5IUCA

Crystal structure of the gspb siglec domain with sialyl t antigen bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
DTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVVRWLYSNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Platelet binding protein GspB
publication title A structural model for binding of the serine-rich repeat adhesin GspB to host carbohydrate receptors.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Sugar binding protein
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iucA00
3QC6X 3QC5X 5IUCA
chains in the Genus database with same CATH superfamily
5F96H 3RVTC 2DS4A 2KLSA 2DZEA 1MFBL 1MFVA 2XXMB 1S9YA 2APXA 2YUVA 4FTVA 1LK3L 4JFWA 4OLWH 2P26A 1IQWL 4GW1A 2QSVA 4PLKD 4Z78A 4ZTEA 4FXGB 5DZPA 2WLIB 4GKOA 4QPEA 4G1EB 2IWKA 3F83A 3L3OA 4GKZA 2Q10A 2UX7A 1QEWB 4OLUH 3D2UD 2CPUA 2OJEA 3DGGB 3HZVB 3QQNA 4EO5A 2Y06L 3LQMA 1U8QB 3IDJA 5JXEC 4IKIA 3FQNB 3WL9B 3K72B 5E7FA 3D4CA 5ETUB 5JMRA 1ZGLB 2L8AA 1VPOL 1EDYA 2VZSA 1EO7A 2OK0L 3VFOA 4HK3N 5E8NB 2C9SA 3KWWA 2YAHA 2G2PA 5C2BL 3H2PA 4RA3A 3NP4A 3ARBA 3PFUA 4MS8D 3UJJH 1L9SA 1MH5A 1BG1A 1J5IA 3JUZA 4IU3B 5KVEL 2C1PB 4HKBA 2XC8A 1AR2A 2CKBB 1WFJA 5KSBE 4P59L 4HZAA 4JFXB 3FZUC 5D7KD 5CMAB 4RFNB 2JKNA 3QI9A 3HZYB 5FDYA 2BOBB 4FQ1H 3W2DL 2ZWZA 1CD9B 1FWXA 3RPIA 3S8WA 5CILL 4LLVB 1TTUA 3F2LA 3FTZA 3O6FC 1MUJA 2KBGA 4LCCC 4DGYH 4QKTA 2BSRB 3WHXB 1UWFA 5EU6B 5B8CB 4UAHA 1ITBB 1S7TA 1XGTA 1NGWA 3UTSE 1SBSH 2FHFA 2P8PA 3IDIB 3EYOA 1HNGA 3BZEB 3B7YA 2B2XH 4LEOA 3RVWC 4YBQD 3HE6C 2IPUK 2B4CH 1P4LA 3IMTA 2NSXA 2YMXH 3DX0A 4KAQH 1RI8A 1I1AB 4QHUB 1OAKL 3U4BL 1N3NA 4Z7UF 2EEDA 4LCWB 3C8KB 4XN2A 3SE4C 2YAMA 1N5AB 2XPGA 5I1KL 1A5FH 5KYUB 5HPMB 1KXQA 5KSUA 1OZUA 3IGKA 1TJGH 3BZFB 4LP4A 4GIAA 4M7LT 3M1BB 3K2UL 4PJ8A 2DI9A 4PJEA 2XN9E 3E6FA 1ZPUA 4H5SB 4OQTA 1WBZB 4LLDB 3SDCC 3SGJA 1F11B 4PLOB 3SDDD 1Y6MR 2DICA 1T03L 2ESVE 4NQCD 1QRNE 4PWFA 3OAUH 5GRJH 5IMOA 4WGWB 5IB4B 3RFRA 7TAAA 3T0DA 1WBXA 1BQ5A 2OP4H 2GITA 5HI4D 3F7VA 3TFKC 4DEPC 3CDFA 4IGBA 3H0TB 3K4ZA 1C16B 2VDML 4GW5A 2FSEA 5AZEL 4F5CE 4PRAA 1NKGA 3RL2A 2VM4A 4F37F 2FYVA 1W8EA 1ZANL 5D1QB 4E42A 1ADWA 3ZE2F 5IFJB 2XN1A 2Z4QB 3DXAD 4HWNA 1DN0A 2OL3L 2EKSB 3O8XC 1YMMA 4P3DB 3M7OA 4QRTA 1KJ2B 4Z95H 1H8LA 4UM9B 4E36A 3JBG7 1LWHA 2YC1B 4HIEA 4G6FD 2WXMA 5EUKB 3ZQ9A 3B9VA 5F9WB 1KT2B 1SZNA 3LQAH 3GSQB 3QORC 2GHZA 3DRQB 3H9HA 4QRQA 3TVMA 2I07B 2QQNH 3K6IA 1AIFB 1SXCA 3UAFA 2H4EA 1TQSA 4UDTB 3DECA 1U6AH 3P9MA 4K3GA 3T0ED 3AQYA 3SBQA 4BFJA 25C8L 1IGCL 4KKCC 1HE8A 1I8UA 1L0PA 2FEDD 2ITCB 4M93C 3BW9B 2VL5A 4ZAKD 1HKFA 2WLLA 3NCEB 3FO9A 1SF3A 3FB8A 4NP4L 3W56A 4LNRB 4R83A 2IAND 3VWJC 1V10A 5BO0D 1ASOA 3PPEA 4YHNB 1JV5B 1AOZA 3LKOB 3WBDA 2PETA 4AH2A 3WGUB 1CFTA 5K59E 1TJHH 1NCWH 3KPPA 4DERA 1GAFL 3EH2A 3NJFA 3OJDB 1OL0A 3B5TA 2EINB 1NLDH 1XH1A 4FNLL 3MLRH 5I1EH 5M94B 2C9RA 3TWYA 3IFOA 4AQOA 2E86A 4PJAE 1U93B 4FXKC 2FGWL 1MFMA 2NXYC 4OZGA 2P5EB 3ZKQD 1OAZH 4KHXL 4W1TA 3SOTA 1NGPL 3VH8B 3AZUA 3EOBB 5SWZE 4YSTA 1I8IB 3RTQB 1LXMA 3WJJA 2JXMB 2J71A 3HNSH 3JUYA 1Q9KA 3LIZA 2QQKL 4LSRH 4V1DB 1ZIBA 3LNEA 4L05A 5J11B 4AIZB 1VERA 2D7MA 2P52A 1TR7A 3NIGE 3VXSB 1KYOJ 4MA3B 5CP3H 4N2DA 2JKXA 4HD5A 5GS2H 5JW3L 3QRBA 3P9LB 4J3TA 4RRPG 3U30C 4KO5A 3UYOD 3WS3B 2JVUA 3MLTA 4HQQH 4G80B 4RSYA 1RH8A 3BPLC 3RVUD 5CJ8A 4ICXA 2TRYA 1K5NA 1N0LA 4JFFA 5C08E 2VQ1A 4S1SL 3KVDD 4O02B 5F7KC 3PV6A 2EDKA 2J8UF 4LSSL 3V9FA 4G72B 1D2OA 1XXDC 4HIHA 1L9TA 3KM1A 1H8OA 5DJ8B 2HN7A 4LOFA 3RWCA 3APCA 1ZOXA 5E03A 2VIRB 2OYPA 4ZUTB 1DBJL 3REVB 2XN2A 5H94A 4Y7MA 4FQXD 1SLVA 4JO5A 3ZRFC 5C6PB 4OFYD 4NZRL 3FOLB 5FF6A 3MJWA 2ID5A 1KYOK 3PHOB 2QKIA 3WEXA 5I66A 4IHOB 4U1KB 5FHAL 4LO9A 1BXXA 3JVFC 5ADPL 4GSDL 3KBPA 5AL0A 4Y5YB 3BH9A 2K9UA 2EH8H 5DI8A 4L3CB 3FTUA 1ZCRA 1MNUH 1KOAA 1UKTA 5ACZB 1WISA 4S1RL 1QA9B 1HYRC 5EU5A 1PZ3A 3TZVB 3RNQA 1E4XL 3BDXA 4DT2A 3CHQA 5CCGE 3QB7C 2X05A 3O6FA 2XT1B 4PIRF 2ZXDA 3E1F1 5B38B 1JPSL 1NMCC 3BZ4B 1BA9A 5FX3A 5IT2H 3GBMH 5IEKB 3FMGL 5EMYA 5IB1B 3LRSB 1TQUA 4KQ4L 2YQ2A 1AGFB 3HE7A 4OLVH 1UD4A 3S96A 3EHBC 4L4TA 3LMJL 4KRPB 4FD0A 5HHOE 1H5BC 4KVCL 5J8OA 4KFZC 4JPSA 2MPAL 1YNTF 3ILEA 4PJIF 3KS0H 4FFZL 2CDGB 1RIVH 2EE9A 5A2FA 4NAMA 5DFAA 4N85A 3REWA 1R34A 3EJRA 1RXLA 1DQDL 3GC3A 3QEQA 1YECH 5CD3A 1ZLVK 4HF5H 4DPCX 4PLJC 1OGSA 4DF9A 5IM7A 4AZ8A 5IB2B 1Q94A 4U1HB 1ZLDA 1TCRA 4M7KL 1KNOA 2V2XA 4LDCA 3B3IB 1SQMA 1KGCE 4OUOA 3CSPA 2MIZA 5LBSL 4EI6B 4ZW3A 4WEEA 1BD2E 2YS4A 1C12A 4NCC1 3RU8H 4RETB 3ATEA 2CXKA 3SJVB 4AM0B 4JRXD 2N3JA 2GIXA 3ZT6A 1I9RH 5I15H 1PAMA 1QUNA 1TZAA 2IDTA 1X5KA 1XV8A 3I75B 4W6WB 2PO6D 2XWTA 1SQ2N 4R2GB 4A37A 4KQ0A 3R4RA 2B5IB 4MD0A 2J6WA 2VR5A 3H7LA 1F3DJ 1QHQA 3A4FA 5D1XB 2XV0A 3CC5A 4PJCB 3BEVB 3OZ9H 1P1VA 3CMGA 2OYKA 4YDJB 1RIUH 2D0FA 2VDRB 1KFAH 3GBLA 4HX1A 5C0AA 3PWJB 5GZND 5T3ZE 3O6KL 4M6NH 3DHMA 4F7TB 1JPFA 5ANMB 4EAEA 3VCLB 2NZIA 2V7NA 3OKOA 5IQ9A 3OKKB 3VI4E 1RUQH 1QI3A 5TDPA 1T04A 4HPYL 1V7NH 4TSBH 2FJHA 3QORA 3MOBH 4ONHB 4U0RB 1N6VA 1U58B 2F15A 2PYEE 1CD8A 4CVZA 1S7XB 1GW0A 3CVIL 3K6NA 5DFTA 3C09C 5DJ6A 1HXMB 5GSRB 1U8IA 2DTSA 3T04D 3HMWH 5F7EL 1K6QL 5GS2D 4LCUA 3QUXA 3WELA 3PWLB 3EGXA 4YSPA 2IWFA 3BXNA 1SY6H 4FXLA 3PDGA 1KUMA 4Y5XB 4WFGE 1B0WA 3Q8CA 5FCUH 4YX2L 3KYMA 4BINA 3HKZA 1UM5L 3X1GA 2LU4A 4PPTA 2R2HB 2XQBH 3MLVL 1RSFA 5CEZL 2MCPL 4GIOA 1RK0A 1T6WA 2FO1A 1CDHA 5JW5A 5LB1A 1B9KA 3OF6D 3RKDD 2P80A 2CWRA 2DM7A 4NRZA 4NFCA 5DLLA 2IQAB 1XIWC 3NCBB 1WIPA 3ZTCC 2IV9A 1P5UB 3QUGA 1UCBH 2D31B 4F1ZA 2EICA 9CGTA 3A6OA 1IGML 3RAJL 1HIML 1PW3A 3HN3A 3QCTH 2WN2A 3HC4L 1VSCA 1ZT7A 2E6JA 1U8KA 3HC0B 3TFBA 3UC0H 4GRMA 1O5DT 2NDFA 4UM8B 5J9PA 5F96L 1M2OA 1JBJA 4M1CC 4BSWA 3QZOA 2V2WB 4OV6F 4ABUA 2VXTH 4PV1C 4OLWL 2LGNA 3H85A 5BS0E 1JGEB 1WFIA 2PTTB 2VYRE 3IXAB 4Y19E 3JTBA 3SKOA 3UBXA 4N90E 1J11A 3ZT7A 1S6NA 1OO2A 2X1PA 2ZUUA 3C87A 1P0SE 5LGJB 2VDNB 4OLUL 5E8OB 4P9MH 4W9IC 4H44C 5JLZA 3GMPB 4RDQF 2F6AA 3LH9A 4RAUB 4F2FA 1GOHA 1MWAA 1RPUA 2OM5A 1YQVL 5AKVA 3RRQA 4BRVA 5D7JB 3RX5A 4NYLA 3V52H 3GLDA 3WO3B 3UJJL 3OR6A 1HSBA 3R1GH 4Z76A 1UT9A 1N2RB 5D4QA 5C0GA 1JXJA 1IX2A 3I85A 1AQKH 3CXHJ 4XNUH 1AKJA 1ND0A 4BQBA 4Z0XA 5M95B 1T1XA 3Q8BA 5ESVA 3TEZA 3D51A 3U9UA 4FQ1L 3LZRA 4GIPD 4Y4KA 3EH3B 4MD5A 5HBBA 4JQXC 4N86A 2GUOB 3BUIA 3FYIB 1KMGA 1ZE3H 3CZNA 3KPQB 1CZ8H 2X4RA 5D4HA 1A7OH 4DGYL 3DARA 4YNYA 3G08B 4LHUA 5LGHH 1JXKA 3NA9H 1BFTA 5KJ7E 1O6TA 2F9BT 2VW7A 3LPWA 3V6FA 5IFAL 2IFGA 4Y9FA 3D25A 4ZYKB 3T1FB 2UZXA 3WMQA 3WN6A 1SBSL 2C3GA 5A2AA 3UTTA 3V4VA 3DOSA 4AE1A 2B2XL 4CVXA 4MJ2A 3D50A 2B4CL 3CXHK 3MUHL 2YMXL 1AE6H 4KAQL 5ISZB 1DJHA 3G5YB 4FQ2H 1MZZA 4NN5C 4P46C 5LG6A 4BK8A 3M07A 4Q6IA 5B7EA 4HU2A 2VMFA 4RWYL 4M4RA 2IGTA 3O6MH 1A5FL 1PMYA 2H32B 3HN5A 1YNKH 3JWDH 5DMYA 2BVQB 4DKDC 1OW0C 1CLOL 3PGFH 4P2QB 1U3NA 1PX3A 2P8MA 5EULV 4G7QB 1JDAA 3NA4A 4XGZA 4EDWH 4NHUA 1TSRA 1YPZA 1TENA 3AC0A 3MRFA 3OAUL 1LD9B 4JRYD 4M8RA 5GGVH 5GRJL 3VB9A 4AG4L 5JA8B 5ICZB 2NNAB 1F1DA 1TT6A 4ERSH 1DCLA 2JKWA 4N68A 2OP4L 4QOKB 5I2IA 3EJJX 2G60H 2EE3A 4FTDA 4HUVB 4MNQD 2CRIA 1UHVA 3V95A 3VNZA 1AYRA 2E75C 2CO6A 4N87A 5JHBA 5BRPA 3OAYK 5E1AA 4QMEA 4PBDA 4Z95L 5I0VA 5EEUA 3AWFA 1TLKA 3HJEA 4NJ9H 4RZKA 3AU1B 4Y2OB 3AG3B 3VRJB 4DEUA 1E5YA 3LQAL 4KY2A 3ZKNC 2WBKA 6CGTA 2QMJA 2BVPA 3VFVA 3QUYA 1I7RA 3EFOB 2C4FU 2QQNL 4OZFG 1YCSA 1S7WB 1R1CA 4HGMA 1IBBA 1U6AL 5J13C 1R3HB 1PS3A 4LCWE 2NLJB 4L8SB 5EB9A 1L9RA 2K45A 5L2KD 5INDB 1FNLA 2WCPA 5JIIA 3S3CB 3TBWA 5D2NE 5C0CA 4Y5VA 1FORH 2F54D 2FX8H 3LNHA 1ZT1A 5KVGE 1JZHA 3VI3A 1A65A 1XB3A 3A3YB 1B0RA 2M2DA 4WENB 2CIIA 1BBJB 5KANG 3HAEG 1CFNA 4R0LB 3FJTA 1CD1A 1SXZA 4L29A 4Z77A 1GTNA 4TL4A 3C8HA 1TJHL 4JFZH 1GR7A 5CZKA 4YN3A 4ZK8A 1EEZA 1NCWL 1F90H 5GXBB 1N0XH 2A9DA 3ULVH 3PWNB 5KJ4A 5GRUH 1NLDL 1S2EA 5EO1A 1KGJA 5I1EL 5JXAH 3PCYA 1EFQA 5FK9A 3FBQA 1QSFB 4PRID 3MNWB 4GO8A 4B3VA 5D1QE 1MHHA 2VDMB 4M6AA 4Y4HD 3HMXH 3T65A 2D7NA 4BYHA 3HNSL 4EKJA 5DHDA 1URIA 3BWSA 3UPAA 3BPCA 4I89A 4JZOA 2RQEA 5C0FB 2LE9A 2IADB 2OL3B 4HLZH 3U46A 3FRUA 4R96A 4NRYB 4UCFA 4TQIA 3QZNA 2BNQD 5ACLA 4JQIH 2YD3A 1DLHB 4HQQL 4AKOA 1NC2D 1NQBA 3E1ZA 1CFMA 1MQKH 2ZNWA 1QR1B 2C4FT 3FQUB 2XZCH 3UOAB 3RL1A 1WFUA 4YL9A 1XF3A 2FJFB 3BGMB 5FOBA 3FU7B 3QIUB 5GS0C 3G5XA 4LEXL 3VXTA 1E9OB 4N8VG 3KPSB 4JCMA 1EEQA 4LLQA 2Y7NA 4OJEH 2E9BA 3IXTA 5LNGA 1MW3A 1NFIA 4WEBH 5D1ZD 4ELMA 4UNVA 2X3AA 3EO0B 1S5HB 3NMEA 1ZS8A 4NIYE 1CG9B 2OW6A 1Q9OA 4HDIB 4PRNB 4PRBB 3RLSA 1QTSA 2FX9H 3D85A 2EH8L 4LCYB 4NO5B 1T1ZB 2AK4A 2YN3A 3PV7A 3RIFF 2EUVA 2OS7A 4UT6H 1MNUL 4KDTA 4N2LA 2OI9B 3CH1A 3OWRA 2IGLA 2P5EE 5B1KA 1S8DA 3HTLX 4M5YH 3I9PA 2YXVA 3FO2B 4DESA 3BLPX 4ZUUA 1SDYA 4ZS7H 4PTUA 4V1DE 5BJTB 1IBHA 1MJUH 1WE5A 1KIUA 5IT2L 3GBML 4HJ0C 5IROD 5GRZA 1DZBA 3SIKA 4OLVL 3WMSA 3DMMD 4PGJA 3H9SE 3QQ4B 3TNMB 1CFSA 3BVDB 4L0ZA 1U36A 2PMZA 3S3SA 5IFHH 4MZIA 2E6QA 5D7LD 3DV4A 1RIVL 5DFVC 2YRLA 2Z92A 4XPHH 3UG5A 3KHOA 4AQAB 2O5ZH 2VN7A 4OH2A 1HHKB 1KJVA 5C3LD 4UINL 1YECL 2JLPA 4QXWA 2IC2A 2E7CA 3QAQA 4HF5L 4IIQB 4P2OC 3VQMA 4AQ1B 5I19H 5MEOB 2V9RA 4Y4FC 4DO5A 3T3MF 5IEHB 1HOCA 1PDKA 2BSBA 1XSIA 1A21A 4QT5B 3RU8L 5AB1A 2GJZB 1A6TA 1IEAB 3MGOA 2EAEA 3I50H 1I9RL 4FMFA 5I15L 1OWRM 3IJEB 1HTYA 1B9ZA 2BVEA 5DD3H 5DHYB 5BVPH 1PIGA 1A66A 1NBYA 2DIEA 2FX7H 2KPWA 3UIZA 2XWDA 3HVDA 3GXUB 4B5ZA 3P30H 2UUDK 2F74B 3C5ZC 4PJ5B 1OXYA 3OZ9L 3FOMB 5F89A 5FW8A 3MGAA 3ULVD 3VWKC 1A1NB 1RIUL 2DQCH 1KFAL 1NGXA 1ZA6A 4AK1A 1CLVA 5LVEA 4M6NL 4JFQA 3JVGA 4S0SD 4U05A 3LZOA 3QJUB 4N1EA 5FYJE 3PNWB 2WMPB 1WITA 4KXAA 5H2BA 1QLFB 1RUQL 1OD7A 4TSBL 5CR1A 3R4DA 1X5AA 3MOBL 3QXUA 4LLMB 3JTTB 1A6WH 3KS0J 4MNHB 5T1LA 3OMNB 2C9XA 1J12A 3FRPG 4Y1AB 2HMIC 4AY0A 4NLHA 3PS6A 1NLBH 3HMWL 3MUUA 4N6RB 5EFIB 2CGRH 3L54A 4WFHE 5FFGA 5FYJD 3G6JE 5J0BA 1SY6L 1I1FB 1NAKH 4ETQB 2J2ZB 3KAAA 1U2HA 2Y23A 1A22B 1JWSB 5I74C 4Y2DA 3KYOA 5DD0H 4DP1X 1YQ2A 2WC7A 4AV0A 2XTSA 2N56A 2XQBL 5TGBB 1ZT4A 5KW9H 3C5XA 2HWZH 4ZMXA 3CBRA 4EZLA 4A2HA 2A99A 4S2SA 3SJVE 1YN6A 3J2PA 4N5ED 2WIIB 2NR6D 2AJZA 2OMUB 3QDGB 2DQUH 2X12A 3O0LA 5IQLA 2XV2A 5IIEA 3KGSA 4M3KB 3MRNA 1NSNH 1DQMH 5HYQA 2DQEL 2BSSA 3S5LG 1M1SA 1UCBL 5K9KA 4R9HA 5D1XE 5JORA 1C7SA 1K8DB 3FN0H 3QCTL 4Y2NA 5BQ7B 5JHDB 1OCRB 3FS9A 4XCEB 3AACA 3UC0L 3GB7A 1FGVH 1FV1A 5IW6B 2B77A 3VGEA 1B0IA 2C3VB 4DVBB 1GC1L 2VXTL 5EUOA 2K8QA 3TEUA 5ENWA 3ARTA 3EGDB 4CNIA 3WHE1 3JZYA 4P9ML 5A6MA 2JJVA 3ARQA 4KZDH 2AFNA 4ETYA 5BW7C 5ANHA 4WUKH 1NJ9A 2J1WA 1UH3A 2FWLB 1JZFA 2YPLD 5A6LA 1GGIH 4DO6A 3VD9A 5I18H 2XX0A 4E2OA 1ZJAA 4R7XA 4XBGB 4JFEB 1KIQA 3LH2H 4X0KA 5F3HA 3FT1A 4W4OC 4OZIF 4G9DA 2B0SL 4BFIA 1WCBA 2CLZA 3AS1A 3VXUA 2NW2A 2NUPB 1HI6B 1WIOA 5GGTH 3T8MA 1FNGB 2XKUA 1AZUA 1PKQB 3AT0A 3QIBD 3R1GL 4KJPD 1OGAA 4H88H 3VRIB 2AABH 4WAFA 2FDBP 1XBRA 3P2TA 1AQKL 4I3SL 2OMXA 3ABGA 4XNUL 3U0WH 2PF6A 4XB3A 2A6KB 3OHXC 1UEMA 4QJ4B 3V9CA 1WJ3A 4J4PA 5LXGH 3U7AA 4Q58C 2VE6A 2J55A 1DBMH 2WVVB 3WNOA 1H19A 4HOMA 1CZ8L 1A7OL 3LKRA 1P7BA 2KS0A 2IOIA 3DX7B 3GMOB 1UM4H 5LGHL 3QZWA 5DVMA 5J1AA 3NA9L 2C3WA 4FG2A 2UWEB 3AADB 2VLRD 3O4LB 1DSYA 1JNNH 4PIBA 3T0EB 4AK2A 3HUJA 3EH4B 2Q1EA 2KLRA 3T2OA 4QRPB 3RWIA 2YOCA 5BZDB 1AE6L 3F01A 2N7AA 4FQ2L 4B9CA 1H15A 3AWGA 3JT0A 2JKJA 3QHFL 3TCXA 3L3JA 3FH7A 3TF4A 2GT9A 3L3GB 4ELKA 4NZTH 4KRNA 1R3JA 3PQYA 1EXUB 1YNKL 3G5ZA 3JWDL 4D8PA 1TU2A 5IVXB 3PGFL 4G1MA 3MRQA 5KSBF 3B9KA 3HFFA 3KLQA 1MELA 5DURD 3BHBB 1IARB 3J27A 2WNXA 3EYUH 4EDWL 3V9EA 1KTLB 5GS3A 1H0DA 5DQJA 5AVXB 5GGVL 5EEVA 1BYOA 1YMHA 4NDMA 1HEJC 2A6JB 2OKMA 4G6AD 1ETZA 4AYSA 1ZEAH 2G60L 2ZOWA 4L9LA 4P2YA 2COVD 2A83B 3SBPA 1PL3A 4MJID 3U7YH 3X1EA 5JPMC 2ZD0A 1PX8A 1D9KA 2WIMA 4HHGA 4I2XB 4AUJA 4PJFF 1CC3A 3BAWA 3S35H 1KY6A 3DPDA 5ABZA 1CI5A 2XHNA 4FMKA 4RGMC 5DMJB 3VWKA 3I9IA 5EIQA 4Q6YA 4BE6A 4AIOA 1FZMB 1A9EA 3GTVA 3RDTA 1M57B 4F7EB 1UCTA 2YA0A 5JZ7D 4Z7OB 1CGTA 4Y16A 3HC3H 2Z34A 3G04B 2NNXA 1T5KA 1K8IA 5KVDH 3X12B 5CJXC 5IQ7H 3KM2A 4GOSA 5ISZE 5SX5H 2A9CA 1FF5A 2OMYA 4HK0B 4Z7QB 3TBCA 2BM3A 3TO2B 4F7PB 2WTRA 4NCDA 3RI5F 5B39G 1FORL 2FX8L 3EJPA 3P11L 1CICA 1UJ3B 1ED3B 2D3VA 1BMGA 2JCCA 2WLMA 3CBJB 4KKZA 3RGVB 4K5OA 1DVTA 2BY1A 4JJHA 2JLLA 4XX1E 1FYTA 4JFZL 1S9YB 2UY6A 1F90L 2GBAA 3DX8B 2PP9A 1CFQB 1N0XL 4HCRH 4ZQKA 3ULVL 3ETTA 1KN2H 4MJJA 1R5VA 3MV9E 4QOKE 5FUCC 4Z78B 3LB6C 2LU7A 5JXAL 4WW2A 3L3OB 3P2DA 1YEDA 3L81A 3OB0H 2BCKA 5AKRA 2OJEB 4KK5D 4XN4A 1MFDH 4I5BB 4PJXF 4NQED 3V5KB 3HMXL 4Y8DC 2WYZA 4JFVA 1L9OA 3QVAA 3QIWA 3L95B 2A74B 2X2YA 4OT1H 4X7DC 2OV0A 3L16A 4OW6A 2XY1A 3FFDA 5DVPA 4KO9A 4P5MB 3KWWB 5I6LA 2A4EA 3NRFA 3V8OA 3QFDA 1OP3K 3WKPA 4K7PX 4JQIL 1F6AA 3IFNH 2Y72A 3ZYIA 1MVUB 1EMTH 3GMLB 4Q2ZB 5E6IC 1CS6A 1MQKL 4OFPA 3EDEA 2X4QA 2XZCL 4PJHA 3TN0A 5K59F 4QTHB 2AQSA 3CFEA 2BNRD 2X41A 1OTSC 2M26A 1UOKA 1A8ZA 3TJHD 2DKUA 4YPJA 3GJFA 1NZRA 4JRXB 3VXNA 4A63A 3MRHB 4WEBL 5C0EA 3QSKB 3R0MA 2VN6A 4HD9A 4XWOD 1HS6A 2WZ0A 1S7TB 3QWRA 3LRHA 3WKYA 2D73A 5ESAA 3TO4A 1JZ3A 3QRFM 1XCXA 4MAYB 3VSUA 4XVSH 3LXUX 4YO0B 1E7UA 2FX9L 4LEOB 4LHQB 3SGDI 1ZK5A 5LNDA 1OT1A 2WO2B 3UYPB 1N59B 4UT6L 1DSFH 1LO2H 3ZSSA 1QSFE 3VXRA 1WT5A 4FFYH 4M5YL 1BHGA 2NCEA 4J28A 1F6LL 4YMPA 4U6XB 4ABQA 4WHYH 5EBMB 4LSDA 5GRXG 3VU1A 4N2EA 4ALAC 5KSUB 3SPIA 4AITA 4ZS7L 3H2WA 2J44A 3NOIA 3JSSA 4NQSA 3S6CA 4ZO8A 2BSCA 4PJ8B 5BOJA 1D3CA 1U8CA 1G7JA 3NK3A 3OL2A 1R3LB 3RPKA 2GW5A 3OKEA 1F00I 1O0VA 5KUMA 1UXMA 1BJMA 2Y7QA 4TVPH 3FT4B 2NW3A 3MAWA 2NY6D 3QDJD 4RGNB 3VGAB 3KPRA 4GI8A 1A2YB 2FH8A 3MJ8B 5LN4A 2WXOA 2J6EA 2BWQA 3MMEB 2XSKA 3B7RL 3Q7JA 4IM8A 5IFHL 3NZUA 3JV6A 1QAWA 2FSEB 4FYRA 4UQ3A 5JQIB 3HBPA 4XPHL 3FQRA 3HOGA 4QXTA 5JPNB 1KJ3H 2O5ZL 2X4TB 4PRHB 3HEIB 1U2CA 1UH4A 5I8EA 3MKKA 4TLSA 5I19L 1CUOA 5MI0C 2ICES 3P9WB 1CXHA 3JYCA 2MCG1 5J56B 4PGCA 4G8AC 5A2BA 2PW1B 1J1XH 2FSDA 5TE7H 4TUUA 4R90H 3DX6A 4HIEB 2JJTC 3FU6A 4N2OA 5E6YA 4IRZA 5F3BA 1S3KH 4G7VH 5B1JC 4DPBX 4IU2A 3LJ3A 4MMZB 3MFGB 3I50L 1DYZA 1HILA 1FNSH 2OX5B 5SX4H 4P2CG 4M8QA 4GRLC 5H37G 5DD3L 2AV1B 4KOBA 2R4RH 1EPFA 3QG6A 4FYTA 4ZMPA 3GZPA 5BVPL 1I1YA 1YO4A 4MWFA 3LEXB 4ECNA 3N50A 4NC1C 2VUOA 5JIHA 3P30L 5BRQA 2DWDB 3NZHL 4AEFA 2WLLB 3L3KB 2YQ3A 3EJYC 2NY7H 2HG0A 1BP3B 2DQCL 2R51A 3RY6C 4JZJA 4JFDD 2I9TA 1ETJA 2ODHA 4OY9A 1I9IH 4TPRH 1G7IB 4AH2B 3NFPA 4FI8A 4G11A 4FA6A 1PY9A 2J1ZA 3BGAA 1RZIA 1A6WL 3GWJA 3WN5C 5A1AA 5JUEH 3PDOA 2GSGA 2BZ7A 2BO0A 1NBZA 2WYHA 5F8RC 4E9RA 4G7RB 3FCGA 2CGRL 2FE0A 3WFDH 4OSUL 1KENL 4GEIA 4UZUA 1DVSA 3LHPH 4TVUA 4UU9B 2OZ4A 1WZAA 1X7TA 4CW1B 2CCWA 1HN1A 1E4XI 5D9SB 3C60A 5DD0L 1J5OH 1TPXB 2ZX8A 3GS4A 1MLCA 3MRLA 3UZEA 1JGUH 1EAPB 1FFNA 3UTQA 1GZQB 5KW9L 4XP4H 4N2GA 2HWZL 3QQ3A 2CO1A 2JIXB 3MBXH 4GEJA 4YFLF 5AOKA 5KUKA 3VDCA 4PJ6A 2V9TA 3MLTB 5FGCB 3CVBA 1WH0A 3F85A 2O5XH 5F88A 5I1LA 2DQUL 5HI3C 3FB7A 5D70L 1N0LB 5DD6A 1Z9SA 1NSNL 3NFSH 4RFEB 4F15C 1FNEA 3W5MA 1LEIB 3VI4F 4QHPA 1KYAA 1UZ8A 3LEVH 5MEPA 1KPRA 4HIHB 3VH8G 3NAAH 5HYJD 1EAQA 1EJOH 2GEEA 2CDEB 4WO0A 1OLZA 2ADGB 4N0UA 2BW5A 1IM9B 3BUPA 3MO1A 4N3UA 2MNUA 1FGVL 4XVJH 4X6BA 1MRFH 3IETA 3TA3C 3IRPX 3ROLA 2BX5A 1IMHC 3BP4B 1QSED 2A9BA 2QKIB 2NTFB 3UFIA 2FYYB 2QT6A 4MKTA 4C55A 1YVLA 4UQBA 4ZFZB 3BH9B 3SCMC 3TBTB 3KGRA 4YSEA 1T2XA 3BQUB 4KKAD 3S0PA 4CVWA 1XF2A 2AXGA 2X9XA 4NO0D 4KZDL 4GG8A 4LKCA 2NDGA 1VCAA 3FFOA 2NY2D 5F7HA 5C3IA 2F7QA 1GGIL 4FYSA 4E41B 5I18L 1VEPA 2CA3A 3DPBB 5DJZA 3LH2L 1EHKB 1A02N 3FCSB 2MQGA 3MBEC 3MRGA 4U0QB 3DYOA 4JN1H 2QGEA 5D7IB 3Q2LA 2P44B 3K6SA 3EO1A 4WTXA 3RZCC 2DH2A 2ZCKH 5GGTL 1GYVA 2EE0A 1GGBL 3HRZB 4MNQB 4HEME 2FLMA 3KEHA 3MUGA 4H88L 4KUZH 2AABL 1IEHA 3TL5A 5GS1A 4XHJC 2DAVA 4YE0A 4YVNA 3QDGE 3QFJE 1LE9B 3S96B 3AM8A 4WO4A 5E8EA 4NT6B 3T4AC 3FCUB 2VQUA 4M3HA 3ARDA 5AVVB 5LXGL 3BP5B 4GS7B 3DUUA 4AL8C 2VABA 1DBML 1U3HA 3WAKA 1F42A 5K1VA 4YEFA 1HDMA 4EI5A 3A4DA 2JKIS 5JHDE 1UM4L 2VJ8A 3L2NA 1OF2B 1E5AA 1TCRB 5DYOB 4H2CA 1YEWA 5B38G 1W91A 4NGHH 3WKNA 4A38A 1JNNL 1OPGH 3L5WB 2HSIA 4KI5C 1C12B 1KFGA 4U1SA 4CMHB 5GZOD 4XN5A 2YA1A 1QUNB 1QZ1A 4P5RA 5EORH 3NSFA 4Y9CA 4J5VA 5CP7A 3WE6A 2DIAA 1XXFC 1AANA 4ZS6C 5EU3B 2Z31C 4EJ1C 1AH1A 4RAHA 4HS3B 4NZTL 3CFNA 5E00B 3VD0A 2RBLA 3X11B 5IK3A 4JFEE 3MV7D 2Q76B 2R2EA 3P77B 3GSVB 3BMWA 1LO4H 5AW1B 4DTGL 3AXLB 3EAKA 2ZUYA 1GGYA 3EYUL 1J9RA 4G8FB 4DQOH 1FIEA 3FSOA 4P4KC 2Y5EA 1PKQE 4P23D 1V54B 1LTXA 3ATAA 3WTXA 3LH8A 5CD5C 3CG8A 4WJG3 3ZKXB 1M6UA 1T04B 1T7YA 4YHKH 2WSDA 3PIQA 3QO0A 1ZEAL 4DWHA 3UPCA 1CGSH 4Z18A 4JJOA 3U7YL 5DJ6B 2K7PA 3VE0B 3VX0A 1NDMB 3KNBA 1ZLWK 1OAUL 1P7KA 4FJYA 4X8JB 4GKLA 2R0WH 1A6PA 2NY0D 2ICEC 1TEFA 3Q1SH 4WWKB 5DLMH 4LCUB 3S35L 5L2JB 2CA4A 3BXNB 1BVNT 3F65A 4FHJA 1HWGB 1A7RH 2UWEE 2A6DB 4PVNA 4WI9A 3O4LE 3BI9X 3DIDA 4Y88A 1T89A 2CUHA 3HC3L 3V0DA 1CTNA 1LEGA 2PXYC 4MKMA 2BFVH 1DUZB 2NNFA 5KVDL 3L48A 5JW5B 5IQ7L 4UNIA 1GS8A 2ENYA 4LSQH 4NRZB 4WUUD 1IUZA 2KI6A 2YHGA 2VITB 2WWMC 1ZTXE 1E9PB 1QEXA 3VFWB 2AITA 2H0FA 4L4VA 2WBJC 5FUZH 5C97A 2N1KA 1LO0H 3PHQA 2WQWA 3TNNB 2C4XA 3C6LD 4I18C 3GJEA 1QBLH 4Y8AA 4KXDA 4NPKA 1PZDA 1ROWA 5CKGA 2YWZA 3EO9H 2R39A 3N1QC 4OZ4B 2LTQC 4HCRL 2D7QA 5D7HA 1VCBC 1KN2L 5AVSB 3UBXB 1TEYA 2IAMA 1DJSA 4GRWE 1R5WB 5IHZA 5HY9A 1EQWA 4I2XE 1MFDL 3KJ4C 5ICUA 2VO8A 3FT0A 1JZ6A 3IU4H 2AK1H 3EZJB 1PPIA 4WNSA 5DT1H 3HI5L 4G6KH 1AZVA 3FK3A 2WZ5A 3T6QC 2NYZA 2F58L 4FYQA 1WZ1L 2DRUA 4OT1L 5CSZB 1XBDA 3RX9A 1N68A 5FKPA 5IB3A 4Z7OE 3EDJA 3TA3A 1BZ8A 1GSKA 4HOZA 4CMMB 5E2UL 3JQOB 1HHIB 1HYSC 3T2NH 4APQD 3IFNL 4TNEA 5C0GB 1MI5A 1EMTL 2WXIA 3PY9A 3LKSA 1UUSA 3ETSA 1AKJB 4NNXB 3SE6A 3S8FB 2D7TL 3PUUA 1J1OH 3OMZA 4Z7QE 4L1TA 4B95C 3D39D 4WSGA 3RWDA 1CF8H 3ILDA 5ESVB 3V5DB 2W38A 1JZDC 4Y4KB 5I17B 4NO3A 4H40A 4JQVC 3O9WA 3QJTB 2X4RB 3MRJB 4MA1C 3O3BB 1J0KA 4YNYB 2EDQA 1H9VA 1YY8A 2UVEA 4LLUA 4WI0A 2X70A 4FXTA 2WCGA 1A1OB 5J57B 4FTVE 5J1TC 4Q9QL 2HT4D 2VR6A 3WXVH 5SX5K 2Q7YA 4ENED 2IDFA 4XVSL 1FGNH 3DOSB 3VM5A 4AXWB 5F7NC 1MCRA 1JZ2A 4NXSA 1JOIA 1P2CB 4W9ZA 3NJVA 1LO2L 1BXVA 3S34H 1ZHBA 1J05B 1QPXA 4M4RB 3RY5A 3W9DA 3CIQA 3BD5A 1ETB1 5J06A 4GAJH 4A7TA 3IMWA 4Y9GA 3CNKA 2IPUG 1AI1H 2X4SA 3CPLB 4R4BB 4FTVD 4P9HC 1NFDA 1P9MC 1R24A 3P3SA 3TBBA 1BPVA 5T5NG 4XGZB 3QDMA 1GGUA 4LLWB 2BRQA 3VA6A 4TVPL 4LIQH 1OSEA 1E8YA 3ABMB 1Z9MA 3FF7A 4XX5A 3PAYA 3VD3A 4WWNA 3ULSB 1MAMH 4XR8C 2FO4B 3LTVA 5EBWB 2WOYA 5C09D 2GJ6A 2FRGP 3G6AA 4CKQA 1X9QA 3JV4B 3PP3H 3F04A 4NN6B 4OLZH 4NP9A 3MQIA 5IGXL 3THMH 1KJ3L 3BUTA 4H8WC 3C5JA 3GD1C 3DTXB 4NUGH 5I6MA 3G7TA 2Z91A 2A4ZA 3S48A 4F33B 2QQQA 5E1AB 8FABA 4X83A 4RQQA 1P6WA 5FFLA 4H8QA 1MLBB 4ICWA 2IG2H 1J1XL 4PU2A 3CUPA 4FI7A 4Q7DA 3VJ6B 2D0GA 4U1LA 5TE7L 2KZWA 4J3OG 4R90L 4ZW7A 3RGHA 1TZIB 3QR0A 2H26A 3QI9D 4XX1G 1S3KL 2CO7B 4G7VL 3DHUA 1EAJA 1I7RB 4UT7H 1FNSL 2X6VA 4ORGB 1Z9PA 2GIYA 2HCZX 2GTQA 2KHAA 2MSPA 3RFZC 4I88A 2AANA 2LAGB 1INDL 2NY3B 3NIFE 5HI4C 1KACB 5EEWA 4BM7A 4LLYA 3R7QA 2B16A 2PCYA 1KXQE 4YFDB 3F05A 2H45A 4Y5VB 2NY7L 4U31A 5F7DA 4AVKA 1IFGA 1NA8A 2BS8A 2EP6A 3E2HC 1MXDA 4PJEE 1ILUA 1QI5A 2CIIB 4XNQA 3AS3A 1RKRA 4MDIA 1U92A 5LN8A 1CD1B 3BIKA 4TPRL 2AJ3A 2ICWB 4L29B 4Z77B 4F91B 3MU3A 4HEPG 1SUJA 4YE4L 1GSMA 4F7KA 3ES6A 4RGNE 4X4ZA 2PXYA 15C8H 1A3RL 3B2MA 2FQDA 4PRPA 4B97A 4P5TA 5SWQA 1DJGA 5JUEL 1QMUA 1HJBC 1CQKA 2NSMA 4QCIB 2EVGA 4D2NA 1IZKA 3SYAA 5CCHE 3WFDL 2XTJD 3ULVF 2ZUQC 3WFBL 1XCQB 1BW8A 4DIXA 1B4RA 3LHPL 4QAWA 3T65B 3NIDB 4XVUD 4ANKA 4ZAKC 1YMME 2ILLA 5KS9A 5DR5H 2Z3FA 1BJ8A 1N8ZA 2DQMA 2K6YA 1LDSA 3L3HA 1J5OL 4IGBD 4YDVB 3SGEI 4YDKH 3FUEA 1AQDB 1JGUL 2VXQH 2HX7A 2JE8A 3U46B 4XP4L 1YDPB 3FRUB 2JI1A 1IM3B 1F2XK 3MBXL 3I84A 5HDBF 5JNYA 5MHSE 1NCCH 2O5XL 1FO0H 1YC7A 1TYEB 3IKCB 2BHUA 3Q48A 4MJ4A 2IH1B 1YMMD 1F02I 3FU0A 4HG4J 2A6IA 3LV3A 3GK8H 3RL1B 1LK2A 4HWZB 3CBKB 5DS1A 2DYPB 4FERA 3T0BA 2BP8A 2VLRB 3LEVL 5I1HH 2H8PA 4HKXA 3G5XB 4JMNA 3UGXA 3PL6B 3NAAL 3K2MC 4EN3D 1EJOL 2PP7A 4FFVC 4A2LA 4H26A 2A77H 5MHSD 1CIUA 4ZXBC 5GJSH 1AGDB 1E30A 4QHLA 3B5GA 4PJGA 4PYHA 3MNVB 3D69B 4XVJL 3RWEA 1MRFL 2P24B 4UOQA 3FQYA 4IRSC 2O1AA 3G6JF 2W9LA 4NQVB 4HSAC 1PZ5A 3FB5A 3GZKA 1QO3B 4PV8A 2D7OA 1CI3M 1NIFA 1W6LA 4P48A 4S1QH 3N85H 3WTUA 1PBYA 1ERNA 2FJSA 4EEEA 1Z0MA 3CH1B 4OZGE 3RVUC 3VXQA 1IBZA 1IGTB 2IBGA 4JGNA 4U1JA 3E38A 2HFEB 2GBVA 3OKMA 5AW4B 1QFOA 4JN1L 1ZA3A 1FI8C 3BWUC 4PTUB 3T08A 5KBKA 2B9AA 3DSFH 3L3IB 5CEYA 4JPVH 4YSOA 2ZCKL 3RQ3A 4I85A 5FGBA 4JPIA 4MJIB 4OZFA 1BF5A 1IFRA 1VA9A 4KUZL 4S10A 5DZJA 5CHNA 3QWOA 4GBXD 1C5CH 5DK2A 5JIQA 4MAUL 1OSPH 4JM0A 5EO0B 1UXSA 4H20H 4KV5E 5FV2A 4A2DA 2EYSA 5G4MA 2W60A 2CJ3A 1S9VA 2Z92B 1EEYA 3RVTD 3ZHLA 3K2KA 4FG6D 4OIIH 2DJMA 2AS5M 1QWHA 3HAEA 4RGOH 1JI2A 1KJVB 5D4JA 4IRJB 3QO1B 5IR1A 2XPZA 4FQQA 3BEWA 2FR4B 4XCFH 2YA2A 3RHWF 1O75A 4NGHL 2XY2A 4JFFD 1ADQA 5GGSA 1OPGL 3B2UD 3OXSB 3F7PC 1AGEB 1OLLA 5E4IA 1KTJA 2FWSA 1L4IA 5JXED 4M7JH 3MLYH 5EORL 2IO5A 4QY8A 1IILE 4G3YH 4XNZB 3WIHA 1KWKA 4AYFB 4ACTA 2DQFB 1W15A 2X4NA 3TWCH 3W9EB 1U8PB 2R9HC 4K7FB 5FYKU 3GFUA 4DP9X 4E9SA 4WDIA 4ZW6A 4OJFH 5D7IE 4L5FH 1NGXB 1LO4L 4X6DF 1IU1A 4IOIA 4JFPA 1XGRA 2L7EA 4JKLA 4PP2B 4R5VA 4DQOL 2IQ9H 3CN4A 2F7OA 3FZUD 2MOQA 5H2BB 1X5YA 1MW2A 4UDUA 3BUQA 4X99B 1PD6A 4YHKL 3LD8C 3RIAF 1VF5C 1UASA 4WJ5A 5KVFE 1T83A 3D3VA 1J5CA 2BY3A 1DBBH 1CGSL 3O6FD 4HMCA 2HJLB 1NCGA 1U8LB 5DJXA 4JDTH 4KROC 3SYQA 3BAKA 3TIEA 1QQDA 3FTSA 5I76A 4N8VA 4MCNA 3ZT5A 5HHPA 2R0WL 3ARGB 5FLUA 3CZFB 2ZCHH 3Q1SL 5DLML 4PJ7F 1FL3A 5CBEA 3PREA 2MQ3A 1E3XA 1U0QA 1QSVA 1X3DA 2XN9A 5C8JB 1IC7H 5K5YA 3HCVB 1DQIA 3DO3A 3HE7D 1A7RL 2ESVA 3RVWD 1QW9A 3X2QB 3X14B 4L4TD 1QRNA 4GP8B 5CCJA 3SO3B 4BUQA 1E5ZA 2ATKA 3C5SA 3NFNA 3W81A 1G7QA 4WTQA 1OY3B 3QJFB 1L6XA 5AW0B 1JNHA 2BFVL 4WRLA 4YUEH 1CYXA 1QLRA 1E67A 2BNRB 4S2SB 4RH4A 3MBWA 3QEQD 4JDEA 3P4OA 4LSQL 4D9RE 4JN2A 1ZD6A 4OJYA 4M61A 5DHXB 1W80A 2DN7A 3UJTH 5AAMA 3OKYA 5FUZL 4IJ3B 1J5HA 1HAUA 3LN5B 4KK6D 3SDCD 1LO0L 1T1YA 2I32A 5C9JA 1QBLL 1INQA 1SJMA 1Q9LB 2VLKB 2LFGA 3IJYA 1M3IA 1E8ZA 1SEBA 5C0AE 3TXAA 1JNJA 1LL1A 2VH5H 1FV1B 2CRYA 1X5IA 1RHHA 3EZ8A 4YVUA 3TFKD 4HJEA 2OSLB 3NJIA 3EO9L 2UZIH 4B9ZA 1DVFB 4L48A 5ENWB 1TSHA 4PLNC 2LABA 2IMMA 4OB5H 3DHPA 2VZ3A 1GKEA 2ZKWA 3GIVA 3CQQA 2Z7ZA 3VMOA 3NGBC 8CGTA 4U4BA 2B3IA 3IU4L 2WNWA 5CKAA 2AK1L 2O5YH 1A7BA 1F97A 2YKLL 1BAWA 4G6KL 4KJWC 4N3TA 5DT1L 1RPKA 3EH1A 3SDXF 3QDJB 2NY6B 1KIQB 2Z93A 5F3HB 4D9LH 5C0JB 2XG5A 3QORD 4K3DH 4OGAC 5DJDA 4KMQA 3V4PH 1YC8A 5E5RB 5TJWK 5KYXB 3KYKH 4GUQA 4J7RA 3T2NL 4YSCA 3AXHA 4W9FC 3MR9A 2W0PA 3QUXD 3S5YA 4RX4A 3SDAA 3SPVA 5DQ9A 4PJAA 4JFOB 5L4IA 2OMXB 2AMGA 2C9AA 4N2NA 2GUYA 4HT1L 3GUTA 2I85A 1J1OL 4WU5A 4Z7VA 5SWZA 2NY1D 1CF8L 2IMNA 3E7JA 3NACH 5E08H 3HS0C 4W9HC 1EWHA 4MQXC 3LKQA 4E9YA 2J1YA 3RVXC 1OOAA 1AZBA 5GISH 5F1NA 2EVHA 3CFDB 5I8KH 5FO9A 2ICCA 3KPLA 4DP8X 4XNXH 4JZNB 2P80D 4M02A 4OV5A 2Z9TA 2DTMH 1UXLA 1IKNC 2DJUA 5HGBA 2NZ9C 2WO3B 1IT9H 1TVBA 3HUJB 1TZ8A 3WXVL 4TLTA 2FUQA 2YEZB 3BISA 4F7MB 5J6HA 3JT2A 3OX8A 5J6GA 4Z7IA 5DMGD 1WV7T 5GRVL 4R97C 4H8VA 3S34L 1K4CB 3H3PH 3ARFA 1Q90A 4GLRH 4JFDB 5HHMD 3SQBB 3RWHB 1X5XA 1VDGA 2GT9B 3D08A 4YPGA 1AI1L 4YBLC 1J8RA 1R3JB 1HL9A 1AS8A 5E56A 2RACA 1E6JH 4D8PB 4AC4A 3PUCA 4R7DA 1O7SA 4ZX4A 1I7TA 3WHE0 5EG6C 3WMPA 4JUSA 4PG2C 5BV7B 1OARH 3ILQC 1ZRUA 4LIQL 5CSGA 4OGYH 1M2VA 2XWRA 4JLRB 4KVPA 4NDMB 1MAML 4TTGA 4F9PA 1H3XA 4DZ8B 1OAJA 1Z1WA 1GZPA 2AJXL 2E59A 2VERA 1JYVA 4WLCA 3AY4C 2GFBB 4OLZL 4H8HA 3GSOA 3THML 2XXFA 3Q13A 4NUGL 4XODA 2IH9A 4V33A 1AMXA 4LK4A 1EVTC 4AJ0A 1BSIA 2K4AA 1BEXA 4P57A 3OWEA 3OC8A 2WPGA 5I8CB 2IG2L 5E4EB 2WZPA 2E46A 1A9EB 4FXGC 3FFCA 4FJ6A 4Y16B 2GBTA 5MEQA 2FJGB 5E8DH 2YK1L 2F53B 4P2RD 5C0BA 4EPSA 5HHOA 1J8HA 4LGPB 5AVUB 1VEOA 4UT7L 4BQ8A 5HYJB 3B8YA 4NPYB 3QW9A 1A14H 3BCFA 4XT1C 4MZ2A 2V5TA 4GG6F 4LHUD 1CURA 2A0LC 1WK0A 2AVFA 3DOHA 3AREB 2G75B 1XR9A 3EBIA 4OF5A 3UJIL 1JUFA 2BP3A 3UTTD 2UV3A 1QSEB 2Y36H 1KLGB 5KWYC 1YEIH 2QADD 3KL5A 4HFWB 3DJRA 3NSCA 1EZVY 5KN5A 3ZDZE 2CD0A 3BGFC 1RZPA 4RAVB 2ARJA 3QXWA 1RSYA 1YPZE 4K2UH 2NY2B 5GRVK 1OGTA 4YZWA 15C8L 2JI2A 3BP6A 1UM6H 2HA1A 3UPRB 5IHLB 4WVRA 1R5VB 1ZTMA 1FSKC 5JQHC 4NEHB 5D8JH 4FABH 4Y89A 4PLJD 2BCKB 1J9CT 1H9DA 2ZICA 1C5DA 1A7QH 3FT3B 4Y9EA 3LZPA 4YGVB 2AEWA 3T2QA 3NCYP 2C7FA 3SB3A 2NNCA 3OPZH 2ZJSH 4LB8A 3Q8AA 2I9LA 2YJLA 3QIWB 4LVOB 3RNKB 1DANU 3TS8A 3V55A 5DR5L 1AY1H 1JK8B 2X9YA 3NZSA 1C7TA 4PMFA 5DA0B 4QD2E 4YDKL 1X6LA 2VXQL 2D8KA 3KL3A 2VLMD 4G42A 2ICWI 2PYEA 2VKWA 1QR4A 3QFDB 5I28A 4OGZA 2ORBH 1VACA 2QDVA 1NCCL 5G4OA 2NXZB 4TYUA 1FO0L 2A1WH 2NQDA 1W0VA 1B3JA 2MTPA 3PP3K 1JN6A 1S7SA 1XF4B 4NHCH 4W81A 5DGRA 5DYFA 4IBSA 3VUAA 3QAZC 2X4QB 3DSNA 5D2NC 4A2FA 3GK8L 2ZYIA 5I1HL 2XBDA 4UT9H 3I6GA 2VQTA 2I7OA 2YPVH 4TSCH 3VI3E 2A77L 2Z7UA 2H3NA 4Y4HC 2F7IA 5GJSL 1D7BA 3TH3T 5IF0A 4JM2A 2E4FA 2YXFA 3ORJA 3ABZA 4KTDH 5IB5A 4N0FB 2IH8A 3TH2T 1FZKB 1DN2A 3EBGA 4J8RB 4K3JH 2JKLA 3D0LB 4HGKC 3UIYA 1O9WA 3K8MA 3MGTB 3GRWA 3FU3A 5DC0A 4NX0A 1YYCA 1IVTA 3TM6A 5IWLC 1HCFX 2UZPA 3OXRB 3QUKB 5C0CD 4S1QL 3N85L 2QV4A 4X9HA 3IJHB 5DVNA 1ID2A 2B39A 2XACC 3D0VA 1CTOA 3V7MA 1SOXA 3VXRB 3IPEA 3O4OC 3WLBB 1IVLA 4IMLB 5MP6H 4CSZA 1IEBB 2PCFA 4U1IB 4KKBC 4KX8A 3NIDE 4P23B 4IEFB 4ORZC 1NINA 2K3HA 2G9HA 1HCYA 4M03A 3DSFL 2IWGA 2IVFC 4LBEA 1DANT 4HCGA 3FQTA 1A3ZA 3WNIA 2EDHA 1D5XB 3EYFA 3IMSA 1U8JA 1XIWD 5D1ZC 4A7UA 4HPOH 2HUEA 4N0YH 1UJTA 3WNKA 3SKNA 4FP8H 1C5CL 2WGNB 2W94A 1IB5A 1OSPL 5AAWA 3O2DA 2GSIB 2FL5A 2MQCA 4H20L 1NCAH 1HHHA 2Z1KA 4D9QD 4LFHD 2APVA 5CSBA 2JJSA 4HU8A 4U7KA 1EUTA 4UQ9A 5K9OB 4M1CD 3MV8B 4RGOL 1A64A 1FL6A 4GUPB 3P4MB 5EF0A 1RZQA 1NCTA 2V7HB 5IOPB 2EC9U 2OMWA 4XCFL 4B50A 4LRIC 3M17B 5CINH 5CCKH 4DKEH 2BZDA 1TETH 5KBDA 5TDNB 3ZL2A 2K4WA 2YSSA 2Z4TA 4I9WE 2XPYA 5IV2A 4GINA 2DM2A 4GKSB 3MLYL 2X44D 4M8QB 2QR0B 1JFQH 3QG6B 4G3YL 2GTWB 2NT0A 3Q8FA 4D94A 1D5MB 2NY5L 5KOMC 3TWCL 1QFWH 1FNAA 2AZUA 2MWCA 3L17A 2OSWA 3EXLA 1LHZA 2UXFA 4JFYA 3MNDA 4I9WD 4X6EB 3N42F 1E2ZA 1FFRA 1HEZA 4KY1H 4FNSA 1WRFA 4L5FL 2VN3A 5AOMA 3D85D 3F12B 3ZIYA 4GUOA 1UA6H 2AK4D 1J7VR 1JERA 2E7HA 3EUUA 3GS0A 1T80A 1UH2A 2IQ9L 2WLIA 3UTZB 3NFPB 1SJEB 4G1EA 5EDSA 2DMBA 5E4OA 4EVNB 5HYIA 1QEWA 2XKSA 1CE1H 1H6FA 3DGGA 3FBKA 2QSCH 3HZVA 1U8MB 1DBBL 1U8QA 4XB7A 4JDTL 2AC0A 4J2XA 5F7AA 3FQNA 3WL9A 3K72A 3TH4T 2RA1A 32C2A 3PPSA 4LGRB 5E99H 5ETUA 5AVRB 5FFOA 2VLLB 1MEXL 3LNGA 4WCYH 4UYQA 5GS0H 3S36H 1E65A 1IC7L 4K3HA 1XR8B 4ZMQA 4IMKA 3WJMA 5E8NA 1VRSA 5FC9A 5K93A 2IOOA 5IJKC 3N43B 4IJTA 3K5SA 4AUUA 1D7DA 2EDTA 2PKDA 4KXZH 4P46D 4Y5YC 1OB1B 1CL7H 5GGSY 5A6IA 4IU3A 2EC9T 4HWBA 4HMDA 3FAWA 2PYFB 2C1PA 3OGCB 4YUEL 3U79A 2CKBA 1A9BA 2EEFA 5CMAA 3RP1A 5C0RH 4LXFA 3HZYA 4UOJA 3FTGB 5I1LB 2BOBA 4K23L 3HZ3A 2BINA 5EU7E 1M7IB 1U33A 4LLVA 3UADA 3UJTL 1MJ8L 1PY0A 4L1HA 2I5YH 1FLTX 1NBVL 3H3KA 2BSRA 1KPRB 3WHXA 4EXPX 2GSMB 3ZUNC 5EU6A 5B8CA 4U3HA 3A4EA 3PYCA 4X7SH 3FTWA 2N7SA 4LDOB 4WU7B 5JHMA 2XG4B 3BVUA 3VGFA 2V5MA 2LHAA 3HHSB 5D7SH 2VH5L 3VTTA 3IDIA 4GQQA 4F2MB 2XCMC 3IETB 5I6NA 5ICYA 3BZEA 1I8KB 2KC0A 2UZIL 4KRPC 4QHUA 1I1AA 5HTSA 4AQEB 3INUH 4FQHB 5FM4A 4O2EA 3C8KA 4OB5L 4B9GA 2A5UA 1N5AA 3VTAA 4MXVF 5HPMA 4UQ2A 2WP3O 2N0KA 4XN1A 3BZFA 5IMMB 2VDLB 4XXCA 2XKNB 3M1BA 1PD1A 3I3EA 2O5YL 3WFEH 1GRWA 4H5SA 1WBZA 4LLDA 3ZKND 2OZNA 1F11A 4K3DL 5T1LD 3UH8A 2ADFH 5FOJA 3V4PL 4BWTA 5C09B 5IB4A 4A66A 3MLUH 3KYKL 5JW4N 1ZLSH 4NAQA 1OK0A 2DMKA 3H0TA 2OXGB 1C16A 5GS1B 4I7ZC 1TNMA 5D1QA 4AGQA 3ARDB 1DEDA 4Y2DD 2APWA 1CXFA 2Z4QA 3H4HA 3NACL 3UBHA 5E08L 3PAVA 4LP8A 5C6WH 5IFJA 1AP2A 2EKSA 4P3DA 2IBZY 1U3HB 4NBZB 1KJ2A 4UM9A 5GISL 1NANH 1UFGA 1OKEA 5TK2A 5I8KL 5L8JB 1HDMB 1R0AH 4XNXL 3IE4A 3MRIB 2VLKE 2YC1A 3PE9A 5EUKA 2CHZA 3ARUA 3WS6C 4GRWF 4RA0C 1KT2A 2V2TB 2DTML 1G6RA 3GSQA 4LE8A 1DCEA 3DRQA 3VGHA 1IT9L 2VRKA 5E2TH 4PCYA 1AIFA 3LKNB 4HUXB 3BVWA 4UZSA 2W95A 4I1NB 1JVLA 2O6FA 1NOAA 3EXJA 3GMQA 2WUCH 3BW9A 5ITBH 3H3PL 5CP7B 4Y5XC 3CZSA 4ODTH 5AOJA 4BUHA 4LNRA 4G59C 5KSAA 1CFVH 3VMNA 1BVKB 1JXFA 1J48A 2HVJB 4YHNA 5ECJE 1FNHA 2CM5A 1JV5A 3LKOA 5IK3B 1E6JL 1HHGB 2R2EB 1SHMA 5IBUB 1F8TH 5I6XB 5KAQF 1T0PB 4MMXA 2Y07L 1RZGB 3KYNB 1OM3L 2V4LA 5CU9A 4AYMC 1MRCH 4H8UA 2DQTH 5E95B 1IIIA 3OJDA 2VAAB 3QXAA 1OGAE 4OGYL 4DGUA 4K8RH 1LP9F 2WO4A 4G2AA 5GS0D 4DHLA 3O3AA 3DIFA 5IMKB 1U93A 2E7LA 4RMRA 3PIQB 1L9MA 4LSUL 1FPTL 3V6OA 3QO0B 2YZ8A 1WTLA 3ULUE 2VDOH 4B96A 3EOBA 3VXUD 3RTQA 1I8IA 2BSEA 4A2MA 2JXMA 2WQ8A 1JK9B 3KNBB 3MRMB 4KVNH 3UTOA 2BVOB 2RCSH 2C8NA 4FJZA 4MCMA 2IOMA 1OGAD 4AIZA 1AR1C 1JS4A 1ODUA 3VXSA 3VD2A 4UI2A 4MA3A 3UDWA 2XLLA 1UA7A 1T4WA 3P9LA 4TQHA 5AYQA 4XCNA 4PD4J 2O93L 1WDAA 4FLRA 1KLUA 4ZX5A 3ULUD 2X09A 2PTVA 3DROB 1MCWM 1X5MA 3HUJE 5HVHB 3FT9A 5E8DL 1FVCA 1LEGB 4NQDD 1ASQA 2QPDB 2WYIA 1OP5H 4HJIA 3LQZB 5DHEA 4EN3B 2R1XB 3ZIMA 1A14L 2WKLA 1YEFH 1DBAH 4S1DC 2GVYA 1UTDA 4OD1L 4NUJB 5DJ8A 4HZLB 4TOYH 1BV8A 1KJMB 3MXWH 2VIRA 1YEGH 3QUZB 3PQYE 4D0CB 4DKFL 3CJJA 2Y36L 1E28B 3KBEA 2VRQA 1IFHH 3UROR 4HJ0D 1YEIL 1WA1X 2IDCA 3FOLA 2V9QA 3GJEB 4KU1A 1RLBA 2J21A 3PHOA 3PWPD 2YAEA 4FG0A 1Z5LA 5IJKA 3KXFD 5DRWA 3BPOC 3DK2A 2JF1A 2EIJB 1DEEA 4AYBA 4Y5YA 3UGEA 1ASPA 1GPOH 3FSZA 4K2UL 2ALAA 4C56B 4S0HA 4L3CA 5DFVD 2ITEA 3PQYD 5ACZA 2G2NA 1EGJA 4V11A 3VTMA 1BFSA 3Q5YA 3H9ZA 1QA9A 5D8JL 4FABL 2IAMB 3TZVA 7CGTA 2R15A 4Y4FD 5IHZB 5ID0B 1WLHA 4O9HH 1A7QL 4XPTH 1UD8A 3L1OH 4N8PA 4PI2A 4IKKA 1HAWA 5D2LF 5F9JB 5B38A 1U41A 4W93A 3OPZL 4CL7A 5MENB 1NTDA 3BZ4A 3IDGB 5IEKA 4GBXB 1NEUA 1AY1L 2CRZA 2QSTA 5IB1A 3LRSA 5CJ5A 1QI4A 4R5XA 1AGFA 4M43L 1JYNA 4DZBB 2RMNA 5DJAB 2HT3C 5T1KA 2F53E 4XH2B 1D9KD 5AOZA 5HJDA 3BIBX 2ORBL 4J1UA 4PJEF 3KL0A 2A1WL 1J5DA 3C5ZD 3Q3GA 2CDGA 3UBXG 2XFGB 3G9AB 1BQSA 2D3LA 3VWKD 3FTVA 4POZC 1BZ9B 5FWQA 4FZEH 4N20A 4X6CB 3RBSA 3RDTD 2W0FB 2QGBA 4BUGA 5IB2A 3BRDA 4UT9L 4U1HA 4J3OC 4FMVA 1P7QD 2W8CA 2YPVL 3B3IA 4TSCL 2JCCE 3WDHA 3O9WB 2RB8A 3LN4B 3ME0B 4O51B 4EI6A 4JNXA 4KTDL 3UEQA 4NQXA 2RR3A 3V5HB 4X7FC 4K3JL 2X70B 4AM0A 4DP7X 4QR7A 1TQTA 2HMID 1U2YA 2EEAA 1GHFH 1Z9LA 4UOW1 3WG7B 3I75A 2CK0H 3W38A 2QTVA 5B22A 3OD3A 1SUHA 1CICD 1EFXA 3OSVA 5HVGB 1TUPA 5D1XA 4PJCA 2MTAA 3BEVA 3QR1A 3ZGHA 2K78A 4U1MA 2CUAA 5LCVH 5IBLC 5AZUA 5MP6L 3HA0A 3SE3A 1HJCA 1FYTD 1BIHA 5DUBB 1M7XA 4J6IA 4RLDA 4K8RD 5FM8A 2KDYA 4CA4A 1UURA 3NH7H 2E76C 4F7TA 2XA8H 4N9GB 5ANMA 1O6SB 3VCLA 5IJBC 4NBXB 3TJHC 3OKKA 4N8UA 4X5LA 3WU1A 1PZSA 4W9GC 1FG9C 4ZUSB 2OCFD 3MRKB 4LCCB 1U58A 3ZN6A 1S7XA 4Q14A 4FLSA 4N0YL 5EPMA 1KCWA 1KGWA 1RLWA 4FP8L 4L8SC 1HXMA 5GSRA 2LU5A 1KY7A 2IXQB 2YD5A 4JJ5B 1RULH 3NK4A 4QRRB 4MXQD 3JTSB 1FO0B 1NCAL 3PWLA 5CZRA 1MFAH 1Y6KR 4PJHE 3QC5X 2J5LC 2AAVA 3RPBA 1X4YA 3HE6B 3MYJB 4GFXA 2CDFB 4MB4A 1W0YT 1F56A 3Q6FB 4DN3H 5EF1A 3H7BB 4NNPH 4PJDB 4QNPE 2R2HA 4HA1A 5CN2A 4OIAA 2XBZA 1RJZB 4YJZL 2AF2A 4OZGF 3HHRB 4YLQT 2FECL 3CUPB 3CV5A 5CINL 4U1LB 5CCKL 4DKEL 3TN0D 1IQDB 4ZMTA 2H26B 1G7PB 3RE0A 4NCC2 3FSVA 2IQAA 3GHPA 4HLZG 2FTAA 3MJGX 4RMQA 1DL7H 4HIXH 1KEML 1P5UA 5TPWH 3KPNB 5AOLA 1JFQL 1GY2A 3VXRE 1YY9C 3UCRA 2KH2B 4DEPB 1ECYA 4LLYB 5LUMA 3HC0A 2BY0A 2Q7AA 2DWEB 4UM8A 3TO4D 3ZR6A 1GTFA 4L18A 2EECA 1V55B 4KY1L 5F7DB 2E9JA 2QELA 1URZA 2V2WA 1NCJA 1UA6L 3TJPA 1C08A 4XNQB 4MDIB 2PTTA 3IXAA 1E9QB 3O8XB 4B7LA 5IUSA 2EEBA 3ES6B 2VZUA 3KPRE 2ZXAA 1NKOA 3J07A 1CE1L 4AT6B 5E8OA 4J3UA 2WWKO 4M48H 3K4DA 3QIUC 2QSCL 4MRCA 2X0WA 3S4SA 5SWQB 2HKHH 4JS7A 3GMPA 3Q2CA 5GIRB 3X3GL 3UAJA 4J27A 4RAUA 2EH7L 3L8QA 5E99L 5K69A 4MVBD 1TO4A 5E9DB 1DP0A 1KB5H 3MV8E 4WCYL 1S9KC 5GS0L 3S36L 3G5VB 1T20B 3ZDYF 3DTDA 3WTVA 2Y9RT 5D7JA 1G84A 4M93B 4U2ZA 4FEIA 2I25N 5KS9B 1N2RA 2Q2LA 1CL7L 1MREH 3VWJB 4X9FA 2LLGA 3X1NA 3RWFB 4TNWK 3VXOB 3MCLH 4MMYB 1F4HA 1P4BL 5C0RL 4MAZA 2A38A 3RGBA 5F7YC 5FUOH 1V3MA 3K1KC 4XAKD 1L6PA 1LO5B 4BZ1A 3ASWA 3DIVA 3KPQA 2I5YL 5C2UB 4N2BA 1N18A 4GP4B 3G08A 4DK3A 4FXKB 2NXYB 2FD6L 1X44A 3CFJB 4X7SL 4ALAH 1GZHC 1YA5A 4P06A 1G9EA 2XU9A 3QCUH 5D7SL 3AUVA 2VDKH 2L04A 4LPTA 4JGUA 1DVXA 2ATPA 4I0PC 1PLAA 2J12B 3VFSB 1W2KT 1NMBH 3G5YA 2GAZB 2X6BA 4B3EA 3RX7A 3KBHE 1F0LA 4PI0A 3TTYA 1MZYA 3F58H 4L1LA 3ZZ1A 3HG2A 2DBJA 4AQ8C 1I8LA 1KBWA 1WS8A 4PQXA 4JHVA 4XI5C 5DHMC 4QO1A 5J3HD 3VXQB 4FKHA 5DEGB 5CIPA 3BPLB 2BVQA 4O58H 1P5VB 4P2QA 2YD6A 3WFEL 4YH6A 2PWHA 4PJBF 3W57A 2X1QA 4RISH 1MSPA 4U49A 3F6LA 3M6DA 1R19A 2OQJB 3GHBH 2HJFB 2ADFL 4R4ND 2GK0B 1LD9A 2CJUH 2EDRA 3U48A 1KPVB 3MLUL 5ICZA 2NNAA 3WY1A 2R0LH 5L7XH 3MFFB 4ILDA 4QOKA 3KR3H 4GW4B 3QWOB 5AG8A 2VZVA 1BPLB 2W88A 3LIUA 2D7PA 4OVVA 1UQSA 4N2FA 1RZ7H 3C60D 1BEYH 4HAGA 4F58H 2W1NA 4HSQA 4BGDA 4KKAC 3SY0A 3SZKC 1IO4C 3SBWA 1JDCA 4P2RB 1R0AL 4Z6AT 4HEPA 1JWUB 2C9PA 4GI6A 5FXCH 2PR4L 3AU1A 4Y2OA 3N55A 3AGWA 3VRJA 4YFEA 3BEWB 4TUJB 2JFCA 2X28A 4F2ME 4WTWA 4M56A 3BAEH 2HFTA 3V10A 4OGQC 1Q1JL 5E2TL 1JG9A 4UV7H 3IDNB 1S7WA 4TXVB 2XJLA 1NIBA 1NMCB 1R3HA 3APFA 2NLJA 4Q89A 5INDA 5BZZA 5MERB 2NUTB 2WUCL 3T3PB 5ITBL 4BSJA 4OLXH 4KO7A 4ODTL 1YLBB 2QVIA 4MCYB 3AS2A 3PJSB 3EHBB 2R83A 3TYGH 1NIDA 1H5BB 1XB8A 2X4NB 4HKZA 1Z3RA 1TZGH 1BBJA 4YHOH 1JZJA 5IHWA 3NJLA 2R1WB 4R0LA 1IC4L 2R8SH 4IW4C 4PUBH 1F8TL 4JGJA 4N2IA 3FPYA 2ZX5A 1F4AA 1SGKA 5E6ID 4JFPB 5F1KC 4ANWA 1MRCL 2DQTL 3PWNA 4LOEA 1E4JA 3HR5B 3P4NB 4IBUA 4O2FB 1MCIA 1OTSD 5LDSA 4C54A 2WSKA 1KXTB 3CQFA 4PSRA 1QSFA 3MNWA 4D0DB 2OTWB 3DX4A 3M8OL 4X6FB 4K9JA 2VDOL 3MRRB 3KLLA 1G87A 3BFWA 4MDRA 3TIEB 5GZOC 1QQDB 2X9ZA 1FL5B 4KVNL 4X9BA 2P47B 2RCSL 4PJ9C 5AOIA 2WQXA 3GM0A 2DQGH 5C0FA 5DS2A 1MFUA 3Q5OA 2IADA 2OL3A 4HUMB 4KBPA 4UZGA 1TQBC 4FQPA 4F37K 5LWYH 4TKWA 3N44B 2ISDA 4WO4D 4G71B 4F2EA 4QI3A 4DO4A 1DLHA 1KYDA 1Y7VA 2VW6A 2B3RA 2CXGA 3U7WH 1PG7X 4JE4B 2FVNA 2ZSWB 5D72H 3HBQA 1QLRB 3FQUA 1N26A 3N1GC 3NEXA 2NPLX 2FJFA 3BGMA 1MY5A 3F64A 3FU7A 2MFNA 1YEFL 3OKNB 1DBAL 3P4OB 4BDVB 4EI5D 3SD2A 2UYLB 2GC4C 1LILA 3G5WA 4TOYL 3UTPE 3DUHA 3KPSA 3MXWL 4XMZA 3T6ZA 4WWOA 3BUBA 1YEGL 4W9CC 1K72A 3ZDXF 1GKOA 3C09B 1IFHL 2EIZB 2NY0C 1JGIA 4PTTB 4BWUA 5E8PB 3LS5H 1RIHH 1DFXA 2YUWA 3EO0A 3B6SB 1S5HA 4U3XA 1CG9A 2R29H 4ELDA 4HDIA 4PRNA 1KBVA 4PRBA 1RHHB 1GPOL 2CKNA 1BQHB 1T1ZA 4LCYA 4NO5A 2AGJH 3KLAB 3UTPD 4POYA 4CSPA 2K3TA 1KSRA 3PG2A 2ZOTA 3TCLA 3ECBA 3P3YA 4FKKA 2AQTA 3IPBA 2WXFA 4K5PA 5E6ZA 4A6YH 3NPSC 1JIBA 3FO2A 1HQ4B 2L7JA 4LDLB 1IL1B 5LJYH 4O9HL 2J1XA 5D5MB 4XPTL 1JPGB 5JOFB 3L1OL 2WAQA 3IAQA 3W11C 3QJXA 5BJTA 4AL8H 1XIWB 1EHLH 5AKSA 1Y0LB 5JA9A 1I1RA 2G30A 1RV6X 5DJDB 1G0DA 2NCMA 5F1OB 3H9YA 4HIJA 3U2IA 3OMAB 4GRLD 2VC2B 3NEEA 2ZCLH 5C07D 4G9FD 1MCLA 5C3TA 3LEYH 3HIZA 3QQ4A 1E3ZA 2I69A 3FYEB 4JANA 2JTYA 3SDAB 1FBIH 2BOCB 2A9AA 3ZDZF 3DVFA 3EJYD 1N12A 4AQAA 1M6OB 2YD0A 1HHKA 5AW3B 3P69A 1YPZF 3ABKB 4FZEL 4IBZA 4IIQA 1A4JB 4AQ1A 4F92B 5MEOA 1FFQA 2EO1A 2OW7A 5IEHA 4LHJB 1UD3A 3EADA 1S9WA 1SOKA 1GCYA 2UY7B 4YQXH 4QT5A 2WUBH 5KZCD 2GJZA 2K0RA 4OZHB 1IEAA 2CNZA 3T0XA 1TVBB 1EZSA 5SWSA 4AE0A 4L4VD 3IJEA 3F8UB 5DHYA 1GHFL 3FTYA 2CK0L 3N5AA 4FE9A 1VKXB 1NCIA 2VGLM 3DX3A 1DZ0A 3CX5J 2KT6A 2IDQA 2J8OA 2NZ1A 2ZXCA 3NQKA 4MA7H 5EEYA 1JI1A 2Y1VA 4PJ5A 4Y9BA 5F7LB 3FOMA 4AGPA 5AD0B 4WK4B 3QHZH 5LCVL 2CLRB 4HVBA 2OLDA 5JQ6H 2H3KA 1HWHB 3BOVA 4ZOCA 4QJ5B 3H42H 5MENE 1FH5H 3NH7L 5E0FA 3CXDL 4JHZA 1CK0H 4XPAL 2WMPA 4X4XB 3HI1B 2R69H 1OE1A 5HI3D 4LEEA 2JKRM 4LLMA 2YRZA 1JNLH 4MNHA 1S78D 1JPTL 4DUWA 1AC0A 1M2VB 5A3IC 2LT9A 1MI5E 3VI3F 4Y1AA 2CMRL 5FYLE 3T2LA 1JXGA 4K71C 4N6RA 2X4PB 4ENEC 3BDBA 4QYOB 3KLHC 4FFZA 1I1FA 1WAAE 4JHAH 4JX0A 4WHTA 2Q6WA 4ETQA 1HINH 2J2ZA 4NN5B 3TA3D 4LQ1A 1KN4H 4DN3L 4NNYB 3ZY7A 3CDGB 4NNPL 2F5BH 5D5MF 2MCMA 1MI5D 5TGBA 2P48B 2CRMA 5FYLD 3QNZB 4JKWA 5LBSA 4HEMA 3EJUA 5I9QB 4EUPH 2WIIA 4N8CH 4XP1H 1LMIA 4Z3HA 2OMUA 3QDGA 2BIOA 1X7SA 3L3OC 4MD4A 4KGLA 3SDYH 2RGSA 1A4KB 1DL7L 2JKSA 4HIXL 4IKNA 2ZYSA 1UB5B 3Q9QA 5GGRB 4IOFD 3EOAA 3NZ8B 2V33A 1TQCB 2XI9A 4GSUA 1K8DA 4XCCH 1RJCA 4I4WB 5FB8B 3RZCD 3VXMB 5BQ7A 1XR9B 5JHDA 2ZF8A 4IS6B 1JUFB 1F45A 4Y2LA 1TKWB 5IW6A 4YIQB 2C3VA 4DVBA 3ARBC 2WD0A 3BKCH 3HG1D 2Z8WC 3S97C 1L9QA 3T9WA 1EJ6A 3BH8B 1KZYA 4P5KB 4MXWH 1UWGL 4XCYB 5INCB 5TK4A 1VHPA 3ZL1A 4PJFA 5GQBA 1CBJA 3IRCA 2QVTA 2DQ6A 3QI9C 4M48L 2H0EA 2YUXA 2H47C 2WV3A 3F7RA 2FIKB 2HKHL 2GJ6E 4QRRE 4ELMF 2WBXA 3SDDA 5CZXC 5DJCA 4NQCA 2ZOLB 2KERA 4JFEA 3L1EA 4XBGA 2VSCA 3HJ0A 1URLA 1C5DB 1KIPA 1KB5L 2C26A 4XO4A 3QDMD 1FHNA 5EU4B 3LS4H 2JB5H 1W8OA 4PJDE 4ZX3A 4AKPA 1AO7B 1MCSA 4WHYG 4Z7NF 2ZXBA 3OZKA 3S88L 2FATL 2I9LB 1JWMB 2WXGA 4KI5D 1FNGA 1T0NB 1PKQA 1H3WM 1EDQA 4TQPA 2W0KA 4CN1A 3VRIA 4UTBH 1TFHA 4NUQA 1MREL 2DDQH 3O6LH 3BH4A 4G42B 4XBPB 3SPCA 2A6KA 2PTUA 3DXAA 2Z31D 3W0WB 1GYCA 2GJRA 3MCLL 3VW3H 4HPHA 1TIUA 1KF9B 3IGFA 1S7SB 2WVVA 4F8NA 3TURA 2APFA 4S11A 1DQQB 3QYNA 4F27A 1SJHB 4PJ8C 1BGXH 5C7XH 1CVSC 4GXFA 4P4KD 4GSQA 3SGJC 2UWEA 2WLHA 2XTJC 1PSKL 3HAEH 3R0NA 4R4FH 3ZE1E 4ALAL 4AZUA 3O4LA 2X6MA 5CD5D 3T0EA 4GB9A 4P9HH 1GY1A 3QCUL 1VGEH 2NRDA 2VDKL 5E7BA 4QRPA 1CD0A 1W72H 5DXWA 1L6ZA 1ADQH 5BZDA 4KJYA 4IGBC 2P43B 3MLSH 1NMBL 4PJXA 4WI6A 2E9WA 4QXVA 2Q8BH 1AZZC 3F7YB 4PRPE 5HGDB 3F58L 4KQ3H 5IBTH 5BO1H 5JPNC 3NSYA 1LE5B 2CBPA 3L4TA 5FV1L 3WEAA 5AW9B 1EXUA 5DWPA 1LWRA 5IVXA 1D5BA 2VISB 5FPIA 4O58L 4N22A 1RUPH 4NKQB 4XZUB 3WJLA 1T5WA 5I71C 1R75A 2PCFB 4RISL 1ZS2A 3BHBA 1G9NC 1II4E 4FDWA 1SN5A 2PXYD 2JKTM 2WQRA 3GHBL 4PRPD 4Q0XH 5KS9E 4X98B 3I3BA 1KTLA 3P2BA 2P7TB 2VSKB 2CJUL 5LBVA 4P3CH 3TVMC 2R0LL 5L7XL 1E50A 2A6JA 2HVKB 2WWMD 3EYFB 4QHMB 1AACA 1XEDA 3KR3L 1U8JB 1R9FA 3HBGA 3VQ1C 2NX5B 3H8NA 5FIEA 3AG1B 1CU4H 3GMNA 4I2XA 3FUMA 4R5TA 5EEZA 1IBGH 1XL4A 3VACA 1RZ7L 2PABA 1ET5A 4F58L 2DWYA 5HDRA 2FZ3A 3FQWA 2PPEA 1C8QA 2C34A 2IF7A 3VRLE 2P5PA 1PLCA 1FZMA 2J88H 4NQDB 4XNYL 4YHLH 4Q6KA 2D9QB 5KJRL 1HQRB 3CMOH 4PJGE 4TVSa 2VR8A 4RDBA 5I75B 4U6HB 5E23A 1HCVA 3BAEL 2X6UA 3WTTA 2FLBT 4Z7UB 4UV7L 4Z8FH 1BAFL 4HCIA 3FO1B 2G3ZA 1E0OB 3QWQB 5EOTB 5J6SA 4HK0A 1BF8A 3IF1A 2V3DA 4FQXA 2CM6A 1X6NA 2BP0A 3OBAA 3AQDA 3TO2A 1QLEB 4F7PA 4KNQA 1MWOA 3WJJC 5IVZA 3WNNA 1UJ3A 1ED3A 3KXFB 2GJJA 4OCMC 3TYGL 4Z3GA 1UUNA 3NVQA 1EJFA 1TZGL 3LNFA 4YHOL 3RGVA 1TPXC 4HIQA 3VFUA 5HYFA 1D5ZB 2DIJA 3CLWA 1Z2KA 4JFYB 2R8SL 1HEZB 4FG6C 1EXGA 1T22A 4ABVA 4BFBD 5F0JB 3DX8A 1CFQA 1Q1PA 4HUKB 4P2OB 3UMNA 1CDIA 1GIGH 4JO4L 5ESQA 3LZLA 4OU3A 4MNGB 4NJAH 1DQJB 1VFUA 1YUHB 1FVDB 3B2UC 2WXJA 3ZE2B 1TYJA 1QATA 2OCJA 4I5BA 3O41A 4YC2C 3V5KA 3QZBA 2G2RA 5T8IA 2X1WL 2XWCA 1SVZA 32C2B 5EUOF 2HKFH 1E2VA 3L95A 2A74A 4JB9H 2DQGL 4N2AA 3QH3B 4L23A 1BAGA 2Y4SA 1V05A 3TPUB 3WJMB 4P5MA 4PV9B 1DBKH 2QKIC 1ORQB 4FCHA 3UP6A 4QEGA 4RCAA 5JOPE 3WV0A 5LWYL 4UTCA 1TFPA 1UZ6F 2HPOA 1B2WH 1MVUA 3GMLA 5IKCA 4Q2ZA 3U7WL 2EDXA 4XBEH 5D72L 4EZMA 5AZ2H 2FH6A 1A9BB 3TCTA 1A6VL 3KWXA 5FO8B 1BX2B 4QTHA 1KCLA 2PPDA 3LZFH 5IVNA 3T3PE 2WHVA 1G7MB 1NDGB 3K4AA 4CBZA 2DEYX 3MROB 1X5ZA 4KDWA 4JRXA 3CX2A 1WZLA 4OF7A 3MRHA 3BWZA 4JG1L 3WY4A 3P0GB 2Y6TE 3U4EB 3LS5L 3ZE0F 1RIHL 3CLFH 2WZ6A 3D4ZA 4J23A 1Q8MA 2PO6A 3MKGA 4WEUD 3ULUF 4YDMA 1NIEA 4ADIA 4P99A 4FNRA 4K94C 2R29L 4JO2H 4MJ6B 3C8DA 5A7EA 1NL0H 3HE7C 4MAYA 1ZV5A 5ICYB 4YO0A 2ZP8A 4L8DB 4TLKA 3EJCA 3ENEA 3UYPA 1N59A 5AVYB 1QSZA 1INEH 4B41A 1S9XA 3D3VE 1SXBA 4O2EB 5E2JA 5GZNA 4A6YL 4GFTB 4U6XA 1F3RB 5EBMA 1CBVH 1KV3A 3UTSD 4UQ2B 4FQJH 4N2CA 2VDOB 4Y1SA 5IVOA 2FT6A 3CIAA 4AL8L 3TC9A 3DI3B 4Z3IA 4YHPB 1R3LA 3B3BA 4JM4H 4KK6C 1NUDA 1OVZA 4F9LA 4L37A 4BHUA 3D3VD 2DMHA 3FT4A 3MA9L 4OJAA 5CP3A 1HSAB 1SNRA 4FZ8H 2ZCLL 3ZKSD 4EIBA 1A2YA 5EO9B 3MJ8A 5AENA 1IGFH 3AY2A 3L5HA 3QQXA 2J8UB 3LEYL 3MMEA 5I1AA 1N7MH 1FBIL 3AB0C 5AW8B 2XN9D 4PY7B 5G2NA 4J2QA 5CJBA 3UERA 4KRMB 3GGWB 5JPNA 4OM1H 2X4TA 4JL1A 4PRHA 2ESVD 1EHAA 1QRND 4M1GH 5JTWA 1AP2B 3RWGA 3BSZL 2DWXA 1AKPA 3KMDA 4HFUH 2ZG2A 2PW1A 3R19A 3IJSB 4ZMVA 4JPQA 4YQXL 3EG9B 4LVEA 3ZKXC 1KTRL 2WUBL 1KGYE 3H55A 3PXLA 1G6RB 2XIIA 4MMZA 2WQVA 1OF0A 3Q01A 5BRZB 2OX5A 1UG9A 3LNDA 1J0YA 2AV1A 1R3IH 5CR8A 5A16B 5EZJA 2AAAA 1A4BA 3LEXA 2RFXB 1WGOA 2EDLA 3FHEA 3QUXC 5AB2A 2IWEA 3GMQB 4MA7L 2M1KA 1NGZB 4R8WH 2DWDA 4MJ5B 4AV4A 2B8OT 3L3KA 4WHDA 2OPCA 1H8SA 3OHXB 5JQ6L 5KSAB 3RIFK 1UB6B 5ECGA 2NY1C 4QRUB 3H42L 1FH5L 2NOYA 4J3SA 4CN4A 5K9QG 1CK0L 3WIFB 4Z3TA 1G7IA 3D05A 1O5PA 4TMPA 3D7PA 4MMXB 2R69L 4PS8A 3RYMA 3LXAA 2H0JA 1KCSH 1YNTB 3ZMEA 1JNLL 4PJIB 5HHQB 2YARA 3QXAB 3K3QA 2JCCF 3GXTA 5JYLA 5LGKA 2H2SD 4YSQA 3KGUA 3DIFB 3O3AB 3OJ2C 1IE5A 4FFVD 1XTLA 2ZYRA 3E8VA 1QWNA 1WD8A 4U6VL 5DMGC 1LWJA 4Z7VE 3DDFA 4ZXBD 4JHAL 4UU9A 4TM9A 1NOFA 3ESUF 4B7IA 3D12B 1HINL 4CW1A 1JCVA 1KN4L 5F3FA 3S2CA 5ID1B 1GXEA 4IRSD 5D9SA 2VDPB 4BFGA 2F5BL 3GPEA 5DU7A 5T3ZH 1EAPA 1GZQA 2WP3T 5IBUG 2JIXA 4OZHE 4UIKH 4XCNB 5C0NC 1KLUB 1A0QL 4N8CL 4XP1L 5SWZD 4BA8A 3PGDA 4BSVA 1J88A 4AGOA 1FVCB 1EZUA 3ILPB 3SDYL 4EF3A 1ZLEA 4OLEA 5T1JA 4AMWA 4RFEA 1LEIA 5AW7B 3CZGA 1CQYA 1XH0A 1MHEB 3QYCA 3MXVH 4JCLA 4URTB 4XCCL 3IGLA 1X5GA 2CDEA 4MBRA 2ADGA 2WOBA 1IM9A 3MRPB 3APNA 1T2QH 4PVMA 5JPMB 2DQIH 1RMFH 1LYQA 35C8H 1G6VK 3BKCL 1OHZA 5C08D 3BP4A 2BZCA 2NTFA 1FN4B 4MXWL 1ZVYA 2KKQA 1Z5LB 2FYYA 5DRWB 3ZHDA 3ARFD 4ZFZA 1DEEB 4G8GB 3TBTA 4UOZA 3D18A 3BQUA 4QNPF 4TULH 3M46A 4I1RA 3MZGB 2G3MA 2JB6B 4OUUB 1A47A 5DTFB 3I6LE 5EF3A 4GO9A 4Y4KC 4K7PH 1F3JB 3PGCA 2B1HH