJL 5JPNB 4ZMQA 1JI1A 3QE5A 2QQKL 4GUCA 3H9SB 3QAZB 3ZZQA 1J9RA 3GHEL 3I9PA 1DEDA 1FC1A 4MMZC 4QRUA 1C8QA 2DKMA 5G4NA 1J0JA 1PMYA 2CD0A 4JB9L 2YPVL 1E2VA 2CHWA 3N91A 3APFA 2QPFA 4MCYB 1ZOXA 4UIMA 1XF4A 4Z7VB 1GGTA 4XVTL 3TO4A 1RUML 4Y4KC 3JWDC 3T77A 1A6PA 1G7QB 4IMKA 4X5PA 3LZOA 3TIDA 2R0LL 5EPMA 3BAJA 4BELD 1TYEB 2VXUL 2IDCA 4FFTA 4KV5E 4YE4L 5LWYH 4KH2A 4JY4B 4AWJC 2AEOA 4CAGA 3ELQA 1Q9OA 1RJCA 1K3IA 3ALPA 2Y23A 4NGHL 4TXVB 4HKXA 4G6MH 3TIEB 2OTUA 3I85A 2E3VA 5GGSA 2HT2D 4AIZB 3DVIA 1G43A 2FIKB 1OALA 1DQDH 4Q89A 2DICA 1P84J 2V0AA 4R83A 4DP6X 3NK3A 4U1KB 2X12A 1LDSA 1P4IL 1LE9B 3VXSE 4QJ4B 4ZFFB 4OUUB 3S0PA 15C8H 1G84A 3TYGH 3QEQB 4PJAF 1KXVA 3S7GA 1JPGB 3KPOA 2YKLL 3HG5A 2EIZA 5T1LD 4P2RA 4ELKB 3MJ8B 5L8KB 3MLZH 4FQJL 4NSKA 4CNIA 5EA0H 4NJAH 5AEAA 3LXUX 4HMDA 1BJMA 3T6QC 1B2YA 4XAKE 5HGAB 2BIHA 4BUHA 4GW5B 2XN9B 1IBHA 3UO8B 3BPLC 4KX7A 1U33A 1SY6H 4JFEB 3QEQD 4U33A 5IB2B 2GEQA 2ZKHH 3IGAA 2YKKA 4OVUA 3D2UD 2EE0A 2KYIA 2H26B 2ARJQ 4P2AA 1QO3A 4HS8H 5IFAL 4YUEH 4K2UH 3HZ3A 1DJSA 2HLAB 3KPLB 4JFPB 3FCSB 1I1FA 4JY6B 1VENA 4MA3A 3SO5A 2RACA 3GDBA 3LPPA 3VMPA 1J8KA 1KCSH 3OG6B 4N0FA 4PJDB 4C59B 3CFJB 2RH0A 1LP9E 1C5CL 4PRDA 1PDKB 2RR3A 2Y2YA 2WGNB 4DKEH 1WA2X 4MSWB 3QDJA 4TVUA 4FQIL 1W72B 4MS6A 4XCFL 2TAAA 1GGIH 4Z95L 1YNKL 4E9TA 5K9KB 2JQMA 1KJ2B 3TBBA 3DRTB 3SDXE 3X13B 4Z6AT 2CLZB 2EEXA 3O4OB 3V4VH 5L8LB 1FJ1B 3L9BA 3VVWA 4OR1A 4G7SB 4U6XB 1QFUH 3AACA 4RFEB 1CLYH 2E9BA 5D7KD 4PWEA 4Y5YC 5TE7H 5KTEL 3C8KA 5LGKA 3D87B 1XCXA 2ZUQB 3DVNB 3MV9A 4Z0XA 2H32A 1URZA 2XDHA 1RLWA 4U1GB 3I6KB 2WXFA 1OE3A 2D2OA 1WG3A 5SWSD 2V7NA 4G7YL 3O6LL 1C7SA 5KVEL 4LB8A 3H9SE 3BWUC 4YHNA 1I3RA 1SM3L 3L5IA 1MEXL 3Q13A 4F15C 1BQHG 1AD9B 2X4QB 4BJLA 4ODSL 2R29L 4YDVA 5FFGA 2GVYA 3FSVA 1B6UA 3L1OH 3V5KB 1GIGL 4PR5B 4E9RA 2XQYA 5E8PB 1H3VA 4GMSL 4PJDF 4UMGA 1XL6A 2B9BA 1JBJA 1A6TA 2KDYA 2UZIH 3O9WC 1F2XK 3GKZA 3OLEA 1C8PA 1F90L 2KLTA 3QHZH 3RVUD 3UPRA 4HKBA 4HK3N 1M56B 4QXTA 1KFAH 4EUPB 2MHAB 4QAWA 1ODUA 2EIJB 1TJHL 5DVNA 2VDNH 1IMHC 4OFKA 1P0SE 4L29A 3FCUB 4PJ8C 4R4FH 5DEGA 1IILE 5I8EA 3JVGC 2VLJB 4K73A 4LASL 2XTLA 1ZV5A 1T7YA 1MVUA 1EUUA 2P8PB 3EH4B 3F7YA 3MBWB 3QZLA 3CN1A 4XPAH 3OTTA 4NKMA 4PFEA 5D4JA 3ILPB 3U0TB 5I28A 3DO7A 3GO1H 1IAOB 5DEFA 3OKYA 4JO4L 4BH8B 2M2DA 1VPOL 3RU8L 2PP8A 1RHFA 2BWIA 4W9JC 2A2QT 1LD9A 4M7KH 2VAAA 3CLFL 4LCCA 1I8MA 3DV6A 3IDMA 3IDYC 2QSQA 2IXQA 2ZT9C 4AL8C 5IHLB 2WBKA 4IMLB 1A6WH 4U0RC 1R17A 3FQNA 4YHOL 1MDTA 4OFQA 3GSOB 2UWEA 1BZQK 2KLRA 3BPNB 2BNQB 3FN3A 3ZO0A 5CJXC 2CR3A 4YMPA 1ZLWH 4W70A 3VGHA 1PF3A 1DBJH 3ZUCA 3DXAE 2CLVB 3MCKA 3T2OA 3N0AA 1QRND 4K3DL 4F80A 2H26A 3QWQB 1TVBB 3UADA 4I1PA 1DE4B 1ZA3A 1FNLA 5C8JB 1FO0H 2XLLA 3ZDYB 5BRPA 1M3IA 2BY0A 1BG1A 3BDYH 5DWUH 1DL7L 2VITA 1INQA 4NQEA 3FO1B 3WD5H 4FNQA 1ZDQA 4X7TA 4L0PB 4UTAL 1A7PL 5GS0D 1NGYA 1QFOA 2ZP0T 2EAEA 4PRID 4YFLI 2D3LA 4EI5C 1DR9A 4ZX3A 2XWCA 3D08A 2LLGA 4PTUA 1MI5D 1XIWD 1RKRA 1V8HA 4D9QE 1U36A 4ZYKB 4KH9A 3CUPB 3A3YB 5E24E 1NGXA 3HS0A 1QFWM 2EQDA 1KIPB 3O3UN 3OL2A 5GGRY 4YXKL 2Y7SA 1A0QL 4P5TB 3SO3C 4EI6A 2NXZC 4RNRB 1YQVH 4Q8BA 3NZ8A 5KVGE 4N4YB 2WAQA 2RB8A 4KHTH 5BPPA 2WWNA 3QZWB 5I8CB 2UXVA 5JUEH 2IGTA 2UY7B 4GAJH 5I2IB 4O2EB 2G5UA 2Q2EB 5CCGE 3TEWA 2BP3A 3BZEB 1HSAB 1ETJA 1NCAL 5E00B 3HPJB 3ZDXB 1QPXA 4BKLB 5L7XH 1WAAA 3QRGH 4FL4B 1EEQA 4HWEH 4J1UA 3LZFL 4JKPH 4M7LT 4G9FD 1XV8A 4TNGA 4QYOB 3WV0A 4TQIA 2I26N 3MOBH 2OYKA 5KYXA 4MJ2A 5TDNA 4FLHA 1FO0A 2AXHA 2DIAA 1NOLA 2PYFA 3UBFA 4OW6A 3DSNA 1B0GA 3OX8B 4H25A 4MKTA 1W91A 4FE9A 1KFGA 3K0WA 4CW1A 5ACMA 3GSUB 1J7VR 3X11B 3MBEA 4IU3A 3N1FC 3CXHJ 5KOMC 1MHCA 3U4BH 2YC1B 3AW5A 1XIWC 1AC6A 4GG8A 4X0NA 5EIIB 3ZTJG 3BYYA 1LEKB 2PWGA 3SCMD 1R3LA 1TQCC 4B3EA 1FNEB 5ENWB 3Q8EA 1MAMH 3SKOB 2PCPA 1LNUB 3V6FB 1LEGA 4AYMC 2AAVA 3F01A 3EYOA 4HCRH 4TUOA 3HG1B 1MW0A 3TA3B 5EO9A 3HMXH 1S7UA 1ZVYA 3OXRB 1YHPA 5MENE 3EJUA 1KNOB 4PGEA 3TWYA 3MV8E 3EUDA 1JXGA 4JFUA 3HCVA 2VKXA 2LQRA 5D7SL 3GI8L 3LH9A 1BZEA 3D0VB 1HNYA 2DLFL 4NO5A 5HDQH 3GGWA 3U4AA 4AE0A 5DS8A 3NIGE 3LPGA 3QPQC 1IAKA 1E90A 3RWFB 4G6FB 4Y2DB 2A6KA 1F11A 1JS4A 4MCZB 3BMVA 2WLIA 5EEUA 2R2BA 4A7TA 5JIHA 2YA0A 5DTFA 4X6CB 2P28B 2ATKB 1WD9A 3EZ8A 3L4TA 1OAYL 4ZS7L 4ZFZA 4Z78B 2IO5A 3L2NA 5KVDE 1J12A 2HT3C 1X9RA 3V4UH 1RHHA 2NPLX 7PAZA 1YDPA 3NT0A 4O58L 1SOQA 3H9HA 4FQJH 1KELL 1RZJC 1ZCRA 3GZPA 4HWEL 4L8BB 2LTQC 3JWNE 4P5RA 1AGCA 3GBML 1FAIH 4IJ3B 5I5RA 1N4XL 3DOSB 3DROB 4PRBA 3QP3A 3FSAA 3MZGB 1UKSA 2VDQB 3DYMA 5A3ID 4NRZA 1UH3A 2DQUL 2P8MA 1G4RA 3B34A 5FV2A 1ZSDB 4YHZH 1KZYA 1CGSH 3DDFA 5JW5B 2BC4A 3D69B 3D12B 5IZ7A 3OZKA 2MTPA 5F7LB 2NSMA 3MUHL 4O02H 1CFQB 5BS0A 5CLXA 4Z3GA 3D3VB 5LWYL 2W9LA 1DQJA 3Q9PA 2QFRA 5GQBA 4MVBD 3T3PF 4ZX6A 2KZBA 2WKLA 3MRDB 2IANB 2A0LD 1L0YA 5FYLH 2BXZA 1QSED 4XP5H 4XVTH 2RFXB 4AI7A 2GBTA 1BWWA 3VGBA 2F8IA 1KTJA 3HB3C 3BT2H 5J13C 3VA6A 3VU1A 4Z7VF 2FWOB 4EIBA 4Q6IA 3ABKB 3ARXA 2X44D 4PMEA 5D2LF 3PXLA 5AD0A 3P3TA 4MB1A 4NFBA 4K23L 2G75B 2BNQD 3QNZB 4QGYA 4BCZA 4QUOA 5MENB 1E5CA 1NINA 4EXPX 3FTGA 1JPST 2NW2B 1MUJA 1WFOA 2Z65C 2X2HA 3GSUA 4XVJH 5I73C 2JIXB 2UYLB 4WWKD 3A5VA 3UYOD 1T0NA 2BHUA 2WXHA 1NC2A 4MXVF 4L5FL 3FQTB 4RBPK 4J28A 2CO4A 3P11H 5LGHL 4GB9A 5T5FH 2H1PH 4A6YA 2FK9A 3MNVB 5IOKA 3BRGC 1WCBA 2EXYD 4UWQB 3VWKC 1D5XB 1LJMA 1OP9A 3CHPA 1U4EA 2I7SA 3LS5H 3MRIB 4HCIA 5EOTA 5C86A 5DMKB 1PY4A 1E6JL 3WJLA 1V5JA 2DWSA 2VDPB 3PNWB 2YAPA 1AGFA 3SJVD 2WXMA 2BFVH 2HLFD 1A3LL 1YSOA 4NCC1 2P8LA 1YRKA 2PKDA 3WHE1 1T5XA 2MFNA 1BQHB 4H88H 2GIMA 1QO3B 2XFXA 1G7QA 3JWNC 3PF2A 4EZJA 3MV8A 1MRCL 3MRJA 3MJGX 1RUKL 3MLRH 5DD0H 4AJ0A 2OXGB 4LHUB 4PJ7A 4KVPA 4N1HB 5MEND 1NCDH 2CO1A 4LLQB 2Y1ZA 1KYAA 4H8WH 3CFJA 2JB6B 1YG9A 2N3JA 1J86A 1TT6A 2HN7B 4AGNA 2ZCLL 2VRQA 5D5MB 4HUNB 4EUPG 3HFML 2F08A 3GI8H 2HFGL 4CSSA 4JPWH 1ECZA 3PQYE 2CU9A 2DIEA 1PLAA 3JSSA 3RI5F 4L8BA 4F37F 4NHCL 5KYUB 1KXQE 1BAWA 2MNJB 1D3CA 3QXVA 4U1NB 5GISH 3SY0B 3L95B 3ET9F 3ARDA 1SMOA 4RGMC 3ZKNC 2P1YA 4UNIA 5E2JA 1IAII 4NN6B 5C9JA 3MI6A 3PL6A 1A3RL 4FFYA 4MAYC 4V2CB 4ZAKB 5KTEH 3D51A 5JHLA 3BO8B 4PJ9C 2VDLL 3S3BB 4YSOA 4POYA 4C56D 2W65B 3G6JA 3RQ3A 1OGPA 5DO8A 2YMOA 3DA0A 5C0IA 1BYOA 2IV8A 3M17A 2QMJA 3EYFB 1CFQA 4KNSA 4HH9B 1Y6NR 2X0UA 3D18A 5I6XC 2GJZA 1VKXA 4HD9A 2Q8BL 4NO2A 5HI4C 4I88A 3KMDA 2X6BA 4ZMNA 2QKIC 4JDTH 3QWRA 3OWRA 1OTSC 4IM8A 4ETYA 3ULVF 1AS6A 3L1EA 4S2SA 1CGSL 2DMKA 3DV4A 1LWRA 2ZP8A 3A0OA 3SQOH 4MRCA 5KBNC 5C0AA 2B2XL 1QSEA 1L9QA 4O4YH 3IPFA 3K6DA 4FFVD 3INUL 4IHOA 3Q6FA 4LEXH 1XH3B 5GRVL 3UG5A 2JKIS 1TR7A 3Q5OA 5HDRA 4TOYH 3CDGB 3ORJA 2YS4A 1N6QH 2CCVA 2G5BA 1CFTB 3DUUB 3H53A 5B39G 3JT2A 2Z1PA 5MENA 4ZK8A 4B0MM 1JV2A 4JPQA 1KBVA 3S2CA 4HWUA 2OMXB 3TT1H 3VFGL 3QO0B 4AVKA 3CK0H 2ZOKA 1ZIAA 2C26A 3GMPB 3ZL2A 5H8DA 6TAAA 5D6CB 3QNXA 4WHDA 1T7VA 4PLOB 1JZ2A 3HJEA 2WUCH 2VH5H 4P23C 5F9JA 3K46A 3VXPA 2C7UB 3NMEA 4PY7A 4V2BA 5DRXB 4HU8A 3HAEA 1N0XH 4LCUA 1E2WA 3LZNA 3LQAC 3KLHD 1N7MH 3C9NA 2OMZB 3BEWA 3RTQA 2R0ZH 4J5VA 2XVLA 4G1MB 1IQDA 1MCKA 2GSIA 4IS6B 2GTWA 4K3EH 1Q0EA 4LO9A 1ROWA 4M1DH 4YGAB 5DURD 1GZPB 3GSNL 3V6OE 3FU8A 4XRCA 1CUOA 4LSSL 5EWIH 3KLAB 2DL2A 1T66D 1XCTA 4A37A 2J21A 4D9QD 3B9AA 3FO1A 5ICZA 1OAXL 3L6FA 3MNWA 1IEAA 2ZPKH 5LN8A 2VL5A 1VHPA 2R59A 1M7UA 3F83A 2GI7A 2J8HA 4P2OB 2BVPA 3OKMB 3P77B 5I6OA 5JXED 4E41A 4OGAD 5DCCA 3QDGA 4E9VA 4W6YB 3DJZA 2BVYA 3S97C 1K85A 1PNCA 3UBXB 1NCGA 4QT5A 3FW6A 1S9KC 3VJ6B 3ZDZE 3D06A 2RA1A 3H9YA 2X1OA 3V6ZB 2IGLA 1AQ8A 1JNNH 3NSJA 2YLKA 2EIZB 3LD8B 1AIZA 4G70B 4HPOH 4RNRA 3TNNB 3V4VL 4HUMB 4WKXA 4FYRA 2DMBA 1XCQA 2NY4C 4HGKC 1S7SB 3IFLL 1HXKA 4P59L 4N22A 4XNYH 3CPLB 2NTSP 4U3HA 1KGYE 2Y06L 4YR6B 4K9EC 3F7LA 1QSFB 4L2YA 3X1NA 4X6EA 1DLFL 1ETA1 1P53A 2WYIA 1XF1A 4GRLC 4JFEA 1S9VB 4KY1L 3WNIA 2XWDA 3INUH 2IG2L 3MLVH 4LEXL 4OD1H 1SYVB 4XMWA 1OP3K 4HH8A 1KACB 2PLTA 3KPRA 3OKKB 4XMVA 1U21A 3SGKA 2DQCH 1FZKB 1RZ8A 2I24N 4WDIA 4ZQTA 4PJ9A 5AAPA 3TBVA 4BDVA 1NLBL 2QBWA 1M53A 2JKLA 4GS7C 4C56E 3GMMB 4PJFA 3HR5A 3HUJE 3O0RH 4FQHA 5E2WH 1ONQB 1HOEA 4ZJ9A 1UADC 2IEPA 1I7UA 4N2FA 2Q87A 1UUSA 3K81A 2B16A 4G9FE 1EJOH 3QDJB 4BFEA 4UM9A 2J7LA 4N2BA 3KM1A 1EXGA 4PMFA 3H55A 1ORSB 4NQDB 4Z7VE 3SE3C 1TQBB 2BSEA 2F7RA 4JHAL 4ENZA 3D30A 2R2EA 1F6AB 1H3WM 1NCCH 2C1OB 3QEQE 2V2WB 5AKSA 1SJVA 4KRNA 2ZCKL 3MZTA 1G87A 2ILLA 1NIFA 4GI9A 1DVZA 3QQ4A 5T1DL 4Z7OB 5DF0A 3UMTA 4EI6B 4JFVA 1MFBH 4NC2B 3ZN6A 1VACA 5EU6A 2F74A 1H8LA 1IQWL 2DQEL 5ACZA 4BGLA 1EO8H 5JW3L 3SOBH 2OYPA 3ZBMA 4NNYB 2YIHA 5KG9A 1UACL 4U2ZA 5D1ZA 3H1ZA 3P4OA 1XGRB 7FABL 2CKBB 3E6HB 4Z95H 2YHGA 4PP1D 4ZW6A 3HE7D 4P23D 4FQPA 4XP1L 2BSSB 4N87A 5ICYB 5J57B 4RQQB 2B5IC 3ZKMC 1E9OA 1RPKA 2F58H 2NNFA 2E7LC 1LTXA 2NZ9D 3GJEB 3ARWA 1S5HB 1G7JA 1B2WL 1M7XA 3KD4A 3QHFL 3KNBA 4JLRA 5CIPB 2ZG2A 1UWXH 4P5KA 1PKQB 4DSYA 5DZAA 1I1YA 1AXSB 1CYWA 2IAAC 4U1LA 3T8XB 3ZE0B 1CI3M 1M05A 4DZ8B 3G08A 3MBEB 4IJTA 4FQXD 4IU3B 4UTBL 3T4YA 3GXFA 3ZDZF 3LEYH 1Q38A 5DQ9B 4U1IB 2WQUA 5JIDA 3WUWB 1OB1B 3WBDA 3KPSE 3ZO9A 4OCSL 3OSVA 4EF3A 5T3ZD 2PUQT 1EJOL 3QUXB 4L1SA 1GC1H 1IAIL 3VDCA 4RFNB 1IE5A 1TZHA 2IFFL 3RX8A 2O1AA 2AVGA 1QBML 2QVMA 2RCSL 4OVVA 1JD9A 4U4BA 5FXCH 3RY5A 4FXKA 4JDVB 4KNUA 1OF2B 5IMKB 4WO4C 3C5ZB 4H1LA 4PJCF 5CSZA 1TO4A 1KEML 3D1MC 4LSDA 4A2DA 1IFHL 4KQ4H 2EXSA 3MKGA 1WS7A 3MUJA 3SB3A 3V4VB 1D5MB 3R7QA 3CFIC 4ODHL 4OJYA 4XVOA 1VJSA 3P69A 1MI5A 1ZKAA 4XCEB 4X4XB 4RAVA 5FKPB 5FUZL 1OIOA 5AB2A 4H44C 3FBKA 2W9EH 4MTMA 1AJ7L 4XMLH 2Y2TA 3WJMB 4F57L 3LNIA 4FQCL 3WTVA 1UXSA 5D2NA 3SDAD 1P1ZA 1HI6B 1GJIA 4Y5XA 2BMKA 1CN4A 1T20A 1VFMA 5GJSL 2VDRH 3Q2WA 4CMMA 2QVIA 5AW3B 2F61A 1OD9A 4NN5B 1WP6A 5KVFL 5C7XH 1YEFL 2AJVL 4GUPA 5EU4A 5CGBA 1RZ8B 4DFHA 4DZBB 2NY5C 5JW4N 2MSPA 4QDGA 5CU9A 3SQBA 3ZHKA 4Z7WB 4MA3B 1T1XA 2FBRA 4PJ7F 1GS6X 3BQUA 3IJHB 2IMNA 2BS71 2R0WH 3X14A 4FNLL 3SN6N 3KYOB 4NUJB 3TH3T 2PWDA 5DRZA 2VABB 1WIPA 3BESR 1WEJH 3T5WA 4LLVB 5E8NA 4BKSC 3MOAH 2GI0A 3H4FA 4TNVK 5JPMA 1WHOA 4UM9D 3D3VD 1X44A 2C1OA 4AGMA 1A1OB 5GS2H 1J9QA 4LPTA 5GRWA 5SWZE 3DTDA 1AIFB 2AV7B 4PP2B 3ZVVA 3EUUA 2ZJSL 4YS4A 3DIVA 3NRQA 3QDAA 1UH2A 2MCG1 2A5UA 3LRMA 4AQAA 2Z1KA 25C8H 1HE8A 1FSKC 1SQ2N 2VLME 1RZQA 3DBXA 3IWUA 2BDNH 3ECBA 2FZ3A 3QO1B 1U8LB 1K6QH 1UVQB 3D3VA 4AK1A 1X5HA 1F3DH 2PXYA 5EUOA 5FDWB 1OSYA 2WUCL 3SCMB 2WPGA 5CCKL 3EO1A 2HJFA 3RWEB 5EEZA 3OAUH 4WUKL 5C70A 1UGKA 4CVXA 5GZNC 4FQXC 3T1FA 4M3HA 4XE0A 4ZFQA 1Z9SB 4U6VH 4A2EA 1FP5A 1I8LA 3MGAA 5IJCC 2NUPA 3ABGA 1AYRA 2J5LC 1ZSHA 3I6GB 5E9NA 3FS9A 1DJXA 3S35X 3FHEA 2ATPA 2QADD 4QOKD 2EE3A 2IDSA 1H3TA 2Z8SA 5HYFA 1A22B 2HPOA 1LO4L 5D93C 4Z7WF 3II1A 5E9DE 1CQYA 3DVGB 1NUGA 2LW3A 1I3GH 3LXAA 2ED6A 1OP4A 1UH4A 2YMTA 4ZXBD 3LN4A 3U7WL 1ZMYA 3KCPA 5FCUH 1VB9A 3UTTD 3HE7C 2ICEC 5IV2A 4PGCA 1FZJB 5DSCB 3VXQB 3WFHA 2O6PA 3W56A 2DWTA 4C58B 5TE4L 2AQQA 2P5WD 5KSVA 2R51A 2DJMA 1GOFA 1J8HA 4X4ME 5C3IA 1GCFA 5IQ7H 3E8UL 1IAMA 4UQCA 4HFUL 1IEBB 4PRAB 3F7YB 3GINA 4KK6C 2Y7QB 5EU3A 4B95C 4DTGH 1N19A 1DSFL 1GCYA 1DBAH 1MG2C 4UDUB 2V8LA 2I5YH 1QRKA 3MV01 1CDYA 3NTCL 1Z3GL 2F7IA 3ATDA 1FG2A 4JDTL 2WN2A 1T1YB 2WBXA 4IBWA 1DSYA 1SFDA 3KPPA 3GSVB 5KVGL 2AJYL 3ZKQD 1PEZA 1PLGL 5JR1H 1DUYA 4P2QE 3E3QC 1P5VA 3GS7A 3L5WA 2I25N 2NXYD 4MYWB 4TQ8A 5J06A 4LL1A 1WH0A 2VLKE 3HUJA 4H26A 2EDQA 3VDAA 4WO4A 5KN5A 4HCRA 4AT6B 5CJOL 5BRZE 1MHPL 3D0LA 2X89A 1T2QH 3C8HA 4JG5A 4LHUD 5I8OL 1AGDA 1WLHA 3RY6C 5I1JL 3QISA 2W95A 5AWNL 4J6RL 3RGVB 3FUJA 2EINB 1QFHA 2LLLA 2K1MA 1FE8H 2XQ0A 2B15A 4NZRL 1RI8A 3JTBA 1NCAH 3TWCH 4LCWA 4U6VL 4MXVE 1T7XA 4G3YH 3SDXA 2DWXA 2ZF9A 2Z8WC 2GCYB 3ZDXE 3FDWA 2GC4C 4UQ2A 3DX7B 2VXQH 3HS0C 2D0FA 4PRDB 4Y5XC 5JUEL 2ZAIA 4P2CG 2BVEA 2PO6A 4LVOB 1FI8C 4BXSV 3N41F 1FHNA 1RIVH 4HJ0C 1P9MC 1I8KA 1MIEL 3L3OC 3OKOB 2GJPA 4ZFOA 4D7PA 1MPAL 5LXGL 4YLCA 4UCFA 3I9GH 2ARJB 3GSXB 1MCQA 3I2CL 3X13A 4XXWC 2YPKB 3MRBB 1AXIB 1B90A 3QNFA 3QPQD 1AKJA 5A2IH 2YD9A 4PRIB 2H3NA 3CXHK 4M7ZC 5HHXH 2ZCHL 1V3KA 2JIXD 3IJEA 4ZOAA 4WGVB 4A68A 3FK3A 5I5JA 5IJVA 3UTPD 4OB5H 4I0KA 4AC2A 4ABWA 4ONFH 5EN2B 2BOLA 4HXAH 4OT1H 2AMGA 1MVYA 5GJTL 4LSPL 2J3SA 4HWBL 1HSBA 3MUZ1 4KNTA 2BSRB 3LPFA 4MHHI 4JR9L 1RUQH 2AC0A 3TEZA 5E8DL 4GAGL 5GS0H 3QUXD 3WFDL 4B5EA 1TSRA 1KYFA 1D6EB 3K1DA 4FLOA 1TJGL 5H2BA 5CKGA 4HOZA 2F54A 2FWOA 2DDQH 4NUPA 3EBGA 2OCFD 4P2QD 5KBKA 1H9DA 2WOYA 2WCPA 1GL4B 4B7LA 1XCTB 3FQRA 4DQOL 4TQHA 3PV6B 3QQNA 3ZKXC 4OTXH 3HPLB 1F02I 3H54A 3OM3B 2Y9RT 4ZMVA 5FUZH 4FKEA 1E3XA 2XUWA 2YD5A 2ADFH 2FWSA 4QOKE 4DESA 1X6LA 4XHJD 2EKJA 1MHCB 5J0BA 1B4RA 3BEVA 1PX8A 4U1KA 4P99A 3FQTA 3UJJH 5DI8B 4X98A 4JO4H 1KCVL 2A74C 3EJZC 4JL2A 1KDIA 1JNLL 1FDLL 4Q9RL 1MCHA 2FX7H 1Q9OB 2VE6B 3EG9B 5LNEA 5DEGB 5CMAA 4E5XG 3U6RB 2OPCA 5E6IB 3VXRA 1RJZA 1U8JB 3O3EB 4I87A 3RUGF 1ZLEA 1VCAA 2EXTA 3NDYE 5DQDH 3TA3D 1QUNA 5FYJE 4GKSA 1HHGB 3SZ6A 3GBNL 3U46A 3SDYL 1JCVA 4UTBH 4EMZA 3IU4L 4IRSB 4YIQA 3CZJA 3OLGA 3ZTEA 4K94L 1EZSA 4KFMA 5IB1B 4NZ8A 3L3GB 3ZMNA 4DKFH 3AMKA 2HT2C 5F7NC 4WFGE 4NM8H 1PJWA 1TZIA 5DHYA 2WKOF 1G0DA 3LSOB 3TBVB 3U9PL 3L1OL 2VXSH 5GGTH 5F7UA 3GEFA 4I7ZC 1NAKH 5I76A 2D7QA 2GITA 5IJDC 3GBDA 4P3DB 1LP9A 2X1PA 3VRLF 3G7TA 4HF5L 4MMYB 1FFOA 2CR0A 4E41B 2OX5B 4FNUA 4GAAA 5IW3A 3ZL1A 5FWRA 2IMMA 1CU4H