5IUCA

Crystal structure of the gspb siglec domain with sialyl t antigen bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
DTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVVRWLYSNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Platelet binding protein GspB
publication title A structural model for binding of the serine-rich repeat adhesin GspB to host carbohydrate receptors.
pubmed doi rcsb
source organism Streptococcus gordonii
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iucA00
5IUCA 3QC5X 3QC6X
chains in the Genus database with same CATH superfamily
2VLJB 1AZUA 1Z9SB 4KJYB 4N6RB 1RIHH 4DEPB 2MRYA 5JOPD 3KLHC 5D7JA 4M43L 1GYUA 3VNZA 3EJRA 2A6KB 4M4RB 4MVBC 1OXYA 3TTYA 2C3VB 4P3DA 4AIXA 5FOBB 1JHKL 2ERJC 3IFPB 2B1HH 1BEXA 1NM9A 2NTSP 4KKQA 1EDYA 2J6EH 4NQUA 4MJJA 5CEZL 4KQ4L 1FVEA 4EZJA 2F54D 4NI6A 3N1PC 3GSNB 1TYRA 5I6XB 5DURD 1EJOH 4G5AA 2NX5A 3O0LA 4ACPA 1QLFA 2QVIA 4H1LB 4OB5L 3TA4D 4AQOA 4AZ8B 2AQTA 2DBJA 1YUHB 1FNLA 1FHNA 1RZKC 4PMEA 1S7RA 1BD2A 1H3VA 5B38A 1IARB 2V17L 4XO9A 3AUWB 4F7TA 3DV6A 1YEJH 1SFDA 3QORA 1XO8A 4RH4A 3K6OA 5HYJE 5DO2D 4GMTL 4I89A 1FORL 4R4FH 5J11C 5J1TC 1DLHB 2G3MA 1OAQL 5HD8D 2OK0L 1KNOB 2DL9A 2WY3B 1A6TB 3CJJA 4FMFA 4D0CB 4OCXH 4APQA 3FFCB 1TFHA 3VCLB 1JVLA 2CJTA 4XP6H 3STLB 1EHKB 3W81A 3GHEH 2X4SA 1N6UA 1EGJA 4GRMA 3L3DA 3LOWA 3TBSA 2IBGA 4Y88A 3CZEA 5F9OH 3OB0K 5DRNB 5FO7A 5IFJA 5JLZB 1ESOA 3WIFB 4H8VA 4LLWB 1J1XL 4KROD 5DUBB 4F9PC 5IG7A 1AOZA 3VFOB 3HIZA 4KKPA 1RZIA 2GHWB 3QI9C 3SYAA 4DP2X 5L2KB 3HVDA 2QZQA 4O9HH 4J23A 1X7QA 2EYRA 1BOGB 2AK1H 2WN3A 4WO0A 4HJJH 3W9DB 4AX3A 3VX0A 1W72H 2HH0H 2X2YA 2OS7A 3MBXL 4LQFH 4RCAA 1BJMA 2QFPA 5KBLA 1FVDA 2FUQA 5KSAB 4G7VL 1OZUA 2DV6A 5TQ2L 4TQHA 4JO8A 4I13B 4KHXH 4GG8B 1HHGB 4NRXA 5CLZA 4PVMA 5F1NA 2QEJA 3MXWL 2OYLA 2RALA 3IEAA 3ZX1A 4MAUL 4C58B 3N1QC 3E38A 4J7RA 3KLAA 5FF6A 1UH4A 2IAMB 4IRSB 3O0RH 5LWYL 2NXZD 3DDFA 4HSAC 3ATAA 1N4XH 2VR3A 3TEYA 2F6AA 3LXAA 4YMPA 5KVFL 2M8XA 2HTLD 3VXQB 4J39A 4G6AD 4NQCD 5JHDB 2WQSA 2CKBL 1IC0A 4YE4H 2VJ8A 3IDGA 5ERWA 4BQ8A 3T0DA 2YN3A 3TVMD 3VWJA 4L4JA 1XWVA 1T5XB 5AOLA 5IBLD 4JANA 4LASL 4MQXD 1FPTH 2J20A 1X4YA 1S78D 2VAJA 5JIHA 3HVNA 2OR7A 4A1RA 2D7MA 5T1DL 3DXAE 3V6ZA 3WELA 1DUZB 1QPKA 4KK6D 1L5GB 2DLFH 2ZSWB 1T21A 1BQHG 1KJVA 4YPGA 4GRLB 4R7DB 1ZSDA 3UJIH 1VGKA 2E74C 5TDNA 1VEMA 3G6AB 5JW3L 3D4CA 4FQ2L 3D6GA 3UTQB 3VYPA 5G55A 4PJEA 4PPTA 4YNYB 1NWPA 3FTYA 3OC5A 3SDXF 2V33A 3GSOA 5DGRA 2DWYA 1U33A 4ONFH 4WV1A 5HVHC 1A5FH 3EYQC 4JFED 3TBWA 2OXHA 1PIGA 2H2SD 3L5XH 3ERXA 2AANA 2OMVA 3D07A 3ALPA 2ATAA 2L0DA 1AG6A 4FQHB 4Z7OE 4HUKB 3PIQA 4HUUB 4MKMA 3V95A 2XQ0A 4YDKL 4D9QE 3GSQB 3QUYA 3UC0H 3MRFA 3O8XD 3SDDD 3PWNB 1TMCB 3GJEA 1KB5H 4APXB 2ZKHH 5D1XE 1YHPA 4YHOH 3FOMA 2YS4A 3BUYB 3TBBA 3CXDL 4N8CH 5DVNA 4OFIA 3WE6B 3TESA 4G9FA 1T1ZA 2AFNA 4QR7A 3KYOA 1TJMA 3DMMB 1SNRA 2RQ8A 2R0KL 5F1IB 1E27A 4KROC 3SSGA 1B9KA 3QR2A 3TNNA 2JJSC 2XY1A 3G08A 3RTQD 1MCQA 2HX9A 1MCPL 1NCOA 2IANE 2WYTA 1I1AB 3ROLB 1H3UA 1OGAD 4AEIL 5KOVC 3GIZH 4KX8A 4CN1A 1Z0MA 1BLIA 2GK2A 5AUMA 4WWOA 2WMPA 4GSQA 3K5RA 4YDZA 1E50A 2EE6A 2FUTA 4Z5RA 2ENYA 4JPWH 3VD3A 4GMSH 2NSMA 4R4NC 2GC7C 3FNKA 3HI6H 4F7PA 3WTTA 1E3FA 2NYYD 4XMUA 3O3BB 1MNUL 4P4KB 1I8LC 4M5YL 2IWFA 1PAMA 5FYKD 5C97A 3NBNA 4LK4A 4OI9A 3CH8A 5E4AA 2XFXA 4YHPB 1ZT7A 3JTSA 2GBTA 2YWZA 1HE7A 4AEEA 4GH7B 3APMA 2OMXB 4HXBH 2NCEA 3FOLB 3N5AA 3QJFA 5FDWA 4Q4IA 4K07A 1JDDA 1LK2A 5DD0L 4PI2A 2DLGA 1YEHH 4P2RE 5TH2B 1D3CA 1H3XA 2OMWB 3PY9A 5F1KC 4LPTA 2E4TA 4I7ZC 3TVMC 3K6SB 3QH3B 5D96B 3HAEG 3TC9A 1MPAL 1MQKH 3P9LA 5DJZB 1OWRM 3EF7A 3HRZA 4G80A 3VXRD 3X1GA 1C5CL 4XMPL 2FBJL 1A6UL 2UZPA 1E9PA 3RRQA 4U2ZA 3K71B 3L5HA 4M1DL 1RZQA 2NY7L 2E8ZA 3MJ9A 3L54A 1D2OA 2X1QA 4YDIL 3JWNG 3DRTA 5I8CA 5FUOL 1JXDA 1U42A 2P49B 1DEEB 2P5EE 3WNKA 3ZDYE 3NEEA 4L4VD 2FLMA 4WO4A 4R84A 3EGXB 4JM4L 3H6AA 3LN5A 4GAJL 1ZTXL 3ZSSA 4ZDHA 1NGYB 4PJAE 1J12A 4HGKC 4RWYH 1JGEB 3LIZA 3EDKA 3QPQD 3KCPB 3U0WL 1FRGL 5EOQH 3RWGA 4GXFA 3RPBA 3BAJA 1UB6A 3IPFA 4TUJA 5AKSA 1IJ9A 3ELAT 3OMIB 3HMXL 5DMIL 4PJGB 4OCSH 1QO3A 2LU7A 3A6BL 4Z3JA 3LJ3A 1DJHA 2PF6A 2VZ1A 3UPRB 3SDDC 4ZFZA 3RGBA 1F90L 1E7VA 5IHWA 4JRYE 1Z9OA 2ZWNA 3GXIA 4Q7DA 5MEND 2CM5A 4GW1A 2V3FA 5C6PB 4YZFE 1ADQA 3RWFB 2ALAA 1COBA 4OGAD 3WEMA 2BNRE 3VMNA 2ZUUA 1ZIBA 4FQXB 3ZLQC 1XEUA 2WZPD 2WIMA 4TQ8A 3G5VB 4AV5A 4WI7A 2PKDA 1CDUA 1VFOA 4FHBD 2O5ZL 4NUMA 3SGDI 2CO1A 2WSDA 4KMTH 1HDMB 3DO4A 3GLDA 4WJG3 3RDTB 3HZ3A 4EO5A 1B4JL 4F2MB 4JBSA 4X7TA 2ZUWA 2YAPA 4JY5H 4CN4A 1DZBA 4KVNH 3LKRA 4RAUB 2BVPB 2BRQA 4P2OA 5AYQA 3SDAB 2R0ZH 3QNXA 2KQNA 4KRNA 3I6GA 4U3HA 4FQJL 1ZY9A 3NAAH 5BW7C 1UWEH 5I1GL 3D8MA 4JFXA 3P4NA 4MQSB 4S1SH 5BVJA 4OJCA 1XDTT 1VRSA 1E0OB 3WEOA 5AB0A 4YAQB 1T0OA 3KWWB 5I1KL 2CIKA 3O81A 3KPSB 1PDKA 5BRZA 4PRNB 4CADB 4YSAA 3UTTD 3W9EB 2W5PA 3HFMH 3RWJB 1E43A 4XVJH 1UD4A 3KZ8A 2VXUL 5EU6A 3C60D 4IK7A 4KZCA 4V1DD 4CL7A 1RUPH 4N0CC 3AG3B 4XCYA 5DFTA 2HJLA 5CINH 1A1NA 3DX4A 3MBEC 4RNRA 5JXAH 1W16A 1MCNA 3IDMA 4MAZA 4NHUB 3VU2A 4ES8A 3BC9A 5D7IE 3CFBB 5KYWB 2VLKD 3FSOA 5CCGE 1KBGL 3RL1B 5KVEE 1J9SA 4CC4C 3WMSA 3QPKA 1A6VL 5K59F 1E8YA 1Z5HA 4UIKH 2PCYA 2Z35B 2ZWLT 2YUWA 4IRZA 3IFLH 4YWGL 5KS9B 3SODB 4PGDB 4XX1G 4AGMA 3V4VB 2D0FA 2WYHA 4ZUTB 3WHXB 4CILA 2XA3A 3ARGB 3KWVA 2HN7A 4I0PC 5HHQB 3QPQC 2Q3XA 3HPLA 3MNWB 2FLBT 4WWID 3V0JA 1TTBA 2VABA 1HKLH 1UJTA 2ZUTA 1II4E 4PG9A 5EZIL 4YHIB 2YXFA 3BEVB 4YBLC 1YY8A 1CIDA 4Y16D 1UB5B 2I5YH 4UZGA 4ZAKA 1H5BC 3CXHK 4KI5D 3RVUC 1MFBL 2QQLL 2VZUA 1U8PA 2FBRA 4HH9B 2PCFB 1GPOH 3LH2L 2BY0A 2VDKL 2VM9A 4JG5A 4DKEL 4M8VA 4ZPTB 1RLWA 4OGAC 2EDJA 2VISA 2IG2H 4OJEH 3GBDA 4ZPVA 4R96B 4QKTA 1JP5A 5B38G 3O4LA 3SY0A 1CFQA 5CP3A 2ZX7A 1FAIL 3FN3A 5HGAB 3RYMA 2ZTBA 5KOMC 3P4OB 1OO2A 3UADA 5F3FA 2Q2LA 4AYEC 2BDNH 3BN9D 4O5LL 4Q9BA 4X6CF 4F5CE 3S9DB 3VFPA 2ICEC 4CSTA 3FQ4A 4G2AA 4Y5VC 1GGIH 1WC7A 3SD5A 3WJMA 2J8UF 4HJ0C 1EAQA 1QP1A 2A1WH 3QARA 5I8OL 5JORA 6FABH 1CTMA 4EN3D 3CLEL 5EOCL 1H9VA 2J56A 2WO4A 5HDQH 1V3JA 4R83A 3VNYA 3ZL4H 3P0YH 4FTDA 2AK4B 1UOKA 1NFDB 3CFKA 3SKNB 4MA1B 1IEBA 2FHBA 4XCNA 4M7LL 4ODWA 3QNZB 2XVBA 3FHQA 5E9DE 3DVGB 3SB3A 5GHWH 1AFVL 4LCWB 3FRPB 2NY0D 3Q2LA 3U2SA 2V5MA 4IBSA 3OJMB 4DKFH 1S7WB 3UO1H 1HINH 4NQDB 2ZX8A 5MP6L 4X6BA 4JMNA 5HVFB 5EN2A 4I18C 4YZWA 3DHPA 4QRSB 1P5VB 3C6LC 4XP5H 3S88H 2NY3B 2I85A 3L4VA 4OKVA 2UVEA 3BZFB 3DJZA 4JDTH 2ZKXA 2XXGA 3EG9A 2I69A 4WGWB 2PYFB 1AJ7L 4XI5D 1T2QL 4HZ1A 1B0GB 1IM9D 2FYYB 4AC4A 2YR3A 4HS3B 4UQ2B 4H8WH 1J9TA 4X4YB 3GLZA 1JUFA 3FU0A 3MUGB 1SEBB 4BYHA 4XPGH 4HBCL 3RZCA 1ERNA 1HQ4B 1HL8A 4G3YH 1YZZA 4HCIA 1ZK9A 1KACB 1AGCA 1NEZA 4M29A 5DJDB 2NZ1A 2NXYC 4KDWA 2J1WA 4NC0B 4Y16C 7PAZA 4OGZA 2H32H 4K9EC 1Z0NA 3DVFA 1LP9F 4IJTA 3RA7L 4KI5C 3N9GL 1YJDC 4NKQB 4ZYKB 3QEQB 1OHQA 2J4WL 3ULVC 4C56A 4N5UA 2ZXWB 3LY6A 3DX2A 2VAAB 5IUSA 4DVRL 2MFNA 1QFWL 5IFHH 5F72S 1NFIB 4LVNB 4HLZH 1QLRA 1WAAF 4JFDA 1BVNP 4Y5YA 1UCTA 2YA0A 5C0GA 1J5CA 5I9QC 3L7EA 3MRBA 3OHXB 4YHMH 5DLMH 5IMOA 3EHBD 3KEHA 5IJBC 1LE5B 1TEFA 2EKSB 3SDXE 1YVLA 4Z7NB 3KXFD 5F3BB 1LO2L 3OAUH 3L95A 3N85H 5EC1A 5I1CL 1I7RB 3N41F 3T6ZA 1IL1B 1WV7T 3BN9C 4LP8A 1KTKE 4ES9A 1G7JA 3D50A 1UVQB 3CGTA 3I6LD 1CICA 2BIHA 4XO4A 1YNKH 1FO0A 1Z9LA 3VI3B 2VLMD 4HWBH 2V5TA 4R4BB 1P4LA 3QDHA 1IC1A 2RR3A 3IGAB 2XVLA 3GSNH 3NCMA 5I6LA 3BSZL 4J27A 3H0TB 3RNKB 4H1LH 1V8HA 4M6NH 2X4NA 4J1UA 2YBRA 5AG8A 1QMUA 1RJCA 2GY7B 4FNLH 4QOKD 1KLGA 4MMXA 4NUGH 5I1EL 3MRNB 2BHFA 4XNQA 4M93C 4CVXB 2ZX9A 1SXNA 2BSCA 4OFKA 1D9KA 4LSDA 5LNGA 2BSED 3DTXA 1UTDA 3O3DA 1BCIA 1I3UA 4Z77B 5HHNB 4X98B 1IAOA 3LPWA 4I4WB 1NINA 3QULA 4HMCA 4UMGA 3VU1A 1UZ8B 3WN6A 1QSVA 2QHRL 1NCDH 3IGKA 1QBMH 4OLYL 3KJ4C 4LU5L 1JNLL 4YPJA 2OMYB 3EYOA 1HJBC 1IGJB 3MRMA 1ROCA 4JM2B 3QIUC 4PBWD 1OALA 5AW0B 3DJSA 1DSYA 1UZ6F 4IMLB 1R24B 3VDAA 1F4WH 5AOKA 5EO0B 4E41E 2MOVA 4ALAL 2GSGA 2R2EA 3VUAA 3SDCD 2D3VA 1CF8L 4BFBD 5J12B 4MJ5B 2GCYB 1QD0A 4X0NA 3VO0A 1GGBH 4ZNEA 5D1ZA 1OEZW 2W92A 4WY7H 1FL5B 3AG4B 3CSTA 3QHTC 1SHSA 5ANMB 4XI5C 1FIGL 1KB9J 3AQZA 4FE9A 1BVKB 2WIIA 1GGTA 4H2CA 5CIPB 2YD3A 2UZYB 1KBBA 5F9WB 2R9HC 4AIZB 1TQBC 2ZWKA 3FAXA 4Y19E 2OMNA 3QI9A 4KQ3H 4U1SA 3QDJB 5JA8B 4QXGL 4YLCA 4ZW3A 3AXLA 3OR7B 4N0RA 5CP7A 1ZSHA 2OQJA 3E3QE 2VQ4A 3EOBA 3H9SA 3N0PB 2EIDA 4J3VA 1V7MH 5BJTB 3DTDA 6TAAA 4DTGH 1NBZA 1HFUA 1HH9B 3BQVA 3O6KL 2XXMB 3SE9L 4U1MA 4LAJH 1EO8H 7FABH 2I26N 1X9UA 3EHBC 1HNYA 3HG0A 4BDVA 2Y7QA 5J7CC 4R5XA 2EIMB 4HXAL 1MFAL 4Q6KA 4JHAH 5T8IA 3FJTA 4KTEL 4BUHA 5DZNA 8PAZA 3QZBA 4FQ1H 2FECI 5FGBA 2MNWA 3C9NA 4RDQF 1U58A 2EEFA 2VH5L 2GJ6B 2ZXGA 3EDEA 2RBLA 3SYQA 2APXA 3FSZA 3FONB 4LOEA 5KVGE 1J1PH 5IEHB 4BE5A 1BAFL 1AZCA 2BSSB 3GRWH 3WFCL 1DJWA 3KPMB 4FFVC 1O6VA 1KC5L 3L1FA 1A9EB 2GFBA 3FPXA 2EXYC 3MLSH 3MLUL 4N28A 5TGBA 3BT0A 4AT6B 2BK8A 4X6DB 5KS9F 3O6FC 1KPVA 2Z8SA 1RP8A 4PY7A 3HC0B 3LD8C 3WI9A 4HHAA 1CBVH 4K8RL 3RB5A 2NZ9D 1QKZH 1SQ2N 1JVOA 2FEDC 2TSAA 5BCAA 5I23A 1QR1B 3U1PA 5C8JB 1M7IA 3PWJA 4YGAB 2CDFB 1HAWA 2OR9L 3FFOA 5I66A 1WFIA 1TFPA 5FW7A 3TT1H 1P7BA 2VM4A 4EDXA 4IU3A 5KBPA 3WOVA 1LDPH 3TO4C 1BMWA 2ADIA 2XJKA 3ALWA 2DKSA 3ASNB 1BGXH 2A6DA 4K94C 5JNYA 2XG4A 1N0LB 1X5AA 4LPXA 15C8L 4WI2A 3FO1B 3RIFK 4XN1A 2JKJA 3A23A 4MZIA 5LO7A 5H2BB 3ZU8A 3L3OA 3GS7A 4JGJA 4G8AC 4OFYD 3U4KA 5GS1A 2DQDL 2IADB 2OMZB 2Z64C 1RK0A 5AW5B 3LKQB 5HDBF 1U4EA 4OLWH 2R69H 2BINA 3SDCC 4Z8FL 3P9WB 2V8LA 5E23A 1H9DA 3VRLF 1PPIA 3VQMA 3FH7A 1H6TA 5CJBA 4BCZA 1FI8C 3GSRA 4HIQA 1U92B 1HOEA 1IBYA 2JCCE 3Q13A 1UD8A 1GCYA 1Y18B 4K7FB 4PJEF 4TL5A 2ZKWA 2HG5B 4BQ9A 4O02L 3WLBB 2WCGA 2G75B 3M8OH 1W9XA 1R0AL 1S7SA 4WI4A 3OSVA 4Y2DA 5JPNB 2JJSA 3D39E 5KBMA 3QUHA 4IGBB 1U41A 3DETD 1QUNB 3HA0A 4HWNA 3HUJA 4U0RC 5FYLH 3SJVA 1T5KA 1CU4H 1S4IA 2DYPA 3KPRD 1Q0XH 5JQHC 4QRPA 1BLNB 3X2QB 5EO1A 1RVFH 2WWNA 1FA4A 3GI8H 3CPUA 4MAYB 1J5OH 2B77A 1N59B 4HAKA 3NP3A 3S36H 2QELA 1XCQB 4NT6A 4MX7A 2QBWA 2GTWA 2E27L 1BVZA 5CKAA 1KN4L 4HSCX 3IMSA 4NO0D 1MH5B 4R0LC 5K59E 3BVTA 4B9CA 4WLCA 3ZDWA 2FGZA 4KKZA 3EJQA 3MX0A 2WNKA 1G43A 1MEXL 2EEAA 5EU4B 5HJBA 2ZOLA 3GMRB 4ZTEA 3NVQA 1U6AH 1D5MB 2MMXA 1L7IH 2FEJA 4M8UA 5BOPA 5C0NC 1JYWA 4KY1L 5IVZB 2NY4B 4Z3EA 2PO6B 4NFBA 4M6OH 5DJCA 2DWSA 3B1UA 4Y2LA 2XBZA 3SPGA 1C16B 2FIKA 4W9CC 5C0BB 5I0ZA 4PREA 1D7CA 1KIRA 1UD6A 4ZOAA 3W39B 3FQYA 3OWEA 1UQSB 1AXTH 2ORBL 4JCLA 2YZ8A 4NHCH 5CGMA 1NAML 2X44D 1EAJA 1FZOB 1NWOA 2ZPKH 2X4QB 1XGTB 3BPOB 3PWVA 4PJCE 3FT1A 4LEBA 2XTJB 4P2AA 1Z2KA 3RWHA 3JV4A 2ATPB 2VITA 1HN1A 1KFAL 2H1PH 2VLRE 2AF2A 3PWPE 3B9KB 5HDWA 3UMTA 3SQOL 4PS4H 5JTWA 5B1KA 1JXFA 1R5VA 4MFHA 2HKFH 5DJXB 1A2YA 1BP3B 2MSPA 4ELMB 1QVOB 1HHKA 5GS0L 1CE1L 1XBDA 3P9MA 1QSZA 4LO9A 3BXNB 1A9BA 4FFYL 3M88A 2ZE0A 3ZL2A 2DLIA 1DP0A 2XTLA 1T2XA 5I24A 12E8H 4KI1A 2DB8A 1RKRA 3IKCB 2E7CA 4HC1H 4DGIH 2DQHL 4X6CE 2BLFA 2H6PB 5HY9B 3NSJA 1B88A 3GTNA 1FGVL 1KZYA 1P7KB 5DJ8B 2HX7A 2DWEB 3BUIA 2J8UE 3IKKA 4QRRB 3HBPA 2R7EB 3JWNE 1LXMA 2GI7A 3FQXB 2X2HA 4Z0BL 1BECA 1OAKH 5F9JA 1XH2A 4X7FC 4Y4KC 3ZOAA 3RX9A 2G5BB 1DQML 1ETA1 1MFNA 1U8JA 2FJGA 32C2A 4G43A 5ICXB 4B9ZA 2Y22A 3E6HA 4LCYA 4Z7NF 4E68A 3JSSA 3AY4A 4KVCH 3AS1A 3M86A 4TSAH 5CUSL 1WA2X 1ZHKB 3LN4B 3S35X 2B3IA 3OHMB 4NQTA 4ZNCD 1S8DA 4FTVB 5C08E 1IAIM 5CU9A 2CJ3A 3L2NA 4ONGL 4PS8A 3PQYE 2EDQA 4YVNA 4L8CA 2QGDA 5DVKA 4NLHA 1U2CA 1INDH 5D6DA 3MRDA 4UQBA 3DETC 2QSQA 3OB0H 3PGCB 5FO9A 4JHWL 1RL1A 1K72A 4JO3L 1CFVL 43CAB 4LDOB 3VX1A 1GSMA 1OCZB 1G1KA 2F53E 2FSDA 3I9GL 1ORSB 3P0GB 1LHZA 1TU2B 2XLLA 4WFGD 4OCNC 5I6KA 5KYUA 3CSPA 1G9NL 3UAAA 2B1AL 4GS7B 1T7XA 3SEPA 3F5WA 3APDA 3AM8C 3KBPA 4M4RA 5BW7A 1UHVA 2BS8A 2O1AA 4OBRA 4MMZC 5FOBA 5E24E 2H26B 4JN2B 2HFGH 5L4IA 3STZA 4WSGA 4FXGC 3BW9B 4MJ2A 4UU9A 4A38A 5D5MA 1EEUA 4IBVA 1L6PA 3SGKC 1CG9A 4HKZA 4NERA 5A7EA 2BIPA 3DRQA 5IESL 2G2RB 1KIPA 4NGHH 4OGXH 5AZUA 3QCVH 1EXHA 3F7YA 5FV2A 2WN2A 5IOPB 2CNZA 1NEZG 5LN8A 2WXHA 3NCFB 3NZ8B 4XNMA 2B9BA 2C7UA 2AJVH 3LRSA 1KLUA 2KH2B 2YPLB 1LP9E 2H1XA 3MBEA 3U83A 3IT8D 3K1KC 4DCQB 3QAQA 4ZUSB 3B3IA 1NGPL 1LJMA 3OV6A 4FHJA 3S5LA 1YCSA 3GUTA 4FF9A 1QSFE 2J6WA 2SEBA 2CLRA 1KNOA 1KGCE 3MRIB 4R7XA 2Z93A 1T20A 5I74C 4X9IA 2ED9A 3FT2A 1O6TA 4D0CA 3GLEA 1RFDH 2R29L 2XN9B 4XNXL 2JKNA 3FFCA 5GGRY 1MSPA 1WT5C 4AMKH 1VGEL 2HT3C 4LSVH 3BVWA 4FABH 1W15A 3ZSTA 3H2QA 4OLEA 4X5XB 2OZ4A 2AKRA 4I0PA 1EAPA 2XKUA 3CN2A 3L1OL 4J3OC 4FCAA 4NUJA 5TF1H 5EUOF 5IBTL 2WM0A 3ESUF 5IQLA 2CJUH 3L5WA 4UBDD 3C5SB 1IGFL 1I3VA 3F58L 5JLZA 5KVDL 4YBQD 3TU6A 1MLBB 2PTTB 3LHPL 1A6PA 1LWJA 4BFIB 1GHFH 4NSKA 2IBBA 3LNHA 4JKPL 3NJNA 5BQDA 3A4FA 4GBXB 5JO5B 5L2KA 1XGQB 1XCTB 5HGGS 4DZBA 1BOGA 1LNUB 1H5BA 2EE9A 2XKNB 4MGXA 4PJXA 5B21A 3T6WA 3TYGL 1F6AA 4QEGA 3JV5A 2AEPH 2FX7H 1MRDL 3VFRB 1QSED 3GXFA 4NIKB 1T5WB 1MELA 4Y1SA 5LHDA 1IC4L 1WCBA 4NM8L 1LO5B 2F54B 5E8DL 3GZKA 4JEGB 4UT9A 2VO8A 1DFBL 2P52A 5DURB 3H54A 4XPAL 1D6EA 3BESR 2DQGH 2GVYA 3TBCA 1OTTC 4NO3A 4NKIH 4HZLA 4R90L 1GSKA 4JG1H 2RB8A 2BOLA 3NSCA 4UQAA 3WAKA 2I07A 4W4NA 4R7NB 4W9IC 1PCSA 3MJ8A 1FJ1A 3SGDH 4XPTH 2J3SA 2OTUA 1UZ6E 2FQGA 5IK3B 5HVHB 3IE9A 4Y5VA 2HRPH 2NY5L 5DHVH 1AY1H 4NZTL 4BM7A 5SWQA 3O6MH 1HOCA 1NAKL 4P5MA 4QRFA 5GGUA 2R4RH 4PJ8D 2NX5E 3L1GA 3QUZC 3MJGX 2WCSA 4WCYL 1T0NA 5ID0B 1TIUA 2DKMA 4MXVE 3LMJH 4Y9CA 3BAIA 1BD2E 3QUXD 3IPEA 2DQIH 3VRIB 1BW8A 4LSTL 3PHOA 4ZZFA 5CFHA 2WGXA 2XWXA 1FF5A 1RJLA 5C07A 5DXWA 4WKXA 2ZSWA 5J8OA 1WISA 5C86A 4XP9H 5ALBL 2XY2A 4M6AA 4AUUA 2ZCLH 5C2UB 2E7DA 3WMQA 5M95B 1LO4L 1E2VA 3MMEB 1NM4A 1M1XB 4U1JA 1R46A 3VH8B 1KELL 3ARFD 4YXLL 3ABKB 5CZRA 4WFFE 5C0DA 4I1RA 3O11A 4QHUB 5FKAA 4S1QH 4MMYB 1OTUC 1IKNC 3KPOB 1RJZB 2JKTM 4I18A 2W60B 3UGEA 3C6LA 4HF5H 1NANH 1G6RL 1S5IL 3TEZA 4LGPB 5INCB 5JUEH 5E8PB 5FS5A 2I9LA 1IC7H 2QGBA 1BXXA 3IPBA 4NKDB 1DBBL 4ZFQA 2VE6A 1DBJL 4HIXL 2NXZB 3ZUCA 4YEEA 1XVSA 4EAEA 5IJVA 4PJFB 4MJ6B 3OKLA 1DQQA 2R69A 1Q90A 4B3VA 1DLFH 5KYXB 3O2WH 4ICWA 4UBDC 3ZDXF 5MEQB 1CGSH 3K6FA 3CC5B 3E8UH 4NQCB 5ECGA 5BO1H 3W38A 3KVQA 3NIFF 2ZSVB 4QO1B 2EIBA 2BVQB 3DSFH 5FYJD 2X9YA 4L8BA 3U36A 5B7FA 4MNQD 4ZX3A 2MQGA 3TVMB 3KYMB 3POHA 4DFIA 4A55A 3CVCA 2FR4A 3DHJA 3LRGA 3BWUC 5FK9A 1JYVA 4AE0A 4ZO8A 3MLTA 4NO5A 4B9YA 1LO0H 2WNGA 4HVBA 2N59A 3TO2A 4G6ML 4WVRA 4GSUA 4P9MH 3QCUH 4PGCA 4FA6A 3EJYC 1OQXA 4JHUA 3O3BA 4FULA 4PVLA 3WKMH 4JQIH 3L81A 4DHLA 2P8PB 4KNUA 5IVXB 4UV7H 3VTAA 1GJIA 2FCBA 3TJHC 2V2WB 1AQDA 3ARDB 5E8EB 1JGUH 3LS4H 1KPRA 1I9JH 3T0VA 1EBAA 1K9TA 2CPCA 2JI1A 2OV0A 3RWIB 4AJYV 5DUJA 4DP9X 1CTOA 4JFEB 5D2LA 3QR0A 4BFGA 2TRYA 2XT1B 4ORZC 5ALCL 2C34A 3V7MA 1KJMB 1CGUA 2OMWA 3VRLE 1SLWA 3SOBH 3K6SA 2DI8A 3QH3A 3WL9A 5C7XL 1X9RA 4WUUA 2VMFA 4L3CA 4BXSV 1FCGA 1J88A 3O8XB 4Z7QF 3SDDB 1I9EA 3ZQXA 3L3GB 2A3TA 4PJEE 3P4MB 2YBGA 1N0XL 4HPOL 1Z3RA 2GITB 1YQ2A 2VLLB 1DJYA 5FCUL 2WNWA 3MUJA 1OWWA 1QR4A 4FCHA 3S4SB 3HE7D 3DUHA 4UT6L 4UOJA 1B3JA 2ICES 4U7SA 1XGUB 3OTTA 3EGXA 5DFAA 1MCEA 1T1WA 3MO1B 5I6MA 2F7OA 2WXOA 2GIMA 3RTQB 2CRYA 2GUOB 4XOCA 1EERB 1NOFA 3ARFC 3PHQB 1OGAB 4HP5A 1CQKA 1R9FA 4WJ5B 1JGEA 4PSPA 2BWIA 1OLLA 2N01B 3TZVD 2XHNA 4MD5A 3T04D 4GQQA 3T77B 4FGMA 3MYJB 2B59B 3UFIA 5HHOA 2YGOA 4G8GA 4PWIA 4G9FE 3QP3A 3ZHDA 3D52A 4Y5XC 5T3ZL 1R3HA 3ABGA 1BFSA 5SV4A 1OM3H 3U7WL 4U1IB 3QIWC 1DQLL 3KPLB 3Q3GB 3ULUL 4OAWA 3ZUNC 1FYTD 2ROXA 4EQ3A 2X89D 5DEFB 3FRUB 1NLBL 1KMGA 4XCEB 1SOQA 1O6SA 4Q2ZA 1E2WA 4PTUA 4TLSA 3O41B 5EEXA 5JW4N 3NFSH 2ZP8A 3GGWA 3RKPA 3RWFA 3MACL 4AGLA 2P8MB 2PETA 2F7QA 4JPVL 3OKOA 1N64H 1U8KB 3GF8A 4HGMA 4IHOB 4CU8A 1RIHL 1UT1A 5HP5A 1F3RB 3KPPB 4XVSL 3INUL 3ZZQA 1IQDA 3VXRB 3BIKB 2A9MH 4BCXA 1CVSC 3MROA 4JFFA 1P84J 3A6OA 4F2MA 1A3RH 2B1HL 5F7LB 4PRHD 1MHHB 4XTRD 1BZQK 4LGRB 5K5YA 4OLXH 1KFGA 3WEXB 3U0PB 2NCMA 2X4OB 1JGDB 4PSRA 3QO1A 1UXMA 4RAVA 3KJ6H 5BS0D 1HXYB 1TG8A 3M1OA 1O7VA 3EDFA 2NPLX 4L4VB 4AJVA 4JAMA 3VE0B 4GQPH 2EO7A 2VL5A 1GTFA 2OI9C 4GAGH 4PP1D 4XXDA 4CW1B 4Q8BA 3UPAA 5ABAA 1NLDH 4NQED 4FLQA 1YEJL 2CHWA 5HJ3B 3S48A 3W9EA 1I3RB 5BZDA 4D0DB 4BEIA 2AXGA 3KHOA 2G2NA 2YGVA 1A64A 2XZCH 3IF1A 3LEYH 4NO2B 3VM5A 3O6FA 3T4YA 2WBJC 4XMXA 3FSWA 1BM3L 2GIYA 2CDGA 5D6CB 4KZEL 2PP9A 5FM5M 4OCXL 2LE9A 3QNYB 1BFOB 3CXFA 1MNNA 5D2NC 3WFDL 4GG6B 4K73A 2WVUA 2PXYD 2HAZA 4BZ2L 1Q0EA 2X1OA 3CFBA 1GOGA 4TRPH 4YL4A 2JF1A 4M48H 3TO4A 3WKQA 1BZ7A 4AL8H 4F57H 1KUMA 3PF2A 4ODSL 1ZANL 5HDBB 3IE4A 1JZ8A 1KLFA 1ND0A 4D9LL 2Z35A 3RWDA 1OK0A 3CHSA 3B5TA 4KDVA 4ZUTA 2R56H 1EZUA 1SXCA 3O2DH 4PJHB 3I74A 4P05A 1NIBA 4HLZG 4RMRA 3APFA 5TE4H 5HHQA 4DF9A 3AS2A 3MNWA 3TZVC 3VMOA 5GS3A 3V6OA 2AK1L 3WY3A 3GIVB 4ZD3H 3IJEB 2ICEB 1W72L 3BH9B 4LQFL 1FL3A 3RE0A 4MNGB 3F6LA 3P77A 3T0XA 3QB7C 4QRTB 3ZPDA 4B50A 4KJWD 1OB1B 4ADJA 1VACA 3CLFH 4B9KC 4XZUA 4NKOB 1KIUB 1UB5A 4YXKH 1M2VB 5GS2H 5IT2H 1CFNB 2AV7B 2CK2A 3BPLB 4BH8A 1UOWA 5EZLA 2K8MA 2PCFA 2WUBL 2X28A 1AC6A 5FM8A 3O3UN 1OPGL 2ENJA 4H1LG 1N4XL 3MRRA 4N2CA 4ZPTA 4U6VH 4M61B 5FGCB 9CGTA 1IZJA 3UTTB 3FN0H 4FMVA 1F1DA 4ZFOA 2CK0L 1VFAB 1CUOA 5EZOL 3M1BA 4EVNA 2X0VA 3C60B 4MCZB 4V1DB 4YE4L 5GZOA 5D70H 2AERT 5ECJE 3V5DB 4PJ7B 5L7XH 4ETQB 2AGJL 4I1PA 2OP4L 5T1MA 1XAUA 3S5LG 1RUMH 1DJXA 2B08A 3LPGA 4NZUL 1FPTL 2BRRH 5JIDA 4BSVB 4O51A 5C2BH 1KPUB 1CGTA 5I2IB 3B2XA 4R0LA 1CLCA 5BRZE 4YDJB 5C0EA 2VLKB 2X4TA 5LCVH 1HU8A 2DLFL 3S5ZA 4WTWA 5EU6E 1L0PA 1AKJA 4N26A 2Z0UA 3JWDL 4OQTA 3WTSA 2GTZA 1JWUB 3HUJF 5DHVA 1GZPB 3GXMA 2AK4A 1KGXA 4YSPA 3V4PL 1NEPA 2VOTA 4JZJC 3WAJA 1IFGA 3BSHA 1R34A 3QNZA 4M03A 35C8H 3QWOB 5T1LD 4HJEA 1A5FL 3FHAA 5C09B 2MQCA 5HYJD 1CGYA 2Q86A 1UM6L 4FFZH 4X80H 4LCWA 4DAGH 4IBTA 4P5KB 3CZJA 4JDZB 4ENZA 1NCCL 2XWZA 1YYMH 1N19A 2CA4A 3VXTB 4RGNC 1LO3H 1JRHH 4GAAA 1HL5A 4BV1A 3CFUA 5JOFB 3E1F1 3SKOB 1KB5L 4QHNA 2YLHA 1EX0A 3CIQA 3QIBD 3DLQR 2E9IA 4XP1L 3NA9H 1CGVA 2BSRB 2OSLA 4WI0B 4YHOL 3LYRA 3NN8A 4LCUB 2BVOA 4N8CL 3BUTA 4TVPL 3FB8A 2H45A 1NMAL 3GPEA 3IAGC 3VGEA 3QDGA 3MA7A 3O9WD 4GY4A 2F0CA 3ECUA 2XU9A 2EDKA 2XPGB 3OWRA 4GFTB 4TNVF 1B0GA 1DVTA 4JFYB 4OZFH 5BZZA 1CLZL 1NIFA 3DHUA 1BFVH 1JNHA 2CR0A 4PGJA 1JF6A 3BVNB 5GJSL 4EOWL 1HHIB 1SEQH 5JYMA 1XT5A 4I87A 4GMSL 5CO1A 1QTSA 5E4EC 4LRIC 5DJDA 1NJ9A 3UIZA 4EN3B 4HS6A 3O4LE 4L1SA 3F85A 3RBGA 1THCA 5AQ0A 4ZYKA 1RURL 5AW7B 2EILB 1M2OA 1TZGH 2VAAA 3MZGB 4HXBL 4AYMC 1JV5A 2QV2A 1CB4A 3KPNB 1P2CA 1YECH 2NTFB 3Q8BA 2DOCA 4LOUD 5C9KA 2WK2A 5AVQB 4WIQA 2UY6A 1ZLSH 5I1DB 3CFDA 1IIIA 1UOLA 4XMWA 1BVNT 2NY0B 3CZFB 4XGZB 3HG4A 5F3BA 4OUUB 4WWKC 4NQXA 2ZXBA 1MQKL 3QQ4A 5DQ9B 1IL1A 1QTPA 1NBYB 1Z66A 1RXLA 1SPDA 3QE5A 1R3IH 4Z7WB 3LEVH 5J1AB 5FKPA 4CDHA 1XMWA 1JGLH 1OAXL 4BFJA 3DXAD 4R4BA 3AM8A 4YHNA 2IPTH 3IGAA 1A21A 3FU9A 3QXTA 4MMZA 1XGYH 1VA9A 2UXTA 3R06B 1AQKH 4LP5A 1JD9A 4XMLL 5IW6A 4JJ5A 1IGMH 3SGKA 3MLYH 4AYFB 4YLQT 5D7KE 3F7LA 1EEZA 2P1YA 3HPJB 3UXFA 1IM9B 3LVTA 4YC2C 3UTOA 1CXHA 3FCSA 4RAHA 4Z77A 2LU5A 4GI8A 1FP5A 1BVLB 5LXGL 4KK9D 1RZGA 3G6JE 4I4WA 1W0VB 4HU8A 4PS7A 1TQBB 3OXRB 5E00B 5EPMA 3NACH 3W11C 4NDMB 1GVIA 1RZPA 1QRNA 1JF5A 3OX8A 3QUKB 3CVHH 1XZ0A 2BCKB 3QEHA 3QQ3A 3HHSA 1HNGA 1A4JB 4D9QD 5HXMA 5LBSH 4Q14A 3TYFB 1G7QB 4HFUH 4IMLA 1IM3A 3EO0B 2VDLB 3DI2B 5D5MF 5KSUB 5D1XD 5EORH 4HAFA 2PUQT 2ZAGA 1IUZA 2OBGA 1RUQH 2A4EA 1F58H 4ZW6A 2EIJB 4FC3E 1SBSL 5CGYD 3B6SA 4D2NA 3EHBB 3HZKA 3GBMH 4U1NA 3VQLA 3HMWH 4O2CB 4D0BB 4GRWF 4PWHA 1Q72H 1ZIAA 3KXFB 4ZS7H 5IHHA 1BVKA 4K5OA 1AACA 3FUHA 1VDGA 2JWYA 1SDDA 2A5UA 2C9PA 3TGXA 4HG4J 4PWEA 4L23A 2OW6A 2IAND 2UZYA 4G8FB 4C56E 3ZZ1A 2OTWB 3EJTA 1FL6A 5ESQA 3BISA 3K0WA 3M1CA 4JFDE 4PJ6A 4HMDA 5B3JF 4ZT1A 1K5NB 1NFKA 1MCWW 4ZX6A 1MCSA 3LD8B 3HR5B 4P48A 4GKNB 3CHQA 3MJ7B 3NAAL 2OYKA 4QOKB 1WFMA 3KPTA 4HALA 2Q7YB 3II3A 1JPFB 4UQCA 5B22A 4MCNA 2ADGA 1DSFL 3L7FB 4HUVB 2W38A 4E9TA 5KSBA 3PL6C 5C0AA 4IBWA 1R4XA 2ICCA 2C3HA 3V0DA 4MB4A 3O3EB 3QQXA 4HIHB 2DICA 2P43B 1QOKA 4P2RD 3UDWA 4BXVA 4X4XB 5F7NC 3PNWA 4WI6A 5IB4B 1U2HA 1OT2A 5E8OB 2FATH 3N42F 2GJ6A 3D33A 4N1CA 4TPRH 4LKXB 3VYNA 2HLAA 2YGNA 5CINL 3FUIA 5KW9H 1THAA 2IFFH 3QUZA 2BSSA 4Z7VA 5JXAL 1LEKB 2UX6A 5EC2B 1G7PA 2FEEL 1PMYA 3S3DB 4X7SH 4WFEE 1AE6H 3SDCB 1NFAA 3BP6B 2A83A 2Y25A 5C71A 1NTDA 4M1GL 3LN9A 2P5ED 3EBAA 5AB9A 2ZCHL 5IQMA 1NGQL 3IJSA 3W57A 4PJ5A 3QRFM 3HKFA 2F7RA 3IFNH 3OPZH 1EIBA 1LWHA 4NKMA 4KKNA 1IKOP 3UJTL 5SWZA 4ZTPL 1SF5A 1I7ZA 1XB3A 1CT8A 4NWTH 5IW1B 1VHPA 4L8DB 1CZ8L 2WSPA 2P47B 1DBKL 1V3KA 2JCWA 1K3IA 3O4OB 4LNRA 3SYPA 3NIDF 1HKLL 1DN2A 2D2OA 3CD4A 1E8ZA 1I4FB 1QZ1A 4LEOB 4D8OA 3H4HA 4ZNEE 4N20A 3AQXA 2EDLA 2XYBA 2J88H 4JZNA 4LLVB 4G9DB 1G87A 2I5YL 1WBZB 3RWCA 4R97C 4H20H 3VD1A 4JRYD 2JXMA 4BH7B 2ZYSA 2Y7OA 3HG1A 3FU5A 4Z7IA 3ZT7A 5AVWB 5DUPL 5EBWB 2IWGA 3WSQL 2CCLA 2AABH 2EIKB 2MPVA 4P23A 1KT2B 3SKMB 3DX8A 4AQ1A 3P3TA 1U93B 3N2JA 4Y1TA 2BNRD 1OF2B 1L9TA 3S0PA 4LARL 4IQHA 3HS0B 2V6HA 3UERA 4OZ4A 2ZF9A 4G6FD 3UYPA 5LQBH 1J0IA 2IDUA 4AQAA 2CHDA 4XB7A 1F56A 1NICA 3H9SE 2G75A 4M5ZH 3WLBA 2EDMA 3WO3B 1HQRB 1OTSD 4PWGA 1QFWI 3LKPA 2Z4TA 4KXDA 3F6JA 4XBEL 5GGSB 2P3YA 3QZMA 4P5TC 4PGBB 3WXVL 4XXCA 5F7FA 3BYYA 4J8QA 4OLZH 5DA0B 4G8EB 3AITA 5E2TL 1AXSB 3B7RL 4ODBD 3L4ZA 1AXIB 3MRKB 5ESAA 3SCMA 6FABL 2V9TA 2OSYA 5FGRA 4E9XA 2C1PB 2KZKA 5CCHE 5IBUB 4PCKA 1ITBB 3V52L 4BGLA 4TVPD 1HYRC 4JB9H 1GYWA 1OGPA 2QSCL 3MRGB 4FI7A 4L4TA 4AK1A 3W0WA 1FFRA 3ZDZF 1FFNB 4M7JH 4U1KB 1WBXA 2VDQH 4MA8H 2F5BH 4RFNC 1E5UI 1M1SA 1A0QL 2BFVL 1I7UB 2E7LC 5IB2A 3IWVA 1JF1B 5FLVA 1CMOA 3KYNB 1U8LB 1ZA6B 5GHWL 5L9DH 3IGFA 3BGMB 3ETBJ 4O00A 3MRHB 2JK5A 4KI5F 1N8OE 3ULVF 1FG2B 3VXSA 3OKKA 1U21A 2EDWA 3QG7L 1PQZB 1W8OA 3MNDA 1P84K 5DO8A 3VFMA 3MRLB 5E2JA 3ZE0B 2XWJA 4XT1C 1EZVX 4LIQL 1ZPLA 1ZV2A 1TITA 3DV4B 3VFUB 4DKDC 2E86A 1TNMA 1DL7H 1BIIB 3CSYB 1CDGA 2QQKH 5E5LA 3SPVA 5JZ7D 4XE5B 2G4EA 5FYKU 5DZOA 2PWEA 1VERA 1EFXB 5IQ7L 3WFBH 3VMPA 3UBFA 2DH2A 5FECA 4J5VA 5CD3B 5IB1A 2R1WB 5DI8B 2ATPA 4EUPB 1JL8A 1PAZA 4JDTL 3EJJX 1WGOA 1Q1PA 3EJUA 4MRBA 1IQWH 1ED3A 4FFZA 2WXPA 1HEJC 2YJQA 1PU0A 4ELMA 3MLVL 3K2IA 3BUPA 1NMBH 1UM5H 1FN4A 5L0QC 4M8QA 1KJ3H 5D2LF 1WH0A 4H8WL 1WIPA 3L3KB 4M00A 2BWQA 2P24B 1TTUA 3SBWC 2C3GA 3GS0A 4J12A 1ECYA 3KPRB 1A14H 1N67A 3ZL1A 1RIUH 2R27A 4B27A 2VKXA 5FEBA 1PS3A 4XCFL 1IGIH 2CM6A 4WW2C 1N70A 2RFXA 5I76A 1EWHA 1F3DJ 3CDZB 4AYID 4Y5XA 4DGYL 1A6ZB 3JWOL 1PLGH 4K7PX 4NO0B 1JGIA 1PZSA 3FU7B 1L0QA 1AP2A 2CQVA 3SQRA 1BXAA 3DPBB 3QIWA 4RFOL 3S3PA 5A2IH 4CC1A 5LGKA 2ARJA 3EH1A 3HUJE 4LSSH 3SJVE 4EJ1C 4OZFA 3CIAA 4NWUH 1YDPA 1ETZA 2FHFA 1GXEA 3LZQA 4QRPE 5DLML 5DRZB 3LN4A 4NCDA 2L7EA 3IDNA 3VXUA 4FTVA 2QQNL 3GSUA 4XOEA 4FXGB 3FQNB 4QGYA 3T71A 1MFVA 4HK3J 3T1FB 4HWEH 2IH9A 1S7QB 2F5AL 4FQLH 2D4DA 4QHKJ 3FRPG 1IGYB 4HUXA 4ACTA 3MGTA 5HGBB 1YNKL 2QR0B 3EGDB 4ZS6C 5KANG 3OM3B 1AVAA 1BBJA 4YQXH 1A4BA 2NW2B 4HWBL 2D2CC 1X5XA 5CHNB 1MJUL 3ULSB 3D5OF 1SYVB 4NJAL 5IVOA 1YPZB 4HT1L 4RSVA 3S35L 4DGUA 5KSVB 3QFJA 4OW6A 2P26A 4M43H 4EI5A 8FABA 1Z32X 1H6UA 1WICA 3CFIC 4UDTB 3BP4B 3NSYA 3O3AA 5DK0A 5CJ5A 5IFAL 4B9GA 4XRCA 1NC4D 3CN1A 2YD5A 4IU2B 4NX0A 1QTYT 4FZEL 1JHKH 2GJZA 1XGPB 4NQSB 5E9DD 5F7WC 1B2YA 3DVIA 5C0IB 1E4JA 2G30A 1M7UA 2BOCB 2C9QA 3GT6A 3PAUA 4KQ4H 3UZQA 2K1MA 2G9KA 3CDYA 4L3FA 5ICYB 5B8CC 2GSIB 1KYFA 3U4EB 2X0UA 3D0LB 1CLOL 2ADJB 3D4ZA 5C70A 4L8SC 1HYSD 3NZ8A 4IKNA 1EJ6A 1CDYA 2WBJA 3GINA 4OB5H 3CPLB 1F4WL 4XNZC 2OMTB 2YPLA 1O7DE 2CH8A 3GEFA 5D2NA 4KPHH 5J6GA 1XR9B 3RUGB 3NTCL 1E8WA 1SXBA 4PJBB 1GGBL 4KVPA 4LLQB 4UILL 2FGWL 3ES6A 1FORH 3GSWA 2BW5A 5K1NA 4CN6A 1OAQH 3QFDA 2OK0H 3MREB 1ZHBB 2Q5BA 4HJTA 3UZVB 5INDB 1BQKA 3CVHA 5DQDL 3F12B 3WHE1 1U2YA 3CG8A 2XBDA 5LBSA 4Q4EA 3G5YB 2HT4D 3RHWK 1A1OA 2X2IA 1BWMA 2FHCA 3ZZSA 2OSWA 4YLBA 4OF8A 4MZRA 4B7LA 1NL0L 2HRLA 2EE3A 1MJ8L 2FWOB 4I9WE 4HCFA 4NYLA 3F2LA 5E5MB 4X50A 1TYJA 5JOEA 4GI6A 1CFTB 1FZMB 2BS71 4JFZL 4W9FC 1MLBA 4H7VA 4JFQA 5AAMC 4GLRI 4BFIA 4DTGL 4OZHA 2ZOUA 1J1XH 1Q9LB 4GBXA 1AZNA 5E8NB 5JO5A 1XGQA 3QZWA 4JRWA 1NH6A 2B16A 5IUCA 1LNUA 5J13B 1YC7A 4UM9D 4BHUI 3ILPB 1MFMA 4RBPK 2DQUH 5DHYA 1KEMH 5MI0B 4ZXBC 2YEZB 3MBXH 4MA7L 5F1OB 3PNRB 2BXZA 1MHCB 2VERN 1L3NA 1QA9B 4G7VH 2FTAA 3Q1SL 5TQ2H 4WSKA 1A6AB 3L9YA 4LF3A 1Q38A 3GMMB 6CGTA 1G7IB 2YPKB 4MAUH 1KSRA 3GRWL 2QKIA 3GQFA 5CZXD 2ZOOA 2EDHA 1DUYA 2AHIA 1XAKA 3MLSL 5LWYH 2D3JA 4FKKA 3LH9A 5LBGA 1BG9A 4JE0A 1G4MA 3SHSA 5D5ME 5CD5C 1QKZL 4PTTA 4WK2B 2PW1B 4LVOB 2CKBH 4A2GA 4G11A 3MV9D 4N0YL 1QACA 3CHRA 2Y3AA 4J3OG 3NIGE 4JRFA 4NQQA 5E1AA 4CMHB 4GRWE 2ZP0T 2F19L 2VR5A 4JZJA 5T1DH 2QMJA 2HTKD 3AS3A 3T65B 1JPGA 3CDGB 3IK2A 3LB6D 3MRQA 1NCNA 1I82A 4PWFA 5T3XL 1HYSC 3SE3C 5IM7B 2MHAB 1FLRL 4WHDA 5KZCD 1EXUB 1N8ZB 1YRKA 2X4RB 3FFCE 3J8F7 5JW3H 1WDAA 4E41D 3VFSB 3X17A 4IS6B 1D5RA 2EABA 5DJAA 4UI2A 2FD6L 5CS7A 2Z7WA 2CU9A 4K3JL 4MMYA 4XBPA 5T33L 1C08A 3WHE0 1RJZA 2AEWA 2JJWA 2COQA 4LMQE 4WTXA 3BI9X 5C1MB 4PB0L 2IPKB 4LGSB 2JIXD 4OCWH 1NDMA 4YDKH 2BO0A 1XHHA 3BX7C 3CNKA 5I28A 2HT4C 3NRQA 5L2KE 1EFQA 1Y07A 2X88A 2YRPA 4G1EB 4AWJC 4PJXE 4Y19D 1CU4L 4URTB 3QEUB 4BINA 3L6FB 3WFEH 3DIFB 3E7JA 4GAYB 2JMRA 3APCA 1PG7X 1R5IB 1RVFL 1CGXA 1MFCL 4HJGA 5DS2A 3GI9L 2LW3A 5IEKB 4QO1A 5F3HA 4JO2L 2XYCA 3VDCA 2BVQA 2OJ1A 1PSKH 4DK3A 1HH6A 1T1YB 1CPUA 1F4HA 1HXMB 2R0KH 3D51A 4LRIA 4PJ8B 4EXKA 1P5UB 1ROWA 3SZ6A 4UQ3B 3CZKA 5J5EA 1MCPH 3ECBB 4OCYL 1MY5A 2WTPA 2ED6A 3QUXB 3NJJA 2H3NB 4AEIH 4A6YA 3FCTA 2AEQH 2H0EA 2XQYA 1H15B 2ODHA 4Q9RH 5C6WH 3P30L 1U6AL 3LKSB 4HG4K 5HHME 4CJ0A 2J21A 1JD7A 3S34L 4P2CG 5BZWA 4JFOB 3NIDE 3VG0L 1GS7A 1U8IB 4M5YH 2QTEA 5EBMB 2P8PA 4WWKA 4LLDB 2QVFB 5ELIA 4NHCL 2YEQA 2KERA 3ARDA 3HZMB 3U7AA 4AXWB 2ZPKL 3PPSA 4F15B 3V6FB 1HKFA 5KEZA 5C07E 4C59B 3C2AH 4AIOA 4QAMB 5C3LD 2GEQA 3CFMA 1JHLH 1H6EA 2BIOA 1M56B 4XVUD 1PLCA 4U31A 2ICWJ 1KJMA 2ZNWA 4QT5B 4CGUB 4PS4L 3GBNL 1OPOA 2NT0A 4JRXA 5BQ7A 2HKFL 4HOWA 4J3UA 5DRWB 3C09C 3HG5A 1CLYL 2AXHA 3TA3C 1ZD6A 5DMKA 3V0HA 5AOZA 4NEHB 3H9ZA 1C5CH 4XMPH 2FBJH 1F4YH 1A6UH 1SJHB 2HTKC 2WQVA 3ZYIA 4YDLC 4ZMWA 12E8L 2NY7H 3RKDC 1YEEH 3ESNA 3LB6C 2UUDK 3VXOB 2J44A 4HC1L 3WU1A 4RZKA 5FUOH 3N55A 2XWTA 4GIPD 3R8QA 3W1ZA 2FZ3A 4Z78B 2Y3NA 3ZE2E 2VDLH 1XGUA 2DM3A 1JHTB 2GT9B 4P46C 4MNQB 3SBRA 3TV8A 1I8UA 5A7BA 2IEPA 3R0MA 2F8XC 3FO9A 2FH6A 1IBGH 3RI5K 3DO7B 1OAKL 4GAJH 4WJ5A 3BKMH 1P7QA 5BZXA 4WU5B 4OFDA 1KN2L 1KTLB 1ASQA 3OG6B 1FRGH 2YSSB 3AU1B 4HU2A 4TSAL 4YHZH 3WIHL 3BRFA 1ZXKA 2J1YA 3E0GA 1K4DB 3ZDZE 4XH2B 4M7ZC 2IV9A 1QFWM 4GO8A 5F2FA 3HMXH 1IFRA 1BYPA 4W70A 1PNCA 3DDGA 4HIPA 5A6LA 1XIWC 3A6BH 2EYTA 1NA8A 4YR6A 1P6WA 1F90H 1A7NL 3D39D 3PWUA 3FRUA 3FQRA 4PWJA 2VMJA 3R1GL 1G7HB 1WD8A 4GQ9H 3ULVE 2CGRH 4Z76A 3BKCL 2VJXA 2OI9B 4GYBA 1UADC 2CG9X 5DEGB 1JNNL 5EIIB 3BO8A 3DYMA 4FRWA 4GKSA 4FQIL 3WY1A 5B3SB 1W2KT 3GXPA 1JAEA 5FYLE 4TOYH 4P9HL 4E2OA 3JV6A 1Y0LB 2PYEA 4AMWA 2BNUB 4IHOA 4N0UA 1G7MB 3AT0A 4F33A 1JMXA 5AB1A 4G7YH 4OZGA 1AR1B 4PBXA 3HC2A 3L16A 3P0VL 4PRBA 1YG9A 3LQZB 2HCZX 2O5ZH 3FTSA 4F27A 2AJ3B 4J3OF 2FBOJ 4PJDB 5IROC 5HGHB 3OGCB 2HFGL 1CIUA 1UJ3C 1LEGB 1DVFD 2VZOA 4NNYB 3PL6A 5D2LE 5J57B 1U91A 1WD9A 5CF3A 5FCSH 1RPUA 3HE7B 4U2YA 4E5XB 4OGXL 2FSEB 5FDYA 4HD9A 4Q6IC 2XG5B 4WUUE 4FQJH 2UZIL 1Q94A 1HCFX 3NEXA 4R26L 5FGSA 5I1GH 4PWKA 2F2HA 2Y72A 3BAXA 3F7VB 4BZYA 3UAJA 4EDWH 4NAJA 5DDHA 5IMLA 4JQXC 2NNRA 3GMLB 3TZVB 3CZGA 3L8QA 3SZKC 4WNSA 1I3RA 1QFPA 2Y5TB 3JXAA 3V4VL 1DBAL 4NO2A 4HYTB 5D7LA 2XN2A 1K4CB 2VLRD 5ACZA 3PWPD 4OZFG 1SMDA 5KSBF 4U1HA 5C3IA 1P1ZA 1U3ZA 3T2LA 1YC8A 1BQSA 2L4OA 2OJEB 2AJYL 4CJ1A 2FO4B 2UWEB 1FYTB 4LSVL 4MHHI 1ECZA 4PRIA 3WNLA 5HYSB 2FO8A 2VQ1A 4DP7X 1GGCL 1HWHB 5E1GA 1P1VA 3EFFB 5HHOE 2X3AA 1Y1UA 4G8GE 4ZOEA 2LOEA 4Y8AA 1V7NL 3BJ91 3WS3A 1A6VH 3BQUD 3NYKA 4PW9A 3TBYA 1M3IA 1RY7B 4AI7A 1P0SE 2BP0B 2E9JA 4YWGH 5E1HB 3NRFA 1RZ7H 1PZ5A 3K6IA 2BP8B 2BY1A 2BSTB 2WKOA 3DTUB 3TIDB 5IJKC 3TCLA 2WSKA 1LK3L 4FERA 3IJEA 4PRHB 2FX7L 3RG1C 2HPOA 4H25B 4ALAC 4NZ8A 1KIQB 3IETA 4GXVL 4BIKA 1F42A 1TEYA 5C08D 5GZNC 1OP4A 4IBLT 2BHYA 1XFPA 2K3TA 4I88A 1U8MA 3HBGA 3LS5L 4QAWA 5GGRB 5BS0B 2J5LC 5EZIH 4ONHB 5C0CD 3C5ZA 3PQYD 1J8KA 3W56A 5J6HB 3DGGB 3N1GC 3OBAA 1PYWB 5DK3A 5TFSL 4HFWA 4HH8A 1MFBH 4JFFE 5I0XA 1HVXA 2MQ3A 3NZHL 2PR9A 2IDSA 4F2ME 3UBXI 4EIGB 1OSYA 4NQEB 1MJJA 2VDKH 2XCMC 4XPTL 1ASOA 4DKEH 3NCBB 1T03L 1OY3B 4MCZA 4P5TA 4X99A 1YY9C 5EU3A 2R4RL 3D3VA 2HT2D 1HX0A 3PWLA 2IXQB 4Y4HC 3A5VA 1EDQA 3NDZE 1FAIH 3D48R 4JPIB 5EFIA 1BF8A 3Q2CA 2MH4A 3H4FA 1C1EL 2NNCA 4QTHA 4BSVA 1HC1A 3WDHA 4UYQA 2YD4A 1A3ZA 2PXYB 4O5LH 1O5PA 2N0KA 3OF6A 1DVFC 3QWQB 1BQRA 3FXIC 3GJFK 3N44F 3ZMNA 3FQTA 5A16A 5I8OH 1ES0A 4KH9A 4Y89A 3WG7B 3CLEH 5EOCH 3U46B 2ZCLL 2GJJA 4H26B 4NN7B 2BS9A 1XF4B 2EO1A 3K74B 2WLYA 1IILE 1L4IA 4KRLB 4TQPA 5DJ0A 4LHQB 4L0ZA 2CKBA 4MCYB 1AZVA 1NGXB 4EUPH 3AQDA 3A4EA 4M7LH 3REVA 3S97C 2R1YB 5C09A 2OL3B 2YN5A 3BZ4B 1TZIA 3ATDA 4RGMB 4TNEA 3OJDA 1TQSA 2KBGA 1QSFD 2AQ1A 5A3ID 1AFVH 1KGCD 1NDGA 1HCZA 2VR9A 4X6FA 1Q8MA 3GS4A 1ILSA 3SE4C 1DN0B 5J0BA 4J3TA 3BT2H 1MWOA 3V6OE 5MP6H 1O5DT 3ALXA 4LNVA 3H7BB 3O2WL 3SBWA 1BYOA 2HVJA 3OKNA 2FJHB 3BQUC 4ZUUB 5BO1L 1DE4B 2DM4A 4MRCA 4ADIA 1EHNA 3DSFL 2XPGA 3K8LA 2BJMH 2IQ9L 4GUPB 4LSUL 1T22B 4JLRB 5D7EA 1WG3A 2CCVA 2F1EA 2ALWA 1RIVH 4L2YA 4X9GA 3EJPA 1AJ7H 4WW2A 1JK9A 2YGQA 1G6RB 2YPVL 1RHHB 3WJJA 3SYCA 1LO0L 3BVNA 4PJ9D 1W0WA 1SJMA 4HBCH 3LRLA 1DJSA 3QCUL 3GZPA 5E2VL 2EDDA 3GBLA 1KDJA 3M17A 4PV9A 3IU4L 1QEWB 3QHZL 3UX9B 1ICTA 2KZWA 1KWKA 1QHPA 4HV8A 2J2ZA 5D7JD 5EH1A 3WKML 3BP7B 1YMHA 4JQIL 4WWPA 3PP3K 4P2QA 3RA7H 2J4WH 3TPUA 4I3SL 5K9KB 1JGUL 3KPNA 2NTFA 4YX2L 3TT3H 5ETUB 3QUMB 4PCTA 3ARSA 4DVRH 5F7UA 1QFWH 1IAIL 3D4GA 3KPQA 2B4CC 5T1LB 3JTTB 2J55A 4L5FH 5HYJB 4XBGB 4Q58C 2FX8L 5HHVL 2Y36H 3NJKA 1AGEA 1ZWIB 3AAZB 3AZUA 1A7RL 3SOBL 1JZJA 4ZQKB 2NX5D 1LO2H 1NBYA 2CGYA 4AGPA 1NGWA 5I1CH 3DX6A 3LDBC 2AK4E 4Z7WA 1F86A 4AKQA 3RFZC 2FE0A 2W0FA 3P3RA 3QIBB 1BD2D 1DJIA 3Q9QA 2XUWA 4PV8B 2WLNA 3KL0A 3QORD 2WLJA 4QYOB 5MEPB 4PGEA 4LBEB 1TQCC 4X6EB 5F6IC 1E9QA 4LCWE 1T7VA 1U4FA 3BSZH 1ZVYA 3O9WB 4XODA 3V5KB 4DPAX 2YD1A 3N43F 3EBGA 4UDUA 4P57B 4M7LT 3HFFA 2NDGA 2X4PA 3I75A 5DFWH 1ONQB 5CBAA 5J1SC 1KYDA 4APQD 5AL0A 2E9WA 4JKMA 1A47A 4ODUA 4XWOC 4PRPA 1KGIA 4I85A 4WFFD 4KITB 4X5WB 1JV2B 3NJLA 5JXEA 1QAWA 1J48A 1G94A 1D5XB 2EH7L 3TBVB 2BOBA 2QHRH 3LSOB 4BSWA 3QDGE 4B95C 2AMGA 4OLYH 4LU5H 5D55A 1KTBA 2YUVA 1YO4A 1JNLH 1PD6A 3BOVA 3FYEB 1A4JA 2XQYG 1OM3L 4LESA 4O4YH 2NUTB 5I1IL 3D2TA 2B5IB 4A2LA 2ILLA 2BIQA 4O58H 3MNMA 3ZKXC 2JTYA 2G9HB 1MCFA 3AU0A 4ALAH 5JMRA 2VDPB 1BG1A 1U3JA 1CF8H 2X4UA 3AG1B 5EDSA 4LVHB 4ZRGA 3QWRA 4LEXH 2AQRA 5GRYA 3K72B 3PDOB 3X11A 5I73C 2CDEA 4QJ3B 2AP2A 3HMXA 1HILB 3V2AR 1HEZB 4JDEB 5AAMA 3D25A 2AQ3A 4ODTH 3BAEL 3DUSA 4PJ9C 4HPYL 3DXAB 1JPSH 2V7NA 1XB8A 4HK0B 3HJEA 1S5HB 5JDJA 4OLXL 1HI6B 1F6FB 2QT6A 4RDBA 3QDMA 3QO0B 4UZSA 3K91A 3MFFA 1KGWA 5FHAH 4IBUA 2JKIS 4GKNA 4YDVB 4QHMA 5D7JC 1KG0B 5B4MD 5H35B 3VWKA 3VWJD 2Q7YA 2BY2A 1S9WB 1JPFA 4Q9QH 1YMMA 3K5SA 5E6ZA 2HUHA 2ARWA 5JW4M 4AGQA 1TETL 2IH1A 2MKLC 2EXWC 1C12A 1NLDL 1SN2A 1JN6B 3L5JA 3WEBA 1LYQA 5AZ2L 2ESVA 5DJYB 4UQIM 4MB5A 5A40E 1X5JA 1GZQB 4OZHF 3LEYL 4HIHA 4YH6A 4HXAH 5FA3A 4MLIA 4X4XA 1KCKA 5FOJA 4KTEH 2Y07L 1F8TL 4MA3A 3TIEA 2K9FB 4Z7OB 1FV1B 1E6OL 3L3IA 5IB5A 2UZXB 3FTGA 1CD1A 2CXGA 3VD5A 5JW4Q 3W37A 3M7FB 1TKWB 2CLVA 4N8VB 2VH5H 2Y5EA 4A7SA 1OAYL 1OT1A 3UAFA 1CQYA 2H2PD 2F8IA 3SDYL 1FNHA 5D1XB 1BAFH 2IJ0C 2Z92A 3BH4A 4JHVA 4MD0A 4TRPL 3WFCH 4N24A 1K2DA 3F84A 4K2UH 4JVUA 4AL8L 1V54B 3MLUH 3L2LA 4F57L 3APNA 1MCCA 5KJ7E 1QRNE 3HJ0A 4P04A 1K6QL 3V5HA 1Q1JL 2APWA 4K8RH 3US1A 1KXTA 2R1XB 2R56L 3UYRL 3O2DL 2GTQA 2DLHA 3BHBB 3QUYD 5D4QA 4APQC 4BWTA 2NYZA 2OR9H 2IANB 1MDTA 5TE4L 3I02B 4N5ED 3V0FA 3KR3L 3K81A 5IW1A 2VDOB 4PJIB 2CBTA 4PLOB 4ZD3L 2HFFB 3PLYA 1FFOB 1BF5A 3CFEA 1I4FA 2QPFA 3PG2A 4IRJC 3AQYA 1IT9L 3VI4A 3BN3B 4BKTC 2QZ5A 3LQAL 4G9FD 4L9LB 3BH8B 3A4DA 15C8H 4NC1E 4LRNH 4HKXB 5HI4C 1R3LB 3NG5A 3RY5A 2EEXA 5FB8B 4TM9A 5AAWC 4MSWB 2ITDA 1BZOA 3AREC 2JKRM 3RWEA 3EDDA 4EXPX 2WLIB 2WWMC 3BFQG 4Z8FH 2QVTA 1M7DB 2V7HB 4U6VL 1G84A 3FN0L 1SLUA 1WTGT 2CD0A 3EJSA 3V0EA 1SVCP 3L2MA 1OF2A 2ZOWA 3U82B 3KYKL 3QVAA 3COOA 5L7XL 3KCWA 1EV2E 1JPST 3D18A 4O02H 1RU9H 3OKMA 4FJYA 2IALB 2BRRL 4OIIH 1EVUA 3VD2A 4OV5A 1B6UA 5CSZB 5IKCA 1OSPL 5GGSA 5BOJA 5KSBE 1I8IA 4K5LA 3FCUB 4GLRH 5C0AE 5DSCB 3NGBB 2WLLB 3C5XA 2UYLA 4JO1H 7PCYA 1R5WB 3HNTL 4NENB 2P5EB 5ESVB 5FWRA 2A77L 3EJZD 3KM2A 4KC3B 3NK3A 1NKRA 2VM3A 3EFDL 2GJ6E 1NBVL 4U3SB 2XWBB 4FXKA 2GBUA 3QXWA 2E27H 2CCWA 3F8UB 4LAQL 4UNTA 4YSQA 4PJAB 4Z7VE 5L0QB 3PREA 5FYJU 5EEWA 1IKFL 1RSYA 2DQCL 35C8L 1I7UA 2E6QA 1N7ML 3FUKA 3VD7A 3KYNA 1WIUA 1XGRA 2VL4A 2F58L 2G5UA 4DAGL 4PVBA 3PUUA 4TVUA 2VDRB 2B7DT 1WWWX 3ESVF 3RQ3A 4DP4X 2NY5C 5LGJB 4PJ5E 2H0FA 4OTXH 1R47A 4KY1H 1YYML 3MCLL 2ZUXA 3U6XA 2R2HA 3QA3A 5EEUA 1KDIA 1JRHL 5SWZE 3TF4A 4HETA 2H2PC 3CSYA 1BIIA 4YHKL 3FFDB 5CZVH 3TA3A 4OJAA 4OFPA 5I75C 4WV1C 1TLKA 1EFXA 2APVA 2ORBH 2DL2A 4GSXA 3V0VB 3V4PB 2K4WA 5FYJH 1RK1A 2NUPB 3L3HA 2R1WA 4EUPA 1CR9H 2BNRB 2DMKA 3FTUA 2Z8WC 4FG2A 4OF6A 4NN6C 5AOMA 1RJYA 1ACYL 4G6FB 3MLPA 2FWSA 3UTSA 2V2XA 2KT6A 4HZAA 2DQMA 4AZUA 5FW8A 3QXAB 2CO6B 1WZLA 2JELL 5B3NA 4LLMB 4P46A 3HG1E 3D0VA 3L3KA 5ITFA 5B7EA 1KWGA 3MJ6A 5GS0H 1CE1H 4UNVA 4FFYH 4PUBL 1MI5A 1WBYB 2L04A 3BE1L 1ZE3H 2NW3A 3RX8A 3OD3A 4OGYL 2CHXA 2HLEB 2ID5A 1AOHA 2XWRA 1GTNA 2DQHH 1OAUH 1S7VB 2CO2A 3UACA 1FVCB 3AJ7A 1FGVH 4L48A 3CFJB 1RZKL 3ATFA 4NO0A 3FU7A 3MR9B 1PX3A 2FLRT 1XIWA 1Z5LB 1T04B 5HTSA 2OZNA 4Z0BH 2VR8A 2W88A 3LV3A 3WNNA 1NOLA 2WTRB 3WD5L 2J1XA 3U2JA 1MCOH 1DQMH 1QPXA 3F7RA 3HZYB 3IJHB 4WU7A 1ZLSL 2ZONA 1R3KB 4P2OD 4DESA 4OCLC 5CUSH 3FQNA 5LBVA 1AS6A 4JVWA 3DIVA 3QYNA 2O93L 3U0TA 2ZOKB 4NQVB 5C0JA 4E42A 4ONGH 1GC1C 1G5AA 4FJZA 4JFSA 1R3IL 4OLUL 4L4TE 4L8SB 3W0WE 4K7PL 4NXKA 2W65B 1NC2A 1AHWB 5HYEA 2IPTL 4XNZB 5D7IB 4NPYA 5CHNA 4WK0B 5BRZD 1GKOA 3Q6FB 1PD1A 4JO3H 4ERSL 5HPMA 5IHZA 3EXLA 2D3LA 1CFVH 2VT0A 3BIAX 1UENA 3C08H 5IROA 3EJZC 5EU6D 3X14B 1SUHA 4RBPH 5CEYB 3VFNA 3I9GH 4PHXA 4H0HB 2OPCA 3M46A 3VXSE 2WKGA 3QC5X 1PY4A 4H5SA 4U3CA 4DH2A 1ZAGA 3O2VL 4JS7A 2FEEI 3LZNA 1G9NH 2PCPB 1E5ZA 2B1AH 1IBDA 4Q6IA 5F89A 4NNXB 3TN0A 1WZMA 1OKEA 4IU2A 3IDIB 4PYHA 3CFCH 4OZGF 4YGVB 1KYUA 4F8QA 5HYQA 3BAYA 1C8QA 5ICYA 4WO4C 1NZRA 4Z3IA 4BRJA 4G70B 2GSIA 4ZMQA 3INOA 1DDTA 3FUNA 5IESH 4Y9BA 3BSZA 1G9MH 4FDWA 4ELME 4HFUL 4O2FB 4TTDC 4WHTB 3W5NA 2NY6D 5EHFA 1OGTB 4HCRH 3X3GH 1XF2A 3VG9C 4AQEA 2OMTA 3QJXA 5CM1A 1GY2A 3ZYZA 3UPCA 4EI6A 3OVUB 4QD2E 1XR9A 3EKCA 2YXMA 3PGDB 4GFXA 5I5JA 3Q8CA 2AZAA 4PJBA 3IXTB 1NGPH 3GBML 4EPSA 4FP8L 5E6IA 2DIJA 3L9EA 3RBSA 1ZLWK 5SX4I 2ED7A 4J2XA 2HWZL 4JHZA 1V55B 4ZAKD 3FO2B 3EGSA 4CMMB 2NY2C 4POYA 3BUQA 1TQUA 2R29H 5DVMA 3VGAB 2EACA 1VGEH 1FFPB 3WLWD 2IWEA 2JQAA 2H3XC 3ZTJH 5MERB 4Q9CA 3D2UB 4MDJA 2DM7A 3V0IA 3L1OH 2FWOA 1ZT4B 2XRAL 4U1LB 3E2HB 4QPEA 3B7YA 2YQ3A 4FTVE 3VXUE 3HZVB 3BWAA 2XA8H 5IBTH 1BPVA 3O4LD 1CFTA 3MGOB 2D7TL 1X7TA 1IGFH 5AVUB 5I17B 5GZNA 3ME0B 4S2SB 4ZMXA 5KVDH 2V2TB 2ICWB 4C54A 1VZGA 4AUYA 1JXJA 3KBEA 2EIZB 2FL5B 4JKPH 4DVBB 5I1JL 3ULUC 2CBOA 4N87A 1NC4B 1A9VA 2EC9T 3T0EC 3I50H 1JDAA 4UQEA 3TYGH 5GRXG 5E7BA 1G7LB 4P2OC 2YEZA 5E9DB 5CSBA 1MRDH 5FAAA 1TQVA 4BRVA 5ISZD 2WKOF 3BLKA 2L7JA 1IC4H 1MJ7H 4NM8H 3ULAB 2ZG3A 2QADD 5D72L 5E8DH 5JPMB 3EO1A 4TPRL 3EOTH 4J8RB 1MLCA 2WGNB 2VXQH 4XPAH 3QFJE 3ATEA 4S11A 1SYSB 5D4HA 2A74B 4PH8A 3AC0A 4K15A 4Y4HA 5IF0B 1KCSH 2FNBA 4R90H 1TTGA 3DBXB 4IJ3C 2YQBA 4XE0A 3WN5C 5E0FA 4F2FA 2Z8RA 1SZNA 2X6CA 2X2JA 3FPYA 1I1YB 5BVPH 1X5ZA 1GS6X 1NMCC 1BOYA 4Z7AA 3LRKA 1UXSB 1XR8B 3QBTB 4DERA 4D3CL 4NZTH 1U8OB 1HL9A 1NAKH 1OE3A 1XSJA 5F9DC 5EWIL 4QF1A 4FNSA 1TJIL 4YHYC 3A6CL 4YEFA 3SQBB 2A6JB 3NPZB 4WCYH 4NWTL 2OL3H 3V0WL 3BEWB 5G5DB 3UBHA 4PW4A 3DURA 4IBZA 2YPLE 4QI3A 3L5IA 5D2NE 4GEIA 3SGEI 1P6AB 4LSTH 1ZHNA 3CZUB 5EBLB 2XZAH 2DQFB 3TM6A 1BZDA 4ODXB 2CSPA 5CEXA 3KM1A 2AXFA 4JE4B 3MNVA 3U9UB 4ELKA 1EZSA 4F7MA 1L9PA 5KG9A 4PBDA 4R2GC 5ALBH 5FO8B 3T2PA 1TVHB 3FB6B 2VKWA 1QASA 4L29A 5AVSB 1LO4H 3RGVC 3AW5A 4U7MA 3VFSA 1WFJA 3SE4A 4UM9B 2P8LB 1KELH 1QZNA 4G7RB 4YXLH 3RZCD 1BZ8A 1M6OB 3LCYA 4MWFA 5DJ6A 3MNZB 4G1MB 1CYXA 4AH2B 3QXDA 3HAEA 4KUCD 2Q6WB 3B9VA 1AIFA 2CXKA 3IJ7A 3SDXB 3CN4A 3P73B 3S96B 2UUDH 2OYPA 5I1AA 1G6RH 1NUNB 1S5IH 4ZMAT 2NY1C 1HE8A 4OZHE 4C56D 1UWFA 3WLWC 5EZJB 4HBQA 5EEYA 4G1EA 1UFUA 1DBBH 1WQVT 1F5WA 1XSIA 1IGTA 1RK7A 4HUMB 3G5ZB 4JFDD 1LWRA 4HIXH 1DVSA 3ZDYF 1OOAA 4JHBA 2XV6B 3PGFL 2CIIA 3KDMB 1U3HD 4EZLA 3OKEB 3WNOA 4WKZB 3KLDA 1KENH 2GK0B 5D7HA 3DROA 4HJIA 3GKWL 4PN6A 3MV9B 3KE0A 2XNAA 1W6LA 4I1NB 4UQ3A 1UA6L 3QUMH 2OFQA 3EFOA 4GKZA 1CICD 1J9CT 1W6WA 1I3GH 1BA9A 4LB8A 1PL3A 2H3NA 3MRPB 2K45A 1EH9A 4O02A 3UZEA 3WBDA 2Y23A 1A66A 4MVBD 4IIQB 3L3JB 3U1QA 5CBEB 3GYRA 1FNEB 4G6MH 1F11B 3U1SL 3KHQA 2F53A 4WW2F 4DKTA 1N10A 1PG7L 3RL2B 4HX1B 1BX2A 3IB4A 3ETTA 3HE6A 3L17A 1BQLL 1Y7VA 4AENA 1EDHA 2H41A 1D9KD 2XTSA 3JV0A 4BHUA 3IMTA 1DL7L 2BNQA 2QQKL 4E41B 5BUPA 3FQWA 4WFED 3RFZA 3CDFA 4QYAA 3TV3H 1JWMA 1R1CA 4MQ7A 2CO3A 3GMQA 5FHBL 4CNIA 5TTRA 3MHZA 2BHUA 4WI8A 3ZRSA 4H13C 2PP7A 2ZWSA 1S2EA 5ALCH 1AAJA 2KDGA 2ZWYA 3D12B 4M7ZB 5CJQL 1IQWL 5DRWA 5KN5A 4PRDB 2JIXB 5C7XH 3IMBA 1YNTA 4LHUA 4QCIA 1KJ3L 3TNMB 2V3DA 5JQ6L 2Q3AA 3WFHA 5IVNA 5B1BB 3QAZC 2WVVB 3QEGL 4RGNE 1FQ9C 2W0KA 3FUFA 4Y19B 4FNRA 1ET7A 1KY6A 1N0XH 2PR4L 2XV3A 4HPOH 3VXOA 3I6KA 5FYKL 4LE8A 4G8IB 4OI7A 2YMTA 1DBML 4JFTA 2IQAB 3VDBA 1NAMA 3KW7A 4K3DL 4YO0A 4XVTL 3IAPA 3UYOD 4UT6H 3S8WA 1MIML 4UM8B 5TDOB 3ZQ9A 1PLGL 1EHLH 1RPKA 4NFDA 4D9RE 4Y4FA 2YD9A 4NAQA 1E28A 5IBUG 1VFBB 3RZCC 1C5DA 2K3HA 5IQOA 4L05A 5JHMA 3QI9D 4PJFE 4NWUL 4F8NA 3K0YA 4F93B 1U8HA 1C8PA 5KYNA 3KVPA 3VRJB 3X1EA 2BX5A 4FFYA 5IMKA 2H47C 3ARUA 1RPQA 3CH1A 2ZWZA 1IEAB 4A2FA 1E42A 3LHAA 3VAEA 4DSYA 3H9SD 4JMXA 4Z0XA 3MAWA 3C8HA 4BFRA 3T09A 4LPCA 1J8HA 2W1NA 2X6MA 2MIZA 5GSRB 1DQLH 1SXSA 1F3JB 1G7HA 1J1OH 2JSFA 3HW7A 4Y5YC 4E9LA 2ED8A 4ZBJA 1BSIA 1JK8A 2Z1PA 1NCAL 5EN3A 1A4KA 4POUB 1JZ3A 4JY4B 5AD0A 4HGWA 1QWUA 4K71C 4XOBA 5E9NA 5ABZA 4JPVH 4U6YB 5EF0A 1S9YA 2G5RA 1U8QA 4O2EB 1AGBB 3NQIA 1CICC 2NNAB 2HFEA 4U6XA 3INUH 1QRKA 2QL1A 4XVSH 3U48A 4EUPG 3NMEA 3GSXA 4N2GA 1QQDB 3FTWA 1JVKA 3NFPA 4KZ0A 2B3RA 1N2RA 2QDWA 2NOYA 3H9YA 2F9BT 3OGCA 3Q43A 5KBNC 1H8OA 3GMNB 3BSGA 1JGVL 4NNYA 4BKLA 1AO7A 3T8VA 3FBQA 4E5XA 4MMXC 5BV7B 1NBQA 3U6RA 4JRXE 1D9KC 1MWAB 2XG5A 4FXTA 3CC1A 4EBQL 3OC8A 2CAKA 1FAKT 3S37H 1T6WA 1TVDA 2WBWB 3FTXA 3K8KA 3MVSA 4Z7UA 5PAZA 3Q9PA 3D05A 3B2UC 5IR1A 1BQHB 1C7SA 3AT9A 4KPHL 3TFKD 1Z3GL 4ODVH 5AYUL 1CN4A 1N5AA 2W9DL 4UUJA 4BFNA 2JCCB 3QQDA 4AM0A 4E0RB 2VMCA 4P4RA 4UOZA 2AZUA 4N2FA 5GGQH 4G6JL 3EYQD 1GJUA 4XN2A 3GJFH 4LLUA 2C1OA 2VDOH 1JIBA 5D1QC 4LDCA 1BM3H 4ODHL 4KZEH 4HULB 3D39B 2HKHL 5ICZA 4RMSA 1A7PL 2X6BA 3WFDH 3MCKA 3WGUB 4AYDC 4QHLB 3D69A 4BZ2H 3HCVA 3OKDB 4UTBH 4H44C 4MB3A 5D1ZC 1UT2A 2Z6FA 4HD5A 3BVXA 3AWFA 5CWSB 4ODSH 1ZANH 1Q9WB 2BMKB 3IMRA 4IRJA 4D9LH 4NRZA 2YAMA 3NSDA 3ABMB 1KTDA 4NN5B 1ET8A 2ZAIA 3KLKA 4PM1A 3T2QA 1QW9A 2ZXCA 4B97A 4Y2DD 4F7CA 2R2BA 4M1CC 1JTPA 2E9BA 4LCCA 4UINH 3DVNB 5IV2B 5AAWA 3SJVD 3NCJH 4WQOA 3WTYA 3BMVA 2DQUL 2DYPD 1KEML 2E56A 3DX7A 3AREA 2R29A 4H25A 4QRPD 3RJOA 4BUQA 1KIQA 5HI5D 1DVFB 4Y1AA 1PZUB 4AVKA 5BS0A 2PYEE 3MU3A 4GOSA 4N0UE 4KQ0A 4GO6B 1P6FA 4R4ND 5JDSB 2EUZA 4OZGE 2NLJB 4NPJA 5AFAA 2ZXDA 3AB0C 3DGGA 3MLWL 5AW8B 2W07B 2EIEA 3VI4F 4RIRA 2VDNB 4NXSA 1WZ1H 2WUBH 2XX0A 3IXAB 4IYKA 1LEIB 1OPGH 2VJ0A 1DVUA 1AZRA 3UTZA 2W0PA 1MHPL 1UH3A 4PJCB 3WNIA 5FGBC 2DMGA 3WTVA 4F37F 2CK0H 2VLRB 3WENA 2BC4B 2QDVA 3PWPB 2XFGB 3LPOA 5EZOH 3WV0A 1HWGB 3VA2C 3OXSA 5DD1H 3NFNB 1UYWL 4JZOB 2AV1A 4N9GB 3WKNA 2AGJH 3FCGA 1T1XB 2OP4H 1JG9A 1QYGH 1WK0A 2K6YA 4NZUH 5MEOA 2Q76B 1KCBA 5SX5K 3PP3H 2VDRH 5LAXA 4XMKL 3ZO9A 2PP8A 1T6BX 4G7QB 4JDVA 5LNDA 2EH8L 3OZ9H 4X6CB 4PR5B 4K9EL 5D7LE 4NP4L 2DBLH 5HGDA 3BUBA 4N2EA 3VXNA 5DS8B 4UNUA 3TS8A 1YJDL 3ULVL 3BQUB 4PP2B 1AD0A 4PS3A 2BXYA 2Q2EB 1QFOA 1MW1A 2J8UB 3JWDH 1ZDQA 2K6ZA 1XF4A 2Z4QA 4H26A 5CEZE 4M9PA 3VFTA 1NIAA 3HLAB 4MCYA 4JGMA 2ATKA 2AQNA 4PRIE 3V4PH 3EIFA 3TFKC 4E9RA 2Z91A 1H0DB 2QPUA 5E2UL 4B5ZA 1OCWL 1Q9KB 3CBRA 4TV3A 3HR6A 5BO0D 3BZ4A 2P80A 4IBQA 1MAML 1ORQA 2QFRA 1RMFH 2B2XL 1FZJB 2F1BA 1I7TA 5C08B 1UM6H 2N1TE 3C6SB 3L3OC 1DDHA 2CLZB 5GS1C 4CDGC 3VM7A 5C0CB 3GMOB 5F7AA 1CXEA 4OCWL 3CCHA 4OD2A 4GW4A 4XB8A 1NCCH 5C9JB 1T3FB 2XI9A 5F71A 3DOSB 2G0KA 2X7LB 3CUPB 2CUHA 3QQ9D 4BFEA 1DQJB 2ADFL 2DTML 1E4KC 3ATBA 3KDPB 3PPEA 4XP1H 4YL9A 3KWUA 1ODUA 3WFEL 5DTFA 1WZKA 3LVEA 3P02A 3B9DA 1DVQA 2X9ZA 4I9WD 1O9ZA 5DWUL 4ZUUA 4TVPH 1DE4A 1FWXA 1NMAH 4HIEA 4ORGA 2A99A 1FDLL 1PSKL 3ML9A 1WVZA 5TDPB 4Y2DC 3IN2A 4PY8I 1CC3A 4IOIA 5TE7L 1CD9B 1G6RA 2GAZB 4WI3A 1CLZH 1UKSA 1JOIA 2IOIA 3SGJA 2AEQL 4L3EA 5HI5C 3PABB 2A73B 4YSRA 1JWSB 1WEJL 4U6HB 4ENED 5EOTA 3US0A 4Q9RL 1VSCA 1I9RH 5GJSH 4EOWH 4KJQC 5F6IB 3C6EA 4JO4H 3POCA 1CDCA 3D3VE 1C7TA 3HI1B 4D8PB 5EA0H 2H7WA 4RFEA 5CAYB 1AQMA 5E94A 4DP5X 1E40A 3FKUS 3TWYA 4EIZC 1U8NB 1UUSA 3IVKB 1RURH 2P48B 1YEDA