2YRLA

Solution structure of the pkd domain from kiaa 1837 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA1837 protein
publication title Solution structure of the PKD domain from KIAA 1837 protein
rcsb
source organism Homo sapiens
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrlA01
1F4AA 3QIUA 4N0YL 3DX6B 1TNMA 1KACB 3BZEB 4QTHB 4J3XA 3OB0K 1QFUL 3IDXH 4MMZC 5JDSA 3QXUA 3GBNH 2CRIA 1HHGB 1IC5L 3QXAA 1S9YA 1FYHB 1RZJL 4G7VL 1SYVB 1HSBB 4JPVL 4UNVA 2Y4SA 3O2DH 5DEGA 2D7MA 3O3UN 3BIBX 4FZ8H 1G6RH 3L1OL 4YNYA 2NW2A 1KSRA 1FIEA 1IARB 1KC5H 5EZJB 1GGIL 1FNSL 4G8GD 2XNAB 2G9HB 4CMHB 3K1KC 3RDTD 1A7QH 3OQ3B 5ADOL 4RNRB 3HAEG 5JLZA 4OZGF 4HKZB 4JO2L 3IU3B 5D7KE 1NCDH 2ICEA 4WCYL 3WBDA 3NFNA 3V6FB 5L2JB 5I15H 2X70A 4G6KH 4YFEA 1YC8A 3ZL4L 3AXLB 3D1MC 2EH7L 4AIXA 3MJ9H 1IGML 2IH1A 4MB5A 5KW9L 1OF2B 3EJYD 1OAQH 1EBAA 1KLUB 2YD5A 5IF0A 3QJFB 3VXSD 2W9DH 4LF3B 2ZUQB 3O41B 3H2WA 4HC1L 3RVXD 3SEPA 1KGCD 3SE8L 2WK2A 4R9HA 1RZFH 4KU1A 2JB5H 2E27H 4ALAL 3MUJA 5D2LE 4WHYG 4PJAB 3GEWB 2VDML 2CRMA 5FDYA 2HKFL 4I0PA 4YDJA 4A6YB 3O4OB 5E4IA 1JPTL 2EXYC 5BVJB 2H8PB 3ZZ1A 5H37H 3IXAA 4NQDD 2O5YL 4OM1L 3IJYB 5GRXG 4Z8FL 4OCYL 2IQ9H 4P2CG 4OF8A 5FXCH 1CTOA 3WXVH 1EHLH 3U7YL 3GO1H 3JTSA 5CMAA 3RRQA 4EI5A 1SY6L 4JB9L 3O6KL 5B22A 1FZJB 5KTEH 3GM8A 3UAJD 3TBVA 3IKKA 4L1HA 1S9XA 3MLWH 3U30B 4OLWL 3LZFH 3RZCA 4FQHA 3CFDA 5CUSL 2F54A 3RKPA 4XNUH 1KEGH 3OKLB 1E28B 1GC1C 3WFEL 1I1AC 1Q94A 2G60H 2Y7QB 1MCPL 4NZJA 5JPNB 2OM5A 2E7LA 5EFIB 3TIEB 1NSNL 2PCPB 4GSDL 1UEYA 4PBWD 4RWYL 1OLZA 1WBZA 4OZHB 4MWFB 1CZ8L 1FLRL 2X4RB 2XTJC 4HLJA 3DI2B 3TCLA 4YEFA 4RAUA 3A6CH 3K8MA 4L4VB 3QIBB 3PGDB 4PJFB 3X17A 5DK3A 3IU4L 3L5HA 4HLZG 2ESVB 2VLRB 3G5XA 3X12A 3EDKA 3TNNB 2D03H 3F6IA 4BH7B 1IGIL 2DIBA 5A2KH 1F3DJ 3F12B 3V79C 4PJ9D 3VW3L 2Z4QA 4PRHD 1DL7L 3QEQA 1HCFX 2KUTA 2DM7A 3O6FC 4TVPH 5I76B 1MLCB 5GS1C 1QFOA 4JFXB 2FR4A 2BVUA 1JWUA 4J3UA 4JRYB 4GUPA 2DQDL 2A6JB 4WW2A 5C6PB 1NMCC 5D1QB 4QHKJ 4X9HA 1KF9B 2Z31A 5FM4A 3IRPX 4JDZA 1AQDA 3IAQA 3RJQB 3RUGA 2Q3AA 4JN2B 1DQMH 2E6QA 1AD9A 1L7TH 2XICA 2Y6SC 5JW3L 3HCVA 1J1PH 4XZUB 1G7QB 2VZ1A 2GTZA 3V5HA 2X7LA 4R3SB 1CD8A 15C8H 3R0NA 2AEPH 4RGOH 4Y4HB 1HOCB 1TZHA 2AV7A 3WUWG 1ZLUK 3IRZA 2DOCA 4WNQB 1UJ3B 5D6DC 5C07A 4D0DA 1KJ2L 4FXKB 3S88L 2JTDA 4M7JH 1NBQA 3V0AC 4PLNC 5C0JB 4OSUH 3SPVB 1HQRA 3U9UA 2D4FA 2YN3A 4G9FB 3ZTNL 2DDQL 3IDYB 3PQYA 5H35B 1MLBA 1J8HB 1S5IL 1F6FB 2ZWLT 4ZYKA 1UWEL 4Y4KC 2H2SC 1DSFH 3FB6B 4W6YB 4X5XB 4XMKH 5HI4D 1GSMA 3GI8L 4Q9QH 3SCMD 5C0CA 3LKOB 5JORB 4ZDHB 1F3DH 3WD5H 4CVWA 4NJAH 4X4MA 8CGTA 4EUPH 1QFHA 2R1YB 5BZWA 4GW1B 1AC0A 3CXHJ 4JFEB 2XY2A 3O3AA 4ELMA 3QQ3A 5GRVL 4Z0XB 4UINL 2XTJE 3RGHA 5IOPB 2B0SH 1A2YA 1GAFL 4NGHH 3GNMH 2P24A 4NCDA 4NCC1 3PV6A 4M02A 5IJVA 1EZVX 1FNLA 2GK0A 2YRZA 4ZTPH 4LLMB 5KJRL 5IR1B 4RX4D 4DQOH 4K23H 4YBLC 3OKNA 3K7UA 2EZ0D 1EMTH 5EO0A 3IDNA 3D9AH 3V2AR 1RMFH 3HB3D 4HCRH 3ZTJH 4FP8H 4ONOA 4OF3A 3AC0A 4OGAD 4OIAA 1MCLA 1QA9A 1LK2B 1A1OB 1UZ6F 4JRXD 5A3IC 1Q9LA 1KT2B 3UTZA 1R3KA 3U4AA 1FYTB 1SJHA 3DVNA 5HYSA 2VERN 3GB7A 2BVPB 2P47B 4HUUB 5J13C 5HY9A 3R8BB 2CLZB 3RWIB 1N5AB 5E9DB 4TULL 1RUPH 1WVZA 4M3JA 5JXED 1YNKL 5B4MC 3LRHA 4MNGE 4ORGA 5JQHC 4LASL 3RNQB 2ZSWA 3U0PB 4LCCA 3ECBB 1QLEL 2J1KA 2HT4D 2NY1C 4JHWL 1HSAA 1S9VB 2IALA 1VADB 1ZT7B 2VAAB 4LLWB 5L7XL 4YHLH 2P5WA 4GKSB 5EU5B 3W9DA 1RFDL 1ZEAL 4UDTB 3MREB 3IKCA 3RTQC 3CUPA 3BESR 3ESVF 1CXKA 1R5IB 2Y36L 4JVWA 4YLQT 4NQXA 4OLVH 1JN6B 5I8EB 5J11C 3LKRB 2F58L 4NO2B 1WFTA 1MCNA 5FO8B 4KTEL 2R0WL 5T1LB 1DQJA 3U2SB 2CKBL 3H3KA 4WUUA 5DJ0A 4JG0H 1AI1H 1UB5A 2FO1A 1HQ4A 5GGUA 3SE9L 2NXZC 2X9WA 2CKNA 2NZIA 3ARWA 1A6ZB 5HHXL 1UKQA 4NO5A 3KJ6H 3MLPA 3TA3A 3TBWA 3MR9B 3DIFB 4NSKB 4GOSA 5B3JE 2H6PB 4K55A 1MOEA 1FPTH 4UUJA 1XCQB 3HFMH 3DVIA 3FCTA 2F53A 4X7TA 3HI6H 4XAKE 4HK3J 5C0BD 2YD8A 1UENA 2YPLD 4GG8A 5TDOA 3FJTA 1YJDC 1T0PB 4KUZH 5CINH 3HI5L 4FQ2L 4YFLI 3T0ED 3T4YA 2GTWB 2A9NL 1ITBB 3D69A 5JHDD 1DANU 3CC5B 4FQJH 4LCIL 2GJ6A 3BE1L 4K3JH 3M45A 4DOHB 5I0DA 1QSFE 3HAEB 5K9QI 1RU9L 2RB8A 3TN0C 4DGVH 5TE7H 1UVQA 2GW5A 3S37H 5CEZE 1MCBA 3ZDXE 1QRKA 3I9GL 2W60A 5I1KH 1NPUA 3S5LB 4P2QA 5GZNC 3IDUA 1LNUA 1ACZA 1XGQA 3MRNB 1XF3A 3GRWH 2K1MA 2HA1A 1JGLH 5GGVH 3L7FA 5EU6D 4I0KA 4JQIL 5FYJD 2YK1H 3QPQC 4GLRI 4JZNB 3DXAB 4X6EB 1VESA 4PRDA 5F1KC 1ZKAA 4ZXBC 1A7PH 1KIRA 4RIRB 3FRPA 3RX5A 1MRDH 1FZOA 5CIPB 4U1SB 3TH2T 1WZMA 5I6XB 2EYSA 4JKPH 3CFBB 2FJGA 1A7RH 5EBGA 1LQSR 5HGDA 2PW1B 2IAMD 2BVQB 1LO2L 3P73B 1M7IA 1WAAE 1XCTB 4ZUSA 5C6WH 1RUKL 2NR6C 5IMLB 5TQ0H 3LKNA 1RZ8B 4GS7C 2PXYD 4LIQL 3TT1L 3BVNB 1U8NA 2Q3ZA 3B2VL 4P2YA 3T4AA 1CE1H 5DRWA 1A6TA 1Q9OA 3M17A 2GT9B 1TZIA 5D7LA 4UT9H 1JF6A 4K8RL 5IFJB 1XIWC 4LHUA 4NO3A 3SGJC 4HIJA 1BQLL 2CDEA 5HHMB 4X6FB 3V0WL 3LRGA 2FHCA 2YPKA 3MYJB 1MWAA 4ODUA 4ZFFA 4XNQA 1J05B 2YUXA 1AGFA 4WWKC 2H1PL 1C5CL 4HIHB 5IEKA 2UY6A 2YZ1A 2H3NA 3CH1B 1SJEB 1LP9B 4NQSA 1Q0YH 4FQXA 5DWUH 5D7JB 4WU7B 4HJ0C 2V2WA 2JB6A 4Y4FD 2HLFD 2MHAB 3C08H 4YUEL 4Q2ZA 3FFCD 3VFRB 3S36H 3CSBA 2IAND 4ESKA 1U8MB 2AXGA 1OL0A 1EUTA 2OS7A 3CVHH 3TYGH 4IHOB 3BD4A 5MP6L 3WN5B 3UTSD 4EN3A 1N5YL 3S3SA 4X6CB 4S1SH 3OKEB 5HDQH 3ARBA 3CK0L 3RWCA 1RHHA 3ARZA 3PJSB 4O00A 2YEZA 2JJVA 5EZIH 2ATKA 3SDAD 4NUJB 2PYEB 2VLLA 3S3JA 3RDTC 2P48B 3MRLA 4TPRH 4G8IB 3LDBC 5DVKA 3WFHB 3KHOA 2VXSL 4CKVX 3X3GL 5J12B 5EOTA 3NAAL 1TXKA 5KG9A 4XB7A 1JPGA 3QCTL 4GT7A 4G6MH 5AUMB 1HKLL 5ICZA 2DD8L 3GIVA 1KB5L 1HH9A 1NC2B 3UCRA 1YYLH 4ODWB 4G42A 1Y0LB 3EJYC 1JGUH 4QRUA 1EBPA 4X6CF 1P5UA 3C2SA 4IIQA 3HE7B 5D96B 4ENED 3IXTA 4MDIB 4MA8L 2KPNA 5E5MB 3WUWB 3KWWA 2HFTA 1TCMA 2UWEA 4F15B 2HVJB 3QUZC 1T4KB 4X6DE 1DBMH 4NHCH 4GXVH 3NCJH 3R8QA 1S7SB 5FB8B 4P2OD 4XNXH 3QPXL 1DBBL 5E0QA 3SDCA 1CE6A 4HJGB 1HZHL 4KY1L 5DRZA 4DGYH 3GFUA 2VISA 1KBGL 4FQCH 5IHZB 1IM9B 4GRMA 4GW5B 2V2XA 2V7HB 4H1LA 5HHOA 1YY9D 3UAJC 5E5RB 2ENSA 3B8YA 4TN9A 1L7IH 4OZFA 4X99A 4AEIH 5AG8A 3MODL 1T1YA 4X9BA 4HUWB 3C2AH 2OP4H 4PJCA 1IZKA 2ITDA 3WV0A 4CUCA 3IDGA 4HQQH 4BFIB 1HNGA 3NIFF 1FFNB 3FO1A 5D5MF 1LEKB 2AGJH 5FYLD 2EH8H 3X14B 5MI0B 4C58B 2D0GA 2DQTH 4ZPVA 1XR9A 4KZEH 4J3SA 4XVTL 1NDGA 4G43B 1XZ0B 4HIXL 3WFDL 4G8GE 2X4SB 4GAGL 1IQDA 4YPJA 4OIBA 1RJCA 3QDMA 1DVFC 1F3JA 5GRYA 1Z3GL 2OSLA 4LPCA 4M93C 1NCCH 3VWKA 2NNAB 5JUEH 4H0GA 2DKMA 5FHAH 1KCSH 4GRLD 3PWPA 1A3QA 2VQ1A 4JQVC 2MPAH 3FN3A 3QXVA 1QG3A 4KI5F 5KSAB 4WEBH 2P42B 2YD9A 1QR1A 4KJQD 3C5ZB 3FHQA 1K4CA 1BEYH 1TZGH 4PJ9C 5D7IB 1GIGH 3GI9H 3EGSB 2Y06H 4XNMA 3EDFA 4WW1B 4HWEL 3RWJB 2L7JA 1F42A 3HZYB 2ICWJ 4JY6A 1F02I 1H3UA 3VXSE 3V4PH 2FRGP 3BSZH 1INEH 5DXWA 2H32H 2FX9L 4LSSH 5I1CH 4AQ1B 1KGCE 1NEZA 2ZCKL 4KUCF 4KH2A 5I8KH 2RFXB 4TVPD 2MQCA 1XGTB 4AIZB 3B3IA 4QRTA 2X4OB 1NGXA 4C54A 1ADQH 2VZVA 3MBED 3BPOB 3LN4B 2DIAA 4CBPA 1JRHH 1ETZB 2VKWA 4XHQA 4NQDE 4YE4L 1HHHB 3UJTL 1X4ZA 4HSQA 1Q8MA 3S35H 2R29L 3RIAF 1XH3A 2EO9A 1WISA 3G5VA 1HWGB 4LSTL 3EYVA 5E2VL 4Z7VE 4K9EC 4XPFH 5JXAL 4KTDH 4LCUA 3O4LB 2YBRB 1OB1B 3SE3C 1XGPA 2XA3A 3PGCA 4JO1H 1JNNL 4HXBH 4K71B 1OVZA 4KQ3H 5CJ5A 3D85D 4PJDF 1T1XB 5FOJA 4BZ2H 1YEJH 5IW1A 1G7IA 1EJ6A 1OCWH 4XXDA 1IQWH 3QDGA 4KJWD 5DTFA 3PHQB 3BO8B 3UTQA 4J4PD 4L3AA 1UXWA 1U8LB 3VFSB 5HI4C 3QIWA 1A9EA 2V5TA 3TGXA 2F5AH 2F19L 2Y07L 4RBPK 1I9IL 2OL3B 3SCMC 1CDYA 3SDXE 3RGVD 4I3GA 3C09B 3H9SD 2BC4B 4N1HB 1JI1A 1N6UA 5FAAA 5EBLB 2N56A 1VKXA 2R0ZH 2ZKHL 2NY0B 2WQ8A 3L5XH 4K7FB 4J2XA 3KYAA 1ZA6B 2N7BA 3AM8A 3TYFB 5CEYA 2O26U 4JFOB 3GJFB 5FYKL 1INQB 2P5EB 4NUGL 4LEOB 3EIFA 4PUBH 3H6JA 5C0DB 2O5XH 1A6AA 3IT8D 3VRLE 5I17B 4U1LA 1MHHB 1I8LA 4I48B 1AXSA 3R0MA 3C8HA 3TEUA 1II4E 3VXPB 3BT2L 1R3HA 3F7QA 3RWGB 4Y5YC 1T2QH 4H26A 1JNLL 5DJ6B 4PRHE 4QT5A 3GMLA 3DETD 2DLGA 4NZUL 1YEFL 3QHFH 2IMNA 2VDRH 4QRPB 3CMGA 3BISA 4P4KC 2VDOH 2BRQA 3RVUD 3UZQA 1U92A 5JQ6H 3EJZD 5L2KA 2GSIA 2BSTB 1GGYA 3QQ4A 1PQZB 3EO1A 4FS0A 2J8UB 1RZGB 2Y5TB 4E41D 2F74A 4M6OH 3IDMA 5JXEC 4HWBH 3QNXA 3HZVA 3GM0A 2UVEA 2VDPL 4M5YL 3LB6D 5FKAB 1JK8B 2X4QB 3LS4H 5L88L 5IKCA 1JZ4A 2HT4C 1VDGA 5I75B 1SHMA 2R4RH 4DEPC 4U0RC 5F7WC 3DBXB 2FX8L 1KTDB 2HFGL 5EZLA 1KXTB 5ESAA 2IMMA 5FKPA 4NNPL 1FL5A 5TDNA 8FABA 1R5WA 4W81A 3KPOB 5DGQA 4H0IA 3L3KA 2X1PA 3NN8B 3V5DA 1X5YA 2AVGA 3L9RB 3QCUH 1Q0XL 1E27A 4QRRD 1ZLVK 2P8LB 3AB0C 2J8UF 2XXCB 4I2XA 2FBOJ 3ROLB 1F58H 1E4WH 1ZLSH 3U36B 1ZS8B 1BWMA 3WS3B 4FTVD 5ERWA 5IHUH 4DCQB 3QHZH 3QUYA 1AXIB 5ACZA 2EDWA 2ICCA 5EBMA 1QEWA 3IYLW 4XP6H 1ZANH 2YUVA 4O5LL 2DTSA 1U8HB 2AJ3A 3T2NH 1NGQL 3WL9A 3QEUA 4L8DB 2V9TA 1YEGH 1QBLL 4MSWA 3BKYL 1UQSB 2LE9A 3MV7D 5E2TL 2WLYA 1GGCL 2R1XA 4HG4K 4LDLB 1MH5B 4U6VH 3OAYK 4XC1L 1MY5A 4OCNC 1JYWA 2B4CL 4P4RA 1MEXL 4XC3L 1FHGA 3L3OB 1MNUH 2AV1B 5I1EH 4Z76B 3KPRA 1H3PH 5K9JL 3C9NA 1CQYA 1KFAL 4TUOB 5GIRB 5BXFA 3QAZC 2FEDD 3T0EC 5CLWA 1IEAA 4L3ED 2IPTH 1ZT4A 4GAYA 4UTBH 3MUGB 4WUKH 1EJOH 1RPQA 3BZFA 4APQC 1N0XH 1X5ZA 4JRXE 5KVGL 3G08A 4DGIH 1P6FA 3NIGF 1RIHH 5BV7L 2C3VA 5C09B 3OAUL 1T2XA 4JPIB 5SX4I 3ARFC 4KGJA 1RUAH 5TF1L 1NBZB 3GSVA 5JIPA 1CLZL 5IK3B 5FO7A 3O3BA 4ZS7H 1AP2A 3KXFA 3OJDA 4YXLH 4QCIA 4DWHA 2FHBA 1K6QL 2R56L 1MI5D 3FQRB 1BLNA 5EBWB 2HH0L 3KPLA 5CLTA 2JJWA 3UDWA 3FN9A 4JO4H 4I13B 1OY3B 5FYKU 4CMMB 2NTFA 2PN5A 3K4DA 4JG1H 1DUZA 3LVEA 4M7LH 3F8UB 4PFEA 4XPGL 3K1DA 5I8CA 2PXYC 4WO4B 1T7WA 5DO2D 3QJHA 3F5WB 4ZNEA 5MEOA 3HUJE 5CJ8A 5MEND 1NCNA 2GUOA 4LLUB 5JZ7C 4RZCB 1Q9WB 4WI4A 1CL7I 1B6DA 4OGXL 3CU7A 1UA6H 3MRHB 1Q9KB 3FO9A 2E8YA 4NN6C 1FNGB 2J5LB 4U7MA 2EDNA 1I1YA 3NPSC 4LLVA 5T1DL 3T08A 5IB4A 3WS6C 5B38B 1U3YA 2J6EH 1PKQE 2EDRA 3MROB 5AEAA 3REWB 5C0BE 4F9LC 5C0IA 4G8EA 4Y4FC 5IB3B 2EDTA 3C8KB 3JZ7A 1FNEB 1VA9A 1NLDH 5IMOA 3P9MA 3T0EE 3MV8D 4Q6IC 2ZNWA 5C0GB 1KIQA 2XZAL 5EOQL 2P8PA 4S10A 5IFAH 5JHDE 1CU4H 1CR9H 1EVUA 1EFQA 2QLVB 3QUML 5HYSG 2YC1B 1IBGH 1GZPA 2Q86B 3T09A 3FHAA 1NUGA 2D9QB 4JFZH 3DRQA 3BP5A 4YXHH 4YC2C 5C9JB 3SDAC 5DZOA 4PJ7E 1ZV5A 2DICA 3P9WB 4HS6B 2CO6B 3RJDA 5EU6E 4YFDB 4YHPA 5FYJE 1U8OA 4JO3L 1QRNB 5D2LA 5K9QG 3EYFB 4LEXH 1M4KA 5LWYH 2VDQH 3TBSA 2LU4A 2ICES 4K94H 1IILE 4IS6B 4F58H 2CLRA 3GHBL 4FMKA 5I71C 3LKQA 4X4XB 1A6WL 3PNWA 2MCG1 1F90H 4Z7UE 5D9SA 1F4HA 1M71A 1EHAA 4P9HH 3WXWH 4YDIH 3ULUL 4DVRH 1J0YA 3NIDE 4DKFL 1MWAL 4ZSOA 4GFTB 4HIEA 4XHJD 5CKAA 2V7NB 1NL0L 2DQCH 1J0IA 1LO4H 4X5WA 3VXMA 1KOAA 4FZEL 3KPNB 5ICXB 4P2OC 2E7HA 4Z7WA 3LKSB 1LDPH 3LPWA 4U2ZA 1TNNA 4P59H 3TT3L 3HS0A 2X4NA 4X98B 1E6JH 4PJ8C 4HKBA 3MA7A 5JW4Q 2VXUL 3W2DL 1G0XA 3C60A 32C2B 5DJ8A 3KPMA 5I1IH 3ULVD 4RFOL 4ONGH 5CILH 4JM4L 2W9EL 5DEGB 1YY9C 2EDHA 5T3XD 3FFCE 3MCLL 5FA4B 1W0VA 4JFHD 4BFBD 5CD3B 1RJYB 2CMRH 3G04B 4YGVB 3PL6C 3V9FA 2IANE 5DMKB 5EU4A 3AMKA 4R4BA 4HUXA 1JF1A 3F6LA 4MXWL 5BCAA 2DYPA 3VRIB 1CD0A 5AZ2L 3ARGD 3E1F1 3UTSE 2B1HH 4LKCA 4F57L 3I6KA 1WCBB 1I1FB 1R0AL 4EOWL 1CG9B 5DRNB 1A3LL 4P23A 2Y5EA 3GHEL 5BVPL 4KRPD 4YO0A 2HN7A 4QOKD 4Y1AA 4JFQB 1I8KA 5C70A 3MFFB 1CDGA 1AQKH 4GRLC 4OFPA 2BOBA 4S1RL 4LRIC 1OSZA 3K4AA 4HZAA 2DBLL 3FRPG 1SJVA 1WWAX 4KJQC 4NKMA 1RY7B 3T04D 2NY3D 4YQXL 3BKJL 5DRXA 4I0PB 2MKWA 4NQCE 2MSPA 4MAYD 1ZSDB 1B0RA 3TESA 3DVFA 1VEPA 4WHYH 5F9OH 4L8SC 3QEGH 2BCKB 1DBJH 4CU8A 4JKWA 3O2WH 4UTAL 2NZ9D 2QQKL 2XWJA 1IEBA 2VDKL 4OF5A 3V5KA 2GK2A 1YEHH 1RQ5A 4LHUG 3PWVA 1UYWL 4EI5B 1QVOB 5F6HJ 1P4IH 3ES6A 3UZEA 3NGBC 1JVKA 1OP9A 2I9TB 2XZCL 5SX5K 3FT2B 2AK1L 2IPKA 2W0FA 1FAIL 1KG0A 4JPWH 1TVHA 3ARYA 1HIMH 5K59E 3RZCB 1P4LB 1XR8B 2F54B 2NPLX 3MACL 1C7TA 1QPPA 1OW0C 3MRFB 4UOW1 1JGDB 3QCVH 5HYJD 3LN9A 1FJ1B 4QWWD 5DFVD 4ZUWA 2VLJD 4N0YH 5M7QA 1TJHL 4KJWC 1EAPA 4NM4H 5ENWB 4J4PC 1QFUH 1ZHNB 2QR0B 3O6LL 3Q3GA 3RY6C 4RQQB 5E1AB 3GSQA 1ERNA 1YECL 5GS1B 4QHUA 1RZJH 4G7VH 5FYLE 3TVMC 5KS9E 1EPFA 4JPVH 3SKOA 4XCEB 4B7LA 4F7CA 4IOSD 1T80A 3QI9C 3G5XB 2A6KA 1NMCB 3L1OH 4JKLA 3BKCL 4EJ1C 2FSEA 3HMWL 4QXTA 3EYOB 4G6AD 2X1QA 4GMSL 4BELD 1G1CA 1GGIH 3O6FA 4PJIA 3JXAA 2Z4QB 3DUUA 3QEQB 4I3RL 2EDOA 3NFPB 1GL4B 1YDPB 5ADOH 2M2DA 2FR4B 2AJUH 1W0YT 4JE4B 4YR6B 4JO2H 4GUPB 1ZLWH 4EXKA 3N1PC 4WW2B 4AJ0A 4WCYH 4M62L 2IGFL 1QQDA 1DQQA 5EU7E 3GBML 2RBLA 1IGMH 3HCVB 5KW9H 3DETC 3OL2A 2GTZB 5ETUA 4MCZB 1D9KA 1S5HA 1KEML 1TZHB 3RVUC 1CDCA 5D4QA 4HC1H 3EJZC 3SE8H 5ECJE 2JJTA 3NCEB 4MNHB 2IF7A 4TVPE 4ALAH 1FE8L 2VDMH 4DAGL 2HKFH 5KVEL 5CGTA 5IROC 1JZ3A 3U9UB 1KJ3L 4Y4KA 1EIBA 4WW2F 3LB6C 2O5YH 4OM1H 4NNYB 3WEXA 4ZYKB 1I9JL 1JTOA 5BRZA 4OCYH 4Z8FH 3GKZA 1A0QL 3RUGF 1J1OL 3H8NA 4BH8B 3BPNB 3BZ4B 5L6YL 1N59B 3U7YH 4NKDA 4OUOA 5C0CB 3KYOA 2X1XR 1SY6H 4OZFG 4PY8I 3LCYA 3GSXB 3O6KH 3ZHDA 1ZT1A 4HBCL 4JN1L 4QHKI 3P0VL 3UYOD 3GSWA 3VI3F 4IMLA 4YBLB 4OLWH 3O3AB 3GMOB 3QQ3B 3VFMB 4MA3B 4N8CL 3DI3B 5CUSH 4HXAL 3ZDYE 1D5ZB 3WFEH 1IM3B 3IJSB 4AK1A 4KV5F 1UKSA 4OTXL 2CLVA 2P24B 1IMHC 1MCPH 3H9SE 5IJVB 4NC1C 1MCCA 3L3GA 1NSNH 2CJUH 3HC0A 4HKXA 4GSDH 5D93C 5J13B 4PRAA 3ZE2F 5GGRY 4XGZA 3OKNB 4N1EA 3MNZA 5EO0B 3I75A 5CGMA 4JFDD 3V0VB 1AJ7L 4X7DC 1CZ8H 3TJEL 5FGRA 2WIIB 3HLAA 2NY1B 5C2UB 3IDJB 4OLUL 2V9QA 3GB7B 3BYYA 3IU4H 4I4WB 4JFYA 3RIFF 3E6HA 4WI8A 1IGIH 2CO7B 3P0GB 4W6WB 1YEDA 4TTDC 5F3HA 3VW3H 3T65A 5HYFA 1DL7H 4L4VD 4GXUM 5ICYA 3QIBD 3WO3B 1NEZG 5BV7B 5J11B 4XRCB 5HI5D 2ESVD 2VLRD 4ODBD 5KSVB 1T7ZA 2DQDH 3GK8L 1HSAB 4MJ5A 4D9QD 4OUUA 4Y16D 3G6DL 1HHKA 3IKCB 3H9HA 2DLFL 5JW3H 1JJUA 2NXZB 2NY7L 4KK8D 2BXZA 3DTXB 1QSVA 4DKEL 5EIIA 2DJSA 4A2LA 2FZ3B 3ZYJA 1AHWA 5D1QD 2DWDA 1CGTA 1OARL 4WUUB 4X7FC 5DJ0B 5E6YA 1KJ2H 2GEEA 3MLTA 1G7HA 1MY7A 3CFKB 3S88H 5GGUB 5INDA 1AO7B 4ZFOA 1ES0B 3HI1A 1S7XB 1UCBL 3MLXL 2MWCA 3VGBA 4Y4HD 2DN7A 5J1SC 3ZTNH 1B3JA 2DDQH 4QYOA 2J12B 4QRRE 1D6EA 3K8LA 4FNLL 1S5IH 1BF2A 2DQJL 4WY7L 1UWEH 5F3BA 2Z9TA 1X9QA 1CLOH 2A1WL 4FTVE 2VWEC 1U8PA 4L29A 4D0BB 1BVZA 2VUYA 1JV5B 1F5WA 4DFIA 3STZB 3QULA 4UUJB 1TTFA 3BP4A 4G9FD 5DA0B 4WI2A 2SEBB 1WQVT 4MXVE 1UG9A 3UYPA 1CD1A 1J8HD 2P44B 2W92A 5F7HA 3CSYB 1OGAA 4WEMB 5FOBB 3TV3L 3MV7E 1NANI 4AIOA 4YIQA 4UINH 1NCWL 4JPKL 3D69B 2DMCA 1MUJB 3T2OA 1G9NL 1CFNB 5FGBC 3TN0A 4OV5A 1NGZB 4P5TA 2PO6B 4JFED 3ZYOA 1UVQB 1MQKL 3WIFA 43CAB 3R06A 2HJFA 1PLGH 3CFIC 3I50L 4L3EE 1KUMA 4F7PB 3JWOL 4IEFB 4LGSB 4P2QB 3QUMB 1XGQB 1XF3B 2WBJB 4LSRL 4NNXB 3LQAH 5I1AB 1FGNH 3WLBA 1JNHA 4OJFL 12E8L 4TNVF 4D9LL 4Y5VA 1JPFA 3IETA 3PP3K 2FYYA 2XFXA 2XPGA 3VXQA 4PRDB 3HNVL 3BHBA 5HHQA 4KXZI 3LHPH 4TULH 1GGTA 4OF7A 3PWUA 1YNKH 1KLGA 4X9IA 5IMKA 2HLAA 1XIWB 4OAWA 4XCFL 4X6DB 2LAAA 1KPRA 1FYTD 5HGDB 4LASH 5SV3A 3QNZB 4I1NB 5E6IB 1ZVSB 1QLEH 4RFNB 1A14L 5T3ZL 4JHWH 4KK5C 5L8JB 3R1GL 4QNPF 5T1MA 1MI5E 5E9DD 5L7XH 2R69L 3T4AB 4IRSB 5DFWH 1A6TB 3M17B 5EUOB 1ZEAH 4F2MA 1TZIB 5D7LB 1OTUD 4HHAA 5F1SA 5BZDA 1S7VB 4HGWA 4NOFA 2Y36H 1HXYB 2L0DA 4LHUB 4CAGA 1UWXH 4P9ML 2A9ML 5EC2A 2CDEB 1K2DA 2F58H 3UBXA 2X41A 2C4XA 5SWSD 2EDBA 1ZHBB 2YPKB 2VWEE 2ADGA 4KTEH 3QG7L 2R0WH 2C7UA 4ZUVB 5IB5B 4ODUB 2CKBH 4ZFFB 1BAFL 2I07A 5MENE 3KYMA 4XHJC 1T89A 5IB1A 3SE9H 2V5RA 5HGGS 3RPIB 4YXKH 4GRWB 2BVTA 4Q7DA 3WIIL 2XN9A 5T1LD 1G9MC 2VXTL 4RMRA 5HHXH 2G5BB 2Q76B 3TJHD 4Z7QE 5EUOF 2ITCB 2AXGB 1WWBX 5EDXA 5J9PB 1P9MC 5CP3A 4EDXB 1QLRA 3OWEA 3FMGL 4PGBA 5AWNL 2DQIL 3UPCA 3ULUF 1AKJB 1N64L 4Y8DC 5DMIL 3MCKA 4CVXA 3MV8E 3F58L 3RDTA 3HI5H 4FQ2H 3U7AA 2YEZB 5GS0D 3IS0X 2ATKB 4PRBA 2AABL 2VLLB 2A9NH 1ZA3B 4WI3A 2NMSA 3W5NA 3HZKA 1NCDL 1YPZB 2C1PB 3KJ4C 4GRWF 4R26L 3UX9B 3VXSB 3ARGC 3MRDA 4LCIH 3BE1H 3SBWA 4HFWB 2NYYD 1BD2E 1CF8L 4X0KB 1DE4A 1RU9H 3WHXA 3DMMA 1MFAH 1F00I 4TYUA 1JPGB 4S1DD 1LVEA 3I9GH 3PF2A 3QDAA 3GIVB 1HH9B 4OFYD 5GGSY 3QUZB 2FWOA 5DHXB 4QRUB 4HD9A 4ONFL 3UEZA 2Q1EA 2EDXA 2X2YA 2NY4D 4BM7A 4JQIH 3VGHA 4ZPTB 1XAUA 2PF6A 1EAJA 1MFCL 1NMBL 4WWID 3VGGA 3BKMH 1YPZF 1T3FB 5J0BA 4RISH 1X3DA 2I5YL 3CZFB 4HZLB 4LVOB 1LO2H 2IQ9L 3DXAD 3FAWA 1RUKH 2GAZB 2HFFA 1EHLL 4XNYH 3ARSA 3E8UL 4LIQH 3FRUA 3TT1H 5DRZB 3B2VH 1J9CT 2VISB 1Z5LB 4K8RH 1PY4A 5I1DB 3BH8A 1JWSB 3E6FA 5DMJB 1BQLH 4IDLA 4OZFB 3HPJB 5IHBA 1KPUA 3VXRB 1DVFB 1JUFB 3DROA 3GSNA 4HT1L 4M93B 4PJCB 2ITDB 3IDGB 2H1PH 1C5CH 3ULVE 4UOJA 5FV1L 3FO1B 1J0HA 2B5IC 1G7PB 4NKQB 5T3XE 5F9JA 4N0UE 1XGRA 5C92A 2VIRA 4JFHE 5JOEA 4QWWC 3I2CH 5DFVC 4YUEH 3RWHB 1UH4A 3HPLA 4PJ9B 3MRGA 3QDMB 3VI4F 5E8NA 1F3JB 2LAGB 2OSLB 3T1WA 3Q5TA 3VWKB 1T04A 2GQHA 3QG6B 4TRPL 1AGEB 1P7QB 5MP6H 4UMGA 1N5YH 2D03L 3QDHA 1QR1B 3CK0H 2BNRB 4PJCF 4PRHA 4QOKE 4OFVA 3A67L 1OGTA 3SJVA 1Q72L 5EN2A 1X5JA 3VFOA 4PGEB 1JRHI 1NGPL 1NEZB 3P30L 2VXSH 2IBZY 1U41A 2CXKA 1Z0MA 2EYTB 4PJHA 3NAAH 1L7TL 2PYED 4KAQL 4CMHC 4EI6B 3B3IB 3OF6A 1BVKB 3FB5A 3QCTH 4PYHA 4QRTB 1NGXB 3FT3B 2DD8H 2VO5A 5F1NB 3DO7A 1KB5H 3GMMA 5E95B 5DQJB 1XF1A 1BFVL 1ITCA 1KYOJ 5FUZL 2BERA 1YEIL 5H37G 1XH3B 4MDJA 4AEHL 3EYVB 5IT2L 5EA0L 5JIIA 4LCUB 1NC2D 3BIAX 4OSUL 1DDHB 1XGPB 4QRSB 5GGQL 1BOYA 3Q5OA 1PBYA 1QOKA 2PETA 3VDCA 3BOVA 4JFPB 3HE7D 1AIFA 1NQBA 1S78D 1YMMA 3QDGB 4JY5H 4MD0B 4OCWL 5DTFB 2OYPA 1RZKL 4LMQI 3QPXH 4XMKL 1DBBH 3RVTC 1UXWB 4JCLA 1HZHH 4KY1H 1DCLA 4FFWD 1KBGH 1YN7A 3O4OC 4PTTB 3S8WA 2P8MA 5HYJE 4MHHI 3WD5L 4RWHA 2Q6WB 3PWNA 2JK5A 1H8NA 1FNHA 2VLJE 2VAJA 4HWZB 4U0QB 3L7EB 4NDMB 3WNKA 2VTFA 5DJDA 4QHLA 2NW3A 3MODH 1UM5L 2AP2A 2D3VA 1IM9D 3VFUB 2VE6B 3QZWA 1HI6B 2Z8WC 5F7LB 4JRXB 2ARJA 4P4KB 4ZTPL 1K8DB 4U1LB 4RX4A 4OZGE 4Y5YA 1RJZB 2H26A 3U30C 4KI5D 2E7CA 2QV2A 2D31B 4NBZB 2APWA 4XVTH 4FXGA 4HIXH 1R3HB 3G9VA 3WFDH 3WKNA 5IGXL 2GSGB 3QFDA 5F97E 1OAXL 1Z3GH 4AL8L 5IG7A 5DVLA 2EYRB 3ARXA 1IGYA 1PZUB 2QHLA 3CVIL 1EX0A 4K7PY 2LABA 1U92B 3FQNA 2V17H 4OKVA 4KUCD 4DEPB 4WHTA 3SOBL 3EOAB 3EO1B 3CH8A 5JXEA 3MGOA 3FOLA 5ILTL 4EBQH 4NFDA 4LVHB 1QBAA 3IDMB 1ZHKA 2C3WA 4NQTA 3LQZB 3QNXB 5HJ3B 4HWEH 3HZVB 4NRYB 3QIBC 1FORL 4LLYB 5KSAD 4M6AA 2O61A 4M1DL 5E2WL 3RNKA 3AB0B 2FX9H 3N9GL 5HI5C 1KTLB 1IT9L 4YHLL 2DLEA 3C5ZD 2ZCKH 4GG6B 5HI3D 1G84A 1QKZL 3CPLA 4GBXB 4Y16C 3RWDA 5EZLB 5FKPB 3Q6GH 1R5WB 5IWLC 3U9PL 3L3KB 4NKOB 1T83C 1VFBB 3M1BA 4YE4H 3UJTH 1EUUA 4I2XB 2R29H 4TSBL 5D1QC 5E99L 1UH3A 4MD5A 2X5PA 1TETH 4LSTH 4CNIB 5E2VH 5JXAH 3RWEB 3LPFA 5IJKC 3CDFA 3DYOA 1ORSA 1P2CA 1PKQB 1MREL 1JNNH 3QYCA 2H41A 4O02L 1QEWB 3OG4B 2YD7A 2YPLB 4Y4HC 4WFEE 4FHBD 4UT6L 5SWZA 2AJ3B 4GG6F 4NZRL 3WL9B 4AT6A 5D1XA 2EDYA 1U3HA 2YD4A 1FPTL 2PW2A 3O4LD 4MSWB 3T0EB 4EUPG 5I18L 4LOUC 3QO0B 5J1TC 4IRZL 4ZD3L 5C0BA 4APQB 2P46B 1Q1JL 2F19H 2Y07H 5FK9A 1I9IH 3IDYC 4RAHA 2J8HA 2HT3D 3FQXA 4PG9A 2JELL 4FABH 1B9ZA 3KPRB 3TPUA 2ZKHH 2F15A 1FVCA 3ARFB 3C9NB 4CW1A 4RA0C 1F4XH 4NUGH 2GI7A 1K9TA 2Q7YB 3BZFB 2A6IA 5H2BB 3G08B 3FQWA 2Q7NA 4LSUL 5DGRA 3B9AA 1ZWIA 2NY0D 4DGVL 3S37L 5AAMA 2W1NA 4MAUH 5E8EA 2WUBH 4L4TB 5FF6A 3ALXA 1BPVA 3BT2H 1NKRA 2P5ED 1BJ1J 1JNLH 3GMQA 5FO7B 3KDMA 1I7RA 4L4VE 4NZUH 4PJFE 5EU6A 4PBVC 1YEFH 1UEMA 2IH3A 4NP4L 1AD0A 1MVUA 4CRPA 4P5KB 2NY2C 2YK1L 3KXFB 1KCRL 2ESVE 2VLRE 5CSGA 4Q6YA 5FA3B 4X80L 4D9QE 2WANA 1CXFA 3IB4A 4PTUA 4QCIB 1J0JA 2XZQL 3K2MC 2OJEB 2IAMA 1U58B 3MPCA 4X8XA 2BJML 5BW7A 2NTFB 4Z7UA 4ZFOL 3U0TA 3HG1B 1ZTXL 2VDPH 4M5YH 4HX1B 3RL2B 4ZUUA 5L88H 1X5HA 5D8JL 5I8CB 5IBLD 3EHBC 4KC3B 1VFAA 4YHNA 1C5DB 3PWLA 5MEOB 2IQAB 2FX8H 2NXYB 2HFGH 4RFEA 4QXGL 2EXWD 4NNPH 4Z77B 1JZ2A 2N4IA 4G8FA 2GUOB 3KLDA 1Q38A 1ACYL 2DL9A 1YJDL 4M6NH 2UYLA 2GFBB 4F33A 1I85C 3WS6A 5DVMA 3FO9B 3NACL 4P5MA 1N26A 5DUPL 2IANB 3ZE0E 4NN5C 3GKWL 4U1KA 1Q0YL 5DJAA 5DWUL 4G9FE 4J12A 3SQOL 1E6OL 1DP0A 5C0IB 1LMKA 1BJ1H 1J8HE 4P9HC 3UTSB 4O5LH 1AGCA 5HVFB 4EQ2A 5J3HD 4WDIB 1NGQH 3MLZL 3S4SB 2GJZA 1QBLH 2XQYK 4XXCC 3TJHC 3BKYH 4YC2B 3SDAB 1FIGL 2X4TB 1CICA 5E2TH 1GGCH 1DEEB 5GS2D 1G6RB 1UZ6E 3OBAA 3UJIL 3QFJB 4XC1H 2B4CH 2N1KA 4LSQL 3VD9A 3OX8B 1MEXH 4XC3H 4M1CC 3SDDB 4JFEE 4XP9L 5K9JH 4OLYH 2XG5A 3LV3A 3PIQA 1KFAH 2FIKA 3DRQB 2J2ZA 1HYSD 3QDJB 3MRPB 5I71B 4OD1L 5KVGH 3VH8G 3FQUA 4NYLA 3MGTB 4BZYA 1FFPA 5L8LB 4S2SB 3U6RA 4C56A 4NQED 5BV7H 3OAUH 2NYYC 3OAZH 4U1GC 1NAMH 5HGHB 1X7QA 4S1DC 4EVNB 1CLZH 1WZLA 4NQCA 3HZMA 4DVBA 3CAFA 1GOFA 3RBSA 1SQ2N 1FYTE 4QKXB 1EK3A 5C09D 4GW4A 3PNWB 4P2OB 1R5VA 4MD4A 2NY4C 1M71B 4ZO6A 5F1IA 1S7WA 3C6SB 3OR6B 4QGTA 4WJ5A 3WKML 2YXMA 3PHSA 1VGEL 5E9DE 3OGCB 1K3IA 4PJ8B 1K6QH 2R56H 3QEHA 4F9PC 4NRZB 1T0NB 1MF2L 4IBLT 4GLRH 4X5WB 3ISWA 1SVZA 5I2IB 4PPTA 2W65A 3ZKND 5D2LF 3DUSB 1W72A 1KJVA 2FECI 2VZSA 5SWSE 5CWSA 4Z7WB 3PL6B 3VFWB 3KPQA 4XPGH 4OCSL 3H7BB 3V6OA 3MRBA 4LSVL 1MJ8L 5I6XC 4OI7A 4HKBB 3MA7B 5CZVL 2VH5L 3C60B 3IFNL 4TTGA 3GUTA 3KPMB 3BN9C 3MRCA 2R2CA 2MFNA 4K3EL 4OGXH 1M05B 1W0VB 2EE3A 1FBIL 4WO4D 1V5JA 4PV9A 1CFQB 4P3DA 1IL1B 5I19H 3IJHB 1C16B 4HQQL 4MVBD 4R4BB 1DN0A 1XT5A 1SEBA 4HUXB 5E8OB 5T1DH 5A16A 2WIMA 4R0LA 2AGJL 3ROOB 5DJCA 3QA3B 2DQTL 5IP4A 2DBJA 5J4MA 2D7TH 5IESL 4Z7WF 4HUVA 4YHIA 4LKCB 4NBYB 3DHJA 5GISL 1P69B 3UTTB 3QO1B 3U79A 2YA0A 1NCCL 2H2PC 4LPTA 4Y1AB 4YO0B 2XZAH 1KCSL 4GAJL 5EOQH 5FHAL 4Y19A 4HH9B 4Y88A 4LNRA 4N5ED 2OCFD 1A1MA 4W4OA 4UU9B 2DRUA 4LP5A 3V8CA 3FAXA 5L0QB 1PY9A 1BEYL 3GSUB 4CVZA 1JL8A 3EFFA 5TH2A 5TDPB 1H3WM 1RZJC 5C3TA 5DRXB 4HGKC 2RAMA 2CGRL 5DI8A 5HGBB 3M8OL 4L8SA 5C3LD 3NGBB 4CADB 2EIZA 4DOHE 4M7LT 3WN5C 1YNLL 3BGMA 4H8WL 1ORQA 4P46C 2BMKB 4JO3H 5D71L 5K9OB 3PXHA 3BPLC 3HMXA 3GMPA 3MV9B 4LGPB 1ADQL 3MBEA 3ARTA 1WBYA 4B50A 5D2NC 2XWJB 1IEBB 1WWCA 3V5KB 1QUNA 5C0FB 4MX7B 3ALWA 3BRFA 4LKXA 4WRLA 2JJSC 4WFFD 3GHBH 5J1AA 2Z0BA 3ES6B 1FFOA 3S35L 1ZLWK 1A6WH 3BP7A 3DXAE 1QRND 4PV8A 2W0FB 1XF5A 1KG0B 4Y2OA 3V95A 2FJHA 1OW0A 1TVHB 5J12C 1B2WL 3ULUH 1UKTA 2NX5A 1OT2A 1MWAH 3D85A 3ILQD 2E8ZA 2IBBA 3AGVA 3GSNL 2RCSL 2K7QA 5LG1A 1YEJL 2FJFA 3QWRA 4WEUD 3TVMB 1NL0H 3L3DB 4TVSa 2ZOLA 5ITBL 2GCYA 2F9BT 4FZEH 3U48A 3QI9B 3HE7C 1S78C 3WHE1 5BS0B 3LSOA 1LO5B 3TT3H 5JPMB 2F5AL 2DQFA 3RGVA 1CDUA 4EUPB 3GSQB 2VXUH 4YDVA 3W2DH 1ZVHA 1QFWI 4RFOH 1M7DB 1T2JA 3OMZA 4F7CB 3BH9B 4X4YA 3O8XA 4JM4H 1N2RB 2W9EH 1BX2B 5IV2A 2R2BB 4KVNH 1MRFL 1HHJA 2FSEB 4MQ7A 2KKQA 2PNDA 5F6HI 2VZUA 1NCAL 2O5XL 3U83A 4PJIB 1LP9E 4EIGB 3DUUB 4MXWH 5K9KA 4PLOB 4LAQL 1LEGB 4TUJA 1CFSB 4E5XA 1OWWA 2KL6A 4Q9CA 5AZ2H 4NZDA 2R2HA 4RDQG 1MFEL 1K4DB 3SO3C 3NCBB 3VWJC 3CX5K 5IIEB 1I8IB 4F57H 2FNBA 1T2QL 4KI5C 1R0AH 4PD4J 4EOWH 3L3IB 1A3LH 3RI5F 1QQDB 3GHEH 3O11B 5BVPH 2V2TA 2KQMA 4E41B 2FB4L 4XP1L 1BVLA 3BP6A 1MJJB 3QXDA 1SMOA 2KZWA 4NBXB 3WJJC 2VDRL 5HHNA 2VDOL 2HAZA 1EGJA 2P45B 4PJGB 4X6CE 3WFBL 3DOSA 1D9KB 2BY2A 1TQBB 1XF2A 2A2QT 4WFGD 4AG4L 2I9LB 2DBLH 2DLIA 4PJIF 2VR4A 2PYEE 5DVNA 1IGJA 1EEYB 3MNWB 4YQXH 3BKJH 1G6VK 4ODXA 4LLQA 1BFSA 4D0CA 1CK0L 2XKNA 5KSAC 5JOFA 3U4EB 4QRRB 2AKRA 1YUHA 1K5NA 1NCBL 1HYRC 5BRZB 1T5WB 3CLFL 4UTAH 2BSRB 2DQUL 4I0PD 2QQKH 4KVCL 4U1HA 1BGXL 5HI3C 4O9HL 3RIAK 2X89D 5GZOD 2VDKH 3MLRL 4PJGF 1BZ9B 1U8JA 3KYOB 4KI1A 1UYWH 5CGYD 1ZT1B 4Z5RA 3L5WB 4OD3H 2XZCH 3GSWB 2AK1H 5F7DB 4IMLB 4H1LH 1FAIH 4UZGA 1N0LA 5DK2A 3CD4A 2NY6D 4J3OC 2HTKD 4D9RD 4OZFH 2EO1A 3RQ3A 3ARDC 3RL1A 3MACH 2LVEA 5JW5A 1SM3H 3VJ6B 3BPOC 4EI5D 5JMOC 2NTSP 5DHVA 1I75A 3NIFE 4JAMB 4IJ3B 5D5ME 4HV8A 5CJBA 3HC0B 4HKXB 1OLLA 4KJYB 4XGZB 2GIYA 3EO9L 5MERA 3MV7A 4P57A 4Z6AT 1TJHH 3RZCD 2F54D 1RJLA 3QUXA 4HPYL 4D2NA 2PR4L 4U6VL 3FTGB 4LPXA 3O6LH 4UQ3A 5GGTA 3V6BR 1JTTA 4JZOA 1YECH 1GRWA 2HP4A 4MHHG 4KI5E 2HT3C 1A3RL 4MB3A 4OFIA 1V3MA 3C5SA 3N1MC 4L3EA 3BKCH 1S7UA 2ADFL 3E6HB 4XNZB 3HMWH 1S7RA 4UTBL 3IFLL 4GMSH 1K8IA 1YEDB 3K80A 3FB7A 4Z18A 3JVGA 1IAIM 3T65B 5GGRA 1A4JB 1WTLA 3PHOA 3C09C 5LGJB 5A2IH 4O58L 1TDQA 5FUOH 2D0FA 3VH8B 3C87A 2LU7A 5DEFB 4MJ5B 5FYKD 1KNOB 1UXSA 4M62H 2IGFH 5FFLA 3AS2A 2Y6SD 1A9BB 3CXDL 4U1IB 4QHNA 3QEQD 3GBMH 5E7FA 4ZTOL 4R96A 1FVEA 1L9MA 3GJFK 3H9HB 3VXUA 5CSBA 1FC2D 1CGUA 4LLDA 2ZUTA 3FL7A 1KEMH 4KK9D 4MJIB 1MI5A 2DWDB 2VABA 1OD9A 1CQKA 5D7IE 5KOVC 5FO9A 3TZVB 1IAIH 1FE8H 4DAGH 4FQQB 5EG6C 1OAUL 5KVEH 3MNVA 4U1NB 4YHOL 1KJ3H 1NCTA 1WIPA 4ZFZB 1U91B 3HE6B 5T33L 2H2SD 4KROC 1LE5A 3SGKA 1I9JH 5KN5A 3IAGC 4L8BA 1GZQA 4L29B 1A0QH 5IFHL 5MENA 1J1OH 1F6AA 3QULB 1U8KA 4E0RB 4WFHD 1TCRA 3L3JB 5EUKB 4HBCH 5DYOB 4JN1H 5BJTA 3P0VH 4AZ8A 1T21A 1Y6KR 3D2UB 5AG9A 2YD2A 1OGAB 2QADD 3O4LE 3ZKXB 3AY4A 2C3HA 3QZWG 1MCJA 1Z6JT 4GKNA 5MEPA 4N8CH 5AYUL 4YIQB 2X4UB 3LQMA 4HXAH 5C0CD 1TTUA 4OTXH 4OV5B 4O2CA 4HEPG 1KXQE 1H8SA 3JV4B 2Z93A 3Q6FB 1NLDL 4IOFD 2A6DB 3MV8A 5DR5L 2XWTB 4LBEA 2Q8BL 5KVMC 3THML 5IFAL 2OTUB 1JYNA 4DN3H 5FGCB 3AS1A 1AJ7H 3B5HA 3TJEH 2BVOB 3HR5A 4GKZA 1IGTA 1BD2A 1JNHB 2F5BL 3ULSA 1B0GB 4MLSA 1V3JA 4OLUH 1JPFB 3IETB 1R3JA 2X4PB 4J1UB 2P5EE 4PRIB 5IM7A 3C6LA 5IMMA 3WLWC 1NBYA 1HYSC 1PDKA 1PG7W 1CFVL 3FQTA 1DN2A 4ZNCD 5KAQG 4B0MM 4JHAH 2NY1D 2RIKA 4HJJL 4MCYA 2R23A 2CIKB 1T1WA 4AM0A 2UZIH 5LWYL 5HDBF 2VDQL 3GK8H 5EULV 2EKSB 4LPUA 1DQLL 1EO5A 4MMXC 5EB9A 3G6DH 1BHGA 1G9EA 5BZDB 4PJEA 5C0RL 3OKKB 4QRPE 4HGWB 2DLFH 4XWGL 2NY7H 1F90L 1TVBA 4F8QA 4V2CB 3MOBL 4DKEH 1K2DB 3QQNA 2J8UE 4FQLL 3OKYA 2ADGB 3FT4B 5IVXA 2MCPL 3BN3B 4ORZC 1OARH 4O51A 4XVSL 3B9KB 1A22B 1AGBA 2Z92A 1OPGL 2NXZD 2HVKB 1JHTA 3KYMB 3LN5A 2GY7B 4PGJA 5IB1B 1EFXB 1PVHA 1UCBH 3MLXH 3BD5A 4JZJB 1LDPL 4J23A 1BFOA 4HWUA 4FNLH 4IM8A 4QEGA 1FN4B 1Y6NR 2B7DT 2DQJH 2FX7L 2FH8A 4WUUD 4WY7H 5DK0A 3RAJL 1P9MA 1WC7B 2A1WH 3SKMB 1P84K 3KPSB 3KYKL 1AO7D 1U8IA 2FECL 2XWBA 1LHZA 1FV1B 4DK6A 1V05A 1X4YA 1T1ZB 1PG7X 4KKNA 1CGVA 1I7TA 1U36A 3T3MF 3TA3D 4CVXB 1FRGH 1A02N 4WO4C 3TWCL 1BWWA 2BFVL 5J06A 3TV3H 2HRPH 1VGKA 1KB9K 4K8RC 4PRBB 1U93A 5I1LA 1S9WA 1NCWH 2F53D 3ARGA 2I26N 3OHXA 1DFBL 4Y5XA 1G9NH 3D0LA 4PGCA 2G2RB 5KSUA 1R24B 4HH8A 2UZYB 3O3DA 4UIKL 2J5LC 4QOKA 1G7LA 2LTQC 1MQKH 5E7BA 2UUDH 3D39A 3MV01 3VE0A 4R2GB 3I50H 2Q20A 1PYWA 3NCYP 4OZ4A 3B43A 3JWOH 3AAZA 2XKUA 1E4XL 2CRZA 2FWOB 3BWAA 1QBBA 4JDVA 4LSRH 3CLEH 4N5EC 4HS8L 5IBUG 1UB6A 4OJFH 12E8H 2PO6D 4NQEE 3GMNA 4D9LH 5IW6B 2FLRT 4I9WD 5DQ9A 6FABL 1N4XL 5GRUL 5CJXA 3HNVH 4P2QD 1C08A 4MAYA 3L6FA 4IRJA 2WBJD 2H32B 2BNQA 2R1WA 4W70A 2ARWA 4XX1G 1FDLL 1UJTA 3LEXB 1FZMA 5C09E 1JCKA 2NR6D 4XCFH 5JNYA 1IAOB 3F7VA 4RDQF 4MQXD 4NWUH 3X11A 5GGSA 5E24E 4N0FA 1A14H 1W72L 1MFDL 1H5BA 1C7SA 2HFFB 5BOPA 5T3ZH 3PABA 3H3PL 3R4DA 3R1GH 5FIEA 5ID0A 1F11B 3AVEA 4RGMC 2R69H 1XIWD 4HK0A 4JQXC 5HYJB 3EJJX 5E6ID 1ZHLB 3MJ7A 4XCNA 5EWIL 4HIIA 1HILB 1R3IH 5FCSH 1KPUB 1C12B 3QG7H 4R97C 2Q87A 4IRSD 3QCVL 5D7LD 5DJXA 4PREB 3ILQC 4XWOD 4LHUD 5FYLL 2VITA 3VFPA 5H94A 2VLJA 4MA1C 5ESQB 3IAPA 2FDBP 4OZGB 3ULUD 4ZUTA 4NM4L 3RWFB 2VIRB 5ID1A 2ZOKA 3WIIH 2VXTH 3GSOA 3HPLB 4PS4L 1CFTA 3FN0L 1W8OA 2WINA 2DJ4A 3ZLQC 3DX6A 3Q0HA 3BUYB 3BZEA 1FG2A 3MLVL 2ICWB 3FMGH 5AWNH 2DQIH 4OZIA 3QIUC 1N64H 2ORBL 5DMIH 2VRAA 4BQBA 1CXEA 1L6ZA 2OR7A 4PBXA 3F58H 1HSBA 4KKBD 1QFWL 3MGAA 4M8QB 3T77B 5C0EA 2AABH 5EN2B 2AJUL 1ZXQA 2AEWA 1SJXA 3VFOB 2HJKB 2XZZA 1AKJD 5EZJA 4R26H 3S34H 2XNAA 3ARBD 2CDFB 2G9HA 5F9AC 5JIHA 1CF8H 1QBML 1FQ9C 1FVDA 4PJHB 3HMXL 3VD7A 4Z78B 2AJVH 3IU3A 4ODSL 3TBYB 5SWQB 4XB8A 2AJYL 4UT7L 4B53A 4CGTA 3V6FA 1DQDH 5L2JA 4TOYL 4YDKL 4ONFH 2YS4A 1NFIA 3E0GA 1URLA 4NOBA 4ELKA 1KYOK 1MFCH 4WHDA 1NMBH 1F45A 3QUZD 4ZO8A 3W39A 4L8CB 4LF3A 3O41A 4U3XA 4WFFE 4XBGB 4WV1A 3VFTB 3TO2A 3EOTL 3L95B 2I5YH 1UACL 5ESVB 1QRNE 3OB0H 5GSVB 1HH6A 2HTLC 4PJAA 4EEEA 1AIFB 1YMMB 4PJHF 2P7TA 4U05A 4A6YA 2ERJC 3E8UH 4PLKD 5BVJA 2H8PA 4V1DA 4DZ8A 4I0PC 2Y1VA 1GYAA 4PJ5B 3DHMA 5GZOC 4HUKB 3IJYA 1Y18B 1YY8B 1D5XA 5MEQA 5DD0L 4KDVA 2JK5B 1P5VA 5CGYC 3SDCD 2F8XC 4Y2DA 3T1FA 4YAQA 1EEZA 5DJDB 2NY6C 3IF1A 2HTKC 3MRQA 5F8RC 4U6HA 5TFSH 4HT1H 4LPVA 4JFDB 4LDEB 5DJZB 2OK0H 4EI5C 3BRGC 3ZE1F 1PG7L 2CJUL 5IVOA 2C26A 5E8PB 3VXNA 1FNAA 3OKLA 1E28A 3VXRD 1OHQA 2MOVA 1DVFD 1YEKL 2Y7QA 3RZCC 4P3CL 5JPNA 5EFIA 3FOMB 2PCPA 5CEXB 4TSCL 4TRPH 2E7LC 4OZHA 1EGJL 35C8H 2VJXA 4MWFA 2XYCA 2X4RA 3EOBA 3QDMD 4Y16B 3MGOB 3TO4A 4L4VA 3VWKD 3EYUL 4X6BB 3A67H 3GJEB 4JGUA 4PJFA 4HAFA 1M6OB 3PWPD 2DMBA 1Q72H 1JZ8A 1ZHKB 1P7QD 2ESVA 2J4WL 2VLRA 2OJZH 4BH7A 3F12A 4JHZA 4PY8J 3RNKB 4WFGE 4PG2A 1NGPH 1NGYA 2BNRD 1A8JH 1JPSL 3P30H 5IB2B 3NCYS 5DLMH 5I8OL 1MLCA 3W0WB 1PX3A 4JFXA 1BZQK 4KAQH 1T83A 4F7MA 4JRYA 1FL3A 3TIDB 5FM8A 1YN6A 3GGWB 1BFVH 5C0AA 4WW2C 4KK9C 5FUZH 4JN2A 1OP5K 1YEIH 3W5MA 4ERSL 1G7QA 2Z31C 4MD5B 4R4ND 4AEHH 1MCRA 4R3SA 5IT2H 5EA0H 4RAVB 1ORSB 1U95A 2CK2A 1HOCA 5GGQH 5T5FL 2BVYA 4LDOB 1HEZB 4O2FB 4WNQA 5KAQF 1CXLA 1UJ3A 1JZ7A 1F4WL 5SWZB 1CLOL 2W38A 4FXKA 5E94A 4OCWH 1RZKH 4D9RE 2AI0L 5C0JA 4JREC 3RX7A 3SPVA 5E70A 5F7UA 3LRSA 1BIIB 2AS5M 5H35A 2EDKA 4MLIA 2WP3O 5GGTL 3VXTB 2ADIB 2DS4A 5FK9B 4P99A 3FQXB 3QDGD 5GSRB 3TPUB 2F54E 5C8JB 2WW8A 1DLFL 2CDGA 2QADC 3WE6B 5JORA 3LKOA 4ZDHA 3BPNC 1UM5H 5A2FA 2R1YA 2A6IB 2YUZA 4XMPL 4GW1A 3VFVB 2NY2B 3FQWB 4JFEA 4M4PA 1ZWIB 2AEQL 5J7CC 1VSCA 3T0DA 4Z0XA 1UZ8B 1QSEB 4IOFC 4UV4L 5D6CB 1YMHB 1PLGL 5FF6B 1IRAY 1ED3A 4M3KB 4XVUD 1TIUA 5IGXH 1UADC 3F7RA 2G75B 3LQAL 4G80B 3RIFK 3KDMB 1OAXH 1I7RB 1FGNL 4LLMA 4AL8H 4P4KD 5EPMA 3MJ8A 4OLEA 2HFEA 1AD0B 1ZLUH 3CVIH 1FGVH 1U0QA 3IFOB 5CHNB 1AGDA 3TBTB 5IBUB 5FYKE 1FCGA 1H3GA 2QTEA 3SOBH 4D94A 1LK2A 1A1OA 3LHPL 3QEQE 1P1ZB 5ILTH 1I4FA 2B4CC 2NQCA 1FYTA 2L7UA 2BVPA 2IFGA 3VGEA 1FORH 3CFEA 2DTML 1NAMA 1RIVL 1CVSC 2CLZA 3OTTA 4M1DH 5E2WH 5HVGB 5E08L 3D18A 3RWIA 3N9GH 4ZUUB 5SWSB 5E9DA 1IT9H 2UV3A 5KBNC 5DMYA 3RUGE 3NCMA 4NN5B 4W4NA 3RNQA 1QKZH 3PWLB 3U0PA 1D7FA 3ECBA 1NFKA 2DQEL 5BV7C 4G8FB 3G6JB 1VADA 3U9PH 1ZT7A 4LCCC 4LLWA 2X44D 4GKSA 3VI3E 5EU5A 3OAZK 1ULVA 4KRLB 3HRPA 3MREA 2D7QA 4GBXD 4TSBH 1R5IA 5E99H 1WT5A 5KANI 3IGAB 4U1KB 3AU1A 3LKRA 3I02B 4WFHE 1MREH 5FO8A 4ETYA 4YXKL 4JGMA 4O02H 5T1LA 3U2SA 4LCYB 3NIDF 1AGCB 4XXCA 4UT6H 3VFNA 4BSVB 2CPCA 4J3VA 4LARL 4NZRH 1BBJA 3QNYB 4OF0A 3UTPD 1ZGLA 4JY4B 5I18H 4I3SL 5C0CE 4IRZH 4U1JA 2VQUA 3GZKA 3WNLA 3G6JF 4ZD3H 2Z35B 4X4ME 1Q1JH 4NSKA 2H6PA 2JELH 2WP3T 4G6FB 4U1GB 3TA3C 1XCQA 2FHFA 2DWEA 2BNUB 4HMEA 3LV3B 4K3GA 2FIKB 3P9LB 4MJ4A 5E00B 4APQD 3VMNA 5D1ZB 2E6JA 2FBJH 3CGTA 4HKJB 3P4OB 2BY3A 4U31A 4JDTL 3FQUB 3KPRD 1FFPB 1J1XL 4LSUH 2W91A 4C56B 3U6RB 1MFAL 3ARFD 2NY4B 1NANH 3BW9A 2GTWA 4QRQB 4WI9A 4KK6D 4TNVK 5INCB 3CC5A 1WITA 4OFYA 2AQ2A 1X7QB 3DX8B 3WDHA 4DW2L 1IAKB 5B21A 4QTIL 2QKIA 3HAEA 2FIRT 4NP4H 1KCRH 1R5VB 2PO6C 4L4TD 2Y9RT 3S5LA 5F1IB 2IBZX 4X80H 1LE9B 2MTPA 3BKML 3VA2C 1CS6A 4RISL 4NPYA 2VLKB 5ELIA 2XZQH 4OCXL 2WBJC 2DI7A 5HPMB 1MCWW 3H42L 3KXFD 3DXAA 4LSPL 4X6EA 1CLCA 2BJMH 1ZTXH 5I74C 4XNYL 4RMSA 4KXZH 1P7KA 4MQXC 4U1SA 5CIPA 4YJZL 3CFBA 5D8JH 3DJ9A 1CBVL 1HXMA 1AR1C 3MRBB 5EH1A 3PWJA 2B2XL 5JZ7D 4HAGA 4QXGH 3UC0L 3ULVL 5IMLA 3GUTB 1W0WB 3HG1D 1RZ8A 2BRRL 4E42A 5E6IC 1N3NB 3BVNA 1ACYH 5T3XL 1YJDH 4RFNC 1NFDB 5TE6L 4KKLD 4WUUE 2GT9A 4PV9B 3NACH 3A6OA 2AQ3A 2EDLA 1X6LA 2DQGL 1BECA 2VDLL 1WF5A 2NXYD 5DUPH 2AEIT 4KJPC 3S96B 4IRSC 5MHSD 1AO7E 1CI5A 1F97A 3VCLB 1NUDA 3GKWH 1T7YA 4R0LB 3QR2A 5I16B 4OLXL 2WM0A 4X6FA 4XWOC 1NUFA 2Q8AL 3SQOH 5JW4N 1E6OH 3MYJA 3U7WL 3I2CL 3CFJB 3MUHL 1J05A 3ULUC 5GQBA 4HIHA 2AK4A 1A64A 3MLZH 3CH1A 1LP9A 3K74B 5D7JA 3C5JB 1FIGH 2MHAA 3K2UL 4J6RL 1I7UB 1A1MB 4FQXC 3UJIH 3VFRA 3VXOA 2APTA 2BSSB 4LSQH 1NFDF 5KSBA 1I3UA 1OTTC 1U8MA 4P46B 1DJSA 1OD7A 2DJUA 3BPLB 5FUCC 5LGKA 4XP9H 5BMFL 5EORL 2O5ZL 5D2NB 4L9LA 4KKBC 4I77L 2WZPD 4S1QL 5HTSA 5E5UB 3D0VB 3QFJD 3KS0J 4MNQB 2VL5A 2X05A 3NZHL 5ABDE 4OD1H 5ACMA 3SDDD 4K7PX 4EN3C 3PJSA 2C1OB 3BGMB 5CBAB 5CD5D 1ORQB 1VACA 1WIOA 3ARBC 4NUJA 2PYEA 2FEEI 1H3XA 3QRGL 3GMPB 4QNPE 4I18A 1RVFL 4P2QE 3NH7L 3QDJD 2KBGA 4G8IA 3WFHA 3G5ZB 1LK3L 3HNSL 3DX9A 1REIA 4ACPA 1FFOB 4H88H 1N8ZB 2IG2H 4KHXL 5AUMA 1XF5B 2BHZA 2VXVH 2FJHB 1NC2A 4WTXA 1AR2A 4ODWA 1Y0LA 3VGAC 3WKMH 2NX5B 1SYSB 1VGEH 1FP5A 3MOAL 1C5BH 5CKGA 1LO0L 3SDYL 1MF2H 3D3VA 4ETQB 1RK0B 5D5MB 2ZOLB 4JY5L 4MDIA 5E5MA 4IIQC 3WUWA 3QUKB 4JJ5A 4PJXB 5DSCB 1FZKB 1JE6A 4PJ8D 1B90A 4OCSH 5EUOE 1L0YA 1T4KA 2AXFA 4PLKC 5D7LE 1F8TL 4LSVH 1MJ8H 1BQUA 1L6XA 1P6AB 1S7SA 5FB8A 2VC2L 1IC7L 5CZVH 3BGFC 3VXMD 2VH5H 3IFNH 3BQUA 5DUBA 4LVOC 1CDBA 4JFFB 3SO3B 3VWJB 4X4YB 3ULUE 5EU3B 5CP3H 3MX0A 4K3EH 1ND0B 3PL6D 5EO9B 5IHZA 3KS0H 3SDCC 3ILPB 1FBIH 1HHJB 5I0ZA 1IM9A 1X5GA 4R7NB 4GW5A 4KDTA 2V7HA 3SKNB 3G5YB 3C60D 1QNZL 5HGAB 3KLHD 4E5XB 4GRWE 4PJXF 5KVFL 5IESH 5FUCE 5GISH 3ZDYF 4ZAKA 3LD8C 4BFIA 3U0WH 1FFNA 3K81A 1I1RA 3NA9L 1IKNC 2DYPD 3BP6B 3CFCL 4GAJH 5IBTL 5HHNB 1XZ0A 1JHLL 1JGEB 1NBVL 2V17L 3SQBA 4BK4A 3CCHA 3UTTD 5H8DA 3ZDZF 4I5BB 2EE6A 4P23D 1BOGA 1EXUA 2NNAA 4EBQL 1MCEA 3GMRB 4PR5A 4Y1AD 3TH4T 3VWKC 1YPZE 2K9UA 2CGRH 5KSAA 5ISZB 3M8OH 3DVGB 4PJDB 2MNUA 3DGGB 2MQ0A 3C5ZA 5HHPA 1YNLH 3KLAB 4H8WH 5D7IA 3EGSA 5F89B 1FSKC 2ENYA 5D71H 3WCYA 4DKAA 1JYVA 4UAOB 4WW1A 3RWJA 5EIQA 3ARDB 3HZYA 4A6YL 3Q6GL 4XMLL 1GOGA 2BSED 2XKSA 4N9OB 4LCWA 3WJLA 1S8DB 3ARVA 1U8JB 1RUQL 2EDDA 1O0VA 5ITFA 1G0YR 2FGWL 1T20A 2RFXA 4Z5RB 1KJ2B 4PRPB 1HINH 2WV3A 1TETL 3MV9D 1FNFA 1B2WH 1ETZA 4R4NC 4UILL 5DD6B 2D7OA 3BIKB 2E6PA 1HHHA 4PJBA 3GSNH 2RCSH 3W11D 4NJ9L 4DK3A 3FFDB 4NCC2 3BPCB 2QEJA 4PGDB 4ODHL 2NLJA 5ITBH 5F8QC 4IMKA 5FDWA 3O4LA 2YBRA 3MCG1 5MERB 4P57B 4F7EA 2YZ8A 2ZUWA 3L5JA 3QUXB 2EDFA 1Z9OA 3VI4E 1T1XA 3WSQH 2JIXB 3TVMD 3MOQA 3PHQA 3BO8A 4FABL 3CIQA 3QI9D 3N85H 4BSJA 3VD4A 1U8LA 1QHOA 1RI8A 3LPGA 3VXRE 2ILLA 3VFSA 5DVOA 5BS0D 1F4XL 4POYA 3KVQA 3C5SB 4PP1D 4D3CL 4JLRB 1MRFH 3BEVA 1S7UB 4PJCE 4R7DA 1S7RB 2OXHA 1FLTX 2OL3A 2YD1A 4OV6F 4D8PB 2HG5B 2BC4A 3QIWC 1NCAH 2WBKA 5C86A 5GGRB 4LAQH 5JTWA 2XG4A 2ZSVA 3O9WA 3MTRA 4MAUL 1G0DA 1ZA6A 1MFEH 2WUBL 3EYQD 2XY1A 43C9B 1JWMA 3GJFA 1INQA 2P5EA 1RZIB 4LEOA 4CL7A 3QDME 5C0DA 1UXSB 3AM8C 4YZFF 4HS3B 5I17A 4XVUC 2YOCA 2FB4H 5TGBB 4EDWL 3PWPE 4I48A 1O7VA 4R96B 4XP1H 1FVEB 1IAII 4K7PL 4ZS6D 3VXPA 1OT1A 4M48L 3RWGA 3WFBH 4OF6A 5D72H 3STLB 2E9JA 4KROB 5DJ6A 1Z0NA 1YC7A 2BNRE 5I1JL 4M6ML 4AG4H 2VABB 5LXGL 4N1CA 3DYPA 4AEFA 2X1WL 1EERB 4QRPA 5B8CA 4FFZL 4Z7NE 5GRZA 1D9KD 3ZSTA 1PQZA 3QWOB 4P2RB 1MAML 1CK0H 2J8UA 1RZGA 4G5ZL 2Y5TA 5DHYB 1LE5B 1NCBH 4KMQA 3CLFH 5DC9B 1NC4B 5FECB 2DQUH 3CDGB 4RBPH 4LVHC 1VEOA 4KVCH 4NRXB 1B4JL 1BGXH 1MCQA 1O5DT 4HPOL 4O9HH 5FKAA 3H0TB 1VPOL 2X4QA 3MLRH 2VNCA 4M6NL 1TCRB 3MXVL 5IEHB 5EC1B 3KLSA 3MMEA 4C59B 4ZO7A 3OSKA 4PP2B 2CKBB 2VR5A 3IDIB 5BRZD 1T21B 1KTDA 4H5SB 2K7PA 3PDOB 4GBXC 4Q0XL 3FO2B 3NN8A 4X8JA 5MEPB 1H15B 1F4YH 3L9RA 3DRTA 3LS5L 2ZJSL 2R15A 2BZDA 3ROLA 3DSFL 3UPRB 3QDGE 1ZS8A 2Z93B 4M9PA 3OKOA 3WS3A 4N8VA 3OZ9L 4B41A 4NFBA 1P53A 3EO9H 3L3HB 2PTTA 5CP7B 3RZWA 4HPYH 4N5UA 1CT8B 3QUYC 2PR4H 4XT1C 4XH2B 2VB5A 1U8HA 3VFGL 4GKZB 3W81A 3DECA 3OXRA 4L8DA 4HG4J 2PUQT 2OMNA 4Y0GA 3TNMB 3U1SL 1UQSA 4NQEB 4OLYL 1PAMA 1A3RH 4XCYA 4DTGL 4Z7OE 3MRRB 1MCIA 3SO5A 4L9DA 3T3PF 4TTDD 2ADFH 4OBRA 3VG9B 3IFLH 1A6PA 5IMMB 4UV7L 4OIIL 1NBYB 2BOCB 3L3OA 2AV1A 4Z76A 3FQTB 3ORJA 1BF8A 1NMAH 2M26A 5GIRA 4MCYB 4DJMA 4O58H 1QLFA 1O7SA 3CNKA 3OXSA 1T1WB 4Q9BA 1GHFL 1NAML 2VXQH 4UIMA 4KK6C 4PB0L 4BA8A 3P11L 1KCLA 3CXDH 1G9NC 5C08A 4ZTOH 5C09A 4PJEB 5DJ2A 5CCKL 1BJMA 4XP4L 4JPIA 1ZLVH 1TVBB 2RHEA 2JCCA 5JDJA 1JHKL 4KDWA 5IVXB 4LRNL 5J6HB 4O51B 3BAEL 5ANMB 1AGBB 4O2EB 4ONHA 4GKOA 2Z92B 4ZQKB 1I1CA 1JHTB 3MLYL 4KGLA 1OM3L 1OAUH 3T0XA 1R6VA 4YHOH 2UZXB 4M61A 4MJID 4BSWA 3FQRA 5T33H 4GG6E 5EBWA 1MHCA 3TZVD 3AREA 2KDGA 1NLBL 4QF1B 4QXWA 5IFHH 4PGZA 4CMMA 4PJEF 3U46B 4NHUA 1U8IB 2A73A 3I3BA 1QO3B 3STBA 3UDWC 1E4KC 1T22B 2BY1A 3CZJA 2OTWA 2QSTA 3HE6D 4WO4A 1HN1A 1PJ9A 2VZOA 4I2XE 5DT1L 2CK0H 3F5WA 3B8SA 2ZG3A 4NQVB 5IVXF 2LTQB 5I19L 4X7SL 2OZ4A 3W9EA 4KKLC 3UTPE 2ADJB 5GS0L 1KIPB 3SY0A 4LLUA 1MAKA 1VGKB 2NXYC 1WZKA 1Q9WA 5JO5B 2GITB 5AYUH 1S9WB 5KANG 3DYMA 3OHXB 2D7TL 4NQUA 3INUL 3MRHA 2YPLE 3S98A 1WK0A 1FNGA 1G7JB 5DURB 1WFOA 3D2UD 5B38A 4HDIA 1OGAD 4YHZL 5DR5H 4L5FL 2Q8BH 1G7LB 4YEEA 3WO4B 3MROA 3THMH 3ULVF 3D39B 3REWA 2FH6A 2C4FU 3AAZB 1J7VR 5IB3A 3C8KA 2VN4A 5HHVL 4P5TD 3I6LD 3KPRE 3P77A 2F5BH 4LHJB 3GMNB 1KCUL 3EO0B 5FYJH 3WHE0 1WCQA 2A77H 4ZOAA 5DC4B 5M94B 3DLQR 4RGMB 1DQTA 3GDBA 1C08B 2FLBT 5EO1B 4NT6B 5F21B 3L6FB 4HMCA 4IRJB 2Q86A 1CFVH 1QYGL 3X13B 2BP3A 5JNYB 3SDDC 1S7TB 4HJJH 4L4TE 4KK5D 1MFNA 2YRPA 3JV6A 3NZ8B 5CD5C 5JA8B 4JM2A 1H5BB 4R97B 4NO0A 4PRID 1KB5B 4TNWF 2XT1B 1D5BB 1TPXB 1DQLH 4HK0B 3KXFE 5C0RH 1QRNA 2FEEL 4MA1B 4XWGH 2IPUK 3ETBF 3MJ7B 3EYFA 5HYQA 1J5OL 3MOBH 3NFSL 2P4AB 3SE4A 5C6TL 1S7QB 4FQLH 3DV4B 2G5RA 2MCPH 3REVB 4X4XA 4XVSH 3NABL 1IC1A 1OPGH 4TUKL 3LKPB 3HG1E 3ZKMD 2VITB 5T1KA 4IOIA 3VFPB 2LU3A 3QIUB 1DTUA 2WWMC 4R4FL 3LH2H 1VERA 3CDYA 3IS1X 4TQEL 5GJTH 3VGDA 2ZOKB 2Z8VC 5JDSB 1GGUA 2V7NA 1KN2L 4ZNEE 2FX7H 3B9KD 1CFTB 3RAJH 3QXAB 1S9YB 3KYKH 1A7OH 2YPVL 3KPNA 5ICXA 1EFXD 1EH9A 3LKSA 4BZ1H 1FG2B 4N9GA 4UDUA 1ZGLP 4OBSA 4OZIB 4KVNL 2XN9D 4NM8L 4YNYB 2NW2B 3T2QA 4LVEA 4X98A 3V7AG 3UXFA 32C2A 5EZOL 2R0KH 3KPSD 3TWCH 4C57C 2BFVH 5C0EB 2A83A 3D5OF 4WI7A 3C60C 2CRYA 4H20L 3S9DB 3CU1A 5FA4A 5JLZB 1DFBH 3MRKA 3KLHC 5CD3A 1RJYA 3G04A 4YGVA 2ICEB 3F7YA 5DMKA 4QY8A 3NFNB 4U6XA 2CQVA 4IDJL 1V3KA 2X70B 1MCDA 2J7LA 4UIKH 1FVDB 2IH1B 3VRIA 5AAWA 3QFJE 1RK1A 1WCBA 1I1FA 1E4XH 5IF0B 1D3CA 1CG9A 4BQCA 4OZIF 5DRNA 1W2KT 4HS8H 3S5LG 3BXNA 2QJDA 4G9DA 2FD6L 3DMMD 4JFQA 1NFIB 2ERJB 4P23C 5LQBH 4K3HA 4R2GD 3MFFA 1UM4L 4ELKB 6FABH 1N4XH 5GRUH 3QDJE 2UVFA 4J8RA 4YDJB 1A6VL 5B39A 5C71A 3MJ6A 3W39B 1P4BH 3IXAB 4WV1B 3TO2B 2D7NA 1FDLH 3LEVH 1YQ2A 1HH6B 2RQ8A 2OI9C 4RMTA 5L0QC 3QWQB 2P7TB 1W72H 2NY6B 2X89A 1MFDH 3RVVD 3TH3T 3H3PH 1ZSDA 4V1DB 5JOPD 4DZ8B 3JTSB 3A0OA 5CMAB 3MV11 1MRCL 2BCKA 4FOMA 1D5XB 3TBVB 5MEQB 4OD3L 1NGWA 1OTSC 1S9XB 1UGNA 5EWIH 1I1AA 4MXQD 4FQHB 1I3RA 3CFDB 4Y2DB 1EEZB 1MCSA 4YAQB 3T1FB 2DQHH 2ZCHL 1SM3L 4ZSOE 1CGXA 3IF1B 4XPTL 3MRQB 1Q94B 1QVOA 3WNPA 4U6HB 1MAJA 5CAYB 2I9TA 3FT2A 3VXME 1X5AA 1QFWM 3KYNA 3W11C 4POUB 4PJAF 5FYLH 2YWYA 5LCVL 1DLHA 3ELAT 1P4LA 4Z7WE 1I9RL 2I27N 1X5IA 1TJGL 1XR8A 3VXNB 3MRFA 1WBZB 1JGDA 3B2UD 3V6ZA 3FZUD 3TP4A 4PS4H 3TCLB 4RAUB 3FN0H 1FJ1A 1NJ9A 3O45A 3DWTA 3P4MA 3T0AA 5GS3A 3VU2A 3MLVH 3QQ9D 5ENWA 4YX2L 1RZKC 5A2LH 5JHLL 3X12B 5F7YC 1ZHNA 2QR0A 2ORBH 4RQQA 5E1AA 4PP1C 5GS1A 3EOBB 4KWUA 3TO4B 2W0PA 1QFWH 4G6JL 1K3ZA 4XCEA 1U2CA 2ZUSA 4H25A 2VUOA 3RI5K 4OQTA 4U6YA 1JWUB 4MA7L 1H3VA 5FUOL 3EYOA 3UTTE 1PEZA 3GSRA 5C2BL 3N50A 2HT2D 3EYQC 3WFCL 3TM6A 1NGYB 3ZSSA 1QBMH 2Z31B 4Y1AE 1T5XA 4JDZB 1AQDB 4MNGA 3NFPA 3RUGB 1YDPA 1AD9B 3SJVD 1CDIA 4YR6A 3HMXH 4DZBA 2XV6B 3Q2CA 4F7MB 4ODSH 3V5HB 5SX5H 2JE8A 2X7LB 1FL3B 4OZHF 4ZS6C 2AJYH 4UT7H 5D6DA 5IVZA 1QPXA 1YN6B 2AV7B 4TOYH 4YDKH 5C0AB 2VSDA 5C07B 4D0DB 1IAIL 4JREB 3RHWF 1CDHA 3PXJA 4YHMH 2L4OA 3P0YL 3OF6D 4PJFF 1AXTL 4MCZA 1TLKA 4NC0B 3NTCL 3V4VL 1U95B 1HQRB 3SHSA 5B3NA 3PQYB 1MLBB 1FL6A 1D9KC 1TENA 3EOTH 4MNHA 1TQBC 1UACH 1UCTA 3RVTD 3BJ91 3MV9E 5E94B 4O4YL 3BDBA 2JJTC 5CS7A 2QADB 4H1LG 3RY5A 3LRSB 2KZ1B 3GBLA 2YKLL 4XBPA 4NNYA 3KHQA 5DD0H 1YMMD 3U82B 5BZWB 2CD0A 2EIDA 4BH8A 3BZ4A 1N59A 4ELMB 1WTGT 2CDGB 4KQ4L 4PJ5D 3CXHK 1ZAGA 1A2YB 3GSXA 5DD1L 4KKCD 2OL3L 1MCFA 2GYSA 3PV6B 1PG7H 4N68A 2GK0B 1LEIA 3GMOA 1MHPH 3VFMA 4MA3A 3F7PC 1MIML 2YRLA 5BS0E 3ZE0F 1D5ZA 4U33A 3B5GA 1IM3A 1ED3B 3IDNB 2VR9A 3IJSA 1YEKH 4DN3L 1IC4L 3Q1SL 4P3CH 1EO7A 1QA9B 1Q9LB 2X1OA 4IJ3C 1QSFA 5EPMB 3UTZB 3MJ8B 1R3KB 2HFEB 4TSCH 1SJHB 3DVNB 4XBEL 5HYSB 3MLSL 4ELMF 1EGJH 5HY9B 1AGDB 1T0MA 3V0VA 4UQ2A 3DURA 3UMTA 4PJIE 2WIIA 5HVWA 1C1EL 4HUNB 3JWDL 1I4FB 3EYUH 4ORGB 5GGVY 3N0PB 4M00A 4JHAL 3BRDA 3IDJA 2VLMD 1JF5A 2ZSWB 3P4NA 4I4WA 2J4WH 4LCCB 3CFEB 2MKLC 1IZJA 1YA5A 2R2EA 2UZIL 1NAMB 4H0HB 1U6AL 4U1MA 5C0NC 2IALB 2QQLL 3D18B 4CDHA 2LQRA 5HXMA 3RTQA 4WTWA 2P5WB 1JPSH 2YR3A 4XNZC 4E41E 3BMWA 2OR8A 5FM5O 3W9DB 5I8OH 3CUPB 4XRCA 1WAAA 4YK4C 4PJGE 1GGBH 1X4XA 5KSVA 1VHPA 4NQXB 5F9WC 5GHWH 3KNBA 1I7ZA 1DQJB 3W0WD 2P43B 4ERSH 1UB5B 1HQ4B 1NH6A 1VB9A 3DTXA 3VDBA 3AU1B 5F88A 2FZ3A 5T5FH 4OCRL 3NCFB 5F72S 5DHVH 4NO5B 1AHWC 5BRZE 3TA3B 1F4WH 3VFNB 2LV4A 3TBWB 2OX5A 4WHCA 2V6HA 1YQVL 5GXBB 4LOUD 3MQIA 3CFKA 3O3EA 1BBJB 1AO7A 2AI0H 3TZVC 1ES0A 4XPAL 1ZGLB 1S7XA 4GQPH 3FCTB 2F53B 4U1JB 4X7TB 4NC1E 2EDEA 3QT2A 3DX7A 2QHRL 4Y8AA 2E5EA 5DZLA 5GGTH 4GG8B 5TDOB 1FRGL 5SWZD 3HE6C 5F7MC 4D0BA 4OCMC 1JV5A 4AEEA 5D1XD 3STZA 1U3HD 5EOCL 2HRPL 2DWEB 3T4YB 1DLFH 2SEBA 4X83A 1UC6A 3HC4H 3VMOA 1KENL 3EAKA 2NCMA 3BDYL 2GJ6B 3CSYA 2MJWA 4XMPH 4KHTL 5FOBA 1WZ1L 5F7FA 3WNMA 2AEQH 3BW9B 1I8MA 2HYMA 4UV4H 3D25A 2AW2A 3ZKXC 2W60B 1G7MA 1JNJA 1MUJA 1CFNA 5GPRA 3WNOA 1NGZA 1LNUB 3HNTL 3CLEL 2QKIB 2NY2D 2PO6A 1NCUA 43CAA 1CDJA 2J3SA 3L7FB 4P5TC 1QSED 5I74B 4ZXBA 3OG6B 4F7PA 5I9QC 5IVNA 1CCZA 3QUMA 1PSKH 3N1QC 5HVHB 1KIRB 5F7NC 2WBJA 4NNXA 4OI9A 1FZOB 5I1AA 4PB9H 2EYSB 4NPYB 2FJGB 3GIZL 4GO6B 1M7IB 4ZO9A 4ZUSB 4NWUL 1A5FL 2DTMH 4Y5VC 3TF7C 3LKNB 1JTPA 1RIVH 3LOWA 5E08H 3EHBD 1P7KB 1U8NB 2CIIA 1JGVL 3EDDA 5DRWB 1Q9OB 3WFZA 1XIWA 1HXMB 3SGJA 4X6DA 3RU8L 2ATPA 2YD3A 3PWJB 3QNZA 5E6IA 1ZVSA 3EYSL 4NO3B 5DZNA 4HIJB 1VENA 2DQEH 4E42B 5A2JH 3NBNA 1BQSA 1R3IL 4MJIE 1JI2A 4WWKA 3I3EA </