5IUCA

Crystal structure of the gspb siglec domain with sialyl t antigen bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
DTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVVRWLYSNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural model for binding of the serine-rich repeat adhesin GspB to host carbohydrate receptors.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Sugar binding protein
molecule keywords Platelet binding protein GspB
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iucA00
3QC6X 3QC5X 5IUCA
chains in the Genus database with same CATH superfamily
4MJJA 5AAMA 3AXLB 4YXKH 3SKMA 1G7JA 5E8OA 2DQTL 1H15B 1LWRA 2IGFL 3I2CH 3QUXA 3RGVB 5K9JL 5AVVB 5MEPB 1UOLA 2FIRT 3R8QA 4BA0A 5JIQA 2NY4C 3IK2A 2BNRB 3V5KB 2VLJB 4MCYA 3OLIA 4BFKA 2OK0L 3MRIA 4JZJB 1RUPH 5D71L 3QUZA 3SE6A 4XI5D 4ZAKC 4MDIB 4JFOB 4AGPA 2OW6A 2X5PA 2O6CA 3IE9A 1G43A 1GCYA 2R27A 5GS0C 2WN3A 1IM3B 1WCBB 4YDIH 3HHMA 4N20A 1JAEA 3CVCA 4JG9A 3STLB 2AK4E 4KH2A 1RIUH 2DL9A 2DZEA 3GSNB 4BKLA 5TF0A 1S7SB 1FZJB 4CRPA 4FLSA 1S8DA 5J4MA 1WZ1L 4OT1H 4OZFH 4OW6A 4KX8A 5EO9B 3QHTC 4Y88A 3QPXL 1G0DA 3W1ZA 1DSFH 5F96H 4DGIH 4LEEA 5BW7C 5DJAA 4WEEA 4XGZB 5FF6B 4P3WA 4WNQA 1C5BL 2YC1B 1KTLB 3A6BL 4J8RB 4TVSa 5GHWL 5IB3B 4XXDB 4H2CA 3VW3H 1NPUA 2JQMA 1VERA 4AGQA 4XVUD 5CIPH 1SDDA 1T0MA 1U3JA 4JN1L 1N9PA 1OP9A 2PR4H 4KVNH 5LGHH 4LE8A 4EZLA 1JHTA 3TC9A 2H1PL 4BDVB 2HFFA 4R0LB 3X11B 5DJDB 1U33A 3ZDZF 5I19H 5CD5C 4GAGH 3CFIC 1XMWA 4N4YB 1NH6A 4BGLA 1J8HD 4HFWB 3SKNB 1EFXD 3KGUA 4FQQA 3K2MC 2ITFA 1T66C 5E5LA 2FB4L 1A6ZB 3D2UA 3O6FC 4N8UA 4X4MA 3BHBB 1U8KA 2E7DA 3OSKA 1C7SA 3U48A 2QPDB 2P43B 2LLLA 3L5WA 1A9BB 4X7TB 3UP6A 3JYBA 3SO5A 5JZ7D 1FG2A 1CD1A 2OKMA 4Z77A 3LEVH 4Z7NF 1DVFA 3IFPB 3ERXA 4AIZB 3PABA 4KHXL 4A6YA 4Q74A 2E7MA 1JWUB 1G84A 4O58L 3FO0H 5JHDE 2JCCF 1SOQA 1T0NA 4OI9A 5E2UH 4XBPB 4OIAA 4B6ZA 1KLUA 2OXHA 2ZSWB 4FFYA 4XX1G 1AKJB 1S2EA 4TULL 3A4FA 1LEGB 1FSKC 1FFOB 4X0KB 4RAUB 4H13C 4WO0A 1LMIA 3WY4A 1MJJA 4YDKH 1GJWA 4HJTA 2HTKD 1HHHB 3QSKB 1L9RA 1OARL 1C5DA 2VDLL 4DW2L 1TVHA 5ADOH 2YSSA 4LZKA 3QYCA 4Y16B 4YDVA 5I75C 5BQ7A 3EF4A 2LHAA 4QHKJ 5EU3A 4ZX6A 3WO4C 1NCGA 1G7MA 2BP8A 3BH8A 4ODSL 2CSPA 2W8CA 2J6EH 1F4HA 2X0VA 3V4VA 4G83A 3CVIH 5IB1B 5JR1L 4KMTH 4PLNC 4U7MA 4I1PA 3A4DA 5HHQA 2A0LC 3PGFL 2FATL 3T4YA 4N2OA 1ETZB 1H6UA 1U8MB 5ALCH 4NI3A 3RFZA 5ADOL 3F6IA 4LHQB 2D7OA 3BXNA 2FHCA 1GA2A 1JVKA 3CUPA 4ORZC 4ZX3A 2XPZA 4WKZB 1PQZA 1XGTB 4FQCH 2B3IA 5D1QD 3LYRA 4LLWB 2ITDB 1PJWA 2OQJA 1T22A 1ACXA 1S7WA 1I31A 1S7RB 1X5FA 2DYPD 3MV9E 2XZCL 3D25B 3NFPB 1PX4A 4ELMF 3DROA 4XNZB 3WTSA 5F0JB 1INDH 4C4KT 3CSBA 5AYUH 1TJHL 3X1GA 1YPZE 4YVUA 4Z3JA 5DT1H 2NY4D 3S5LG 1GS6X 4JL2A 3D39A 5KVDH 4G9FA 4KHTH 3AGVA 1PYWA 3GMRA 4XZ4A 2KLSA 1BP3B 5IUSA 2ZP9A 2APTA 4AQEA 1GTFA 2BSEA 2VLRE 3BUBA 3VI3A 1KBGL 1ZS8B 2A6KA 3IJHB 1S9WA 1KBWA 2AITA 2UWEA 3D2TA 3KPOA 5KN5B 1PS3A 4ZMAT 1XF3B 4MWFB 2MFNA 2CDEB 2WWKO 3IYLW 4OF8A 3Q8AA 2OL3L 3KYMB 3H3BC 1BMGA 1ZHNA 2DMHA 1JGVL 1XGUB 3QDGA 4YZFF 3PNRB 4O9HL 3DUHA 4R26L 5C7ZA 4MX7A 4MD5A 1I9JH 4HBCL 3J2PA 3VGBA 1IGYA 1JUFB 3KNBB 5I1JL 3DO7A 4YR6A 4F5CE 2SODB 3WKQA 3EBIA 2BHFA 3V9EA 4G72B 4RGOL 4AYGA 3HZKA 1EO5A 2AKRB 3IGUA 3QXDA 4LSRL 1S9KC 4M7JL 1RL1A 4FFWC 3FU0A 1DL7H 4KZDL 4HKXB 3B37A 5A2LH 1CVSC 2WLLA 4HCFA 4ACPA 4YFDB 3PAUA 4K7FB 3BQUA 2OJEA 2NY0D 3OKDB 2GHWB 1G7HB 3FSVA 5DZNA 1DJIA 4DW2H 3MV8A 5D70H 2IPUG 1ZT7B 4GAJL 4TSAH 1VGEL 2Y7OA 2J1ZA 1S9XA 4PRID 1R24B 5KEZA 4GRWH 2V7HA 4W1TA 2ZZUT 2KQNA 2L4OA 3TZVA 4BRVA 2YD6A 3VGGA 1H0DB 1IC0A 5FYKU 3OX8B 3W0WD 1MOEA 2CNYA 4U1NA 3KLHC 2V2WA 4P5TB 4DF9A 3BZEA 3AREB 3HB3B 3WLWC 4X6CB 1SJEB 3ROOA 3MLPA 3FTXA 1WAAE 3FO1B 1MHHB 3HBZA 4ZRGA 2ZOKA 5DO2D 1OSEA 5JPMB 5J11B 3OD3A 4Q6IB 4GG8B 4UNIA 3D0LB 1L0YA 2Q76B 4EIUA 5AOJA 3OGCA 4F2MA 5B8CA 2B77A 1DSYA 3S6CA 3LMJH 3UBXI 3U0TB 5C3TA 2NR6D 3MLTA 1AS7A 1EXGA 4CUCA 4WI6A 4CKVX 3KZ8A 1OGTB 3PRZA 4MQXC 3JV4B 3NFSL 1J18A 3LKNB 4WU7A 4E5XB 4TRPL 2WSPA 4KNUA 1E4XI 1ZMYA 1QW8A 4RBPH 5JOPE 4FZ8H 4L0YA 4ZPTB 3QIUA 3RUGA 4G1EA 2FJGB 4WDIB 4UDUB 3MLVH 1H3UA 4LSDA 1RZJL 3FU8A 3F83A 4TXVB 1RJYB 5CJBA 4YN3A 2Z92A 3ESUF 1WBYA 1U0QA 4JY5H 2J7LA 1UXSA 2H6PB 2I27N 3NCEB 5DD3H 4NHUA 5E6RB 3SKOA 3WD5L 4DGYL 5FYKD 4MA3A 3SE8H 1QPPA 4YDMA 5KSBF 3H7BB 5KSVB 3QORB 3O3AB 4HIHA 5FECA 5DC0A 3MRPB 3RLSA 3TBWB 4OFQA 1Y1DA 3PGDA 3VO0A 4R4BA 2BC4B 2YD0A 1IIIA 4HBCH 4XMLL 4K8RC 4GG6B 1GGBL 4LSPH 4FNSA 1GGIL 2R4SL 1RJZA 2VM4A 4HHWA 4POZC 2KMWA 5C0JB 1OE1A 4Q2ZB 4XVOA 4GQRA 4IKIA 3KDPB 4F7MA 4KK8D 4NBZB 5I9QB 1NDTA 3TBTB 1FZMA 1A9EA 4ALAH 4UT9A 5LDUA 1YEHH 2G9KA 5KW9L 2WTRA 3QEQA 5C0ND 3LVEA 4M7KL 3KDMA 4MXWL 5C0AA 3AADB 4H88L 1GYUA 4KAQH 3BVNA 5IT2H 1UD3A 4WUUB 1FCGA 3ZE2E 2E9JA 2J1XA 3F04A 1U3NA 3P9MB 5I5MA 4JRXA 4PJEB 5F7LB 3UGXA 4BWUA 2EDNA 2G3NA 1H6EA 5HYJA 1QUNA 3GC3A 3MCLH 2D3LA 4KVCH 4BUHA 1ZHKB 3ZTJG 2VITA 5F1NB 2YKLL 1Q9LA 2VL4A 3F12B 4C83B 5IBLC 1P2CB 3ZJAA 5MENA 4M43L 5E2WH 1X6LA 5T1DH 3BPLB 3N50A 1SXSA 3KWWB 1XXFC 3BAWA 3QUXC 3KCPA 4Z1PA 4D9RE 4DTGL 1ZK5A 4N26A 4JFTA 5EU6E 4XNXH 3AS2A 1BIIA 5AYTA 1SHMA 5KS9F 5GGSB 4D94A 4ELMA 3UTZB 2ADJB 1VDGA 4W9HC 2Y06H 1EPFA 2DV6A 1TFPA 2JIXD 2R8SH 5GZOC 4DAGH 4JN1H 4KVNL 4OF0A 4E41B 5TJWK 4PW4A 1QRKA 1M6OB 1YMMD 4PJ8C 4LF3A 3HG5A 3TO2B 1YO4A 2A9ML 5EO1B 1JK8A 2NR6A 3V55A 5ACZB 5I73C 1SZNA 4YSEA 1AKPA 5EU5B 4NX0A 5IP4A 2CK0H 2EEFA 2H2PD 3VMOA 2LAAA 3HVDA 4N2FA 1YMMA 3HE7D 1E30A 3K8MA 4X6DB 5C6TH 2DQEL 3CMOH 5D1QC 3DSNA 1G0YR 4ZMLA 3BUIA 3V6OA 1VZHA 2BINA 2R69L 4OCYH 4S1QH 2VW7A 2WIMA 3VRJB 4PV8A 5KVDL 2QLVB 3APMA 4FTVB 3H4HA 3SCMD 4BSWB 2DMBA 4PVMA 1NKGA 1H3XA 3OKLB 3SZ6A 5AFAA 1GY2A 1OCWH 4NO2B 3MJ8A 3QNFA 2G2PA 1XHHA 2ZOWA 5HGHA 1Q0YL 1KPUB 3IDJA 3CQPA 3SQOL 1NEZB 3FQTB 4M5ZL 3FFCA 1DCEA 1E43A 2FSDA 2X3BA 1QNZL 3B7SA 1ZJBA 5I15H 3B2VL 1FFRA 4L18A 2J72A 2DM4A 3X17A 2LVEA 4QHKI 1YJDC 1W72B 3S96B 3WO3B 1IGTA 3VM5A 4C56B 3TJHC 4PRNB 2ZNXA 2CA4A 4AJYV 4IM8A 3SBWC 2J88H 3ZE2B 1K8IB 4OQTA 2B2XH 1AG0A 3EYUH 1A3LH 3WEMA 1WIOA 4XCNA 2HFTA 2R2HB 1LILA 2H32B 4PV9B 4MB3A 4UIKL 4KITB 1WA1X 2DYRB 1KJ2B 1KIRA 4K8RH 4PJAE 1GAFL 1VESA 4PJCE 3NDZE 4JS7A 1OD7A 2IPUK 1U95A 1M7DB 1F58H 1Q94B 2ZYIA 4XRCB 1YDPB 3KHOA 2DI8A 5GJTH 2E7LC 2BO0A 4KK5C 1FFNA 5HPMB 3Q01A 4XMPH 3EG9B 4EDWH 3HI5L 5KYYA 2MHAA 4IIZA 4X6DF 3ESNA 2D8KA 3JWNE 3SJVA 1OL0A 3C08H 3U36A 3VM7A 3FNKA 3QUKB 2VC2B 4G1MA 4IU3A 3OMNB 4MQ7B 3C6LB 4PJ5A 4AIZA 4DP5X 1RZ8A 1YNLL 2E7CA 1F8TH 1ORSB 2ESVD 3APNA 5T5NG 2HB0A 2D3VA 3Q48A 5MEQA 4I5BB 1O5PA 3UTPD 2D03L 2WP3O 4PCTA 3RWJB 4DPRA 1ACZA 2MQCA 5IZ7A 4M8UA 4HS6B 3OV6A 5GJSL 1NGPL 4PGCB 3QJTB 4GI8A 1FH2A 1ZSDB 3NIFB 5IJDC 1OLLA 2ZYHA 3MLYL 4HWEL 3ZHFA 1Q9WA 1UWXK 1NM4A 5D55A 5K33A 4PJ9C 3KWUA 5JORB 1CD9B 2E86A 1NC4D 3JVFC 4QKTA 2BNRE 4RAUA 3RTQC 3ZR5A 4ABUA 1T5KA 2GJRA 1HEHC 4AOFA 1QYGH 2DYPA 1HHKA 4YLBA 4YPJA 1RUQL 2CALA 5F7EH 3APDA 1HHHA 4TQPA 4XCCL 1RZKC 4GYBA 3MBEA 4J1UA 5ISZD 4Q9QL 4OB5L 2EILB 2FNWA 3A24A 2EXYC 4M6OH 1KJMA 3GZPA 3C6LC 4AQ8A 4MJ2A 1I8MB 2ZWNA 5MP6H 3LNDA 3IDUA 1OM3H 3MJ9H 3KYKL 3DX6B 3A22A 3G6JB 2CDFB 4XP5H 4XWOD 1U8MA 3V52L 5EIIA 5EH1A 3S8FB 1OGAE 3FULA 3VCLB 3C5SB 3WFCH 4NM8L 1TZGL 4RLDA 1NGZA 3IF1A 4S1RL 3P69A 3CUPB 1OALA 2XXGA 1N3NB 2VB5A 1QZ1A 1JZ4A 4B9CA 3WNPA 3ZTEA 5ID1A 4U7SA 4X5PA 4N25A 4RAVA 1S7WB 1KXQE 3TYFA 3BUQA 4ZFOL 1MSPA 4UYPA 4BCZA 1S9VB 4BH7B 3SE3C 2VW6A 3QHZH 4U31A 2X4QB 3S8GB 2O6DA 3HA0A 3H1ZA 4OCSL 1GH7A 2DM2A 5F3BA 5DD1L 3G5ZA 4ZAKD 4NP4H 1WVZA 1P4IL 4U3SA 4AT6B 5GRXG 2KC0A 4IBZA 1MDAA 4NC1E 2N59A 1NAKL 3K0YA 5SV4A 1G0XA 4LGSB 4OVUA 1BX2A 4KGJA 5I17A 5JXEC 3SDCA 4PRIE 3TVMA 1T7XA 3KPSD 2VMEA 5KN5A 3RILA 4KKAD 4PJ7E 4DP4X 4BFJA 4BZ2H 4OLXL 5DVOA 1S4IA 2R9HC 3KXFE 4XWOC 1D5MA 1S7UB 3ZTDC 1ZLVK 1N7ML 4XNMB 1U8OA 3KAAA 3IRPX 2ZXWB 4KAQL 3A4EA 3U1PA 1GKEA 1AHMA 1BJMA 2A38A 3LH2H 3BAXA 1MI5D 5TQ2H 3BZFA 3CIAA 4OD3L 12E8H 4N8VA 3FYEB 3GKWH 4OF5A 4PG2C 3BGFC 4YXLL 3MR9B 2PYEA 4PWIA 5F7UA 4DVRH 3QUMB 1R0AH 4P3CL 1JF5A 4TVPD 4HISA 3BP7B 2WANA 3CH8A 5F7WC 4EN3D 2FBOJ 5D5ME 4WJKB 3MNZB 2OSLB 4JDTL 3C8DA 1WRFA 3RDTA 3CSFA 3MGTA 3P0YH 5IJVA 4J4PC 3S3PA 3QNYA 1EIBA 4WK4B 3GS7A 3MACL 4JKPH 3QFGA 3QO1A 4PR5B 4U0RB 4YPGB 1PY9A 4P3CH 3FN0H 2R0LH 3O81A 1LTXA 5DI8B 1J87A 2HJKB 1OSYA 1RUQH 2E56A 1MY7A 2Z1KA 4AJVA 1U93A 2EDDA 1W6WA 3VXMD 3VAEA 2EKJA 2W65A 4OGYL 1KSRA 3P30H 1LDSA 4ZUWA 3FQRB 2JI1A 5J06A 4PGEA 4DGIL 1TZIA 1X6NA 4JB9H 2OMZA 5D72L 4XC3L 5IHBA 1KWKA 2DICA 2FO4A 1MXGA 1BD2A 4XX1E 4MD0A 3NCXA 4PVBA 2APWA 4PN6A 1KCUL 4Y4FD 4QT5B 1R4XA 1QA9B 2FBJH 3MLUH 2EUWA 1A7NL 1UWXH 2BVQB 3CMOL 1A14H 4DETA 4F2MB 2WBJD 2R29H 4AVHA 5C2UB 2DLEA 4U6TA 3MV9B 4P3DA 1P7KA 5HHVL 3PS6A 1IAKA 4K3GA 4NRYA 2J2ZB 2CG9X 3Q8CA 5DD1H 5CLZA 3TV3H 3DX3A 1E4WL 1QTYT 2FO8A 2IH3B 4IRJC 4EUPH 3ZZQA 1QSED 2W9EL 3EIFA 3SDYL 1BZ8A 2XQ0A 2OR7A 4MD4A 4RISL 4P2QB 3RWCA 3H9YA 1O6SA 4BUGA 3SDDA 4JCWA 3C5ZD 4L4JA 1R3KA 4RRPA 5JIDA 4HUUB 4UDUA 2VQUA 2XV6B 5C09A 1IM3D 2XV0A 4WI2A 5KJRL 1M2VA 3H53A 4K7PX 3O4LE 1ASQA 2Z31A 5TH2A 3DTUB 2HVJA 2O5XL 4A7UA 4ZJ9A 3P3YA 1W0YT 2J88L 4XN1A 1YC8A 1SOXA 4JJOA 4UBDC 4LEOB 4V1DA 1R5WB 3CFKB 4N2DA 4JO1L 4O2CA 1YEIL 1U2CA 2HZHA 3RPIB 4W6YB 5FECB 1GGUA 2MJWA 3SODB 3WNOA 1DVSA 2FEDD 4UDTA 3ETSA 1I7ZB 3N42B 2O5YL 1E4JA 3N44B 3UDWC 3QDJE 4QHMA 1VCAA 1IEAA 4HPOL 2CIIA 5D1ZB 3EJUA 4KI1A 1QSEE 4X0NA 5DGRA 4F7MB 5CHNA 4UTBA 4PMFA 1JYNA 1O5DT 2ZCLH 3HG1A 3LJ3A 3KPNB 3MRRB 4OLYH 3PIQB 3IDGB 4AVKA 4N0YH 4DVBB 4JFHE 2UZIH 1KBKA 1V8HA 2H3NB 4RMVA 1EEUA 5ESVB 1B9KA 4AV4A 4HH9A 1UCBL 4F2FA 1AQKH 1HCFX 1MIEH 5ACLA 4MMZC 3KLSA 3IBEA 4IMLB 2ODHA 3QPXH 2YMOA 3BMWA 1EK3A 2QSTA 3RA7L 3GYRA 3PHQA 2D03H 1ZA3B 3HE7C 4H7VA 4N2BA 4ZOEA 4BQBA 4YHKL 2VR9A 1EJFA 2FWOA 4J28A 5EORH 4OLYL 2BIHA 3V0WL 4G71B 4IIQA 1DJXA 3LS4L 3AU0A 2BDNH 2HG5B 2WWMC 3RWHA 3IS1X 1NMAH 5C0FA 3CZFA 2DQJH 4Y16C 5B1JC 1QO3B 1NDMB 3E7JA 4HG4J 2EVJA 1R6VA 4X4YA 3KCPB 4ZUSB 3WDHA 2ODIA 4ZQKA 3FCBA 1A65A 1X5KA 5E1GA 3Q6GH 5F6IB 1G7PB 4R6UA 4RIRA 5E5MB 1AO7D 4CMMA 1M71B 4LSQH 2WJ5A 4DZ8A 4N85A 1FA4A 1YPZF 5FKPA 1NCUA 1JPSH 4HPHA 1CO1A 2PCXA 2Y1VA 4YDLC 4TV3A 3HUJA 1K5WA 5C97A 3UO1L 1GMIA 1MHCB 2XN9A 2P5EB 5DXWA 1MEXL 4LLVB 1JK8B 3IVKA 1KFGA 3B5GA 3S97C 1UZGA 2WWKT 4X9YA 3AS0A 1TTGA 4JM2B 1UXWB 3JVGC 4GUPB 4K8RD 4MS8C 4CGTA 3MLRL 5SWSB 2BK8A 3NJMA 1TLMA 1OF2B 2P8PB 3BDYL 4PWGA 4X6DA 2BOBA 2UYLB 1D6EB 1J1XH 3DA0A 2VQTA 5ALBL 1U6AL 5EUKA 1YA5A 4TMPA 4MXVF 3W39B 3L7EB 2CIKB 1V3MA 3C5ZA 2X7LB 4RAHA 1Q72H 1TUPA 1E4HA 1IGCL 4LL4A 4R5TA 3Q7JA 4QO1A 5FB8A 2DLTA 5J6HA 2WXJA 3EYFA 4P5TD 2QR0B 1MCBA 5DJZB 1FIGH 5T1KB 2W07A 2D7TL 3LPPA 4ZFZB 5LGYA 1TQBB 2YGVA 4QOKD 2N0KA 5FS5A 1FFPA 4PUBL 1OK0A 1F6AB 1HJBC 2IGLA 4GRLB 3SPIA 5DVKA 1B4JH 2DWTA 4GSRA 5T1MB 3T0EB 4F7EB 5DDHB 4MQXD 2I32A 3QEHA 5BZZA 1KCLA 4LLAA 3DBXA 5ABAA 3A21A 3BH9B 1CLYL 5HYEA 5E8DH 2IAND 1O6TA 5DC9B 3HMXL 1KTDA 2BP0A 3D3VB 3CLEL 1QR1B 1FGNL 1FDLL 1T21A 2AP2A 3GHPA 4L3FA 1QTSA 4QHLB 2BVOA 3TEYA 4GQQA 5JNYA 4I4WA 3HTLX 4NPKA 3ALXA 1TU2A 4XNXL 3SGEI 1TENA 5I1KL 5K69A 2R56L 4NYLB 4HJGB 3Q05A 3OTTA 2A3TA 3CPUA 3CMGA 1NKRA 4FULA 3KBHE 4I13B 4TUJB 3FMGL 1NOFA 4KMQA 4Y5XB 4ZD3L 4LLYA 3OJ2C 3UTTD 3P0YL 3IDIA 1MFCL 3IMRA 2L8AA 2GTQA 1CLVA 1CXFA 4PRHB 5E94A 4EI5B 2CH8A 5FPIA 3GUTA 4JFWA 3DHPA 5BS0D 1KJ3L 1KIPB 1LP9E 3D3VE 2HTLD 1AE6L 2QZQA 1MRCL 2ZWKA 1JXKA 4UQBA 3MOBL 4PJBB 2XWTB 1EEYA 5DR5L 4P5TC 3IJSA 5E6ZA 3TPUA 3VG0H 5A3ID 5I74B 5I0VA 1PEWA 4XN5A 1ZSDA 1XZ0A 5KVDE 2YBRA 1RVFL 2EKSA 4F7TB 3GK8L 2A1WH 2CJTA 5F93C 5T5FL 1JIBA 3IE4A 5DSCA 3HPJA 2X4OB 5CJQL 5DYOB 4KQ4L 2A73A 3LH9A 3QUYA 4P5RA 3ECBB 2VMFA 4I9XA 2DYPB 3NAAL 1MEXH 2ADIB 3BN9D 4NQDD 4DKTA 3MUJA 3VXUD 1F8TL 3FN3A 3HHRB 3NACL 3QPQC 4AK1A 4DUXA 3RJOA 4A68A 2MQ0A 4E9SA 1CMOA 1XQ4A 2Y25A 1BQLH 4KO6A 4C58B 2E9GA 4Z76A 35C8H 5IVOA 2LLGA 3OZ9L 1J1XL 3GSNH 3ZDXB 5JXEA 2Q8BL 2J8UB 5CUSL 3MBED 1RU9L 5FDWA 2NY2D 3HC2A 5D4QA 3ISWA 3NH7H 4MDJA 5HYQB 4K94C 3ZMNA 1IKFL 1KCSH 2LU4A 1E9OA 3OG4B 2AEPL 4KV5E 1Z5LB 5C07B 5DZPA 5GZOD 4M9PA 1LO4H 5DMIH 3U4BH 4YHPA 4L05A 1JV2A 3QQ4A 2DKUA 3BE1H 3QIUC 5E70A 3LTVA 1ZT1B 1A6VH 2HH0L 2GK0B 4LCWA 3VFNA 5KANI 1H5BC 1QFUL 1FVCA 1U21A 1OW0C 5MHSD 5F7KC 1UUSA 2YRPA 3T8XA 3PL6B 3CZSA 1FDLH 2DRUA 4MMYA 3NJXA 3WJLC 1LL1A 1KNOB 3AU1B 2OLDA 4N8CH 2OSWA 3WTUA 2BSTB 4PJ5E 4R7VA 5G5DA 2AJZA 4OV5B 2P5WB 3FB6A 1E9PA 2J73A 4ZAKA 4Z7VE 2HUEA 2COVD 2GJZB 1PZCA 2YFNA 4JUSA 5HYFA 5B39G 3FQ4A 5E2TL 3WEXB 4D3CL 5MEOB 3MBEC 4NZ8A 1CE1L 4WHYG 1QASA 2GBVA 4MAUH 2R1YB 4G6ML 4OGAD 3UTTA 4N8VB 1G5AA 3HRZA 2ZIDA 1EXUA 4GEIA 1Q4NX 5IHZB 4RX4A 4RVBA 4I9WE 4LGPB 3O2VL 2WINB 4ODUB 1T1YB 4PVNA 1A1MA 4Z7VF 1BD2E 1CZ8L 1IB5A 2EDKA 1ZV2A 2QQQA 3PPEA 4HEPA 3RDTB 2HJFB 4HIEB 2JXMA 1GKOA 1AGCB 3NYKA 4XB7A 1I85C 1OAKH 1VEOA 3AFLA 4ZX5A 4D0DB 5BW7A 3GNMH 3M7FB 4OQTH 3UADA 1QBLL 4KTDH 5FCUL 4PR5A 4YPGA 1E7UA 4JFYA 1E27A 1NAMB 4GP5B 4PD4K 2EIZB 2LLNA 2O6FA 1EDQA 4OD2A 4Y5VC 1L9NA 5A16B 4DEPB 1G7LA 3ATAA 4TNWK 2V3DA 3GMOA 5CGYD 2CO3A 3WHXA 5JW4M 1UD4A 1IAMA 2GCYB 2GIMA 1ZLSH 1E65A 2W95A 3BO8B 3BP5B 1LO0H 5IEHB 4HT1H 3ILQD 4FLHA 2XIDA 3IGLA 3B9DA 4OSUH 4GXVH 3EOTH 4HSCX 3JWDC 5FHBH 3IPEA 2Y07L 1BQ5A 3D39E 4NN7C 1H6TA 5E8EA 5DRXA 4EVNB 2JKSA 4ZSOA 1BF5A 3L6FA 2LGNA 3DYOA 3C5ZC 4UQDA 5IOPB 2OJ1A 4P5KB 4RZKA 4DN3H 5DK2B 1RMFH 1YEKH 3WFHB 4N0CD 1J7VR 4ONGH 4C56E 4YNYA 4JO4L 5CLYA 1QLRB 3U7WH 3TCTA 2RIKA 1NUFA 2F8VA 3W5NA 1U3ZA 3UGEA 3RA7H 1J9QA 4HUUA 4QRPB 1EWHA 2ZJSH 5CCJA 3PV6B 1CTNA 4YXHL 3QQDB 3TA3B 4ZMYA 4QF1B 1SMOA 3EGDA 3WD5H 2ATKB 2A9MH 4ZXBC 2IQAB 3RVXD 5GGRA 2X09A 3EH4B 4AENB 2W94A 2VL5B 1HQRA 5T33L 1HNFA 2Z35B 4K3DH 1RKRA 4WUKH 3OG6B 3X1BA 3A6CH 2PCPA 3P30L 1YQVH 4ZYKB 4HXAL 4MLIA 1WS8A 2V4LA 2YAOA 4RWYH 1I7ZA 5F21B 3TWCL 4FNUA 1VFBB 5CZRA 1WAPA 3OSVA 4Z78B 4Z0BL 2C9SA 4LSSL 4TRPH 2CKBL 1B90A 3BDXA 3TO4D 4A6YL 1E67A 3QG7L 4F57H 4F7CB 1TKWA 3L9EA 1PBYA 5DUBB 1A7OH 2FBJL 3EHBD 3MOAL 4HJSA 3DX9B 3TF7C 1LK2B 2CKBB 4ATWA 4CW1B 1KCRL 1MCQA 4XPFH 1FLRL 1KB5B 3FH7A 4N22A 3DARA 1P84K 1KEML 4LFHD 4YDJB 3T2OA 3KPRA 1MKFA 2JCCE 2GBTA 2X3AA 4UV4H 4H8WL 2NX5A 2YAFA 2VR3A 2GJJA 2KT6A 3VQ2C 6PCYA 2OMUB 4KI5F 4OLXH 3K6DA 4K7PY 4IBLT 2WUBL 3BKCH 4RZCB 1BQSA 1F4XL 4Z7QB 5C86A 2P48B 4EN3A 4OUOA 4W6XB 5DFTA 3QJSB 4ZUVB 3WN5B 1SDYA 3KEHA 3WFEH 1BQKA 2XVBA 2CQVA 3GXFA 3ARFC 3I6KB 3MV7B 2PMZA 1OTSD 1SDDB 1SYVA 1T0MB 1YEEL 1WBZB 3EOTL 1W0VA 3OR6A 4JPWL 5EZJB 4BKTC 4CSSA 2YAHA 4MCMA 1ETA1 2V8LA 4FL4C 1KEGL 3KR3L 2QQKL 1AD9A 3RTQA 3DO3A 5FKPB 4FLQA 2HVKA 2E4TA 1U2YA 1XR9B 3ILPB 1DANT 2YQ2A 1IE4A 4U2ZA 1UZ8A 4GIOA 3Q9PA 2FHFA 5E1HB 4A7GF 2XY1A 3BHBA 2ZCHH 4FMFA 1NEUA 4L2LA 1DEEB 2R23A 1UXWA 4GUPA 5I26A 5B4MC 5HI5C 1TTRA 3L5WB 2WIIB 1MHPL 5H4ZA 2ED7A 3VD5A 2CO7B 2J3SA 1C5CH 1UXMA 3VFRB 2Q7AA 2R2EB 3JWNH 4U1SA 3WXWL 5C70A 1U8LB 2WCSA 1DVFB 5EBLB 4M3KB 2IPKA 3MNVB 1IC4H 1XGRA 4PJ9D 1YUHB 2OMBA 5DJXA 1OP5K 3O8XC 2IG2L 2UXGA 4M5YL 5BVPH 2VKWA 4X83A 4KPHL 1BG9A 3WXVL 3JQOB 3E6FA 2D31A 1PD0A 2OXHB 1R0AL 1HAUA 4BELD 3S5YA 1E5AA 2XICA 1OHZA 3P4NA 4MLSA 3CVHB 2P7TA 2ED8A 4HJUA 4LMQE 4KOBA 4UWQB 4H8VA 3R7RA 4LO9A 2IALB 1J86A 2YPKB 1LMKA 3EFOB 4LSTH 5INCA 3BPNC 3BJLA 3CU7A 4G6FD 2CMRH 5DDHA 1PG7L 4G8EA 5TE6L 3TU6A 2K4AA 4UT6L 3GLDA 1ND0B 1A3RH 3X2QB 4JX0A 3ZIMA 5D7JD 3TN0B 4K3EL 2UXTA 3HLAB 3V4VB 5G4OA 3VDAA 4XVTH 4PWEA 4IYKA 2BVOB 1G6RL 1MIML 4PLOB 3OHXB 3ABZA 1H19A 3T4YB 3LAFA 3HMXA 4L5FE 4ZS7H 3UBFA 1SLWA 3QARA 1SHXA 1JTOA 2BVTA 2VQ1A 3N1PC 4F15C 2BFGA 1JFQL 3QZOA 4KU1A 3W11C 5K1VA 5BXFB 2FL5A 5T3ZD 4FGMA 1HXMB 2XFGB 3EJTA 1FL3B 2DPKA 5JTWA 3NFPA 2NSXA 3G5WA 3ENEA 2IV9A 3HC0B 1TQWA 3TH4T 1S9YB 4DFHA 1S7TA 3FQ2A 3WY2A 5E6ID 1X5LA 3EO9H 3U9PH 2CDGB 1XF2A 1C16B 1QHOA 4QXVA 2OMTB 4G9FB 1OOWA 4HUKB 2DQFB 5D7JB 3TN0D 3TEZA 4OZHF 2EDMA 2EKSB 3L1OH 4F7TA 4HX1A 5IHWA 5E08H 5HVGB 1N5YH 1MH5A 4JRXE 2F5AH 2BERA 5CGYC 5AENA 4MQSB 5HHNA 2AABH 1UJ3B 2KERA 3AAZB 4FFZA 1VEMA 1JHKH 3GTNA 1SBSH 2WZ0A 2VUKA 4L8DB 5KAQF 5D1QE 2DQUL 3FSZA 1ED3A 5T3XD 3OKYA 1OY3B 2VSKB 3O3DB 3EXJA 5KBLA 1J0KA 3RI5F 5FKAB 4LFHG 4R90H 4E9LA 2F61A 4FD0A 3PHSA 4PJ7A 1H5BA 1SLVA 2EDOA 5EUOA 2WAHA 3M1BA 2VDKH 3NRFA 2ISDA 1DO5A 2O1AA 3PP4L 4OJYA 1AGBA 4RBPK 5C0BD 3UAJD 4G6KH 2NUTB 3UC2A 4KDTC 2BHUA 3OAZH 1QWUA 4Y19E 1VFOA 3NSDA 4FFVD 4LP8A 5JOEA 3O9WD 3O8XA 2IAMB 2IF7A 4HDIA 4K94L 4X6FA 1U8JA 2FX7L 1OWRM 1MQKL 2ZKMX 4UILH 4JM4L 3QDMA 4YAQA 2TAAA 1AQDA 4U1JB 2Q86B 2BP3A 4G5ZH 4L3EB 1OKEA 3FB8B 3SN6N 5BOPA 3MV8B 1F5WA 3AW5A 5F9AC 3WJJA 3ULUL 1A3RL 3NCCB 2YPLB 1Z9OA 4U1GC 4MAYB 4QYOA 1HHGA 2VJXA 4AYMC 1Q0YH 4U1NB 5ES4B 2V2WB 4KGLA 1TJGL 1SVBA 4CADA 3TM6A 3PL6A 4JJ5B 2BCMA 2VYRE 5H94B 5C1MB 5DJCA 4NUMA 3GPSA 3RWFA 1Q9OA 4LQ1A 4XPGL 5DFVC 1JNLL 1TTBA 2A83A 5ERWA 2Y22A 1JTPA 4IMKA 1E7VA 4NC2B 3NEXA 4UT7H 3WJJC 1SMAA 3MTXA 3OGCB 3BZ5A 5MEOA 1LEIA 5DYFA 3L95A 2YGQA 3PQYD 1BM7A 1DUZB 2BSSA 3MRHA 1I7RB 3P73B 4NWTL 1J9RA 4GS7C 2YMXH 5GRJH 1NIEA 1HE8A 2JJWA 3EO9L 5D1ZI 4GP4B 1TO4A 4GMTL 1KPRB 3KS0J 5IHZA 4PLKD 3OHMB 4RA3A 5CR8A 3TTYA 3FOMB 3RX9A 1N10A 1MG3C 1VGKB 2E7BA 3WHE0 3VGDA 1AD0B 5CP3H 2KPNA 4G1EB 4WDIA 2AV1B 5DJ2B 4I48B 3IMWA 2GC7C 3BJ91 2ZNWA 4L4VA 3VXUA 1BZ9A 1I8KA 3P9WB 1FFTB 2OI9B 1N8ZB 5I71C 3RY4A 1W9XA 1DVUA 5HVHB 3CE1A 2EUXA 4POZD 4P46C 4XP1L 4FP8H 4JPWH 4XO9A 5LQBL 3IWUA 3REWA 3SJVE 5F0MB 1TIUA 1YG9A 3OZKA 5I1LA 5T1DL 3TL5A 4Y1AA 3I75B 4YLQT 4WHTB 3CLWA 4GRWF 4JHVA 1I1CA 4AUJA 3DETC 4PWHA 4M8VA 3DGGA 4AUUA 4LARH 2BC4A 1E5UI 4R84A 3NSCA 3HOGA 1ZPLA 2YA0A 1AGEB 1ZHLB 2WGXA 3KPSE 3MLVL 4PJGE 4PP2B 4QEGA 3IDYC 3SPVA 3F58H 5C0JA 3EO0B 3PP4H 4G80A 4WNJA 4LIQE 4RMRA 1JGLL 2NY7H 4FFZL 4NN6B 5DRXB 4EVNA 4OGQC 4YBLC 5GGUB 5BV7C 3GEWB 1EHLL 5I1IH 5EU6B 4HWZB 3DX1A 4YK4B 4Z6AT 2GSGA 3ALWA 3TWYA 5F9OL 3ZYJA 5E8DL 5A2JH 1NBQA 4ESKA 1YVLA 3ARBC 2RD0A 1YEGL 3QORC 3VXSD 4JE0A 4U0QB 4WO4B 5EOTB 1KXVA 4NPYB 1DN0A 5C71A 4LSPL 2DQEH 4NQCE 4KV5F 3VQMA 5EN2A 4Y9FA 5KBKA 1UOWA 2QQNH 4HBQA 3T6QC 4KK6D 3LEXB 2DAVA 2HRPH 2ZOOA 1P2CA 1VLXA 5MENB 5DRNA 2I25N 2KZBA 4XPGH 1A6UL 4FMKA 4X9GA 1GMEA 4YQXH 1E40A 3RRQA 3EGDB 5IVNA 5DHEA 4YEFA 4X7CC 4AITA 1PAMA 1ZA6B 4GP8B 1AE6H 5C2BH 3C5JA 2YZ1A 1GS8A 1RZJH 3F7PC 2OCFD 1XAKA 2DI7A 1U4FA 3EGXA 2AQ3A 3MGOB 3MRJA 4OZGA 2H3KA 3I2CL 4ZW7A 3UJTH 3WYRA 3L3OC 4XOBA 3QDGD 3TO2A 2BSCA 4GT7A 5IB2B 5EMYA 4G8FA 4MMXA 2D4FA 2ED9A 3OAYK 5L4IA 3STZA 2V2TA 1J10A 2CGRL 4HZLB 3ESPA 1NCAH 4A7GA 3DXAB 3CC1A 4GSXA 1G9NL 3MYJA 2AHIA 2PP7A 3HBQA 5JO5B 1EEZB 4BEIA 4ZG1A 1YNTA 3BFWA 3P2BA 4JFPB 4P4KB 3EO1A 5IJKA 3WL9A 1H3PH 4D9RD 3PFQA 2ALAA 4OIFA 1JF6A 3T4AB 5L88L 4R96B 1T4KA 4ODWB 5GIRB 5EORL 3V0WH 2XWXA 1HYSC 3QJHB 4YGAB 4PJ7F 2M83A 4S0SD 4N1CA 1LEKA 5I15L 5EU4A 5AEAA 2F5AL 3BFOA 1IV8A 3LKQA 4W68A 4L0ZA 2NX5E 1DLHB 3RU8L 5FM5O 3FQTA 3BAJA 2F9BT 1HCZA 3QUXD 3P2TA 3E0GA 2X40A 2GHZA 4KXAA 4Y4FA 4RFNC 3QHFH 2BWIA 1I4FA 3G7TA 4MZ2A 4QD2E 3OR6B 4FXTA 2XWJB 3AS3A 2JK5B 3QE5A 3SDAB 1AZNA 4E9VA 3D4GA 3QVAA 4R9HA 4WHDA 3WLBA 5LUMA 1JZ2A 2X0UA 2F8OA 2I9LA 4WTQA 2FJFB 3LKSB 4ENZA 3UMTA 4PV9A 1G7QB 2G5BB 1KYUA 1FC2D 4FG0A 4O02H 4Y8DC 3ATFA 4N28A 4HJJH 4X9FA 5T1LB 1XAUA 2D7QA 4PLJD 2WXKA 2YUXA 4M7LT 3ATEA 2XZAL 1RPKA 5D1XA 1RUKH 4GBXC 5JW5A 3FRUA 2PABA 4JKMA 5IBTH 4OLWL 3R06B 2D7PA 2C7FA 1DR9A 1BBJB 4HUWB 2FX8H 1FFNB 5GGVL 4PW9A 2CKBH 1OM3L 4NOFA 2HLFD 3RWGA 3K2KA 3MBWB 4P2RB 1NUNB 4G9FD 1FNAA 2PTUA 2BVUA 3S37L 4KZ0A 5EBLA 5FXCH 2IPKB 3LZOA 3MNVA 3L45A 3SKJL 1T1WA 2WY3B 4XODA 4Z0XA 1L7IH 2BRRH 2FSEB 4J3TA 4D9LH 2GUOA 1DQJB 2DTSA 2I69A 1D2OA 5JIMA 2G3ZA 3E6FB 5CJQH 3BVWA 3AVEA 4FQHB 3PL6C 2MKLC 3HFFA 3V9FA 4CC4C 2I9TA 4OD3H 4X50A 5AKSA 1X5ZA 3BCFA 3ZLQC 3VXPA 5CBAA 2FYYA 5IQOA 5IVZB 3JTTA 3FB7B 3L4CA 4BWTA 2B08A 3FL7A 1BIHA 2CUHA 3AQDA 4LHUB 4GMSL 1UH3A 3UXFA 3TPKA 1SVZA 3UIZA 2KZWA 2R7EA 1WEJH 4JFFD 4PWKA 4K5MA 3SSGA 4C47A 3QFDB 1KELH 2CK2A 3MBEB 4J1UB 5CCKH 1HNYA 2OMNA 5KBMA 2JSFA 2FZ3B 4M29A 2R2BA 3SD5A 2JB5L 2E47A 3KPRD 5CEZH 1E6OL 2KZ1B 5BRPA 2FBRA 1U92A 3CK0L 1CCZA 3D9AL 5IF0A 1JGDB 3EJYC 2QSQA 3OHXA 3NH7L 5TPWL 3ZTCC 1I8IB 5CBEA 3WIIH 3V4UH 2HVBA 1RUML 4C4KO 3O6FA 4NRXB 4RGMB 3DOIA 2PW2B 4PRDA 1CD1B 4JGMA 1IE5A 1I1AB 1V7MH 2FGZA 3MLXH 4PJXE 4UB0L 2WO2B 3PABB 2A6IB 5JQHC 1NWPA 1P1ZB 4FQJH 4IGBD 2C1OB 2Z0BA 2EYRA 3JT2A 3VH8A 1M1XB 5IGXH 4ZS6D 2HLAB 4WJ5B 1IGJB 3HG1E 1EO8H 4WCYL 1R47A 4CN4A 3BVTA 2XBTA 1SYSB 1IQWL 1HU8A 2CHZA 2EDTA 3BEVA 5BVJA 4U1IB 2XY2A 3GB7B 3B3IB 3O45B 3KYKH 4DPBX 5I1AA 1ZT4A 4AT6A 3W82A 2X70B 1UKQA 4P2CG 4UQ2B 3ARPA 3N0PB 5E4AA 3MJ7B 3AABA 4FMVA 1QRNA 5GGTL 4R8WL 3H9SD 3T2LA 1TVHB 3U0WH 1B4RA 4KUZL 5SX5H 2PCFB 3DNKA 5LGHL 2NY0C 2DIAA 3SGDH 2BP8B 2QPFA 3BH8B 3P4MB 3HE6A 5IW6B 2GUYA 3O2VH 4L29B 4R7DB 4XI5C 2RCSL 2VUYA 3WNIA 4NJ9L 2IH1B 3HPLB 5HDLA 1WTGT 1L7IL 2BRRL 3U0WL 4P07A 4R0LC 5D7IE 1YUKB 4EN3C 1PGRB 3STBA 2ZF8A 2J8UF 3RVVD 1EZLA 1F1GA 4M03A 2WXRA 1F97A 4WKZA 4BM7A 2OMWA 3DJZA 3IGKA 2A4CA 2ENSA 3CHXA 5KOMC 3D18A 4ODXB 3ZDWA 2PPFA 1NFIA 4GRWE 4DP2X 1NGXA 2IAMA 3O2WH 4HDIB 4JPKL 4Q89A 3T0ED 4JFEA 3D25A 5D7IA 2AEPH 1HE7A 2CBTA 4FEMA 1PDKA 6FABL 4W93A 3QDMB 3T6VA 1TNNA 4YSSA 4I2XE 1NJ9B 1L4IA 1YCSA 3QZWG 2FATH 3ZT5A 4BQ6A 3F6JA 1DUYA 1A2YA 5D9SB 1OWWA 1PCSA 3O9WA 2NTFA 4XP9L 1JRHH 5I6XC 5AW6B 6FABH 2VWEE 4UTBL 4AM0Q 2Y9RT 4UV7H 3V4UL 4GKSA 5KG9B 3B3BA 4TPRL 2PPCA 9PCYA 3N3EA 1F00I 5LAXA 1DJZA 2MRYA 3NCFB 1Z1WA 3OR7A 4RA0C 4JM2D 1AG6A 2CCWA 4OLVH 5ERWB 5H37H 2Y1YA 4BHUA 3FSAA 5I28A 4W9GC 2OL3A 2Z7UA 4ZPVA 3O11B 3RIKA 4TVPL 3TLRA 1LEIB 1NCIA 1J1PL 4IOSA 4AL8H 1JGLH 2NY7L 4FABL 1WV7T 2NT1A 4GW1A 4KUCF 4N5ED 3MLYH 3WJMB 1T3FA 4HWEH 1N7MH 1WH0A 1UG9A 2F19H 1CBVL 4JGJA 4WNSA 2QJDA 4S1QL 3LHPH 4Z7VB 2F5BL 1BGXH 2G0KA 3GF8A 4X8JB 3OKOA 5CSZB 4UM8A 4HV8A 3NSFA 5GGQH 5AZEH 1A6AA 5I8KH 2AV1A 5DJ2A 4I48A 4B27A 1X4XA 2FX7H 3EW3B 3PF2A 4RNRA 5L8KB 3ARFB 1UGKA 1M9WA 2FJHA 3CFDA 2A9AA 2HJLA 2BH0A 2BWDA 3L17A 4I18A 2ZG2A 2E4FA 4JFDB 5CLTA 5I1LB 3S98A 3VG0L 3T0AA 1IZJA 4RWYL 1JPGB 4N2NA 4DJMA 5J9PB 5AZEL 3LX9A 5LAPA 4QHPA 1IGIH 3RPKA 4LEXL 4PRPA 4X6CA 3RTQD 2CRMA 1KUMA 1E28B 2QADC 1CD8A 1D6VL 3GSUB 3VFMB 4OZIB 1JNHB 4QGTA 3IMUA 2X2IA 4YHMH 3U79A 3CSYA 4G43B 4NQSA 2VAAB 4OKVA 3KBEA 4ELME 1SF3A 1LQBC 4F2EA 4UZSA 4JQXC 3V6FB 3TVMC 1W8EA 2XYBA 2LVCA 2X3CA 4FP8L 2C3GA 3RFZC 3NA4A 1JXDA 4Q56A 1T5WB 4FQ2H 1O9ZA 2H3NA 5ITBL 1OCCB 2E59A 2WV3A 3K91A 1LO3H 3ME0A 4GSUA 4J3OC 4IRSC 4WU7B 3QDHA 4ZMWA 3PCYA 4ZX4A 2APVA 5L8JB 4AK2A 1LP9F 1ZLVH 1KGXA 1RK0B 3BEWA 1A3ZA 1A22B 1GC1L 2YXVA 5AD0A 4OZGE 3FOLB 4HZ1A 2OX5A 3MKGA 4ZMVA 4Z7IA 1J5HA 3LPGA 3MUY1 2ZUTA 3EDFA 4FFZH 3HG4A 3QI9D 1RPQA 1EQWA 3LDBB 5D2LE 5F44A 1ITBB 3GSWA 4GXUN 2WCGA 1BPVA 4QJ3B 1KF9B 4U6XB 3BE1L 4FG2A 1KV3A 1U3YA 4PRBA 3TJHD 2ZUVA 3MRPA 4MMZB 4KROD 4PYHA 1UWGL 3TBWA 3WNNA 4OI7A 4UOZA 3ULUE 3RZCD 3T2NL 1GGCL 1K5NA 3VDBA 4XOAA 1HEJC 1FL6A 3ARVA 2AVGA 4IEFB 4APQD 5FYLH 3IAQA 1NIDA 2ZKWA 5DMJB 3HNTH 1JZIA 3QNXA 4MAZA 1PG7W 3RZCA 4TYUA 3AREC 4XNZC 2MWCA 5DZAA 2V2TB 1TZHA 2WTRB 1BFVL 4YQXL 1KB9K 1J8HB 3ULVC 3SOTA 3ABGA 4UT9L 5JDSA 1C8PA 5E23A 3KD4A 4B0MB 5F7HA 2NRDA 3GJFB 2H47C 4L3EE 3C60B 5KVGE 1GHFH 4BXSV 1CFQA 1R1CA 2WXFA 3SDXB 1IC7H 3ECQA 3S37X 1RY7B 5GIRA 5HYIA 3FBKA 2WLZA 2Y1ZA 2ZOLA 2YWYA 5A2IH 4YBHA 2R0WH 5FEBA 1BQLL 3P3RA 2OMVA 1AGFA 2DEWX 5BS0E 4KVPA 3ZTNL 4POYA 3HN3A 3CZKA 2XCMC 1UJ3C 3U1QA 2NQDA 1IL1B 2YWZA 1FFPB 3FHAA 1N0XH 4UMSA 5J1SC 1CICB 4KQ0A 4L4VD 2WVUA 4XBGB 3QUGA 3KW8A 2Z6FA 3N40F 5DHYB 1RULH 1G6RB 4WWKA 1VSCA 4PHXA 3SYCA 2NNFA 5B3NA 5EZIL 5DURD 3GXMA 2CLRA 3UZEA 1FUNA 4E41A 2XFXA 3ARUA 1BAGA 1ANUA 1DJSA 1GW0A 4NQCA 1BLNA 2M1KA 1FV1A 2J5WA 3PREA 4KK6C 1LO4L 4WGWB 3ZDZB 3FT3B 3VFPB 4JJHA 3FFDB 3CCHA 3QPQD 4HGMA 5CN3A 1TF4A 2EDJA 4KC3B 1SQ2N 2C9UA 2BCKB 4KI5D 3MLSH 2Q7YA 3PAYA 4N90D 1YMMB 1TJIH 3GTTA 4PJIB 1I9RH 2HLEB 4K7PL 3UO8B 1K4CB 4GXFA 1IBGL 2XKSA 1FJ1A 3PXJA 3T0VA 3WY3A 2YUVA 1KXHA 4LXFA 1Z0MA 2DLHA 3LEYH 3QH3A 4DN4L 3K6SA 4OZIF 3UG5A 4N0UB 3OZ9H 1GL4B 1KT2A 3GLAA 3L2LA 5AKRA 1SJMA 4KXBA 4BSWA 3BD5A 5F96L 2BOCA 1WF5A 1Y0LA 4M7JH 2MOGA 3HZYB 4FQPA 4CC1A 1EANA 4NAJA 3B43A 1DLFH 1I7UA 4IRSA 3CZJA 3HS8A 5CINL 2WAQA 5C09E 2X2JA 2EE3A 4E9TA 3UJJH 3BWSA 6PAZA 5DYOA 2B0SL 5I1IL 1QWHA 2FO1A 2W92A 1JZ7A 5FO8A 3DDGA 1T2QH 3NFSH 3CHRA 3DYPA 1TOXA 1AHWB 2VLJE 2E8ZA 4Z95H 3PHOA 3PXHA 4NC1C 3V6BR 3MOBH 1TQUA 1VHPA 2KZKA 3D3VD 5KS9E 1LK3H 1I53A 1SPDA 4ABWA 3W9DB 5BZXA 3BIKB 4RRPM 1CGSH 1Q94A 4UQIM 1DVXA 1OE3A 5E0FA 4JFZH 2BS71 1P5VB 3WS6C 1FNSL 1EMTL 1BW8A 3AB0B 5KJ4A 5FDWB 1TDQA 5EPMA 4X4ZA 3O6MH 4M1CC 2CLZA 4LOUD 2C26A 2VAJA 3MCG1 3SKUD 4HT1L 2E27L 4JKNA 4A7TA 4IKKA 4EIZC 1CFSA 1HZKA 3DHJA 2YOCA 3V0IA 1HINL 2P8MA 5DJ0B 4QOKB 2WXHA 3B2MA 3PWVA 4LVNC 4F3FB 3OGOE 4DCQB 1N70A 5DO8A 1PKQA 1F90L 3QQ4B 3IMTA 4LB8A 2DL2A 2O5XH 4Q0XH 4XCEB 5D96B 2WGNB 3TIEB 5T3XE 2J1WA 2CZNA 2GYSA 2W91A 2MNWA 3FT4B 1Z9LA 3CC5A 3FTYA 4HD9A 2AJXL 1WO2A 2YZ8A 3BAEH 3M46A 4JDEA 5GSVB 4B7LA 5JPMC 3GNML 1BMWA 2DW5A 2X70A 4UQ2A 3KPPA 1EGJA 1KG0A 3BP4A 1OAUH 3IJYA 4J3OF 4P23D 5D5MA 1A7BA 4CNIA 2RFXB 2X6CA 5IKCA 2XKNA 1QHPA 3F5WA 3F7YA 2BRQA 2PCFA 3S4SA 4XXCC 2AEQH 3U2IA 4AW7A 3U0PA 3IPFA 2Q87A 4NO5A 1UB6B 5GGTA 1QEWA 1K6QL 1D9KB 2UZPA 1IGMH 4PHZA 4O4YH 4Y4KC 1F6LL 3G6JA 3Q5TA 4KY1L 3D07A 4LVNB 2IH1A 4YHOH 4RFNB 4N1EA 4UUJB 5AW8B 1B0GA 3LH2L 2I5YL 5E1AB 5IHHA 1IAII 3WUZA 3RVUC 4J6RL 3RVTD 4HK3J 5GS0L 4PPTA 5MHSE 4KUZH 4F91B 3QUXB 3U2SB 4Y2DB 5MEPA 1PZUB 1UA3A 2DOCA 5D7IB 1Y18A 1X5MA 2B0SH 3MCKB 2YMTA 2JXMB 1W6LA 2CLVB 4JRFA 3MRIB 5IMLB 1KCWA 2P80D 4WY7L 1C5BH 3QG7H 4XH2B 2Q3ZA 3UBGA 4I2XA 4JO8A 1FGVH 1DVZA 1Z5YD 4MNGE 4Y1TA 4CA4A 2IADB 2AK1H 3KPSA 3CLFH 5EA0H 2VLRD 1F3JB 3MXWH 3PXLA 3VWJC 4TSBL 2IGTA 3L3OB 5FW8A 3IMSA 4MB5A 2K7PA 2X6MA 4LCCB 5I8EA 4CBPA 1BXAA 2OAAA 5GGVH 3P0GB 1PD1A 3DVGB 4I9WD 1BAFL 2NOYA 1FF5A 1R19A 3E8VA 4TVUA 5ABDE 2QGEA 2V7NB 5F9OH 5BUPA 1HXKA 2CHXA 2IAAC 4HQQH 1FZKA 1G1OA 4HS8L 2F7OA 4LKCA 4LU5L 5EOQL 4P4KC 5I82A 1P6FA 3H6AA 2VLRB 1IC5L 1VFAB 1CLOH 4FNLL 5KTEL 4ZPVB 2CBMA 1NOLA 4MHHI 5F9DC 1OP3K 1ZDSA 3EJZC 4TTDD 1KTLA 4KKCD 1XD1A 4ACTA 5BO1H 1KGJA 1E4WH 4UBDD 1X7TA 2GBUA 3GGWA 5KVFL 2WZ6A 5DUML 3UABA 4AEFA 2WOBA 5FHAL 4I89A 3WFHA 3D69B 1SJXA 1L9MA 4RQQB 4DP0X 4PRPE 2IOIA 5IROA 2FHBA 3OAUH 4P9HC 4KXZI 5GQBA 2OTWB 2HFFB 2DIJA 4LCVA 3B8YA 4R0LA 5DJDA 2X1OA 1ZLSL 3X11A 4PD4J 5LBSH 1P4BL 1ACYH 4HOZA 3P0VH 2EVGA 5FYJL 1P7BA 3MHZA 1TJGH 4X4KA 4QIRA 4PQXA 5E2UL 5T3ZH 3TNNB 3UTQB 4U6YA 2B1AL 5IMOB 1ZKAA 3D2UB 2W0KA 3QRGH 2VDQB 2Z4QA 5D6DA 1A4AA 2WBKA 2Z64C 3DX7A 1E4XL 3EDEA 4AENA 1VPOL 3UBXA 1TO5A 2R0KL 4FJ6A 3ML9A 2V3FA 4UTAA 1HCYA 4D8PB 4XN7A 5E7FA 4HLZG 3NOIA 1AQHA 1EGJL 3UCQA 4F8TA 1RURL 2G5UA 1JZFA 2YOAA 4JKPL 4WU5A 4WGKA 4CSPA 1KC5L 2VAAA 4LCIL 4PJ9B 2CU9A 5I30L 1MW0A 1VPOH 4XBPA 4P4KD 3V6FA 4JRLA 2YK1L 5HHMD 3BESR 1IKNC 1NCWL 1JYVA 3IJ7A 5IFJB 3RVWD 4FA7B 4YE4L 2L7EA 3VB8A 2H1PH 5C8JB 4K8RL 1WWAX 3ZTJH 5FV1L 4HH8A 2UUDH 1LLAA 2ZCZA 1IBZA 5CFHA 3AWGA 2XU9A 2E5EA 3L3KA 1QYGL 5FK9A 2DBLH 3QFJA 2YSSB 3KHQA 1TSHA 4Y16A 4PBDA 3BT2L 1PEZA 3VTTA 1KCUH 4JRYA 5C09B 2HT4D 3H9SB 3QXTA 3C8KB 3OJDA 3U25A 2OMUA 5F97E 2H8PA 5E4EB 4PBWD 1KTKE 5T8IA 3ARGC 2J71A 4EN3B 5I66B 5KSUA 2XJLA 3ULUH 3GSWB 4J27A 3QWNA 1XSJA 4JO3H 3TH3T 3AXLA 4PJIE 5FUZL 2AC0A 4ZUUA 2WO3B 1H3TA 3A67H 1WIPA 2H0PA 3FBQA 2VDRB 5G4NA 2IDSA 2PWHA 2OYMA 3VVWA 1BSIA 1ORQA 4GKOA 4HEMA 4ONHA 1CDIA 4U0RC 2VO8A 1IU1A 2BVPB 3SO3B 4PJ8A 1DQQB 2D7MA 1YY8A 4JKWA 3LZFH 4MDIA 2PO6C 1CXIA 1UM4L 4H8UA 3EJSA 4RGNC 3O2WL 4X80H 4OJCA 1TTCA 1VACA 4M4RB 4RGMC 5ANMB 1RUAH 2F68X 4P9HL 3QDAA 4JFOA 2AXHA 3MCYA 4LRIA 3ARWA 4FI7A 2AXFB 3GSNL 2P3YA 3QNZB 2BIQA 4I3GA 3BUYB 3NCMA 4K4KA 5KVGH 4LCUA 4M1GL 2H26A 2FT7A 1XSIA 4MVBD 3D08A 1Q0XH 3L1GA 4ZXBB 3VD1A 4GW5B 5F3HB 3EHBB 2W0FB 3EYVA 1JHKL 2RCSH 2I24N 1XGRB 3L8QA 5GISH 2FWOB 1UEYA 1XF3A 3EH2A 5E2VH 5CWSA 1RSYA 1HI6B 1WEJL 3RQ3A 5IVXA 1YLBB 1XF4B 4HSQA 3EOBB 1GC1C 4IGBC 2HG5A 3KMDA 4XZUA 4XGZA 5AVZB 5FF6A 1DJHA 1WQVT 3OWRA 4LRIC 4EIGB 5L2KE 4OLZH 4Q4EA 4FE9A 2H9GB 5C0RH 1MHEA 4Q97A 2BFVL 4H1LA 4XOCA 3G5VA 3LXUX 4ODTL 4FCHA 5E2VL 2AF2A 4L5FL 4FQIL 2YAPA 1BZ7A 1GS7A 3ARTA 3KPQB 5E03A 5E9DB 5AB1A 3TFKD 4W9IC 2H2SC 2CUMA 3II2A 4R5VA 2AABL 1QLEB 1AR1C 2VJ0A 2YK1H 4FQQB 2KH2B 5H4YA 1PAZA 2A9CA 4U1LA 4H5SB 1G7HA 4UTCA 3E2HB 2PTTB 1BQHG 1NANI 3K2UL 4WW2A 4HG4K 1EHKB 4NQDA 1M7IA 3P4OA 2VN7A 1XVSA 3BT2H 4ALAC 4PW3A 4WCYH 1QKZH 4OGYH 3B9KD 5DEFA 5SWZD 2ZCLL 4AIOA 4X7TA 4D7BA 5IGXL 3UPAA 4B9JA 4WV1B 3MUHL 4XWGL 4Z77B 1FYHB 1KBPA 4LPCA 3MRMB 4W9LC 1HK6A 2CIKA 4UT6H 1MNUL 4H26B 4M62L 4Q4IA 3U83A 3K6SB 5DJ6A 5D2LB 3EJYD 4LSTL 3ROOB 2F8XC 2OMXB 4UQEA 4AYFB 5ISZE 1LO5A 3DUSB 3ZSSA 1CFTB 2ERJC 1U36A 3QK0A 5CO1A 4FADA 2VERN 1S9YA 3M17A 2YQGA 5L4FA 1XR8B 1CUOA 4PJXA 3VXRD 2UY6B 3MU3A 4G5ZL 2C4FT 1LEGA 4XCYA 2G2RA 1U8CB 5BJTB 4IRSB 4GRLA 4F9PC 4JY5L 5FO2A 3NIGE 4CU7A 4PREB 4CVZB 4OUUB 5ENWA 1UC6A 3W0WB 3MZGB 1SEQH 1KB5H 1EAPA 4JHAL 3FRPG 4G7YH 3BH9A 3AAZA 3QCUH 3MV9D 4PRHE 2ADFL 3MLZL 2L04A 5EU3B 2VNCA 4GAYA 5DUJA 4FFYH 3CFNA 3AWFA 5J12C 4KHXH 1OVZA 1FLRH 2YLHA 3DJTA 4DKFH 5C0AD 2P24A 1F4WH 5J1AB 4F8QA 1QX1A 4LP5A 4JHAH 1F2QA 3BKML 1UD8A 1CG9A 4F8PA 5KVEE 1GVIA 1AZUA 3BGMB 3EJZD 1QACA 2IDCA 3ULUF 4LVOC 2Y4SA 3QORA 3ZT6A 4YHYB 5HVWA 4HJ0C 1G1KA 4FQJL 4P2RE 3S48A 4AGLA 1U8NA 1MCJA 1YEEH 2WUCL 1U6AH 1J05B 2XYCA 2E8YA 3QEUB 5ESQA 3VU1A 1DJWA 2GG1A 4QRRD 7FABH 4E41D 3MX0B 4ODSH 1RJZB 5J89A 5E99L 1PKQB 4OZ4B 1KYDA 3VRIA 3OC8A 1AC0A 1CGSL 2XVLA 5ICYB 1W16A 3HHSB 3OLGA 4ELKB 9CGTA 4P9MH 3D8MA 5FFGA 3RVUD 3L5HA 3ILDA 2N0MA 1ZS8A 3IJHA 5C0AB 2WUCH 3WHE1 1E6OH 2EE6A 1MW3A 3L9RA 1H8LA 3TURA 3FRPA 5EA0L 4JRXB 3ZL1A 1YEDB 2XKNB 4M5ZH 5BRQA 3CSGA 4NM4H 5HY9B 4F7KA 2ZKYA 2L7JA 4JFQB 1LHZA 4PCKA 3MFGB 2HRGA 5AVYB 1SLXA 5FM8A 3ULVF 2YPLE 1YEKL 1BVLA 5GGQL 4C83A 3GIZL 2IBGA 2A6JB 3H7LA 1CDUA 3ABKB 2HX8A 4LSVL 4NN5C 2YFOA 4G42A 2LAGB 4LMQI 3KL5A 5IESH 4HQQL 4QRRE 5B38B 5JHAA 3HNVL 4XB8A 2DQDL 4I0PD 1Q1PA 1EVUA 5E1AA 2Y36L 2BZCA 3VFGH 4NQXA 1OAUL 4B9GA 1BZOA 1KGUA 2R69H 4MDJB 1JYWA 3I6LE 2DIBA 1GZQB 2R0ZH 1DANU 2BZ7A 3C6SA 3VYPA 2FE0A 2C9XA 4MJ6B 5IB5B 3WFDL 1YECL 1MLBB 3QR2A 4TOYH 1JDAA 3DSFL 3VXSE 3V4PH 3VXUB 3H2QA 4Z7UE 1RZGB 1UOVA 2GBAA 4Y5XC 1AAJA 4I85A 5B1BB 5E4IA 3L54A 3S5LA 5CUSH 3L4WA 3TYFB 3BZEB 4NBYB 1YECH 4GRWB 4XTRD 5HDQL 3LRMA 5F7DA 2TRHA 4ZMOA 2V2XA 1H9VA 2ROYA 4LL1A 3UYOD 1B88A 1JWMA 3IAGC 4WWOA 1NEPA 2WVVB 3SPVB 2F54A 1TETL 5AZUA 3A5VA 4OI8A 2F18A 1NFAA 1YYLH 3WEXA 3OKLA 2C3XA 5A6IA 2ZSVA 2VLRA 3V7AE 1QSEB 3G5YA 3IDJB 5EU6A 5F7FA 5TGBA 1JGUH 5KVEL 4O2EB 2GSIA 3ULVL 1FCCA 1DP0A 2B1HH 4QXGL 5AOKA 5CEZE 2O61A 5F0LB 2V37A 5LGJB 3GJFK 2VLLA 4OM0L 5HHME 4TL4A 4Q8BA 1HIMH 1VIWA 2GW5A 3B9KC 3Q2CA 3L81A 3LCYA 2OTWA 1FO0B 4NQEA 3V9CA 1QRND 4ZW3A 4AM0A 5IV2B 2HKFH 4MJHA 3Q1SH 3AQZA 4KX7A 3SEPA 5A2KH 1A02N 2WLNA 5KAQG 3ISYA 2A74C 1AR1D 1AACA 4G6JL 1NGPH 1M7DA 1TFHA 2AQQA 4XRCA 1A6WH 4NQED 4KJQD 1IJNA 1YEFL 4RFOH 4ES9A 2GCYA 1BJ1J 1QTPA 1OTUD 1DBBL 4I7ZC 4EO5A 3AROA 5D72H 4GG6A 4AG4L 3CLFL 2HAZA 1EERB 4FQCL 2E74C 4PRAB 4PU2A 4ZTOH 2X42A 3FH5A 1P6AB 1NBVL 3WENA 1O7SA 3D06A 3PGCA 4UQCA 3MRFB 4P48A 5F1IB 3QWQB 1QNZH 3G6AA 1CR9H 3KGTA 3LZNA 3E1ZA 4FERA 1UYWL 4TOYL 4WWPA 2OYLA 3GXDA 3KDMB 3X14A 4GIPD 3WLWD 5DQJB 4DQOL 2CD0A 4ADGA 3ZSTA 4AQAB 4PJDE 3P9MA 2NQCA 2VRKA 2PWEA 1UA6L 4QYAA 1CU4L 5C8JA 5IY5B 2FUTA 5E9DE 4GH7B 4Y5YC 4ZQTA 2EEDA 1KLGA 1I3RB 4P2OD 4XAWH 3NCBB 3X1NA 3QFJB 2OJZL 2K9UA 4Z3GA 1MDTA 3ULUD 1CLZL 4HF5H 1X7QA 3TX4A 4DVRL 2QV4A 3FQUA 5BO1L 3OAUL 1S6NA 3LXCA 1AO7B 4HS3A 1HHJB 2IQAA 2EDXA 4IDLA 3BWUF 2OTUA 4M93C 4P2YA 2J25A 4OFVA 1GZHC 2X2HA 4GB9A 4ERSH 5BS0A 2ZQKA 4JFVA 3MLRH 3EFDH 4YK4C 5F9JA 4ZUUB 3ZL4L 1RHFA 4TSCL 5BZWB 1UACH 3ARED 2SEBB 3SDAA 3TONA 2H4EA 2O5YH 2VERA 3ZE2F 1TXKA 3IXTB 3QXAB 4RAVB 1JPFB 4TPRH 4APQA 4YVNA 4HAGA 3BAKA 5ANMA 2XIIA 3N85H 1CC3A 1R3IL 5FHBL 3GBMH 3R1GL 1WUZA 1VGEH 4BBWA 1CFVH 4YH6A 1RURH 3NUKA 3W3BA 4RDBA 2DQHH 4HWNA 3D0VB 1LK2A 2CKBA 2DKMA 1TSRA 3QYNA 3DRTA 3BWUC 3VXQA 1XGYH 3GSRA 5D7SH 4K94H 3BH4A 4HK0B 5I8CA 1XGPA 3B4NA 3EUUA 1NBYA 3RWDA 1XH1A 4FTVA 1M4KA 2F19L 2OXGA 1CLYH 3CHOA 2AI0H 2Y3AA 2OZNA 2O30A 3UH8A 3BKYH 3ZE1E 1NGQL 1EX0A 2ZP0T 3PU7A 5DS2A 4BFNA 5IVZA 4KXDA 4OFYA 2WLIB 5TDPB 1R5IB 4FI8A 5I1GH 5IJCC 1CS6A 1VADA 4KBPA 4NEHB 2A4EA 4OCLC 4B9IA 4PJDF 5TDNA 3UPCA 3F7VB 2UZXA 4J2QA 4K9EC 3FH8A 4LLDB 4M6MH 2F1EA 1ET8A 1IILE 3MREB 3FHQA 1MFNA 2NNXA 3SQOH 2DWDA 3LSOA 4QTHB 3H42L 1CB4A 1OAJA 1VEPA 4LL9A 3GMQA 5HDRA 1QZNA 4NQDB 5CZKA 1I8IA 2ZWYA 3V5DB 5DEFB 1U8HA 2VISB 3LEVL 2KHAA 2QKIA 4D2NA 2IWKA 1JXJA 5E6SB 5BPPA 1U8LA 1I1AA 1OAQL 1F3DJ 3MRMA 5FA4A 2Y7MA 3HKZA 1YUHA 2V3EA 2EXWD 2Z93A 4AI7A 5C0BA 3L2MA 4M1GH 4I0CC 3FTVA 4BK5C 4Z7WB 2EVHA 3HAEH 4UTAH 2Q2LA 3S9DB 4K2UH 1QNIA 1V10A 1SN2A 4ZOCA 1LO2L 2P44B 5I8OH 3WTYA 1CFTA 1G1CA 1PX3A 3FTWA 3KPRE 3M17B 1XR8A 4FC3E 2IBZY 5GJTL 1Q9WB 1TVBB 2CBQA 4F33B 1MCWM 1X5IA 2OZ4A 1FE8H 5CEYB 1F4XH 4P0DA 2YAQA 3QUHA 2BVYA 1KCKA 2MTPA 4IOSD 4L4TD 2BNQA 2VMDA 1ITCA 3KLKA 3LS4H 1WG3A 3D85B 4OZHB 4ZBJA 2EACA 1XMEB 4EN2A 1PNCA 2VT0A 1Q90A 1NC2A 2G2NA 3FONA 3R8BB 3DX8B 3LKOA 3EZJB 5C0IB 4KJYB 3QQNA 3MN8A 5FM5M 1USQA 3MRKB 3SQBB 1JGUL 3LNGA 3QULA 1VZGA 4P04A 3E6HA 1GIGH 2NY2B 3NK3A 4BHUI 3EADA 4OU3A 4WKXA 1IQWH 3H0TB 2AI0L 1GJIA 4XP4H 2OV0A 3BZ4A 3CNKA 1YEGH 3CHPA 4M56A 4J4PA 2ZCHL 3FKUS 3JXAA 4XPAH 1N3NA 2FL5B 5DQDH 1Y7VA 3OLEA 4NO0B 3PQYA 1NMCB 2MOQA 4OF6A 4P5SA 3BFQG 4PBXA 5KVMC 2OTPA 2X4UA 1MQ8A 3H9SE 5AYUL 4IIQC 5GGTH 4Z7WF 1DSWA 1NGWB 2EP6A 2ZX9A 4U49A 2YRLA 2FB4H 4QY8A 2FNBA 5JHDA 5GS2H 5K5YA 3QUZB 3MX0A 4TSBH 2D9CA 4AEIL 1O75A 5SWQA 1RD6A 3MUGB 4WFFE 4ZS7L 1TZGH 3HG1B 5SV3A 1UT9A 4U05A 2LTQC 4ELKA 3EJCA 3MJ9L 1E2VA 5EU7E 4ZTOL 1HILA 5I8KL 2BXZA 5FUCE 1X44A 1LP9B 4OGXL 4C4BA 1VENA 2HPTA 1C08B 1ZSHA 4NB7A 4IMLA 5J13B 1XB6A 4BKLB 3LB6C 5DMYA 4QRUA 4BJLA 4Q6KA 1DQTA 1FZJA 8FABB 2CMRL 2EC8A 2EYTA 5E4OA 4K15A 4LPYA 3UTSD 4MCNA 3TJEH 3T09A 3CD4A 1ZTMA 2JMRA 1OTTC 4NZTH 2GITA 2VLJD 4IIQB 3O6LH 3Q6FA 5I76B 4JY4B 5BNXD 1UH4A 2CR0A 1RZIA 4U1HB 2WBJA 4YE0A 1QLEL 4G42B 2X0WA 4MA8H 3FAWA 4J8RA 1MCKA 4JW3A 2PTVA 4D0BA 4XXDA 4RRPG 4X4YB 2MKWA 3SYOA 2UY7A 2FH6A 4OF7A 3X3FL 4BZ2L 4NQXB 4X6FB 2WLMA 1KJVA 2G9HA 1LO3L 2ICWI 5L4JA 2PPEA 3ULVH 1FI8C 3LZRA 4NZRL 3TBCA 3CFBB 2WYZA 4RGND 1QD0A 1NMBH 2IANB 2ZWSA 3D34A 1NGYB 5FGRA 3HUJB 2D7TH 2XX1A 1J11A 1IX2A 2ENQA 4YHIB 3JVGA 3D39D 4HMDA 1BEYH 4QRPE 4LLVA 4XMZA 1X5JA 2WD0A 4KFMA 5E99H 3NQIA 1F58L 4FHBD 3S5LB 1GJUA 3UZVB 1GZPB 4Z8FH 4J3XA 3HS0C 2P8PA 4LOUC 1YSOA 5AW9B 3U1SH 3UBXG 2BOBB 1XX9C 2UYLA 4JVWA 4CILA 2V2XB 4C59B 1NLDH 2DQIL 2IFFL 3GSUA 2ZCKH 4PJ5D 3RWFB 5J3HD 1P7HL 2YA1A 3QZBA 1KN4L 2VDNB 3DIDA 4L9LA 2J55A 1H3VA 1V7NH 1NDGA 1HL4A 1RFDL 2AJ3B 2CPUA 4G8GD 5GPRA 4MCZB 2BVQA 1R3HB 2YAMA 4AYDC 1AKJA 3L95B 2K8QA 5DS1A 2F58L 1ZGLB 4IMKC 2HN7B 4K0OA 2YEZB 3HG0A 4NQVA 1XBRA 3DGCR 5TGBB 2QMJA 3RVWC 3T8MA 3FSOA 4KH9A 4XC1L 5C0GA 5TE6H 4PWFA 1RULL 5E6UB 5I6XB 3FU9A 5ADPH 4IOFC 4KJQC 4IHOA 3DBXB 3SKJH 3HR5B 4YMPA 3F2LA 4M7KH 1MCWW 5D93B 4PJEE 2XZCH 2FD6L 1M2VB 1FVDB 4E9QA 1CQYA 2YEVB 1LVEA 3GXPA 1DCLA 2YPVH 3A4AA 4JFHD 4P2QD 3H4FA 4JPQA 3REWB 1DHKA 2PETA 3IN0A 4NKOB 2R0WL 3OKMA 4Z3HA 3RFZB 3F7RA 5K59E 1UTDA 1R5WA 2IG2H 1OOAA 2F74B 4ZFOB 4ODHH 3GM0A 3OHXC 3QQ9C 1NA8A 2QMKA 1F1DA 4FNQA 1ML0A 1B4TA 4Z5RB 2RH0A 3ML8A 5IOKA 4UQ9A 3FZUC 5H35B 2VWEC 4GPVA 5T3XH 3FCSA 4U1GB 1YEWA 2W0LA 4GRMB 3OC5A 2QVMA 1KIPA 3LD8C 3EO0A 3Q8FA 3ES6B 4G80B 4HKZA 4KTEH 4N2KA 4MFHA 4Y5VA 4HUXA 2LT9A 1CIUA 5IEKA 1HH9B 2UUDK 4PJBA 7FABL 3FCUB 1TZHB 4XE5B 3QXWA 5IWLC 2WWOA 4Z3TA 5B22A 4YX2H 3CVDA 3M45A 4DO6A 5EBMA 1IJ9A 2BW5A 1C1EL 1B6UA 4C56D 4AZ8B 4NPYA 1I8LC 3K8LA 2HG0A 2HFGL 2X6AA 1DQMH 4L1DA 4MB4A 4WENB 3BYTA 3ECBA 4JPIA 2X4SB 2J6EA 1KGWA 4HUCA 4QNPE 2ZOLB 2GTZB 3PDOA 1FVEB 4ZK8A 1X4ZA 4OCNC 3QUML 3US0A 2YGOA 3L3DB 2OA9A 3I3EA 4OZHE 2CBPA 4MZRA 4M8RA 3QRBA 1UB5A 4GI6A 4JCLA 3RHWK 1UGNA 3T6ZA 1HHJA 1HIML 3COOA 1CICA 1Q38A 1TJMA 2FT8A 2GIYA 4HIQA 5J12B 1G7PA 4RIRB 3SOBL 1GGTA 4MNGB 4LLUB 4YHKH 4HD5A 4XMKH 3HE7B 5BZWA 2GTWA 3MV01 3EGXB 3MGOA 1GHFL 2DI9A 3PJSA 3VI3E 3UJJL 1DQDH 3ZW3A 2NY5C 1Z3RA 2FEEL 1ILSA 1UQSB 2CLRB 1E9OB 2O6EA 1BQHB 4F20A 4HXBH 1EJOH 3V4VH 3FFDA 4TM9A 1REIA 1B2WL 5I2IB 1E0OB 1FNGB 3AG4B 3D30A 3D52A 1S9XB 3B2UC 1KY7A 5I1KH 4O58H 5LGKA 3U6XS 3VE0A 5I0XA 1J0ZA 3GINA 2QSCH 2ZXQA 3IDYB 4ZO6A 2F1BA 2RJMA 3W39A 2D3NA 4PJHB 4Y4KD 5FO9A 3WO4B 2VSCA 4MMYB 1N5AA 2IBBA 1NIAA 2DD8H 4PJFA 2IEPA 4ODHL 4F24A 2RB8A 1PJ9A 2Q9OA 4NNPH 3U9WA 2AJZB 4NKIH 4OV5A 3CFCL 3H3PL 4GG8A 2CJUH 1XIWA 3CZUB 5EBWA 3EBHA 4PS4H 3UAEA 5DD5H 2DWEB 3F8UB 4HWBH 4UT7L 3R0NA 1QFOA 1WK0A 3VXMB 3K5RA 1IC7L 1R5IA 3WSQH 2X89A 3LKNA 4QRAA 1UH2A 5I1HL 3S35L 3INUH 1VADB 3GHEL 3MRLA 3K3QA 1W0WA 5T3ZE 4QLWA 2WC7A 1QR1A 1T1YA 1MJUL 4J2XA 4KKBD 4LLQB 1BVKA 4I4WB 4AWJC 1FG9C 4BKSC 2V33A 1FFQA 3NCJH 5AAPA 2JB6B 2A74B 1RJYA 2VLKA 4X4XB 3AT0A 1RJLA 2P80A 1WZAA 4KDVA 3WSQL 1WBYB 1NGQH 2C9PA 4NBXB 1SQMA 1FSKB 2F54E 4QTIL 8PAZA 5KZCD 4GRLC 4B5EA 4NHUB 2JQAA 3ROLA 1JNLH 3IDIB 2E9IA 2DWYA 5FYKH 3RL2A 1ASOA 3BVXA 4DESA 1X9UA 3O3AA 1NC4B 2VDOH 1WZMA 5CIPB 4QCIB 4K5NA 5TQ0L 5JIIA 3RIAK 5FA4B 5IFAH 3S34L 1WLHA 1M3JA 2WXNA 1FYTB 2Z93B 4A6YH 2CJSA 4LPWA 1T1WB 4LDEB 2E7LA 3D4YA 3K1DA 4AE0A 1SBBA 5L4MA 2VC2L 3K6FA 4TNVF 4IK7A 3VFVA 3X13B 1NTDA 5JUEH 4ZMPA 3FTSA 2WTOA 3O3EB 2J21A 2PN5A 4BE6A 1J8KA 5IFAL 3D12B 4LHUA 1H8OA 5J5EA 1M57B 3BVNB 1NEZG 4HXBL 4AY0A 2IJ0C 3QZWB 4X5XB 5I5RA 1OAQH 4LGRB 1PIFA 4S2SA 4V2BA 4H8QA 2QSVA 4HULB 2DBJA 2OZ4L 2XTJE 3F5WB 3F7YB 3PWPB 3WELA 1QSFA 3L5IA 3OLDA 1NICA 5D7LB 3WV0A 3VSVA 1F4WL 4QJ4B 1JGDA 5CMAB 5LNDA 4I1NB 3E6HB 4V1DE 4ZZKA 1CN4A 1F3DH 2VDPB 5FV2A 3ZMEA 5CBEB 1T04B 4A2MA 5FWQA 3FT0A 5ADPL 4WHCA 4LU5H 2EVFA 2WB7A 4W9JC 2NMSA 1Z9SA 1ZE3H 1TNMA 4K5LA 2CBOA 5BMFL 2R1WB 4KZEH 3QIBB 4HPYL 2J1YA 3RAJH 4AC2A 5AYQA 4AXWB 1A0QH 4ZMNA 2KI6A 3G08A 5DK0A 3FT2B 3FTGA 3WAKA 4EAEA 4P46B 3RG1C 4U6VL 3TBVA 5DJYA 3CQQA 3WMPA 3ARDC 1CTMA 3VH8B 3NAAH 3LKPA 1U58A 4ZW5A 2X41A 5IBUB 3ZMRA 4HWBL 2W9DH 4QWWC 2JKJA 1FORL 4IBTA 1N0LB 1AHWC 3FUJA 3BC9A 4PRPD 1CVRA 4DP6X 3P1VA 2V17H 3ARGA 4APXA 1ZHBB 4UTAL 2BWQA 3WUWA 3VFNB 4BK8A 4I2XB 1CGTA 1YNLH 3ARXA 4N68A 1B0IA 3WEAA 3NJNA 5A40E 3MODH 3HI1B 5DUBA 1QRNB 2J8OA 3JWOH 3DVFA 4OCWH 4PJHF 2MCAA 3WKYA 2C9QA 1P6WA 1MRDL 5DK3A 2H7WA 3SDXF 3LRSA 3NJVA 3KXFD 5ISZA 2UWEE 3MJ9A 1P4LB 5GHWH 4YBQD 2K9FB 2AGJL 3RGBA 4OFYD 1JVLA 2VN3A 2IFGA 2K6YA 3I6LD 4YL9A 3H56A 4NSKB 3TO4C 5CP7A 3QIWA 5HGHB 5EOCL 1ASPA 2NXZB 1UCBH 1IRAY 3GMMB 5B21A 1Z3GH 3UL4A 1QBBA 1P84J 5F1KC 4F5CA 3S96A 2JKTM 3BN3B 4Q9QH 3MO1A 4Q7DA 2HWZL 1D5XA 4JY6A 1AI1H 1M6UA 4QRQA 4ZO7A 1K85A 4FS0A 1ZY9A 4N6RB 5EDSA 1PDKB 3TP4A 5J11C 2GC4C 4ZXBD 2XPGA 2VXQH 4NUGL 2ZP8A 1CE6B 3BPOC 4HJ0D 3MMEA 4BZ2A 1KJ2A 1MFMA 1DYZA 2VLMD 3QR0A 3Q1EA 5EUOE 4ANUA 4ZI8A 3EXLA 4M6ML 5K9QI 3LN4A 3NSJA 1NAMA 4MA7L 1KCVL 2HKHL 4HZAA 2VZ1A 3MUZ1 3FN0L 1YDPA 4J3OD 3RX7A 3QA3B 2Z4QB 2OZ4H 4HLZH 5E9NA 1UHVA 3SPJA 4P49A 4EKXA 3VFRA 4HKBA 3TVMD 2W1NA 4FTDA 3GSNA 1TPXB 1RSFA 1MFCH 2HA1A 1OAXH 4HA1A 4NNXA 3UCRA 2NYYD 4ZO9A 5DZOA 5LAXB 4MQ7A 4EJ1C 4WI7A 1CYGA 3BKYL 2G75A 5KVFE 4JAMA 3IM1A 3UYPA 3ZKSD 1ORSA 4KKZA 1L6PA 1WD8A 3DUUB 4H8WC 1XH0A 2R4RH 1MIMH 4BZ1A 3QJVB 5FCUH 3TBSB 2GFBA 3KGSA 4XO4A 2IMNA 2ZXAA 3A6OA 3LQMA 3K6OA 2E7HA 3IJ9A 4P5KA 4LQFH 4PJBF 4HU2A 2CO6B 1IKFH 1KCSL 1WC7B 3P4NB 3VFOB 4YS4A 4BCXA 2ZAHA 4IJ3C 2PCYA 3NQKA 2H6UA 2JLLA 3SDYH 2V5YA 3RNKA 5TDOB 1JMXA 3QUYD 3VWJB 3AY4C 2W0PA 1IAIM 3FAXA 2FYVA 2WBJC 3CVHL 3KCWA 4K23H 4BDVA 1ZGLP 3DV6B 4JQVA 4Y2OA 5LJYH 3DI2B 3HFML 4YC2C 2NDFA 1AZVA 5I0WA 5BV7H 3VMPA 4J4PD 3TN0A 1UUNA 4NENA 4L1BA 3Q1SL 4B9PA 4BK4A 1I8MA 2B7DT 2WUBH 3BKCL 2Y5EA 3BYYA 2FRGP 1CBVH 3SDDD 3FUHA 2F74A 3ZBMA 2DIEA 4KKQA 2Z35A 1SBSL 1F4YL 4Z5RA 5TE4H 4GBXB 2JWYA 4Z18A 3VFMA 4YDZA 4MHHG 4ZW8A 3CZLA 1FL3A 2F7RA 3VGFA 1JPTH 2G0LA 5EEYA 1KLUB 2ZSWA 5AB0A 2EYSA 4G8GB 3VXRA 1UM6L 2VDOL 2ZYRA 3H85A 4KOCA 3O41A 1C16A 1M3IA 4LP4A 3LZPA 2JB5H 5C08A 1PF3A 2ZWZA 4LNVA 1RAMA 1IM9D 4UM9A 5MERA 1LXMA 1MJJB 4E0RA 2J20A 4GAGL 3IETA 2X88A 4WUKL 3CBKB 2N56A 5AKVA 1JZHA 3MROB 1C5DB 5SWZE 1KWGA 1HL5A 1UJ3A 2KUTA 5AD0B 1QKZL 3QJXA 1HZHH 3FOLA 3RBSA 4LSRH 2YXFA 2Y0SA 3CDYA 1S7VB 4KTEL 1IC1A 3O3DA 4M4PA 5KYWA 1ZANH 4XNMA 2YHGA 1V27A 3N1FC 4PCSA 2FECI 4TQIA 3BZFB 2PYEE 3V7AG 2ENJA 3FQWA 1EZSA 2XVKA 5CILL 3S88H 1HYSD 3MRNA 4PRBB 3GJFH 2H0FA 3WIFA 4Y4KA 1JNNH 5AW2B 5AG8A 4MMZA 3QUMA 4E42B 5FCSH 2NUTA 4RX4D 1WDAA 3TASA 3AXHA 1I1FB 4ZMXA 1HKLL 2YPVL 1ETB1 1A6TA 4PGBB 1G9EA 5ECJE 1XH2A 3TCLB 1BQHA 2EO1A 2K8MA 3MGTB 3WUWG 5IJVB 3U9PL 1AQDB 2Q86A 4NP4L 5AOIA 5KW9H 3QISA 3FB8A 4RMQA 3L1EA 4OH2A 2KLRA 4B9FA 1G9ML 4AMKL 1M7IB 3ARDD 3P4OB 3QBTB 4QHNA 1MUJA 3ULSB 1DEEA 3NZHH 5E4EC 3JUZA 3FSWA 1JPST 1WGOA 4LIQH 4EI6B 4QYOB 5EIQA 3NJIA 2HMIC 1FZOA 4QR7A 3X3GL 3I9PA 4U1SB 4JQIL 1IBGH 3REVA