4POYA

Engineered dual specific vhh antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VHH-metal
molecule tags Immune system
source organism Lama glama
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4poyA00
4XP1H 5FM5M 4HC1A 1IT9H 1DQMH 4POZD 2X4NA 4MD5A 1M7DB 1JGLL 3B5GA 4AIZB 3HFMH 4NQCB 1RVFH 3CNKA 3C6SA 4K7PH 3TP4A 4PYHA 5DEFA 3MA7A 3HC4H 2GTZB 3DIFA 2VXUH 3CJJA 5FUZH 2ZUXA 2Z31C 3SGKA 3MRLA 3P77B 2O61B 4DW2L 4I9WE 4H8WH 2QHRL 3BWUC 4U6XA 2V9RA 2Y5TB 1XF1A 3K2UH 2EC9T 4J3SA 4X6EB 3MJ7B 4WO4C 3HKFA 2N4IA 4OZIE 1RZJL 1C16B 4CMMB 2BHZA 4M7JL 1XF3A 5JPNB 3CFEA 2HT2C 4LCIL 5BW7A 4I2XA 5FDWA 1KB9J 3OR6B 2DI8A 1JMZA 4NQEA 4JFFE 5JUEL 4J3UA 2YPVH 2P5WA 3JV5A 1IC7L 5KAQG 5CJQL 1S7TA 1I3RA 4ZUVA 2J8OA 1VADA 1L7TL 5T33L 3ZKND 1NBYB 4M7KH 5SX5K 4J6RH 4O4YL 2BC4A 5I74B 1Y0LB 2XV6B 4NKMB 5IW6A 1AHWB 2HH0L 3RWGB 3BN9D 4Z7VE 3U36B 1N8ZB 2FSEB 1YN6A 3G6DL 1YY8B 4MAYD 3O3DB 4XHJD 4HDIA 3TN0A 1VHPA 1H5BA 3L5JA 3O6MH 12E8H 4P5KB 2E8ZA 2HFFB 5IK3B 2VR9A 5KS9B 1SY6A 4DN4H 2R29H 4R26L 2NY1D 3UP1A 4PUBL 1YEHH 4YHYC 5D1XB 1SEQL 4ZYKB 3H0TB 3C5ZB 5CJ8A 2BZDA 2C7UB 2EKJA 3MV8A 5ANME 4CU6A 3PP3H 5SWZA 4FNLL 1UQSA 4Z7QE 5BOPA 3LMJL 5E8DH 3PDDA 5INCB 3ZZ1A 1N4XH 1A6AA 1NL0L 2JB6B 3WEXA 1JK8B 3VWKC 4HWEL 1T7VA 2CDFA 3MRRB 3OZ9H 1XR8B 1QR4A 2HP4A 1BD2B 4TSCL 1JV5B 2BNRD 4LKCA 1ND0B 2G75A 5J06A 3WNOA 2P5WB 4GQPH 5DRXB 1NLBL 2W9EH 4DOHE 3IDUA 4YEEA 3BPNC 2NY0B 1JZ3A 3TA3C 2A6DB 4QRRE 2VZVA 1T22A 4R0LB 1IGIL 2OR8A 2DMCA 2XFXB 5A2JH 3K2UL 1N0LA 1D5MA 4E42A 4NZUH 4AEIH 2E6PA 4YO0A 1HYSD 1Q38A 2GJJA 1RZFH 2YRLA 1DVFB 1UM5L 3KPOA 3PUCA 3E6FA 3MRFA 3MGTB 1QACA 4YFDB 3QEGH 4NNPL 1EH9A 4YHLH 1XGUB 2YD5A 3WXVH 1RK0A 5CJOH 4FTVB 2X5PA 3LQAH 5IBUG 4QRPD 2XPGB 4Y5YB 5CEYA 1A2YA 5JW4M 3R1GL 3SDXB 3QO0A 4R4FH 2I5YL 3BT2H 4JFEA 4PJGA 2X4SA 3KDMB 3ULUH 3LEYH 1YEGH 5H37G 4JPVL 3QDMA 4UT9H 4J4PD 3H9SB 3QXVA 4MX7A 1V7NH 4PRBB 4ODSL 3P9LA 1LE5A 5EFIA 1QSEE 2VDPL 5GSRB 2RCSH 3PQYB 5DHVH 3HPLB 1YMME 4KXZI 3CZJA 5IV2B 3RGVC 5I1KH 3BPLB 2GIYA 1JF1A 3CU1A 1SVZA 2CGRL 3WJLC 3VGAB 3T2NH 3S36H 2H32B 3MFGB 4YLQT 4G6AD 3IFNL 3QFDB 3QDJD 3C87A 1QYGL 2PN5A 4P48A 3FO2A 1A0QL 4LMQI 4QHUB 1QFWH 2XPGA 2B1AL 4Y5YA 3HR6A 4K8RC 1IL1B 3EO9L 2KZ1B 3DYOA 3BD4A 3BDBA 5AG9A 1BFOB 5GRVK 4R2GB 3TVMB 1KC5L 2FECI 1CTOA 1HHGB 3DPBA 5D4QA 1OAKH 4GXUM 3AB0C 3QI9B 4PJIE 2R2BB 3T1WA 5I0ZA 3EZJB 1IGTB 4O5LH 4M43L 5FM4A 1T04B 2VDKL 3VXRB 4CVXA 3S35X 5HDOA 1FIEA 4HW6A 3RZCC 1MQ8A 1X5FA 2EE3A 3Q48A 4IBLT 1HSBA 5CIPA 1FVCB 3C6LC 4M1CC 1M05B 2AV1B 1YJDH 1NCNA 2QSVA 4CNIA 1IQWH 3NN8B 5IVZB 2AJ3A 2H9GB 4MJ2A 1IMHC 3PGFH 1FLRL 4C4KO 4OZ4B 1JYXA 5T5FH 1HDMB 1JUFB 1T03L 1QA9B 4ODUB 1A3LL 4NQVA 1EFXA 4U1SB 3TCXA 2CIIA 1U3HC 4P59L 5KSUB 5SX4H 4KRMB 4XVUD 5LKNA 2XI9A 5D71H 3QEGL 4NNPH 1MI5B 4RGND 4YHLL 2VL5A 2DQGL 4QRSA 5IBTH 1JYVA 2PYED 2V5SA 4FQJL 3QI9A 2NXZD 2WINA 1MLBB 4M8VA 5CEZH 1CT8B 3TNMA 1FFOA 1BD2D 1WZ1H 5LGJB 3CFBB 3D18B 1IGCH 3BISA 5HDQH 3A6CH 5DRWB 1KXQE 1IL1A 1U3JA 4JDTL 2Q8BL 3F65A 2W59A 5AZ2L 3FCTA 5ID0B 3S36X 1F6FB 2Y7QA 3WD5L 5C0ND 3RDTB 3WLWD 2BVOA 4F15C 3K46A 5FAAA 3JV4A 1AP2A 4JQIL 2F8VA 1PLGH 1K85A 1DQDL 1D5ZA 4GXVH 1JYWA 5E6IA 3KLAA 1WAAE 2VXTL 2BSTA 3LPWA 1AXIB 1Z9LA 3VXRA 4NWTH 1LD9A 5ICXA 3F5WA 2DQHL 4XCYB 3KPPB 2ZCLL 1GGBL 1NQBA 3MJ9H 4AH2A 5J3HC 3LN4B 1YPZF 2E3VA 3VXTA 2I9TB 3H9YA 4HSQA 2WBJA 3CAFA 4XB8A 3I9GL 1S9YB 25C8L 1RUKH 3WXWH 4JANA 4M6NL 1WFUA 3X17A 1MF2L 4XHQA 1ZTXH 4H1LA 3PWJA 2EO9A 4H8WC 1UWEH 4UQ2A 2QQNH 3VWJC 4X6DF 5H35A 1TDQA 4UI2A 4UOW1 5SWSA 4UILL 4NQDE 1V7MH 4JO3L 3S7GA 3FN0H 4OTXH 4ZNCD 2ZPKL 4MLIA 3WS3A 3E8UH 5HBBA 5DVOA 4K71B 4ZXBB 3QQ4B 3KXFA 3EYOB 1CFQA 5I18H 1HXYA 4TVPH 4EXPX 1G1CA 4EUPH 4LF3B 2EEBA 4XTRC 2GCYA 4WHTA 3IU4L 4H8WL 5D72H 3I6LE 1RUAL 2C3VB 1H8SA 4IOSD 2FWOB 4QXWA 4BQ9A 5MP6H 2AJYH 3PJSA 1VGKA 3KNBA 4NZJA 4OZIA 1QBML 1U6AL 4PUBH 2VQUA 1U8KB 1TJHL 2XTLA 3MSPA 1FPTL 1HIMH 2XWTA 3C60D 3KPRA 2VLKE 1WT5C 4BFIB 3RVWD 4OLVL 4DAGH 5EIIA 2YZ8A 2ZG2A 3G5YB 1U3HA 3HE6B 3T8XA 1DQJA 3QNYB 3SPVA 3O8XD 2A0LD 1QFHA 4KK9D 3VXUD 4WWKC 4MCYA 5HGDB 3QNZA 4LVOC 3CCHB 4JANB 3DOSA 3HZKA 1D6VH 4YBLB 3DETC 1K9TA 4LCCB 1QEWA 4UINL 3GJFA 2O5XL 4PRIE 1BWWA 4G3YL 3L1OH 3EFDH 4K3JL 3V6ZA 2CR3A 2AJZB 4GXVL 2ENYA 3TN0C 2DM2A 3RNKA 1KNOA 4LCCC 4M3JA 3P40A 3FQUA 3T2OA 5M94B 3V6OA 2EDWA 4KJWD 4WUKL 4KKAD 8FABA 2GFBA 3F12B 4HUVB 2FECL 2JCCB 5CWSA 5EPMA 2ICWJ 2LFGA 4YDKH 2UVEA 1BGXH 2X9YA 2YD4A 3FOMA 2FNBA 5E2WL 4I4WA 2FWOA 4M7ZB 4DTGL 3BDYH 5L0QC 4V1DB 3LMJH 4JG1L 1XEDA 5DUPL 5DZNA 1AXSA 4PR5A 3HI6L 3GMLB 5D6CA 1ZHKB 2IQ9L 5DUMH 1OAKL 4PGEB 2AJZA 5KVDH 1NC4D 5EBLA 5BZWB 5C7XL 1BP3B 3FB6B 3I84A 4ZO7A 3NZ8A 5FGCE 4M93C 2ZP0T 1C08B 4BELD 1XF5B 1QFWM 2DI7A 3SDCD 1KPUA 1Q9OB 4Y1AD 2VSDA 1JVKA 3B2UD 3LKQB 2VUOA 4AIZA 3KLSA 2VLJA 2OR9H 2AVGA 5TDNB 5IEHB 1QFUH 1IBGL 4KZDH 1AGFA 2YPKA 3EOBB 5J1SC 1D5BA 4GG8A 3X12A 3HLAA 1D5MB 4E42B 3GMQA 3BOVA 4M7LH 4DFIA 3CGTA 1G7IB 4WFHE 4H25B 4PR5B 4FTVD 2EYTB 4RMTA 3MUY1 5IBTL 1CLYL 1RJLA 5F6HI 2EDOA 4ZS6C 1HXMB 4R4FL 4DGVL 1EJOL 4N0FB 3BPCB 1ZK9A 2ADIA 1RZIB 3MLPA 4X6CB 1RZ8A 5DFTA 4PJCA 4U6HA 3LKOA 5IKCB 2HAZA 1UM6H 2PO6D 3ZYJA 4IRJC 4MA1C 5AZ2H 2JJTA 1FFPB 1T21B 1CD1A 1XGYH 4FG6C 4DZBA 5GRUH 3GJFK 4O2EA 3W0WE 3GRWL 2WW8A 1TETL 3BEVB 4EI5C 5D70L 2Y7QB 4UDTA 1CZ8H 4LLDB 5H35B 4Z0XB 2DMKA 1FLTX 1MIEH 5EBLB 5BZWA 4GAJH 5IIEB 1NEUA 4NPYA 4U1IA 3SDAA 4LLUB 1W0WA 1MH5B 1WITA 1Q8MA 4PJHB 4KROC 2IFFL 4G9FE 5C8JB 1KTKE 1FFOB 1MCPL 2AK4B 4RFNB 5F1NB 3T4YA 5FCUH 4ORZC 3OAYK 3MRGA 4OAWA 1HEZA 2ICEA 1KC5H 4XH2A 4M6AA 4NRZA 4JJHA 4J3VA 5C0CA 3CLFH 3IJYB 3QULB 1EHXA 5I1JL 3L5WB 1SEBB 4NQDD 1XH3A 3PDOB 1P1ZA 2YKLL 4A2MA 3D39A 4P4RB 4YHKH 3O9WD 5H8DA 3I50L 5GGQH 2CKBH 3RPKA 1U8HA 5CHNA 1BZQK 3WIFA 2YWZA 2IPTH 4ALAH 1XGQA 3KPNA 1HZHL 1TVHB 5I1DA 1MEXH 1IGYA 2ZCHL 4UB0H 1BQHG 5FDWB 1SM3H 2VXVL 4KJYB 3FQRA 4F8QA 3CFJB 5JPMB 2XQBH 4L3CB 1OTUD 1DANT 2YBRB 1T7WA 1QHOA 1FVEA 3UMTA 4F7CB 1WZMA 4BK4A 5ANMA 3QI9C 4WWKB 3HUJB 1CLOL 3UO1H 3OF6A 4HBQA 1UCBH 2VE6B 4PRAA 4JKPL 3S37X 3PWNA 3BEVA 1I4FB 3KPSA 3TVMC 4RAUB 4XGZA 4LLDA 2YD3A 3BGMA 4JFPB 4JFDA 4YHML 5JQHC 1CFNA 1HQ4A 1QRNA 2DQFB 4JQXC 3VH8A 3J8F7 1LWRA 2YRZA 4FFWC 1DDHB 1VFBA 3M8OH 4GRWE 4QEGA 2CMRH 2O5YL 4PJBB 1UM6L 1HXMA 5LVEA 3B9DA 5GS2D 1KELH 4WUUA 1FCCA 3ZTJG 4ELMB 4GQ9L 1I75A 3FONA 2Y9RT 4E0RA 5BCAA 4W4NA 5EORL 2YS4A 4U1JB 5C07A 3ROOA 4UDUB 4IRJA 4CJ0A 5HVGB 3RIAK 1PKQE 4FQPA 3HNTH 3I3BA 3UPAA 3F7VA 2IADA 2ZUTA 3VFPA 4RX4D 4RMQA 3BQUA 2ZCLH 4OGAD 2GKIA 3SEPA 2BVPB 2X42A 3H6JA 2W60B 1DVFC 3VFRB 1FG2A 2R8SL 2DJ4A 2CIKB 4AENA 1J1OL 4FQ2L 3QG7L 3DUSA 4URTB 1CFTB 3FN0L 4MVBC 4FQLL 4OTXL 5F7MC 2WBJB 1HHJA 4PRHD 3PV7A 3WDIA 2JKXA 1CGUA 1RZKL 5CJXA 3HUJF 3U7YH 4JO4L 1FVDA 2VDNL 4NHCH 2ESVB 1M6OA 2R15A 4EOWL 4LLYA 2HFEA 3V7MA 4G8FA 4L1HA 4IDJL 5I1LA 3ZDYF 3AS2A 3CH1A 3UJTL 3MROA 1V3KA 3HLAB 3OQ3B 3O8XA 4IIQB 4UDUA 3VWKB 2W65A 3OB0H 1D5ZB 1QHPA 4NYLA 3HE7A 2L7UA 5DMIH 3HNTL 5I1HH 3DMMB 5DJ8B 5IWLA 3SKOA 1J1XL 3CVHH 2HKFL 4IMLB 3EYUH 3HAEG 5CIPB 3QEQD 3EO0B 4XMLL 5EC1A 1LEGB 2H41A 5F9AC 5D1XC 3TV3H 1F90L 3CFCH 3BESR 4UIKH 3WDHA 6CGTA 2QADB 3HC3H 4HEPG 4AMKH 1A6VH 1Z5LB 4Q74A 5D1QA 3HUJA 5JMRA 5F7FA 3U4EA 1Y6KR 1EGJL 4K9EC 2IPUK 5HVHC 1H3VA 2QKIB 5TF1H 5I1GL 3GHEL 4F3FA 2EIZA 5GHWL 3MUJA 3EFDL 3RWDA 4ZSOA 2ZSVB 2KL6A 1G0XA 1NGQH 3VDCA 4HEME 1XF2A 4OD3H 3LN9A 3D2UB 2NX5D 3BYYA 4LRNH 2X70B 4RGOH 1AO7B 2H2PC 4EI6B 5BQ7A 1YY8A 2X2YA 4DKEL 3BGFC 1BBJB 3R06A 4IMKA 3OKYA 2BOBB 4TUJB 1SJEB 3BPCA 3PNWB 4LDEB 5IOPB 5ITBL 4IRSA 4K9EL 4X6DB 1U2HA 2DM3A 1HOCA 2NY3D 1R0AL 3SE8L 4J4PA 3F7VB 4XVTL 1ES0A 4LLVA 5DT1L 4JFED 5C0FB 4KHXH 3L7FB 3EJZD 3TLRA 3HZYB 3UPRA 4XP5L 4O5LL 4K23H 1IEHA 4LLUA 1UC6A 5D6DA 2ARJQ 2Q7YB 5C8JA 1IQDA 2V17L 1HHJB 3A67H 1A7OL 5DUPH 5KN5B 1QKZL 1QSFB 4F58H 1U92A 4F9PC 4JKKA 1XGRB 4X6BB 3QZWA 4EIZC 4HIIB 5C7XH 2RBLA 4NM8L 3RVUC 4UQ2B 3KJ6H 4LSRL 3SO5A 4PGEA 1AGCA 3BPLC 5HYIA 2Z4QA 5MEQB 3I6GB 5DLML 3ARED 1QBLH 1MHCA 1O7SA 2WMPA 2ZOLB 5T3ZE 5EFIB 1JGEA 2CJUH 3QAZB 4Y5VB 4Z7UA 4Z7WF 3FRPG 3QJFA 3ZO0A 4D0DA 4G9FB 3AGVA 3AXLA 3LRGA 4PJBA 3HR5B 4QXUH 2W92A 3DHMA 3GIZL 2OMBA 3DX8B 5JMOC 4P46B 5DJAA 5CGYD 4KRLB 3NACL 4Y2DA 3IU3B 1XGTB 1VCAA 2VXSH 1QR1A 4R7NA 2BXZA 4H1LB 3AUVA 4K3DL 2P5ED 5CKAA 5ESVA 3RWEB 2Y07L 5MEPA 1CBVH 4KKAC 4JB9L 1N2RA 2AI0L 2JK5B 4PJIB 1P4IH 3OG4B 1JTPA 3IDIB 3GSVB 4P5MB 2BSSA 3OJ2C 4E41E 3KJ4C 4Z7QF 2AEQL 1M7IB 2GUOB 1A1MA 3IXAA 1NGYB 5I8KH 4G42A 1ZT1B 1AO7A 3RTQD 4FXKB 3CFJA 5JPMA 4NJAH 5E8OB 3T0VA 1IEBA 4O58H 2PW1A 1I9RL 4JPWL 3FTGB 3KJ4B 2DBJA 1A6TB 1Q94B 3OKLB 1IGFH 3V0VA 1KTLA 4JHWL 4XBGB 4KDTA 4OF6A 1F2QA 4YFLI 1KCLA 5AAWA 3VD7A 2YOCA 5E1AA 1ZTXL 4KK9C 1X5YA 3BHBB 4PD4J 1I8LC 3I85A 1FP5A 2O26U 3DVGB 3VFVB 2YKLH 4UOJA 4MXVF 3SGJA 1JNLL 2X4TB 3O6FB 3SGEH 4JO3H 4PJAE 4YHMH 4WUUD 2BY0A 1DSFH 2UZYB 4QXGH 1TNNA 1PDKA 1MRDH 2B20A 4WHTB 4RFEB 2VQTA 4YX2L 1GIGH 2QQLH 4RAVA 3VXMA 4TNWF 2F8OA 1F45A 1UVQB 4OZFB 5HPOA 5DD6B 4KKBD 4KZEL 2XQBL 3BZFA 4XNXH 2ESVA 1DQDH 2HFTA 1QA9A 1AXTL 1NDGA 1WBXB 2YHGA 3CSYA 4KI5F 1OGAB 1JBJA 4D9RD 3VH8G 2OI9B 1N2RB 2EH8H 4YDIH 3BRGC 1AGBA 3CPLB 1A4JB 1KV3A 1LK2A 3FZUD 2FJGA 4RA0C 4HUXB 4KK6D 3RVXC 3B8YA 1D5XA 3E2HC 1EGJA 3LIZL 1J8HE 2J8UF 3DUSB 3NFSH 5LG1A 1SJVA 1UFUA 3MACL 3OXRB 4M7LT 4FHBD 4IS6B 3O3AB 3V9FA 1I1CA 5GRJL 1S9XB 5GGVY 3IJSA 1VGEL 5E24E 2AV7B 1A8JH 5FYLL 1ZV5A 4I0PA 1M71A 4PJ5D 3D5OF 4OUUB 1MVUB 2NY3B 4PJBF 1CDHA 1N7MH 2VDNH 1N59A 4NHCL 1MCDA 4U3CA 4GQ9H 5J3HD 3C2SA 4HPOL 1G7IA 1TTFA 1MCBA 2ATKA 3CX5K 2Z91B 5DURB 1PG7W 1U8QB 5CD3A 1DL7H 4WFFD 2HJKA 3V7AE 1YY9D 5DO2D 1AH1A 4JREC 3QHFL 5EU7C 4F7MA 4M5ZL 1AGBB 3TT3L 4M00A 3WJLA 1MIML 2AXHA 3B9KD 1T0PB 5C0RL 3WKML 2X4QA 4OCMC 2VWEE 4LEXL 4IHOA 1WF5A 1I9JH 4HC1H 3O2VH 2YRPA 4PLOB 3D85B 3T3ME 4ZAKB 1HKLH 2XFXA 1UB6A 3GMPB 5E5UB 4HZLA 1HHIA 3LS4H 1UM5H 4NQXA 2Q6WB 3SKNA 2R69H 2AABH 5E99H 3NOIA 3F6IA 4I9WD 4N0YL 4HX1A 4CVZB 3HG1B 1EEYA 2X4PA 1T80A 5TF1L 4H26A 1I8LA 2DWEB 4JHAH 5E94A 3SO3B 1DLHA 1YEJL 4IS6A 3WBDA 5DTFA 2OQJB 2VB5A 1RV6X 4PJAA 2VO5A 1INQB 2FJFA 1Q9LB 5ITFB 2FX8H 3LS5H 3QHFH 4UINH 1DUYB 2C3GA 2Y6SD 4N0RA 3L5WA 5FF6B 1IAIH 4GG6F 1JIBA 2RCSL 4HMDA 2IGFL 3GUTA 1A7PL 5C0RH 5E9DE 2X10A 4YGVA 3GSUB 4G6KH 5JIIA 2ZWLT 1D9KB 3EZ8A 3VD5A 3FFDA 4LEXH 1B0RA 4OSUH 3MODL 3NFSL 4MJ6B 1CDGA 1OD9A 4QY8A 3DYPA 1NCCL 1NSNL 2G60L 3GSVA 4P5MA 1B2WL 4KROB 4JFOB 1MRCH 3P73A 1CT8A 1NC2A 1U36A 4LCIH 3CCHA 1Y6MR 5CFHA 4TVPE 1H5BB 1FNFA 3GIZH 3SE4C 1OPGH 2WWKT 4GRLC 4EI5B 4PJ8D 1LO0H 2FJHB 3MRPB 4HPOH 4EUPB 4RMUA 1EZVY 3BAEL 3NN8A 3K1DA 4QT5A 1BLNB 1XGYL 3EJJX 1QUNA 2NTFB 4D0CA 1UWXH 1NPUA 5E6IC 3T4AA 3JVGA 4L9LC 1FQ9C 1AFVL 1ZVHA 1NBVL 4OCWL 2VLLA 4Y5XC 5LGHH 2BDNH 1FJ1A 2KKQA 4Y2OA 3H3KA 3X3GL 4MJ5A 1HYRC 3RIAF 2BY3A 3QBTB 3VI3E 5I15H 4CL7A 4LHQB 3QH3B 1JZ2A 4G80B 2YD8A 4J4PC 3DVFA 5ESAA 3W5NA 2NY4D 1N64L 4PS4H 4HMEA 2H6PB 4PRDB 1NGZB 5E8EB 3GM8A 5HDBF 1AKJB 2DYPA 5F8RC 5ENWB 4JY6B 5ADPL 1XFPA 1GVIA 4TSAL 4OFYD 2V2XA 2GTZA 3LH2L 4M61A 3QB7C 2HVJA 4APQB 3GKZA 2K7QA 3WFBL 5FGBA 4MXWL 5TE6L 4L5FL 4HJ0C 5GGRY 4Z0BH 1BECA 4WEUD 2FJGB 4L4TB 3VG9C 2F54B 2EDXA 2A6KA 1FHGA 1WISA 1RFDH 5D2LB 1F58H 4TSCH 4MJ5B 1G7LB 2NW2B 3QDGD 2ED9A 1WQVT 4AK1A 1TZGH 5I8KL 3VI3F 3KR3L 1EHNA 2D3VA 5FO7A 3T0DA 1YN7A 3TA3D 5FXCH 5FKAA 3ARZA 3GMOB 3CVHB 1X5GA 4MS8C 4Y4KB 2NY6D 5GGTL 3STLB 3NCJL 4OZGA 1MVUA 1AGCB 4M1GH 2VTFA 3VXSB 2LAGB 4M7ZC 3EGSB 2IMMA 4P9MH 5GGSY 2IF7A 2VXTH 2FB4L 1I3VA 4M1DL 2AGJL 2V7NB 4PREA 3DVGA 5SWZB 2D7NA 1U8MB 3QUYB 1W2KT 5KSAB 2CKBB 2ID5A 1OWRM 1A4JA 1LK2B 4CMHC 1CICC 4LCWB 4C56D 4P3WA 1LEKA 4JFZL 4HDIB 3TN0B 3P11H 1AY1H 1NGZA 4KI1A 4CVUA 3MRMA 2H6PA 3L7EB 2BCKA 2KH2B 2HFFA 2YR3A 1I3UA 3CXHJ 4TSBL 5EIVA 5HJ3B 2NY1C 3FB5B 5IMOB 1LVEA 4NC2B 5D7LE 1OAXL 4D9LL 1KJ2A 1KG0A 2PKDA 1PW3A 4MVBD 5KSVB 4OCRL 3HI1B 1SY6L 4U33A 1IAMA 4JO1H 4R7DA 4Z5RA 5DEZA 1YEKH 1QTYT 4GW1A 3KPTA 1F11B 3NFPB 3E6HA 1HZHH 3MV7B 2DBLL 4P9ML 2ICWB 5DJXB 3T0ED 1BBJA 3IRPX 3R06B 1KENL 5CD5C 4HUKB 4XXCA 4HKJB 5DJDA 2WANA 3TA3A 4IOFC 3QG7H 2C1PB 1JGVL 5T1DH 2ZJSH 2Z8VC 3MJ6A 1AE6H 1OLZA 4OLWL 1K3ZA 4F9LC 5BS0E 3QPXH 1QD0A 1GIGL 2QQLL 2F9BT 1OSZB 3M1BB 4LVEA 1WJ3A 3D85A 3VRLE 3MRKA 3D69B 2VNCA 2C4XA 3ALWA 1MFAL 4MNQD 5CEZD 2AKRA 1LMKA 3AM8C 1XZ0A 3MLSH 1NGPL 4UV4H 1FNGA 4FNLH 5JOFA 1GL4B 4JQXA 3B2VH 2B2XH 2J4WH 4M6OL 3ARFB 3QFDA 1PZ5A 1CL7H 2HTKD 4HCRH 2GK0B 2FL5B 3OMZA 3V6OE 3UBXB 3HS0A 5HPMB 5KBNC 1P2CB 3DI3B 2OTPA 1UB5B 2FHCA 4YXKL 4I18C 4I48B 4Y5XA 3STLA 3U9UB 4KKCC 4KRPB 2EEDA 5EBMA 1KEGL 15C8L 4WHCA 3G6DH 2YSSA 3KYOA 4C83B 3B3IA 2DQGH 1LQSR 3MREB 4G9DB 3ZE0E 1VGEH 1R3IH 3BD5A 1FL6B 5AWNH 1VFBB 4JQVA 5GGSA 4ZFOA 5FUOH 4PLKD 4OZIF 1ZLWH 5HD8D 3P11L 3F5WB 1CXKA 2ADGB 2Q87A 4F8TA 1XR8A 4WFEE 5HHMB 4HPYH 4DTGH 2IANB 1YQVH 1IC7H 2CO7B 4X99B 5HYQB 1C08A 3MJ9A 5J11B 3WO3B 4NCDA 2QR0A 4K8RD 3CU7A 4RGNB 1PLGL 1NCTA 2D03H 4WU7A 4EI5A 5KTEH 3BAEH 1G0DA 3DIFB 3ULSB 1MFCL 5E9DB 4PV8B 4QHNB 3RL1B 1OY3B 3TT3H 3DGCR 3G6JF 4KHTH 4BZ1L 5LBSH 2V9QA 4YDLB 1F3DJ 2EDTA 5I1HL 1U8IB 1X5ZA 4FQIL 4RWYL 4KKBC 4ZOEA 4FXGA 4BUGA 3RUGF 4P2CG 2YD7A 1H0DA 3LKSA 3TNMB 1UH2A 3BUYA 1MAJA 2OJZL 1TQBC 5I1CL 5DJCB 4OLWH 3GGWA 2X4OA 4PB9H 1FIGL 4X6FA 5IEKA 3C8KA 4EUPA 2VDQL 4PJ5A 3NMEA 1IEAA 1L7IH 3WUWG 1IM3B 5IVZA 1MFAH 4XPFL 3VXSA 1VGKB 4MB3A 5E8DL 4GRLD 5DHYA 5DWUH 1J05A 4Q9QH 2X1OA 5F7DA 3S97C 3O81A 1NFDF 5EO1A 3DRTB 5GRVL 4PD4K 5GRWA 1FL3B 5I6XB 5HHVL 3O41B 4YHZH 1AO7E 2UYLA 4A6YL 5CLWA 4K3HA 3TPUB 1IGYB 1M7IA 3IXAB 5F7KC 1ED3A 3N1GC 1B2WH 4NC1E 4K71C 2HT4C 5C0AA 4NNYA 4R97B 4GMSL 1FDLL 1CD1B 1ODAA 4OSUL 2IPKB 1DBJL 3PWJB 3C8KB 3L3IA 2EYRA 3UZEA 1S7QB 3GJFH 4WNQB 1G6VK 4QOKA 2F58H 4GRLA 5AWNL 2OZ4H 4F37F 4PRHE 3QUMB 3PWUB 1WV7T 3N9GH 3BFOA 2XOTA 2EE6A 4LKXA 1Q9KA 1BQSA 1H0DB 2FD6L 2BNRA 1JGDB 4RDQF 5GISH 1MCFA 1OPGL 1FNSL 1NCBH 1MFNA 5C0BE 5F1NA 4X7CC 1LO0L 5F7WC 3TNNB 4CMMA 3OKOA 2GITB 4M3KB 3SDXF 5I8OH 3S34H 1KJMA 3TBVB 5I1KL 1EAJA 4ZPVA 5J8OA 2LAAA 4YNYB 4HH8A 2FEEI 3V0WL 4U1JA 3QFJE 1BLNA 2GJ6A 5TH2A 3HPJA 1MCOL 1P4LB 3QR2A 3H9SA 4OT1L 3RGVA 4PJ8A 1DBKL 5B4MC 1XCQB 1AKJD 3VFMB 4UAOB 2P42B 1AO7D 4POUB 1G9MC 3MZTA 3F58H 4ONHB 3U83A 1EERB 3WIHL 2PTTB 3BGMB 4HKZA 4JFPA 5GZOD 4F7MB 5J11C 5F3BB 4XT1C 1RD6A 3VFRA 5HSFA 1KJVA 2VDOH 3WNNA 3TN0D 3MRFB 1N6UA 1P6FA 3CIQA 1R3HB 1YEIH 1AQDA 2DD8L 4ZUTA 4TSAH 3VFWB 1YMMB 1FNSH 3BZFB 3EJZC 4JPVH 4UT9L 2OTWB 5HHPA 1QEWB 3CSGA 2R2EA 4LVHC 5TE6H 1X4YA 1HOCB 5CUSL 5JIKA 1KIQB 1ZA6A 4HJGA 3PWPD 5D7LA 4N0UB 1WTLA 1ORQB 3VCLB 3O8XC 1MY5A 2B0SH 2K9UA 5D7LD 4J6RL 5AZEL 4D3CH 3EO1B 4EBQL 3FAXA 5HHOE 4Y19D 4YE4H 4ZPTA 5ADOH 4YR6A 4I1NB 1I7RB 4QOKD 3OHXB 4ENED 2Q1EA 5JNYA 3UX9B 3TIEA 1RK1B 5HYSG 3TVMD 3BXNA 1U58A 4WI6A 1QFUL 3L3JB 3DV4B 3IDNB 2E7CA 3CMGA 4LBEA 4XRCA 5C0AE 1CYGA 1CICA 1BWMA 5GGVL 5EU5A 1Q94A 5IG7B 3U4EB 3FJTA 5TE4H 4AM0A 5T1MA 3INUL 1EMTH 4XPHH 5ICZA 1QBMH 1ETZA 1U6AH 2P43B 4RGNE 3U9PH 5FHAH 2DQJL 2VLRE 1H3PH 2PUQT 2WUCL 3P0GB 3PIQB 3MV01 3QNYA 4OI9A 2WP3O 2VLKA 1YECL 1FNHA 4GJTB 1SY6H 2BNUA 2CLVA 4Y2DD 5HDQL 2R2HA 3VD9A 4O4YH 5DJ2A 4PLJC 4LPTA 4M62H 5JW3H 5ERWB 3ARWA 4ZPTB 2XWJB 4D9LH 5HHOA 1HSBB 1LO3L 1ULVA 5IB2A 1ACYH 1JHLH 1I7RA 1MOEA 4G8IB 1SBBA 4EN3B 3OKNB 3CLEL 1WWWX 3WKMH 1J0KA 5IR1A 4XBGA 3FO0L 3NA4A 3HNSL 5CBEB 5J1TC 3MROB 4YFLF 1JGVH 1F4YH 3TBTB 3WUWB 1DQLL 5DUBA 3VCLA 3VXPA 5F7EH 4HIEB 3VXOB 4XC3H 2NPLX 2ZNXA 1J12A 3C9NB 1MF2H 1Q0YH 5E8PA 4Z7NE 5IM7A 2CKBA 2QQNL 2LVEA 4WI8A 4TNWK 1Q1JH 3DVNA 1MI5D 1RUKL 2P5WE 3E2HB 1KOAA 4KWUA 4FZEH 5D7SH 3KPOB 5CJOL 2IALB 4KMTL 5FYLD 3LZFL 3MGOB 3QUZB 1A02N 4EI5D 1U8OB 2ZZUT 5D1QD 5C0JA 5ALCL 4Q9CA 3D9AH 5B8CB 1SVCP 4K2UL 3RWJA 4G8GB 5GRYA 4WFED 3MXVH 1IC5L 5IVXB 2PO6C 2DQEL 3U2SB 4JM2F 1ACZA 5LAXB 5ETUB 4P49A 2W1NA 5EOCH 4WHYH 5GPRA 3E1F1 4H0HB 3FOLB 3PP4L 4NZRH 1CR9H 2EDKA 2YD9A 4NO2A 5IROC 3VXRD 3KVQA 3KXFB 2ED8A 3RWFA 4BH8B 3TNNA 2AXFB 5D7JD 1GH7A 2QL1A 4C54A 5L9DL 4JE4B 2BP3A 4JQVC 2NXYC 1IAOB 1J11A 3EOBA 4OCYL 3UYRL 3MYJA 4OV5B 2C1OA 4XVTH 2XTJE 4P9HH 2BRQA 4Z7VB 4CDHA 3T0BA 4X9BA 3U82B 1DR9A 4X6BA 5DHVA 1E4WL 2X40A 3D3VE 3QXAA 4OKVB 4JZOB 1T7XA 4P2QD 1YEGL 4HIHB 3RZCD 4NUGL 4HPYL 3HZYA 4LEOB 1SYSB 4FQHA 1S7UB 3L6FA 4DQOH 3BDYL 3MRDA 3FMGL 4XPGH 1A1MB 1F4WL 1NANH 1XF4B 1F8TH 2NCMA 3P0VL 1HWGB 4W4OA 3WIHA 5HHOB 4GKZB 2C9AA 3HZKB 5ACZA 2EH7H 1MAML 2EIBA 1HKFA 4M8QB 4ZUUB 4I3RH 2MQ3A 3FT2B 3G9VA 3FB8B 3QT2A 1PYWA 2MNUA 4KDTC 3TBSA 2BVOB 3DLQR 3OG6B 4WCYH 3MLVL 4HIXL 1MCQA 5GGRA 3FAWA 3O4LE 3RVUD 3U0PA 3PGFL 4H26B 8FABB 4CW1A 1BIHA 1JPSL 1QRND 2DQTH 3RWHB 5KS9F 1E6JL 2DQUL 4JFYB 4OGXL 4LLQA 1FFNA 3GGWB 4AY0A 2RIKA 3MRBB 4KMQA 2ZOKB 5HI3C 4OJFL 4B7IA 3WFCH 3CVHA 4L9DA 3FQNB 2O5XH 1A7NH 5EA0H 1NMCC 3JTTA 2BSED 1FVEB 3W9EA 4F7CA 2Q8BH 3IKCB 2JE8A 4PJ8C 4WFFE 2V7HA 5DDHB 2FX7L 4APQD 3C5SA 3ARTA 4N8VG 4KV5E 3I6LD 2OXHA 1UKSA 5FEBA 4JQIH 4C56A 4NP4H 5MEPB 5C9JA 3EOAB 4M03A 3PP4H 4MNQA 2JK5A 5LWYH 4WI7A 4TOYL 5GZND 3G5VB 2H26A 4BM7A 1S7VA 1U41A 4LQ1A 1ROWA 5I1IH 3TO4A 4WENB 4JPWH 5HY9A 2LE9A 5DJ0B 3VRJB 4PY7A 3L3DB 5EH1A 3RVWC 4ODXB 2B5IB 5FO9A 1XR9B 3EO9H 5JHDD 3P0YL 3GMMA 1U8PA 3VFWA 4YK4B 4QRQB 2MKWA 1OCWH 3CK0L 4NCC1 4DZ8B 2RHEA 1SYVB 1JF5A 1IAKB 4KQ4L 4I0PC 3HNVL 2Y4SA 5FYKH 1ZT4A 2WBKA 3ZMRA 2PYFA 1D5BB 4GG8B 3RTQB 1WFTA 5I1GH 1TENA 5JOEA 3WFBH 1YYMH 5C86A 1R5IB 3LKRB 4JFDD 5FHAL 3G5ZB 3KLAB 4F33B 5E2JA 1F3JA 2MOVA 1R3KA 1YJDL 2QSQA 2EXYD 4WW1B 3DETD 2DKUA 3CUPA 2IFGA 2JJTC 4FQXB 2O5YH 3RVVC 4ZUWA 3VE0A 2BNUB 5E2TL 4LPUA 4KTYA 3G9AB 4NQSA 2IALA 1BEYL 5E9DD 1UVQA 1BFVL 1XGRA 2Q86A 3K4AA 5D7JC 5F1OB 5D72L 1ZT7B 2FH8A 2V7HB 1CG9B 2COQA 5DJZA 3FO0H 4N0CC 2ZCKH 3AC0A 3HMXL 1M71B 5I71C 3AS1A 3QPQC 1YPZA 3BN3B 2ARJA 4NKDB 3U1SH 1MCRA 4YHOL 5KANI 5GS0D 1CGWA 1BQLH 3QWQB 3QEQA 3SOBH 5C71A 2A0LC 5IB1B 2G2RB 2FGWH 4MGXA 2EYTA 3DECA 5ISZE 5CD5D 4NQDA 1KLFA 1ZMYA 2DQJH 1YY9C 4UILH 1ZHNB 5DO2C 5EIQA 5F7LB 4CJ1A 1MCWM 1I1YB 2V17H 1ZVSA 1KN2H 4DJMA 1MWAL 1FPTH 4L3EE 4LP5A 5CUSH 3MUHL 1RZ7L 1S7XA 1CWVA 1LE9B 1SJEA 3BIBX 3WD5H 5I16B 5GIRB 3GBML 3MCLH 1RZKH 5DMKB 4JFDE 4P2RD 1S5IH 1LO3H 1NFDA 4I3GA 5J13B 1MWAB 2P44B 4AL8H 4Y1AA 1FO0L 3S88L 2VR5A 3S4SG 3HZVA 1B4JH 2DM4A 3JBG7 1KLGA 2CXGA 1NCAH 3MV9A 4PV8A 4WO4D 4RWHA 3JUYA 4XNMB 1CU4H 4KVCH 4DVBA 1CLZL 2NXZC 2ZKHH 4NCC2 4OF8A 2YMXL 1T89C 1BREA 2CDFB 2CDGB 3MRRA 5B21A 4AENB 4M02A 4OLZL 1H3PL 2HLAB 4NO0B 3TBWB 5HYQA 1LEKB 1I1YA 4LSQH 3TYFA 2VKXA 3GSQB 5TE4L 3M8OL 1NBZB 1YQVL 4GOSA 2ICCA 4U6VL 3IJYA 3QULA 5C70A 3NCYP 3RNQA 2G5BB 4YHKL 3SHSA 2ARJB 1DEEA 1BVKB 2Y25A 3OKKA 4S1SH 3VWKA 3MLSL 4Z95H 4HWUA 3PWPA 2E7HA 1CQKA 5I18L 1NKRA 3C5JB 1CDJA 1MFBH 3S37L 5HYJE 1SQ2N 4MHHI 4GRWH 4Y5VA 4X6EA 3QHZH 4H1LG 1KN4H 4LGRB 2BRRH 3DROA 4JAMB 3DV6B 1NCDL 5I76B 4DN3L 3MR9A 1JNHB 3MRDB 1OTUC 3SDXA 4LAQH 3BDXA 4BUHA 2QSTA 1NLDL 4R26H 5HHNA 2EDRA 4G6KL 1G7PB 3TO2B 4N0CD 1LGVA 1GOGA 1OLLA 4MWFB 1Q0YL 2VAAB 1I3RB 5GJSH 3B9KA 3BQUB 3IDJB 2BVPA 3RTQC 1G0YR 4YO0B 5A2FA 3SY0A 4MSWA 3HI6H 2GJ6D 5J89A 3NZHL 2J6EL 3EYSH 4KK8D 2P8LA 1R3JA 4Q2ZB 4WHDA 1C16A 5IQ7H 3CH8A 3HS0B 5HPMA 5IVNA 3FRPA 3NAAH 1CGSH 3B9VA 1QLRB 3T0WA 5SV3A 4PY8J 5CGYC 2DI9A 3QXDB 2YA2A 5TJWK 1FDLH 1I7TA 1LNUB 1MNUL 2NY6C 4I0PD 4NRYA 4Q6YA 1EK3A 9CGTA 2OJEB 3ILQD 1BHGA 4NDMB 5C2BL 2EDJA 5DDHA 4UIKL 2GI7A 4Z77B 1INDH 3QPQD 1UQSB 4GAJL 2Z92A 1QBLL 3L3OA 4N8CH 2VMFA 2VL5B 1WCBA 3MNZB 2WINB 2XN9E 4KC3B 3CXHK 4UV7H 3AMKA 3UTTE 4RAVB 1NGWA 1G7JB 4UTBL 4KJYA 4RRPA 5E8OA 5EU4A 4OGXH 5JOPD 1U58B 3QQ3A 4K3EH 4TTDD 2EDYA 5D1QB 5IJVA 2I60L 2FO4B 1J0ZA 4ZTPH 5D1ZA 1BBDH 2PR4L 3SGJC 2DLEA 3OX8A 2W0FA 4P57A 2Q7NA 4I3RL 4PJIA 1BZ9B 2OJEA 5E1AB 4PLNC 4BFEA 4ODBD 4HK3J 1G7MB 4CVXB 5INCA 3HE7C 2A83A 5DQJA 4Q2ZA 4M1CD 3S5LG 5DT1H 1INDL 5DTFB 1IBGH 1BF2A 4QXTA 4R4BB 3V5KA 4XX1E 4EDWH 3QRFM 2IH3A 1VB9A 3N1QC 1E6JH 2DQUH 3P0YH 1MHHB 4WW2C 1F42A 4U6TA 5D9SA 5EU4B 2NTSP 4MNGA 2X4RA 1D6EA 3GKWL 4WEBH 3LS4L 3TFKD 2YXFA 1KT2B 5FYJL 3BD3A 4HFWB 3U7WH 3X14B 3PL6B 2R0LL 5D8JH 2GJZA 4RGOL 3BMWA 3B9KC 1E4XI 1T5WA 1HQRB 3CUPB 32C2B 3DVIA 3EW3B 5K59F 1JMXA 3TYGL 4NQDB 1BOYA 4GW5B 2FIRT 2X9WA 2OBGA 2CLZA 5FA4A 1QSFA 2H45A 1KPUB 1Q9OA 3OL2A 5AYUL 4YDJB 3O3BA 4NKOA 2CJUL 4PJEF 2X4NB 1KBGH 4JM4H 3GSOB 2FDBP 3T0EE 4OD1H 2CMRL 3WSQL 3HE7D 4Y4FB 1E4KA 2ICES 2X1PA 4JFEB 4PJGB 4MNHB 2XZAH 1EO7A 3QO0B 1E28A 5I8CB 4U1NA 2X4UA 5JO5B 4XNXL 5E6ID 2A73B 4CN4A 1GCFA 3MOAL 1KIUA 3HAEH 2AQ2A 2YSSB 1TVBA 4PBVC 4PRNB 1VFAB 2M26A 2R2BA 1TXKA 4P2QE 1TQCB 3JV6B 3MJ7A 4OIAA 5IBUB 5IB4A 4HKXA 2D7PA 4PJEB 1LO4L 4NN5B 1RZGB 3W39A 1IVLA 3P4MA 4GRMA 4MYWB 1KFAL 2CIKA 5D6DC 2VISB 5JW4R 4JRYA 3NPSB 1T1WB 4LVNC 3RTQA 5IT2H 1G9MH 4DVRH 4U6VH 1X7QA 2JELH 4HFWA 1OT1A 4FQLH 2ZG1A 3MCLL 3OV6A 5D1ZB 3V2AR 4I3SL 3JSSA 3FQWB 4TUKL 2BSRB 4ODTH 1OARH 2QKIA 5EZOH 1DQLH 1F6LL 5TE7L 2RR3A 4HFUH 2EIZB 4LVOB 4RSVA 3CD4A 4X4XB 1IKFL 2DAVA 3TT1H 2XN9B 5BVPH 3KPMA 3U1SL 3NFNB 2C4FT 2DQIL 1I1AB 1FCGA 5L2KD 2CLZB 2A83B 3T3PE 4HK0A 3LD8C 4L3EB 2W38A 4P2OC 2HT2D 3R4DA 3DBXB 5IB5B 4OZGE 3Q3GA 3RJQB 4LAQL 1RZKC 1A3RH 4UOW0 1MUJB 3FB8A 1IEAB 4NKDA 4X80L 4LPXA 4OIBA 2H3NB 4OCNC 1MWAH 2Z31D 4U0RB 1V7ML 2AJVH 2ILLA 2VERN 4JN2A 4PLJD 3MRNB 4JN1H 4O00A 3QQNA 4MD4B 5JZ7D 5IUSA 4YHNB 1GPOH 4Y4HA 4OCLC 1AHWA 1MI5A 4JRWA 2D0GA 5C6TL 1WICA 1WCBB 2UYLB 1ZT1A 2D9QB 1OAUL 2HG5B 1VERA 2H32H 4LCWA 2EO1A 5FYJE 4Z18A 1MJUL 2XY1A 3CSBA 5DRXA 1U92B 4OCXL 1VA9A 5DQDH 4JLRA 4QHMB 3ROLB 2FEDD 2ZKHL 1E4KC 2MKLC 5MENE 2N7AA 4J2XA 1A3RL 3REWB 1ORQA 2P1YA 2WQRA 3HI1A 2FZ3A 2W91A 1KJ2H 5CMAA 1ZLUK 3PABA 2B1HH 3QJHA 1TQCC 4LVHB 5FM5O 1UZ8B 4NHUB 4JO4H 4MA8L 5JHDE 1NGQL 2X89D 3AXLB 3HZMA 1BOGB 2FH6A 1U8PB 5GJTL 4WUUB 4WTZG 5EG6C 3AFLA 3VRIA 5C08B 4PIRF 3SE9L 4IRSB 2VLRB 4X6DA 1KN4L 2V2WA 4P3CL 4ODHH 5F88A 2Y5EA 4BFBD 5A1AA 4WIQA 2IBGA 1X7QB 5MENA 1VENA 4JHAL 3MC0A 4Y19E 2XA8L 3KJ6L 3QIUB 4LSRH 1AGEB 1NUGA 4FFZH 4G6MH 4S1DD 2AP2A 3MRIA 4B0MM 1NH6A 1U8QA 1NCDH 4X7FC 4AG4H 1JPGB 2GJZB 3DROB 3QIUC 3OPZL 1HQRA 5I76A 2PYEA 1IAIL 2ZSWA 5GZOC 4X6CA 4GMSH 1A7PH 3U46B 4RX4A 3NCMA 3QZWG 2L7JA 5L8KB 5DR5L 2APWA 3UTSE 1EFXD 3IJSB 2WWMD 4M9OA 1PEZA 3PV6A 4KPHL 3O4LA 4JY4B 3GHEH 4DZ8A 1RIVL 5KSBE 1WVZA 2F58L 1VFOA 4XP4L 1BZ7A 3MV8E 2CRMA 3MRJA 1DEEB 4WNQA 4HV8A 4XC1H 3ZKMC 1I8KA 2IANE 3D3VB 5KVEH 4D0CB 2FZ3B 4JFEE 4PJGE 3GSNH 1QPPA 1G7MA 4GW1B 1CBVL 4MJIB 2W65B 1JZ5A 2C3XA 4K94C 2WK2A 3SDDB 3I02A 3DSNA 2YN3A 1NFKA 2Z8RA 4OCXH 4XH2B 2XYCA 1F2XK 4MXVE 4MNGE 5CS7A 1I9JL 4YPGA 5C0CB 3KPSD 3TWCL 4TULL 1VSCA 1DN0B 1ZKAA 2X05A 4UU9B 4G6AC 5EOQH 5D5MF 1EVUA 3U0WH 5HJ3A 2YN5A 1DTUA 3ARBB 3RGVD 4PP2B 5IG7A 4WW2F 5HI4C 4AEEA 3U4BL 3UJJH 3FFDB 5TFSL 1A64A 4X98A 5GXBB 5T5NG 1R5VA 3TJEH 5IIEA 1JPGA 4RIRB 4NGHL 4UNUA 2CKNA 4N5UA 5K9OB 2DQTL 3VWKD 3BHBA 1OGTA 5JW5B 4QF1A 2DM7A 4YHPA 1I1RA 3FQXA 3L5HA 4PJAF 5BJTA 4JB9H 1HILA 2JJUA 2I9LB 1D7FA 1U93A 3GSNL 3I2CH 4ZMAT 1FC2D 3C09B 1I7ZA 4O2CA 4AZ8A 1FZKA 1KF9B 1Z2KA 5BOZG 5ITFA 3K3QA 1FVCA 3ILPA 5DA4A 2V2WB 2GSIB 1JNNL 4GG6A 2F74A 3T0EB 4OZGB 4FQ1L 4MD0B 4JM4L 2DRUA 4D0BB 2JF1A 4YDLC 5BXFA 2YPLA 3GI8H 4D3CL 3OBAA 4GW4A 1WWAX 2Q20A 1CXIA 5EZOL 4PJDE 2X41A 1MRFL 4WW2A 5C0AD 4HS6B 1V5JA 4MJID 2H2PD 4O02H 1QSEA 5KG9A 4PRPB 3ULUD 5EBGA 4WFGD 3B2UC 4NN5C 3HC4L 4W6YB 2VL4A 2R0WL 4PJEE 4S11A 1RZJH 1GAFH 5GGTA 1FORH 1MQKL 3KGRA 4LCYA 3DO7A 3HB3D 5T3XE 5FGBC 2BJMH 1T1YB 3H9HB 4O9HH 2Z8WC 5C0BD 3PWPE 4IOIA 3VXME 4NQCA 5DI8A 1BM3L 5C6PB 1YC8A 2IADB 1SYVA 3QNXB 3KPRD 4WEMB 2ITDA 2R4SH 1ZT4B 5CJQH 5EZLB 3DTXA 3GMRA 5TQ0L 4XI5C 3PJSB 3GO1L 1YZZA 4JPKH 3TBTA 2YK1L 3VGBA 2YPLB 4RGMB 1CE6A 1GGIL 4TUKH 1CDCA 1IGCL 3PABB 2Y5TA 5IFAH 4O58L 1OARL 3ZKMD 2E5EA 4WFHD 4M5ZH 3NTCH 5FA4B 3IETA 2GK0A 5FYKE 1LO2L 4YWGL 4N9GA 2GK2A 2QQKH 3UBXA 1N5YL 1MHEB 4JRXA 4HCRL 2BOCB 5DRNA 4XHJC 1OW0C 1FRGL 1N26A 2W9LA 4QCIA 4KKCD 3H0TA 4I77L 3TO2A 4DW2H 1EZVX 1AQKL 2YA0A 3C5SB 5ACMA 3SDAD 3SDCA 1IM9A 3FT4B 5EUOB 4LSUH 2Q3AA 4WW2B 3K0WA 5J4MA 4R2GD 2NLJB 4ZUSB 3LN5B 2CO6B 4G7VL 4ZG1A 5IM7B 2H1PH 4JM2A 4MAYA 4Z95L 3I2CL 1RFDL 4QRSB 4NFDA 1NAMA 4LNVA 4QY8B 3AMLA 4XB7A 5C09E 1HCFX 4HKBA 5FUOL 4OGAC 3VXMD 5ALCH 2ATPB 4YHIA 4KUZL 4JJ5B 4N0YH 4C4KT 5J13C 1IQWL 1AXTH 1CIDA 35C8L 4J1UA 3TZVC 1K8DA 5DS8B 3LQMA 3NTCL 1NMBH 4IMKC 4MCZB 5DMJB 4D9QD 3ROLA 4S1RL 3UTOA 1JN6A 3GBNH 4ZUUA 5ABDE 1HK6A 1NGXB 2XRAL 4MLSA 2X9XA 1KG0B 5I1AB 4G5ZH 3ARYA 4HC1L 1RSFA 1RQ5A 4Z7VA 3TCLB 1IGIH 3EKCA 3RNKB 2C7UA 3MV8B 1U8KA 2ICWI 5H2BA 3HG1A 1VFAA 4CAGA 3EFFA 2APXA 3NH7L 1NLBH 1ZHNA 4U1KB 3BUYB 5E94B 1QNZL 5E00B 1T1XA 4FQIH 1XCTA 2GY5A 4FFWD 4MAYB 4JFHD 1K4DA 3RWIA 5F44A 4LLAA 1A4KA 2EXWD 1EXUB 5C0EA 1J1PL 1CD0A 3NIGF 4YPGB 4JDTH 3RI5F 4ZO9A 3T3MF 1MELA 3DV4A 3IDNA 4NOFA 2Q86B 4BQ6A 1IFHH 2IAND 5J56B 3AM8A 1GSMA 4NDMA 3GK8L 1DL7L 5JDSB 4ODHL 2B4CH 3QCUL 4NM4H 6FABH 3Q2CA 3VFPB 4UDTB 2IBZY 1MJJB 3BP4A 3UYOD 4X7SL 1X4ZA 4NQUA 5BRZB 2X6MA 1VACB 3HCVA 1GGBH 1EEQA 1VEOA 4LPVA 2F15A 4NO3B 4I18A 2P4AB 4AQOA 3P4OA 3VXQA 2H8PB 3EYUL 2XQYK 3RFZC 1GOHA 5KSBA 2WM0A 4OCWH 1VKXB 5MHSE 4ONGH 1AQKH 2B7DT 4EQ3A 4HIXH 1I85C 3MLVH 1QFWI 2C26A 3EYQC 1AGDA 5A3IC 43C9B 4U6XB 2BNRE 2XWBA 4AEHL 3REVA 4R3SB 3KXFD 1K6QH 4PJ7F 2B2XL 3E8UL 5EU3B 4BJLA 3VWJA 3D48R 3UBXG 4YDKL 5CEXA 2B4CL 4MNQB 3S35L 1T0MA 3G5VA 1UJ3B 4S2SB 4KY1L 3UTTD 1ZLWK 4PJ9A 1CGSL 1A3QA 4X7TA 1QO3A 3JTTB 4FFZL 3MNWA 4E5XB 3R1GH 1X5XA 4UIMB 3RGVB 3KYNA 3TFKC 4AG4L 5D7JA 3MYZA 3ECBA 1K2DB 4I48A 4Y5XB 3U9UA 2GSIA 4OM1L 4XPBL 4QHLA 5EU6B 4WVRA 5E6ZA 4HAFA 5I1IL 1AD0B 1G6RH 5DRZB 4KI5E 4WY7H 1P1ZB 5K9OA 1JHTA 4FFVD 2GTWA 1DBBL 1ZHBB 1FH5H 4G6JH 1WT5A 2ICWA 4LLWB 5DJXA 4IRSD 5FB8A 5E8NB 5A2KH 4KJWC 2HTLC 4OD2A 2AS5M 1A5FL 3C6LD 3SKOB 5CEZL 1GAFL 3WN5C 1E4XL 5E5RB 4DKDC 4LU5L 3MLUH 3TBYA 2O5ZL 2UWEE 4O51A 1JZ7A 4RBPH 3FRUB 2VAJA 4L3CA 3NA9H 1Q72H 1DLFH 4QTHB 1WZKA 3C5ZD 2BDNL 3IDMB 3WHE1 2NXZB 4YGVB 4Y1AB 4JFQA 4LFHD 5D7KE 1T22B 4QHNA 4R0LC 5IHZA 4L8CA 3WIFB 2Z92B 2J12B 1FL3A 3X13B 3D25B 2B0SL 5EC2B 1S7UA 3QQ9C 2BSSB 4FQHB 1SYSA 1B90A 2MHAA 2QSCH 4GH7B 4O2FB 3U6RB 5L9DH 1BGXL 1J0YA 5E8NA 2BOBA 2QJDA 4JJ5A 4FMKA 4CUCA 1YEDB 3O4LB 1K8DB 5IJVB 1BJ1J 3LV3B 3WIHH 2IMNA 3MRHB 3FT2A 3OR6A 5T1MB 1G9ML 5I71B 1BX2A 3RI5K 4RIRA 2VDMH 3STZB 4YUEL 4OCSH 1R24A 3V52L 4YHYB 1YNTA 1MHCB 1IM9B 4PJGF 2YD2A 3KS0J 5GSRA 2GY7B 1NGPH 4UV4L 1FGNL 1SBSH 3FOLA 2DWDB 1F4WH 3LEXA 3P9MA 3MOBH 4KGLA 2A9MH 1QFOA 2MPAL 4NJ9L 4CKVX 1RZJC 2BC4B 4BA8A 1YPZE 3C2AL 1WTGT 4UTAH 1N8ZA 5IMLA 5F70A 3V4UL 2IJ0C 3BKYH 4PRHB 4XMPL 5E70A 2F54D 2R0WH 4P2QA 3HPJB 3QUZC 4S1RH 2GJ6B 3QZWB 5C1MB 2ATKB 3PGDA 3T0AA 2OZ4L 4PRAB 2A9NH 3O6ML 3PQYA 3RPIB 2J8HA 3X14A 4DN4L 1QSEB 5GS2H 3WV0A 4YEFA 4MAYC 4G6JL 5LXGH 3MLRL 2CPCA 4HCRA 4DCQA 5ID1B 2BNRB 2UUDH 2DOCA 1KFAH 3RBGA 2X7LA 4X4YA 1MCNA 4YXLL 1R6VA 4G9FA 5F8QC 1GGCL 4YX2H 1SBSL 5JLZB 4MA7H 2ERJC 2VITB 3OKNA 3LZFH 1M05A 4PTTA 3WLBA 4BQCA 4HWBH 5JR1H 3OKEA 3LRSB 2XTJD 1NEZB 2D03L 2R9HC 1G7PA 3T77B 3VFNB 1DJSA 3JV4B 5CGMA 4PJ8B 1S3KH 1MIEL 5JHLL 4OZHA 2XY2A 4LL9A 3KPQB 4AQ1B 4JZNB 3GMLA 4L8CB 3S3JA 1YDPB 4W4OC 2DQDL 1A6WH 1URLA 4LLQB 1B0WA 2AJYL 3ZDZE 3PDGA 3BH9B 4ORGA 1LILA 3PWLA 3FOMB 1X5JA 3ABZA 3FQRB 3RHWF 3C08L 3ESVF 4Z7UE 4LBEB 4XRCB 5FYLH 5CSZB 1YEDA 4ONGL 1P69B 1W72H 3WN5B 4M5YH 1L7IL 4P4KB 1TVDA 3A6BH 5JW3L 3RA7H 4HWNA 2WUCH 3WL9B 4J8RA 2V5TA 2DIAA 2RAMA 1YECH 4YIQA 2QHLA 1ZLVK 2IQ9H 5D5MA 5A40E 5E2WH 3E6HB 5B39G 3SDYL 3WLWC 5C0NC 3S35H 4OFIA 2DWEA 4H0IA 1IAIM 3IVKA 2UV3A 2OQJA 4PRIA 1RJLB 3ZL4H 1RUAH 5E7BA 2PW2A 3ZSTA 2VLKD 1SHMA 2XRAH 2PCPA 4P9HC 1AIFB 1OGAE 2HG5A 3JXAA 4XBEL 1FC1A 4DGIL 1L0YA 3WE6A 3SCMB 2ZCKL 3JTSB 1CF8L 1NFDB 1BVLB 3DRQB 1CVSC 2ITCB 4KMTH 5C0DA 3LVEA 5JZ7C 1KIPA 5L7XH 3CVHL 2AXJA 3RPIA 2VWEC 2XQYG 3FL7A 2PETA 2D7OA 3T2QA 4PG9A 3TVMA 3P77A 2O61A 2B1AH 4WI4A 4HXAH 4PJIF 2J8UA 4HKZB 1FN4A 4QHKI 4P9HL 4OIIH 4UAOC 3LSOA 3OR7B 3ARFA 5M7QA 4XVUC 1A5FH 2X7LB 4Y19A 2JJVA 1ZEAL 4P3CH 5I8OL 4QRTB 4AT6A 3UEZA 2FX8L 4IOFD 1T3FB 4NQEE 1FAIL 5D2NB 3RUGB 1CN4A 2GCYB 4IIQC 1F4HA 3VD4A 5E95B 4UBDC 2OZ4A 4YQXL 1AJ7H 2CR6A 1LP9A 5H94A 3Q5OA 4DGVH 1IC1A 3STZA 2EZ0C 3MV8D 3KYMB 5B38B 4EDXB 2YUZA 4Z7WB 2P5EE 5DJ6B 3IDXH 3BEWA 4W68A 5I1CH 2VR4A 3PL6A 4PB9L 1AR1C 1OF2B 1X5LA 4HUVA 2PTTA 3A0OA 1CFSA 2PTVA 5I9QB 1FBIL 3QDME 2HWZH 4M7LL 3F58L 4ODVL 1MCIA 5K9QG 5F88B 3QWOB 5HHNB 3SKJL 1MFEH 5CP7B 4PRDA 3RVVD 4KK5C 4YBQC 2X4RB 5L2JB 4QGYA 1AKJA 1FZOA 4KZDL 1Z0MA 5FYKU 4JGMA 3VFSB 2CSPA 2D7MA 3W2DL 1HINL 4R0LA 3V0WH 1D9KA 3G08B 1KLGB 1QLEL 2XXMB 5EOCL 2AQ1A 4L1DA 4OJFH 1OQXA 1UZ6F 4PJHE 1CR9L 4BSVB 3VGEA 4MQ7B 1XGQB 3KPNB 1UM4L 3HI5H 4HGWB 4JGJA 4NO5A 3TO4B 2BNQD 1W72B 3IVKB 4Y19B 4ACPA 1JWSA 4TRPH 4Y7MA 3BKJL 1P7HL 5IWLC 2KZWA 1CF8H 5C0GA 4NZUL 4I2XB 1K4CB 3QDGB 4PJCF 4O9HL 4PJ5B 4H88L 4XP9H 4BFGA 3CX5J 3LKPB 3EGSA 4PV9A 3BRDA 4ZFZA 4PPTA 3BP5B 1OTTC 4HJ0D 7FABL 1X3DA 3NA9L 3VI4F 1EX0A 3I9GH 3FT4A 3OKMA 2CIIB 2W0PA 5EUOA 2OS7A 2XA3A 2M8XA 3DO3A 1EEUA 4MJ6A 4XNMA 3ARXA 3WYRA 3L3OB 4WUUE 2J1KA 4WTZA 5IFAL 3O41A 3OXSA 4U1MA 3LHPL 4HBCL 1BJ8A 4XP6L 1UH3A 2FLRT 5I66B 3D0LB 4XVJH 3RU8H 1NDMA 5FUCC 4K9EH 3VXUA 4FABH 3O2DA 3QUZA 4FQXD 3DMMC 5TPWH 4DUVA 2YWYA 5DJYB 2YXMA 3Q3GB 3VGGA 3V4UH 2WBWB 3NCJH 4Y16B 4M8QA 1P4IL 4NN7B 4IRSC 5LWYL 2LABA 3T2NL 4TVPL 4Z9KB 3G08A 4FS0A 3C60A 3LRSA 5T5FL 4DGYH 3U30C 5K9QI 4BQ8A 3O8XB 4AIXA 3K8MA 4RGMC 4OZIB 4NNXA 2G2RA 3N1PC 3CFDA 4H25A 1X44A 1N6QH 3EDJA 4CVZA 3B3IB 4XPHL 4FMFA 2P47B 1JGDA 4X0KA 4L4TA 1H8OA 3H3BC 3GRWA 4X4YB 2BHUA 1MPAL 4FP8L 1CFSB 4QNPE 3L5XH 3B5HA 3BYTA 4XCFH 5L6YH 4PYGA 4KRPC 2WIMA 2VZUA 4NZDA 3MCKB 5EU7E 4EJ1C 4F9PA 4Y2DB 2R4SL 3T2PA 4HULB 1U8NB 3AVEA 5KSBF 2QBWA 5ENWA 4O2EB 5SWSD 5AG8A 4POZC 5E8PB 4ZFGH 4F33A 2IH1A 1FNAA 2VZTA 3UJIH 3SGDI 4Q0XL 5C0EB 3Q6FA 1RZIA 4F7PA 1N5YH 4H20L 1XAUA 1A9EA 1MCKA 4EDWL 2LQRA 4IOIB 4XBEH 5M95B 2MCG1 3SDXE 5CEYB 3QA3B 3RWJB 1GYAA 1FZJB 3QDGA 3MLRH 5TGBB 3W11D 3AS0A 5L6YL 2R8SH 3RZWA 4M5YL 5FF6A 4LDLB 3GK8H 1BVLA 4DWHA 3B6SA 1U42A 4P0DA 1KIPB 4M62L 1F11A 1RUPL 2ZUUA 3MO1A 3QYCA 2QQQA 2AEQH 3HAEA 5KS9E 4HZAA 2O93L 4HUNB 3GEWB 2VIRB 3G6AA 4FABL 3FZUC 1I7UA 4V2CB 4WWID 5FKPA 3RVXD 4Y89A 3ZT5A 3KLDA 2XTJB 1TFHA 5D1ZC 3H42L 1BD2A 3IGAA 3VXTB 3OAZK 3O6LH 5JHLH 3RY5A 2HVKB 3ULVF 3D85D 5DD6A 4LCCA 4LRNL 1AJ7L 4BKLA 4Y16A 5EBWA 4J3XA 4ZAKA 3V6OC 2GAZA 5D7KD 4PGBB 2HA1A 3ARDB 4KTDL 4NWUL 1K3IA 3LQZB 3S96A 1S8DA 1RUQL 3CVIL 3QDGE 3QUKA 1QG3A 4Q6IB 4AEHH 2D7QA 1QFPA 5DMIL 4J3WA 3PIQA 5I30H 5HYSB 1R3IL 4U3XA 3HHRB 1UG9A 4WHYG 3F7RA 3FQXB 1OVZA 2NY5H 3MV7A 3AAZA 4TQEH 1JHKH 1JZ6A 3UROR 4N9GB 3ARDC 3P4LA 3GSQA 1A9BA 4DQOL 4GKZA 5DJCA 5IB5A 5KS9A 1K8IB 3CFEB 4HIJB 4MZ3A 1EXUA 4Y4FC 1QKZH 5FGSA 5FKAB 4PGZA 3PF2A 2UZIH 2DICA 4K23L 1J0IA 2HVKA 3ZE2F 4GLRH 4RGNC 3L3HB 3VFTA 4YBLC 4YQXH 3FO1A 4PJ5E 1A7OH 1J8HD 4X5WB 2L4OA 1SJXA 4UQ3A 3QG6B 2BVEA 4WY7L 1CD9B 3DMMA 1RHHB 3QCTL 1FNGB 1T66D 1DBBH 2FX9H 1RZGA 3W39B 5GS0L 3HC3L 1F02I 2HN7B 1HHHB 2VISA 4RMVA 3B5TA 4NQEB 4P5TA 2KQNA 1FIGH 4NNYB 3O3UN 2DLFL 1RJYA 5J6HA 4XAWH 3O9WA 1TITA 1GHFH 3QIWD 3D39D 2Q3ZA 4GBXB 4N5EC 4NUGH 4UNVA 3VA2C 3NBNA 5F6IC 3EIFA 4WEBL 2RFXA 2ADJA 5J6GB 4U1NB 1PQZB 3CMOH 4QXUL 3IDJA 1N0XL 3J7HA 4FQCH 3REWA 2A73A 3F62A 3FT3A 2R0KH 4DKEH 1ZANH 2EDNA 3QWRD 1Z3GL 4RCAA 5C3LD 5HHVH 3T09A 5IBLD 3CFIC 2R0ZH 1PG7X 3Q1SL 4PJ7E 4X7EC 5CBAB 1C7SA 2BSTB 2H8PA 2YPLE 4O2CB 1V7NL 4I18B 5DMGC 5D7IE 3UPCA 4N1HB 1PD6A 4HLJA 1FYTD 1EBAA 3IDYB 1RHHA 4GO6B 4MQSB 1B6UA 4X9HA 5I66A 4M93B 5IEKB 3QFJA 2ZG3A 1Y18B 1GRWA 2Q76B 1IZKA 1FFQA 3GI8L 1OAQL 3IDYC 5ALBH 4YC2C 3RY4A 4OFYA 4WUKH 4U49A 4KJQD 1NCWL 1TPXB 5C0DB 5JDSA 3ARSA 1YNTB 3SJVA 5I30L 1LE5B 2I60H 4AJ0A 1OQOA 5KSUA 3DRTA 4IM8A 1KTDB 4CGTA 2ZUSA 1W0YT 3VGFA 3EYVA 4RFEA 5F6IB 1JNLH 1RURL 3LN4A 1A14L 3AAZB 1LEGA 5FOBA 1RK1A 4GKNA 2HMID 2D4FA 3D0VB 4FTVA 5GQBA 4HKJA 2NY0D 1CGXA 3K1KC 4Q58C 5TDPB 5IOPA 3F7YB 3TZVA 3BKYL 4F15B 5C2BH 2ENSA 4ONFL 1J87A 1GGIH 3VI4E 1SEBA 4HV8B 5F7YC 1BZ9A 2VLJD 3Q5YA 3BI9X 4H88H 4HGWA 4XP9L 2VLKB 3EDKA 3ES6A 4XWGH 5KZCD 4P2RB 3HZVB 4OLYL 4OFPA 1EFQA 2X70A 3QEUA 4I5BA 4EI6A 5BQ7B 4AL8L 1J7VR 4KI5D 5BVPL 3S88H 1P7QA 1HH9A 2NY1B 3MNZA 1MCPH 4KKLD 4ZAKC 4P59H 3NACH 3MNVA 2HJFB 2WIIB 5DMKA 1T1WA 3BX7C 3E3QC 5CP7A 3B4NA 1ADQL 5EUKB 3H3PH 4XVJL 1YC7A 4P5TC 4KJPD 5E8EA 3SE4A 1FFPA 1T21A 4EIGB 4V1DE 1MJ7H 2AXGA 3QA3A 4HIIA 3BJLA 4ZFFA 5DC4B 5TGBA 1A6ZB 4LSVH 4X98B 2XKNA 2ZUVA 3RWCB 1RHFA 4DK6A 4F7PB 4YAQB 2FBOJ 2Q7YA 1BIIB 4J23A 5SWSE 1DSFL 4QXGL 4PLKC 4E9LA 1IKNC 4Y1AE 4LMQE 2ADFH 3MXWH 5IK3A 2VZSA 3O3BB 5D7IA 4EKXA 4ZUTB 3RY6A 1A7RH 3GKWH 5F97E 4MXQD 3L5XL 3MRHA 4XCFL 3HFML 4JRXE 1UYWL 3Q6GL 3RVTC 3BZ4A 4HK3N 1G9NL 4EN3D 2A1WL 4R7NB 4MXWH 4XTRD 4NGHH 3H3PL 2DMBA 3JWDC 3QCVL 3RIFF 1KN2L 4DVRL 3VMPA 1KCRH 4Z78B 2VRAA 2MFNA 3HMXA 1GOFA 3QG6A 3TYGH 1J1PH 2VZOA 3ET9F 4IEFB 5AYUH 3QUXC 5KVMC 1K5NA 5T3XL 2CLRB 3BZEA 1N7ML 2H2SC 3B9EA 5K59E 2Z93B 1DE4A 5D93B 3BE1L 1QPXA 5DEGB 3FFCA 4TPRL 5HGHA 2OP4L 1JZ4A 3MRMB 5GGTH 2YC1A 1CQYA 2A6DA 1RY7B 2PXYC 2YA1A 1JWUB 1IAII 2EH8L 4YDIL 1PKQA 4Q0XH 1YEFL 4YBHA 3V5HB 5MERA 5F9JB 1IC4H 4ETQA 3KDMA 4AIOA 1WC7A 2I07A 1JI2A 1XH3B 4GRLB 4LSSL 5HYSA 2DTML 3EOTH 12E8L 3ARGA 3Q5TA 4OZHF 1AI1H 2ORBL 3D2UA 3F8UB 3VFVA 2YD1A 4OLUH 2BMKA 3BP6B 1U93B 3MMEB 1RK0B 4RFOH 3F12A 1XGUA 3S4SA 5J1AA 1H3XA 5D1QC 4NRXA 3MJGX 1KEGH 3VRIB 3P4NB 2A74A 4JKWA 1NUNB 4JZJB 4Z8FL 2HTKC 4LGSB 3BXNB 3KLHC 1G7JA 3TH4T 3SCMC 4U0QB 2VH5L 2YUWA 1T5XB 1E0OB 4MNGB 2FR4A 2EDEA 2CK2A 5ANMB 4HG4J 4DUWA 2DQEH 4Z77A 4GXUN 5F7DB 2BRRL 4D9QE 3U0PB 1PJ9A 4JFXB 5HYJA 2MSPA 4NKMA 4NO5B 4HHAB 4Y16C 2NX5E 1FG9C 4PJCB 2UVFA 1Z9OA 4JY5H 4WJ5B 4S1QH 4HH9A 2GJ6E 4YHIB 1J5OL 4GBXD 5E4EC 5HHQB 4KTDH 2VITA 4S0SD 5E2UL 3BRFA 3FHAA 5IHBA 2FHFA 1UB6B 5I1LB 2CRYA 4LPCA 2X4UB 1KPRA 3OB0K 4MS8D 5T1LA 1NUFA 5FFLA 4ZTPL 5KSAD 3GSXB 2OJZH 2VSCA 3QAZC 2ZUQC 1RIHH 1G6RB 4QRPB 3SQBA 2BMKB 3BP6A 5K9JH 3MLTA 1HXYB 1OD7A 1XIWA 1RURH 4ONHA 1C12B 1AHWC 2OP4H 3QI9D 4PJ7A 1HI6B 3LQAL 4X99A 4GW5A 1WGOA 5FV1L 2J2ZA 1TZGL 1IAOA 3ZYIA 3VGDA 3QDAA 2P5EA 2X1QA 1NMCB 3OJVC 2ERJB 3QIUA 5DR5H 2XKSA 4Y8DC 3TO4C 1QVOA 3MBXH 5MHSD 2MJWA 4MNHA 3ARDD 4ODSH 4G8GD 2A6JA 1FNLA 5E2VH 1FV1A 4GS7C 1VFMA 3QDJB 3ARUA 1QLFB 4N0UA 4XP4H 2NNAA 2XT1B 4MSWB 2E9BA 1MRFH 4K94H 4NNXB 3G5XB 2APVA 4ZTOL 1Q9KB 5ID1A 1LHZA 3D3VD 4WO4B 4LCYB 1OW0A 3OAUL 3P4OB 3VXQB 1DBJH 2EYSB 3H9HA 4M1DH 3QDHA 5CWSB 5EPMB 3ARPA 2J8UE 3EDFA 2AK1L 1TTGA 3MNVB 1P84K 4PRHA 4DEPC 4XGZB 1AGDB 4Z6AT 1A7QL 1AP2B 5DGRA 43C9A 3R8BB 4JPIB 4BZ1H 1J0HA 3DX9A 1DQML 1UM4H 2R1WB 2W9DH 3MRKB 5D2NE 3MV9B 1FJ1B 3SGDH 3BPNB 2MQ0A 2EIEA 5B4MD 3QDJA 2E27L 4FFYL 3FB6A 1UKQA 2NY7L 5EO0B 1MLBA 4IRJD 1FZMB 2IAMA 1UXSB 2YEZB 1T89A 5E2UH 4JO1L 2AGJH 3U48A 1IARB 3PHOB 3L3JA 4P23C 2P5EB 4JO2H 1P6AB 1U0QA 5HHMD 4F2MB 4CU8A 4TUOA 3WNKA 1R5WB 3Q6GH 4DZBB 1NBQA 4I77H 4RAUA 3H8NA 1T03H 1T6WA 1XGPB 2Y6SC 3ZDXF 5T3ZL 1FORL 1MQKH 3R0MA 2OL3L 1C5BH 3ULVD 2XG5A 1T7YA 1CFVL 2D7TH 2DLIA 4LOUC 2AJVL 1G6RA 4QRPA 2D4DA 5B3JF 4PJXF 3KLHD 4ALAL 4HK0B 4L3EA 4OD1L 5FA3B 2W9DL 2JJSA 1OAUH 1FYTB 2VLMD 3H7BA 4GLRI 5GGQL 3MBED 1KUMA 5DD0H 5L8LB 2Y36H 1T4KA 1K4CA 2Q76A 3MA9L 1GPOL 5DEGA 2EE9A 4HXBL 1NMBL 4QTHA 1MWAA 3WIIL 4TVPD 5FUZL 3TCLA 3V79C 4JPIA 3CSPA 1YEFH 3BJ91 2Y06L 3MV7E 4YE4L 5ADOL 3S5LA 3RDTD 1B88A 2DQHH 1T2JA 1VADB 2A77L 1NFDE 4JZOA 3MJ9L 1FL6A 3C60C 3VW3H 1JPFA 2YUXA 1EHAA 4RA3A 3TM6A 2A38A 4JFXA 1OTSD 3THML 3CDGA 3T8XB 3BN9C 3ILQC 2H32A 3QXWA 1YEHL 1GC1C 1MPAH 2N1KA 4JFZH 3MR9B 3N0PB 1EEYB 2X4PB 4RNRA 3TPKA 4KQ3L 1R3JB 4NHUA 1EHLL 2BVQA 3PHOA 3GMMB 3M45A 4EEEA 5SWZD 4NZTH 1T2QL 4QRQA 4YK4C 5IHUL 1VKXA 3KPRE 4LFHG 1OT2A 2QEJA 3GO1H 4HFUL 2B5IC 3BVNA 2PTUA 3T08A 3U2SA 1E28B 5I8CA 2J4WL 3MRLB 4M6OH 3D6GA 3RDTA 4OI7A 3SDYH 5DQDL 1NAML 4K7FB 2V5RA 1B4JL 5GS1B 1BAFH 2AJSH 1XT5A 5GGUB 4CN1A 1UYWH 1AGEA 4PJ9C 4ZNEE 5HI5D 3MGTA 5EU3A 5I1EH 5GS1C 2WQ8A 1JRHH 1MHPH 2HRPH 5C09B 3MUZ1 1E6OH 3DV6A 5JTWA 4KK6C 4YH6A 1QLRA 5C08A 3RGHA 3B8SA 5T1KB 1NC2B 3SCMA 2HKHH 2YBRA 3BPOB 3QDMB 4JM2C 3UTTB 5HD8C 1AXSB 3N1MC 1C5BL 1TZHA 1P7KA 4G7YH 5GRZA 2DJUA 2P5WD 5KVGH 4NQED 1JPFB 3UAJD 3R8QA 4Y0GA 3MRQA 4OLXL 5E08L 2F5AH 5CZXC 5IFHH 2PXYA 2B39A 4N1EA 5EZJB 1CL7L 2WUBL 1X9QA 1ZSDA 1IC4L 4QRUB 1IFHL 3ULUL 3X11B 3WHE0 1XF5A 1T20A 2VN4A 3TBWA 1C5CH 2DTMH 2I9LA 4P2YA 3RL2A 4ISVB 5F71A 4LSPH 3MXVL 1FRGH 3ULVL 2LU4A 3FB5A 4K7PX 4X6FB 4M48L 3L95B 1ORSB 3VFOB 1DBAH 1BZ7B 1E27B 3GSNA 1X5KA 3OX8B 4A6YH 3NH7H 3W9EB 4NN6C 3DXAA 4HWBA 1NKOA 1LDSA 3GZKA 2H3NA 3D69A 3GI9L 3WO4B 2NR6C 2I24N 5EOQL 5HVHB 3MO1B 3RRQA 1N0XH 4FQCL 3IRZA 3WHXB 4JEGB 5DFWH 5F1IA 2W60A 2E7MA 1Y0LA 1WZLA 3SKJH 5DC9B 1EV2E 5BJTB 1I1AD 1TZIA 3LEVL 5L2KB 1OAYL 2JB5L 2BXYA 2OXGA 3O3EB 4P46A 5DJAB 3TYFB 2AJ3B 2H9GA 4HWBL 4ISVA 4P23B 4IRJB 4HD9A 4WI5A 5EBWB 5KVDL 4LSPL 4JDZA 1X6LA 4JG1H 5EU6A 1S78D 1RI8A 2WSKA 3NGBC 1FV1B 5FK9A 4BSVA 5C0CD 2EE2A 1EVTC 2MWCA 1T0NB 4MQ7A 3GIVB 3FO9A 1NGYA 3QEHA 3WFEL 3K4ZA 3VXUE 5BV7H 1FLRH 3OKDA 4FZEL 5D7SL 3LB6D 4G8GE 4NUJB 2CUIA 4S1DC 1I8IA 2AAVA 1OOAA 2A74B 4R4NC 3P4MB 1HHKB 4GRMB 4OZFG 5EWIL 1S7RA 3N85L 7FABH 1FYTE 4FRWA 3IYLW 4UNTA 4YXHH 1JE6A 2X44D 1KT2A 1M7DA 3EHBC 1N4XL 1G9EA 3C6SB 4F58L 2J7LA 4QRRA 3DHJA 2DWDA 1ZWIB 2PO6A 1ITCA 3MLUL 5IW1A 1GZPB 4GS7B 2DQCL 1T0NA 4N5ED 4N90D 2ED7A 1CE6B 2F8XC 5FECA 4ZQKA 3NIDE 1DUZA 4BZ2H 5BVJB 3U46A 4NO3A 4ODXA 3VXMB 1MCEA 4ODWB 3CDYA 5T1KD 1U3YA 5SV4A 3EUUA 4JFHE 1TJGH 3KYAA 5ERWA 5L0QB 5FGCB 4NP4L 5DJYA 3B9AA 3RUGA 1KSRA 2P46B 2BK8A 3HRPA 5IB2B 1U8LA 3VG0L 5HYJD 3L3KB 5IGXH 4N0UE 5DEFB 1LO2H 4YWGH 2CUMA 3O6FD 5JQ6H 3SGEI 1INEH 1XGPA 4L8SA 4KV5F 5J12C 3LRHA 1I4FA 3F7QA 2CRIA 3KPSB 5DFVD 1PYWB 5ISZB 2IC2A 3IDGA 5D70H 4QOKB 4LPWA 4QLRA 1NCBL 4HUXA 3NFPA 1H8NA 5D71L 2AJXL 4XNYH 1WFOA 4NSKA 3C9NA 3CK0H 4TN9A 4PP1C 5HI5C 2XNAA 5ILTL 3GNMH 3H7BB 1FFNB 2ESVD 4N9OB 1VESA 2J5LC 4Y4HC 2JCCE 1RJCA 2APBA 3E0GA 4G80A 5CINL 4YUEH 5IR1B 1ZGLP 3I75B 2WBJD 3D2UD 1CFBA 1NEZA 5J6HB 4GG6E 2W07A 4XAKD 4QYOB 4ZUVB 1JPTH 3QUYD 3SN6N 4HXBH 2NY2D 3DURA 1NAMH 1KLUA 1H15A 1NFIA 2G5BA 1S7SB 3WFEH 1F6AA 1UXWA 2FB4H 2QSCL 5F9JA 4P57B 5ISZA 3ETBF 3SQOL 5EB9A 5EC2A 3CLEH 4PGJA 5IESL 1DQJB 4BSWA 3B6SB 3EYVB 1YEIL 5T3ZH 2CLVB 4QF1B 4U1HA 1IGTA 2H1PL 4CU7A 2D9CA 5HGHB 5F7EL 1MRDL 1BM3H 2X09A 4F9LA 5CSZA 3ZKXC 1BMGA 2XNAB 4JKPH 4NFBA 2UUDK 3MUGA 3ZDZF 3HUJE 4HLZG 4OQTH 3WN5A 1CK0L 2VXQL 4G43B 4GMTL 1W8NA 5EZIL 2C3VA 4Y4FA 1G84A 4U1LB 5B22A 1JGLH 1LO5A 2GSGA 2P7TA 4NZTL 3A6BL 3W9DA 4C59B 1AD9B 1DQTA 4LARL 1TPXC 4ODTL 1XIWD 3ARFC 4OLXH 3VFMA 2QQKL 3EYFA 4X5XB 3ULSA 1NBYA 2HVJB 5DJ8A 3PWVA 3QIBB 2VJXA 4WW1A 3HE6A 4N0FA 3VW3L 1C12A 2ORBH 2WZPD 2EIDA 1UXSA 4ZPVB 3TJHC 3U0TA 1OGAD 1KENH 2XICA 5ESQB 3ZSSA 3BWAA 3O11B 1RPQA 1S9YA 1BJMA 5D93C 1OTSC 4GBXA 3O2DH 5FHBL 2R2EB 3QNXA 5IVXA 1YPZB 1MCJA 1CK0H 4GMTH 1E4WH 4LIQL 1I9EA 4DK3A 4G8EA 5A16B 4DCQB 4Z7OE 1KB5H 3QJHB 1HSAA 4KUZH 4MDJB 3T4AB 3HCVB 3RBSA 1BVZA 1GC1H 3M17B 4WJ5A 1MY7A 2P49B 1U2CA 5IB4B 5CINH 2JB6A 1Q9WB 2QTEA 3V5DB 4N8VB 3WEXB 4KRPD 3B83A 1ZGLM 1K6QL 5D2LE 4TUJA 3RDTC 2HFGH 1F8TL 4L8DA 2OCFD 2KDGA 2I26N 1NL0H 1UA6L 1ED3B 1YYLH 3CDCA 5IVOA 5KN5A 1LO5B 2GSGB 1PFCA 4OZFA 5GS1A 1AD9A 4PRBA 4MX7B 3M1BA 2HKFH 5C0FA 1QBBA 3O6FA 3ZKXB 3QUYC 5SWZE 1P5VA 5GS0H 4PJXB 5EOTB 3W82A 5B39A 1U3HB 4OCYH 3UYRH 4JFDB 4RRPG 2CXKA 3MRBA 5CSBA 2LVCA 1OGTB 5JW5A 2GTWB 3QDMD 5TDOA 4LKXB 3U36A 2VZ3A 5HXMA 2DLGA 5DF0A 3O3EA 1YUHB 4P5TB 5DURD 4G7YL 2X4OB 2UWEF 1FYHB 4PBXA 3PNWA 1A7NL 4P4KA 5EA0L 3ARBA 4Y4KC 1K2DA 4NBXB 4AM0B 5MERB 4BYHA 4PJHF 3F7PC 4QRRD 1MHHA 2OL3B 4XPGL 1PGRB 2NX5A 1BQHB 4L4VD 1DBMH 4NZRL 4LHUA 4U31A 4DUXA 4F7TB 1PKOA 3ALPA 1HCVA 4X9FA 4HIEA 1ZLVH 3MODH 2V5MA 2J5LB 5EO1B 2DIBA 5DK0A 5E6YA 3ULVH 1Y6NR 5ESVB 1YDPA 1PBYA 3I02B 5ECJE 5FYLE 2UWEB 3PP3K 1HH6B 5CILL 1I7UB 1XMWA 2CLRA 5FKPB 5FYKD 4DGIH 2BY1A 3BZEB 3HE6C 3X3FL 3P4NA 4WCYL 3IFPB 3MPCA 3HMWL 1EAPA 1BFSA 1S9WB 4LU5H 3VDBA 4NOBA 1B0GB 4LLMA 4RISL 1PKQB 2J88H 3V5HA 3ZHLA 3HC0B 1I1AC 1OCWL 4NQXB 3SKNB 3GFUA 3MFFA 4IIQA 3GDBA 4PJXA 5B39B 3WS6A 4NPYB 4U1IB 3SDAB 1FO0B 2I5YH 3BT2L 5EO0A 1CLYH 3IT8D 1DANU 1JGEB 1T04A 1A6PA 5E6IB 4XBPA 5FO9B 2X4QB 2BVQB 3L1OL 4AT6B 2FYYB 4NQTA 4IHOB 5F72S 1VFUA 1IE5A 5D2NA 2C3WA 4EBQH 4XX1G 1RIUL 3HA0A 4MNQE 5CEZE 2WNGA 2BOCA 4NJ9H 5DRNB 5ID0A 2CGRH 3HTLX 3NPSC 3O0RL 4BZYA 3SDDC 2C3HA 5MENB 3IS1X 1JI1A 5FYJU 1L0QA 2FBJL 5GGUA 4L4TE 5KAQF 3ZTNH 4R3SA 2VDRL 5DVKA 3SDCC 4OIIL 3VWJB 1E4XH 3BQUD 5GGVH 2CH8A