2YRLA

Solution structure of the pkd domain from kiaa 1837 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1837 protein
publication title Solution structure of the PKD domain from KIAA 1837 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrlA01
1FNHA 3O6FB 3D25A 4JFFD 3SE9L 3VFVA 3E1F1 1P84J 1HOCB 1XGQA 5T33L 3AS1A 4Y19B 1ZLSL 3C60B 4LARH 5FA3B 5E9DD 1OT2A 2UY7A 3DVFA 5L9DL 3U46A 5EULV 5IFJA 4YK4C 4MD4B 3GJEA 5D4QA 1ZLWK 2DIJA 2P24B 3CXDH 3T2NL 1RZGA 4HG4K 3EFDH 1QEWB 1A1MB 2VRAA 3LEYL 1SBBA 1FIGL 4HT1L 4WW2C 2RBLA 2HVKB 3PDOB 4LLMB 2I5YH 1X5GA 3U79A 4RRPA 2YD9A 2XWTA 3DBXB 3CD4A 1X5AA 3VXPB 1AR1D 1F6AB 2VZ3A 2EXYC 2P1YA 3UPRA 3FQWB 3GDBA 5JHDA 4HULB 5JPNA 3KLDA 1IARB 1ZHBB 3G6JB 1A6UH 1T04B 1W2KT 5GRXG 4K3HA 1T0PB 2E7LA 3NZ8A 4M6OH 4RAHA 1QYGL 4Y4FD 5FFLA 3KPQB 3C9NB 2Y07L 1ZA3A 2XQBH 3TNNB 1A6ZB 5H94B 4RWHA 2EDQA 1G1CA 2P7TB 2ARJQ 2DBLH 2OXGA 3H9HA 1KXTB 3UDWA 3GSXA 32C2A 4OZ4B 5J3HC 3WS3B 3IRZA 3RY6A 2CSPA 4QOKE 4U6YB 5DJ6A 1FBIH 3RIAF 1KYOJ 3BJLA 3U9PL 5EZLA 2Q3ZA 5T1DH 2H32B 1TZHB 4QOKD 5I1CH 3TBWA 4KRMB 4PS4L 1U41A 2A1WL 1H5BA 1F2QA 1TQCC 3LOWA 5INCB 3T65A 2AAVA 1BIIA 3FFDA 2OK0L 1VERA 1GL4B 4YXLH 3MRQA 2YN3A 5CS7A 5GRWA 3T2QA 3CCHA 3RAJL 4E0RA 2HG5B 3I6LE 3BZFB 1T21B 1B0GB 1D5XA 5HI4D 1LO4L 4Z7QF 4CBPA 2UUDK 3SDXB 3BN9D 2NY1D 1ODAA 3JV0A 3VFUB 3TESA 3I3BA 3MRKA 3FO2B 3I6LD 5EZJA 1WFOA 1L7IL 1QFWH 2R2BA 1U58B 2W0PA 5C2UB 3MV8B 1PG7X 4FXKA 5IK3B 3BXNA 4OD1L 1U93B 3V7AG 4KXZH 1I1AB 4LVEA 3VA6A 4RMWA 1ED3A 1W8OA 4U1IB 1RJLB 1CDHA 1OTTD 2OMBA 3GHEL 5D7LB 5FM5O 1U8QB 4G6MH 1UJ3C 3P0YH 3CK0L 1QFUH 4LPWA 2JELH 2X1WL 2OSLB 4JN2A 4I13B 5I74C 3KG5A 4WFHE 4PJAA 4RAUB 2W60B 3BKCL 4R2GB 2WM0A 3PGDB 2C3WA 2BNQE 3PWUB 2FJGB 4WTZG 3SKOB 5K9QI 3X14B 5JDSA 4P4KD 1F4HA 4WFHD 5A2KH 3HMXH 2EXYD 3MV01 3VWJA 5AD0A 4Z78B 2IALA 4NDMA 5HHVH 2BNQD 5I8OH 5F3BA 4A2MA 1E6JH 2OTWA 3L3DA 1AHWC 4N8CH 2VNCA 1I8LC 2XV6B 3BISA 1T22A 2NY6C 2GYSA 3JV4B 2ZOKA 4PR5B 1Q9OB 3O3UN 1CVRA 3QFDB 1BOGB 1MWAL 3DUHA 1G7HA 1L6ZA 5D2LA 5TH2B 5DJAB 3UTSE 3SBWC 3RI5K 3WDIA 4YHYB 1EJ6A 3C08L 4FQ2L 4Y4HA 5H2BB 3GSNL 4P0DA 1HSBB 5J3HD 2PW2A 1NFDB 4PJ7F 4X6EB 2RHEA 1SM3H 1UT9A 3UTSD 4YUEH 5C6PB 3IFPA 2BDNH 5HDBF 2WUBL 4YHLH 4KK8D 2KZ1B 2XPGB 5KZCB 1Y18A 3WIFB 5CEXA 3V4UL 5J06A 5GJSH 1QFWM 2ATKA 3TWCH 4JB9L 3RWDB 1XR9B 1CI5A 5FHBL 2HLFC 1NGWB 3VXRB 1ZVHA 1LD9A 2SEBB 1TJIH 2G5BA 1LEGB 4OTXH 1ZTXH 3LKSB 4Q9CA 4Z77A 5D72L 2HJKB 4K8RH 3U0PB 2Y72A 1S8DB 3TBTA 3B2UC 1S78C 1J1XL 4FQXC 4UIMA 3P73A 4QWWC 3MUZ1 2LABA 5HHPA 1VFAB 3U7YH 3N9GH 3CXHJ 1H3TA 2CIKB 4RGNC 4XP6H 4YZFE 2XA8L 4D9LH 1QPXA 1GZPB 4QTHA 2CH8A 4XWOC 2YD5A 2YK1L 4DOHB 1AP2B 1T5XB 4OLUH 1QZ1A 3ZHLA 5EDXA 1JYXA 4XNZB 2OQJA 1ZLVH 2Y6SC 4NO0B 4HDIA 2DWEB 4NKMA 1OM3H 4DGYH 1NCUA 2A73B 3NACH 5I66A 2VDNH 3I2CH 3QBTB 3L5WB 3B2VH 2CDFA 4MX7A 1LE9A 2WV3A 1IM9A 2BC4A 3FQRA 3N85L 1INDL 2Y1VA 5CIPB 1EDQA 3QUZB 1F58L 3B43A 4JPIB 5EA0L 2F19H 5E56A 5GSRA 3RIFK 5C70A 4OF7A 3EOTH 3ZKQD 5F88B 2W0LA 1EJOH 5C0GB 1EXUB 3WIHH 3SKNB 1A0QH 1F00I 5CILH 5E8DH 4UINH 5KVFH 4Y2DB 1DLFL 3QFJA 4M4RA 3JTTB 4Y16B 3FHAA 5DC0A 4NOFA 3S97C 4I4WB 3C09B 1ZEAL 5CGMA 4N1EA 3O81A 3MLXL 1AQKH 3QNYB 2Q87A 4N1HB 4PJDB 3AREA 3O8XC 5I16B 4QHNA 4PJGE 3D39B 3BYTA 1LEKB 3FMGL 4J23A 1CD9B 5DHVH 5CD5C 1MCPH 1KLUA 2EC8A 3QCTL 3I75B 3WD5H 1ONQA 1T20A 2DAVA 2R4SH 2NY5C 4X4MA 1Z5LB 2EDFA 3PL6B 3MRPA 3BIBX 1HDMB 4PJXB 2AV1B 2X09A 1IEHA 2ZUTA 5TQ0L 4OBRA 4ZNEE 4RNRA 4WU5A 2HLFD 1PD6A 1IGCL 2IANA 4WDIA 3SPVA 4HS3A 5JXED 3TN0B 1G7JB 2R0WH 1BZQK 1JMZA 4RGNE 3B2UD 1S78D 3LRSA 4FQXD 4FXGA 5AWNH 4QWWD 3RUGB 3TBYA 3OR6A 3VG0L 5GPRA 5IEHA 4CVXB 1JZ5A 4JRXB 4EN3B 3DSNA 5BO1H 2GCYA 4GRWE 4ZQKB 5IW1B 4PRNB 4RGND 3O6FC 1QPPA 1QO3B 3C6LA 4LLYB 5E2WH 4OZHA 5F96H 1MLCB 1IGYB 2EYRB 1AGFA 1YJDC 1YYLH 4KZEH 3C60C 4MXVF 1EZVY 3S5LG 5HYJA 1ZLVK 3U36A 1BQHA 3DX8B 4V2CB 2CLVA 3V6ZB 2DKUA 1WEJL 2EDLA 4WIQA 3GSQB 3O9WB 1IQWH 4HV8B 2P49B 4ZXBA 1JWSB 4J6RH 3LEXA 4KK5C 4PYHA 1TPXC 3Q0HA 5JPMB 3U30B 4QRRE 1FFPA 4ODXA 4DUXA 2ENYA 3SCMA 4DJMA 3UZEA 2VZOA 4Q9RH 1X5HA 5ADPL 5EPMB 2GUOB 3LKPB 1UZ8B 5DI8A 2BJMH 1IKFH 4MA8L 4HKZB 5IIEA 4APQB 4QRRD 5F6IC 1IT9L 1FL6B 4WHDA 4U1NB 2F74B 3TBVA 2V5MA 3MJ8B 4YFEA 5T3XH 2WZPD 3VFRB 2DYPD 3T0EB 2HMIC 3FQTB 5I1CL 3SDDA 4NWTL 1P53A 2LFGA 5K59E 3KAAA 3FT3B 1P7KB 1JNLL 1I3VA 5SWQA 4GXUN 4M62H 1QBMH 4XCYB 1MFBL 2GTZB 4IIQA 2EH7L 3ARDD 3O8XD 4P2QB 4ERSL 1IL1B 2KQNA 3WXWH 3WLBA 4PPTA 2IMNA 3MLTA 4XMLH 5B3NA 2BNUA 1IC7H 3T8XB 5CD5D 5FCSH 4YNYA 3QRFM 5TE4H 1KCVL 4EJ1C 4H5SB 3H7BA 4YDKH 4BQ8A 1AC6A 3TM6A 1OAUH 3H42L 1QFWL 1G9NC 4X7TB 4JG0L 1HN1A 3ZT7A 2WBKA 1EA9C 3BPNC 3QXAA 1KPVB 5DJDB 4NC1C 1F3RB 5KSUA 4E41E 5F1NB 5ERWB 1I85C 4IHOB 3O3DB 3AM8A 5FV2A 3E6FA 4G6ML 1A02N 5TPWH 5DK2A 2XN9B 4OM0H 1B3JA 3LQAC 3BJ91 1TZIB 4E41D 3MCKA 3HC4H 2Q7YA 3O45B 4MQ7B 1JVKA 4Y19E 3TT3L 4KC3B 3IFLH 4QRTA 3O6FD 2P45B 4S1DC 2X10A 5JUEL 3LSOB 2YBRA 5GGQH 1L7TL 4LOUC 4NSKB 1KBGL 3HMXL 1F2XK 5DHYA 1CWVA 4Y19D 3C60D 3OX8B 3K1DA 4I3SH 3WXVH 4OGXH 3BSZH 3IAPA 1P1ZA 3LKRA 5IBTL 2APTA 4ZFZB 2NR6C 4I1NB 1U91A 1UKTA 5DVNA 3ZT5A 3SKMB 3BDBA 4KK5D 3DMMA 2OJEB 4K7PL 4BH7B 5GJTL 2IMMA 3HTLX 4YIQA 3W9EB 3G6JE 3QXDB 4CW1A 3B83A 1MY7A 4PRHB 4O9HL 5BRZB 5EN2B 1WCBB 1U8KA 3H0TB 1I7ZB 1T1YB 4YUEL 1OF2B 1NCCH 3MRHB 4XAKE 1YC7A 3MOAH 3H3BC 5GJSL 5D8JH 4EKXA 4JPVH 2F5BL 1YMME 3D69A 1IFHL 3RWIA 4S2SB 1EEZA 4XAKD 4P23C 2X70B 3RWJB 4K3JL 1ND0B 4KMTL 5F3HA 4YHYC 4KHXL 1XIWB 3BIKA 4EQ2A 1Q0YH 3UZVB 2APFA 1YMMD 5SWSB 1LO2H 2R0LL 4ETQB 1WCQA 3NCYS 5B4MC 4MXQC 1S9WB 5HJ3B 5EOCL 4IDJL 4NC1E 5IJKC 3KYKH 43C9A 5DFTA 3K3QA 1RMFH 1JTTA 2NPLX 3PGCA 4G8FA 4IEFB 3GO1H 3NIDE 4WTZA 4YHPB 3SDXE 5GXBB 1IQDA 2N56A 1KG0B 1HYSC 3TCLA 3O2WH 1KB5A 2FL5A 1MPAL 3V5HA 3I2CL 4GAGH 4OZFG 4KQ3H 4OFIA 2W38A 4ETYA 1S7XA 1TETL 2VLRE 3MV8E 1MWAB 3D0LA 1RPQA 4DAGH 5I1GL 3ARBC 3O41A 4JFZH 5F6HI 4PJBE 5A43C 2JIXA 2H41A 3MGTB 5CGTA 2X4TB 3GSNB 5KS9B 4KRPB 1I7UB 3MV8D 2HTLC 4QXWA 1A4KB 5ICXA 1FZKB 5AG9A 2BFVL 4TUJB 3WIHL 4HWZB 1DL7H 1TCMA 2MCG1 5FKAA 5J1AB 2H9GB 1KCLA 5I9QB 5IKCB 1BIHA 1A2YB 4QKXB 4UOW0 3MRNB 5BZDA 3ZHKA 1CICC 2PUQT 2OX5A 4U1JA 1BVLB 4TVPE 1T1WB 4R2GD 3NAAL 4U6XB 5L88H 2DN7A 1OOAA 2NY0B 3CFBB 4FXLA 3PHOA 1YECH 3V79C 3FO0L 3MJ9H 3STBA 3WFDH 1MCPL 4UTAH 1RZIB 4UT7H 4TOYH 2BSSA 1I3GH 1KNOB 4KTEH 4QXTA 3C09C 2A9NH 2X9XA 4U1GC 1H15A 2ZUQC 1CLCA 4XCEA 4BM7A 4A2LA 1EVUA 4PUBH 4PJ8A 1NFDE 4QT5B 5KW9L 1OSPL 2UYLB 3NMEA 5I17B 3LKNB 4WUUA 2FNBA 3ZDYE 4P23D 3S35L 1KJVB 4K3GA 4BQ9A 4R97B 1FV1B 3QUYA 4N68A 3IT8D 3JV6A 4HLZH 1U9KA 4NNXA 4GAJL 4JY6B 5C2BL 5AWNL 1MI5B 1KLGB 1FFOA 3LN5A 3MOBH 4MDIA 4QRSA 1AGDA 4XVJH 5KN5B 5GRZA 5CMAB 3VXRE 4MA7L 5A2IH 2ZSVA 5B4MD 1INEL 3QISA 4M7KH 1QR1A 2IPKB 3QHFL 1T0MB 2EKSB 3D48R 3GK8L 3JXAA 5KZCD 2YRZA 5E2WL 5FM4A 1ZLUH 4RBPH 3VXRD 4HKBA 4PREA 3QIUB 5EZOH 4ZUTB 3GIZH 3WN5B 3HI1A 3QDMA 1MEXH 3LPWA 3QXWA 4GAFB 5FM8A 4X7EC 5F7KC 5E5MB 1BJ1H 2OTUB 3V9FA 5CBEB 1J8KA 1FC1A 1DE4A 1JGUH 5LCVL 4EEEA 3PWPB 4LSRL 4M3JA 3VFWA 3K7UA 3TO2B 4HQQL 5LGHL 3MBEA 1C16A 1TVBA 2HH0L 5C0FB 1DN0B 2B7DT 2IH3B 2IH1B 4D2NA 1ZOXA 4DKAA 2AK4B 2HLAB 4CDHA 1YMHB 2FIRT 4K7PX 3WCYA 4YDVB 3U7AA 5DJXB 5IOPA 3GUTB 4P9MH 2BJML 3WJLA 3CUPA 5TJWK 4AEEA 1UEYA 3OGCB 3OMZA 3QDGA 3GBMH 1MCWM 5EZIH 5BVJB 2P8PA 2HKFH 4PD4J 1Q72H 1FZMB 4G7YH 5T3XL 4NO0D 2HJLB 5TDPB 4HIHA 5D2NB 1ACYH 1PJ9A 3EYOA 1JJUA 4OCXH 5I71C 3UJIL 1CT8A 3DUSB 5MEQA 5AZ2H 4M62L 4WWKB 4Y0GA 5L2KA 1T5WA 4U3CA 3BPOC 3QUZD 4R0LB 4M1DH 1C12B 2V7NB 2BRQA 5DRXB 4AK1A 3WXWL 4BYHA 3ARWA 5HTSA 1RULL 2V5SA 3L6FA 5MI0B 4JEGB 3VI3E 2KBGA 4Y5VC 5TE4L 2VUYA 3OL2A 4LKXA 3OPZL 1GIGH 3IKCB 2OS7A 3T0EC 4KI1A 1I3RB 3SGKA 3BAEL 5D6CB 4ORGA 3I3DA 4CMMA 3EW3B 1MJ7L 5F7MC 3ZE1E 2I9TB 5IB2B 3EO0B 5F89B 3D39D 1SEQH 4XPHH 2MPAH 4P5TC 3VD3A 2BVOA 4X9BA 4HW6A 4PJXE 4OM0L 1OARL 3B9KC 3AB0B 4C56A 1PZUB 3S5LA 2HFGH 4XP1H 4OIIH 3HC4L 2W65A 3BDYL 3U4BL 2XG4A 5T3ZE 3PL6D 4JHAH 3E8UH 3DIFA 4YC2B 3QG6A 1G1YA 4QY8B 4M1GL 1ZLUK 4UMGA 1BLNA 4PJHA 4RBPK 2BY0A 2WW8A 4HUMB 3RUGE 2V7HA 5T3ZD 2D0HA 3CDCA 4I3SL 5ETUA 5D5MF 1I75A 4JRXE 3FTGA 3EJZD 5KSVB 3HZYB 2G2RB 5MEOA 3NABH 3TGXA 3AXLA 1UM5L 1NGZB 4WHYH 4NHCL 2NLJB 1IGIH 4UILL 2EDOA 4JRXD 4J4PC 1BZ7A 4WW1B 4JRWA 1J0HA 5L0QB 4P46A 5C86A 1U2CA 2P43B 4M7LH 4OCYH 2X1XR 4AYFA 3IFNH 4RDQG 1CDGA 4QEGA 2AEPH 4YAQA 4KKAD 4ONFH 3P0GB 3RGHA 1NCCL 3HZMA 4PIRF 3KWWB 1D5MA 4UDUA 3MOAL 3WIIH 1A1NA 1F3DJ 4G5ZH 4JPVL 3O9WD 5KBNC 3B9AA 2PO6C 4IRJB 2A77H 5DVKA 4F33A 1D9KA 2CLZB 2A9MH 2OJZH 2AJUH 2CRZA 4ZUVB 3S35X 4RA3A 3S7GA 3GJFB 1VB9A 4S1SH 3T0EE 4APQD 3LS4L 1RIVL 5KVMC 4M8QB 5EO1B 4M6AA 1NCWL 3G5YA 4MAUH 2E9WA 2V2XA 3T1FA 1NGQH 1A3RH 1XCTB 4PRPA 3T0ED 2D7TL 2XTJC 1HWGB 3EDDA 4LVOC 3WNMA 3HI5H 1NPUA 1TJHL 1R3LB 7CGTA 5ACZB 1A7PL 2NW2B 1XIWC 4F37K 5E8PB 4LL9A 4JE4B 1A7RH 3TYFA 4AEIL 3FN0H 3QIWA 3O2WL 4X5XB 4X4YB 3LN4A 4XBGB 1UM4H 3CDGA 4ZO6A 4XP5H 1P4IH 1GC1H 4X6BB 4GAGL 3RL2B 1G84A 3TZVB 4IRZL 5DD3L 5E2UH 1YC8A 2G9HA 1SVZA 2ZJSH 1T3FB 4KVNH 4PV8B 4PB0L 1GGTA 2YRLA 4NZTH 1FAIH 4ZUWB 2XN9E 4L8CB 5E6IB 4IDLA 1GHFH 3ARFA 4IOFD 2GAZA 4CVWA 1TFHA 4EI5C 3BP7B 4M9PA 2CIIA 5DD6A 3OKLA 4PJEE 1OLZA 5J6GB 2XN9D 4OF5A 4FQJH 4KJYA 2HT2C 5ENWA 4ZUSA 1HI6B 2XY2A 3CPLA 1HHGA 2G60H 5TGBA 1RZKH 4BA8A 3BP6B 4JR9H 4NN6C 3BZEA 5IJVB 1ORSA 4J4PD 4XC3H 2DQCL 1Z0NA 1P6FA 2EDNA 3SGDH 3FQUB 1A3QA 1J8HB 2E3VA 5MENA 4NQSA 3N0PB 2DTMH 4UTAL 5HVHB 3IXAB 3IDIB 3REWB 4PLNC 1N3NB 5EOTA 3RIAK 3TVMB 4LSPH 1I3GL 5DEZA 4QHUA 1U8JA 2W9DH 5FO7B 5GHWH 3DURA 4ACPA 1M71B 1FGVH 5IHUL 4WJ5A 3MMEB 3CX2A 2VSCA 2ZG2A 2YPLA 1H3PH 4ZFGL 4H88H 2PO6D 3GMMA 2NY0C 3CX5J 4PTTB 3X3GL 4M3KB 4CJ1A 4JO1L 1JPGB 1F11B 3DARA 1KIUA 4PRHD 4F7MB 1EEQA 2UWEA 4IOSD 1JF5A 3OAUH 4L8BA 4IS6B 5BRZD 5JO5A 4OCLC 2XTJE 2YD3A 2B0SH 3MOBL 2EZ0D 3REVB 5FOBB 3L3KA 1MHCA 2HRLA 5TDOB 4OZFA 4Y4KA 4CMHC 4R7DB 4HIXL 1B0WA 1X7QB 2MJWA 5F7EH 4K23L 3RZCA 1DQMH 3W81A 1YQ2A 2EH8L 4JO4L 1OPGL 2VLJB 3QEUA 1GOHA 5SWSE 2K3TA 1S5HA 4KJQC 1VSCA 3MODL 4JFDA 1XIWD 4R97C 4YFLF 1OAZL 3LKQB 5BXFB 2XKSA 5SWSD 1VEPA 3ZE0E 2P8MB 4Y1AA 3RX8A 1OHQA 3ARRA 4LLVA 3LIZL 3KPSB 4LFHG 5HHOA 4MHHG 1DUZB 3SOBH 4J3SA 4DFHA 4Q6IC 3UTZA 3QIUC 4RMUA 1D5ZA 2E8ZA 1OGTB 3X3FL 1WC7A 3BEVB 4NQXB 5CSZB 3WE6A 2MCPH 4XVTH 5EZIL 4F9LA 2MHAB 1YEDB 2HKFL 2H6PB 3EO9H 4PG9A 3AROA 1XGPA 2EEAA 2V17L 1P7QA 4U6VH 4AL8L 1KENH 2D31B 3PWVB 3UJTH 5KSBB 1TTGA 3HKFA 2GI7A 5T1KB 5KS9E 5D1XB 2Y7QB 3IDXL 1GGCH 4QRPA 4OQ1A 5SX5H 2HT2D 1KPRB 5JW4Q 4HUWB 1D5BA 1LDPH 2A0LD 1D6EB 4X80H 4P5MA 4Z9KB 2CDEA 1MCJA 4Z7UA 2CGRL 4UV7H 4X9FA 1MJ8H 1WAAF 5GZOC 5CEYB 5D1ZA 4PJ5A 5MERB 1OB1A 2BCKB 3IYLW 5C8JA 3LH2H 4OKVA 4HUXB 4PRBB 5I2IB 1R3JA 4FFYL 1A9EA 1GIGL 5D1QB 3HZKB 3DO7B 2ZG3A 3OHXB 4PJIA 1BX2B 3K8MA 3G6AB 3PGFH 4X7FC 1TLKA 2FEEL 3ZTNH 4ZYKB 2BVPB 3CVHA 1WK0A 3RVTC 3L3GA 4JKLA 5I76B 2VDRL 3OV6A 4YGVB 3GRWA 3DHJA 2NY0D 4HUUB 4BSWB 1F42A 2MPAL 4HPYL 4HX1A 3HE7A 1TVHB 4F7EA 3WL9B 4IRSA 3UO1H 2HFGL 4YHIA 3ESUF 4LASH 1WZ1L 1YEFH 5DR5H 5FYJH 2Z92A 5DUMH 2IQ9H 4WI8A 3UAJC 4JHAL 5L6YL 2BX5A 4HH9A 4XPGL 4J3TA 3VFGL 1FYTB 3KJ4C 4Q2ZB 3C5ZB 4JCMA 4XHJC 1FFNA 4ZUUA 3TYGH 3I85A 4HG4J 1JI1A 2NX5A 3QA3A 1EHAA 2PXYA 4GBXA 1U3JA 2XYCA 4GKNA 1DANU 3UEZA 3AB0C 3SQOH 2M8XA 5ESAB 3MNWA 4WRLA 4XB7A 3IS0X 1K6QH 3J8F7 3LPGA 1IGIL 4MA1C 4WI9A 5EG6C 4O58L 3DXAA 3MGOA 1R3KA 4X6DA 2E8YA 1T2XA 3ZYIA 1G6RH 4PP2B 1K2DA 2KZWA 3QDAA 4MNHA 3IFNL 4JDVB 3VFPA 3QIUD 4ISVA 2EE6A 3D0VB 1CG9A 1E4XH 1SJXA 4YEEA 1QQDB 4HWBH 1LP9B 1VACA 1A8JH 4X7DC 4GMSH 2AK4E 1OW0A 3KPRB 3VXUA 5JNYB 1WFTA 1FCGA 1KJ2A 3QUMH 2O61A 1EGJL 3PWPD 1OWWA 4UNTA 4F57L 4NYLA 4WU7B 4QHLB 4G5ZL 4JQVA 1UWGH 3X11B 4W4OC 5EU3A 2RIKA 5SX5K 3B8SA 3WKNA 1RK0B 5IG7B 2A9ML 2AK4D 2VDLH 4ZFOL 5L0QC 1QLEL 4POYA 4EDWL 4QO1A 3J7HA 4R7NA 3E6HB 4UU9A 5CSGA 3JZ7A 1BBJB 5D2NE 3CMOL 5ICZA 1MIMH 2RR3A 5C09A 1C5DB 3T0AA 3NA4A 4FP8H 1IBGH 1P5VA 4MAUL 3GGWB 4X4ZA 4M9OA 3IF1B 1FO0H 3OKMB 4WHCA 4RFEB 4BQCA 1SJHA 4DZBB 3EO1A 1BFTA 3HI5L 4WHTB 3SDAC 5DQJA 1FLRH 4FQ1L 5D6DA 35C8H 5CP3H 3U6RB 1QA9A 4WWKD 3BMVA 4WFGD 2BSTA 4LLAA 3I02B 4JY5H 2XZQL 4IM8A 4AT6B 3FN0L 3T77A 2GSIB 5BVPL 1HCFX 1GC1L 5BCAA 4G6JH 4WCYH 5DGRA 3LMJH 5DEFA 1X5YA 1QR4A 1HILB 5AEAA 4GRLB 5IHBA 1GGIL 4I2XA 4L4VA 5GGUA 4KVNL 1D7FA 5ISZB 2F54E 3ARSA 3DROA 2YEZA 3LS5H 3F8UB 1FAIL 2MKLC 3B5HA 3UTTE 4NFDA 1FCCA 3ZE2F 2UZIL 4PGDA 3MA9L 3G5ZA 1ZS8B 2X4SB 3HHRB 4O00A 4Y5YB 1BAFL 3HE6A 3FO1B 1D3CA 1NSNL 2F54D 3K46A 1MRCL 4PFEA 1N5AA 4JFXB 1H8SA 5F7DA 3UTTD 3MRCB 5MHSD 4X9IA 4NQDE 5HI3D 3UYPA 3T1WA 4XCNA 4Z7VF 5LBSH 5C07A 3QJHB 3H9SB 2G60L 3SO3B 1T83A 5DRWB 5DHXB 1NFDF 3HNVH 4G6AD 4NO5A 1R5IB 4WFFE 2MWCA 4NQDD 4KHTL 1IAIL 5I6XB 1MAMH 1NLDL 3V52H 1JFQH 4KDTA 4WO4A 4G8GB 1YNKH 1QSFB 1HQRB 3GEWB 1OGAE 1JUFB 4WFFD 5INDA 4DZ8A 3VCLA 4W70A 1DUYB 5HGHB 5GHWL 1YEKH 4ZAKA 5EU6B 1CLZH 1XCQB 2QKIA 1I7RA 1FGVL 1J0KA 2HT4D 3QULB 4R26L 5HGBA 1OGAD 1AGBA 1U6AL 1X5XA 2A6JA 2C1OA 2DIAA 2DQHH 4H88L 4BZYA 1V3MA 1YPZB 4PRIE 1U3HA 4WI7A 4F80A 4LCYA 1P2CA 4M1CC 4QNPF 3RP1A 4L29B 1VESA 5IVXA 3NZHL 2WUCL 1C8PA 4L3AA 1A7OH 1KFAL 4PRID 3TVMC 3IU3B 5JXAL 1A6VL 5CJQH 1NUFA 3MBXH 1XGTA 3OAYH 5GS0L 2XZAL 3K4ZA 3P4NB 1FVEA 1ZSDA 1R3HB 3AAZB 3D3VA 5ESQB 4NUJB 4PJFA 5FUZL 2ZP0T 4IRJD 2X4QB 5FYKH 1PX4A 1OAXH 2VN4A 1CFNA 5GGVH 4LDLB 2VH5L 1NGPL 1YN7B 1DQDH 5E1HB 1A6WL 2ZUUA 3F7YA 5I1AB 1HSAA 3M17A 2IBZX 1P9MA 5E4IA 1F6LL 3IJHB 4N0FA 3RNQB 3X12A 4WTXA 1QTYT 1WGOA 1A3LH 4UBDC 2B5IC 3MFGB 1LO3H 3KLSA 5I73B 4M7ZC 2BOCB 1JWMB 1QRNA 5FGSA 4ZSOB 3TBSA 4K55A 1FNGA 1V5JA 5E2VL 1NDMB 5IMKB 1DFBL 5D7IB 1HKLL 4BELD 3H9ZA 2FRGP 3ULUF 3L7EB 4H1LH 3OBAA 5SX4H 1XH3A 4PJDF 3ZKNC 4LCWB 4JM2C 2DLFH 4XVSL 3SY0A 4YX2H 5E5RB 1UH3A 3JV5A 2CMRL 3D2UB 2WIMA 4LCIH 2NY3B 3IJSA 2FGZA 1FL5B 5ID1A 4ZO8A 3MLVH 1KTDA 3R4DA 1LDPL 4JCLA 4MD5A 1FN4A 4NQTA 5KVEH 5CWSA 4FFZL 1A7NL 4UV7L 1AXTL 1GAFH 3L1OH 5DLMH 2Q6WB 3U83A 1NFIB 2HKHH 4AG4L 3RY4A 5J9PA 4FHBD 4DK3A 3C2SA 3GMNA 2ESVB 4PJXF 2VITA 1ZGLB 2I07A 3RY5A 1RURH 2V5YA 2EIDA 3KR3L 5E6YA 4D0BA 1GGBH 5TE6H 3L3IA 2DMKA 4ZDHA 1NANI 5IVZB 3QEQB 1S9YA 3G08B 2LAGB 1OAYH 4KMQA 1XZ0A 3BQUB 1J8HE 1Y0LA 1J0JA 4U49A 3KDMA 3IGAA 5IM7B 1U3ZA 5F9WB 2AS5M 4CGTA 2IG2H 5ECJE 4PRAB 4HCRH 4U1MA 3O4LE 1J8HD 1WIUA 1FFRA 4M1CD 1S7RA 5J8OA 4O2EB 4LSTL 4G7VH 1X3DA 2CKBA 3U7WH 1ZHLA 5F1IB 3TVMD 2X4RB 1OCWH 4X8XA 3LHPL 5FYJL 3BZ4B 3IU4H 3EJJX 3O4LD 1XF2A 1NUDA 3OAYK 5A2JH 2DQDH 2V9RA 1K5NB 3ALPA 1JZ8A 1ETZB 1QKZH 4N8VB 1HZHH 4Z5RA 4HIIB 5FHAL 4M48L 1BQUA 3HMWL 3TYGL 3ZYJA 1SY6H 1ERNA 2AJYH 4TSCL 1P69B 3X13B 4I18B 4LSDA 3ZTJH 4LAQH 4NNYA 4L5FL 1HH6B 3HNTH 1VADA 2Z93B 2GKIA 1YNLH 2FBOJ 2R0KH 2ORBH 2DLTA 4G80B 2R29H 2XTLA 4GW1B 4FQCH 4JO2H 5FECA 2J8UB 1ZV5A 4NN7B 5E95B 3OSKA 1KGCE 3MLUH 3S96B 1DCLA 2CQVA 3D85B 3RVWD 1E6OH 4P57B 1P5UA 4YXKH 2CRYA 1E27A 4A6YH 4LSVH 1MCIA 4CVZB 1CBVL 3DTXA 3QAZC 5IQ9A 3EOBA 1KGCD 2E6PA 3QUML 1S9VA 1ZMYA 4MLSA 2RFXA 2Q8BH 4TUKH 3SGDI 3V5KB 1N7MH 5JIPA 2DQFA 3HUJE 4Y4FA 2AXFA 5AUMB 4NWUH 3WSQL 2EYTB 1K3IA 5EORH 1YNTA 5TFSH 1P4BL 2GJ6A 4NT6A 2AJXH 4XI5C 5FUCE 3RL1B 5KSBE 1JNNH 1PSKH 4AMKH 1C5CH 4M6ML 4XMKH 3QH3B 3GMRA 5GRJL 3JTSA 4LCUA 1AY1L 1YY8B 1TZGL 2YA1A 1EHLL 1JPSL 4U0RB 4M43H 3DSFL 2XY1A 2VWEE 5I30L 4F8QA 1T2QH 2D7NA 4J8RA 5D1XD 3BH9B 4JY4B 1JPTL 1FLRL 3VGFA 5JLZA 2IGFH 4X9GA 3H3PL 3PE9A 1ZT4B 4H8WH 4XP9L 1PQZB 3EYVB 4HHAA 3MXWH 2ZCLL 5IROC 2X4NB 3OF6D 3IDJB 5JW5B 1WISA 3ARXA 1H0DB 5F21B 4F3FB 3A0OA 4UUJA 3CFKA 4JZJC 1MHHA 4WI6A 4G6JL 2X41A 3DHMA 1T6WA 3LMJL 2XKUA 2FJHB 4HIJB 3KLHC 1BWMA 1HHJB 2OI9B 5DJ0B 1K8IB 3V6OC 5DFVC 1KN2L 4I3GA 4F7TA 2FYYB 5GIRB 1ES0B 1N64L 4NBZB 3T0XA 3G5VB 4UOJA 5GS1B 1CN4A 3TCXA 1CGSL 1CCZA 1FIEA 2B2XL 4N9GB 4P59H 5I15H 1BREA 4G8IA 2MMXA 3QIBB 1FG2A 2G5RA 3F58H 3HS0A 1NCBH 4LHUG 2ATPA 3QNZA 1J05B 3S34L 3LD8B 2Z31B 5KJRL 2F5AH 2F58L 1RK1A 1FC2D 1FYTE 3PWNA 1VFBB 5MEPA 2JCCB 1L4IA 2AXGA 1A1OA 2YHGA 1G7IB 4GRLC 4TNVK 1HXYB 1U8OB 3ARVA 4ZFOB 2NW3A 3DVGA 5BV7H 5CUSL 4EDXB 5KG9A 4JAMB 4WW2A 4X6FA 5T3XE 4XMPH 4MJ4A 1FYTD 2WBJC 1KELH 2NZIA 1NCDH 2VB5A 4JFYB 4L8SC 5GGTH 3C5ZD 4HPOH 1S7UA 4UT6L 3E0GA 4XC1L 1MCQA 1YNKL 1JGDB 1Q1JH 4EIZC 5I1DB 5T3XD 2BNQA 2EIEA 3CZFA 5I1LA 2ID5A 3GSOA 1T1XB 3HA0A 4OQTH 1OTSC 1ZHKB 1CLYL 5IB5A 3O3AA 4P5KB 2Z8SA 1LP9E 5I6XC 2CDGA 3S3JA 5E7FA 1ZXQA 3O3BA 4CNIB 3QUXA 3MV7A 4NRXA 4R3SB 2YSSB 4JRYB 5CZVH 3HAEA 5DUBA 2BSRA 3F7RA 3CFEB 3UTSA 4JVUA 2AW2A 3CMGA 2FATL 3P4OA 5CJQL 1SYSB 1ZHNA 4XPTH 3EHBD 4O51A 5GSVA 1IM3B 2PTTA 4ZO9A 4ZOBA 3MREA 3DLQR 5FYKL 2ADJB 5K9OB 1OAXL 3BPCB 4L9LB 3WHE1 5HGDB 2R56L 1VKXB 5C6TL 4EOWH 3TT1H 2JE8A 2VQ1A 2H45A 2M1KA 4G43A 3D25B 5KS9F 2EDYA 4Z95H 4C55A 3VFVB 1P6AB 4W6WB 5IEKB 1XGQB 3TA3A 2UVFA 3KLHD 4NKIH 4KRNA 2ERJC 1A3LL 1B2WH 3V95A 1M7XA 5HVWA 4KK9C 5IFJB 3GJEB 4DCQA 5IQ7H 2XRAH 2MNUA 4EQ3A 4MS8D 1CXLA 4R8WH 4LLWA 3LZFH 2X1OA 3MLZH 2V9TA 4DVBA 1RZGB 3DRQA 3BWAA 3X17A 3SKUD 3WO4B 2HT3C 4TRPH 4BQ6A 1CIUA 2R1XB 1XF3B 3CXHK 3Q2CA 4QCIA 5D93B 2EDDA 2ZG1A 1U8MA 4KUCD 5IMOA 1DEDA 5ISZE 1J18A 3GMLB 2XWTB 3Q48A 1EO8H 3TP4A 1UJ3A 4LCIL 4F58L 5H35A 3VJ6B 2GT9B 1UWEL 3UPRB 3PDGA 4GRLD 1E4XI 1T7ZA 5I1IL 5JHDB 5JPNB 4OAWA 4XBEH 1PEWA 5HD8D 5ISZD 2ADFH 4S0SD 2WBJD 4C57C 4XTRC 1YQVL 2IQAA 3SDYH 4Z7WF 4S1RH 1Q94A 3FCTA 3NZ8B 1JV5A 4QTIH 1NC4A 4FQIL 2IFGA 1ZA3B 3G04A 3W11C 3MNVB 5F7NC 3H9HB 2NY3C 3GSXB 1AHWA 5EBLA 4GRWH 32C2B 1I8LA 2X9WA 4HK3J 4ZPTA 4F7PA 1RUQH 4YR6A 2WP3O 4TQEH 2JJVA 4RGMC 3ARGC 5DJ6B 1WWAX 1B6DA 2GJJA 1I3UA 4G8GE 1QSFE 4D3CH 1OTSD 4JN1L 5EZLB 1LE5A 4HCRL 2OYPA 3SBWA 4YBQD 3VXME 4NKOA 3EDKA 5IESL 3TBWB 4I3RH 4G8GD 5B3JE 1QSFD 4UT9H 5C92A 1QSVA 2RB8A 1H5BB 4PJGA 3T65B 4GKZA 1BIIB 3FFDB 4G3YH 4HIEB 4O4YH 3VXMD 4Q97A 1C08A 2DQDL 3MRQB 5EU6D 4JZOB 5DJYA 5E70A 3BQUC 1CLOH 3R8QA 4PTUA 3CCHB 3MRLA 4LVHB 1VPOH 1O7VA 3U1SL 4E0RB 3QG7H 3BEWA 1QKZL 4NO2A 1D5XB 1NL0L 5LXGH 1JGVH 2O5YL 5CZXC 1A6TA 4PGBA 4BFBD 4ODUA 3JVGC 2AJYL 4ZNEA 4AM0A 2BXZA 5EZJB 2VYRE 4FQXA 5GGRY 2R2BB 4JFOB 1UQSB 4FXKB 3SO5A 1YNLL 4P99A 2R0KL 2H1PH 3FB7A 3BXNB 2WQRA 1I8IA 4JPWL 2Y06H 4FN0A 3UC0L 2R29L 1ED3B 3KJ6L 2L7UA 3UYRL 3ISWA 3RVXC 4K71B 3DRTA 5JW3L 3V6FA 4PLOB 4G9DA 2XT1B 4JN2B 4HC1H 3KPTA 3P11H 5FO8A 3PWLA 3M1BA 4A6YL 1BD2A 1UA6L 2DJUA 2HT3D 4I18C 5DD5H 4WGWB 1LK2A 5JR1H 5HHNA 2WNGA 1B4RA 5JDSB 5DD0L 4UZGA 4ZSOE 2VXTL 2DQIH 4NWUL 1W72H 5GZNC 3INUH 3ROOA 3VWJB 3K2UH 2IALB 4NDMB 4DN3H 5CINH 1WZKA 5F3BB 2OTWB 3L3DB 4YPGB 4HFWA 1JNNL 1KB5L 4MNQA 1PW3A 2J6EH 2ZOKB 3A6CH 4TYUA 4QRRA 3CLFH 4CRPA 1IMHC 1Y6KR 4JGJA 1F4AA 3ZDZE 3S6CA 4IMKC 5D2LB 2DQGL 4NCDA 5LVEA 1RIUL 2E7MA 5JA9A 5DJ2A 1I4FA 2DYPA 3NFNB 4ODVL 4WTWA 5AZEH 4NPYB 3D2UD 3QUKA 2Z35A 2NY3D 2IGFL 2PETA 5L7XL 2PW2B 2X4UA 1F5WA 3L5XL 1UCTA 3UTOA 2V6HA 2YXFA 1IEBA 3MNZA 3IFPB 3O8XA 3QCVH 1UVQA 4NJAL 5EU5A 1CS6A 1RY7B 3C87A 4NGHL 3SE3C 5CEXB 5BS0E 1T03L 4KZDH 4NOBA 2ESVD 3QEQE 2ATKB 1IILE 2NY7L 4YQXL 3C8DA 1HQ4A 1LD9B 1N0XH 3DVIA 1KULA 4ZOEA 4Z77B 1RUKL 2ITCB 3TV3H 4RQQA 5BS0D 5C1MB 3QEQD 4PGEA 4DUVA 3TBTB 3BQUD 4UIMB 3P73B 2DLIA 4ODSH 5HHPB 4P59L 1ZT7A 5I75C 4HFUL 2CLRA 4GAYA 5E8EA 2VXSH 3DGCR 3T09A 3F58L 3R06A 1MSPA 3RWEB 2BHYA 1OAKH 2OBGA 2VIRA 4QTHB 3DV6A 1AI1H 4JFQA 3D9AL 2BVYA 4I77L 4E41A 1HEZA 4HH8A 1QHPA 2VJXA 2OQJB 4KROC 5JHLL 5LWYL 3T4AA 5SX4I 4NKMB 3O6FA 1BJ1J 1KUMA 1CFBA 1MFCH 1V7NH 2CJUL 5I66B 2FX8L 3OKOA 4OIAA 2CDFB 2H32H 4MX7B 1LE9B 5K33A 1IM9B 2BC4B 3FQRB 1Q1JL 5FK9A 4Y19A 4JG1L 3C60A 2HFFA 3QPQC 5HHXH 3QJFB 3LD8C 2Z31C 4Q6YA 1UZ6E 1G9NH 4BZ2L 1JK8A 3CSPA 1X4ZA 2P24A 2J8UE 5GSRB 4LSQH 3IJYB 2CK0L 3MZTA 2DTSA 3IDYC 3PDOA 1BF8A 3FQXA 2AJSL 5GZND 3VXTA 3DBXA 3LQAH 1SJEA 1KIQA 2NY2B 2VZTA 4ZS7L 3QFJB 4KUZH 1JRHH 5CZVL 3RVUC 3FQWA 3D85D 3T3MF 5F44A 3GKZA 2VDOL 5E4EC 3O0RL 1F13A 3C2AH 1U42A 3GB7A 5EWIL 3AREB 4PP1D 2VDMH 3G6JA 2W59A 4QHNB 4MJ2A 1KJMB 5KVGL 5J57B 4ONGH 1HWHB 1G7PA 2HN7A 3C9NA 3CVIH 1KLUB 2VR5A 1SQ2N 4BUHA 3FT2A 5F7UA 3T04D 1ONQB 3E2HB 1T20B 1GC1C 1BVKA 3O2DH 4OT1L 5T5NF 3MRPB 1YMMA 4JQIH 6FABH 4OJFH 5IT2H 5C0AE 1LQSR 4K07A 2XWBA 1CL7H 4LHUA 1QVOB 4PJ9C 4RNRB 1NC2A 2WLZA 4HBCH 1NCTA 5B38A 2IANB 4WDIB 1P7HL 1GCFA 3NGBB 5C0AD 4HS3B 4HS8H 5F7FA 2XRAL 5DTFA 4X4XA 4L9LC 3QDJA 3LRSB 4DGIL 4FXGB 4S1QH 3BGFC 5IEHB 2IBBA 4TRPL 3FAWA 1G9MH 2GCYB 1I85A 3MXVL 3K4AA 4BSVA 2Y36H 2YRPA 2YMXL 1RZKC 3C6LB 4OZHB 3SDXA 4LHJB 1XMWA 1AGFB 3MRBA 3JBG7 1FORH 2R4RH 2AXJA 3DECA 1AKJD 2ADFL 3BP5A 3HPJA 4H20L 4OLYL 3U36B 5HYJB 1H9VA 4N0YH 2C7UA 1U58A 4YHKH 2CLVB 4NBYB 2VLRA 3MV8A 1IAKA 4S1RL 1PZ5A 4Y8AA 2QJDA 3WO4C 4JANA 5D93C 4PJBA 4M93B 4WY7H 4ZXBB 3LEXB 3EYUH 3QIBD 1FFPB 1I9EA 4GG8A 1U8QA 3QPQD 4WV1C 2Z31D 4NP4L 4XNUL 4FQLH 5DI8B 4I8DA 4ZNCD 1FNSL 1IGMH 5IIEB 4IJ3B 5J13B 2W60A 2ICEA 4Z7QE 5IGXH 4D3CL 3ARZA 3O6LL 3TBVB 3AU1B 3UCRA 1JF1A 3LCYA 3X14A 4DW2H 4YH6A 5CCKH 2P5WB 5IUSA 2JJTC 4ALAL 1MFAH 4M61A 4LPXA 4UT9L 4FG6D 1MCSA 2C26A 4Z78A 1WTLA 3WFCH 2A6DA 3V5DA 5SWQB 2BY3A 2EICA 5I8EB 2P8LA 4IIQB 3FFCB 4MA3A 4CADA 1CLOL 1WZMA 2F9BT 4JRYE 3MLTB 2BNUB 5C0ND 2E27H 5LXGL 3SJVE 3BRFA 3L7FA 4DEPC 5JQHC 5HYIA 4XNXH 3P30L 2QHLA 2F53B 3L3JA 1NDGA 1X5IA 4P23A 3I9GL 3H7BB 2ZSWA 1KB9J 1RU9H 4XT1C 4NKDA 3VFMA 4JRYD 2VDPH 3DPBA 2M2DA 5CIPH 4LKCA 1BJ8A 4MB5A 4QF1A 3MA7A 4LF3A 1CGXA 3UPAA 3QXAB 4C59B 2Y06L 1S5IH 5KSUB 3Q5OA 2XPGA 3EDJA 4G6FD 3M8OH 4X6CF 5IJKA 4XCFH 5DK2B 2B1HL 5IBLC 2AK1L 2SEBA 4MD0A 3WFEL 1NCAL 3MCKB 2GITB 2Q7YB 4MZ2A 4P48A 2R9HC 2FWOA 4B7LA 3QRGH 3GNMH 4RFOH 3ET9F 3KPMA 4DGVL 4LRNL 4QRTB 1VFAA 4GOSA 3B9DA 4XNMB 3TEUA 1JZ2A 3TPUA 2CO7B 1TCRA 5DHYB 3W9DA 5DYOA 4Q0XH 3ARBA 3HG1E 4ZODA 1V7ML 1YEHL 4PGJA 1JPFA 5HDBE 1DBKH 3LKRB 3JWOH 2YC1A 3A6CL 1U91B 4OGYL 3DVNA 2QADC 4GRMA 1NLBH 2DQJH 3DMMB 4Q58C 4G8EB 4NO0A 3RBSA 2DD8H 4TTDC 4KTDH 1YEEH 5T3ZH 5C0RL 1J0YA 3U9UA 5D70L 1DP0A 4OZGA 3DV4B 1ZAGA 3MYJB 1U8KB 1CICA 1BQSA 5E2TH 3QCVL 4P3WA 4EIGB 4EUPG 2EEBA 2FIKA 3IRPX 1RV6X 5ANMB 4EBQH 4KZDL 1CZ8H 1F3DH 4O5LH 3D69B 3RRQA 3RWIB 1EEZB 5JOPE 3IAGC 5GS0D 2XFXB 5DEGA 5F3HB 3BIKB 5IP4A 1BM3L 1SEBA 3Q1SL 1LDSA 4LAJH 5D7SL 1E0OB 4UTBL 4U33A 5CBAA 4B41A 3MC0A 3VXOB 1OAKL 3DUUA 5GRUL 1D5IH 1XAUA 2D03H 43C9B 5I1EH 5E0QA 3MUY1 3I75A 3QB7C 1ADQA 2VXUL 1ZT1A 3PGCB 4V1DB 3A67H 1SBSL 2OL3A 5LG1A 2A6KA 5E8NA 1HDMA 1IQDB 1OT1A 2ZCHL 3PDDA 1KB5B 4ELMA 1V3KA 2FL5B 4XWGH 5DUPH 3V5HB 2K1MA 3B6SB 1S7XB 5IBLD 1QACA 3D0LB 2H2SC 2C3HA 4PBVC 2E6JA 3Q5YA 5F9AC 1MCOH 3SE9H 1MCFA 1PKOA 1G7JA 5D96C 5T33H 4AY0A 3V7MA 2R9HD 1QD0A 1ZLSH 4K3EH 2GSGA 3RDTB 4FTVE 4LU5L 4MCYB 4UIKL 3RUGA 5L9DH 1XR8A 5ICXB 3TNMB 1M4KA 4BZ1L 4CU6A 4KY1H 2VAJA 3T2NH 4I0PC 4QRQA 5FKAB 3LEYH 4FTVD 4HT1H 1IGYA 43CAB 4MJIE 4R4NC 5HHMB 4KJWC 3O6KL 4YXHL 1CDJA 5BZDB 4U1JB 4FNLL 2QADD 4OLWL 3C2AL 1X44A 2VDML 3DX8A 1FPTL 1A5FL 3IVKA 3GSQA 4ONGL 2C3VA 1HYRC 3PHOB 2A83A 4HV8A 2HRPL 2R15A 4HJJL 3FB6A 1QYGH 3VWJD 2I25N 5FYJE 1LO0H 4MWFB 1MJJA 5D5MB 2BSSB 2NY2C 2Y07H 3G5XA 1X5KA 5T1LB 1JHKL 3O2DL 4ZMAT 2YUXA 3V0VB 2GUOA 4QXTB 2Z8WC 1BJMA 5HYFA 4QXUH 4HKZA 2NY4C 1H15B 2X6MA 3HC3L 4R96A 4XCEB 4U1NA 5FYJD 3V8OA 4PJ8B 4Y5VA 3MJ8A 3QQ9D 4YDIH 3JWDL 4WUUB 3DETC 3MV11 1JZ7A 3T0EA 4HS8L 5F97E 3SDCC 1YY9C 3C8HA 3FT3A 5HDLA 4NNXB 3V0WH 3FB5A 4S1QL 1FFOB 1K4CA 2NXZB 3MRRB 4MDIB 4QRSB 1AGDB 4HF5L 2GTZA 5C0IB 1UM6H 4JQXC 2BRRL 1MQ8A 4PS4H 3VG9C 2R1WA 2ZSVB 3PNWA 1IL1A 1QR1B 1D6VL 1SYVA 2YD2A 2OR7A 4P5TA 2OK0H 1U8LA 2OP4L 3QT2A 3B9KA 4WUKL 3RAJH 4HKBB 4PREB 1MCDA 5CLTA 5IFAH 3OQ3B 3IB4A 4FQQB 1RQ5A 4U6HB 2PCPA 3HI1B 1LO4H 1NBVL 5EOQL 1MNUL 3QDMB 3L5JA 3EYQC 1MREL 2MKWA 2O5XL 4N0YL 1DE4B 2IC2A 3EYSL 3VFWB 2YUZA 3MBEB 1B88A 1C16B 1KPVA 1TVBB 1I9IL 1L7IH 4WY7L 5JMRA 5C0JA 1JTOA 3EYUL 2AI0L 2D3VA 3O3DA 4P2OC 4OD1H 1ZWIB 2NQCA 3ULVF 1YPZF 3C6LC 4LCCC 3WYRA 1IGFL 5I8KH 2D7PA 3PQYA 4EXPX 1TQBB 3GHEH 5IOPB 3PV6A 3CK0H 4U0QB 3VFNA 3O45A 3QDGB 1FLTX 4HJ0D 4PJEA 3CSYB 1M05A 3MFFA 4RGOL 4J4PA 2CUMA 1ZA6A 2DQUL 1NUNB 1HXMA 3F7VB 2X89A 3BKCH 3DX7A 1HHIA 3EYOB 1F45A 5TDNA 4YWGH 1CT8B 3MRJB 4N0UB 4P2RB 3WFCL 5I19L 1T5WB 2FSEA 1A9BA 1IAOA 2WWKO 4X99A 3S3PA 1KXVC 3FB8A 1U92A 5GRYA 3NN8A 3QFJE 4IJ3C 5J13C 3L6FB 4PY8J 3CIQA 5D7JC 5C9KA 2HWZL 2PO6A 2HAZA 5IVNA 4LKXB 3W39B 1R0AL 2LQRA 4M5ZL 3PP3K 2P5EB 3QXDA 1MWAH 2NY2D 1RU9L 3OJMB 3QFJD 4ORGB 4CMMB 4KQ4H 4PV9A 1DQJA 2VDPL 5EN2A 4KI5F 1HHKB 4MQXD 4RAVA 2X9YA 3VWKC 3C08H 4FQ2H 1KC5L 3QPXL 3GSNH 4U3XA 3PHSA 1EERB 3ARED 4GS7B 5DMIL 5D7IF 5TF1L 2AQ3A 2V5RA 3ZHDA 3M8OL 4X4ME 2BVOB 2WUBH 1H3WM 4S2SA 4C56B 1JF6A 1TITA 3S5LB 3V4UH 3FJTA 4JB9H 5HVGB 3SKJL 1XIWA 2W65B 4ONHA 2AQ1A 4RCAA 3WUZA 3ULUL 2B4CL 3DIFB 5DURB 3IETA 5D72H 2BVQA 1AD0B 4PJHB 1JN6A 1J1XH 5GGVY 1DQQA 3RZWA 3P9MA 5ETUB 1L0YA 5EUKA 5DVMA 1U0QA 2P48B 3EYQD 1DBKL 3BD5A 3FOMB 5MEOB 5LGJA 2PYEE 1QUNA 3CFJA 2YK1H 1G0XA 4K2UL 3RWCA 3HRZA 4CN6A 1NLBL 1KG0A 3EUUA 1BZ7B 2W91A 1JMXA 4EI5A 4P46B 3RVVD 6CGTA 4J1UA 5HYJE 2VQTA 5DDHA 4ZTPH 3C6LD 4GKOA 5E94A 1F02I 5HGAA 4XGZA 4BFIB 1DQTA 4FMFA 4XPBL 2YA0A 1X5ZA 4YAQB 1J87A 4D0CA 3NIFF 3MGTA 1GPOL 5HYJD 2C3XA 3HZMB 3N85H 1INDH 3LPFA 1I7UA 2UZYB 1C1EH 1BFOA 1D5MB 4UDUB 1F58H 1A1NB 5DVLA 4TUJA 1FL3B 5EB9A 5FYKE 4ZXBD 1RZ8A 4LEXL 4MQTB 5CJOL 1MQKL 4F33B 1D9KB 3QZWG 1LHZA 3V4VL 1KIPA 3RHWF 2VR4A 4KAQL 2DS4A 4OIBA 1WBZA 2H9GA 3THMH 2EE9A 3IXTB 1KPUA 1PLGL 5FYKD 3O6ML 4U2ZA 3MRNA 3UJJL 2FX9H 1DLFH 2P5WE 1CL7I 1N8ZA 4UAOC 1BVLA 5HYSA 5D7JD 3BW9A 3KYOA 2FO4A 4U6XA 2WP3T 5FB8A 4DUWA 3OXSA 3MLXH 2H8PA 3CFBA 2V2XB 3T1FB 1A22B 5B8CC 3BI9X 4PRPB 3OGOE 3FFCE 1D5IL 2P5WD 5I1EL 3UTQA 4PRDA 2FHCA 3GSWA 4OD2B 4AJ0A 3A67L 4NNPH 4HXAL 4P3DA 1KNOA 3BKML 3QCTH 2F53E 3CH1A 1JBJA 5KAQG 4JFFE 3FFCD 3G6DH 1EFXA 3GIVB 3QIWB 1O0VA 3B8YA 4KV5E 4RFNB 3LN4B 5E9DE 3F6IA 4QT5A 3CC5A 2F53D 1AE6L 5HSFA 5TQ0H 3MUGA 1KJVA 1MCOL 1H3VA 4M7LT 1CDIA 4U1SB 5EO0A 4K3EL 4KGLA 4R90L 1HINL 1IGCH 1OTTC 5LQBL 5FO9A 1S7QA 4QXGH 5KN5A 4I5BA 3L3HB 5M7QA 2WMPA 3PV7A 1WJ3A 1QNZL 4KY1L 2Q8AL 3NCMA 3ARFB 3VG0H 2GAZB 1UFUA 4NQEA 5IB4B 2AKRA 2CIIB 5DD6B 1HNFA 3LB6C 2Q76A 4Q6IA 5F9JA 5ENWB 4P4KC 4ZUSB 5C0DA 3CFIC 4EUPA 3CPLB 8FABB 5TGBB 3RGVC 3OKNA 1X6NA 3BZEB 2WQ8A 4OCWL 2DLGA 1ORSB 3RDTC 5I0ZA 2AJZA 4H8WC 1GH7A 1A14L 4NQSB 1WEJH 2IH1A 4NC2B 2AK4A 2HLAA 4DK6A 1LO0L 1UEMA 5EOTB 1RUPL 2YWZA 1CR9L 4QHUB 1U8JB 4Y5XB 3DURB 1U8PB 3NCCB 1DDHA 4QXUL 4XCCH 1KCKA 3OGCA 3LV3A 5ADPH 4WJ5B 5BVJA 2DL9A 5H8DA 2YPLB 4MA8H 3DMMD 4YDIL 3GMMB 2HJLA 2V9QA 1IT9H 3PIQA 2R0ZL 4KK8C 3DUSA 2UWEB 3IKKA 4IBLT 4L8BB 5ANME 3V0WL 5JO5B 3UP1A 2J4WH 1BMGA 2JCCF 4NWTH 1UM6L 2I24N 3L3KB 1MHCB 4GUPB 5FV1L 2V7NA 2YD6A 4HZLA 2V2TA 4OZFB 1JNLH 4Y4KB 5DRXA 3U48A 1J5OL 4QYOA 1WWWX 3V2AR 2CXGA 1MFBH 2VL5A 3VGEA 2FHFA 3P4MB 2EH7H 2OZ4L 5BV7C 4OFPA 4ERSH 2BY1A 1PBYA 3LN9A 4YBLC 1TMCB 3QEUB 4OLVL 5IFAL 5DJCA 5BZWB 2PYFA 4AH2B 3MR9B 4HEPG 1KCVH 4L3EA 2FR4A 4NN5C 2C3GA 3TC9A 1LEIA 2N7AA 4Y1AB 4YJZL 2JB6A 3H42H 4LLVB 2AGJL 3MX0A 1AGEA 5HHOB 4JG0H 1BFVL 2CKBL 4V1DE 1UXWA 2F54A 4OGAC 2GK0A 1Z9SA 4OF6A 2HFEA 3BD3A 2QEJA 5I8KL 3UTTA 4DVRL 1U8NB 2BZDA 4PGZA 2A2QT 3PP4L 4ZS6C 1D5ZB 4LLQA 3BYYA 4V1DD 1WC7B 3M45A 3WE6B 3GJFH 2BHUA 4PG9B 4NQDA 1P7QB 4OCSL 2WIIB 4W4NA 5CEZH 4LLUA 5E24E 4F15C 1DTUA 3LB6D 4YWGL 3TT3H 4LVNB 1DZBA 4QRPB 5JUEH 3HZVA 2ZCKL 3W2DL 3VXNA 1L7TH 1D5BB 3RGVD 1T0NA 2MQ3A 1KBGH 4GG6F 3VFTA 1MUJA 2CDEB 4Z7UB 3RDTD 1NGZA 1RUAL 1FE8L 1OGAA 2EEDA 2OR8A 5D1ZB 4PJ5B 1OB1B 4W4OA 5IBTH 2VLLB 3LRGA 5C8JB 4OKVB 2E9IA 2JTDA 1R3JB 5EIIB 4LP5A 4FQHA 1A9EB 2BOBA 3GI8L 4XP4L 1T2JA 3SHSA 1QFPA 3EDFA 4K7PH 3UROR 4KQ4L 5GJTH 1J1OL 1S7VB 5CJXC 5ALBL 8CGTA 2EDRA 4Z7VB 4PRIA 4M00A 3CVHB 4O9HH 4J3UA 3L3GB 15C8L 2C4FT 5D5ME 3K8KA 3HE7B 4F7EB 3CFCL 3F5WB 3SDAA 4IRSB 2B1AH 5ALCL 5IW6A 5EUOA 4YHIB 3WUWG 2F5BH 5DC4B 1IFHH 2C1PA 2Z92B 1T89C 5T1LD 2PR4L 4OUUA 4HH9B 4JKMA 1N4XL 4K3JH 3LVEA 4KMTH 5JXEC 4KHXH 3QCUL 1QP1A 4GLRH 4M8QA 5F72S 4PJ8D 2EDJA 1FFNB 5A40E 4ZUUB 3F7PC 2R0LH 3QA3B 4NZDA 4GBXB 1ITCA 1J11A 4ODBD 2GFBA 5EOCH 4M6NH 2DQEL 3HMXA 1LK3H 2DKSA 2WSKA 2XQYK 4IDJH 3ZKXB 1CD8A 1VGKA 2NW2A 3W0WA 1RFDL 1GVIA 3O3EB 3QQ3B 4JO3L 4OGAD 2KL6A 3L9RB 4XBGA 3DXAB 1BBDL 1X5JA 3MGOB 1R3KB 1QG3A 4X6DB 3CAFA 3HRPA 4ZTPL 2BNRA 4MNHB 4OCMC 3ALXA 3DGGA 4BJLA 3VFPB 4ZS6D 3EFFA 4ISVB 1MPAH 4MJ6B 4MNGB 1CG9B 3GJFK 1KCRL 3WS6C 1WFUA 1T3FA 1TETH 1VACB 1TVDA 1ULVA 3P4LA 2CO6B 2D7MA 3KXFB 4HXBL 4LEOB 3VXUB 5A3IC 5I1GH 5F1KC 4ZUWA 1KJ2B 1C1EL 3RWGA 5ESVA 3HFMH 2LTQB 4RX4D 3JSSA 3GZKA 5K9KA 1Z2KA 1KTRL 2EC9U 2BFVH 5ILTL 4K7FB 3CSBA 3GSUB 1FSKB 3THML 4R7NB 4UU9B 3FQNA 3S37L 1UXSB 2FX9L 1J86A 5ICZB 2NXYC 4CUCA 1QLRA 5C09B 4G9FA 5A2FA 3ABZA 1E4WH 5DFWH 1GJIA 2AP2A 4N0UE 4P2RE 2FJFB 5E08L 1AO7E 4MAYC 2FBJH 4U1LA 5J1TC 1BFSA 4XHQA 1J8HA 3ARDC 1EHNA 1SJHB 3NAAH 3EO1B 5DQJB 4P2RD 4NBXB 1QA9B 3FO0H 1AO7D 3MLWH 3TVMA 4NNPL 3O4LA 2BSTB 5AAWA 5FO7A 3ZT6A 1JHLL 3G6DL 1QSEA 3K8LA 4PJAF 2H26B 2P5EE 4XBPA 4NCC1 3T77B 2RAMA 5CD3B 4HLZG 4Z8FL 5DEFB 4PTTA 3BWUC 1E4KC 1MRFL 2P5ED 4L4VB 5KW9H 5GGUB 1OSPH 1R5WB 4OV5B 3DROB 4IS6A 2YEZB 3S35H 2EIZA 1CFSA 4QXGL 2EDKA 5J0BA 5C08E 4PGDB 1CD1A 4C56E 3G5ZB 3OG4B 4GAJH 2R39A 5C2BH 3VRLF 3HE6B 4XNQA 5JIHA 2VLKA 4MA7H 5CHNA 5J6HA 5D2LF 1F90L 1N5AB 1INEH 5F7DB 2DI8A 5C08D 3QHFH 3TJHD 3WIHA 3GK8H 4C56D 4XCNB 2V5TA 2O93L 3VFOA 1YEGL 5C07B 3QO0A 1Z9MA 4PJHE 2XXMB 3BGMA 5ITFA 4LIQL 3U2SA 4NO5B 1RJYA 1K9TA 2CR3A 5EH1A 5DURD 2EE3A 1S3KH 2J88H 4ODTL 1S7TA 4JM2A 2P8MA 3VH8B 3QZWA 1G7LA 1INQA 2V2WA 4WO4B 5LCVH 4LSRH 3ALWA 4N8VG 4HQQH 1YUHA 5LGHH 2HH0H 5DHVA 5E8OA 4DZ8B 3VDBA 3NPSB 3VCLB 4JDTH 3HUJA 1PDKA 2X4OA 1CFVL 5A3ID 3TIDA 4ZAKB 3ME0A 4XCCL 2QKIB 2E7CA 3ULSB 5LAXA 1YEIL 1I7RB 5GGSY 2LU4A 5HGBB 5CSZA 1GSMA 2A6JB 3W5NA 2CKNA 2J5LB 1Q9LB 4PG2C 4U3HA 3MACL 1U3HB 2DBJA 3PWVA 5ADOH 5KSBA 5IWLC 3RIFF 1Q9KA 4LCYB 1NQBA 2W9EL 1G7QA 2AV7A 2Y7QA 3MJGX 1EMTH 5IVXB 1J1PH 2R2HA 4LMQE 2J4WL 2NXYD 4YFDB 3UJIH 3LKOB 1CFTB 4Y5XC 3AS2A 1S9KC 2NYYC 1XGTB 2E6QA 4MAYD 1KIRA 2X7LA 1R6VA 1K4DB 3V6BR 4XPFL 1FVEB 5MERA 4DKFH 3D3VB 4GH7B 4PJFB 3H9YA 1RULH 1CFNB 1D9KD 3HZKA 4JFPB 2ILLA 3G6AA 3F7YB 1DJSA 3OPZH 1HSAB 3AUVA 3M17B 3BAEH 3IDNB 1KT2A 1KN4H 1MJ7H 4NM4H 4C83A 4N0FB 3X12B 1EAPB 2GIYA 1UACL 1NH6A 1NEZG 2Q7NA 5T5FH 1U36A 1JTPA 3S88L 3PXHA 1E28A 2NTFA 4TSAL 2IPUK 3Q3GA 4YHZH 3WL9A 5I8CA 4MLIA 4E5XA 1UGNA 1QRNB 5DS8B 1WAAE 3VRIA 3TBSB 1IKNC 1P4LA 1OARH 1RI8A 5KVDL 3VI4F 4LRIC 2VN7A 4KK6D 5DO2D 3QIWD 3CDYA 1XH3B 1W0WA 3BDYH 5CEZL 3SY0B 2D7QA 2WK2A 3U4BH 1JYWA 2C4XA 3RKDD 3WKMH 4AQ1B 4NCC2 1N26A 3IJSB 4WHYG 4M1GH 1KEML 1KTDB 4ZD3L 4MD5B 1HCVA 2QHRH 1I1AC 4Y2OA 4IOIA 4LGSB 3GI9L 1EIBA 5CWSB 3T3PF 2AABL 5ESAA 2KKQA 5GISL 3U0TB 4TVSa 3P77B 2IFFL 3CU7A 5J9PB 1PGRB 3S37X 3GMNB 1PAMA 1EO5A 5DQDH 1UM5H 1J0IA 2AEWA 4NHCH 1NMAH 4ZTOL 1AXSA 2DF3A 4UILH 4R2GC 4PP2A 3L3IB 4GW5A 4HMEA 1RZJL 1S9YB 3VXQA 2DQTL 4KFZC 1XZ0B 3JWDC 3D0VA 5HDQH 3RTQB 2MQCA 4RWYL 1Y0LB 1DBBL 2Z9TA 3KDMB 2YD4A 1LP9A 3IGAB 3MO1A 5FOJA 4HK0A 4LPCA 3HI6H 4Z0XA 4F7CA 5FDWA 3ZYOA 2UV3A 1AR2A 4XX1E 1IGJB 4U1MB 3K0WA 1G6VK 1VFOA 2XA3A 5ABDE 3NA9L 3P3YA 3X11A 5ICYA 1S7RB 5DC9B 5IG7A 2B1AL 1G9MC 4JM4H 1GOGA 2CKBB 4OZHF 1ZHLB 5M95B 3WFZA 4DQOL 4KKCD 1M6OA 7FABL 1WFNA 2FLRT 2BERA 5IROA 3LEVL 1XF2B 2B8OT 2NYYD 1BBJA 4JGMA 1CQKA 4JZJA 4Z5RB 3MCG1 2LVCA 5H37H 3AVEA 3IF1A 3LS4H 3V6OA 1RIVH 3MTRA 1NCWH 2J8HA 4IRSC 1J9CT 4M6NL 1LK3L 4NNYB 3U6RA 2D7TH 2IWGA 3TIEA 5HBBA 3DI3B 3I6GA 3I02A 4EI6B 3C5SB 1TJHH 3B5GA 5FECB 1A7PH 3ULVH 2NY5L 4LNRA 4J3XA 2J12B 1WBXA 2YZ8A 4AEIH 1EEYA 1MVUA 2BXYA 5J56B 1QLFB 4WFEE 2D9QB 1UCBL 5E1AB 4IRZH 1E27B 1F3JA 5DD3H 4PJCA 4L1DA 2WBJA 3DTXB 5IQ9B 3EOBB 3BKJH 4OM1H 2GJZA 1S9VB 1IC1A 4L8SA 2EDTA 2RFXB 5DQ9A 4YPJA 3HFML 4K9EH 4Y1AD 4PB0H 2AXFB 4WFED 5D7LE 4G42B 4FFVD 3FO1A 1EV2E 2QSVA 5EU4B 5HHOD 1AC0A 2J7LA 5GS3A 4OF0A 1YNTB 1J12A 3S4SG 4KVCL 1CF8L 4XNZC 1I1AD 3MRCA 3VDCA 1F4XL 2GJ6B 2VZVA 2FZ3B 3PWJA 5D7LD 2I27N 4XB8A 5I1KL 4KV5F 3QJHA 4LPTA 2Z4QA 3D6GA 1EBAA 3VU2A 5DRWA 3GMRB 4HWEL 4TTGA 1E4WL 3JTSB 1YJDL 1RVFL 1DQLH 5FAAA 2FBJL 1CGTA 2X40A 1P7QD 3QUZC 4DKDC 2LTQC 1ORQA 4JQVC 3RPIA 3WUWA 3A6OA 4H26A 4HJGA 2DQCH 4J8RB 4Z7UE 1QSFA 1CDBA 4RRPG 5JLZB 1T7YA 2RCSL 4RIRA 3ZE2E 3L5IA 3MLWL 1AH1A 5HYQA 1DUYA 1YEJH 3QI9A 4I48A 3VXMA 2HP4A 4ESKA 4CL7A 1FZOB 3QULA 2GTWA 4Y2DC 2CD0A 4Z7WB 3CFKB 1RUML 2VL4A 2WWKT 4Y16C 5DJZB 1MHHB 4PJ5D 2VE6B 5E99L 4YDLB 4X5LA 4Z7VE 3ULUC 5IHUH 3LQZA 2NY1B 3NOIA 3VXSB 1GZQA 5FYLL 3MRGA 4ZFGH 4F7TB 1TIUA 3X3GH 4JHWL 5FCUL 4JO1H 1CE1L 1IC5L 3IU3A 4TULL 5EC2A 3ELAT 4UNUA 3HNSL 5L8LB 1QFWI 4G8IB 1FGNL 4K94L 1NMBH 1FG2B 3HS0B 3JWOC 1HIML 5C0BA 2ENSA 3QNZB 5MP6H 1JL8A 3PL6C 4KXZI 1RK1B 4HIXH 3PWNB 3KYNA 3RWFA 4IRSD 5MEPB 2AXGB 5IW3A 2R2CA 3BPLB 3FRUA 4K23H 5HXMA 4ZO7A 4X5WB 2EH8H 4JO4H 1OPGH 2NW3B 3DVGB 4XPAL 5KG9B 4WW2B 4X6FB 3MODH 2RGSA 1S3KL 2DL2A 2J88L 5EU7C 2DLEA 3TN0C 4NRYA 3EJZC 4AENA 1OAZH 4QNPE 4IMLA 4U1KA 4GFTB 2FLBT 4I0CC 1CTNA 3LIZH 4OGZA 4DOHE 4KPHL 4EN3C 4GBXD 1K8DA 2BOCA 3MJ9A 4JDTL 3WJJC 3RFZC 1JWMA 5F9OL 3CZFB 2DM3A 4U7KA 3OAZK 3DXAE 3QWOA 5J7CC 5I1LB 3CJJA 5IMKA 4FABL 3BUYA 3GSOB 4MNGE 5IB5B 3O3AB 1MCWW 4KKAC 3X3FH 3DXAD 5ADOL 2ICWB 3GMQA 5GGRA 2CDGB 3KXFE 3O3BB 3QUXB 3MV7B 4NRXB 2V17H 3OKEA 1EMTL 3U4EA 5HY9B 1J1PL 4AL8H 3O9WC 3HAEB 3ARGA 2BSRB 3NPSC 3IDXH 5B21A 1XGUA 3P4OB 3U30C 4WENB 3KXFD 3VXUD 4O51B 5GSVB 2BMKA 5JIKA 1W0VA 1N5YH 4DKFL 2PTTB 2CGRH 2J5LC 3MREB 4CVUA 3MLYH 4APQC 5C09E 2EYSB 1NAML 1TQCB 5IVZA 1ZGLM 3GHBL 5BS0A 3ULUE 3QEQA 4FFYH 3IFOA 3NFPB 4OFYA 3BQUA 4PJDE 4U31A 4Y2DD 2L7JA 2VQ1B 3D39E 4G43B 4GLRI 4Y16D 1KN4L 5C09D 4NM4L 3WBDA 4TVPL 5T5FL 5DSCA 3TA3B 1EZVX 3ULUD 2JJWA 1KCUL 1F6FB 3JVGA 2VDRH 4YHZL 4ZFFA 3B3IA 2Q86A 4HPYH 4JVPA 4LLWB 2X4RA 4DVBB 3DRQB 3UMTA 4N8PA 2VC2L 4QCIB 1U8MB 1WZ1H 5IMOB 4U1HA 3VD7A 3OKDA 5DVOA 1UJ3B 4XPGH 4XAWL 5L6YH 3VFGH 5JOEA 3WKML 2QQNL 3OJDA 3WDJA 5EU7E 5I74B 2COQA 3DOSA 3U4AA 2QHRL 3VW3H 4OAWB 5C0EB 1FH5L 4I18A 4IOFC 4K3DL 1L0QA 2K7PA 2XKNB 3EZ8A 2IQAB 3TN0D 2I60L 3FCTB 1JV5B 5DQDL 1HH9B 3SEPA 1NC4B 3HE6D 1MHPL 1VCAA 5C07E 4BK5A 3G04B 1NMAL 3SGJC 2J8UA 3LDBB 5HPMA 4EN3D 4CU8A 4O58H 1AHWB 4NZUL 5HDQL 2NY6B 4P9HL 4EVNA 1CD0A 5DXWA 5C07D 1OAQH 4DN4L 4FA8A 5F7LB 3HI6L 3KPLA 4IMKA 5JORA 1Q9WA 2IADB 1LE5B 1R24A 3RHWK 2GQHA 4NKOB 5CP7A 5B39G 2XNAA 2EYTA 1EGJH 4WVRA 5I0DA 4F57H 4JM4L 4X7SL 4PJGB 5ACLA 1PY4A 2HJFA 1WSST 4GKZB 3DX9A 3KPOA 3V4PH 3GSRB 3RL1A 3DYMA 1C08B 3TJEH 3HR5A 3RTQC 4HWUA 1QLEH 5DJYB 4EDWH 4ODHL 4PTUB 1NEZA 3MRLB 3SE3A 1NJ9A 3F7QA 5IVXE 3BEWB 3U0WL 1DEEA 1FRGL 1CGYA 3L95A 1YY8A 4NO2B 3GMOB 1G7MA 3CMOH 4YHML 2EZ0C 1U3HD 4PGBB 1KSRA 5C0AA 5KSAA 3KS0J 4ODUB 4Z18A 4ELKB 5BJTA 2R8SL 1XF5A 3ZO0A 1BGXL 5F70A 4AM0B 3F62A 5B22A 5EBWA 1ZT4A 4P2QE 1PQZA 3D3VE 3EYVA 3FB7B 4FQ1H 3SGEH 1JIBA 4NQUA 12E8H 5GS2D 4B53A 4RGNB 2HVJB 1DBAL 4NQCA 3KPPA 2Z91A 5BOZG 3ULVL 4P2QD 2XZQH 3D3VD 3DRTB 3V6FB 4HIJA 4G9DB 4HAFA 1QRKA 1WBYA 4GW4A 5BVPH 4NHUA 1XGYL 2DLHA 2DMCA 1WQVT 5FO8B 3M1BB 4GQ9L 1AKJA 1BD2B 4Z7OF 1GGIH 5K93A 3BKJL 4OM1L 1LK2B 4QRUA 5HHNB 2VXVL 4K9EL 3P0VL 3PG2A 1QRNE 4YE4H 1PY9A 5DJ8A 3M07A 5DZNA 2UZIH 1ADQL 3ROOB 3MA9H 1EGJA 1WUNT 1UYWL 2Z31A 2OL3L 1BAFH 3F12A 1VFBA 3NH7H 4Z6AT 1NSNH 4XNYL 5IMLB 1MRCH 1QRND 1UG9A 3CDFA 4YHOL 5FUOL 1T1ZB 1T4KA 1AFVL 4MNQB 4ZFOA 3HLAA 1RHHA 25C8L 3NCFB 1DQLL 2A0LC 3OG6B 3QSKB 4JFYA 1I8KA 4L3CA 3MCLL 3QUKB 1DSFL 4KRPC 2Z35B 3OB0H 4KHTH 1IAIH 1KCSH 4J3OC 1LO5A 2DRUA 5IHZA 1NLDH 4MQSB 3QNXA 1DVFA 5A2LH 1YEJL 3MNZB 4I9WE 4DTGL 4JKPL 1UVQB 1VGEH 3QR2A 2YPVL 4OF8A 5EU5B 1T1XA 1RJZA 1KJ3L 5I9QC 3P9LA 4JZNA 2BSED 4PY7A 4R26H 1HQ4B 4I9WD 4PJHF 4PRHE 3NFSL 5BRZE 4UV4L 5CKAA 1U6AH 4XXCC 3P2TA 4MDJA 5IB1A 4POUB 1N6UA 3H6JA 5BW7A 5EO9A 3SJVA 3RTQD 3I50L 1M7DA 3NZHH 4PJ9A 2WUCH 3FO9A 1HE7A 2ED8A 4GAYB 3E3QE 2L0DA 2Q20A 5E8EB 1NMBL 1KFAH 3GMPA 4KTYA 4OB5L 3IAQA 3R06B 2VIRB 1V05A 5JXAH 5L8KB 5MP6L 1A6VH 4YDLC 1KB9K 1H8OA 2YUWA 1AGCA 3KNBA 3ZYZA 5GS0H 3T4YA 2XZAH 1OSZA 4L9LA 4MCZB 2LV4A 4E41B 1HEZB 5FUZH 2HTKC 1UB5A 2A74A 5FIEA 2VH5H 3W82A 1NGPH 4GJTB 3B4NA 2D4DA 3T4AB 5IB3B 1A6WH 4NZRL 2FX7L 4F37F 3OKOB 3S4SA 5IEKA 2XWJB 3OWEA 5FK9B 5IFHL 2EXWC 2HFFB 2ADGA 4W6XB 4TSBL 3T0VA 4H1LG 2NCMA 1JK8B 4LBEA 3BPLC 1NGXB 3VE0A 4PJ7A 1QSZA 1IAIM 4C4KO 2DMBA 3MRMA 2Y5TA 5BQ7A 3HG1A 3KLAA 2R1XA 1XF3A 1I7TA 1TPXB 5E2VH 3WN5C 3FQXB 2ADIA 4NRZA 1DFBH 4WV1A 1HKLH 5A16A 3GMLA 4W6YB 3VXTB 1SJEB 3VJ6A 4X6CB 1KIQB 2GT9A 1KEGL 5TQ2L 4XVSH 1I8MA 5IF0A 2CMRH 4HMCA 3HCVA 5F6IB 1QHOA 3GB7B 3D5OF 3VD4A 1BOYA 2KQMA 2QBWA 3T0DA 2GJ6E 1G7PB 2AJVL 5CFHA 5DMYA 1WT5C 4FFZH 3OB0K 1JNHB 2AQ2A 1A7NH 2HN7B 1AXTH 2JJTA 4KRPD 4ZPVA 3B9VA 2DI7A 3DX6A 4AG4H 3MNVA 3MLYL 3FT2B 1EPFA 3QUXC 5DWUL 4RMVA 3KR3H 3TH2T 2GJ6D 1BVKB 1YMMB 2P44B 5D2NC 4XXDB 1EAJA 1FNFA 1O5DT 2XWBB 4LHUB 3MPCA 3ILPA 1ROWA 1EX0A 1NC2B 3BZDA 4WWKC 1F8TL 2MSPA 2DJ4A 5F7YC 5B38B 4R0LC 4G6KL 1CIDA 4Z0BL 1A21A 5DTFB 2OLDA 4X4XB 4Z7WE 3QDJB 5MI0C 3W5MA 2VXQL 1PKQA 1RIHH 4LSTH 3LAFA 2BHZA 3BPNB 4HIEA 4JZOA 3QO1B 1A4JA 3VXSE 4OSUH 4BSVB 3LHPH 1CXIA 3ZTJG 3N1MC 3TA3C 3EOAB 2DB8A 3MLRH 4NQVA 4WNQA 3VXSD 2E5EA 3MRBB 1U95A 5FHAH 4M48H 3VW3L 3HMWH 1MI5E 2HTKD 4OFKA 4O2CB 3CU1A 3BP5B 3HPJB 2C7UB 4OLXL 4JFOA 4F9PC 4HZAA 2WINB 2VLRB 1UQSA 1IAKB 1PZ5B 5E6ZA 5HI3C 4TSCH 4HLJA 4L5FH 4JANB 1MH5A 4PJBB 2I9LB 5F9DC 1MI5D 2JJSC 3ZZ1A 2EXWD 4GG8B 5I1JH 3VFSA 4G6AC 4FTVA 4GMTL 4YC2C 3SE4C 1RZFH 2H3NA 4QLRA 1OP9A 4FZ8L 2FB4L 2K9UA 1NAMB 1OAQL 2DDQL 2UWEF 2A6IB 1N2RA 3PWPE 2ICEB 1ZANL 2IAMB 3WHXA 1EFQA 4MJIA 5HYEA 4X8JA 3RU8H 1JF1B 1I1CA 5EIVA 3WEXA 1CBVH 4XH2A 1WWBX 2HT4C 4M61B 3MRFB 1JGEA 1FZJA 2NNAA 3LDBC 3OXRA 5FF6B 2A6DB 1N6QH 2J1KA 3V5DB 3WSQH 1HK6A 3V4PL 2P8LB 1FVDA 4YPGA 3TJEL 4MA3B 4CADB 1AD9B 4FRWA 1IE5A 3MV7E 1P4BH 1FDLL 5C0CB 4OLZL 4NM8L 4M7JL 3L7FB 2QR0A 1NAKH 4DKEL 4M6MH 3L3JB 3GFUA 3RBGA 1NDGB 4P23B 3NFNA 5GRJH 2N7BA 1I1FB 4R6UA 1AY1H 2AJ3A 4NPYA 1TZGH 2ZSWB 3EIFA 3QUXD 1EHLH 1JPSH 3MV7D 3VFMB 4NKDB 4WFGE 3DSFH 1OWRM 1X4YA 5DMKA 4D8PA 4B0MM 4JPKL 3GSVB 4UQ2A 5I30H 5K9JL 1NUGA 4LKCB 4QF1B 3MA7B 4IRJC 1JPTH 4KU1A 4LF3B 4P3CL 5JOFA 2HFTA 2JB5L 3H3PH 4XP9H 12E8L 5CLWA 1I1YA 3ZDXF 2ZCLH 2FDBP 2ICWJ 1CFQA 4P4RA 1T7XA 4MD0B 3MOQA 4LIQE 3N1GC 1G6RA 2ITCA 3QHZL 1CDYA 2FWOB 5L2JA 1KN2H 3KPMB 1N64H 4HWBA 4Z7UF 4YE4L 1PFCA 2VUOA 3BVNB 3TPUB 4L4TB 5AAMA 1CGSH 1IJ9A 3TA3D 5MHSE 3RWEA 1MLBA 1TCRB 2X4PB 3QUMA 2B2XH 3W9DB 1T7WA 5DYOB 5D9SA 3ARBB 1DBJL 2VISA 1JPFB 2ZPKL 3VRJA 3NH7L 3AS3A 5DT1L 2APBA 2YD7A 4MGXA 3S34H 5KJRH 4PJIF 3MYZA 2F58H 3BN3B 2YC1B 3DVNB 3TZVC 3MLSL 4JJHA 3RA7L 1FVCA 4X98A 4JFEA 4GRMB 5B39A 3OZ9L 3QEGH 1RZJC 2CRIA 4I0PA 3MROA 5CUSH 5EC1A 2JK5A 3U9UB 1XGRA 1KCSL 3RWHA 4OZGB 4QHMA 4J2XA 3CFDB 5E6IC 1AIFA 3PJSA 1FO0A 4UT6H 3QJFA 1CICB 4XC1H 4UB0L 2DM2A 1H3GA 2FCBA 2OR9L 1FG9C 1TNMA 1VGEL 2EO1A 3T2OA 2FIKB 5CP3A 3IJYA 4R4BA 2OCFD 1MOEA 1NC4D 2VKXA 5TE7H 1B0RA 1CK0L 5SV4A 2VDKL 5DEGB 1CLYH 3KYMB 3UBXG 1SEBB 2FEDC 2ICCA 2KDGA 4U1GB 2NY6D 2ZUQB 2W0FA 4N0RA 4PGCB 4OCRL 4ZG1A 5HVHC 3BO8A 4MJ5A 5DRZA 5CBAB 1KJMA 4CKVX 2FEEI 4WEBL 2FATH 3DUUB 4K7PY 2Y4SA 1NGYA 1VEMA 3EDEA 5DK0A 3SDCA 4X6DF 3QWRA 3MV9B 3FONA 1JWUA 1ZT1B 4LGPB 4MSWA 4POZC 2OL3B 2A6KB 4JQXA 5E8NB 3VGBA 1I1RA 2R56H 4RISH 5C6TH 1MCHA 2QQLL 5CEZE 1QFHA 3GM0A 2FD6L 4LLDA 4E42A 2BY2A 4RZCB 4ELMB 1QVOA 4NO3A 4LARL 3T3ME 3FAXA 1Q8MA 5CEZD 1TJGH 3RQ3A 2ITDB 3FOLA 1MVFA 1Q38A 3I6KA 1SJVA 2GSGB 2BVUA 3CXDL 2IEPA 1XR8B 2VABA 4OZIA 3EFDL 3EGSA 1IEAB 3C8KA 1PYWA 3RVWC 5SWZA 5DZOA 2I5YL 4P2OA 1BZ9B 1A6AA 2ZUYA 1BD2E 1QFOA 4QRQB 4LCCA 2PYEA 4XWOD 5IV2A 4X9HA 1LMKA 5CZKA 1JNJA 3BX7C 4YHNA 3QXUA 3ZLQC 2OXHA 3WFBH 4F58H 1UWEH 3TZVD 1CDCA 1BD2D 2W9LA 4D0DA 1M7IA 2R23A 2ZOLA 1A6UL 2Y6SD 4AEHH 1DLHA 5I1IH 1XF4A 2C9AA 3IVKB 4M6OL 1K85A 2C3VB 2A83B 3Q6GH 2B20A 4GKSA 5I71B 5HGGS 4MNQE 3FB6B 2XQBL 1YQVH 2DM7A 1R5VA 5E6ID 1XF1A 5CJ8A 3FHQA 1MJJB 2DBLL 3BPOB 3G5XB 4FQIH 1FNLA 2DWDA 5FUCC 5DMGC 4M5YH 4MNQD 2YWYA 1MCEA 5D1XC 3LY6A 1FBIL 4R96B 5D7JA 3BRDA 2F15A 3AU1A 4Y5VB 2ZNXA 4XVUC 1HHHA 5T1DL 3OR7A 4FFWC 2VWEC 3IDGA 3TO4B 2P5WA 1LVEA 3C5JB 4JN1H 1TTUA 3DWTA 4K94C 4RDQF 2G75A 2FEDD 3FB5B 3VWKA 5IESH 1K4CB 2EDWA 1RIHL 3ZSTA 5I8EA 4D9RE 3SGEI 2PW1A 4YXLL 5AG8A 3FFCA 2R1WB 3PNWB 5D1QC 4OSUL 1SYVB 4P5TB 1XT5A 3EKCA 1U8LB 2Y9RT 5AYQA 5IR1B 3B9KB 1B6UA 4D9RD 3U1SH 2F53A 4H1LA 3MLRL 4JFFA 5FA4A 3T0BA 4X0KB 1NL0H 1OTUC 2PCPB 4POZD 1Z9LA 2O5YH 3VA2C 2PKDA 5E9DA 1OD7A 1T6VN 2Y25A 5EOCJ 3P40A 4YBHA 4D94A 5C0JB 1FHGA 3IDMA 2VLJE 3TF7C 5I1JL 2PF6A 4JPWH 2CUIA 3P0YL 1QFUL 3UC0H 1RZFL 3PQYB 2JELL 3KJ6H 3QHTC 1ZKAA 2QQQA 3UYRH 3C5ZC 2ARJA 3PV6B 4H25A