4POYA

Engineered dual specific vhh antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords VHH-metal
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4poyA00
3ARBD 3TBYA 5ERWB 4PJ5E 2CSPA 1I3VA 1P4BH 3R4DA 1TZHA 3PF2A 3BKCH 4P4RA 2VDKL 5C7XH 4WHYG 1WAAE 2YPLA 4MDJB 4F37K 3BZDA 2VERN 4DKAA 5DQDH 3GBMH 2VLJD 4IEFB 4EQ3A 3HNTL 2D31B 2MKLC 4FQCL 1DQDL 4ZOEA 4NUJA 2WBKA 4OFYA 5B38A 3WLWD 3MV9E 4UUJA 4ZAKA 3G5YB 3UJTL 4UAOB 5FYKH 3FN3A 4AIZA 1WFNA 3R06B 4NQUA 3OAUL 4GKZB 4JR9H 5FA3A 1GL4B 3H9SB 3VXSA 4K71C 1T22B 4XNUL 3EYQC 5D5MA 3MLVL 5BQ7A 4O58L 3P73A 4MXWH 4C56A 1UWEL 1F13A 1FNGA 5ADPL 1T3FB 1T2XA 5EFIA 5E2WH 4N8CH 3GUTB 3OKNB 3C2SA 4GBXA 2VSDA 3TCXA 4Y2DA 4EJ1C 4KY1L 3TWCH 5HPMA 3H6JA 3BKMH 5CLTA 1ORSA 4NYLB 4Q58C 1G7LB 5JOPE 1U8KA 4KJPC 3VG0H 3T09A 4ELKB 4JCLA 5D2NB 5I1HH 3V52L 1KIUA 1CD1B 5E1AB 1N6QH 4KK5D 5DC9B 4EI5A 5D93B 3TIDA 2EDQA 1TTFA 4NT6A 3GI9L 3GRWH 4YBQD 1YEIH 3RWJB 1QO3B 4U1LA 1U95B 4JDZB 3KPQA 1FNAA 1C5BH 3QA3B 4PJIE 5C09E 5BVJA 1KULA 4TUKL 4MNQD 4G80A 1EO7A 2ITCB 3H3PL 4OCNC 3H3BC 1I3GL 4K8RD 3HTLX 1FDLH 1I4FB 3FFDB 5FO8A 4OGYL 4FQXA 2O5YL 3MA7B 3GSXA 4L8BA 4LBEB 4IDJL 1BF8A 4APQD 1Y18A 1KJ3H 1QHOA 5HHOA 4NN7B 4LASH 5F3BA 2AJSL 1G9MH 4OCRH 4WUUA 1ZS8A 3BGFB 4EIGB 2OQJA 4ODHH 1KJ3L 1KBGL 2P5EB 5AUMA 3VU2A 2XOTA 2Q76B 2ZJSH 3MJ7A 1K5NB 4LLUB 5FYJH 1CD0A 2H9GB 4PR5B 4OGYH 2DB8A 4PJCF 5E94A 3WD5H 2EH7H 5ESVA 1R3IL 4YAQA 3LB6C 3V8CA 3H3PH 4CAGA 3EOTH 4RAUB 3NZ8A 3ARRA 2J1KA 4U1JA 3CNKA 1ZK9A 5FHBH 4UNTA 3RIAK 3Q2CA 1JGLL 2A77H 3GHBH 4H88H 25C8H 3O8XA 4FTVD 3H9SD 3TT1L 4K3EL 5GISL 1TZIB 4UTBL 4PJHB 1HDMB 4YGAB 3D85A 4HUUB 1WIOA 4PRHE 4LKXB 4WENB 2ICWI 5KAQF 5GGUA 4WWKA 3SDAD 3S35X 1DQQA 4RNRA 2IQ9H 2IAMA 2GK0B 1U3JA 4HWUA 4KTEL 5LGJA 4PJ5A 3ULVF 1U8OA 3QAZB 2EZ0C 5DJYA 2MPAL 2Z8WC 1T0NB 4G9FA 5DVLA 3EO0B 3RU8L 3QIUB 5FKPB 4RRPG 4XMLL 1ZLSL 5J89A 5FK9A 3TH2T 3MJ6A 3W0WA 3MA9H 3RGVB 4DN3H 1TMCB 2UYLA 1CFQB 4FP8H 4KH2A 5JUEL 4C4KT 5IB3B 3T0DA 1P5VA 2R8SL 2DTSA 5E5MA 3PP4H 3T3PF 2AJUH 3QZWA 1BD2B 4PS4L 5EIVA 3QEQE 5CILH 3A6CL 3AFLA 4FZ8L 4PB0H 3TYFB 4EKXA 3GNMH 4PFEA 5DT1H 4GRLB 5K93A 1NKRA 1BLNA 1WFOA 4JZOB 3JTSA 3LQAH 1UB6B 2R1XA 1YEGH 3FB7A 1CDYA 1ZGLA 1TVBA 5FOBA 5JHDE 3RI5F 5IVOA 4V1DE 5A2LH 2VLKD 2XWJB 3D0VA 4RQQB 3FFCD 3UPRA 4OCWH 4UTAH 4ODUB 1IT9L 4CADA 4NRYB 1FO0H 1N26A 3NH7L 5IB1B 4J1UA 1FFQA 5DJAA 3HI6H 1F58H 3ROOB 5EUOF 4G43B 1RD6A 1V3LA 5EOTA 4G7YH 4OD2B 5KVDH 1KTLA 4AH2A 4B0MM 3TZVA 3KAAA 4X7CC 2CGRH 3NFSH 4OFKA 1R3LB 1GZQA 1P7QD 4W70A 4U1GB 2HKFL 1NUDA 1P4BL 2ZWLT 4Y2DB 4L8SA 1E4WH 3ARFB 3NIGF 4I0CC 3BYTA 4HXBL 5HHME 5HYSA 1H8OA 1RIUH 4G6AC 1OPGL 3IRZA 4PJ9B 2FJGB 4H5SA 2KBGA 4JFEB 1RV6X 3QFJD 2WWMD 2H32B 3NN8A 4S2SA 5TQ0H 2DLTA 2BVOB 4R7NA 2FR4B 3LKNA 1E28B 4XCCL 4OLVH 3EYQD 3MROA 4TVSa 4R7DA 2AABH 2NY0C 3TT3L 5AG9A 1JF1A 5TE7L 1D5ZA 5JDJA 4HV8B 3V6OA 1NBYA 4Y0GA 5LG1A 2MSPA 1RUQL 32C2B 3EHBC 3FOMA 2NTSP 3BQUB 3F58L 5F7UA 4OZFG 5KSAD 4W6XB 4MQ7B 1JP5A 3H9YA 1MREH 5TDNB 1U9KA 1KNOB 1SY6A 1NGQH 3IXAB 3WLWC 3QUZC 5MEOA 2X4PA 1T6VN 4AY0A 3D0LB 2R4SL 4CN6A 2P5ED 1UQSA 3B8SA 1L9MA 4GQPH 5D71H 4RWHA 5CHNA 1NEZG 3ME0A 4O02L 3MRDB 3MJ8B 3U4EA 3G6JA 1OM3H 1CD1A 5E1AA 4W68A 4U31A 4YDIH 4S1SL 4ENED 4KMTH 1ZMYA 5DEFA 3T0EB 4XXDA 4TSAH 1A7PH 4G5ZL 1FFNA 2WINB 4IRSD 1C16B 5E6YA 4PP1C 5AYQA 1KPVA 4Q2ZA 3IDXH 1CZ8H 1B88A 2EO9A 3W9EA 3GMOA 5EN2A 2AK1L 1DL7H 3V6ZB 1WBXB 2IG2H 4FHBD 2PYEB 2ZUQB 4ETYA 2E27L 4X4YB 5B3NA 2JK5A 1AKJA 2JELH 4YXHL 5JQ6H 1MRCH 1HIMH 4MD4A 4IMLA 4FZEL 1NGPL 1YECH 4P2RB 5E8NA 5C3TA 2XTJE 3OX8A 4NN7C 3SKOA 2YR3A 1ZHNA 2B2XL 3OKLA 4PB9L 1U91B 1X3DA 5I66A 3FQTB 4ZSOE 4Z76B 1GZPA 4FFWC 4MVBC 4D9QD 4OLXH 1OY3B 5IHZB 3R06A 4Y89A 2R56L 4LCIH 3T2PA 3MUHL 3VGAC 5CP3A 3PNWA 2YEZA 5FHAH 2FIKB 1T89C 1NL0H 1MCEA 4S11A 4PGDA 5E95B 1EX0A 1ZTXH 2GSIA 4U33A 1RZGB 4PPTA 4RBPH 2PXYB 4YHIB 3T1FA 5DVMA 1YEEL 5HTSA 4TOYH 4XRCA 2CDGB 1ZA3A 2BRQA 2CUHA 4YC2B 1S9WB 3PGFL 4LPCA 4MB5A 4WI4A 4U05A 4YHOL 2AAVA 1M71B 5GJSL 4PTUB 1A22B 1PZUB 1TVBB 3BD4A 4OQ1A 1MQKL 1HILB 2VKWA 2PTTB 2E7CA 4KI5C 4R2GB 4N1HB 5DJ0B 1J1XH 1UT9A 2BJMH 2ZUTA 4Z7NF 2J8HA 3CVHH 3WO3B 3NCFB 4M6ML 5K59E 3O6FA 4NDMB 2HN7B 3RDTC 3U4BL 3DXAE 5EIIB 3S37H 3QDJE 3RKPA 3VFSB 3L3DA 2PCPB 2A73B 4Z6AT 2YUVA 1MCOL 2GJ6A 1IC5L 1SBBA 4P5KA 3VFOB 4D0DA 1A6VH 4NZUL 4AQ1B 3KJ6L 4HLJA 1OB1B 1KB9J 1JK8B 4QRRE 1XCQB 1MHEB 5D7LA 4X6DB 5DMIH 1WZ1H 3PWUB 2A9NH 3ECBA 4O51A 1L7IH 5E94B 4JQIH 1G7MA 5DRWB 4DFIA 5JW4Q 1RIHL 1G1CA 1AD0B 3MCLH 1N7ML 2YBRA 4YDKL 2ED8A 2PUQT 3DMMA 5I8EA 1CTNA 2W9DL 5I8CB 5T1LB 1DE4B 1B0WA 3WXWH 4WI3A 3VXSD 2VXSH 2GY5A 1T0PB 4HUMB 2HVJB 3KPRA 4MCZA 4YEEA 2X1QA 1RK0B 4M4RA 4UNVA 1EHNA 1A9EA 4B50A 4HUKB 1RZKH 5A1AA 4LDOB 3ARUA 5EBWA 3RVWD 4WHYH 4ONFH 5F7NC 2QR0A 1ZKAA 5AEAA 2AEPL 4LCYB 2XA8L 5KS9A 2X42A 1T4KA 4P2RD 1Y18B 3CGTA 4NO2B 1N6UA 1NSNL 2P8PB 3SDCA 4K07A 4HBCL 3T0XA 5LVEA 1T1YB 1FNHA 1ZVSB 1AR1D 3ZO0A 4RGNC 1C12A 1SBSL 1EO5A 4HBQA 4JG1L 4JLRA 1SJHB 2ESVA 4Z7VE 1ZWIB 3CXHJ 4V2BA 1BREA 1S5IL 3QXAB 4G6ML 4PJ8C 5E8NB 3MRPA 1FBIL 2HKHL 4XZUB 4NQDA 1RZIA 5I1EH 3TH4T 3LD8B 5F1NA 4L1DA 3K4DA 5FO7B 1NEUA 4HFWB 2Z35A 1U8PA 1RUKH 5IVZB 1T7XA 1II4E 2WBJA 5GRZA 3HAEH 1OCWH 3P77B 1GVIA 1KXTB 4QTIH 5T5NF 4X6CE 3KNBB 3MUGA 4E5XB 1NFIA 4XNXH 2L0DA 5MEPA 4PJ7B 5FYLE 1ZHKA 1OAYL 4I13B 1JWUB 5IVXF 1BZ7A 5EG6C 1MFBL 3VXOB 1FE8L 4U1HB 5KVFH 1JE6A 1K8DA 5TE6L 2NY1B 3V5DA 3WHXB 5GGTH 1G7QB 1MRFH 1CR9L 5DEGA 4HIIA 4DGYL 1MJ7H 4FXGA 2J8UF 2ARJB 3V6ZA 3L5HA 4UT9H 3AVEA 5DUBB 5SX4I 5DA0B 3IFPB 4QHUA 3B8YA 3HI1B 2IBZY 1GIGL 2ICWJ 4BJLA 4D9RD 3W5NA 3LN4A 3BDXA 5CZXD 3EO9H 3TV3L 3WLBA 3O4LD 2W9EL 5J56B 5I19H 1F3JB 5JPMB 3PGDA 2ATPB 5ILTL 4XT1C 5E2VH 1UQSB 3N1PC 4Z95H 5HGDA 1T7ZA 3FAWA 5I16B 1ZLVK 1ACZA 1PG7L 2I9LA 5ETUB 1MI5D 2ERJB 2X44D 1U3YA 3EFFA 1GYAA 1MPAL 3ARVA 3EYUL 2AJXH 1KELL 5T33H 4RX4A 3VI3E 4QNPE 3QUMB 3LD8C 2VQTA 5KVGL 3KPPA 3EKCA 4Z7WE 3RWEA 3MSPA 4R97C 1P7HL 5JTWA 1QFHA 1MH5B 1CTOA 2I25N 1G9NL 2AXGA 1MLBB 3VXOA 4HS3A 1UEYA 3WNOA 4FQHA 1S7XB 4P46B 4H26B 1NDGA 4UQ2A 1AGCB 3QDGE 3JWDH 4R96B 5DJYB 1AHWB 2JJTC 3LKPB 5LQBH 3BT2L 3BZFB 2Z92B 3RKDD 1DVFA 5I1CL 2ILLA 1GGTA 3C5ZB 3HRZB 5ID0A 1MCSA 4KTDH 4OV6F 1QA9B 4K8RL 1CE1H 2GSGB 1TETH 4LLDB 3QEHA 1A6TB 1BAFH 1WBXA 3S9DB 4M7KH 5C0CB 1OVZA 2VZ3A 7CGTA 4M7LH 1MIML 1BIIA 1A3LL 2A6IA 4OZHB 1I9EA 4KJWC 2UVEA 5FOJA 5DRZA 2OL3B 4K94C 4JDTH 15C8L 3Q6FA 4HS8H 3FT4B 1D9KD 1A7OL 3PL6C 1CICD 5JHDD 2PTVA 3VI4F 4LU5L 1EHXA 2MJWA 4NZDA 1JRHL 4MXQC 1L9NA 4MD0B 4XPGH 2NCMA 1P7QA 2AEWA 3VDCA 3UPCA 5CBEB 4CVZB 5D1XC 3SEPA 4Y4HD 5ESAA 2XV6B 4X9IA 1KFAL 4JFPB 3O45B 3T0BA 3VXTA 3TN0A 5EDXA 4NJAH 1DBAH 1S3KH 1WFTA 2HG5B 5HBBA 2V9QA 1YMHA 2FGZA 1Q94A 1MAJA 2AXGB 3QQ4A 5HVFB 4X6FB 4AQOA 2JCCA 1VHPA 4MZ3A 5DR5H 1QLRB 2EC9T 5IGXL 3SDDD 1H15A 1U8QB 3VWJD 4R4NC 1XGQB 3QHZH 4M1CC 2WW8A 4TVPH 1TTUA 4EI5B 3QUXC 3VW3H 3TN0D 1T5XA 2KKQA 3WNPA 3VGDA 5JDSB 5I1JL 3VWKC 2VXTH 1MJ8L 5IK3B 1NLDL 3KPMA 1RUMH 4P4KD 2O26U 4P2OD 4V1DD 5B22A 3OAZK 2FGWL 4DWHA 4Y4HC 1QZ1A 4WO4C 4P99A 3FMGL 2EYTA 4L3EA 2V2TA 1F8TL 1P4IH 4PGZA 1A14H 3TBWB 5HHOB 3KYOB 2NTFA 4L4VD 4PREB 2DJ4A 4U3XA 1MF2H 1Y6NR 1JPSL 3KG5A 4F7EB 3MNWA 3PWPA 1JZ2A 3F5WA 1K85A 4HIEB 3KPNB 2F54B 3RZCC 2IANA 3TBTB 3LOWA 5ECJE 1WAAF 2CMRH 4WWID 3HMWL 5E9DD 5DO2D 5DUBA 3D39A 2WWKO 2Y36H 1RUAH 3UZQA 2EZ0D 1ZVHA 3U9UA 4RFEA 4X6CA 2EE3A 3LEXA 3QSKB 3T8XA 3UJJH 1CDJA 5I8OH 3O8XB 4XHQA 2R4RL 3GO1L 4KQ3H 5ACZA 1OAKH 4FNLH 3I6KA 4N0UB 1M6OB 4HDIB 5E2UL 4P2QB 5EWIL 3F12B 5FM4A 5IB2B 2GK0A 4NWTH 3HPLB 3IU4L 4JO3L 4YBLC 1MWAA 3T0WA 5KSUA 3X14B 3MXVL 3LRSA 2FATH 4ZOBA 2CLVA 4R90L 3SDCC 1DBKH 1S78D 4J4PD 3FO1A 2DYPA 5H8DA 1SJEB 1RZJL 1TJIH 3NPSB 4NO3A 4XNZB 3HUJE 1XF2A 1JTTA 4P23D 2YD9A 2E8ZA 4DK6A 2LTQC 3FO2A 4CMHC 5DJDA 4P4RB 2V7HA 3T0ED 1CF8H 1VGEL 5FA3B 3IB4A 4L9LA 2H1PH 1MLBA 1AI1L 3EUUA 2EC9U 5KSBB 3CUPB 3G6JE 1TCMA 2ZNXA 2WIIB 4JO4L 4DKDC 3O8XD 3KYNA 3P40A 4ZFFA 4TTDD 3QUZA 1OGAD 2X4TA 1DVFD 3WUWB 4APQC 3CC5B 1CFSB 4XCYA 1IM3A 4AT6A 2YHGA 4J3TA 5GGRY 4IDLA 1EAPA 1UWGL 3NABL 5DRXB 4DTGH 1H3WM 3ZT5A 3EW3B 2JCCF 4MB4A 5DFTA 5C6WH 4ERSH 1U92B 5DQJA 1YEJH 4A6YB 4E5XA 1FVCA 1T20A 4P3CH 4BH7B 5K33A 3U9PH 5FGBA 5IFAL 1NDMB 2B4CL 3FQWA 4JFYA 4MS8D 5IR1A 1PJ9A 3UAJD 3ARQA 2YRPA 1ZE3C 3OGOE 1K2DB 2DQUL 4LRNL 1DBKL 1LDSA 3NIDF 3ZKNC 5CCKL 3MRMA 1U8OB 3RDTA 1FORH 2RQ8A 4N9OB 4QXWA 1IAMA 1G9MC 2DLIA 4WI5A 2EXYD 4FQIL 5CJOL 3T2OA 5C0RL 1LGVA 4JPKH 3IJYA 5E2UH 5T3ZD 3U7WL 4C56B 2VC2H 3E3QC 5FDWB 4G42B 1LEGB 5I6XC 3RA7L 1ZEAH 4U2ZA 2PO6D 4LPUA 2HFFB 2G2RB 4IIQB 5HHNA 2H26B 4JJHA 1KPRA 1Z9OA 3IDIB 3RVXC 4G9DB 1U8JA 2GJ6D 2ITDB 4JKLA 3G6AB 1RUAL 2RGSA 3MLXH 2QSQA 3ZE2E 1BFVH 5DURB 3L3IA 3IFNH 3DBXA 2OTPA 3FB6B 4N8VG 4K23H 4Y88A 3OJDA 2GFBB 1K4CB 3U6RA 3SO3C 3QG7H 3EYOB 4HUVB 1JGUL 3ES6A 1CI5A 5JZ7C 1PYWA 4U7MA 4M4PA 3G04A 3MRRB 1ND0A 4KJPD 3P0VH 4Z7QF 3CFDB 1I1RA 4I18C 2AW2A 5HYSB 1P4IL 4BSWA 4S10A 4PG2C 3P11H 4X6FA 3X3GL 3S36X 5CUSL 1ZHLB 1U36A 3EYSL 3QIWC 3D6GA 5HD8C 2R39A 2F19L 1WZLA 4PBWD 1MNUL 3K4AA 4GLRI 4TUOB 1ZHNB 3OKLB 3WE6B 3B9EA 5KS9E 4LP5A 3D9AH 4Q9QL 3LSOA 5EOQH 5DZNA 8FABB 4M7JL 3LKSA 3VGHA 4I2XB 4YDLC 4XC3L 4L3CA 4WFHD 2HWZH 1YMME 5TPWL 5ICXA 1U3ZA 4MAYB 1SEQL 3WS6A 1TIUA 1MFEH 5FGCB 4FFZH 2CH8A 2BVPA 2K7PA 3WN5A 1HHJA 3Q48A 2DI9A 3DTXB 4JM2C 1LO2H 1P84K 2I9TA 3DARA 2B1HH 3AREC 4LCUA 3DOSA 1NFDB 1PG7W 2AJ3B 2HT4C 2Q7YA 2P45B 3P0YL 3QEQA 5GS1A 1BQHA 5ITBH 3VRIB 4P4KA 2YPVH 3SDCD 1PVHA 2JIXD 4HKXA 1S8DB 3MOAH 3OGCB 4R4BA 5C0BA 1D6VL 2FECI 1C5CL 2NXZD 3HZVB 3T65A 4XGZB 3MTRA 1KFAH 4FG6C 4WV1B 5MP6H 1NAKH 1R5WA 2ZG1A 5IB3A 1MHCB 4O2FB 1QA9A 3WIIL 4FFWD 4TUJB 4QXUH 3DRQB 1FL3B 2UWEB 2K9UA 5EA0H 4GG6E 4PGBA 4G9FB 4PJHF 1FFPB 5ABDE 1VEPA 2LQRA 1EH9A 4DZBB 1FZMB 3BZEB 1W0VA 4TVPD 1T5WA 3IYLW 4OKVB 1JGVL 1A3LH 3AM8A 2AJVH 2A73A 3V6FA 4NZTH 1M7XA 3WIFA 4NCC2 1D5BA 2E7MA 3QUXA 5IMLA 6CGTA 1YEKL 4PJXA 1CXIA 1TETL 3QFJB 4GKSA 4Z7OE 4K8RH 4POZD 1HYSD 2VAAA 4Y19A 1OQOA 3UTQB 4OJFL 4PJGF 2IMMA 3RNQB 1UJTA 4GXVH 1DANT 4R3SB 5KSAB 1ITBB 3L3JA 4Y4HA 2PYEA 4I48B 5J6GA 4WNQB 4H5SB 3IFOB 2ZZUT 2WUCH 1F3DJ 1CXKA 2A83A 3VGFA 2C4FU 4S1RL 2EYSA 2PN5A 1NDMA 4HJJH 1Z5LA 4PBVC 4XVJH 4JFDB 4JE4B 4PRID 3S35L 5F7LB 3DV6B 2DAVA 4MCYA 1R3LA 1AGFA 1UB6A 4W4OC 3MRNB 5D5MF 4N0UA 1QSEA 3H3KA 4JRWA 1O5DT 4YHML 2H3NA 2P42B 3CFBA 2DD8L 4YIQA 4ZFZA 3BHBB 5EZIL 3J8F7 1XR8B 3DSFH 4WW2A 5IJKC 12E8H 4NO5A 2VITB 4OGAD 4AK1A 5IB1A 1U93B 3RQ3A 1NCTA 1LQSR 3LRSB 2OM5A 1IILE 2J12B 2J8UB 5IEKB 4L4TE 1CFTB 4PD4K 1LO4L 1S5HA 4M93B 1HSAB 1EO8L 4OD1L 3BQUA 1R6VA 4JFDE 3H9ZA 3OKKB 4OZGB 1IGYA 5L2JB 2Q3AA 1BVKA 3O2VL 5D1XA 1EJ6A 3HNSH 1INQA 2VZVA 4LIQL 4BYHA 4JFEA 4MNHA 1DSFH 3NZHL 4WHCA 3Q1SL 4AEIH 1OW0A 1MWAB 4HT1H 3W11D 2D2OA 4M1GL 1CLCA 2ZUQC 1CR9H 3OJ2C 3GGWA 1P2CA 1MRFL 5T3XE 4HC1H 2KUTA 2FRGP 5GGTL 3E2HC 3HUJF 4HKXB 3P4OA 1MLCB 1JN6A 3H8NA 3CVIL 5E7BA 3I6KB 1CLOL 3KJ4B 4UV7L 3NCYS 3GI8L 1D9KA 4BFIB 2WM0A 2DQCH 4JM2F 1HH6A 1V7NL 2A83B 4WWKB 1AQKH 1I1FB 5CAYB 2XPGB 4QTIL 3V5DB 2XFXB 5E6IB 1CLOH 4R4BB 4NKIL 5D7IE 1F4XH 5LBSH 2HTLC 4PRPB 4Y5VC 5C0CD 3NAAH 3QIUA 5FKPA 3FOMB 2HKHH 4UV4L 1DP0A 2BRRH 2ZSVA 3WDHA 4BH8B 4RGNE 3BP4B 2Q1EA 3Q1SH 1X5XA 4GKNB 3S4SG 3DLQR 3O0RL 1GOHA 2PR4H 3RWHB 4NKDB 3H0TA 4LPXA 3BW9A 2NX5E 3HI5H 4NKMB 1VFAB 2Y1VA 4HBCH 4OZHF 5TH2A 2EYTB 4L3EB 4Y8AA 3QIBA 4GMSH 1FZMA 3OGCA 2FBOJ 5SWQA 3RL1A 1CGUA 4JKWA 2XA8H 2ORBH 4KUZH 1NGXB 1XCTB 4MCZB 4Y5VA 3PWUA 1RURL 1YMMA 2IBBA 4XBEL 3MLYL 3DYOA 4ELMB 1G7PB 3DX9B 2ZP0T 3HLAB 3FO9B 1E4KA 5CJBA 2M26A 4JKPL 5DJAB 4K7PL 3TCLA 1AGDB 3U79A 3REVB 4HMDA 3VA6A 1TZIA 5CSZA 5KS9B 4XVUC 1QQDA 3WV0A 3DMMB 2VXSL 3BN3B 2APWA 4ONGL 4OZFB 3ULVC 2W0FA 4M9PA 1Z0MA 3AUVA 3Q5OA 1K3IA 3OXSA 4M6OH 1RJLA 1XH3B 1R3JB 4X4ZA 1F11A 4O5LH 4HS3B 3EDEA 4MNQB 4UDTB 4PRIB 4Y1AB 1GXEA 4FTVB 2XN9D 4MJ5B 1AXTL 3BUYB 1TZGH 1CK0L 1WZ1L 5LXGL 4LHUB 1DBBH 3C09C 4EN3D 1CBVH 3FRPG 1JNHB 5FECB 5FYKE 1HHKB 4PYGA 1JZ6A 1CQYA 3VRLF 2JB6B 5ADOL 4YFLI 4I0KA 2E6QA 2XWTA 5DJ6B 2X1OA 1U58A 4GKNA 5HY9B 1A7NH 3BESR 5SWZB 1PSKL 1RZFL 3H42L 4LNRB 1I4FA 4R2GD 2F9BT 4XX1G 1YEKH 1VPOL 2B1AH 4OLZH 2OL3A 1K4DB 4GMTL 1HYSC 4HWEH 4PY8I 3V2AR 4U6HB 1YYLL 2VABA 4PJAA 1DEEB 5E9DB 2FH6A 5I9QB 3WEXB 4GW4A 1ADQL 3MBED 3WHXA 2MCPH 1N59B 2F5AH 5ANMB 3V9FA 3LN5B 5HHVH 1I7UA 1WT5A 5EU6A 1IAII 1LDPL 3GBNH 5HHPB 5KJRL 4XP1L 3RTQD 4ZUUB 4OFIA 1OT1A 1FL3A 1BF2A 4B5EA 4FQHB 4WTWA 3HNVH 5CIPA 3S88H 5F1OB 2AJZA 3MBXH 3IDJA 2C5DC 4YNYB 4EIZC 3S4SA 4MD4B 3OR7B 4KJYA 5A16B 1JMZA 1YEEH 2VXUH 5EBLB 5KANG 5SWZD 2W38A 1AIFB 5ITBL 3TNNA 1NL0L 1PZ5B 1A6ZA 4NRXB 4ORZC 2OBGA 1JNJA 4J3WA 3OHXA 3ZE1F 5J6HB 5IQ9A 5HDQL 1B6UA 3C60D 4GH7B 2BSSA 1KB9K 5DTFB 3VFWA 5F96H 1KTDB 3TBSA 1SEQH 2AJYL 4PB9H 1UFUA 1NFDF 5L8JB 4PG9B 3ESVF 5EOQL 2HFTA 3WO4B 4S1DD 4GRLC 5CHNB 3UTPE 2BNUA 4KHXL 1OGAB 3QEQD 4R8WL 3VD9A 1K4DA 4URTB 2CDFB 7FABL 4PJ7A 1RK0A 4QLRA 3X3GH 2AK1H 3MNVA 3X11B 1C16A 2ZPKL 5D72H 2EO1A 5ANME 3WFBL 1CVSC 5ERWA 2IALA 4NM4H 4DEPB 2VLKE 2DQGH 5C0BD 5B38B 2VL4A 5ICYA 4FFYL 2VZ1A 2WNGA 2YD5A 5SX4H 3ES6B 5IIEA 1T5WB 3QUKA 1FFOB 4RFEB 3JWDC 5H35A 2X4RB 1GPOL 1QUNA 3N1GC 1DN0A 4U6VL 4P4KC 5MHSE 4NN5B 4C57C 2O61B 4HEPG 4LGSB 1IGIH 1FL6B 1DDHA 1EV2E 1FPTH 3KR3L 1GZQB 5L0QB 3QQ3A 1ZHKB 4MAUL 4ZUWA 3KLAA 3RL2B 5F8QC 4XPFH 4CL7A 4LSUL 3BZ4B 4WY7H 4K9EH 3QQNA 3ILPB 4I8DA 5MI0C 3BAEH 4GAYA 4K7FB 4KJWD 1CT8B 1XEDA 1NAMA 2VE6A 3PQYD 4R7NB 4YQXH 5JOEA 1N5YL 2J88H 5CJOH 2I07A 1A7RH 2PXYD 4HGWB 4CDHA 4WHTA 1ZLVH 4ZSOA 4TULH 2OR8A 4O51B 1OAUH 4YR6B 5H2BA 3T04D 1E4WL 3CCHB 2KQNA 4LRNH 3UMTA 4N5EC 2PKDA 2EDRA 4F7EA 2DQFA 4DN4L 1RK1B 4UB0H 3U7AA 4ZXBB 3WSQL 5AZ2L 1T7VA 3B9AA 2YWYA 3VCLB 4AMKH 3ZDZF 4G7YL 5DZOA 2YMXL 4XPBH 2Q8AH 4XXCC 3NH7H 1IM9B 1QSVA 1F97A 4ODTL 1J0HA 2NW2B 1LO5B 2F74A 2CK0L 4OLUL 4OM0L 1T2QH 1Y0LB 1CL7L 1EGJL 2DN7A 4Y4FA 1UM5H 4NHUB 4I5BA 5CEZL 4BUGA 3PJSB 5ENWA 4GJTB 1KLUB 4U6YB 5IB5A 2CJUL 3HE7C 1WBZA 4TRPL 2IANE 5FXCH 4FZ8H 4P5KB 3VFOA 2XZQH 3S5LA 4XCEB 2OCFD 4EZMA 1CF8L 1VGEH 2DL2A 3QG6A 1YN6B 3VFWB 3L3KA 2HLAB 3ZDYE 4HH9B 3VFTA 4X4ME 4PRBA 5TGBA 2OXGA 3CFJA 5CJ5A 4KI1A 2BVEA 4LCWB 3TN0B 1AP2A 5CD5C 2NY2B 1TJIL 2DLHA 5LKNA 2E6PA 4IRSA 1CGSL 2A6DA 5L9DH 4L4JA 5CJQL 2W60A 2IBZX 1U8IB 2V7NA 2AK4B 3R8BB 4P2OC 2DTML 2J4WL 4NBYB 5C08E 3G5XA 5E8EB 1DLHA 5TDPB 2CPCA 3K8KA 4MQ7A 3IAPA 1IKNA 5D7LD 4KQ3L 1S9VB 4MXVE 1MFCH 3FTGB 5IVXB 4P3DB 1MVUA 1XH3A 2DYPD 3LEYL 2X1XR 3U7YL 1AY1H 1BPVA 4X80L 3QO1B 3RRQA 1B0RB 5DRNA 3WD5L 3CX5K 2AXJA 5DK0A 1JWMB 4QRPD 2IAMD 1J5OL 4L8CB 2D03L 2Y36L 4OLEA 4QT5B 2ZUVA 2LTQB 3MV7B 1N0XH 2Q7NA 1WC7A 2AJSH 4WW1A 3GSNA 4N68A 3UC0H 3P30H 2EXYC 4DKFH 3L3HA 4IMKC 5B4MD 5IHUH 3F5WB 1J0IA 1KENH 2H6PB 3PXJA 2DLEA 2CDFA 3UTTA 3FMGH 3OBAA 2ZCHL 5AD0B 2FR4A 3NTCH 3ROOA 1F4YH 2Q86A 4QXTA 5C07D 3MJGX 3MZTA 4F7TA 1CCZA 5M7QA 4LP4A 3VD7A 4LHUA 1DBJL 4YGVA 3MREA 1FNFA 2EDOA 3N85H 3QFDA 4Y4KB 3VWJA 3OKEA 4BQCA 3IDNB 2A1WH 3KDMB 3U30C 3D2UD 3WFCH 4DEPC 1L0YA 4LSRH 5IOPA 3B3IA 1PKQA 2GK2A 3HR5B 2GTWB 4KXZI 1BMGA 4XXCA 4X83A 1UGNA 4OD2A 3BKML 3BEVA 1S7RA 2R0LH 2V2TB 3T08A 5L6YH 2UUDK 3HUJA 2BOBB 2YC1A 5E2WL 4YUEH 3S4SB 5J12C 2WLYA 3RKDC 4HXAL 4XNQA 5GQBA 1AR2A 3IRPX 3O6KL 4BSVB 3HAEA 1EJOL 1L7TL 4TNWF 4L4VA 4YE4L 5IB4A 5DHVB 1I8KB 3QIBD 3WS6C 4GRLD 3AY4C 3MROB 3FHAA 3DWTA 3SGEI 4GW1B 3MJ8A 1WC7B 4OF6A 4X98A 2OP4L 4LU5H 1BOGA 1GGYA 1V8HA 4RZCA 4PJ9C 1HCFX 3MJ9H 3VFPA 15C8H 4PUBL 5TDNA 1FZOB 3IXAA 4FQCH 3VXSB 3QIUD 5ALBL 3FT4A 4Z9KB 3CH1A 3QH3A 4JY6B 1TLKA 5IB2A 3GBML 5C0DA 3PQYB 4NUGL 1IAIL 3L3KB 1B2WL 5C7XL 4YE4H 2VZSA 3EYFB 2FB4L 5IG7A 2CR3A 2UV3A 1GCFA 1YEDA 4HMCA 4ZAKD 2X4UB 2R2EB 4BFEA 4DZ8A 5ICXB 1Q9OA 1A1NA 3Q0HA 1SMOA 2BVQA 2A6DB 5ITFB 3B9KD 3ZE0E 5GGRA 1VENA 3RNKB 3SJVB 5MEPB 2YXMA 3DURA 1UYWH 2BHYA 3B43A 1FYTD 3VI3F 4OT1H 4POUB 1MCQA 4FTVE 5HYEA 3OV6A 4H0GA 4LSRL 3J7HA 3WFCL 2GY7B 1SYSA 3LB6D 2XA3A 3RIAF 3WXVH 4JZJB 2NY7H 5BZDA 4P2OA 4UT7H 1ED3B 2BCKA 4POZC 3BP5A 3QNZA 3RVUD 4JCMA 5DRNB 3QNYA 1YY8B 2E6JA 1UXWB 2P43B 5L8KB 1JGEA 3U82B 3MLUH 1G7MB 5DRWA 2BY0A 1KJVB 5IW1B 1QP1A 2DQEL 1MCIA 2IPTH 2APVA 2WV3A 3G6AA 4Z95L 1S5HB 4OTXH 3ULVD 2IWGA 1M1SA 4DK3A 2UZIL 3WHE1 3GSNB 4M00A 5TDPA 5IHUL 4NWUL 1S9XB 4X0KA 5I19L 4DKFL 4PRNB 5C8JA 2E8YA 2C3VB 3TN0C 2HFGH 1F3JA 1TITA 4PRPD 3EO9L 2QJDA 1R5IA 3OKMA 1MCPL 2XQBL 1B0RA 3DMMD 3D2UB 1C7SA 2NX5B 4ETQA 1FNSH 1X6LA 4WVRA 3EFFB 3HI1A 6FABH 1T1XB 3DIFB 4M6AA 3DVFA 4QRRB 4UT9L 4M61A 4ZDHA 1X5LA 1J05B 2O5ZL 2YXFA 1U3HA 3FFCE 1G9NC 4R97B 5E8DH 5K9QI 3VI4E 5IMOB 3GMQA 3U0WH 1OB1A 1KLGA 1DQQB 4RNRB 2VH5H 3QJFA 5FYKD 3ZYZA 1IE5A 1JI1A 4AJ0A 5D7IB 1IQWL 4GAGH 1R5WB 1Z0NA 3FT3A 4RGOL 5D1QB 4Z77A 4I77H 4LVHC 1FFRA 5E08H 4O4YH 1CGSH 5JMRA 1L6XA 5CGYD 4NZRH 3D3VA 1ZLUK 1BQHB 4KAQH 1OCWL 4LDEB 4MA3B 4BSVA 1QFWM 2NY6B 3IDNA 3GUTA 5DHYB 1RUKL 3O3UN 3TPKA 5HGGS 3PWNB 1CIUA 5I1EL 4NQCB 1N64H 1U93A 3C2AH 4ZTOL 4XPAL 2XZQL 3E6FA 3IJSB 3MA7A 3QXDA 1RVFH 4FMKA 1LE5A 3C8KB 3BRFA 3C60A 3MNVB 4KK9D 3X11A 2X89D 1MLCA 3LS5L 4MNGA 5I30L 5CLWA 4JDZA 3E0GA 4I0PD 1EGJH 4OM0H 1FLTX 3O3AA 4LLAA 3ARBB 3WJJC 1QFUH 4NO2A 4YBHA 5EU6E 1HOCA 5HHOD 1A3RH 1CL7I 1EBAA 3RIFK 4ONFL 4P23C 1IGFL 1Y6MR 3G04B 5GIRA 1YNLL 3MLZH 5A43C 3QUZD 4PY7B 2I27N 4AMKL 2RAMA 1J11A 5FUZL 5I1AB 1S7QA 3W39B 2W1NA 4OI9A 5FCSH 1V7ML 4FABH 2XZAL 4MXVF 1FC1A 1S7TA 1BX2A 4PYHA 2QHRL 5DEGB 3JWOC 5T1LD 3SDYL 2Z8SA 3ZT7A 1A3QA 3WKMH 5CJ8A 1I8IA 4WW2F 4RMRA 4YEFA 3BRGC 4I48A 3CJJA 4JY5H 4KZDH 4H25A 5D7SL 5D70H 3ZL4L 2VQ1A 3TPUA 1N5YH 2BNRE 2VDMH 1A02N 1A4JA 1OW0C 2CRMA 3N1MC 3L6FA 4N0UE 2R1YB 4ZAKC 1A7BA 3RGHA 1WSST 1IC4H 2VSCA 4OLYH 1Q72H 3G5YA 1NCBH 4OZIE 1W0WA 3CU1A 4MAUH 3BDBA 4NZUH 1HXMB 1IGIL 1G6RB 1IFHL 1NEZA 2CD0A 2NNAB 1R3HA 4U6VH 1O7VA 2CO7B 1NANI 4U1MA 2PF6A 4G6KH 2VLRB 4B53A 4IIQC 4TSCL 5FOBB 4P59L 2FEDD 4WJ5A 4NPYB 1DVFC 3TBTA 2NW3B 5B39B 4NM4L 2XYCA 3VH8A 1TVHB 3LRHA 1U92A 4WW2C 4WU5B 4WU7B 2J7LA 3OXSB 3L3GA 1CXLA 2PTTA 3K0WA 4JFEE 4G9FE 4GG6B 7FABH 1XGQA 1OTUD 4R8WH 4CU6A 1TENA 3QNXB 3PGFH 4ISVA 1T04B 3EDJA 3BH8B 3EYVA 2H8PB 1ZV5A 3NFNA 3I6GB 4PRNA 1S7TB 3MRPB 2R9HD 1A6WL 1CDBA 5D1QD 2IANB 2Y5TB 3UDWA 4OQTH 1A1OA 2IH1B 1AC0A 2AV7B 3E8UL 1B4JH 1QNZH 4XI5D 4OCXH 1CE6B 2F15A 4ZPVB 1JGEB 3TIEA 1EXUB 3QXDB 1JVKA 3BEWB 3U48A 3T0AA 1QHPA 3RVXD 3RGVD 3STLA 5DO2C 5DZLA 4NKDA 3SPVB 5E8OB 5CEZD 1CG9A 3L5WA 1U8MA 3B2UC 4DW2H 4K7PX 3WEXA 1ORQA 3UXFA 1S9XA 4JRYB 4XMPH 1ZA6B 1A9BA 4PRAA 2M8XA 4MB3A 1U8NA 4GS7C 4CVUA 3MYZA 3VXRD 4LGRB 1AQDB 5HHPA 1EGJA 5DA4A 4XBGB 2DBLH 3D87B 3RY6A 1NCDH 1AXIB 5KJRH 5C0CA 2FYYB 3C6LA 3WKNA 1CGVA 1LDPH 4LCCB 5B21A 1DL7L 1I75A 5JIIA 2HTKC 3IDXL 4F8QA 1VADA 5D6CB 4P9MH 3SE3A 4I4WA 3MV7D 5DJDB 5EIIA 1KSRA 3FN0H 3WFHA 3ZE2F 2ZSVB 2CDEB 2HA1A 2CLZB 2D9QB 3TYFA 1BFTA 1FVDB 3CH1B 3NPZB 4JY6A 3UBXI 2H9GA 2YA2A 2NXYC 4IMLB 3FB5B 3SGDI 1I9RH 3ZKSD 1UZ8A 1EVTC 3STZA 1T83A 4PREA 5GS1C 3G6DH 4X5WA 4RA3A 1NBQA 3P9LA 4MD5B 4CUCA 2XPGA 4HG4J 5JA9A 1NCBL 3CH8A 3VXNA 5L8LB 1IEAB 5T1MA 1Q72L 5FM8A 2VDOH 4YPGB 1IC4L 2AEQH 5DJ8B 1BBJA 1WQVT 4R26L 2FO4A 1N2RA 4PJDF 2VL5A 4C56E 2XN9B 1DBBL 1KCVL 5D9SB 2VLKB 4V1DA 4E42A 1U3HC 3OHXB 1J8HA 3QPQC 4OLVL 4NGHH 5DF0A 3NCJL 2NXYB 4BK5A 4O5LL 2VLRA 4JRYA 4Z7WB 3HRPA 3JTTA 4KXZH 4POYA 3CVHA 5I74B 1HSBB 4RMVA 1D5IH 3WS3B 3O3AB 3BZFA 1J18A 3PNWB 3D3VD 5FYLD 3LEVL 1QSEB 1T7YA 4X6BA 4PJGA 1QTYT 3UBXA 4OM1H 4G80B 4AEHL 4LFHD 4KTYA 1P69B 3F65A 5F1SA 1IGFH 1KPUA 4AYFA 1C1EH 3QPXL 2BSTB 1I9JL 4X99A 2YD6A 2H2PC 5TH2B 3U46A 4YHPB 3RZCD 5ICYB 2PW2A 3KHQA 4KJYB 5A16A 4F57L 3GIVA 3HI5L 1AO7B 3LQAL 4GG6A 2ATKB 4GQ9L 4G8GA 1JPFB 1RIVL 2CLRA 4L5FL 1C7TA 2P7TA 5F9WB 1RVFL 3SGJA 5KSBE 4LF3B 2AJUL 4PS4H 5IT2H 4JAMB 1ONQB 4HCRA 4QY8A 1B3JA 3EIFA 3NA9L 5EOCL 1BBJB 3P0GB 3S34L 2FIRT 4IMKA 4A6YL 4JANA 2QTEA 2JIXB 3L3JB 4FOMA 2JB6A 4IHOA 1YEDB 4RQQA 2BC4A 2N7BA 1KLGB 5EU3B 3CIQA 4PJ7E 2P8MB 4XHJD 2ED7A 4NZRL 1QRNA 4M1DH 1D9KB 3KYMB 3MV8A 2FWOB 5E08L 1V7NH 4Y1AA 1KTRL 4NQXB 5EUOA 4OAWA 5KW9L 1U8HB 3PL6B 1GSMA 4HV8A 5CSGA 2C7UB 1DUYA 4NO3B 3Q5TA 3HG1D 4D2NA 1MFAH 4HC1L 3EGSB 1WWCA 1KT2A 3PDGA 3PWNA 5DK0B 4PJ9A 1F02I 3THMH 1MCFA 2C3WA 3PHQB 2KZ1B 6FABL 2EH7L 3MRBB 3RWCB 3V5KB 1MJJA 4N0YL 1FNSL 4ZUUA 4JJ5A 1T0MA 2EYRB 4LPVA 5D5ME 5INCB 5FYJL 4ZO8A 4QRTA 1NQBA 4ZG1A 4OZGA 2D7PA 1QR1B 1MCPH 3V0VA 1CXFA 4HH9A 3VFTB 2Q6WA 1FLRH 3C5ZC 4K2UH 1WIPA 1VESA 4FQXD 1P7KA 1QSED 4YC2C 2F53E 3HE6A 1HNGA 2I60L 5GRVL 4KK8D 3OQ3B 3MYJB 2Q86B 5GGQL 2C9AA 4H1LB 2EEDA 4CDGC 1UZ8B 5GPRA 2IPTL 2DQEH 1I3GH 5BS0B 1EIBA 3GEWB 3BMVA 4OD3L 3AC0A 4PJDE 5EZIH 1UH2A 2DD8H 4Y4FB 4PGCB 1JWSA 4OUUB 1AFVL 2IAMC 4OIBA 2X09A 5EZJA 4JFPA 2F54D 3N9GL 4WFED 3CFDA 2EXWD 2DBJA 3VD5A 4XVJL 4LSTH 5SWSD 4WI7A 3PABB 1KG0A 5T1KB 4S1RH 4CN4A 2JF1A 1UYWL 4JQXA 4TUOA 3BO8A 4MNQA 4UDTA 4XP5H 3LS4H 3MACL 3HC4H 5DVOA 4YR6A 5C0FB 5F3HA 1Y0LA 3CCHA 43CAB 4PJGE 1RJCA 4WJ5B 4EUPH 2OI9C 5HYJD 1OT2A 1B9ZA 4PRPE 3V6FB 3QUYA 2G60L 1B2WH 2W60B 3DXAB 3BEWA 3VFSA 3H7LA 2A74B 4OZ4A 4D94A 4UINL 3GZKA 3UJIL 3V4VL 3MGOA 4DZBA 1TNMA 4NP4L 4JFDD 4JQVA 5FYKL 2P4AB 4PJEF 3UJTH 3VFVB 1QPXA 4J3XA 4RGMC 2PO6B 2VDQH 2VWEC 5J12B 1ODAA 4X8JA 4QOKD 5DJ8A 3QQ9C 1JL8A 5FIEA 1MOEA 2P8MA 4CVZA 1KCUH 4X7SH 4HWBL 4OZHE 3QUKB 1A6AA 5DQDL 1IEHA 4P2QD 4MQXD 4YJZL 4QHNA 4DVBB 4RMSA 2VLJB 5IW6B 5T3XD 2VDKH 1G6RH 1Z6JT 5MP6L 3BP6B 1DFBL 5L2JA 3SY0A 4Y2DC 4HXAH 5A2FA 5IOPB 1PDKA 2Y5TA 4YUEL 4HD9A 5CJXA 5EU5B 4LHUD 3PV7A 3P0YH 5L6YL 2R0LL 3FO0H 4QTHB 1CWVA 3NA4A 1LEIB 1I1FA 4XCFH 2JJVA 1ZT7A 3SDXE 1KN2H 3WFEL 2J8UE 1I8IB 4FQQA 4HK0A 1RZIB 3TIDB 3MRQA 1IKNC 4HAFA 4G8EA 1X9QA 2HWZL 3LSOB 3PHOA 1DLFL 4XC3H 5JW4N 2R2BB 35C8H 2XTJB 3H9HB 1IGYB 2BNQA 2G5BB 1GGBL 5I15L 3I6LE 1FG2A 4WFFE 4BKLB 2MQ3A 4YXLH 1T1YA 4LLWB 5I9QC 2V9TA 2F19H 4IRSC 2H26A 3MO1B 5SV3A 3BIAX 3WIFB 2DKUA 2V17H 1FGVH 4EDXA 3P11L 2XY1A 4QXTB 3L5JA 4Z7WA 4ZFOA 3MMEA 1BVLA 4MVBD 5GZOD 2CKBB 4LQFL 1K8DB 3T77A 1SYVB 3QUMA 3I02B 3T0EE 1I1AA 5IEHB 5DUMH 2OLDA 4PJIF 4ZPTA 1WAAA 4K23L 3L95A 1NCNA 3GSQB 5I17A 1UKQA 3FB8A 5I16A 2D03H 3DGGA 1J5OH 3QAZC 5D8JH 1IQDB 1MWAL 3QXTA 3TEUA 5C0EB 3QFJE 3MV9A 5HYIA 2HJLA 4X80H 3BVNA 4CMMA 3ZT6A 3U36A 3MLWH 4EUPB 2HMID 5K9OB 1H3GA 4X7FC 1B6DA 4HKBB 2VC2L 3RHWK 1MAKA 5FF6B 3LCYA 3QHFL 1AP2B 1GGCL 2J4WH 1PFCA 5GRWA 1YEFH 5J6HA 1MHEA 3INUH 5TQ2H 5IB4B 3QB7C 4Q0XH 4L1HA 2ADGB 1DBML 2FL5A 3A67L 5CJQH 5HHMB 1ITCA 1LEKA 4I3SL 5FGRA 5GHWL 2VXVH 2QQKL 1F3RB 1XR9A 4GOSA 2BOBA 5DUPL 4HWNA 4HFWA 3QDHA 3K46A 4HCRL 4JO2L 5DURD 3X3FL 5C0NC 1D3CA 1Q9LA 1OOAA 1W2KT 2V2XB 4OUOA 1ZLWH 1KXQE 3CFIC 4X6EB 2FHFA 1QYGH 4J4PA 3TVMA 1VGKA 4JFQB 2WP3O 3OJVC 1S9VA 3V4PL 3HR5A 5IBTH 3A6BL 3MLTA 2GITB 1EA9C 1BQHG 1NFIB 3VXPB 5T3ZE 2ARJQ 4X6BB 3VXME 1J7VR 4ERSL 2KL6A 4MAYD 2X1WL 1IZKA 2FX8H 3HB3C 3IDYB 3U4AA 1E4XL 1NFDE 3JV4B 2DM3A 2NY0B 4OIIH 1R24B 5JHDB 5KTEL 3IDUA 3QDJA 3C6LB 3CFKB 1JMXA 1QBAA 4YX2L 2F58H 1Z2KA 1MAML 3IKCA 3JV0A 1UM5L 2GJ6E 1CL7H 1YMHB 1T2QL 1NCWL 1YMMB 4IOFC 4I5BB 1EFXD 5BW7C 4Z7UE 5GGVY 4EUPG 1BD2E 3GMMB 2EXWC 1KJ2L 1C12B 5LGJB 2DQDH 1ZHBA 3ZYOA 1W72A 5HGHA 5BV7C 4YHLL 1A6PA 4RRPA 3GMPB 5ANMA 3K8LA 3IDMB 5K9QG 4FQXC 5C2BL 1N4XH 5CD5D 3UPRB 4UB0L 3P9LB 4MD5A 1IGCH 3I9GL 4DN4H 4JHAL 5EC1A 1NUNB 4R90H 1SVZA 1BBDL 3S97C 4KC3B 1TQCC 5EZLA 5BO1L 4MJ5A 5DSCA 4Y5XB 1JZ3A 3IU4H 5H2BB 3HMXH 3MRJB 4GRLA 4P9HC 5L88L 3VGEA 3V5KA 1A7RL 1HHJB 2DDQL 4OZ4B 5I1IL 1FHGA 5FKAB 3MXWH 4YQXL 1EEZA 4ZYKA 1OAKL 4FNLL 4N8VB 1H8NA 3DECA 4K9EL 3VFPB 3GO1H 1NEZB 2NNAA 3SGEH 2FJGA 1CQKA 1FGNL 4ZOAA 2MMXA 3WFDL 1M71A 3DVIA 3KR3H 4G8FB 1H5BB 2CUIA 2Q8BL 4KVCH 4K3GA 3HE7D 4XX1E 4BH8A 4WTZG 2YD8A 4GSDH 3D1MC 2ZSWB 5FA4A 3UP1A 1OTSC 1S7VA 2DKSA 3GB7A 1BZ9B 3KWWB 3UTSB 3EJJX 4FFYH 3JVGC 1MIEH 3I2CH 5DYOB 3VXUA 5IMKA 3PDOA 5IIEB 3MOBL 1MF2L 2H2SD 5F6HI 5F3BB 2X4PB 2GCYB 4UIKL 3HE6B 2GSGA 4Q97A 4Y19E 1F8TH 2VZTA 4QRRD 5D1XB 1BGXH 2JCCB 3M8OL 4FMFA 5DD6A 5EBMB 3LPWA 4N0CC 3WHE0 3IAQA 3EOAA 2HT2D 4BFGA 4M7LT 1WT5C 3DUHA 4QCIA 3TFKC 1J0ZA 3W39A 2YD1A 4XP6H 1OL0A 2HP4A 3BO8B 1YQVH 2AQ3A 2W91A 2JE8A 1MJ8H 3BJ91 1EEUA 4HQQL 1UM4L 2A9MH 4ZFGL 1FNGB 1A1NB 5E03A 2F5BH 1CS6A 3AMKA 3TA3D 4NO0A 3FRUB 1MY7A 2OJZL 1YY9C 4K94H 3PIQB 1U3HD 3VFUA 3TESA 3X14A 1J8HE 4KQ4H 4HC1A 5KOMC 3D3VE 2GTZB 5EU4B 2BSSB 5JOPD 4UU9A 4M8VA 3TZVD 4PD4J 3QULA 3NCEB 1G0YR 2GEEA 5GGTA 2ZUSA 2FWOA 5GGVH 4DAGL 1WCBA 4HUXA 4XCYB 1AR1C 4FQLL 3DX8B 1HHHA 3VXMA 5BV7H 4P2OB 2C3GA 4ODUA 3S88L 3TP4A 1XGUB 4P2RE 5IROA 1QG3A 4QYOB 1CGXA 4WWKD 4I3GA 3SDAA 5IJVA 1T1WB 3E6HA 4Z7VA 3C6LD 1JRHH 1HEZB 2GJZB 3O6ML 4M7ZB 3GBNL 1AJ7L 1SVCP 4K3HA 3KLAB 1RHHB 3EFDH 3PWVB 5LWYH 3GM8A 3VH8B 2PETA 3SKOB 1P6AB 4KFZC 3WFHB 4U1KB 4JDTL 2EE6A 1ADQH 3QO0B 4ORGB 1CVRA 4LPTA 3VD4A 1U6AH 4GMTH 4F7TB 3O3EB 3CUPA 2UUDH 2LABA 2FCBA 1VPOH 3P9WB 3BWAB 3O4LA 3FJTA 3B9DA 3BT2H 4KK5C 3PWPB 3QT2A 1HZHL 1DQMH 5ACZB 3JWDL 1I7UB 2F54E 3VFUB 2Z93A 3F7VA 4OGXH 3MRFB 4HFUL 3BDYH 3O11A 2ADIB 2DIJA 1MI5A 2BNUB 4C83A 4X9HA 1S9YA 1TZGL 4S2SB 5JXED 1HQ4B 3N1FC 4KRLB 3AAZA 3BUYA 3TVMC 1X4XA 4FQJH 1QLFB 2ZOLB 4OCLC 2C26A 3UAJC 3TO2A 3FTGA 1IEBB 2NY1C 4KRMB 5JW3L 1QFWL 4CVXA 1I8MA 1I1AB 4ONGH 2Q87A 5HDBE 1YNTB 4RA0C 2F53D 5F21B 3VG9B 3TNNB 2DWEB 1DZBA 3IVKA 5IM7A 5TE4L 1PG7H 5FYJD 2J3SA 4QT5A 4GBXD 3MR9A 1U6AL 4NC1E 3STZB 4Z7UA 2VISA 3ARDB 1QFPA 1QLEL 3QXVA 3RPIA 4RCAA 4NQEB 5ENWB 1QOKA 3AROA 1SM3H 4PJAF 3MLRH 1U8NB 1CICB 2HVJA 2IH1A 1TVHA 5D7LB 4J6RL 3QI9B 5DD6B 4Y5YB 1ZHLA 4PJFE 3EOAB 5MEQA 3WN5B 4WFEE 2VB5A 3ARYA 3UYRH 3O0RH 2AK4A 4LHQB 4ZTPL 5SWSE 3STLB 4PJDA 5BV7L 1VKXB 1U8PB 4IOIB 2FEEL 2DI7A 1EEYA 1UH4A 4ONOA 5BV7B 4DAGH 3BZ4A 3MGAA 2XNAA 4WU7A 1FE8H 2J5LB 4WU5A 5D9SA 4KKLC 3HE6C 3QDGD 4NKIH 2OJEA 5C9KA 3LPGA 4JLRB 3O6FD 3IF1B 4RFNC 4JFZL 1KPRB 3AXLB 3C6SA 3TBVB 1DN0B 3I3DA 3VXRB 1FC2D 2ENSA 3OR6A 4X5WB 1KLFA 3JWNC 3W81A 2DQCL 3JV4A 1LEKB 1Q0YH 4U1SA 2YRLA 3U6RB 3ABZA 1YQVL 2BMKB 4JY4B 3DX6B 2VQUA 1J1OH 5EZLB 4M1GH 3WJLC 5DSCB 4U3HA 4JFFA 3BPNB 1MELA 5MERA 1DSFL 3NZHH 1P9MA 2YD4A 4WHTB 3WUZA 3CMOH 2AP2A 4NUJB 3UTZA 3QNXA 5IBLC 1YNKL 1ZS8B 5BRZE 2YPLD 1E27A 1WIUA 2P5EE 3R0NA 1OLZA 1QR4A 5E2JA 3KPRE 1KCSL 5B8CB 2AEPH 3IS1X 5DHVA 4FG6D 4P2CG 5I8KL 3RJDA 3B3IB 3IS0X 4Q6IA 5FGSA 3UEZA 4UDUA 3LVEA 2FSEB 3W2DL 3IFPA 1IAIM 1OSPL 1CDCA 3KHOA 1KCLA 4NHCH 4Q9RL 2X4SA 4GFTB 4X4YA 3DSFL 4ISVB 3QIWD 5GRJL 1JFQL 4XAKD 1JNLH 1NMCC 1EPFA 3PXHA 2H3NB 2EIBA 1N7MH 4YDKH 1YPZE 2DDQH 3ZKXB 1B0GB 4N90D 1R5VA 5BW7A 1U8KB 1HXYB 4HGKC 1R0AH 4HJJL 2VDNH 2XTJD 5IBLD 5BO1H 1F2QA 4OF7A 5MENB 2A9NL 1PZ5A 5INDB 3QIWA 3OAYK 3LMJL 4P5TA 4QRSA 5BXFA 4JHAH 3FQUB 1YQ2A 4GXVL 2ZNWA 4PJXE 4ZXBD 3C8DA 4RIRB 4CW1B 1AGBA 3PWPE 3F7VB 3VJ6A 3DROB 3BZEA 1A6VL 3WMSA 3GM0A 4JFFB 2FZ3A 2H6PA 1QEWB 2P47B 1MHHB 2RIKA 3TA3C 5E6IC 1RHFA 4F15C 5INCA 2I9LB 1NBVH 3LZFL 4HIHA 2AJVL 3QCUL 4M6MH 5ISZA 3FN9A 4CKVX 5AWNL 4D9LL 4DKEH 2IC2A 1YJDL 3UTPD 1MAMH 1TPXB 3HC0B 3VXQB 1FYHB 3HN3A 4LLVA 4YHKL 1T4KB 4NZJA 3BMWA 4OIIL 3G08A 1I85C 4Z0XA 4YHZL 4HKZA 4LOUD 4L8DB 3MBEA 5DDHA 3V6BR 4TTGA 4MNGE 4EI5C 4ZDHB 4ALAH 5ESQB 1IM9D 5DFWH 3BP6A 4N8PA 2GJZA 5E99H 4EOWH 4UU9B 2VN7A 1QYGL 5KVMC 1NAKL 4U1SB 1CLZL 3DV4B 1JV5A 3MRIA 3KJ4C 4NQSA 3W11C 3SQOL 4QHKI 5J9PA 1T21B 1ED3A 3T0EC 3MRCB 3SE3C 1EFXB 4I2XA 1HHHB 5MEQB 4PLOB 3X17A 1XF1A 1A6UH 4NFDA 1NCAL 3HLAA 3QIWB 3QI9C 5DTFA 1ZT4B 4XCNA 1HI6A 3D3VB 3GIZL 4LF3A 3O3DB 1LO2L 2E3VA 1J8HB 4JZOA 5IQ7L 3HZMB 4LCUB 1R3KB 4RMWA 3TH3T 2VRAA 4TQEL 3KGRA 1FH5H 3VMPA 1F3DH 3AB0C 3ARZA 4Y4KA 5E8OA 3QYCA 3MLWL 3QNZB 5F93C 2B0SH 5T1LA 3D9AL 4Q9QH 2ZCKH 1VERA 1IRAY 3HZVA 3DX8A 3ARGC 1OAXL 3G5VB 1H3XA 1KYOJ 4HZLB 4KK8C 3PWLA 5D7JA 4LQ1A 1I9IL 1EEQA 3UBXB 4NC2B 1Q9KB 2LVEA 4L9LC 4GBXC 2ZSWA 5CSBA 1QLFA 4NJ9L 4LLQB 1U58B 4KKLD 5CIPH 2BXZA 1BQUA 4NJ9H 3BN9C 4S1SH 1F4WL 1JPTL 5LAXB 1PGRB 3HAEG 2DJUA 3MRFA 1I9IH 1X5FA 1CFNA 1FZJA 1BFVL 3FO9A 3MLXL 2X6MA 1JZ4A 5D71L 1WWAX 2EDWA 2R69H 1J05A 1OAXH 4YXLL 5J11C 2LU7A 1F5WA 4ZO9A 3QWRA 5IESL 2B0SL 4HDIA 5JXAH 2XZCL 2W92A 2XY2A 5F89A 4M48H 4PRPA 1RUQH 3MNZB 3FT3B 2BCKB 4KDTA 5L2KB 4AL8L 3BP5B 5TE7H 3RUGF 2HLFD 2AABL 2BC4B 2GYSA 1EBPA 1PW3A 3CPLB 4MD0A 3HG1B 3BUTA 1C5DA 3O4OB 4RGMB 3QUYB 4DVRL 4MNHB 3CLEH 4QOKA 1H3VA 1FORL 3BX7C 4IRSB 2BNRD 5TQ0L 4J3SA 1X5JA 1OPGH 1IKFL 1Q1JL 5EUOB 2VLMD 2ZUUA 2H32H 5HJ3A 1HHIA 4LSPH 2DQUH 2ZKHH 2AGJH 5CZVL 1AGCA 3RPIB 3B5GA 5HI5D 3SQOH 2GJJA 1OGAA 2CGRL 2BVQB 5ITFA 1G0DA 5GGSY 4CN1A 2FJFB 1KG0B 5T1KA 5E99L 1M7DB 4BQ6A 2QHLA 5BMFL 1U8QA 5H37G 3WIHH 4WI2A 5CGTA 1G1YA 3FOLA 4QRQA 1ZOXA 3KXFD 5SV4A 4UTAL 3GSXB 5E8PA 1JJUA 3HHRB 2R1XB 3C5JB 5CP7B 3NGBC 1PLGH 5IK3A 3FQTA 1KGCE 2DRUA 1TJHH 4NP4H 3N0PB 4U1IB 3REWB 4HKZB 5DDHB 4KI5F 2J6EL 2OTWA 5I0DA 5LGKA 3LZFH 1HQRB 3OKOB 4PP2B 5I1DA 5DT1L 2I5YL 3LDBC 3VWKD 3A6CH 4KK9C 1AI1H 3BE1L 3V7AG 1VCAA 3IDJB 3DV4A 3OKYA 3O6LL 4E0RB 4HW6A 4MNGB 1ZAGA 4MAYC 3VDBA 4HJ0D 4IRZL 3TJEL 4MDIA 4JRYD 1MCKA 3BWAA 3MA9L 4YDVA 5DRXA 3WNLA 2P44B 3HC4L 1VGKB 4XP5L 4LMQI 5HGAB 3VWJB 3C6LC 4JPWH 4YHNB 3OZ9L 4X4XB 1MH5A 4JO3H 2BOCA 2HJLB 3GMNA 4NQTA 2GT9A 3AB0B 1HKLL 1HE7A 4X6CF 3K7UA 3P4NA 4LLQA 3GK8H 1GZPB 1JNLL 1EAJA 3NIDE 3PL6A 1JGLH 1KPVB 2D7QA 1FQ9C 1BJMA 4CMHB 1I7TB 4OD3H 3EDDA 3UJJL 2ESVD 3DRQA 1R3IH 1PY4A 5HVWA 5GGQH 3QEUB 1XMWA 1YN7A 2CLVB 4G3YL 2UY7A 4NKOA 5MENE 2ZG3A 1A4KA 3T4AA 5I8KH 5HYSG 1FIEA 1G9ML 4OCRL 2FH8A 1DR9A 4LBEA 2OTWB 3FB7B 1LMKA 1OTTC 4IDJH 1E4JA 1GAFL 4EVNB 4OCMC 3RTQB 2O5YH 1LE9B 1NGWA 5L7XL 4M6NH 4U49A 1FDLL 4LSQH 5I76B 3THML 3RY5A 4JRXD 1AGEB 4LSSH 4FFVC 3MRLB 4LEXL 4RBPK 1A64A 5IVZA 5KSVB 2K3TA 3TCLB 1QPPA 4L3CB 5F7DB 4JVPA 4N0FB 4PJEB 4V2CB 1XF4B 1UEMA 3V52H 1OLLA 3KPRB 2DF3A 5EORL 4MJIE 2P5WB 1JYWA 4HZLA 3QHZL 3E3QE 5BRZB 1D5MB 1YN6A 2B5IC 1IM9A 4X8XA 4KY1H 3TWCL 5BJTB 3VXNB 2NY6D 1UENA 2EH8L 2IQAA 3SO3B 5JHDA 5C6TL 4IRZH 3OR6B 3T2QA 4PLJC 4XGZA 1LK2B 1QKZH 1XR8A 5F44A 2CIKA 3PDOB 1UWEH 1DBAL 2PNDA 4GAYB 4MXWL 4NJAL 2EE9A 3O2DH 1KLUA 3NA9H 2VNCA 3RVTC 5AYUL 4HPYH 4IRJA 4KU1A 2X4OA 5I0ZA 2EDDA 1PQZB 2CLZA 1A9EB 2K7QA 1PAMA 2J6EA 4XNUH 2VLLB 2VLJE 5HGBA 4XCNB 2I5YH 4L5FH 1EHLL 1NFDA 1IL1A 4LVOC 2NW2A 4W81A 4XPGL 4KRPC 2GW5A 4XWOC 3E6FB 3IJSA 2I26N 2CRYA 2QQQA 3SCMC 4J6RH 4N8VA 3UTZB 1A7OH 5C9JB 1NMAL 2OL3L 3MNZA 1DQDH 3HCVB 1AQDA 2DI8A 3CFEA 3SE9L 2Y6SD 4HZAA 1MIMH 1DQJA 2IADA 4M7LL 2OMBA 3OG6B 5TE4H 5B3JF 3ROLB 2W65B 1CE1L 3WNNA 3ARED 3BH8A 3BKCL 4QHNB 3QWOA 3L5WB 3TBYB 4LKXA 2IFGA 4QRPA 3WNMA 5JW3H 4ZUTA 5I1CH 4Z78B 4C58B 5LQBL 4RX4D 4RMUA 3CK0L 5K9JH 5BRZA 3GMRA 3S5LG 1MJUH 3NCJH 1T0NA 1YZZA 3N06B 4P46A 2C4FT 4JEGB 1H5BC 4XMKL 3M1BA 4AL8H 2HLAA 4KMLB 5A2JH 4P5MB 5IF0B 5KZCB 3HPJB 3I6GA 2GSIB 3UCRA 4XNMB 1U95A 2VDOL 5JXAL 1ORQB 1DE4A 4EI6B 1Y6KR 2ICES 1NCCL 5BRZD 5TF1H 2HJKA 5FDWA 1D6EB 2VITA 3G6DL 5IM7B 3IU3A 3BPOB 1KN4L 3BGMA 4RDQF 3KPRD 1G7JA 4GT7A 3CSPA 2EDEA 1T22A 4F3FA 3V0WL 3AREA 2P46B 2IFFL 4F15B 1D7FA 1NGYA 3DV6A 4AEFA 4I0PA 3FN0L 3PV6B 3MRKA 4U1LB 3K2UH 4ZFOB 2BNQE 3MLSL 2Z4QA 3FQRA 2X4TB 2M2DA 4HGMA 3JWOL 1FL5B 3O11B 4KJQC 3O6MH 4W4OA 4Y16B 5I76A 5CEXA 2SEBA 2DBLL 1PKOA 2KDGA 5D5MB 2BY2A 3L5XH 5EB9A 2H41A 4I1NB 2ZCKL 4OAWB 1KTKE 1NJ9A 3A6OA 3P4MB 5ESQA 4QHMB 3GSWB 3T4YB 4KVNL 4NFBA 5EIQA 3H9SE 5D2LB 3UROR 4P2RA 5GZOC 3ARDC 2GQHA 4Z77B 5A2KH 5JPMA 1F90H 4FXLA 4CNIB 2AVGA 3QEHB 3T3PE 5F8RC 2NY3C 2IPUG 1MRDH 3QO1A 1JNNH 4ZS7H 4ODXB 3U0PB 3IFLL 3LDBB 4JHBA 3RX5A 2WIMA 2EKJA 4QY8B 1CGWA 4K94L 4PTTB 2ADGA 2OJZH 4LAJH 2VAAB 4XPHH 3SQBA 2G75A 4PGBB 2LAGB 4XBPA 4NRZA 4U0QB 4GKOA 1UM4H 2A9ML 4ZFGH 1A6WH 3CLFH 3OKNA 3KDMA 3L6FB 3P77A 5EU3A 2WANA 4EOWL 2P8PA 5GRXG 4G42A 5FAAA 3U4EB 2FD6H 4IOSD 4XP6L 2V2WB 1FBIH 2DIBA 4OKVA 1L0QA 4ALAL 4PJIA 5KBNC 4XVSH 5FUOL 5CGMA 2OI9B 3BEVB 4G7VL 5BJTA 1Z9MA 2W0LA 1JWUA 4JFXA 4EBQH 2MQCA 1WF5A 2NY6C 3BOVA 4YHKH 5CJXC 1YEHL 4LPWA 2F54A 1UVQA 3DUSB 3SE4A 1I7RA 4FFVD 3MOBH 1V3JA 4L8SC 1NGXA 4DKEL 4UUJB 2IBGA 3F7RA 5IV2A 2SEBB 4OFDA 5LCVH 3FKUS 3M07A 5EOTB 1NBVL 1XGUA 5I73C 2YSSA 3B9KB 2I24N 3T8XB 4PP1D 4OQTA 1CFBA 4N5ED 5HVHB 2R2HB 2XACC 3O81A 3HPJA 3FB5A 4JAMA 3WFDH 2QQLL 3H7BA 4DUXA 2R29H 4FQ2H 5C0FA 2JCCE 1UB5A 1AGFB 4Y19B 4M7ZC 1T7WA 4G9FD 4QRUA 1GOGA 1YMMD 3GIVB 1BM3L 4M62H 5F6IC 3RZCB 2OMNA 3TC9A 4OZIF 2PO6C 1BD2A 3ZKQD 5L88H 5CBEA 3PGCA 4HK0B 3B9KC 1RIHH 4WNQA 2BVTA 1JNHA 2XWBA 4YK4B 3RWHA 4ZO7A 3JXAA 2OR9H 3GMQB 3UPAA 3C60C 5DHYA 2Q6WB 4NKQB 5JW5A 2VTFA 1IGCL 2VLME 3LKQB 3UTOA 4HIEA 4LNRA 1RJLB 4Q9BA 3U0TB 2QQLH 3Q5YA 4J12A 1JTOA 5FUZH 3R1GH 1G9EA 1HSBA 5J7CC 2ZUXA 4CJ1A 3MYJA 1YDPB 3DHJA 1YNLH 3MLZL 2X4NB 4M5ZL 2HJFA 3S37L 1AO7D 4NNPH 4P57B 4X0KB 2HAZA 2ED9A 2Y06L 3VFGL 5ALCL 2KZWA 3QP3A 3VXRE 2HN7A 1RJZB 4Z7VF 5F7HA 4HMEA 4YX2H 3RX8A 2FLBT 1MQKH 1CICA 5DQ9A 3UO1H 4PV8A 2X4OB 3ARWA 1K5NA 1DANU 1RZ7L 2IAMB 4DUVA 4G7VH 1ZVSA 4XPAH 4XVSL 1E28A 5FUOH 2GKIA 1HK6A 1P7QB 3C2AL 3BW9B 3EJYD 2QADC 2WUBL 5IBTL 3T0VA 3UTTE 2ID5A 4OBSA 2N4IA 3OJMB 4Z7QE 2X70A 4M3JA 4GAJH 4XC1L 4NO0D 4WFGD 5KZCD 1JHKH 1BVZA 3U30B 3RZCA 1DTUA 4JO2H 4KAQL 4PJCE 5EZJB 5DUPH 5DJCA 4JRYE 5J3HC 4Z0BL 2QQKH 5J8OA 4ONHB 3QNYB 1AKJD 1KTLB 5KS9F 4MJIB 3O9WB 3ILQD 4Y16C 1U8MB 1WTGT 4R2GC 5IUSA 1XGTB 2X2YA 4GRWE 5TQ2L 1YEFL 3D5OF 2R56H 4LCIL 5IG7B 4NC0B 5D2NA 2VYRE 4C56D 1MVFA 4IS6A 1MQ8A 2L7UA 3U0WL 4LGPB 3RGVA 1HXMA 5FUCC 4KVNH 5JPNA 2V7HB 2GITA 3S98A 1YECL 4APQA 4FZEH 2VLRD 1MRCL 2H2PD 3MFGB 1MWAH 2ESVE 2E27H 1W72H 1MUJA 3ZHKA 3QUZB 1TXKA 1XR9B 2Z31A 5D1ZA 3HE6D 3H0TB 2EIDA 5MEND 3HC0A 2GI7A 4BSJA 5C3LD 4EDWL 3VGGA 1RFDH 4XPTL 5EN2B 3KPSB 5D2NC 1NLBH 1X4YA 2HG5A 4LQFH 4NBZB 3MLTB 3D69B 4OTXL 4WHDA 4BQ8A 2XKSA 1C08B 1OM3L 5K9KB 4MGXA 4PR5A 4I18B 1RULL 3ZTJH 1NBZA 3QXUA 5F70A 2NY3D 3FO1B 1QFWH 4F9LC 3OKDB 4GW4B 4MA8L 4Y2DD 3MRLA 5JOFA 1MREL 4E41A 4HUWB 3IDYC 3GMOB 3F58H 1GRWA 1HOCB 3DGCR 4L8SB 2NY4B 5IHBA 4ODVL 5DS8A 5I17B 2JKXA 5HYQB 2VIRB 4XMKH 5FYJU 4A6YA 4JZNA 3VRIA 1G7IB 5F7WC 3GSVB 3BDYL 2EDTA 1DLHB 4HFUH 3DRTB 5EO9A 5BZWA 4JFXB 2WBWB 1DQML 3MMEB 3S96A 1JPST 3WUWA 2FBJH 2MKWA 5TFSL 3SDXF 1J8KA 4HEME 3F7QA 3BIKA 4CW1A 1DFBH 1JPGB 3I3BA 4H20H 3VD3A 4NUGH 4ZNEE 1FZKB 5DQJB 2BXYA 5KVDL 5EOCJ 3SE9H 1G7JB 4HWBH 1M05A 1JF1B 4OV5B 4WW1B 5ALBH 5JZ7D 1FO0L 3LKRA 1OF2B 4PUBH 1NMAH 2OL3H 4JZJC 1Q9LB 2EDBA 3C9NA 5LWYL 1S7WB 2P8LA 3DUUA 1T21A 2WQ8A 1F6AA 3OKOA 1HQRA 2NXZB 2LU3A 4X9GA 4Y19D 3ARBA 4MLSA 1E6OH 4Z5RB 3B83A 5EBWB 3CX5J 1REIA 1KEGH 5F1KC 5F7YC 5CILL 2FSEA 2AJ3A 5GS1B 5GS0L 4PRBB 5TGBB 4JKKA 1EJOH 1L7TH 4HPYL 5AYUH 2NZIA 1LWRA 4NQCE 4XXDB 4RISL 2VZOA 5DHXB 5HHQB 4XP4H 1QKZL 1ND0B 2NR6D 5DMGC 4XMLH 1ZLSH 1TPXC 5EO1A 1UCTA 2A38A 2MPAH 2HYMA 5I1GL 5MEOB 3O3BA 4MWFA 2PCPA 1WZKA 43C9A 4P4KB 3OXRA 3SBWA 1J0KA 2V5TA 4PRIA 1OAQL 3QQ3B 2IQ9L 3UTSE 5IROC 1MCWW 4HQQH 2LVCA 2KH2B 2A1WL 2VKXA 4UTBH 3H2WA 3KPSA 4OLWL 3SDCB 1AFVH 1BHGA 4Z18A 5FHBL 2EIZA 5EBGA 2NY5L 5IFJB 1KXVC 4WTZA 4LSSL 3EOTL 3RI5K 2VUOA 1HHGA 1MUJB 1T66C 1BZ7B 4Y2OA 3KLHD 4NSKA 5L7XH 3RGVC 1CGTA 4FA8A 4KROC 1FNEA 1R3KA 2XKNA 1DDHB 1Q9KA 4KV5F 1XF5B 4H1LH 2I60H 1TZHB 3O4OC 3UC0L 1LD9A 2ZG2A 1ZA6A 4MLIA 5JORB 1MCJA 1RUPH 1KB5H 4PJBB 5GRYA 2P24A 1XCQA 2BNQD 1N0XL 4DCQB 4H1LA 1MHCA 4O2FA 1CFSA 4XP9L 3TFKD 4DQOH 4GSDL 3FQRB 5C09A 1AD9B 3CD4A 4DOHE 4PJ8A 2YEZB 3FB8B 3Q6GL 4LARH 3TM6A 3DBXB 1AY1L 3O41A 1WCQA 3U7YH 1ZHBB 4QOKE 2V5SA 4HS6A 2LFGA 1FYTE 3CSGA 1MFAL 4YWGH 3QZWG 3H7BB 4HHAA 3GK8L 5L2KD 3GRWL 4WEUD 5GGRB 1MEXL 3GI9H 3NCMA 4D9QE 3T3ME 2DTMH 3MV01 4M9OA 5I1HL 3W9DB 5F1IA 4QWWD 3VCLA 5I1LB 4M1DL 1TDQA 1WZMA 2EIEA 4HIXH 5GJTL 3LQZB 5E6ZA 3F7PC 1Q0XL 3MRNA 1NMBL 3WL9B 4JPVH 5EZOL 1I8MB 4N8CL 3CFCH 3CDFA 3ULVE 1S78C 1RJZA 3S34H 1EHAA 3O6LH 5DJ0A 3GJFH 4G6JH 1INEH 1BFOA 5HDOA 2V2XA 3MRRA 2D7TL 5KG9A 5FYJE 4LVHB 3EJZC 1HQ4A 1MFDL 4U1NB 2C1OA 4NKOB 5CZXC 1R3HB 3L3DB 5DMKB 2CJUH 2J8OA 4JR9L 4O00A 1T1ZA 3PE9A 5HHQA 1KB5B 4F57H 2EKSA 5HHXL 2VDPL 5C0AD 5KTEH 3MRGA 1E4XH 5CKGA 4F2MB 2MHAB 2C3HA 4Z5RA 5DS8B 3QIUC 4Z7WF 3DXAD 3WIHL 1G0XA 2VISB 1P4LB 2ICWB 1DCLA 2CKNA 4JFFE 3MODH 4PJ7F 2D31A 2YOCA 3EYFA 4X98B 5ISZE 5ICZB 2F8OA 3FQNA 1OAZL 4I0PC 4WEBH 3GDBA 5JNYB 1ETZB 1Z9SA 1U2HA 1CGYA 4CVXB 5GHWH 4L9DA 4EVNA 2NY0D 1OAUL 3O3BB 4MWFB 5JPNB 1QVOA 2B39A 3KS0H 3CLEL 3F8UB 2DYPB 4LL9A 4DVRH 4QGTA 4NGHL 3ARTA 5IJVB 1QRNE 1UACL 3TNMA 4EN3B 3K3QA 3BAEL 3B2VH 3LKRB 1KNOA 5CMAB 4YO0A 2WQRA 2G9HB 4LSUH 4WY7L 4LLWA 2XZCH 4XPFL 3JV6A 4TYUA 2OTUA 5CP7A 1LHZA 4JGUA 4OZIA 1DUZA 1EVUA 4XRCB 1DEDA 1KJVA 4OBRA 3M17B 3D69A 4KV5E 1LE5B 3ZKMC 3RWCA 2E9JA 1FAIL 3BQUC 5HGDB 3GKZA 2FX9H 3KYOA 4MJ6B 1E27B 5D6DC 3S36L 4L8CA 1WVZA 3FT2A 3D0VB 1CFQA 4PJBA 3LY6A 1JBJA 3SDXB 1S7UB 4Y5VB 4QF1B 4UDUB 4HH8A 5T1DL 5C0GB 5D1XD 2V17L 2HVKB 3RNKA 3FCTA 4GKZA 2VIRA 2HMIC 3I85A 1KEML 3RWIB 1RU9L 4BSWB 3RTQC 4OZGF 4KHXH 3RVTD 3MV8D 5ID1B 4IOIA 4XI5C 5F7EL 1ZT1A 5FECA 1CN4A 4WDIB 35C8L 4PJHA 2XWJA 2IAND 1LNUA 2DLGA 5F1NB 1BD2D 5F96L 1YC8A 4TQEH 4DW2L 1CXHA 4X6DF 5F89B 1IGTA 2D4FA 3WUWG 1CYGA 1N2RB 3GIZH 4PJ9D 4XCFL 1INDH 4F7MB 5HYQA 1JYNA 4M02A 4RMQA 3L1OL 4UOJA 4H8WL 2A74A 5SX5H 4OCXL 1MHPH 4JFOA 1XZ0B 3BPNC 4D0CA 3EDFA 3QEGL 4XWGH 1T2JA 4WRLA 1UA6H 5D6DA 1CLZH 3NOIA 1QSFE 1S8DA 4BFIA 4KKNA 4F37F 5CINH 3AS3A 3QH3B 4L4VB 1TJGL 1KCUL 1BLNB 1LP9E 1D5ZB 3BP7A 4PJGB 3TZVB 5D7LE 3ORJA 5C92A 3MUJA 3PG2A 1BQSA 1HINH 1VFBB 1VKXA 1VFAA 2VDQL 3I84A 5JR1H 4GUPA 1RPQA 1YJDH 2KQMA 3V4VH 3ARFA 4KK6C 4QRPE 4JFHE 4P59H 5I18H 4C55A 5J57B 1SJXA 3S3PA 1K8IA 3QCUH 2VZUA 4OLZL 3KXFA 5J1AA 5MI0B 4JB9H 2G60H 4K3JL 1LE9A 4CBPA 3FFDA 2X4QB 1FO0A 2AXFA 1K3ZA 4LNVA 5E2TH 5ESVB 4JJ5B 3AS2A 1IFHH 5K59F 5TDOB 1A7NL 5KAQG 1KIQB 5ESAB 1LNUB 4PJFF 1FSKC 5IWLC 4PJDB 1I8LC 1U8LA 4CRPA 3WYRA 3RL1B 4F7CA 1NC4D 5T3XH 4J2XA 3WN5C 3WNKA 4AG4H 1BZQK 5BZDB 4DZ8B 3SCMB 4Z78A 3MACH 5DHVH 5ID0B 1Q94B 3CX2A 1CK0H 4H0HB 5LXGH 2IGFL 4L9LB 1AXTH 3AU1A 2JJSA 2YZ1A 3BP4A 5D7SH 4BM7A 4KZEH 1J0YA 3AY4A 3ILQC 3V4UH 4LSTL 4HF5H 2F53B 2VLRE 3OB0H 3BI9X 4LOUC 3SDYH 3KYMA 3MV8B 4S1DC 3FAXA 2EYSB 1KB5A 5F7KC 1G84A 3P9MA 1K2DA 1HYRC 1JFQH 5I75C 1EFXA 1BEYL 2NYYD 3QDAA 1OWWA 3W0WE 5I71B 3HRZA 1WFUA 3LKOB 1L6ZA 3EJYC 5CWSB 5D93C 4F33A 4JM2A 3W2DH 2AKRA 2BDNH 5IW3A 2FEEI 1ZANH 3P4LA 3C8HA 5B38G 4K3DL 1NJ9B 5JIPA 4KUZL 1BIIB 3WL9A 3I02A 3SDXA 2G9HA 4WWKC 4RFOH 1NAML 3BPLB 5AAWA 1H9VA 2YD2A 4K2UL 3DROA 5B4MC 4MA1B 1NAMB 2VE6B 4PJ8D 2YKLH 3CZFA 4WUUB 3D0LA 5CGYC 3QCVH 4JPIA 5GSVA 4I3RL 4HAGA 3D39B 4NQDB 4MJ2A 1FN4A 5KSAC 2RB8A 1W72B 3ZLQC 4NFCA 2IPUK 4U7SA 4G8GD 4X7DC 2CIIA 5IMMA 4LCWA 4MDIB 1FSKB 2CXKA 2FJHB 3BGFC 4FS0A 3KYAA 2NYYC 2Y07L 4YZFF 2MCG1 5FCUH 1G7HB 1Q0YL 3PIQA 5EU6B 3G08B 3IFOA 5F7DA 3ULVL 3LV3A 1WEJL 1QSZA 3RWEB 1KC5L 4O4YL 3MUY1 3SN6N 3ULVH 3GI8H 4RGOH 3B5TA 4HIHB 5FCUL 3W5MA 1J88A 1IQWH 4LVEA 1I1AC 1U91A 5JNYA 2BHUA 5FUCE 2NW3A 5B39A 5EOCH 1M6OA 5FF6A 2ARJA 1BFSA 1X6NA 4QYOA 3LN5A 4YHYC 3VJ6B 5IT2L 4HT1L 1OGTB 1D6EA 3LAFA 2V2WA 1RIVH 5KG9B 2QR0B 2YZ8A 1IBGH 3HNSL 4HWZB 1Q9WB 3U9UB 4Z7OF 1IQDA 1IGJB 3QWRD 1I3UA 4DGIH 3UTSA 3VMNA 5T5FH 4P5TB 4R9HA 4NRZB 5B39G 3C08L 1X5ZA 1NAMH 2AXHA 4LRIA 4Y4KC 2EDLA 4XHJC 4RFNB 5JQHC 4RWYL 4KI5D 4G8FA 2OZ4H 5EC1B 2BDNL 1JF5A 1CFNB 1FZJB 5IMLB 4P48A 5E9DE 4KKBD 4OM1L 2XQYG 2DM2A 1FL5A 2DQJH 1SY6L 2X4NA 1L0XA 2Z8VC 4Y4KD 3FFCB 3MLUL 3CDGA 3BPCB 3WE6A 1BZ9A 1M4KA 3KWWA 1KV3A 2HFEA 5LGHH 4YHMH 5DWUH 4UAOC 2G75B 3RAJL 3MCKA 4K7PY 3RBSA 2ADFH 4R4FL 5KSBF 4HS6B 4LHUG 1IMHC 2QADB 3KNBA 4FQJL 3S35H 3OPZL 4TSBH 1F45A 1ADQA 3MX0A 3TLRA 2BVPB 5HDBF 5J4MA 3S5LB 1SHMA 2WUCL 4OT1L 4CNIA 1WWBX 2IGFH 1BJ1J 4MQSB 3PGCB 2H32A 3NN8B 1KCVH 2YBRB 4PRIE 2FYYA 4MNQE 3GSOA 5I73B 5F9JA 2Z92A 3QUMH 3RWDA 1HZHH 1UJ3A 4OJFH 3IETB 4JQVC 2A6KA 4NNYA 1XGYH 5ACMA 1UCBH 2AV1B 4D3CH 5C09D 3H9HA 4NNXA 5J13B 4KPHL 5D4QA 4AM0B 3ULUH 1A8JH 4KHTH 2I9TB 4XH2A 4JM2D 4Z7UB 1J9CT 5JLZB 3BKJL 2QQNL 2N1KA 5J3HD 5I6XB 4NQDD 3BGAA 1JGVH 4L4TD 2GJ6B 4P9ML 5HGHB 4WO4A 5JR1L 3HC3H 3V5HB 3BIBX 4I0PB 5J0BA 1HINL 3OF6D 3HFMH 3DUSA 4NHUA 2RFXB 5C0AE 4PJBF 2IADB 5FEBA 5J11B 3NPSC 5BS0A 1NCDL 3GJFK 2YUZA 3G5VA 3BPCA 4MHHI 4PRHD 3WIIH 2NPLX 5GIRB 2YSSB 3B9KA 4YZFE 4WI8A 5KSVA 3P73B 4JFFD 4ZUTB 3KYKH 3SOBL 4MHHG 5ISZD 1HDMA 1KACB 2EDJA 3EYOA 4MSWA 1NC4A 5GZND 2Z93B 1X7QB 5GGVL 4MMZC 1RK1A 1WV7T 1MCCA 3DHMA 2P5WA 1ORSB 4NYLA 5I66B 2AV7A 4F58H 1B4RA 2B1HL 5F9WC 4Y1AD 4PY8J 1OSZA 1WK0A 3CXDL 1OP5K 4K9EC 1QRND 3N50A 4Q9CA 3E8UH 1BOGB 4GG8B 4JHWL 2KPNA 4JM4L 5TPWH 3K1DA 3W82A 3VWKA 4U1KA 5EC2A 5KN5B 1PEZA 2YN3A 1RI8A 2DWDB 1W8OA