5IUCA

Crystal structure of the gspb siglec domain with sialyl t antigen bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'DTERPVVNVPSEITVYRGESFEYFATVTDNSNAFDLAKTVVRWLYSNQPGRGTEWLQYSVTQVGNQLKVRIFGNVPIDTTIGDYTRYVVATDAAGNVNATQTEMGNAAVDKTSVNGQFKLIIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Platelet binding protein GspB
publication title A structural model for binding of the serine-rich repeat adhesin GspB to host carbohydrate receptors.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Sugar binding protein
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iucA00
5IUCA 3QC5X 3QC6X
chains in the Genus database with same CATH superfamily
2VLJA 1Z3RA 3AITA 3O9WB 3SDDC 3V0HA 3BWUC 4PRPA 1UQSA 3KPNA 4H8VA 4QRRD 2WINA 5KJ4A 5J6SA 1X7QA 1FZMA 1AGCB 3TBSB 3VNYA 5MEPB 1NEZB 3IE9A 5AAWA 5HHVL 1ZANH 5BV7H 1QFOA 3VXOB 3TA3C 2X42A 1I9RL 1QFWM 2W60A 2YRZA 5EZLA 2D7PA 5AB9A 2KQMA 3SKNA 1YYCA 4AQ1A 4JRYD 4G6AD 3FU6A 2P4AB 3WDJA 4DH2A 1LXMA 4KK8D 3QCVL 5C08B 3N41B 4X4ME 4EO5A 2EKSA 5A1AA 5DURB 4N2DA 2K7PA 4KO9A 3CH8A 3S35X 4OLEA 4JUTA 4EAEA 2WB7A 3L3JB 1XGTB 1NSNH 3QXVA 1V8HA 1ONQB 3DTUB 4XZ4A 4F2MB 4JKKA 5EF3A 5ADOH 5DR5L 4GIOA 1NAKH 5DUBB 2GT9A 5TDPB 3ZW3A 3SCMB 1JGIA 3IETB 2ADIB 2ZX9A 2MMXA 4OUUB 3MBEC 4JPVH 3ARDB 1KXTB 1R24A 2YGVA 3T0EC 1MNUL 2ORBH 2IBBA 3BGMA 4K8RC 3AGVA 5ICYA 1VKXA 1D6VL 1EJOL 1ACYH 3GHBH 4R0LA 2ICWA 5HDWA 3ULSB 1MRDL 1ETA1 3WN6A 4X5RA 1AQMA 1CMOA 2BMKB 2VSKB 5MEQB 5DWUL 4RA3A 3QJFB 3RILA 3KPQA 3FULA 4LIQH 1WAPA 1A4BA 1IKOP 4LVHB 4MAZA 1A64A 2HT3C 3KYOA 3SJVD 3DSNA 4IMLB 4WFFD 1AI1H 4Z77A 3B8YA 5I6MA 2LAGB 1SHXA 4F7CB 3BT0A 3AWFA 1C1EH 3MV9D 4OZGB 3MFGB 3GS0A 1HHJA 3POCA 3VD7A 1OP4A 3QZLA 3U6RB 1WFJA 4I1NB 1E67A 4GT0A 2L3BA 4O2CA 1SLWA 4X6DA 3MR9B 4LB8A 2CRIA 4G72B 3SDDA 2GY7B 2GBUA 2P8MA 1M7IA 3U2SA 3D05A 1HHIA 2XTJB 4J3OH 3OHXB 4OFIA 5E0FA 5AVVB 3FUFA 4XMPL 4PGDA 5C7XH 2BIOA 1DLFH 1TKWA 4NO2B 5DEJA 4IRJD 4OIBA 3ARYA 3S3PA 4HOZA 3G6JF 1FNGA 1OGTA 3TA3A 1UXSA 4FHBD 3ZDYB 1P84J 1UENA 2JQAA 4CC1A 3MFFA 4OCXH 2D9QB 2BY0A 4RGND 3PIQA 4YHML 1J1OL 4J3BA 4BFEA 1KCUL 2Z31D 2DQTL 5C0FA 1TYEB 3PYCA 3AJ7A 4NQCD 1XGRA 4P5RA 5C1MB 5J5EA 3HPLA 5IHHA 4BINA 1I7ZA 2MQ3A 2OX5B 2NPLX 2E8ZA 3OZLA 4FG4A 4M3KB 5D72L 4N85A 3JWNE 2A83B 3WN5B 2VE6B 4G3YH 5KOVC 3FO0L 2E27H 3DNKA 2HWZL 1LEKB 4ZS7H 2ATAA 5LXGL 1YN7A 2A74B 3H3KA 4Q4IA 1UWEH 2X4PB 3PP4L 2BIPA 2NOYA 2EYSB 2EVJA 4TVPL 4PBVC 2BZ7A 3T0EA 1QASA 3MCLH 5KVEL 3BUBA 3GMQB 2FT6A 5FUCE 15C8L 2UZIH 5EUKB 5T1LD 5TQ2H 5E9DE 4RMSA 2GSGA 2OLDA 4HHAB 3ET9F 1J8HB 3Q43A 3UH8A 4LCVA 4HIJB 1OARH 3C5ZD 1BGXH 1F42A 4JQIH 2OMWA 4I0PB 4M7JH 3KCPA 1ET5A 4N3TA 2NY3B 5I66B 3WIIH 1SFHA 2OL3H 1FA4A 2XKSA 2EXWC 3Q2VA 3HZKA 3NJXA 3FBQA 5B39B 4WU5A 5JHLL 4PB9L 3SGJC 3HPJB 1FAKT 4JFHD 4JM2B 4JVPA 2UXTA 5EIIG 3HG4A 1C5DA 5ETUB 2X4NB 5D2NC 5DRNA 4WF7A 5I5MA 3A6BH 5K33A 3QPKA 1HSAA 3N2JA 3E6HA 3B9DA 3MRQB 5F9JA 2IC2A 2MPVA 1QLRB 3FQUA 5E4EC 3G9AB 5AWNL 1JGEB 3TZVC 2CDEA 3BAEL 2IPKA 3FCSB 4EUPB 4HP5A 3C60D 3KLSA 5F7BA 2J5LC 3SE3A 1JPSH 2WSDA 4CNIA 4XCNB 1RULH 2VDLL 3KXFB 4P2QD 3BKCL 3QW9A 3SN6N 1U4EA 5T5NF 4LASL 4Q6IB 1E8YA 4LESA 5E2TH 5C08E 2FQEA 1CE6B 3DX1A 4QNPE 4IHOB 4TVSa 2NXZC 4NAQA 4W6YB 2HLAA 1BZ7A 1U33A 3ZBMA 4MAUL 1OSPH 2ZUXA 5SX4I 4DK5A 4XO5A 4M7KL 1M7DB 1X5HA 2ITDA 4F58L 3NCJH 3JWOH 3E7JA 3QZOA 1NMAH 5FHBH 4JG5A 2WLMA 5DRWA 1YYLL 4M00A 2V3EA 4FTDA 2YKLH 3VFOB 5BJTA 1DCLA 3S96B 3DX6A 2FBJH 2EINB 2Y69B 3VDAA 4O9HL 4UWQB 4MASA 1JYWA 3L7FB 5IW6B 4JUSA 5A16A 4ZDHB 5LBSA 1IAOB 1R4XA 3HUJB 2Y3NA 4LVOB 5HGHA 1NM9A 1BVLA 3OVUB 3KWWA 4QHLB 1WFUA 5IVOA 4GMSL 4QXGL 2BW5A 1DVTA 2FJGA 2LABA 2C1PA 2F7OA 3UP6A 2EJ1A 4IHBA 2KMWA 5HHNA 3HS9A 3VWKB 3BKJL 4UMGA 1OGPA 5IJKA 3RPBA 3RZCD 1QUNA 1WSST 4GXUM 5C86A 1S7WB 1B0RA 5A2FA 4EQ2A 2G4EA 4PRAB 1CZ8H 4OZGE 2OA9A 4BQBA 4K23L 5TH2A 1OM9A 3KWVA 1URZA 2K7QA 3ZZLA 5KVEE 3SGJA 4D9RE 3CSYB 3ME0B 3M88A 4P3DB 5IB1A 1DDHA 4MVBC 1T03H 3I9AA 4TTDC 1ID2A 1QLFB 4X4YA 3TZVA 1I3RB 1G0YR 1NGWB 2E8YA 2R2EA 4WW2B 1EO8H 3P4LA 5F97E 2F8IA 2CZNA 2H1XA 3JUYA 3P54A 5DVOA 3NZHL 2EH8L 3K6IA 4LSTL 1TLMA 2DIJA 4FQ1H 3SYPA 3WTXA 3CHOA 4HK0B 4XPFL 1BZ9B 4JDTL 3VGAC 2NCEA 1T1YA 2GK0B 1YLBB 1JK9B 1FL6B 3QORD 5KTEH 2PTTB 5IHUL 3P3UA 1J05A 2K45A 5IREA 3HI1A 5DHYA 2LLNA 5DJYB 4M5TA 1M57B 3GC3A 1Z9MA 1IBDA 4O51B 3CX5J 4A2LA 4AK1A 5J4MA 2BCMA 3WJMB 2EDEA 3FTWA 3PWJA 5AOZA 4OBRA 4ANXA 1DJXA 3ZR6A 4K9EH 4Y0GA 4MS6A 3UC0L 4ISVB 2A6DB 2V17L 4JFYA 2VUYA 4XMUA 3WU1A 3WELA 1MFNA 4YHPA 3JXAA 3UP1A 1FI8C 4BWUA 5CLYA 4F92B 4WTXA 4R7XA 3NJJA 4JDVA 3RY5A 3SBQA 1CWVA 2O26U 4KK9D 2WBJC 1AY1L 3FCUB 2VXSH 2ZOKA 3N44B 4O58H 4BSVA 3ARUA 3ECBA 4WSJA 3SDXF 1RZFL 3FAXA 3QEUA 3UYPB 4G1EB 4LVEA 4WJKB 4YE0A 1WHOA 4IOFC 2OPCA 3H2QA 1RHFA 1VPOH 3BMWA 4Y4KA 1KBBA 1MCJA 1MCBA 1BZEA 4V1DB 1S9YA 3F05A 2NUTB 4WI3A 1I9JL 1LK2B 5BS0B 1T1XA 1A6VL 3ILDA 3GI9H 2OYLA 1PYWB 4G71B 1S7VA 3F5WA 2A6IB 3SE6A 2ETWA 1T6VN 5IESH 3PGCA 1PZ5B 1R3IL 2W65A 2MRYA 2BP5M 2VLME 3F85A 4D94A 4R26H 4X9IA 5I6OA 2ZXDA 2WC7A 1DLHB 1F4YL 2YA0A 1AQDB 5IR1A 3R7RA 4YWGL 4LHQB 2RA1A 1JZ7A 2DY2A 3EJYD 5BZWB 1E3XA 2F54A 3W9EA 1Z9OA 3EO1B 1HL9A 5EC1B 3M17B 4DP5X 5MEOB 1HHHB 3LZOA 4PLNC 3GKZA 1SJEB 3H7BA 4K8RH 5GRVL 4G9FE 3P9WB 1E8WA 4K2UH 1U2YA 4DW2L 4ZX6A 2EDKA 4F15C 4FXGB 4MQ7B 1E5BA 5SWSD 3BT2H 2GJ6D 2OMYA 3D85D 2F58H 4PS4H 4CU7A 2QQLL 3FH8A 4PJAB 2APXA 4Z7AA 3ZTJH 4UOQA 4MD4A 2BVYA 2VL5B 1MEXL 3KLDA 1ID5I 3TURA 2JXMA 4HPOH 2XTSA 2QJDA 4KK6D 1MJ8L 5T1KA 4KZDH 1AD0B 5LG6A 5AYTA 1USQA 4D2NA 3DRQA 5ISZE 2DQUH 1E9QB 3ABGA 3IXAA 3TYFA 4MWFB 3VXRB 4ODVL 5LBGA 5D71H 1OIOA 1W16A 2WBJA 3GMRB 5HP5A 3O8XA 1YPZA 3MV7A 4NAJA 5I8KH 2O61A 3F04A 3NSCA 3H85A 4O02H 4OLYH 5E6RB 4K7PY 4W4OC 1L3NA 2A77L 3HA0A 2QHRL 5D7HA 1J0IA 4QRPD 4QXWA 4MCYA 4E36A 3IU3A 5FYJE 4XO8A 3WMPA 4NRXA 2E6QA 3TH2T 3MOAL 4HKBB 4P5TD 1TLKA 4PJ7A 5CN2A 2HMIC 5FC9A 4LCYA 5HYSB 3MLYL 3JT0A 5FO9A 4WZ9A 1ORSA 1SDDB 5JLZB 1CD9B 1TZHA 3OBAA 4I89A 1KYUA 4NKDA 3BAIA 2Y7OA 3KW8A 4NM8L 2QKSA 4XMLL 5D6CB 2ZUYA 3NDYE 5FUZH 4JHWH 5TDOA 3GLZA 1INQA 1OGAA 4XWGL 3UDWC 1DQKA 5EORH 3RL2B 3R8BB 4FNLL 1KXVA 5DQJA 4PYHA 2DMGA 4JO8A 3HJEA 5I1LA 4JFFA 5LBSH 4GUCA 4IJTA 2R9HD 1YY9C 3HFML 3OJMB 5ICZA 1XIWB 3QCUL 4XE0A 4ES8A 3BP4A 1V3MA 3NJLA 3QUMH 4JZJB 1HZKA 4AVKA 4OLZH 1ZVSA 4PS8A 2I24N 5CJ8A 2FZ3B 2UV3A 2C3WA 4JN2B 3OM3B 4QTIH 2C4XA 3APFA 3IFPA 1WEJH 4JPQA 4L4JA 4OCMC 1OV8A 3R8QA 2EVFA 4OGAD 3U1QA 1T4KA 2WXRA 3EGSA 1W0WB 5KANI 2R1XB 2J88H 3WXWH 1OTSD 3QUGA 3OKNA 1Q9WB 3ULUD 2EAEA 1XFPA 1A4AA 4HVBA 5HJDA 3DRTB 4PG9B 5HJGA 3MRHA 4EIGB 4FKEA 4UT7L 5CBEB 1NEUA 1GZHC 3VFMA 5BPPA 4HLEA 1JWMB 3O45B 3EUDA 5IW3A 4G80B 4FXKC 1IU1A 2ARJB 2VDRL 3O6KH 2C7UA 1A14L 5E23A 1EMTL 3UEZA 3LXBA 2YPLE 1UACH 1I8IB 2C3GA 2HVJB 4NRZA 2WOBA 3ESVF 3MLRL 2ILLA 1LP9B 4BQ8A 4FFVD 1F4XH 3F00A 4U1KA 4W6WB 5ERWB 4P23C 4W4OA 4LEEA 4KGJA 3NPSC 5ECGA 2VH5L 4QRTB 5DRXA 5E5LA 1X7TA 4XP9H 4FQ2H 3U9WA 12E8H 4M29A 4MXVF 3DXAD 1TEFA 1DFXA 4L8BA 4TQEH 1UASA 4EBQH 3KPSE 1PY0A 3KPRB 2FDBP 4JZOB 3ARZA 2ADYA 1WH0A 3PV7A 4HIQA 3OG6B 4KHTH 2VXTH 4X5PA 5L6YH 4WHCA 3IJEB 1EUUA 2YAPA 4PS7A 4LEOB 1X5FA 3NFSL 3AS2A 2YD5A 3JZ7A 5HI4D 1P4BL 1H6UA 4NS0A 2IJ0C 5IB4A 3HG1D 3RKDC 5D1XA 3A21A 3N91A 3UDWA 1YNKH 1F58H 2P5EA 4S1QH 5DZNA 4U4IA 4MJ4A 2IDQA 2WO3B 1WISA 5FX3A 1UXLA 2E5EA 2VQ4A 1TTUA 2WSPA 1DVUA 4HSCX 3P9LA 3HR5A 4N2MA 5CEXB 1DBAH 2H4EA 3CV5A 5B8CB 3G6JA 3WKQA 4PHXA 4XOAA 4F7PB 4PWKA 5FFGA 4J39A 3AG3B 1L7IH 2VDKL 4E41E 1PMYA 3H42L 3NAAH 4HJIA 5DMJB 2FX8L 1UJ3B 3BQUB 5I6XC 3K6SA 1F6FB 1LHZA 3BVVA 4LDLB 4I4WA 4X7DC 2DTMH 3BZFB 1BD2A 5KSVA 1LNUA 3RIFK 5GZOD 1T7ZA 1LDPL 3MA7B 4IIQB 1QEXA 1B4JL 3F3HA 4QF1A 4LSQL 1LMIA 4MYWB 4RZCA 9PCYA 4FNSA 2GPZA 2X4TA 3OKEA 5I2IB 2W59A 3IMUA 4PJXB 3VXRE 5I6NA 1GZHA 2F8OA 4FC3E 3Q3GB 4WLCA 3GSNB 3QWQB 1RJYB 2G9KA 4FXKA 3CUPA 4YLCA 4RETB 1T1ZB 1OAXH 4L8DB 4K3EH 4QHKI 4P4RB 2IADB 1GZPB 2Z9TA 3OF6A 1JNHA 4NUMA 3WI9A 1KPUB 4UQ2A 5MHSE 3IKKA 3IMRA 3L7EA 4LVNC 3TBYB 1S7XB 1XB3A 4G6KL 4XVSL 4D3CH 2CHWA 4PJ9A 1K9TA 1KPRB 2WGNB 4P23A 1A4JB 2CLZA 4OGQC 4GINA 3ORJA 2AKRA 2LW3A 1KBPA 2ICES 1CDYA 4PAZA 4XB3A 3AU1A 3TN0B 1HU8A 2DWXA 4N2OA 3CVIL 4DKTA 1KCKA 1GKEA 4R2GC 3DA0A 1GSKA 3Q1SH 4JY5L 4MD0B 4XNXH 3H2PA 1O6SB 5DC0A 2ZUTA 2GJRA 4CN6A 1HL8A 3IJYA 3QJHA 1T3FB 2D7QA 1DN0B 3RWGA 4FI7A 2NY5L 2B8OT 3I75B 1EDQA 3NJNA 2HKHH 5IG7B 4BA0A 2LT9A 3WHXB 3WUZA 1XL4A 2Y6TE 2UX6A 5FYLD 2H41A 4E42A 3D25B 3NCYS 1L4IA 4B9FA 1EJ8A 3LN5A 4M4RA 3FSZA 3GSNL 4GRMA 4IDLA 2FYYA 1SDAB 4OKVB 4ZMWA 1OD7A 4O5LH 2WLIA 2XVBA 4L5FH 4QI3A 3BIAX 3B1UA 3V6FB 5AZEH 3QXAA 4JKPH 1MCOH 4N5EC 4NQDA 4LPTA 1NINA 3OB0H 1JMXA 4UDTA 1RK0B 3TWCL 3KEHA 4F7EB 2ZSVB 2Q86A 3QWOA 2G9HB 3RVTD 2XV3A 1N59B 4YL4A 3R18A 4HUWA 2GI0A 3H9SD 2CO7A 3MLZH 5JORA 3H3PH 4YJZL 1E5UI 1DQLL 4HSAC 4P48A 3MUY1 3WLBA 1LP9E 3CVBA 1GZQB 3CSPA 4HCFA 3KPOB 3C5JB 4LLYA 3R0NA 2FD6H 3V10A 4E2OA 1X9UA 1GJIA 5IKCA 2ICWI 3FFDA 1OSZB 3OZKA 4WJ5B 1ETB1 5IVZA 2IALB 2YLKA 3RIAK 5LAXA 5EN2A 3IAPA 5J06A 2HFGL 3ARED 1SJHA 5DQ9B 1NQBA 2VDMH 4XR8C 1ZE3C 3S35H 2XXFA 1UVQA 2DWSA 4XXDB 2ICEC 4RNRA 4KNQA 2XWBA 3X1BA 2J55A 4NZDA 1KN2H 1XF4B 1XT5A 3PS6A 4EN3C 1F1AA 5C0RH 4J12A 2GHZA 2FNWA 1I3VA 4QGTA 2EZ0C 4MDIA 4OFKA 4M8QA 1G7IB 2CIKA 4WFHD 1WFOA 1EO5A 3CVHL 1AACA 5KYWB 4ENEC 4JG0H 3V5DB 1SXAA 3QFDA 5J12C 1QNIA 5GSVB 2WXIA 2YC1B 2DL2A 4AMXA 1QNZH 1A1NA 3RWIB 3UTZB 4LOUC 3L4VA 1A7RH 4UNVA 4AEHL 1CGSL 2NZIA 2ZYRA 4MMYB 4Z7WE 3ABZA 2WCSA 2PPEA 2J8UE 3ERXA 4XZUB 5BOJA 3G6DL 1FVDA 4I5BB 3MN8A 5F7EH 2WKLA 4XVUD 4HYTB 5E8DL 2X4OB 4XNZC 1GSMA 3VI3F 2GUOA 1IBGL 1M42A 4IKLA 5SX5K 5HHXH 1MFCH 1XB6A 4DKDC 5M95B 1VLXA 5GGTL 1RKRA 3DBXA 3B9KA 2X7LB 4HJJH 2YAEA 1GGTA 3K0YA 4PJXE 4AVHA 1GJUA 4LNVA 5T1DL 1CO1A 4NO0A 5EPMB 1I1AB 3BQVA 4QHPA 2WWNA 3BX7C 4GAJH 4GUPA 1HZHL 2DM2A 4PRDB 2V9UA 3U4EA 4JFPB 3FONB 4P4KC 4KNTA 3G5WA 3M46A 1HI6B 4ODUA 2RH0A 1PQZA 3QC5X 4G2AA 1KYOJ 1KJ2H 1GRWA 4HV8A 2IAMC 3SDXA 5GS2D 4GRLD 2YD8A 4FFTA 4KI5D 3EOTL 2J3SA 5L88L 1WO2A 4FZEH 1YEEL 3KW7A 2AQPA 3VG0H 2ICEA 2Z34A 3QZWA 1J1XL 5ACLA 1RH8A 1MVUB 2ZUSA 3QE5A 4S2SB 5AOMA 4JMXA 4JO1H 5EZJA 5ESVB 4EN3A 4UIMA 3IVKB 2GCYB 1W2KT 2RGSA 1DQTA 4HZAA 5D1ZB 5HI3C 1ZWIB 2H1LM 4G70B 4YBQC 4ZX3A 4RA0C 4JHZA 4HZ1A 5EOQH 4WNQA 4R7NB 3D4YA 2VUOA 4B50A 3WAJA 3UJIH 2Z35A 4AKPA 3A6OA 1QKZL 4FG2A 4U6HA 2Q8AH 3QDMA 1AR1B 1GYAA 3WFDH 1P5VA 2QKIA 3AADB 2Y6SD 4PJGA 5MENB 4UMSA 1P5UC 5DUMH 1QLEB 4OFDA 3MV11 3DETD 5FCSH 5H4ZA 1NFDF 1MQ8A 4H8UA 2EYRA 2C34A 2BWQA 3X11A 2G2NA 1C5BL 5F9OL 1IGTA 2NY6D 1FO0L 4YHIA 3WSQL 3HAEB 4L3EB 4KTEH 4GRWF 4NJ9L 4ABVA 2FJSA 2HJKB 4ZMZA 2K8QA 2HUEA 2DM7A 1AS6A 3BH9B 1F3DJ 3ZTNL 1BAGA 3FAWA 4KJWD 2V9RA 1XVSA 4IRSD 3QNYB 5MERA 2AABL 4YHZH 4U1HB 2CBOA 3TBWA 3GWJA 4DQOH 3PAVA 3LQAC 5J8OA 1G7MA 2F1EA 4ZFZB 1MIEH 4K7PX 1REIA 2PW1A 1IARB 4ZUVA 4M3JA 1A9BA 4WUKL 1LEGA 1M2VB 5E2VL 2XCMC 3NYKA 4GEIA 2Q76A 4KROB 2A6KA 1RUQH 4B9YA 2D3LA 2LOEA 3BD5A 2R23B 5ESQA 3UMNA 3ZL4L 3IJHA 3D39B 2A4CA 1O7DC 3K2KA 1UH2A 4B9ZA 3D34A 3DGGB 5G2NA 4AIXA 1CG9A 3X3GL 2NW2B 2EO7A 2O5XH 4PREB 4LGPB 1EFQA 3QAZB 3ESOA 5D7LB 1FVEB 1S3RA 4UTBA 5KS9B 1QLEL 3J8F7 1CU4L 4Z7UB 3QFJE 1X4ZA 2EH7H 4IBZA 1BBJA 3OGCB 1Z9SA 4WWKA 1D5RA 5FW8A 3NP4A 3FZUC 3GD1C 2VZUA 1E4XH 1TPXB 2IXQA 4L4VD 4M56A 1C16A 3ZDZB 1NGQL 1KB9J 1NFAA 2OJZL 3RWHA 5E56A 2I9LB 3OXSA 1NCHA 3W82A 4RFEB 4L9LB 1RZIA 3FQNB 2R0KL 3RTQB 3AS1A 2HT2D 3FB5B 3FRPB 5EU7C 4EDXB 2JJSC 2PP9A 3OL2A 4S1SH 3IN0A 4YEFA 3BPOC 5C3TA 4WW1A 4X8XA 5IMLA 2YRBA 3GBMH 4LGRB 2EXYD 4KKQA 4QMEA 5F0JB 2J71A 2P80D 5IB5A 1L6XA 1TQVA 4Y2OA 5I1CL 4PP1C 1TTBA 4AENA 1IQWH 4TTGA 4YQXH 1BEYL 3NZ8B 1QHOA 1ML0A 3HKFA 5EU3A 3V0DA 5E08L 4ZFFB 2XFXA 3CFQA 4U05A 3PWLA 2WJ7A 5CKAA 4NQXB 3IMTA 4AUJA 5KVFL 3PXJA 4FYQA 4AYDC 3G3LA 2BCKB 3VWJD 2QQNH 3N41F 1OAQH 2O5ZL 4D9QE 4Y1AB 5I15L 4G8GE 4NAMA 4DEUA 3MLTA 3BPCA 4NQEB 2GTWA 4F57L 1JZ2A 4OCRH 1XV8A 2YJLA 5IMMB 3J07A 1HIML 4KKCD 5FIEA 3TIDB 3LN9A 1MH5B 3SDAD 2DWDA 1E9OA 4FFYA 1KNOB 1UZ6F 2Q7YB 2XI9A 4UT9A 3K0WA 4NOBA 4AL8H 2EKJA 1IAIH 3WFEH 5C0CB 4N2LA 1IE4A 1DQJB 4DP0X 4HJ0C 4FQXD 5IFAL 2HJFB 3PABA 4W9JC 3VD5A 3QDGD 5HVHC 3MDJA 2W9EL 2UY7A 5I1EL 3QXDA 1D5XB 1G7JB 1T5WB 3IDYC 2ZXWB 3VGEA 3IKCB 1Y0LA 3SGDH 1HT6A 1NUNB 3HKZA 3BKMH 1EAPA 4JEGB 3GMPA 3ZDXF 3B9EA 1QSFB 4ZSOE 5ESAA 2F5BL 2QPEB 4WWID 1Q0XH 3EAKA 3K2UH 4P5MB 4X9FA 4F8TA 2B5IB 4M7LL 2FGWH 4UB0H 3VFTA 1J5CA 4G8EA 2Z1PA 1KMGA 4RDQG 3VRLF 4JFWA 5I19H 4R7DB 3WE6B 4X9HA 4F2FA 1MHPL 2AV1B 2R1WA 1MHEA 4JREB 3AWEA 3Q5YA 3FFCD 4H0LC 3KH3A 2HRPH 4KTDH 4NNPL 2AERT 4JFXB 1FG9C 3PJNA 2Z8RA 2CU9A 1RCYA 3LKRA 3G04B 3L6FA 4Z78A 2GHWB 2WIMA 4XNYH 1SY6H 5GGRY 3ZDWA 2JLPA 5E5UB 1JS4A 3SBWA 4IBWA 3LXUX 3K7UA 5IF0B 2R0ZH 4KX7A 3HS0C 1K6QH 4MX7A 3IU4L 5DUPL 2EUVA 2Z4QB 1WAAA 1ZE3H 4NP4L 4ONGL 2VC2L 2FEDD 3IDIA 1KG0A 5D55A 3ZDYF 3U0PA 3K2MC 5GJSH 3IBOA 4W1TA 2YGPA 4LAQH 1P4IL 2E7CA 2PWFA 1WBXA 2JMRA 5C0IA 3WIFB 2ZCLH 4JFZH 1NWOA 2W95A 3TJPA 4PGCA 2UZXB 2OV0A 3ABLB 5LNGA 4DP7X 4FTVE 4X6FA 3S34L 1HHGA 1P7QA 3H0TB 4PJ8B 2OMXB 1QSEB 3D39E 3KPLB 1PLGH 3E2HC 4WUUD 5KVFE 2OZ4L 4JM4L 2NX5B 4MZRA 1JDCA 1DO5A 1XF2A 5DU7A 2DI7A 4YHYC 1BFOA 2ZYIA 1N12A 3JV6B 2GFBB 2VDQH 3DYMA 1A3RH 5M7QA 2NR6C 3QO1A 2G5BA 2BVPB 3ZZSA 3FH7A 1A6TA 3KM2A 3D07A 4OFPA 2ODIA 3FUDA 3ZDZE 4NQUA 2OFQA 3O9WD 4PJEB 4TUJA 4JE0A 2W9LA 5IQ9B 3ASOB 3WFZA 4UV7H 3GM8A 3PGDB 1MI5E 5FKPA 1I3GL 1E27A 5C6TH 2A1WL 4HIHA 5EBMA 4JM2F 1CYGA 3RVUC 4F80A 4QHMA 4M61B 3GSOB 3D2UA 4HKXA 3FN0L 2DQFB 1RURH 4ODBD 3MRBB 5BO1H 1Z3GL 5C08D 2ITCA 1E4WL 3KCWA 4GSUA 3F12B 4L18A 4D0BB 1NCGA 1FSKC 3CZGA 3OWEA 2NY0C 2P7TA 4HUXA 3S88H 3EJTA 5E8NB 1WGVA 2QGCA 4WCYH 3JZYA 1FZJA 4MXQC 4TUOB 1Q0YL 3GKWH 1TQUA 4RLDA 4UYQA 4WEBL 4UINL 4OLXL 5E00B 2ZUQC 5EDXA 5GXBB 1AO7B 3IJSA 1FV1B 1AHWB 4UTBH 4Z0XA 1TEYA 1WRFA 1OO2A 4JDEA 4NKOB 3VM7A 3ZE2F 4A7TA 4BV1A 5AFAA 1SF5A 2P28B 4WAFA 5TJWK 5KZCB 4HEME 5HHQA 1FFPB 3FQWB 1NCWL 5E7FA 3WXVL 3U0WH 1FLRH 1CL7H 3GXIA 5JW5A 1JG9A 2DIBA 1HCVA 1QWNA 1BAWA 1FH5H 1IBHA 4LSRH 5CD5D 1XTMA 3JYBA 2G0LA 3FQ4A 4IS6B 2A4ZA 3B3BA 4BBWA 3WIHL 1EXUB 4OFQA 4X6CF 5D7JA 1HH6A 2XPGB 3NRQA 1QI5A 5BZDB 3LKPA 5FM5M 1HEJC 3OJDA 3OR6A 3B2VH 1DJGA 2ADGB 3U79A 2EO9A 2JKIS 3PWPE 3Q6GL 3SKOB 1JPTL 3HUJF 3PY9A 3G5ZA 4FA6A 4FABH 3LZPA 1UM5L 2VMDA 1DJIA 3GBNL 3L17A 1L9SA 4TVPD 3K6NA 4JKLA 3UTTA 1QSFE 1NM4A 1Q9KA 5CGYC 3VXSE 1MJUH 3KPMB 2O5NA 4OFYA 3SYOA 1OZUA 2N1TE 4EN2A 1EEQA 4XBEL 4RBPK 2H2PC 3UTQB 5CBAB 5G4MA 1KGXA 1Q9LB 2CCWA 3UGXA 3VFVA 3P11L 4OCYH 5D5MB 4UT6L 1N6QH 5E6IA 1LO0H 5I75C 1WZMA 1RUMH 2DEWX 2Y5QA 4PJBE 5ANME 5I8CB 3LQAH 1C8QA 1IEAB 1RPKA 1TNMA 1ZPUA 2DBLL 3ARBB 5DJ8B 4E0RB 1S7SB 1JFQH 4K15A 3S37X 4BE6A 1J9RA 2VZOA 2OBGA 3IDXL 4YDIL 3BCDA 2A73B 2OJEA 4NRYB 4FFYH 4HPYL 2B1HH 4G8IB 4CL7A 3FCGA 3LN4A 4UT9H 1YEGH 3WNKA 3SKJH 5DFWH 2P5WB 4WTZA 3VX0A 1E28A 3DOHA 4WW2F 4KZEH 3IS0X 3ROOA 2XVKA 1NJ9A 2DEYX 3GGWA 3SKMA 1BW8A 3L3IA 5AAPA 3VI3A 1NBVH 3TP4A 1Q9OB 4N8CL 1QABA 3ZQWA 1SGKA 3DX7B 4JX0A 1SN2A 4NIKB 5I0VA 1ND0B 5HD8C 3EYVA 5AKSA 4NT6A 4RX4A 3N40F 4FG0A 4AYGA 3W2DH 1KTLA 2RR3A 5IEKA 3QIWD 2YD4A 1QSEE 2G5RA 5EWIL 2ZCKH 5TQ0H 1F3JB 4M9OA 4AYMC 2JJTC 1BYOA 2N01B 3PFQA 3MRRB 2WZPD 3NRFA 1PJ9A 2NY1B 3UERA 1J0JA 3UO1L 5ITFB 3VI4B 4EE2A 3LH2L 4BJLA 3NGBB 2JB5H 1V7MH 4I0PD 1UB6B 1KCBA 2EABA 4M8RA 1YMHA 2P43B 3B6SB 4KVNL 1OE3A 2EEAA 3BP7B 5IK3B 25C8H 3WS6C 2FJHA 2F5AL 2BVQA 3N44F 2UX7A 1H8LA 1T2QL 2G2RB 3ASWA 2OP4L 2IANB 3CN0A 3KYKL 3P77B 4PJEE 2JKTM 4WFEE 1UWFA 2J4WH 5DO8A 4D0DB 1Y6KR 2DKMA 1KN4H 2VLMD 5KSBB 3Q6FB 1S6NA 2A0LC 5I73B 2Z7UA 1MHCB 2F6AA 1HJBC 4EOWL 4GW1B 4U3SB 2EYTA 3MNDA 5HY9A 1HQRB 3NSYA 4EMZA 4GG6B 5CJXC 1I85A 1EGJL 1QVOA 4ZS6D 1O7VA 1OP5K 4U1IB 4J8RB 3AXHA 2MCMA 4RWYH 3DUSA 2JKSA 1MCPL 3FHAA 2D2OA 1UZ8A 4G9FD 4KY1H 3CE1A 5KN5B 5D70L 3FMGH 4MNHB 4QHKJ 4XVTL 4YSSA 3GSVA 4HIPA 1NFDA 1N4XL 2GITB 4AZ8A 2N1KA 1BVKA 1TUPA 1MFBH 2XZZA 4LSSH 4G7VL 2X88A 5T1MB 2HA1A 4CADB 5FO8B 4ZOAA 1E4XI 3EJRA 2F8VA 1A6AB 4G5ZH 2G60H 3JBG7 3DMMB 5FA4A 3L81A 2NLJB 4X8JA 3VG9B 1DFBH 5LKNA 4N0FA 1IEBB 2Y1VA 1T7YA 4KUZH 1MREL 3CQQA 4LLDB 4PJAF 4OZ4B 5ISZD 2TSAA 4P0DA 3FB8B 1VGEL 4R97C 4XWOC 4Y4HC 2A9NH 3CFUA 1GAFH 4G1MB 4TUKL 4WWPA 3SOBH 3MRMB 3T8MA 1YY8B 5EC2B 3VWKD 2BSDA 4YX2H 1OF2B 1SBSL 4AJVA 3PWNA 4U1NB 1U93A 3LNIA 1IC4H 2GBTA 1ZTXL 1LILA 3PWVA 5D1QC 3W0WA 4ELMB 3WTWA 1YNLL 5JDSA 4PGEA 4OD2A 5CR1A 2J73A 2BDNH 3KL5A 4WHYG 1TQBB 1NCAH 3WS6A 2IMMA 1EHNA 3BZ5A 4ZFQA 4FP8H 4PPTA 2ZNXA 4LE8A 2PPFA 5J57B 2VQUA 5HYEA 2JJWA 4G8FA 3CFDB 4Z23A 3B2PA 4PVBA 3QYMA 1PLAA 2W07B 3VTTA 5BUGA 1BV8A 3NJVA 1HC1A 3WKPA 3QXWA 4FLOA 5EOTA 3SPGA 5CM1A 3DDGA 1OOAA 1G6RB 1XEDA 3WEXB 3VJ6A 2UXFA 2OTWA 3NESA 3VD0A 1IAII 3BAXA 3FH5A 1HOEA 1KV3A 1RK1A 1XSOA 1ZV9A 3O3BB 4FGMA 1KFGA 1MLBB 3O3AA 4JK0D 1JTPA 2WIIB 1IJ9A 1U3HB 1N0LB 2PYEA 3TNMA 1B6UA 1DE4B 1U8IB 2X3BA 5ES4B 1IGJB 3DTXB 1TJMA 3QG7H 1Y7VA 5KYUB 2ICWJ 1AQHA 2DQIH 3L3HB 4R5TA 4BRJA 4CSZA 1EVUA 4U1SA 1AGCA 1HESA 2Y1YA 4LL4A 1IKFH 3V5KA 5FDWA 3SGDI 4DESA 3FK3A 4E5XG 5IJCC 1SMOA 2QTVA 4L4VE 3BUTA 1JZ5A 1E5ZA 1SHMA 4X5WA 4QUOA 3RUGA 3X13A 1BJMA 1KTBA 4F7TA 3ATFA 4E9LA 3HMXL 3QI9B 1JZFA 4HWBA 3W39A 3CCHB 1VJSA 4MB4A 3ZRCC 5C3LD 1BSIA 3NJMA 3EBHA 3TNNB 1DBJL 2VMJA 3NACH 3MCYA 4OZFB 1AKJD 2AJ3A 4LP8A 3O4OB 4N90D 4MXWH 4A7VA 4QLRA 1ZJBA 3MROA 4Y4HA 4DP2X 1AIFA 3FN9A 1QBML 5HSFA 1LVEA 2BH0A 2HX9A 2N0MA 3SDCB 3N06B 1RZGA 2DJ4A 1RZJH 3Q13A 1A9EB 2HX8A 2IANE 3NCMA 1XH1A 3O6FC 3OSKA 3QH3B 4JY6B 5I1KH 4D0CA 1UATA 4FMVA 3SQBB 1H6TA 3IFNL 4QRUA 2C5DC 4HZLA 3TT1L 2DRUA 3KPSD 4DN4H 2QBWA 2EIDA 4R9HA 2BSBA 3I02A 5HDLA 4PBXA 4YHKL 4YSUA 2JSFA 3EZ8A 4QOKA 4GFTB 5FO7A 5FWQA 3KPTA 1TVHA 3MRKA 1ZTXE 5CHNA 1JIBA 3RE0A 3VXUA 2R4RH 2BJML 3E6FB 3N55A 1NC2B 2J8OA 4G6AC 2AJXL 3NCWA 3GTVA 2OTUB 4FNQA 4KK8C 1TSRA 2VABB 5DD3H 2G0KA 3GO1H 3ZPDA 1RUPH 1YAZA 2B1AH 2C4FT 2CKBL 3Q2LA 5CCGE 3S9DB 3HHSA 1JD7A 3HB3B 2F53E 5DQDL 2PWGA 5A7BA 2ZPKL 2HRLA 3LS5L 5B3JF 3EKCA 3WO4C 1T2JA 5C9JB 2AGJL 4UZSA 4E41D 4U33A 3VFWA 4YO0B 3BXNA 5IQ7L 2CHDA 1IM3B 2BVTA 5FF6B 4AM0B 2FX7H 2NY4D 2PLTA 1S7RA 2AJYL 4FFWD 4X7EC 3CH1B 2A3TA 2V3FA 2A7BA 5CWSB 5C0EB 1SVCP 1FIEA 2H2SD 5BXFA 1S7QA 4WU7B 5GIRB 2Z64C 1UXWA 4M6NL 1F2XK 1R5WA 4DEPB 3NABL 3QDJA 4H88H 2V7HB 1YQVH 1XWVA 2ZUWA 4PWEA 2Y5TB 3LIZL 4XNUL 1P6WA 1QATA 3T8VA 3VXRD 2D9CA 2C9UA 1A8JH 3BVDB 3J2PA 3UZEC 5ALCH 1JGLL 1KPVA 1FWXA 5HYJE 2CDGB 2AMGA 1BWWA 4IRZL 1MF2H 4JO4L 4RMQA 2VLRB 1RQ5A 4YOKA 2C3VA 2PW2B 4PGJA 4Z7QB 1GOGA 2VE6A 2BK8A 4GP8B 5MHSD 1SM3L 1EERB 5T3XL 5DFVD 5IT2L 1XBRA 5D2LE 5LWYL 5KSUA 1T5KA 1A2YA 2XN1A 1ZHBA 5I5JA 5CJ5A 3MCG1 2WVUA 2CO3A 1YECL 3HLAB 5IIEB 4ADJA 4LRNH 3O6FA 1YEKH 3VFPA 3PP3H 3BIKA 2AK4E 2PNDA 4UQ3B 5JOEA 3HC4H 2E7HA 4N6RA 4K3HA 1NPJA 4ADGA 4FYRA 3BDYH 1KT2A 2Z1KA 4MB1A 3GQFA 4GP5B 4HLJA 4M5ZH 4NC1C 5DVNA 3TASA 1CL7I 5J9PA 4K7PH 3DOIA 4G43A 1H8OA 5JQHC 3VDBA 3FO2A 3HRZB 4IRJC 2QFRA 3FSVA 1KJVB 3PQYE 4GKOA 4LLWB 4JL2A 5HDOA 3EOAB 1BBDH 2FO1A 2BNRA 4JRYA 3BW9B 3PG2A 1XIWD 1KTJA 4PBWD 3KR3L 4RGNC 1X3DA 1L9TA 3MACH 2F19L 2Z31C 3RKPA 4X98A 5DS1A 3O2WH 2HFFA 1PKQE 1T2XA 5H2BB 3EYUL 1IGCH 4KX9A 1XZ0A 4HT1L 1XD1A 3GB7B 5ALBH 3OKOB 3U83A 3PL6B 5I1IH 2VLKB 1YMMB 1DBMH 5F96H 2NY2B 4HGWA 3L5WB 3P4OB 1KIUA 4GSRA 4L37A 1DBKH 4XCNA 2AQ1A 3KXFA 3OQRA 4AIEA 1KULA 1UB5B 1EDYA 3UIZA 3QZWG 3ZLQC 5DEZA 4KKRA 1R46A 5IV2B 3U1SH 1E6JL 3FQRB 4XBPB 4YK4C 4LPWA 2Y7SA 1ZCRA 3Q1EA 2MKLC 4ZUUB 3V6ZA 3QJTB 2VW7A 4C56A 1L5GA 1R3LA 2AP2A 4RAUB 3HNVH 4OM0H 1UEYA 2QVTA 4O4YH 4Y9GA 2Y1AA 1MIMH 3UZEA 3LPFA 4B27A 2YMXH 3C5ZC 1I53A 5H94B 4EI5B 4R4FL 1NSNL 3EF7A 1TR7A 4HETA 4X6CA 1IGYB 5C0JB 3GI8H 4BQ6A 3UAAA 4IDJL 3H55A 4HKZA 4XVJH 3V0GA 4ZUTA 2YD7A 2HFEB 35C8H 4IGBC 4JPVL 4RFNC 4HX1A 4PRHA 2XOTA 3HZMB 2ORBL 1NLBH 2P24B 2BX5A 1GPOL 2R4SH 1EANA 2IOOA 3C60C 4I77H 3STZB 2RJMA 3ZE0B 4ZMLA 5BVPL 5EDSA 4GIAA 1ACYL 1P7BA 3GHBL 3HI5H 3UPAA 1CQYA 3A5VA 3APDA 3MX0A 4O2EB 1OM3H 1CI3M 1HSBA 3PP3K 1WFIA 4HWBH 5HGBB 4BYHA 5MI0C 6PAZA 2XKNB 5DFTA 4KQ4H 3QSKB 1BMWA 3KS0H 1AI1L 2BLFA 3LNFA 1ADQH 2EIMB 2Z31A 1C1EL 4YDKH 5F8QC 1ZDQA 3QIUD 3TCLB 2OMUA 2YMOA 3AG2B 4P9MH 3EOBA 4IOIB 2WLLA 4M1GL 4XMTA 4JGJA 2DI8A 1DVQA 1R3JB 3T5WA 2W0FB 5EUOE 2XN9E 3V5HB 3TEWA 2BXYA 2ESVA 3MJ7B 4KBPA 1MAJA 4XCEA 3CXHJ 1QPKA 4UQEA 2AJZA 3WHE1 4Y7OC 1OY3B 5C7XL 2VW4A 1DLFL 3WKMH 2OL3B 2PR4H 4QTHB 3EJJX 2PCPA 3LRSB 5EFIA 1FL6A 1IFHL 3O4LE 3S48A 2OXGA 5DK2B 3S5ZA 5F3BB 4GG8B 5L8JB 5T1LA 1CDJA 4PGZA 2RQ8A 3MAWA 2VLRE 2V5YA 4FQIL 1MHHA 1YAIA 4UV4L 4CMMA 4JO3H 3NCEB 1NKGA 2ZJSH 4GBXC 4KI1A 5DTFA 3C8HA 4NZTH 3C5ZA 3RZCC 4P46D 4F3FB 3G7TA 1QYGL 2P8LA 2CGRH 4L48A 4PV8B 2F2HA 5JHDB 3LZLA 4G3YL 1G94A 2E27L 1T66D 1NMCB 3N1PC 4KO7A 4ZS7L 3TN0D 3FTGA 1LDSA 4X6EA 1Z9PA 3WTSA 3IDMA 1OT2A 4NCC2 5JUEL 2FE0A 4Y4FA 2VITA 1ORQA 4K5NA 4IGBA 3RTLA 2VAAA 5IVXF 2R8SH 3IGKA 3IDGA 4OM1L 2Y07L 1JYXA 3D2TA 4AV0A 3MCLL 1FGVH 2YPVA 1UT1A 3C60A 3BAKA 2UZIL 1WCBB 2H6UA 1BAFH 3TJHD 5FCUH 5BVJA 4P2QA 4HQQL 3BSZH 2YUWA 4L4TA 4NUGL 4W93A 4Y19A 5ILTL 5LVEA 2LVCA 4HIXL 3CDZB 4NM4L 1Z2KA 2YD2A 4Y7MA 1BGXL 3STBA 3DJTA 4ENZA 5LLIC 1Q72L 1K8IA 5JO5A 1VGKB 5I18L 4MDJA 1SUJA 4LCIL 3O11B 3V0JA 2VLJB 1U8NA 2X4QA 3NTCH 4PRPB 3INOA 5GJTH 4NJAH 3PE9A 1UQSB 5IWLA 3KPNB 3A6BL 1DEEB 1KCVH 2WINB 4Z7VE 1X7QB 3IGFA 1FZMB 1V7NL 2HG5A 1EFXA 4QDGA 3K71A 3ARFC 3K1DA 5F7DA 2APVA 2W60B 1SOKA 5EZLB 4RAHA 1CPUA 3SKNB 3RJQB 1JPSL 1AOZA 4AQ1B 1GOFA 3BD4A 3Q01A 4P2OA 2WGXA 3ECQA 4IJ3C 4KK9C 5EU6A 5E2TL 1FNSH 2EKSB 3JSSA 4ICWA 2WMPA 3B83A 1TOXA 5HVGB 4F27A 2GSIA 4Z0BH 3B5HA 2LU5A 5B3NA 4YXLL 1S46A 2YBGA 4GBXA 4ONFH 1NMAL 2RFXA 2GT9B 1CLOL 1BYNA 5C07A 4P59L 2ZG1A 3GHEH 2FT8A 2MCPH 1R24B 3WTVA 3GLDA 4WTWA 2MQCA 2JE8A 2UYLA 3BGMB 4Q9CA 5ICYB 1VKXB 3MGAA 3RX9A 2DJSA 1S9WA 4PB0L 2E4TA 1C7SA 2ICWB 4R0LB 3ZE0E 3CSTA 3G5VA 4S0SD 1B9ZA 3QFJD 2FVNA 3ULAB 4HEPA 1FYTE 4A7SA 2X4SA 3CNKA 1UGKA 3EJYC 2I5YH 3KPQB 3RDTD 3HNSL 5FHAL 3SYAA 3QEQB 1G7LA 3KBEA 1DUYA 3KYOB 2HT4C 4OGYL 3DSNB 1KELH 1W72L 4JMNA 4JS7A 5LGHH 5KOMC 2ZX7A 5KUMA 4Z77B 1GHFL 5KS9F 5H8DA 2CWRA 4Z7UF 3KE0A 1HHJB 2JCCA 3V55A 1CZ8L 4PIBA 2DLIA 5I71C 1KCLA 2AEQL 1P1ZA 4O2CB 4TQHA 4X6DB 4K7FA 5C0ND 4RH4A 1ZLWH 3SDDB 2P8MB 2R0LL 1JV5A 1BXUA 1JAEA 1M7IB 3U2SB 1ULVA 3UJTH 3FT0A 1HHIB 3HS8A 2ENPA 2F0CA 3RL2A 4PGDB 2WKGA 4ORZC 3ARFA 3UBXA 3BZEB 1TKWB 2L8AA 3TA3B 2KYIA 1FNGB 1OGTB 1PL3A 1UXSB 3VXNA 3VXQA 1QX1A 3WMSA 5TK4A 3MFFB 1I1AD 4N8VG 4HK3J 3PIQB 3LEYH 2EDYA 2BM3A 4XC1H 3NJKA 5C0FB 4Y5VC 3H1ZA 4D9QD 1XGRB 4G8GD 3HPLB 1I7ZB 3DV4A 3JV4A 2GJZA 3S37H 3VSUA 4UOW1 2QGBA 2Q1EA 2D31A 1IFRA 3DSFL 3HVDA 3B7RL 3ZJAA 1YN7B 4Z7OB 1WZLA 3L45A 4P5TC 1Q1JH 4KJYA 1TZAA 4LKXA 3VD9A 1JK8A 3GHPA 5K9JL 3MQIA 3MLXH 1A65A 5LB1A 2X0UA 4J5VA 1UJTA 3QR2A 4HU8A 1F5WA 4JFEE 3T0EB 3X3FH 3DHJA 4M5YH 2ENYA 1PVHA 4EEEA 3PU7A 3X1GA 1KCRL 1F1GA 3QJSB 3D0LA 3ZZQA 2APSA 2GSGB 4XOCA 1QRNE 5TFSL 4OF6A 5D1ZD 2XN0A 5IJVA 2VXSL 5EEXA 1IO4C 2MCG1 3FOLA 3K5SA 2CJSA 3BWAA 4PMEA 2OMWB 2Y7MA 7PCYA 1TJHL 3KCPB 2BWIA 4XH2A 2A99A 3CLEH 3F7RA 5GGRA 5AZ2L 1II4E 3MRPA 1T22A 1I75A 1I1RA 3HZKB 4CKVX 1VPOL 4EQ3A 4WU5B 1LLAA 4PLKD 2V6HA 3N6YA 5KVDH 4JGUA 1Y6NR 1C5DB 4KVCH 5DRNB 4LMQE 4R5VA 2CDFA 1WHPA 4TLSA 1HSAB 3E6HB 2KPWA 2GJ6A 5F9JB 3FQUB 3D85A 4OGAC 3KLHD 1NC4A 1HE7A 1Q90A 5EEWA 2CDEB 2IPKB 5I82A 4U6VH 1RP8A 1IIIA 2FQGA 1KEMH 4L3ED 3ULUC 1TQSA 4W9EC 4CNIB 2YJQA 3I6GA 4PJ5A 3G6AA 3FYIB 1L6ZA 1U21A 4H13C 2XWDA 4YDLB 2BZCA 2GABA 4GOSA 3TX4A 2G30A 3T3PB 2X1OA 4I7ZC 5A2JH 1NPUA 1QW8A 4HJUA 1G87A 5CS7A 2HLAB 1BZ7B 3DJ9A 3GRGA 2YPVH 2V9TA 4K8RL 3T6QC 1HDMA 5SWQA 2ITDB 4OZIA 4Y5VA 1LQSR 4FFVC 4NKMA 5DRWB 5EEYA 1D5BA 4NHCH 4KH2A 4FTVD 4RSYA 2F58L 3DX6B 4PS4L 3BZFA 1VIWA 2BINA 3D39D 2HVKA 4P04A 1GS8A 1OEZW 5IB2A 4TV3A 1A4KA 4JGMA 3GNMH 1E30A 3ES6A 4P5TA 1OAKH 5A16B 4ABUA 3HE6C 1IE5A 1NLDL 5HYIA 3MV8A 3FDWA 3I9GH 2HLFD 2ZP9A 4OAWA 5HGHB 1BVLB 3NN8A 3KWWB 5D4JA 5DVLA 4BD4A 4WTZG 3NIGB 4BZ1H 3NZUA 4XNMA 4Z8FL 5HI4C 1ZS8A 2HPTA 2FJGB 3L13A 4YSOA 4QJ4B 3GEFA 5G5DA 2C1PB 1UURA 2DWYA 3QUYA 5HHNB 5I8KL 4QLWA 5CIPA 4FFZA 3TBCA 1QUNB 3BH4A 2BSTA 3BLPX 4OCWH 4PJHA 1NIEA 4Q6YA 4DO5A 4KO5A 1B0RB 3PREA 3EH2A 4IBUA 2WLKA 1D2PA 2JKNA 4RMUA 5TH2B 1TYRA 5HVWA 1JRHH 5I1JL 5IVNA 1U92A 4PRIA 1PF3A 4S0HA 2R83A 4BFNA 2B7DT 1XCWA 1A47A 1DDHB 1QFPA 2B2XL 3KYAA 5IB1B 2QLVB 1PZSA 2DQCH 3VQLA 2PCXA 2EACA 3H9ZA 3A4DA 5E4EB 5C0BA 4X4YB 2WLYA 3TZVB 4S0TD 2CGYA 2R2EB 4DUXA 5GZOC 4OCSL 3V0AC 1KCSH 4NXSA 5FUZL 1A0QL 5CLTA 2JI2A 5HYQA 4I87A 3B2MA 2K6ZA 2C9XA 1B0IA 2WTOA 5KVMC 1BM7A 1T1YB 4QWWC 3UYOD 1H5BC 1NAMA 4PJIE 2XIDA 2NXZB 4WI7A 2RALA 3EO0A 5J3HD 3FU8A 2QT6A 2YFOA 3D9AL 1CF8H 1J05B 1CICA 4N20A 1ET8A 4U0RC 5FK9A 4IKNA 5INCA 3RY6C 3HI1B 1VACA 5J1SC 5DHYB 3O2VL 4Q9RH 3QCTH 1VAHA 3T2PA 4LRIA 4KRNA 4QTIL 4AGQA 2WZAA 3PWJB 1LJMA 1DJWA 3Q2CA 5DZJA 1CIDA 3B7UX 4JFYB 1NOAA 4F5CE 5DJ2A 5ABZA 3CBKB 4PTTA 4YHPB 3KJ4C 4X2UA 2IBGA 4ZFOA 5GS1A 2ZX6A 2GAZA 2PMZA 4JDVB 2ZT9C 4LCWE 1LK3L 2WCGA 3HE6A 2YPKA 2ED9A 1NFKA 1DL7L 1P4LA 3D52A 3PHQA 4ZI8A 2DQGL 2ZOKB 4BSVB 1Z1WA 1N6UA 1UA6H 2MNWA 3VVWA 3ECBB 1QSFD 3UADA 1JV2A 1B2YA 3QEUB 3VXSD 2YD0A 4KXDA 2H8PA 1UACL 4GB9A 4Y4KB 3RFZA 3KGSA 4ZFGL 4P05A 1F4XL 1S9YB 4DGYL 2OR7A 1UCBH 1T1XB 2CUAA 2WBKA 1KENL 1S7VB 3F5WB 2RBLA 1BA9A 4FQ2L 4PY8J 12E8L 3PGCB 5TF1L 5TE6H 4LCCC 3TFKD 2W65B 4MJIE 4PJCE 2IH3A 3C08H 1M7XA 4Y9EA 4Z1PA 2YGNA 4EBQL 5D5MF 3ZT5A 1GGYA 4K5PA 3Q8CA 5L6YL 5IR1B 4A7QA 4DK3A 1UYWH 3ARSA 4DETA 3VD3A 2X2IA 4WI4A 3CFBA 1KY7A 5JIHA 2F54B 2FK9A 5DVMA 3W9EB 3QIBD 2PXYD 3RVTC 2ROXA 3WFHA 4HH8A 3LAFA 4IK7A 3T3PE 2WW8A 4U2ZA 4KUCD 5SWZA 2Y3AA 5I8EA 2HCZX 3Q2NA 3AWGA 3LTVA 3H7BB 4LO9A 4S1QL 5TPWL 5I6LA 5F1KC 5E4OA 3VGAB 4RGOH 4GFXA 3P2DA 4P2RB 1MFDH 1SUHA 3CZNA 3MBWA 5CZKA 5IFHH 4L3AA 1OHQA 1ZXQA 3IJ8A 2OMYB 1DBAL 2B4CC 4W70A 3RG1C 3QUXD 3S97C 1QSED 1CGWA 4JPWH 1EWHA 4MA8H 3G9VA 4CILA 5L8KB 1AXTH 2RCSL 2VR6A 2VSDA 3AREC 4OI8A 2DZEA 3VGBA 2GJJA 1AMXA 2R51A 4MD4B 3MRFA 5IHZA 2ZZUT 1CK0H 4NZRH 5K9KA 5JPNC 2EDHA 1PG7L 3NH7H 3QJZA 5JIIA 1IGMH 5T1KB 1FHNA 2OXHA 5JXAH 3Q44A 3WNOA 4NKIL 1AZZC 2R56H 4JJOA 3CD4A 5BOZG 1YJDC 1BF8A 3DRQB 1T89A 3IXAB 4Q97A 3TYFB 4TNWF 4QO1A 1LO4L 3NOIA 5IQOA 2WBJB 3OXRA 2O61B 2VGLM 1YPZB 1UA3A 3MV7B 3O8XB 4EDWL 4WFED 4G7RB 4NGHH 5TGBA 3VI4F 2NYYC 5IVXA 2VM9A 1NEZG 4Z95H 1AZCA 3J27A 5FS5A 4MCYB 2VDNB 3IU3B 3LQMA 5GGQH 3L4CA 4A6YA 4XO9A 1KYAA 4NRXB 2XRAL 3I74A 4JCWA 4D3CL 4PJ7B 1B4LA 2EICA 1N9PA 3OMIB 2P47B 5LQBH 3CMOH 4LCYB 3CDCA 5FO9B 2E46A 1TJGH 1ORSB 3Q8EA 1J9TA 2FO8A 4XVUC 3NEOA 4K71C 3WY4A 3US0A 4OIAA 3UEQA 3ULVF 1TZHB 4NKDB 3RWEA 1OAYL 5KSBF 2W0LA 1XH3A 4S1DD 3U46A 4XPTL 3SYCA 5TDOB 1INQB 1OGAB 4F37F 4LF3A 4LL1A 3AMLA 5DQJB 5I1LB 3REVA 3QQ4A 1JDDA 4GG6F 4JFFB 2VJ8A 4DUVA 5E8OA 1AO7D 4TL5A 3CVDA 5ICZB 2FJFA 3BP4B 4UIKH 4KITB 5FGSA 4R4BB 1IGIL 5HDQH 2VDMB 1EEYA 1ZVSB 4HCGA 4NQSA 1ITBB 4R90L 1U8MA 2DYRB 1CCZA 3IFPB 5A3ID 2B39A 5CZVH 5INDA 4DUWA 5CIPH 3OAWA 4FFZH 5IBLD 3MLPA 1C08A 3TPKA 3EGSB 4KV5E 4ODTH 4NUQA 4O5LL 4J4PD 4BXVA 3CFNA 4D7BA 5A43C 2EUZA 4GRLC 2VDNL 3OKNB 4KI5C 5T5FL 3EXLA 2HG0A 4HC1A 4Z5RA 1NCDH 5AZEL 1HOCA 4L23A 2QADB 1CYXA 1L7TH 4J3WA 2X4RA 3MRHB 1U3ZA 3KL3A 1G9EA 1UWXK 5HHPA 1P84K 2XY2A 1X7SA 3D87B 4PCKA 3ALPA 4OV5A 1RZKH 1KIPA 1EHXA 1UG9A 3GSXA 1BX2A 2VISA 3MLZL 5FAAA 4DT2A 1FG2A 4MA7H 3ULUH 3H3PL 3MMEA 4NRZB 5LCVA 2F7PA 3APNA 4U1KB 4DGVL 1YQ2A 5I1GH 2R39A 3VB9A 3B1TA 3VA6A 1TQCC 2FD6L 4HJSA 5FM5O 4DNLA 5HGAA 4ELMF 1NAMH 2WXQA 3ARBD 3C8DA 3MJ9A 1UOWA 2NW2A 4PUBL 1WIOA 1GGIH 1MSPA 2F61A 3FC8A 2Y6SC 3P0VH 2VDML 4FNRA 4ZPVA 4Q9QH 3S35L 3W37A 3DETC 5F7UA 2YQGA 5IHWA 4QRAA 1A6WH 4TS6A 4Z7UA 5DF0A 5ITBL 1ZGLP 4Y5XC 2CHXA 4NWUL 2NY6C 5C0RL 1J9SA 2MKWA 1F90H 2F54E 2N56A 4I88A 5IB4B 5EBWA 5D1XB 4GS7C 4ZT1A 4LARH 4K5OA 3OJ2C 1N8ZA 1ZIAA 2KZWA 2P5EB 4KJWC 4UAOC 4IRSC 1MW1A 1S9XA 2FQDA 4Y9FA 3HVNA 4JG0L 1U9KA 3MV9E 2QQKH 1G9NL 1N7ML 2HXAA 2WPGA 3K6DA 3P9LB 3HR5B 3Q9PA 4LKCA 3ZU8A 1QNZL 3P4NA 1VFBA 1QPPA 4NP9A 3GZPA 3IM1A 5JIPA 1SYSA 3G6JB 3QPXL 3V6BR 1A7RL 3CIQA 4YUEL 5HPMA 3UZQA 2YUZA 2YAFA 1FC1A 1HEZA 5TTRA 3SSGA 3S36L 2ZWYA 5JW3H 5E2JA 1M7UA 4AEEA 1FZKA 4NKQB 3K6SB 4F8LA 4I4WB 1BD2B 5KSVB 4J23A 1LM8V 4LLMA 1JSYA 1LNUB 3H8NA 4ANUA 4XN9A 4GRLA 5HHXL 3VRJA 1MRFH 5C0AA 5C0GA 1ZT4A 2OI9C 2X4TB 3OKEB 2X28A 1FZOA 4C4BA 4NQCE 5CR8A 1YPZE 3MV7E 2YK1H 3ARTA 2NZ9C 4FXKB 3CUPB 2QPSA 2IAND 1W8OA 2HYMA 5DC2A 2WXNA 2X3AA 5C7ZA 1MH5A 2GIYA 1JNHB 1MAKA 4UQ2B 4ZUWA 1QTPA 5HDBE 3L7EB 4PP2A 4AK2A 3P3YA 2NNFA 4PJ9B 4P8QA 3EJUA 4P23B 1ZGLM 2CLZB 5I1HL 1I8MA 1C8PA 1WBZA 4YHLH 2AKRB 2HT2C 3LHPL 1XGPA 4I18C 2AJSL 1YC8A 3AU1B 3IAGC 3F65A 3QUZD 3FFOA 3MNWA 4QKXB 1F02I 2AQNA 1M71A 2N4IA 3L5XH 4FZEL 3AB0C 5B4MD 2EXYC 1AP2A 3LDBC 1H3GA 3IKCA 4LSVH 4L3FA 1YVLA 4HF5L 4UILH 5B1BB 1OGAE 5SV3A 3PDOA 4XP6H 2CJUL 3IJYB 4Y5XA 3QJHB 2Q8BL 2ZWZA 3WEOA 3BUIA 1AGDA 1T0MA 1UHVA 5SV4A 1RLWA 3RWGB 3ZKXC 4EIUA 5D96B 4B9JA 1FGNH 4N0YH 1UUNA 3E1ZA 4J3UA 3A0OA 4N2FA 3WEAA 1I82A 5CCHE 5JIQA 4IRSA 2YA1A 3KGRA 1GCFA 3SPHA 4JFHE 3GK8H 3NT0A 3E1F1 1E4JA 1DVXA 3B43A 2WNGA 1S8DA 4E42B 2WUCL 3BN3B 1F18A 3MUHL 3LN5B 1G1OA 3DMMD 4KKAD 4M4RB 5AVTB 4P9HC 3B4NA 4GRMB 2FYYB 1CTOA 4KKCC 4URTB 2X2JA 2Q8AL 3UJJL 3NK3A 2WLIB 3WFDL 3CHPA 4DAGH 4TSCH 1BLIA 1JRHI 4JR9H 4NQDB 3VW3H 1MJ7H 2BRRH 4UDTB 3EH5B 5FYLH 3EJZD 1D5MA 1UWGL 3QWOB 4JRXE 4JPIA 2Q86B 3UL4A 4AQOA 4FQXC 4HUWB 2Q10A 4N86A 2CO7B 5JORB 2UWEA 4HCRA 5DRZA 1U6AH 4N0RA 2FSEA 5BOPA 1KLUA 3WLBB 5HXMA 1MIEL 3AC0A 4LLYB 2EDNA 4Y5YC 5DEGA 3FSAA 4OCNC 2AK4D 5IKCB 4XP4H 4L4VA 4Z7QF 5AVYB 3FFDB 5AVUB 5DD0L 5IVZB 4KOCA 3O0RH 4LVNB 4RFOH 4JG1H 5EZIH 2N0KA 5F89A 5LAXB 5EN2B 2CK0H 1RUQL 1SJHB 1DJHA 1V3JA 2BHUA 5E1IA 1ACZA 1R6VA 1AXIB 1UVQB 4H8WL 4RNRB 2XWBB 4I18A 3PQYD 2JJUA 1T21A 2O6FA 2GG1A 2AEPH 2B4CH 2BIIA 3ZTDC 1RZ7L 3MUZ1 2BVOA 4MDIB 4YFEA 4M8QB 2CIKB 1U3HD 4CRPA 2LLLA 3S6CA 3PF2A 4NX0A 2CPUA 3GM0A 5AW5B 2W0KA 1YUHA 2X6VA 3QFDB 4YBLC 1MWOA 2FEDC 3QC6X 4NBZB 3SGEH 3JWNC 5E94A 2G3MA 4CUCA 1A1NB 3T1FA 3U7YH 1I7TA 3Q8FA 4WKZA 1AZRA 5TE4H 1FYHB 1YJDH 3UBXI 3ZVVA 3G6JE 4PFEA 2CIIA 4BFRA 4XPGH 4ESKA 4XMVA 1MZYA 3FUKA 5JQ6H 2DYPD 2FEEL 5LCVH 3H56A 1FVDB 4XMXA 3MRBA 2IPTH 4DFHA 4LP5A 1QPXA 1NGZA 4HFUH 2QMKA 4W81A 2D73A 5FUCC 3WTTA 2GUOB 3BFWA 1D9KC 1I4FA 3U2JA 2PWDA 4UF7C 2FRGP 4POZD 1FL5A 5KBDA 1FNEA 3JYCA 4IU3A 3MJ9H 1W6WA 2P44B 1IQWL 4BRVA 3DBXB 3B9KB 2OK0L 2D3NA 3RWJA 1CURA 1EZVY 4RGMC 4YC2C 1Z9LA 3NA4A 1VSCA 4NO0B 4J3XA 4NKOA 3PLYA 3QS3A 3MRCA 1KIRB 4KO6A 5F2FA 4W9HC 2XQ0A 4GUPB 4L3CA 4KGLA 2QQNL 2XKUA 4YSCA 5GRJH 3ALWA 2VN7A 3U4EB 4WEEA 5AUMA 1K4CA 3CTTA 4Y5YA 1KCWA 2KI6A 4UQAA 4ODUB 4GI9A 1PQZB 3K6OA 1X9RA 3MTRA 5IBTL 3NA9L 4HV8B 3SDXB 4J3OF 4WFGE 4F9LC 2HRGA 1MG2C 2X89D 5F71A 5T3XD 1CBJA 3GJFA 3VFUA 1NC2D 4L1DA 3P3RA 4AL8L 5IEHA 1H19A 4OJYA 5DMKA 3VGDA 2ICEB 3WFEL 4AMWA 4CVUA 3C6SA 3QZWB 5IMOA 4G6FB 1T04A 4PS3A 4X80L 4EN3B 7PAZA 5EZJB 1KC5L 1T7XA 3HB3D 4C4KO 2ZKHH 4I13B 4UIMB 1CXKA 1X4YA 1XR9A 2B59A 3QJVB 4FNUA 5C6WH 5GS2H 4MRCA 1ILUA 3GUFA 2ZUVA 4NN6B 3BKML 3SPVA 2HUHA 3DGCR 2YOCA 3UTPE 1KBWA 4WNQB 1IT9H 1IM3D 5TE7L 1G9ML 2DMBA 2GVYA 4JFDA 3ARQA 1AZBA 4N1HB 1L9RA 2Z35B 5T33H 3K2UL 4ORGA 4UB0L 1ZT1A 3C9NA 5CINH 4U6HB 5D7IF 3LPOA 3QDMB 4C47A 3HBPA 2ZKXA 3VFSA 1P5VB 2QKIB 4ZXBD 1PPIA 4PJGB 1HL5A 2HAZA 1UM4L 2WP3T 5CD5C 1JPEA 4ELKA 1M1XA 4PG2C 2VDQB 3WMQA 2EYRB 4FJ6A 4HHGA 3X11B 3TCTA 3MHZA 2HRPL 4XNZB 1IGTB 3O4LD 4MB3A 4YVNA 1IILE 4YHIB 3WNPA 2V2WA 1BIIA 3I85A 1D9KA 2Z7ZA 4X6BA 4S1RL 4XNYL 5E9DA 2BP0A 1JNNH 4LVHC 3BE1L 2VLRD 2HVBA 1DQMH 4PVNA 2R0ZL 3P30L 3UOAB 3APMA 5MERB 4AJYV 4KJPD 1FPTL 5GISH 1PDKA 3TBWB 2J1XA 4LHUA 5KWYC 3CFTA 1G7MB 1SZNA 5EU4A 4AQZA 5SWSE 4YL9A 4LAQL 3GIVA 2PW1B 3P1VA 1SHWA 2WHVA 1XSJA 4ZUVB 1A9BB 5BMFL 1LEGB 1AJ7L 5C6PB 1JUFA 2Q76B 3WJLA 2A6KB 4YZWA 3Q5OA 2NSXA 5ESQB 1NGYA 1WQVT 3H6JA 3IJHB 3UBXG 4HWZB 4I1PA 2VQ1A 2BNQE 3TJEH 2AHIA 4U3CA 1FFOA 1GMEA 1PLGL 3FQTA 2F7RA 4F9LA 1FFNA 1KTRL 1CG9B 1ZVYA 5GZND 5B1AB 3BUYA 4DGIH 3BKYL 1MWAH 4ABWA 4KKNA 2CA4A 3T2NH 4KKPA 1GGBH 5DK3A 5DLML 5I5IA 1T6BX 1T83C 3IGUA 2F1AA 1A9VA 1BBJB 1Z9SB 4MAYA 4WWKB 1A3RL 4I3RH 3BISA 2GBVA 3QEGL 1OANA 4YLBA 1AAJA 1F0LA 1MQKH 3VTMA 2IXQB 1AGEA 4K9JA 4QRPE 1R34A 3MRDA 3PL6D 2EADA 4WHTA 2NY2D 3RWHB 3E8UH 3OXSB 1OAUL 3AACA 1OK8A 2A74C 2XZQL 2MIZA 4HCRH 1RZIB 3V0WL 5ADPL 1KJMA 2IO5A 2WM0A 4PWFA 4F2EA 1GIGH 3SDYH 2OMZB 1ZPLA 5DD5L 1ZHNA 5AYQA 5IMLB 4WW1B 3QIWC 4R6UA 2P49B 4ZYKA 5IB5B 1RURL 4HOWA 4Y2OB 3HN8A 4AENB 4KXAA 3P2TA 4KXBA 4DKFH 2K6WA 3MA9L 2WWMD 4KRPB 3RA7L 3FU7A 4MZIA 5EU3B 2XFXB 4Z7NE 5KBKA 5E70A 3PWLB 4EI5D 2HKFH 4I0PC 3FJTA 5I74C 4WCYL 4DP4X 3AZUA 2F68X 5K1NA 4G7SB 3AUVA 3CWGA 4PI2A 3DO7A 1P7KA 4Q9BA 2B3IA 2MH4A 5CD3A 2LU4A 1OLZA 4U0QB 4X9YA 3CHRA 3MLTB 3BPCB 2GTWB 4DIXA 4BUGA 3CIAA 3OSVA 4FG6D 2W5PA 2O5YH 1NIAA 2X53A 3A4AA 3MLUL 5AKVA 4H0IA 1RPQA 2DWDB 2X9WA 1I7UA 1E9OB 4UCFA 4XHQA 5I1DA 5BO0D 5F72S 1MCEA 3ZE1F 3AG4B 5I6PA 5DCCA 3B37A 4OD3H 1BOGA 1FYTD 3L3KB 3ILEA 4GAGH 2PETA 1SXZA 3AY2A 1OL0A 2WV3A 4ZS6C 4N1CA 1ZSDA 3PABB 2JI3A 2C9PA 3B9VA 4P9HH 3B5GA 2UY7B 2OSWA 5JHLA 3WTYA 3QXDB 1B0WA 2EDXA 3KDPB 4E9RA 1Y0LB 4FABL 4ZPTA 2L04A 1T83A 4Q0XL 1EAPB 2Y7LA 3GMPB 4ODHL 5F7AA 2F9BT 5ESAB 2FECL 1A6PA 1XCTA 4U6XA 1E65A 1UFUA 3KS0J 1MY5A 4XCCL 3T6VA 3VFTB 5AVZB 4G8EB 5EN3A 4YXKH 1PZUB 4YR6A 2GJPA 2K6YA 3QDME 5E99H 2ZYSA 4FRWA 3ZKMD 1AGFA 1A3LL 1G6RA 2R1WB 1MHEB 3QO0A 4HXBH 1MCIA 4X6DF 2A9BA 3BPOB 3HZVA 4JJ5A 4ACTA 3QIWA 3LKRB 3VACA 3BWUF 3L6FB 2RAMA 1ZVHA 4Z78B 5AKTA 4FFYL 4WKXA 1RHHA 2B1HL 2KHAA 1ETZA 4J8QA 1W80A 2WZPA 4UT9L 3GJFH 4J3TA 4MX7B 3SKJL 3LRHA 3VSTA 4A63A 3WAKA 1CJYA 2IVFC 2OSLA 3IDIB 1KG0B 3U0PB 1A3ZA 4OKDA 5D8JL 3CXDH 2IF7A 2BY3A 3VUAA 1SXCA 1INEH 1NBVL 2MOGA 3O0LA 4GW4A 4OIIH 1GS6X 1WBXB 5C0IB 3T1WA 3D69A 3K4ZA 4NN7B 4PGCB 2FT7A 1OPGH 1G4RA 4LDEB 1A7NL 5EULV 2OYMA 4X6FB 1HHGB 1P7QB 5HHVH 5E0QA 3JWNH 3I6LE 3ILQD 5AW2B 3CBRA 1B3JA 4Z7OF 5FB8A 1CIUA 3HE7C 4MHHI 1QRND 4K4KA 2BIMA 1CBVH 4NDMA 4AE0A 4NERA 1XF2B 4EZKA 3CFKA 2Y0SA 1BFOB 3ATDA 1AYRA 2WWOA 4M93B 1ZLVK 5DZLA 1U58A 3U25A 3UTSE 5HVHB 3QO1B 2G5BB 3B2UD 1KLFB 1A6TB 1NCIA 2YA2A 5KJ7E 1F00I 1E4HA 5BRZB 4G9FA 2MPAH 1N8OE 2EE9A 2VLJD 25C8L 5DR5H 4TUJB 1GYVA 4PRPD 4YH6A 3VO0A 2J4WL 1CGTA 4MJ6A 4XP5L 2YAMA 5FKPB 1E27B 3FQXB 3P4MA 1KN4L 5EBMB 1MNUH 3EFDL 1WWAX 4W9GC 1CS6A 4QHMB 1RJLA 3D2UB 2Y7NA 2ZF9A 2W9DL 1CXFA 5AEAA 1JZHA 2ITCB 1TTFA 3WS3A 3K4DA 5F7HA 5CEZL 5FR3A 1FH2A 3L4WA 1MCHA 4AE1A 3ESMA 2P7TB 4HUXB 4YE4L 1ZGLA 3S3JA 1RLBA 4HJGA 1ZOXA 1QACA 2D0HA 1FZJB 2HTLD 2O93L 3HS0B 4GKLA 1OQOA 2Z4TA 4M43H 5F7LB 2GY5A 2XYBA 2XPZA 3DX3A 3IJSB 3OKMA 4KZ0A 4XNDA 4Z0XB 4JDEB 5F7YC 1ODUA 1CLYH 4H20L 5JW4R 4HIIA 1WTLA 1P6AB 1X5IA 2XWXA 4KKLD 1JCKA 2BFVL 2C9VA 5HHQB 5JW5B 4ZNEA 3SGEI 2PKDA 4I1RA 3IFLH 4JM0A 2OR9H 2J1KA 2YFNA 5FA3A 1KSRA 1M56B 1TMCB 4Z3EA 4B95C 1TQWA 2ZP0T 4LPCA 1DFBL 4XMPH 5D7JB 1CR9L 2HB0A 3U9PL 1HH6B 3ZMRA 3LKPB 3E2HB 4YHNA 3OJDB 2IDTA 3OR6B 1KZYA 4UYPA 1IMHC 1SFDA 2XY1A 4UTAL 3HE7A 2FR4A 1DUZA 2J20A 3GINA 3H9SE 1N5YL 1GAFL 2ZONA 4BUQA 3SOBL 1CVRA 3G5ZB 5BQ7A 2JH2A 1J1OH 4MXVE 5JTWA 1KCUH 2DQTH 3FUMA 2EE6A 3HCVA 2YO3A 4YGVA 4CVWA 3NIGF 3OB8A 4N2NA 3UTTB 2ZAIA 3QEHA 5EF2A 4FXGC 1CQKA 1Q9KB 3LXCA 5F93C 2R0WL 1TZGH 1BP3B 4W68A 4N87A 5IGXL 3FO0H 1NCAL 2HWZH 4JFVA 5LXGH 3VFVB 4FP8L 2JFCA 2KKQA 5E6IB 1G9HA 2NY4C 1AZNA 5LJYH 4FFWC 4XXWA 1KYOK 1VZIA 1SEQL 3LH9A 2H2SC 3R4DA 4NZJA 2F7IA 3QGVA 5AQ0A 4M4PA 4JB9L 5KVEH 3TIEA 4MD5A 5KSAD 4QHNA 2IH1A 15C8H 2ERJC 2WUBH 2OJEB 4PJDB 3L4ZA 3O3UN 1ZHLA 2Y2YA 4OJAA 4U7SA 1BFVL 3LN4B 3N43F 1KZQA 3GS7A 3F64A 1TO4A 3NJHA 1QBLH 5GGSY 1FSKB 3D3VA 3FTYA 3K46A 1E28B 1BQUA 5EA0H 3V4PA 5BCAA 1AKJA 2NY0B 3D8MA 3ROOB 1NJ9B 3GGWB 3SKMB 3LRGA 2YPLA 3L3IB 2J6WA 2XA8L 1ECYA 2CO6A 3SKUD 3VQ2C 1U8OA 5DFVC 1PS3A 3F84A 4PB9H 3QG7L 3DO3A 4RISH 5JHLH 1H3TA 4TNWK 2ZUQB 2DQIL 3MYJA 1DJYA 4GH7B 3JUZA 3EYVB 3K6FA 1R1CA 4NT6B 1XMWA 1B6DA 2IGLA 3II1A 5CEZE 1KTLB 5AWNH 5IEKB 4ZTPH 5JOPD 4LCWD 4ZMXA 2AV7A 3KPSA 4K8RD 3SPIA 1VERA 2PCFA 4YDVA 2VXQL 1NBYA 4CC0A 2VDLH 5IMKA 3BKCH 1WS7A 1P4UA 5CU5A 4LASH 1WD8A 3SE9H 2XWZA 2ITFA 5FW7A 3HNTH 4GKSA 3ZHDA 4NXKA 3WLWD 1KB5A 1XIWC 1YMHB 5AVWB 3F7VA 1DQIA 2MWCA 4JZJC 1BJ8A 2AFNA 4Q89A 4MAUH 2Z92A 4M7KH 2VOTA 1GR7A 3U7WL 4F37K 4HA1A 2FJHB 4XB8A 4F58H 2BVQB 1UGNA 1SLVA 4OTXL 5DEFA 5EO1A 3TO4D 1RZJL 4QAWA 1S9KC 5E5MA 1YYLH 1LO3H 3NMEA 5DVPA 2G3NA 5IW1A 2V2TA 1WWCA 3EIFA 2FSDA 4Z76A 4ZK8A 2AZAA 3WYRA 4MJID 3KZ8A 5KJRH 4E41A 5F3HA 3CVCA 1AE6L 2IGFL 3KYNA 1R3HA 4BWTA 2BXZA 3Q2WA 1GW0A 2EYTB 5I75B 4O2EA 4POUB 5HY9B 3I50H 4RIRA 1TCRA 1EV2E 2GKIA 1QVOB 2KLSA 3OAZK 1JJUA 4QRSA 2KDYA 3I3BA 1X5MA 2R4RL 3DUSB 4APQD 4QXGH 1BHGA 3DPBA 1OW0C 3TM6A 4TNFA 1JWUA 1UZ8B 4M1DL 2PPCA 3EGDA 5D7IA 3UG4A 1XCQA 5E6YA 1U8JA 3IRCA 1JI2A 3BKJH 2FBRA 1HFUA 3KVQA 5EB9A 3GSVB 1NFDB 2Y2TA 4AZ8B 1BQLH 1BVKB 5CMAA 3VXTA 2ZSWA 1KB9K 4JFQA 1QEWA 3O2DL 2W81C 4ZZFA 2W8CA 5LHDA 2FX7L 5FA4B 1RIHL 4UOZA 2OL3A 4X8JB 4N0FB 3DVNA 4H88L 4FL4C 1YQVL 3S3BB 4H2AA 1LWRA 1JZGA 4PCSA 3NZHH 2EH8H 1DTUA 2DH2A 2WOYA 5ALCL 3HTLX 3BN9D 3PWNB 5AW9B 1G0XA 1U93B 4JDTH 4XPFH 3ELQA 3W0WB 1GYWA 3PWVB 3PAZA 3FRPG 5AG8A 3E38A 2EE0A 4GEJA 3UTTE 4PGEB 4OD2B 4A68A 1RD6A 3DVFA 2YEZA 4OSUL 4X7FC 1ZRUA 2H0PA 2R29A 3PHAA 1LO2L 2AK1L 2ENSA 4KPHL 4RCAA 3QIUC 4HLZH 4WVRA 5I0WA 2PR9A 3ZX1A 1GMIA 3TV3L 3UC0H 4NNYA 1FNAA 3RGVC 2AXGA 4G8FB 2V17H 1EHLH 2NY5C 5FYJH 1I3UA 1K8DA 1ZY9A 4PJ7F 1GYUA 2KH2B 4K7PL 4UM9A 5EOTB 4Z3TA 3K81A 5F6HI 4HS3A 4ZMQA 3VJ6B 1AY1H 1RI8A 2OTWB 2PABA 1T0PB 2NXZD 4JKWA 3DTDA 1RZFH 3DHUA 1YN6A 3CFEA 3O3AB 3VAEA 1F2QA 2PYEB 4R7VA 3MACL 3TNMB 4BZ2H 4FZ8L 3VI3E 3B2XA 1DEEA 4XN5A 4P46C 3VXME 1IGCL 4UDUA 5FFLA 4U1SB 5IQMA 1I9JH 3V5KB 5FDWB 3D0AA 3GZKA 1A6VH 1OCWL 1ITCA 2OS7A 4KMLB 4XMZA 1M9WA 1T66C 4X5WB 2X2YA 3RUGB 3TN0C 5A2LH 3X13B 2FWSA 2Y25A 4F7TB 3GMLA 3W39B 4ALAC 4HH9A 3VNZA 4BK5C 5F0MB 4DN3L 1GC1C 1WYJA 3BMVA 3KBFA 3U1SL 2R59A 5LXVA 4YWGH 1I1CA 4NCDA 3QJQB 1X4XA 2AJ3B 5CJQL 3VB8A 2H9GA 1NMBH 3IFOB 3L2MA 3MROB 4R97B 2XQYK 4FJZA 3TJHC 4Y4HB 3BRFA 1TENA 4PJBF 5A2AA 2EDWA 3KBPA 1AIFB 4Y4KD 5K9QG 5IOPA 1MIML 3QT2A 4N9GA 2YMXL 3LB6D 4AJ0A 1RZGB 4DW2H 4TNVF 2OJ1A 3OMZA 3V52H 5EZOL 5FOJA 4D0CB 3V4PH 1MCCA 3MGTA 1AS8A 2K3TA 4N28A 4U3XA 4QRUB 4Z7WA 4HZLB 4FNPA 2QQLH 2V5TA 1IQDA 4E9SA 2J8UA 3QG6A 3QIUA 2GW5A 3I02B 3C6LC 1VADA 1MEXH 4QOKB 1K4DA 3RGVA 5FO7B 3ZDXB 4AQEA 1H3XA 1TVHB 3MRKB 4XC3L 3QEQA 1MJ8H 5CHNB 2F54D 1ZA6A 3C8KA 3VXUB 3QDGE 3VM5A 3DHMA 2O6DA 1AZVA 1IEHA 2E7DA 3A47A 3HN3A 4ODVH 4PCYA 1JDAA 1MCWW 4NZ8A 4G5AA 3SY0A 3HHSB 3NCFB 4XAWL 4KQ4L 1M3IA 2VZTA 1YYMH 3AQYA 3N42F 3PNRB 2B20A 1OOWA 2A77H 2QHRH 1F4WL 1U8QA 1ED3A 1KB5H 1B4TA 4WO4D 3VFWB 4YVUA 3QRLA 2W91A 3BXNB 2NT1A 4GRWE 4JHVA 3MOAH 1WBYA 4P46A 1S5HA 1CGUA 2CJTA 5L4JA 3EJQA 1S7RB 7FABL 4XP1H 4HOXA 3OLIA 4PTUA 1A7PL 4KOBA 4PWGA 5BXFB 4IW4C 2G2PA 1S7QB 3JTSA 1DVSA 1TETH 3EGXA 1UXWB 5EOCH 3MOBL 3FFCE 5GS0L 1R5WB 3TTYA 3QDJB 2NUPA 1C12A 4XMLH 1J1PL 1EUTA 4BEIA 4EIBA 4BK5A 5CN1A 4XWGH 2WBJD 3O8XD 3MV7D 3IMBA 3CHSA 3AQXA 1KPVB 1I9EA 2R1YA 3RDTC 5BUPA 4G7QB 4XX1G 1O7SA 5L4MA 3VX1A 2C3VB 5CEYB 4DP9X 4KH9A 3A4EA 2WXOA 3QCUH 2X6BA 2VL4A 3CZKA 4BK8A 4JO3L 2YQ3A 4LLQA 5AW1B 1EPFA 3QHTC 5KSUB 2C7FA 4M6ML 1A2YB 1SVZA 3GPEA 5IFJA 1ZHBB 4M8UA 1E7UA 4OLVL 1E6OH 3MBEA 1ZSHA 4W4NA 4XNAA 2VRAA 1EZLA 3O6FB 3VFPB 2VUKA 3BIKB 2V5MA 1NWPA 1ROWA 2EP6A 4N6RB 5E5RB 2BP3A 3L4TA 5C0NC 4EXKA 4ONHA 2ZWKA 1R0AL 4WUUE 1KT2B 2ZUUA 3GUTA 3NCXA 2XVGA 4J1UA 3CVHA 2YN3A 1OGAD 3C6LA 5J9PB 1X6NA 8FABA 4G43B 3FO2B 1S5IH 3Q48A 4WENB 3L1OL 4UT7H 4NWTH 1MVFA 1NGXA 3GS4A 3DUUA 2BNRB 1I1AC 4JRYB 1A8ZA 3IS1X 4XXCC 4B7IA 1U8KA 2VDRH 3MGOA 1A14H 3D12B 1EMTH 4DPRA 4MTMA 2PYEE 4ODXA 1G7PA 3NJFA 4X98B 2HFFB 4IBYA 2WWKO 2E59A 2ZG2A 1XZ0B 2J1WA 3F62A 3BPNC 4A2GA 2VH5H 3OG4B 3WO4B 4HGWB 1KIUB 4M7LT 4NJAL 4L37B 5C2BL 4LBEA 2V8LA 2QADD 2R29H 4O02A 3M1CA 2BNUA 5K5YA 2UVEA 1XXDC 2XJKA 4JRXD 1B2WL 1CN4A 1ZT7A 4WNSA 2YWZA 2X05A 2VKWA 1HE8A 2D4DA 2VDOH 4G9DA 4U31A 1RV6X 4XI5D 4PW3A 3UC2A 3V6ZB 3ZE2B 1P4BH 1UT2A 1Z6JT 2AITA 4B97A 3WFBL 4C56B 1L5GB 3GJEA 1R3LB 3THMH 2X1WL 1FNSL 4GSDL 4F93B 3VTAA 3BOVA 3QFJA 4Y16D 3FU0A 4ZAKD 4DFIA 4F2ME 3FTXA 5C9KA 5HHMB 1UZ6E 3NIFB 4BXSV 3RDTA 4GXFA 3JWNG 3A6CH 4MZ2A 4X6CB 4NC2B 2YSSA 4LT7A 3U9UA 1F6AA 1SRDA 2YSTA 3IGAA 4HKZB 4PLKC 3GBDA 4YFLI 4ZUTB 1A1MA 2VDKH 3TGXA 1BPLB 3GHEL 5C09A 3UPRA 2KQNA 3P2BA 4K07A 3RWCA 3V0EA 4HIEA 4HX1B 2MCPL 4PRHB 3KLHC 2OKMA 3L3DA 3NK4A 1IAIM 3QUMA 4QOKE 4URKA 3ZDXE 2ED7A 1FORL 4NZFA 1PIGA 1LDPH 5DSCA 5LGJA 4HKJA 4DTGL 5I76A 2WNXA 5D1XD 1B4JH 2J1YA 2OW6A 4LSQH 5B3SB 3WDIA 3MX0B 1HSBB 1MAML 4LHUG 3T4YB 3VRLE 4TVPE 1HYSD 4XXCA 3QBTB 1ZLUH 1T7VA 4RGNB 3NCYP 4QYOA 4XCFL 3NBNA 4G6MH 2NTSP 2Z31B 5DJDA 3BJLA 4ZOBA 2ZG3A 4G8GA 5D2NA 2CO4A 4A66A 4G6KH 5EV7A 2OMUB 4XVSH 3RB7A 4XPHL 2XTJE 1WS8A 3EOBB 3QS2A 4MSWA 2WLLB 1ZV5A 4JO2H 1FO0A