4POYA

Engineered dual specific vhh antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VHH-metal
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4poyA00
1T20B 3QUZA 4NZTH 4KMTL 4JHAH 2NY6B 3MO1B 2MCPH 3CSBA 3O2WL 3D85A 4PJIE 1RUPH 2BFVL 1I3GH 4WFFD 1KPUB 4Z7NE 2HFGH 1W72B 4KKBD 4ONGL 5D9SA 2JJTA 3D85D 1QBBA 4HKZB 4U1GC 1MF2L 2VXQH 3N0PB 5HHME 5F7EL 4NRXB 3BMVA 5AZ2H 1H5BC 3HZVA 5E2WL 5AUMB 4A6YH 4NN7C 3GSVA 3B9KD 5F8QC 1X7QB 2ADIA 32C2A 3NCEB 1BZ9A 1P53A 5H2BB 1IM9B 4XPBL 2P5ED 3IT8D 5ID1B 4DGYH 1JHKL 4QHMA 1TNMA 3OKDB 2FBOJ 5A16A 1RMFH 4KAQL 4CVWA 2NXZD 4JFFD 2HT2D 1LP9A 2XWJA 5J12B 5F1OB 4LCUB 3CH1A 5EWIL 2IC2A 4ZQKA 4PFEA 2MPAL 4H8WL 1VACB 3MMEA 4XCNA 3L5HA 3QFJE 1RHFA 1DL7L 1MI5B 2W65B 3V8OA 1IBGL 4GMSH 4YDLB 5HHXL 1NMCC 5C0ND 4G7VL 4GRMB 4F7PA 3PDGA 4XMPH 3UYRL 5C2BH 3WXVH 3QQ4A 5HXMA 2DL2A 4P5MA 3CLFH 1TETH 3V5KA 5HI3D 2ATPB 3T65A 1ITCA 3STBA 4HS3A 2X05A 4EI5A 3X13A 2QSVA 4R90L 1PW3A 3LEVL 2OX5A 2C1PA 3MACL 3I75B 4HFWA 3K4ZA 1HHKA 2EE2A 3ZT6A 5T1LA 4EI5D 2CR6A 1A6WH 1F6AB 1IQWH 1IKFH 1A47A 2RJMA 4F7CB 3NFSH 4WFHD 5T5FH 2EYTA 3NPZB 3E6HA 4LSVL 2IH1A 1A7OH 1NGYA 3T2OA 3VFMB 2CO7B 4PJAB 3TWCH 3MRMA 1FNSL 4ESKA 4CMHB 3PL6A 4IRSD 1QFUH 1CFQB 4M3KB 1H0DB 4WTWA 2F5AH 1Z5LB 3BKMH 2C3VA 4K23L 1RIUH 2CIIB 5J12C 4NQVB 4MD4A 3GKZA 4HWEH 1B4JH 4WI8A 1NDGB 1FVCA 5GISL 1GRWA 2UY6A 1ED3A 3OGOE 2A77H 4HKXB 4I0PA 4ODTL 3TH4T 3FTGB 4GW1A 2K9UA 4XNUH 3I3DA 2E7BA 5BQ7A 2FDBP 4NRYA 2P24B 3GMNB 4N1HB 3O2VH 2MCG1 4KRPB 2C1OA 4LCCA 2NY3D 1A22B 4FQLL 1OGAB 4XX1G 4JM4L 5IMOA 3IAQA 1YEEH 5CEXA 3E0GA 4P9HH 3UTQA 4HT1H 3GB7A 3FZUD 3WS6C 2W0FB 3KPMA 5IROA 1INQA 1SYVB 5CUSH 1JGDA 1NGXA 4UV4L 5CCKH 1BZ7B 2DQDH 2NPLX 3DXAA 5JPNA 2BXYA 4FMKA 4FQJH 1A8JH 5FYLH 2D7OA 3CFBB 5E08L 2GJZA 4YHYB 4R4FH 2BSRA 2DIBA 4WHYG 2V5SA 4FQ2H 3WFEL 1CK0L 1S9YB 2R1WB 3EDDA 3K74B 3ROOA 3WLBB 2WUCH 4MAYA 4XXDA 3NN8B 2F5BL 1EK3A 1E6OH 2RFXA 1DBAH 4NN5B 3L3OB 1FCCA 3FAWA 2ICEB 4PGBB 5EOQL 2VXUL 2IPUG 4HH9B 5EU6B 5FHAL 1C7SA 3BE1H 2LTQB 1Q9LA 4ZOAA 1MIEH 2GK2A 2YPVL 1WZ1H 4KVCL 1U8PA 2HT3D 2G9HA 3IKCB 1TZHA 1ZHLB 2ZUVA 3CMOH 3BZDA 4X6EA 4QHUA 3WDHA 3BXNA 2CRIA 2B1HH 2IG2L 2LE9A 3KXFD 1U8IB 3OXRA 4RGOH 4JCLA 3MV7A 1S7VB 3SGEH 3FOLA 3SCMB 3T2NH 1KXTB 2YEZB 4ELMA 4LLWA 4X6CA 1ZGLP 5E7FA 4KRPC 3HS0B 4HJGA 4DN3H 1M6OB 1L9MA 1RI8A 3BOVA 3P0YH 5T1MA 2DKUA 3KHOA 4MCZB 4XP9H 1RD6A 4ZS6C 1LK2A 1DBJL 1PVHA 5J6GA 3IDXH 4GFTB 4H20H 1J11A 1QRKA 3B2UD 4TUJA 4R7NA 4X0KB 4KJPC 1ZA3B 5J13B 5C9KA 1EEQA 1NCBH 1AR1C 4YHYC 1FNFA 1OF2B 4FFWC 4YFLI 1MCBA 3C5JA 4R8WL 3SDAC 3MRJB 3MV01 1BOGA 4Z7UA 3T3PF 4GRWH 4X6DF 3SJVA 2QHRH 2GTZA 4JZNB 3U9UA 4ZTOL 3MUGA 1EIBA 5ETUA 3O6MH 4NJ9L 1IC7H 3PG2A 3T2QA 3L5JA 3SJVD 2HJKA 2X4UB 5GJSH 4QRTA 2LTQC 3SBWC 1IEBA 3HAEA 3P2TA 4NRZB 3F58L 5I1IH 1NLBL 2Z31B 4D9QE 1A1OB 1JJUA 1HINH 5ACZA 3BIKB 5BW7C 4G5ZL 4LEXH 3WNPA 4HLZH 2R39A 4MQ7B 2YD6A 4U6HB 3SY0A 1U92B 3ARFB 3B3IB 5D7JB 2G5BA 4GG8B 4GS7B 4PV9A 5EUKB 4NFDA 1L7IH 1G7QA 5IHLB 4MD5B 5L2KB 3UTZB 4P49A 3K2MC 1WEJL 1G7IB 4GJTB 2X1OA 4NHUB 3DHMA 1ULVA 3QUXD 4M7ZB 1DBML 4OF8A 5E2VL 4L3CA 3FKUS 5EN2B 4R96A 5C6TH 1S8DA 2CJUL 4BKLB 3T0XA 5EA0H 4G9FD 1JNNH 1BX2B 4WVRA 4GQ9H 4UT9L 4M02A 1HHGB 4XCYA 1DBKH 1X6LA 1T80A 5C3LD 2OL3H 3K8LA 4PJBF 2WIIB 2C3HA 5J13C 3D39E 3BH8A 3VRIA 3TESA 1HI6B 2I9TA 4QRSA 1U93B 4ZS7H 4LPYA 5IB5B 4P46B 4XNYL 3SKJH 5D2NA 5IW1B 2XI9A 4L8CA 3VGHA 3GIVB 1AGFB 4ZOCA 4PG9B 5L9DH 5EU7E 3MBXL 2RBLA 2IBZY 1WT5C 5SV3A 2BSSA 1QEWA 3MNWA 2FSEB 1WBXB 1FQ9C 2Z31C 4HDIA 1JZ8A 1L9NA 2H6PA 3D87B 3UTSD 3R8BB 3QHFL 3FO2B 2J8HA 1C5DB 3L5WA 4LF3B 3P9WB 3WIHA 3WLWC 5ADPH 3DBXB 2HG5B 3BH9B 4TQEL 5D7JC 4PJ8B 5FM8A 4GS7C 5JXEC 1AC0A 4NCC2 1CXKA 4JFPB 4ETQB 1KJ2L 4I3RH 1QA9A 3LN4B 3X12B 1VFUA 4NZRH 2QSCL 1KN4L 3DO7B 4PV8B 2D7NA 1TJHH 1OAUL 4Z9KB 1XGYL 3LAFA 3HMXA 5KOVC 4PJEA 1NAKL 3H6JA 3EZ8A 4M7ZC 4BM7A 4H1LA 2NY6D 3QO1B 1KPRB 3Q6FA 4HKZA 3V7MA 4ZSOB 5F9JB 1WAAA 2OI9B 3S3PA 3O4LE 4FQPA 1UB6B 4K3HA 3IXTB 4EZMA 5AUMA 1Q72H 3OKNB 1RVFL 3MCKB 1D5MA 4P46C 3G5YB 1N64L 1IGFL 3HNSL 1IVLA 3LKSB 2AEPH 4HS8H 4A2MA 2F74A 43C9A 2HTKC 4FQXB 5C7XH 5E0QA 5TE7L 3KS0H 3TBWB 2IANB 1OAKL 3NABL 3C60A 1IQDB 4BFBD 3QEUB 3KYKH 2XZCL 1ES0A 1Q9KB 1IM9D 4YDJB 1A4KB 1OPGH 3VMOA 5CAYB 4L3EB 4ETYA 2AQ2A 1G7JA 1R3LB 2FLBT 4JFDB 2W60A 2A83A 3GMRB 1TPXB 4NP4H 4ZUWA 4TUKL 4NUJA 3ULVH 1DUYA 5I1GL 4YHLL 2VWEE 4QOKA 4P23A 4Y4KB 2PYFA 3P73B 4IIQB 3QUMA 2FJGB 4N1CA 3GSOA 3VD3A 3P0VL 4TTDC 1ZHKB 4XAWH 3QO0A 1PG7H 4XWGL 2F8VA 2C26A 1TQCB 5IFJB 1P2CA 1MI5D 3G6AA 3O11A 2OMNA 4K3EH 3EYUL 3MV11 3WKML 2BJML 2BOBB 5TGBA 3GJFA 4HWBH 4NQEA 2OZ4L 4FFVD 2VKXA 3C2AH 1MLCB 1G9MH 2X70B 1H3UA 1SJEB 3P9LA 1VB9A 2OI9C 4K3GA 3V6FA 4H88H 1ZT7B 2DS4A 4KKLD 4MJ5B 5MENE 1S9VB 1SEQL 3LPGA 4N0UA 3VXSB 4GRWE 5HHOE 1TQBC 1B2WL 1LQSR 3H7BA 4KU1A 5DJZB 2R1XA 4JRWA 4RQQA 3CFJB 1BD2E 4PJXB 2EDDA 1H3TA 2J88L 5KVFL 3LCYA 4O51A 4H25A 5ECJE 3V6BR 4FQXC 3NVQA 2HN7A 3GO1L 4E41E 1S5IH 4PJAA 1F00I 4MCYA 3LHPL 4YXLL 1QKZH 2V9RA 1BM3H 5L6YL 1WFTA 1RZ7L 5HJ3B 3SQBA 4G8FA 3EYFA 1FNGB 1TPXC 2DD8L 4D0DB 4NNYA 1FFPA 2OTUA 2Q86B 5F7FA 4PBVC 5E1HB 3CZFA 2B4CC 4BUHA 4IIQC 2A9NH 3RWHB 3PJSB 2A73B 5D2LB 3U6RA 1T7XA 2DLHA 3MRNB 1PD6A 1AO7A 1NEUA 1TQCC 2BNQA 4ZUUB 5TPWL 1OGAA 3OHXA 2J12B 3ECBA 4KRPD 5K93A 2EEBA 3HG1B 1KFAH 1OGAD 1J5OL 2V5RA 2GSIA 3J7HA 4XI5C 3GBNH 4C4KO 5FKAB 4ZS6D 4CADA 1NJ9B 2BVUA 1B0RB 1CDCA 2FL5B 3LPWA 3ZDXF 2VQ1A 4MMXC 4MA8H 5I6XB 4H26A 4KJPD 4RAUB 1S9YA 5DWUH 3RL1A 1I8KA 3GSQB 1FSKB 1WQVT 4GKZB 5B3NA 5D5MF 1LE9B 4MZ3A 1JN6A 4M7LL 4HUVA 2FX7L 4RRPG 2M8XA 1T2XA 4XBEH 3OKOB 1ODAA 4YX2L 4X9HA 4Z7WE 5GRZA 3ULVC 5DHVB 2W38A 3ZE2F 3HC3L 4TNVF 3ZDYF 4FQ1L 3UJTH 3GRWH 1JI2A 3G5ZB 4PRBB 5GS0D 1QACA 4XTRD 3MJ7A 3PXHA 5EU6D 3B8YA 4HEPG 5F6IC 3N1MC 4PJCF 4QT5B 4ALAL 1QRNE 3IFOB 1GYAA 5ADOL 1NGZB 4RWYH 1NFDE 2V9QA 1UB5B 3OR6A 1T4KA 1CDHA 1FIEA 1UA6L 2BVYA 4PJIF 2FNBA 3QIBB 2BP3A 4I13B 1CXHA 3ZTJH 1E28B 4UDUA 2JK5A 3MRBB 3DYMA 3GSXB 2GJJA 2HFEA 1FNHA 4XPAH 2ARJQ 2P46B 5D7IB 2ENYA 3SCMD 3S3SA 4OSUH 5JDSA 43CAA 1FVDB 4BK5A 4K94H 1M6OA 4K7FA 4XHJC 5JIPA 5ICYA 5ITFB 1A2YB 4R7DA 1J1OH 1U91A 4MCZA 4XP1H 4OUUA 2HFFA 1RK0A 3CNKA 3VFTA 5IVXB 2V7NA 4JG0L 2PTTA 3D25A 3QNZB 1ZMYA 4NQXB 4RMRA 4XHQA 1U8JB 2VLJE 5I6XC 4FTVB 1J1XH 4Z95L 1XEDA 4NDMA 4ZTPL 4OF5A 4L4VB 5I66A 4HV8B 3TF7C 3QJHB 1UVQB 3S97C 2DM3A 1T5XA 2WZPD 3RKPA 5JO5A 2DKSA 4RIRB 4IRJB 3ET9F 1MWAA 3NH7H 3KVQA 3KS0J 4OBRA 3MLYH 4GO6B 5GIRA 1HXYB 1EJOH 2VH5H 4Y4HC 3JSSA 4C56E 5JXAH 3DARA 4YQXL 5BVJB 2BVQB 2GW5A 3CVIH 1EJ6A 2Z31D 2YWYA 4XZUA 1S7RB 1QSFE 1EUTA 1MCPL 4PJBB 2QADB 5CIPB 4YAQB 3S7GA 4ZFFA 3BYYA 1JGVL 4XAKE 4PJHE 3D3VB 3WLWD 3TZVB 3ARFD 1F4WH 5D7JD 5JXED 5I19L 4YDVA 2JIXA 4PY7A 4BUGA 5HGHA 1HOCB 1KIQA 5L2KD 2I5YH 5KOMC 1J0JA 2OTWA 3T09A 4BKLA 4R9HA 1BX2A 4U0RC 5B39G 3L3IA 4MDIA 2NNAA 3HCVB 4FXGB 4U6VH 3ULUD 1LO3L 2DIAA 2XYCA 3FN9A 2UV3A 1NMAL 4LQFL 1SY6A 4JLRA 4QKXB 1JGUH 4G9DA 5F3HA 1FORL 3FB6B 2BC4A 4UAOC 1KENL 3DSFL 3SKNB 5C0BB 1P4LB 4GAJH 4HBCL 5EIIB 1MREH 3GIVA 1AGFA 4P46D 3FHAA 4LSSH 4PG9A 5TDNA 2GAZB 1RUML 4JRYE 1KPVA 4EVNA 2C9AA 3C6LB 1HDMA 3KPSA 2DJSA 5CP7A 4K7PL 3U1SH 2NW2B 5JA8B 2D03L 3RVUD 1G7HA 3BEVB 4GBXA 2C7UA 4LIQE 4I18A 4OB5H 1QHOA 2CO6B 4P99A 5C0EB 3IDNB 1UWGL 3F7YB 2R0LL 4GBXD 1MCWM 1JNHB 5ITBH 4NN6B 1VGEH 3RX7A 2AJYH 3RA7H 1CU4H 4ETQA 1TZIA 2DQFB 4KWUA 2MHAA 2NY4C 1FLTX 2M2DA 2X4QB 4FQCH 3ZZ1A 4AENB 3TZVC 3DO7A 2W91A 3CMGA 3QXAB 1R5WB 3QNXA 4ONHB 4PJ8D 2R0WH 3WL9B 4OCYL 2XKNB 2ZCLL 2PO6B 1U2CA 1ZHNA 5I18L 3I6KA 2HLAA 5CEZH 3C2SA 4M48L 4HJ0C 3CD4A 2XN9B 4JY4B 5KW9L 4RFOL 2H32B 4QY8B 3TGXA 1PZUB 4JFEB 5I16A 1C5CL 1K5NB 4OLWL 4HS6B 5ISZE 3L95A 2J6EL 1RJZA 1HNGA 1MAMH 3LKOA 2AI0L 4AL8L 3KYMA 5F7WC 3JV6A 1AJ7L 1ZVHA 2PF6A 5B4MC 3DV4B 1CTNA 4JPIA 1NCTA 1GGIL 4JB9H 3IJSA 1IQDA 3LKPA 5FHBL 3C6LC 2Q8BH 3BAEL 4FQXD 3BPLB 5INCB 3LQMA 3U0PB 1B0GA 2JB5H 3BFOA 3KWWB 1ZLWK 4GG6E 2IAND 1AY1H 4PJ9C 1TLKA 4JFDA 4LHUB 4JDTH 1TJIL 4HULB 1MLBA 4MB5A 1FFNB 3M17B 4L3ED 2DWDA 1LDSA 3RVWC 1ETZA 3FT2B 4JFDD 4NM4L 2HRPH 3QIWA 1T21A 3G5VB 4Z0XB 2J5LB 4O5LH 3CIQA 1K3IA 1S7UB 2FATH 2QR0B 4XP4L 1A1NB 4PGDA 2CQVA 4Y4KD 3AMKA 5C0AE 3HNVL 2MKWA 3EO9L 1T2JA 5GSVA 3VXMB 2PO6C 1T5WB 2L0DA 3QWOA 1ADQH 1KF9B 3PWVB 1JPGA 2XA8L 4RBPK 1S78C 3GSNB 1YECL 1BVZA 3MBEB 1S7QA 4Z6AT 3KR3L 4LRIC 1QYGL 1RUAH 2MSPA 5F6HI 1K2DB 1S9VA 3RL2A 1MFDH 1UG9A 3IDIA 4HJJL 5DJZA 3BSZL 2NQCA 2GT9B 2ZUWA 1BFVL 1YEIL 4N8VB 4ZNCD 5JQHC 3VXSD 4K3JL 4ODVL 4XPHH 2R0ZL 4TNWF 4HUNB 5A2JH 4WRLA 5SX5H 1BGXL 3AS2A 4PLNC 1UCTA 3E6FB 3VFWB 1ZVSB 1DQJA 1LK3L 1R3JA 3DROA 3Q1SH 1RURL 4FZEL 3BPLC 3F62A 2Q8AH 2FR4B 4NO0B 4OFIA 4K7PY 5ILTH 1GGCH 1JRHL 1OM3L 4AIZA 1QFWI 4J4PC 2VMFA 2IFGA 1JHTB 2IADA 4MGXA 4JQIH 1X4XA 2YSSB 2J5LC 3LKRA 2WBKA 3DVGB 4G6MH 2DQUH 1IILE 1J8KA 4CRPA 4IHOA 4EEEA 3OG4B 2QQQA 3GSRB 3SDYL 4GOSA 1NCCL 5DUPL 1BVKA 4KHXH 1MCHA 1AD9A 4W4NA 3JWDH 4MMZC 4K8RD 3DETC 4DCQA 1V05A 3V6OA 2VIRB 1Z9MA 2KZWA 5FUOL 1MHPL 5KTEL 3MBEC 4GKSA 4KPHH 3HG1D 4BQ9A 3EFFB 3FOMB 1BQUA 5DRXB 3KYNB 1I85C 4UIKH 3FQXA 1YMMB 3VH8G 1S3KH 5BV7H 2I9LA 4OCMC 2YRPA 1CVSC 4HUUB 4CN4A 5MERA 2X7LA 2ZCKL 1PX4A 4P3CL 2HMID 1QSVA 5BJTB 4YR6B 5LGJA 4P2RE 1WZKA 3W5MA 4NKMA 4DGVH 2JJWA 5TJWK 5F71A 3OKMA 4MXVE 3QA3A 3U4BH 4KDTA 2CRZA 3VXTB 2VLKA 3UZQA 5JHLL 1KSRA 4CDHA 3KPNA 1F3DH 2PCPB 1UFUA 1EVTC 1KIUA 1NGZA 5D1XC 5EH1A 3BP7A 3IAPA 1IAIM 3S8WA 3BPNC 5IBUB 4WEBH 5KSBE 1PEZA 2PW1A 5E2TL 3UJJH 3OX8A 4JQXA 4XMKH 3QIBD 4FHBD 1FE8L 4KY1H 5E5MA 5BO1L 1FVDA 1YEFL 4P59H 1QOKA 4X6DA 1D6EB 4JKKA 3K4AA 1U6AL 3MRIB 1HH9B 1U8LB 4EQ3A 3D9AL 2BOCA 2AERT 4HWNA 3KJ6L 3B2VL 4M3JA 4U1KB 3VW3L 3QFJB 3QJFB 4DVRL 2GFBA 4ZFGH 1A4JB 2AXGA 5C0IA 4FNLH 1OT2A 1ZLVK 2J6EA 2R0KL 1KJVA 3DYOA 4DOHE 1VKXA 3FN0H 4FTVD 1EGJA 1IC5L 2L7UA 1UVQA 1SEBA 4L4VD 1JF1B 4LSTL 1MCOL 3BKYH 2AKRA 4QXGH 5DF0A 1UKSA 3VG0H 4QEGA 4NFCA 4KHTL 2ADFL 1U0QA 4QRQB 4IRJD 5ANME 2E6PA 5DVKA 8FABA 4ODUB 1G6RB 1XCTB 5F88B 2HRLA 4V1DE 4E42A 1XFPA 1RULH 4PJBA 3ROLA 2APXA 2XIDA 4PYHA 1F58L 2QADD 1YYML 1FGNH 3PV7A 3C08L 4L8BB 4HK0B 5DD3L 5EZIL 5IFAH 1TXKA 3D3VD 3OXSA 5C07A 1DQQB 3TZVD 1JNLL 4GRWF 5C0DA 1WIOA 1AGEB 1PKQE 3M1BB 4Z78A 5F1NA 1NMBH 1JUFB 4QTHA 4HJ0D 3MFGB 1ZT1B 3OAUH 4O4YH 3WO3B 1OVZA 1YNLL 3O3DB 1HQ4B 1FN4A 4G3YL 1UJTA 4OQTH 3D18A 3H3PL 4D0CB 4HD9A 5JORA 3ZKMD 3TNMB 1MCDA 1IFHH 5C0BD 4PGEB 1JHLH 2JJVA 3VFGH 3OTTA 5B4MD 4O9HL 3WE6A 3LZFH 5MEQB 2XQYK 1N2RB 2V6HA 2X09A 4UQ3A 5EBWB 3IJYA 4OT1H 1I3UA 3C6LD 3EYOB 4BJLA 5DFTA 4NZDA 3WEXB 1PX3A 2OJEA 4HWZA 2Q1EA 4M1DL 3UYPA 5SX4I 3UJIH 3TH2T 2Q6WA 4PP1D 4UT6L 1V3MA 3SE3A 2GY5A 5JW5A 2H1PL 4PJDF 1RZ8B 1MJJA 3BHBB 3RVWD 5KS9E 2DJUA 1T22A 3QDAA 2BVOA 2EDBA 3SPVB 3UBXB 3S9DB 3A6BH 5DI8B 4P3DA 5IEHB 4MA1C 1MVUB 4LVNB 3DX8A 4KJYB 3RKDC 1DQDL 5L2JB 4GLRI 4PR5B 3L6FB 4KROB 4PS4L 4C55A 4YXHH 4QRPA 2DQCH 1OT1A 2YA2A 5E99L 3S4SG 2PO6D 3DUUA 4I4WB 3MNVB 1KTRL 1MFBH 4ZPVA 3GMOB 4Y16A 1TITA 1IAMA 3QUYA 1S78D 3SGKC 3BMWA 2XN9D 2VLMD 3HR5A 3VRLE 4JVWA 3MOAL 5F9WB 5IOPB 4JFED 2VE6B 1BBDH 5HGAA 4M93B 3HUJF 3QUKB 1NLDH 1SYSB 2DQEH 12E8L 2R2HA 5ALCL 1JWMA 1VCAA 5DD6B 4P2OA 4J23A 4UOW0 5DRNA 1A7QH 5INCA 4J1UB 1JWUB 2YD4A 3PWJB 1E27B 5E8EA 1XZ0B 4NQSB 4MNHB 3I6GB 2HT4C 5JOFA 4UDTA 4CVZB 4ONOA 4LHUD 1X5IA 4PJFB 3RWFA 5HGBA 1F4YL 1F3DJ 4WFGD 1ZXQA 5HYJE 3RX5A 2NW3A 1IGTA 2HVJB 5D7SH 3SE9L 4AQOA 4J3TA 1FPTH 1JZ4A 4PB9H 1KLFA 1CL7L 1YQ2A 2XNAA 3GHBH 4L8DA 3KJ4B 3CDYA 2O5XH 4DKAA 3VXMA 4LVNC 2CPCA 1RUKL 5E6IC 2G60L 4LHJB 1SM3L 1HWHB 2GKIA 4KROC 1U3HB 3FFCA 4XB8A 3MCG1 4DTGH 1QBML 5DYOA 4RAVB 3VXMD 4MAUH 4XXCA 4KVNH 5JOPD 3DURA 3N1PC 3U7WL 1QQDA 5FYKL 5T1KA 3DETD 2IGFL 1K8IA 1ORSB 4Y2DB 2XFXA 4RDQG 4YHZH 1DANT 4WY7L 2Y72A 4IRZH 1X4YA 2QKIB 4OCSL 5D7LE 2JF1A 2V17L 3MBED 2BMKA 5HVFB 5IEKA 4WJ5A 4YIQA 1N6QL 2N7AA 3KPTA 3DIFA 2PYEB 2WWMD 3O0RH 3ULVF 3VWJB 1C08A 4S1SL 4F7MA 3MROB 3BKJH 1CT8B 4OGXL 1LVEA 4LDEB 5EBLA 4Y4FB 1XF3A 1DBBL 2J4WL 2UUDK 1S7TB 2GI7A 5FCUL 1QBLH 5IBLC 2VC2H 2ZUTA 3KPLA 4OCLC 3KYAA 1UEYA 1A9EA 3D39B 3RQ3A 3U0WL 1LO5A 5DD1L 1FZOA 4XBGA 3SN6N 1A1MB 1OTSC 4NO0D 4PJHF 3H0TA 4LSRH 5CJ8A 1AH1A 1NUNB 3IU4H 1MJ7H 5I9QB 3V2AR 1K8DA 5IT2L 4DZ8A 1T1YA 5IB1A 4ZXBA 1TZGL 1V3LA 5GRXG 4UQ2B 1BFOA 3BD5A 5D6DA 3L5XH 4LSQL 1BEYH 5GGSB 2A6IA 1D9KB 2XG4A 5ALBH 2AABL 4OCRL 4EDXB 1BQHB 2NLJB 2XQBH 5D5MA 4KXZH 5DRZB 2DAVA 4RX4D 1J7VR 1MJUH 2IF7A 3V0WL 1U3HC 3WBDA 4JAMA 1XF1A 1RZFH 2OS7A 3I84A 3QAZC 5HYQB 2EE3A 4U6XA 1YC7A 3C09B 4Q2ZA 3WFHA 4GW5B 1HHJB 3PHQA 2ZJSH 4Y2DC 1FBIL 2E3VA 2YD8A 1BECA 1CFNA 3GSUB 4PJCA 2FHCA 2Z93B 4UIMB 6FABL 4I2XA 4PRPE 1W0YT 1I3GL 1P9MA 3LEYH 4HUUA 1X9QA 3FO0H 4PJIA 1YMMD 3VWJC 4YR6A 3ARBB 1M05A 2H8PB 5I1AB 4QYOB 1FDLH 3TNNA 3RU8H 2BRRH 3PABA 4X5XA 5C0CE 4JFQB 3RWEB 3M45A 5FF6B 3O4LB 1S7WB 4PY8I 4IBLT 3NCJL 4LASH 2AEIT 3RVTC 4DAGH 5DR5L 5GGQH 2MJWA 3K0WA 3DVNA 4DKEL 4EXKA 3E8UH 1WBZB 5I9QC 3UPCA 2WAHA 1T03H 1RU9H 3TA3B 5TF1L 5DJ0A 1IC1A 1IAKA 1D9KC 3RY6C 5E00B 3GGWA 3MRFA 3OAZK 1KB9J 1FCGA 1BIIB 4LRNH 1KCVH 4GUPA 1KTLA 4PP2A 5A40E 4JZJA 4K2UL 5F9OH 4F7EA 3HZYB 1VFOA 2MOVA 3LH2L 4GMTL 3RI5F 4BSWB 2VDNH 2CLVB 4NKDA 4WI5A 3C09C 3KNBA 1YYLH 5DJXB 2OSLA 4HAGA 1OW0C 1DCLA 4Z0BH 1IAIL 5C2BL 3MUHL 5CBEB 3QJFA 3WXVL 3VGDA 5F3BA 2ID5A 3DRTA 1AP2A 1JGLL 1QLRA 2BCKA 4MWFB 4P2CG 3QFJD 3FT3A 1CYGA 3QSKB 3GUTB 1I8LC 4NKOB 3TN0C 5JR1L 1ZA6B 5B8CB 3CH8A 3LRSA 1J8HA 4U1SB 1MFNA 3O3UN 4KZEH 1NPUA 3G6DH 2V7HB 3VFVB 2DLEA 5ICZB 3LS4L 4G7YH 4BH7B 5ID0B 1IKFL 2GHWB 5MENB 5AZEL 2LAAA 3QHZH 3MGAA 3NFSL 2FH6A 2Y06H 4GRWB 5HHOB 1EA9C 1HEZA 2FO1A 4NGHL 5DEFA 4QGTA 1H5BA 4OM0H 4NYLB 1BD2B 3QBTB 3PWUB 1FJ1A 3TA3C 3MRLB 5MEPA 3WJLC 3H42L 1QFUL 2AJUL 3HE6C 4E41B 3WV0A 4D0BB 3CXHJ 1KELL 2AVGA 4BZ1L 5TH2B 1EXUA 1A0QH 3CVHH 3HC4H 3WFDH 1EEUA 3MRHB 2GSGA 4G8GA 1CD1A 1ZWIA 2DIJA 1CLCA 2EDNA 1DTUA 3HN3A 5F72S 5IESH 1AGEA 1TDQA 1UKTA 2V9TA 4JO3H 4TRPL 4UILH 3RKDD 3O81A 3EO0B 1EO7A 2G5RA 1UCBL 4LKCA 1I1AA 2VWEC 3BWAB 4F57H 4J3VA 3E1F1 1CD9B 1JUFA 5DJAA 4LU5L 5E2UH 1HWGB 3EJYC 5DD5L 2FD6L 1B0WA 2B5IB 2DLTA 4XNZB 2XT1B 4YDIH 3QEHA 5AG8A 2AJVH 2FHBA 3ZTNL 2YBRB 1FNLA 1R3HB 4I0CC 3PGFL 2AJ3A 2VLRA 3FQNB 3TBVA 2FJHB 3L3KB 3O8XB 5B8CC 4J3WA 3D0VA 4U1IA 3O3EA 3VI3E 2R29H 4JVPA 1NC4A 4FQJL 3Q48A 4KMTH 3ZYZA 4WW2F 4IDLA 3VG9B 1F8TL 1RJLA 3O2WH 4HXAL 3GSWB 1Q9WA 2E7CA 2BFVH 2VERN 1T04A 5EO1B 4ONGH 1P7KB 1PG7X 3V4PH 3DPBA 4LVOB 1MF2H 2F53A 5E5UB 5F7EH 1QNZL 1WJ3A 2HT4D 3MXVH 1A5FL 4TVSa 1OSZB 5LAXB 3WNNA 4Z7WB 5IJVB 5C8JB 1WZ1L 4BK4A 1XIWC 2NCMA 3VFNA 4JVUA 4XPBH 1LP9E 3PV6B 4XWOD 1JHKH 5AG9A 1UH2A 1QRNB 2FYYA 3RWGA 4WWKB 4X6FB 2P8LB 3DLQR 4KAQH 1NFDB 5ERWB 4P57B 4KROD 4BFGA 3AAZB 3TPUA 2EC8A 5DJ6A 5DJCA 4W70A 3VE0A 4DN3L 2B5IC 2CKBB 2DTSA 1DUZB 4HZAA 3SO3C 1UXWA 3QZWB 1RHHA 1FZKA 5F7HA 3BRFA 5J1AB 1MAKA 2MPAH 4H8WH 2VJXA 1U8KA 3QUKA 3O8XC 1DL7H 1IBGH 1AI1L 3X14B 5HHXH 5DJYA 1X5XA 4G7VH 1HIML 4YZFE 4A6YA 3VG9C 1CIUA 5EZJA 4R3SB 2BX5A 5A2FA 2FIKB 5HGDA 3FRPA 2VLJB 5B38B 2QTEA 5IBLD 5KSBF 2IBGA 4G8EA 3LEVH 2HJLB 1A6AA 2ADGA 5KVMC 1T7VA 3O6ML 3MACH 1IC7L 3HLAB 4LEOB 5IVZA 5J6HA 4RWHA 4WCYL 5DJ8A 1ORQA 5GJSL 4X8JA 4KK6D 2CDEA 2V2WB 5FK9A 4M6ML 5GGTL 4LSVH 4PJ7A 3OPZL 4C56B 3MLUL 1FNSH 4LQ1A 5BRZA 4WWKC 2CDFA 5J1TC 1FO0B 4L4JA 3VXPB 2YS4A 4D9QD 1U3HD 2F58L 5EC1A 1QSFB 4KI1A 4NO2A 5E9DA 1MPAH 4K23H 1KB9K 2QKIA 2WUBL 1L4IA 4PJHB 3OMZA 4N8PA 5GISH 2PW2B 4Y2DD 4JGMA 1KB5B 4ODTH 1DR9A 2WK2A 1KBGL 2X4RA 3T0BA 3HZMA 3RWDB 1FAIL 4L9LB 1DJSA 5IB4B 5J56B 4Y4FA 2PYED 1HHIB 1W0VA 2OL3L 3CC5A 3VWJD 1I4FA 1WBYA 4O2EB 3K4DA 4FQLH 2YRZA 4Y4FD 1CDJA 1VFMA 2QSQA 4JM4H 3CCHB 4PRAB 1LE5B 2E27L 4B53A 3DXAE 4LKXA 4DN4L 2YPKB 5L9DL 4Y1AA 3D39D 4UV4H 1RZGB 1VENA 2ZUUA 2AGJH 3RVTD 3IDMB 1D5XB 1PYWB 2NXYB 3TO4B 2HLFD 2IQ9L 3SDAA 3RTQB 3WFEH 1CK0H 2RIKA 3SDCB 4R97C 3TYGH 4EDXA 4XCEA 5HHNB 2F5BH 2DM2A 1D9KD 1DSFL 4M1GH 3UTPE 3WDIA 4CBPA 3WHXA 1M4KA 2OXHA 4LSPL 5EOQH 2VXUH 3MLVH 3SBWA 2D7TL 5FHAH 4WEMB 3DV6A 1FZMA 2ZSWB 1WWBX 2DF3A 5BW7A 2YPVH 1KG0A 4WDIA 4HK3J 4MNGA 1TJHL 1MJ8L 4KVCH 5KSAB 2Z91B 3MV7E 4HG4K 2B4CL 3CXDL 2EXYC 2H26B 5SWZA 1P4IL 2IG2H 3FQRB 2ZOLB 4JDZA 3VDAA 4ELME 4X6CE 4ZFOL 3IRPX 3J8F7 2XTJB 4GKNB 1E4JA 3ARBD 3ZE0F 5IB2B 5E4EB 3QEGL 3V6ZA 5DMIH 1OP3H 4X8XA 5HHPA 1NDMA 5K9OB 3X11B 2AEPL 3D5OF 4AQ1B 3NZ8B 1DBJH 4R4BB 3O4LD 2DQTL 2P43B 3Q5YA 2XPGB 4BQBA 1WBZA 5ISZB 3O2DL 2LU3A 1P7QA 1XGUB 5JOEA 5DJDB 1WGOA 3TO4C 3UDWC 4Z7UE 1UJ3C 5FUCE 1TMCB 2EKSA 3L3DB 3SDCC 3U7YL 4R8WH 3TA3D 1JRHI 3LV3A 3TIDB 2JELL 1BIIA 5SX4H 4GG6B 3ULVL 3B6SA 4ZTOH 4M61B 4HPYL 2EDEA 2Y5TA 4NJ9H 3RGVA 2EH8L 3R8QA 3BZEB 5B3JE 5F7YC 3LB6C 3FB8A 4YHKL 5DJXA 3T0EC 4TUOB 2JJSC 3F58H 2VUOA 3HNTL 1CICB 1NLBH 1E4KC 3K1DA 5KSAC 1KOAA 2VXSH 3INUL 4G5ZH 3I9GL 4ZUSB 4L1HA 4X9GA 5C0AB 4GLRH 4Z7OE 5JIKA 2N1KA 4ORGA 3FONA 1GIGL 3EJYD 3ESVF 3DX6B 4QXTA 2R4SL 3C2AL 1X5JA 2XTJC 1QO3B 1E6JH 5CJQL 2X4PB 5CSZA 1OTTC 4JFOA 4EN3B 4F58H 4U1SA 4P5TB 4Y5XA 5ICZA 5IMKA 1EHXA 1RSFA 2PTVA 4ERSL 2YK1L 1DBMH 3A6CL 4U49A 5E2VH 4UUJA 5MEOB 2CJUH 1DN0B 1DP0A 1U8HA 4APQA 5GRYA 2P5WE 5B38G 5MEND 2A6JA 3EIFA 5FO7B 5HHOD 3MLZL 4HMDA 4KJQC 3TVMA 5FDYA 3V9FA 4HEME 5D2NE 5LVEA 1BD2D 1RQ5A 5FDWB 2YA0A 4G6FB 4XNYH 2OXGA 1LNUA 4TN9A 3OR7B 3T1FA 2AV7A 4E41D 4PD4J 5EBMA 1DE4B 3DMMA 4X80L 3MBXH 4X9BA 3U0TB 1G9NC 1ZS8A 4L1DA 2A9NL 3AS0A 4WW2B 5IB3A 4YO0B 3BWAA 4GAYB 4BSVA 5T3ZE 1NBVL 1NL0L 3UPAA 1CICC 3Q2CA 4OIBA 3LOWA 3HPJB 2B0SL 1A02N 3QHFH 1JNJA 4N8CL 2WM0A 4PJDA 2A2QT 4OGAD 4TQEH 4X98B 3W9EB 4NO5A 1KJ2H 1Q8MA 3K81A 4EN3C 4AG4L 2A6KA 2OL3A 5C0JB 4P5TC 2QSCH 1KN4H 4HCRL 3HZKB 1OAUH 4MA8L 1XGYH 3ZHKA 1NAKH 3GSWA 3QYCA 2VZVA 4HZLB 1WAAE 1GZQA 4XC3L 1QR1B 4Z76A 1I7RB 2A0LC 2AXHA 1O7SA 2ITDB 4IMLA 3EYQC 4U1JA 2F9BT 2DQJL 1MFCL 1KIPA 4HUXB 1NEZG 5E5RB 4OZIF 4P2RB 1KEML 1AGBA 4KK9C 1UADC 5LAXA 1F11A 1SHMA 5C8JA 1N64H 1IGFH 1RIVL 3VDCA 5FUZL 3EYVA 1LILA 3FB5B 5EU5B 4O2CB 5C9JB 2Y23A 1BF8A 2VB5A 3HUJA 3LEXB 5J3HC 5TE7H 1EVUA 3PV6A 3WN5A 1OAKH 3MRCB 3NABH 5HSFA 4WNQA 4XPGH 3UROR 5ACLA 5DK2A 4XPAL 3S88L 1JK8B 1QRND 4IS6B 4WWKD 2EDQA 5EOCH 2WANA 3OF6D 4Y19A 2DI9A 4TUKH 1LDPH 5H35B 5I1GH 2OBGA 4YHLH 4FQHA 2FHFA 4ZO8A 4WIQA 5J1AA 4ZFOA 4ZG1A 4GSDH 3VD9A 3ARDC 3P0VH 3X14A 4YK4C 1S9WB 2NMSA 4XWGH 5B39A 1INDL 4NQEE 3NIGE 2X89D 3P9MA 1BQLL 3EYUH 3WKMH 3LQZB 3EOBB 4U1NA 4YHIA 1OGTB 1NGWB 4JJHA 2CMRL 3WXWH 3V0VB 2OZ4H 1NCUA 4PRIE 5D70L 4EOWH 3FL7A 3PWNB 4N0UE 1SJHB 2IQAB 2VLJD 3R1GL 2R1YA 4DOHB 3ARUA 3MRPA 4ZYKB 2ATKB 4Q6IA 3BGAA 3WD5L 1SEQH 4F33B 5IK3A 4PLKD 1B2WH 3QWRA 3Q0HA 3MLYL 3NOIA 4XGZB 1D5BA 5D1ZB 5JZ7C 1J0ZA 1EJOL 3IXAB 2DM7A 2J88H 1BAFL 1YEHL 5KVFH 4X4YB 5DQJB 2ZG2A 2X44D 1OAYL 3GO1H 5C1MB 5ANMB 4Z77B 3RWCA 2W59A 1CD0A 3U83A 3LHPH 4YXLH 4IM8A 4V1DB 1CBVL 4AH2B 5L6YH 1QSFA 1RZ7H 4C56D 1F4WL 2PUQT 3LKQB 3DX9A 3X3GL 1CFTB 2D3VA 1O5DT 4Z8FL 2IBBA 4OKDA 4E0RA 1IJ9A 4PJHA 4RGNC 3LVEA 5DC9B 1QSFD 2DRUA 4HWBA 3IU3B 4M5ZH 1TTUA 5L0QB 1AO7E 4XAKD 3ES6A 2JB6A 3GHEL 2BNQE 5GSRA 2D7QA 2P48B 5IB4A 3P4OA 1IEHA 2XQYG 5FO8B 3HC0A 1PKQB 2O61A 2YC1B 3JVGC 4ODSL 3QQ3B 5TPWH 4ODHL 4GAJL 3PIQA 1C16A 1ZE3C 1J5OH 2VZ3A 2ZOKA 4LVHB 3ARYA 1T89A 4MB4A 4ZOBA 2AXJA 2ERJB 1PYWA 2VISB 3RTQA 5F1SA 4JRYA 1DFBL 1N5AB 3CFKB 3THML 3KYOB 2NXYD 3G6JE 3TO4D 1IL1A 2IPKB 5J06A 2W0KA 3R0NA 1DVFB 3RTQD 2A6DB 1Y18B 4DFHA 3SDCD 3BP6A 2FX7H 5KANG 1A6TB 3FFDA 3VXUB 5ITBL 5FA3B 1VEPA 2LABA 5A2IH 2D0GA 1RJYA 4FS0A 4Y4HA 4I48B 4HPOL 1QVOB 4WGVB 5FYJE 4ALAH 5KS9B 1CL7I 1JV5A 2X4NA 4GXUM 4M4PA 5IR1B 5TDPA 5ADOH 1A7RH 3FAXA 1IZJA 4PD4K 1GAFL 2J3SA 5KSAD 1F2XK 4W6YB 1UA6H 3RVXC 3UZVB 5CEZL 2J7LA 4QRUA 3MZGB 3H9HA 4GKNA 5FB8A 2Y36L 4U7SA 3AREB 1OY3B 2NR6D 1VEOA 3W11C 4FP8L 1BPVA 1ZGLB 5BS0A 2X9YA 2XTJD 1ONQB 1KJ3L 1OWWA 4U31A 3BVNB 3TBSA 1F97A 4JJ5B 1BJMA 4OZGE 3GSNL 3MNZB 4P4KB 1BFSA 4R4BA 1OP5H 3U46B 4CMMA 3S5LG 4OCXL 2ERJC 1XR8A 4OLZL 3PNWB 3GRWA 3VXOA 1J0KA 3ZYJA 3MQIA 4HIEB 5ISZD 5C0GA 1ITBB 1ERNA 5BOPA 4Z95H 4KJQD 4U05A 4NT6A 2VABA 2NZIA 5I73C 4KJWD 1DVFC 3K7UA 2R2CA 1D5ZA 1TFHA 3GEWB 1UACL 4J8RA 3NCCB 5DMGC 1JGEB 1MCWW 1ACYL 1F3JA 3G9VA 4MD0A 3UX9B 1NFIB 1FL5B 4FQQB 2FATL 2ZZUT 1JIBA 1LEIB 3NFPA 2E7LC 2DQIL 2I26N 3L3GA 1I8IA 1WITA 5JIIA 4YQXH 1R5VB 3V5HB 5C0AA 1CICD 1HKFA 4M6NH 1ND0B 3KPQA 5EOCJ 1ADQL 3L5IA 3RWIB 5F8RC 4OFYA 1FYTE 1MCPH 1NCNA 3U79A 5GS1B 1DEEB 4JY6A 5C0AD 4DGIH 1JGVH 3V52H 3ARQA 5ESQB 2D31A 5FM5M 2ENSA 1NAMB 5HYSB 4O2FB 1VFAB 2HP4A 5DO2C 2HA1A 3MUJA 2M26A 1I9JH 3RHWK 4EN3D 3EDJA 4P5TD 1P69B 5H94B 4KGJA 5M94B 1ZSDA 4XPHL 3FQUB 1DN0A 4P4KC 5D7LB 4IMKC 5IWLC 3VH8A 4KDWA 3ZL4L 1T1ZB 3KPRA 5DQ9B 3I02A 1LO3H 1NMAH 4LQFH 1R5IB 3LQAC 2H2PC 1O7VA 1OD7A 4JANA 1IZKA 1FORH 2EIEA 4CUCA 1KENH 2DBLH 1U8OB 1JPST 4HBCH 4YBLB 5IQ9B 5INDA 4KK9D 1XGRA 5C08A 4FXLA 1HYSD 3KPSE 1EAPA 4G6FD 2YD1A 3FB7A 4HK3N 1RUMH 2DTML 4K71C 3GJFK 4WW2A 4HKJA 4G6ML 4PJ9A 2DQUL 3MLTB 4K7PH 5EOTA 1N59A 4OLUL 2WINB 4P2QA 15C8L 3P4LA 4GAYA 1YEGL 2D03H 4OZFG 1HQRA 1QLFA 4OCWL 4RISL 1AFVL 1IGJA 1UWGH 4LNRA 3MRRB 3NBNA 2R0LH 2BSTA 1B6UA 5GS1C 5D96B 2ESVA 5HDLA 4NZUL 2VAAB 4URTB 4D9RE 5AD0B 2EDHA 2IWGA 2JLLA 3QWQB 1PKOA 1IAII 5T3XD 2Y7QA 5HHQA 1QFPA 3G08A 4OCYH 5A43C 2A74A 4F9LC 3O3BA 5I18H 1QR1A 1V7ML 1AGCB 1XGTB 3HE7A 5E94B 3IAGC 2YMXL 3CFCL 4M48H 1ROWA 3T4AB 2M1KA 5KW9H 4RFOH 1OAXL 1D7FA 1C5CH 3U36A 4OLWH 3SDXA 1HNFA 2YKLL 1M71B 1T3FB 2YPLB 5C0CB 1B6DA 4AL8H 2AI0H 1HH6A 2CRYA 4P2RD 2XOTA 2CLZB 1AJ7H 3WKNA 1N8ZB 5JZ7D 2DL9A 1IM3B 1K85A 1IGIL 3CPLB 4KQ3L 1GGIH 1CE1L 3JZ7A 5FHBH 3NACL 3BAEH 4Y5YC 5I1JL 1LHZA 2Z9TA 1YMHA 4AT6A 3QFDA 2GCYB 3TJHC 4U6TA 3ARGA 4PRNB 1AXSB 4J4PA 4OZ4B 1JTOA 4M8QB 3IFPB 1G6RL 4ISVB 2XG5A 5KSBA 1K4CB 4P59L 3UPRA 4PJGF 2R23A 5KAQG 4NM4H 3LY6A 2E9IA 4J12A 4DJMA 2J2ZA 4LPCA 5CMAB 1OWRM 4G43B 4P5KA 4XP4H 1MELA 2GTWA 1S9WA 4KRNA 4P2YA 3SKUD 2E8ZA 3QPQD 4JO1L 1IEAA 3HNVH 3EO9H 5C0FB 5GRWA 1XF5B 4Q0XL 4WU5B 5FGBC 3VJ6B 2VITB 4KDVA 4S2SA 4FFYL 3QI9C 4RGMC 2XA8H 5EU3A 1DANU 4TSAL 3RDTB 4N0FA 3WUWB 4AEFA 5LQBL 3QQNA 1YECH 4RMSA 3VD7A 5I75C 2VDPH 5IHZB 3KR3H 3UO1L 1FL3A 2BNUA 4F33A 1BHGA 4HJJH 3BSZH 3PHOB 4UV7H 1BFVH 2CDGA 3MRQB 3VWKB 1YEIH 3RY4A 1YN6A 1X5GA 3O41A 5D1QC 1IGML 4KI5F 3RWJA 4JFYA 3RNKA 4ODVH 4U1LB 2R0ZH 2E6QA 2A1WH 5D1ZD 2APFA 1BGXH 4W81A 2AW2A 4MDJB 5KG9A 2JCCF 1NH6A 1RULL 2VZ1A 1OTUC 1RURH 4FZEH 5FOBA 4Z7OF 2I24N 3AM8C 4KRLB 5J4MA 3CUPA 3PP3H 4RFEB 4JZOB 1JRHH 1FGNL 5D1XA 3LKNA 3LKQA 1OM3H 1CTOA 4NQDA 4V1DD 5E95B 1FFOA 5I17A 3WJJC 4MJIB 1H3VA 3MYJB 4BZYA 5IKCA 2KL6A 1ADQA 2VL4A 4POYA 2KUTA 1T1XA 5HY9B 3SE4A 2R15A 3SGEI 1CZ8L 3JTTB 3P30L 3RIFF 2ADJA 5CKGA 3RJDA 3VRJA 4F2MA 5DMJB 5JLZB 3RVXD 3W39A 2VL5B 1T0MA 3MLRL 3OAUL 4O4YL 3UTOA 4ZFZB 4JM2C 3SDYH 2OLDA 3W11D 5CD3A 3V6OE 4LSUH 1UQSB 4N68A 1NCCH 3UCRA 5I1LB 1ZT4B 4LLUB 4NKIH 4ZO9A 1MH5B 2UZXB 5IUSA 3OKEB 3RDTC 4IOIA 3QDMA 2BERA 5ENWB 5FUOH 1S9KC 1MHPH 5KTEH 1JHLL 3QUZB 1MHEA 5KVEL 3FMGH 1YUHA 2WIMA 5KSVA 1U8MA 3TV3L 3D85B 3D48R 5GRUL 3VWKC 4KKAC 3EJZD 5TFSL 3T0AA 1SBBA 2QQNL 4N0CC 4P3CH 4NQCE 3C5ZA 3OKKA 1WFNA 3W9DA 4I8DA 4F7TA 5EPMA 1DVFD 2VSDA 5JUEL 3HZVB 5TF0A 3ETBF 2VLKE 2AJSL 3O6FA 4LPWA 5DMGD 3GSVB 1PAMA 1T83A 5A2LH 1EV2E 2DI7A 5JHLH 2HVKA 2ADIB 5JMRA 32C2B 4ZPTA 1BZ9B 3W0WA 4PGZA 3SGJA 4PGCA 5CJBA 1NGQL 2DQCL 1TTFA 4QHMB 1PBYA 4FFZL 4I77L 5A16B 4WFED 3O6LL 1NCWL 4WV1C 2W0LA 4U1HA 5E2TH 3VGAB 3GI8L 2FECL 2OR7A 3T3PE 4X6DE 1LP9B 4P3WA 1ZGLA 5F70A 1FE8H 2XWJB 3DHJA 5BO1H 2PXYC 3ARED 4WUUA 4ZAKC 1YEFH 2W1NA 4M4RA 3CH1B 3WNLA 1KCUH 1U6AH 4H0IA 4ZQKB 2AK1H 3ELAT 4AEIL 4EIZC 5DO2D 5IP4A 1S9XA 1PZ5A 1YEKL 4M62L 4XCNB 1N26A 2DWEA 5I1HL 2MQCA 5FECB 4LLDA 3D9AH 4PIRF 2BSED 3QUZC 4P4KD 3JTSA 3KJ6H 5F96L 4F7PB 3RHWF 4LP4A 3B2VH 5F93C 3VW3H 4KKBC 4DVRH 2X1QA 4P5MB 4L4TA 3V5KB 1VSCA 2R0KH 3AGVA 3T65B 2BHZA 2EO9A 2H2PD 4HS3B 1IC5H 1YPZF 3X13B 3ABZA 1JYWA 4O02L 2C1PB 4LSTH 1MCOH 4HFWB 1HHKB 3B9KC 5T1LB 1YNTA 4OQ1A 1EEZA 3N9GL 4QXWA 4XCCL 2FWOA 4KHTH 3M07A 4NKQB 2OR8A 3HI6L 3ZKXC 5HYJA 2EYTB 5HYFA 3E6HB 4EUPH 2EEAA 1MRDL 2IH1B 1NGYB 3NIGF 2HT2C 5SWSE 4F3FA 4PTTA 3MRMB 3F5WB 3PL6B 4KVNL 1CGUA 3O3AA 2CGRL 1VPOL 4QXUL 2I60L 5C07E 4F15B 5HYSA 1F58H 1I1YA 3C87A 2C3VB 1YYMH 1VFAA 3C08H 2ZUQC 4MD4B 4NFBA 1R3KB 5DD3H 5IMMA 1FVCB 1ED3B 2VOTA 2W9LA 4I0PB 1N6VA 5C0NC 4GW1B 5HYEA 1K6QL 5BQ7B 4NRYB 5DQ9A 3AY4A 1X5YA 3EOTL 4V2BA 5D7LD 2W9EL 2C1OB 2APBA 4LCCB 5K9QG 4G80A 4LSDA 5IMOB 1YEJL 4Y5VC 5CEXB 4ENED 4G3YH 3UTQB 3QXVA 3H3PH 4EI5C 3KPMB 1INQB 5DHYA 1M7DA 1NGXB 3LSOA 2X9WA 2DBJA 2IMMA 3DXAB 5JPNB 1LD9A 3JWOC 5TE6H 4O9HH 2GJZB 1OP5K 2BSRB 3ROOB 1B9ZA 4MAYB 4XVJL 5IGXL 4M1DH 4JPVL 2RFXB 1B3JA 5KVDL 1L7TL 3VFUA 4ZODA 5HHVL 2FLRT 2H1PH 4PJ5E 2WLYA 5BOZG 5CGTA 2OCFD 4U7MA 4JFFE 4OZIA 4WHDA 3SDDA 4CGTA 1Q9LB 5DT1L 4F15C 1SVCP 1U8PB 2WLZA 1CE6A 5ESAA 5HPOA 5E6IA 1TZHB 3B9DA 4X6EB 5I76A 4QHUB 3BXNB 4M9OA 1DQDH 2N4IA 4PS4H 3OXRB 4OQTA 3VFRA 4TVPL 3MV7B 1AGCA 3FOLB 5E99H 3RAJL 3ZSSA 1II4E 4PRPA 3G6JF 1CCZA 4ELMB 1IGYA 4LLWB 4X6CB 1XF2A 4N9GA 3REVA 1KLGB 4HJGB 1EDQA 3FZUC 5T1MB 2ARWA 3MOAH 4OF7A 3L3HA 4UTBL 5KVGL 3QH3A 1FNAA 1LK2B 1N8ZA 5J6GB 2Z8RA 5IROC 5JQ6L 2YPLD 5C0CD 5IHBA 4TUJB 12E8H 4R7NB 5ALCH 2FJFA 4K3DL 5JW4Q 1MHHA 4RA3A 3RPKA 1GHFL 3MV9A 3QB7C 3E3QC 4OZ4A 3C5JB 3WNMA 1BLNB 4M8QA 1OTUD 4X6BA 4HGKC 1BOGB 5F97E 4Z7UB 2XACC 1R24A 4WHYH 3SJVB 3U9UB 5F9OL 3MUGB 5ETUB 1HSBA 4S11A 1F4YH 2ED8A 4HX1A 5JHDA 2OR9H 2V5YA 2HJKB 5GGSY 2Y4SA 4QRTB 1HCVA 3T8XA 1IEBB 1IGCL 1CVRA 3HAEB 4OZGF 5E8NA 4Z0BL 4H5SA 3CJJA 1U58A 3I2CH 5ACZB 4PRDB 1T7WA 5FA4A 3F7QA 1Q0XL 1RUKH 2G60H 1SM3H 3P40A 3SY0B 4KC3B 2PN5A 5C09E 1QBMH 3P3YA 2G5BB 4PV9B 3TJEL 3WUWA 1T0NA 2Z4QA 3CLEL 4LK4A 5FYKH 3S34H 1WCQA 2IGFH 2IBZX 3G6DL 3RDTD 4WY7H 4G7YL 4OCSH 4M03A 2V17H 2APWA 4OM1H 2R69L 4L3CB 1FRGL 4R96B 1S8DB 1EBPA 4CW1A 2MQ3A 4E5XA 4U1LA 4S1SH 4XCYB 3B43A 4OGXH 3VWKD 2V2XA 1DBBH 5BZDA 5FCUH 1GJIA 4X83A 3VRIB 4U2ZA 2DLFL 5T5NG 2DYPA 2O5YL 3RY5A 2I9TB 4QRSB 1WF5A 3B8SA 5IF0A 1AKJA 1EFXA 1KTDA 1W72H 4OLXL 4F37F 5D2NB 5HVWA 4MHHG 3U0WH 5DD1H 4L8CB 2UYLA 3CVHL 3HC4L 1G1CA 3MV8A 3QIUA 4I3GA 5DVMA 5IT2H 4POZC 1TZGH 3T3MF 1GC1C 2BSSB 1QEWB 4MJID 3I3BA 4LLMA 5D5ME 3MNWB 2ZSVA 4LSQH 1WZLA 2EDOA 2AABH 4OCRH 4HDIB 2H6PB 3F65A 3HB3C 4ZFZA 4QHNA 5EORH 3ZE2E 2EDWA 3ZDYE 2AJVL 2UWEF 3L5WB 1ZT4A 3P77A 1VADA 3V0WH 5E2JA 2Y9RT 1UWXH 1QA9B 2R29L 4OGYL 4I2XE 4X4MA 3VGBA 1D5IL 1FBIH 1URLA 2CKBL 1I1FA 1BZQK 1FIGH 4PJEB 1YDPA 3GIZL 6FABH 3QUZD 4H1LB 1MQKL 1QSEA 1KACB 2XWTA 3TN0A 3Q6FB 5DURB 5GZND 4F9PA 3V4PL 4EDWL 2RHEA 4QRRA 3HFML 5DEGA 1UM4L 5JA9A 5DVNA 2W07A 3HRZA 4EUPG 3WHE0 3MXVL 2QQLL 5KAQF 2FB4L 1D5MB 1LWRA 3NCJH 1CDUA 4DQOL 5DR5H 4HBQA 4Q9CA 3WFBL 4X7TA 2B20A 4DKEH 2F74B 43C9B 1BBJA 3BUYA 4KRMB 1I9EA 4DK6A 4O00A 3RNQA 2I07A 3C60B 4X9FA 1ES0B 2Z35B 1EHLL 5TF1H 4A2LA 4TOYL 5IIEA 2EZ0D 1G7JB 2W60B 2A83B 1HN1A 1R3IL 3VFOA 2RR3A 3NA9L 4ZUWB 4BQ6A 4NUJB 3RZCA 1DUYB 1F5WA 4K2UH 2VDRL 5MI0B 4QOKB 1YN7A 4P23B 2PYFB 3LH2H 1FO0L 4GMTH 2P1YA 3QUMB 2VDKL 3GSOB 1CDYA 3OG6B 1LEKA 1F6LL 5FECA 3PGDA 1N7ML 3QO0B 4YHOL 2EDKA 1MUJA 1IAIH 2NY6C 3Q3GA 5DC4B 1P2CB 3U82B 3IDYB 3G6AB 3O11B 4KKCC 4XX1E 1JGLH 1KB5L 1L0XA 4AK1A 5TGBB 5E7BA 3GJFB 1J8HE 4NQEB 4N0YH 3CFIC 2VZUA 3P9LB 5JR1H 3OB0H 3V6FB 1JPFA 2E7HA 4PRIB 1NBZA 3PUCA 3EDKA 4N0UB 35C8L 1CG9A 3H7BB 3LS4H 3QEQA 4HH8A 1A6VL 2R1XB 5LWYL 1A6PA 3O6KL 1QPXA 4RQQB 1FGVH 5T1LD 4B7IA 3BKCL 2EH7L 5AZEH 1S7SA 4R6UA 3UAJD 4O51B 4H25B 4NGHH 1Z9OA 2HN7B 1DQML 1UYWL 5DUBA 4HSQA 4Q7DA 4J3XA 8CGTA 3O9WA 3C60C 2SEBA 4MCYB 3F5WA 1WZMA 4K07A 1TCRA 3T77A 3NIFE 3H42H 5IBTL 2AJUH 1XIWA 1A7PL 5FYKU 2WBJA 4G8GE 2HAZA 5KSUA 1A64A 1KELH 1HYRC 3EYFB 4G8FB 1MPAL 4G6AC 4BZ1H 3PL6D 3P11L 3AS3A 4NNYB 1R3KA 4FN0A 1FFPB 2OTUB 1BJ1H 4M00A 3K2UH 5FYKE 3CZFB 4P4RA 5SWQA 4P23C 1XAUA 5DMYA 3WYRA 2YZ8A 4TSBH 1P1ZA 1INEH 5DA4A 4TRPH 2R2EA 2GUOA 3U30B 1UCBH 1CFVL 4XNXH 4YDLC 3MRDA 3U6RB 4I0PD 4E9LA 1AO7B 3MCLL 1G7PA 2OK0L 4LU5H 2BNQB 3TLRA 5DD5H 2FD6H 4FFVC 3QHTC 2VLRE 4HFUL 3U48A 2X9XA 3OHXB 3ECBB 3ZTNH 3PGFH 4KKLC 5I1KL 1UM6L 4PGJA 2GSIB 4XBPB 2AGJL 5DVLA 3EGSA 4CADB 3KLAA 5MP6L 1FV1A 1G84A 2VQ1B 1F8TH 1Q9OA 4KUCF 4HXAH 4H26B 4LPTA 3DXAD 3TYGL 3RL1B 1I8KB 2FZ3B 2F53E 3LN5A 1EAJA 3CVHA 3GZKA 4HGMA 4M1GL 1U8QA 1JN6B 4HUVB 1DLHA 2NX5E 3BRDA 3R0MA 1RJCA 2I25N 4MAYD 1JFQH 3AVEA 1KT2A 4XH2A 3MLVL 1QNZH 2WQ8A 2EC9T 4CMHC 4PBXA 5J0BA 1A5FH 3MJ7B 3UTPD 5LJYH 4C4KT 3DVFA 2ZPKL 3NCYP 2EDJA 5DQDL 4NC2B 3OR6B 1G9NL 5IW3A 1Q94A 4S0TD 2C4FU 1T4KB 3EO1B 3F7VA 4ZUVA 1MCLA 3AC0A 3MRKA 3OQ3B 5EO9A 3VFPA 4UDUB 2JK5B 4FOMA 4MNQA 3U30C 2HFEB 5IG7A 3MV7D 3IVKB 3EUUA 3IDGA 2HKFL 1KLGA 4DKFL 43CAB 5JDSB 4KKNA 1MI5E 4WU7A 5DMIL 3Q5OA 5JPMA 4K7FB 1NC2A 5ICYB 1OAQL 4R7DB 4PJGA 1U91B 4OUUB 2HFFB 3VGGA 1RK0B 5GRVL 5DUML 3VFTB 2WP3T 4H1LG 4U1MA 2V7NB 4ZUTB 4I0KA 1JPTL 4OBSA 1ZOXA 3C8DA 1AI1H 2PTTB 3D25B 4OZGB 4RMQA 1HIMH 4XNQA 5FKPB 3RRQA 3VD5A 4TNVK 5IW6B 4NDMB 3ULUH 1BLNA 5I66B 4NC1C 1HZHL 5CHNA 3PGCA 4M1CC 3E2HB 4NN5C 1T5XB 1OAZH 2P7TA 5JO5B 5GS0C 4XTRC 1UGNA 3JBG7 3F7PC 4WCYH 3SKMB 1MWAB 5B22A 2CXGA 4POZD 3X17A 4PJ7E 5GIRB 3RGHA 4GAFB 1MCIA 1SQ2N 3CZJA 1UXSA 4M6MH 5GGTH 4PRDA 2VXSL 5BRZE 4X7SH 3OPZH 4YE4L 4F8TA 4XZUB 3OKLB 1X3DA 3HB3D 3NZHL 2JCCA 5DTFA 3MLUH 5E9DE 4ODXA 3SCMC 1Z0NA 5I0DA 1E6JL 4ZFFB 5LCVL 4KQ4L 4F58L 2F58H 1FLRL 4Z7QF 4YDVB 5F7NC 5DSCA 3MGOB 2JIXB 4PY7B 2DM4A 2WUBH 4JN2A 5HGHB 1KIQB 1HXMB 1XH3A 1DLFL 2F8OA 2OTWB 3QDJA 5T3XL 4L29B 3L3IB 1KBGH 3EAKA 3BZFA 4MDIB 3T0VA 5HVHB 2NNAB 1AQDB 1RZJH 4QHLA 1FAIH 5L7XL 3K8MA 1WV7T 4JLRB 2W9DL 2P5WA 2O26U 4GRLB 4NOFA 1ZTXL 4G9DB 3IGAA 5F3HB 2BC4B 4Y1AE 2E27H 1A9BA 5CGYC 3D69A 5CLWA 1NEZA 5EUOF 3ZHLA 4UBDC 4DN4H 2OQJA 5TDNB 3E2HC 4X7FC 1KPVB 4EVNB 1UJ3A 2VUYA 1T6VN 5AWNL 1HDMB 3KPSB 5CP7B 1PFCA 2XY2A 4RFNB 2IQ9H 2LVCA 3JXAA 3BQUA 3PE9A 1KJMA 1N4XL 4KTEL 5DFVC 1G7HB 4GBXB 1I9RL 5EU6E 3O45A 1KXQE 2C7UB 4I18B 3FHQA 1PLGL 1BVLA 3PXJA 1DSFH 2NY5C 4O58L 3BESR 1HSAA 2DB8A 3CFDA 4OKVA 3S37L 1IC4L 4LSPH 2F54A 3ARFC 4MNGE 2D7TH 3KDMA 2JJSA 1BJ1J 3CFEA 1TZIB 4JDVA 5T3ZD 4BFIA 2MHAB 2BY1A 4XB7A 4RMUA 1MCRA 4HIIA 5SWZE 1XGQA 3QNXB 5T1DL 1MJ8H 5GHWL 2B4CH 3CXDH 1ZHNB 1P4IH 5CSBA 3I6KB 2HLAB 5FYLE 4D9LH 3ULUC 2IPUK 4FQIH 5HVHC 4KKCD 2AK4A 2FCBA 3GMLA 3GI9L 3MLXL 5DURD 3GK8L 3PQYA 4XC1L 1GL4B 5I16B 4CJ0A 1VHPA 3GMQA 3QEGH 3LDBB 4JCMA 3L95B 4OD2A 1RJZB 3QNYA 3LKOB 3KYMB 3AB0B 4DKDC 3JV6B 1PGRB 3EHBC 2DQTH 3T2PA 2UVEA 3QDGA 4JPIB 5LXGH 3O2DH 3IJSB 3LKPB 3RVUC 2Z35A 3C8KB 1B0GB 5EC2A 3U2SA 4XPGL 3H9SA 5F7UA 4MA3A 3U7YH 3C60D 4GBXC 3BWUC 3C5SA 5EOCL 4I18C 2JELH 4GW4A 1MLBB 4LLAA 1WCBA 1NBQA 1LDPL 2DWDB 1YPZA 1ETZB 1LEGA 4G6AD 4QF1A 2YHGA 4HPYH 3QIWB 1T21B 4MSWA 4YPGA 4X4XA 2EH8H 3UMTA 4PJ8C 4GSDL 4PGDB 4YHKH 1VEMA 3OAYK 1RZJC 4QOKD 5FXCH 4P23D 4LNVA 5I8EA 1AHWA 3HNTH 1HK6A 1MHCB 5GGRY 4WI6A 5GSVB 3INUH 5L2KE 3I9GH 3JUYA 4K7PX 3NAAL 3QWOB 4OAWA 3WXWL 4X4ZA 1GIGH 1JPGB 4KK8C 4EOWL 4GAGL 2R4SH 5CJQH 3VMPA 4HC1H 1AIFA 1S7QB 4NQED 4OFVA 4PRIA 3FO9A 4K8RH 4EI6A 1OP9A 3RL2B 3IDJA 3IDIB 3ISWA 3LDBC 3V4UL 4UNTA 2HFTA 4I5BA 4ERSH 1C12A 2YK1H 1OB1A 4PRID 4PREB 3A6CH 4HIJA 1Y0LA 3GMMA 1I1CA 4HKBA 1QD0A 1DQJB 3MLZH 1R3JB 5K9KA 2VZSA 3DROB 2DN7A 3TIEA 5DK3A 1CGTA 2N56A 3A0OA 4LVEA 4AIZB 1RK1A 4JFXB 1G7LA 2QHLA 2IADB 4DWHA 2ZUSA 4PRHA 4X80H 4FXKA 5DHVH 3V79C 3QIWC 4M5ZL 5DJ2A 4Y4KC 3LKRB 2IAMA 1WTLA 2VDQL 3F7RA 4UNUA 4NWTL 1DQLL 1NKRA 2FECI 1BOYA 2EE6A 2OM5A 3ORJA 4IHOB 1NBVH 1NL0H 4R26L 1G7MB 2EXWD 5BVPL 3R06A 3PDDA 4PJDE 2EECA 2B0SH 3TO2A 1OL0A 1BVKB 2AAVA 2FGWH 1AO7D 4N8CH 1AD9B 5FOJA 2BNQD 2DMBA 3FT4A 3MXWL 1QHPA 4Z5RA 4DCQB 5F21B 2Y5EA 4XBPA 4TNWK 4GKSB 4AG4H 4KZDL 5I1DA 3WO4B 4C54A 4ZO6A 3CSGA 4HCRH 3FQXB 3S5LA 1DDHA 2Z92A 3K8KA 2FZ3A 2I9LB 4B0MM 4UOJA 5DLML 2X7LB 4TPRL 5MERB 4I9WE 4XC3H 1D3CA 2YRLA 5LGJB 3G6JA 3IDUA 4NKMB 3LQAL 2DQJH 3TBTA 1MFCH 4M1CD 5D6CA 5D93B 5CKAA 1CF8L 1KEMH 3OKMB 5EDXA 4YDKH 2X2YA 2H3NA 1I7TA 5GXBB 3QA3B 3HUJE 5F7DA 1RIVH 5F1IA 2WP3O 2VLKB 5FUZH 4Y7MA 4AM0A 3KPNB 4L3EE 4HAFA 1A7RL 4M6AA 3IJHA 2D2OA 3EO1A 4G8IA 3BP7B 2H41A 1KULA 1KJ2A 2PW1B 3IFNL 3OX8B 4LLYB 4Y19E 4DK3A 5FYJD 4JRXA 3S88H 3IVKA 5E5MB 2X4TA 1D6VL 4K8RC 3ZDZF 4PUBH 4X6DB 2B7DT 5CIPH 2PKDA 3V6OC 1YEDA 5EO0A 2UY7A 4ZUTA 3EOYG 2BOCB 3D6GA 4OZGA 4QWWD 3QCUL 5FKPA 1INDH 1IAOB 3F12A 2HMIC 5C0IB 2GFBB 2AXGB 4MJ6A 1BQLH 5IW6A 1AD0A 3QR2A 3V8CA 1H3PL 1G0XA 1KJVB 1FSKC 2CMRH 1VKXB 3BGMA 4XRCA 3L7EA 2NYYD 5D70H 3WNOA 2BVPA 1MNUH 5CWSA 1SEBB 5CGYD 3C8HA 3R1GH 4UBDD 4F8QA 4DEPB 2AKRB 3WD5H 3B4NA 3SKMA 4ZNEE 5D93C 3FRUA 3ULVE 1I7ZA 3AMLA 4KDTC 1GGYA 1YZZA 4LOUD 5I8KL 1BAFH 1YEHH 8FABB 4BZ2L 4KXZI 1VGKA 3NTCL 5DFVD 2Q7YA 4M6NL 4G6KL 5LBSH 4OZFA 1OAYH 4E42B 3OKLA 5IMLA 5FGCB 3QIBC 3ROLB 1HKLH 4DGIL 1Y6MR 3V52L 4CN1A 4JQXC 1CBVH 4JQVA 1FYTA 5MHSE 3HMWL 2HH0H 3X3GH 3MGOA 4Z8FH 1I9JL 3Q6GL 3JUZA 3OXSB 5C07B 5GZOD 1HXMA 5HD8C 1J05A 5H8DA 2OZ4A 3WNKA 1E4WL 3KAAA 4MZ2A 2B2XL 5C0DB 2JIXD 4L29A 4YNYA 2MQ0A 1BFTA 4Z78B 1AQDA 3GHEH 3F6LA 2X40A 4WWID 5F1NB 1X4ZA 5DZLA 4OZHF 1T2QL 2FBJL 1IE5A 1GZPA 1KCKA 4QTHB 3RPIA 2VDLL 5I0ZA 4GRLA 4JKMA 4PTUA 1IKNA 4ODSH 3TP4A 2FX8L 1NGPL 3G04A 3D2UA 4ODHH 4Y8AA 3QCTH 2DBLL 2UWEA 2EEDA 1FN4B 3NIFF 3MJ8A 4GRLD 3D18B 1RZIA 4WO4A 1BREA 5FM5O 5JORB 2H32H 1KYOJ 1FHGA 1X44A 1HHHA 3B9AA 5I15L 3EHBD 3WE6B 4U3XA 4NNXA 4IRJC 4AEHL 3B9VA 4RSVA 4UQ3B 2GEEA 3IJYB 5EZOH 5ICXA 3OV6A 1DFBH 2J8UF 2FO4A 3UTTE 3THMH 4LLVA 3KPSD 2OJEB 4HWZB 2XTLA 2H9GA 2Q6WB 5FO9A 5JW5B 1KIRA 3FCTA 4MXQD 2QADC 2GQHA 1MJJB 1I8MA 1T22B 3R4DA 2BVOB 4PJ5B 1VESA 4HPOH 4P3DB 4HF5L 3O4OB 2XY1A 3DX8B 1GAFH 2QQKL 4LFHD 4QRPB 5BS0E 2E7MA 3LPFA 4BA8A 3UXFA 2Y36H 3DUUB 4JGUA 2ICES 4ZPVB 5F7KC 1MIML 4FP8H 4CU6A 4KK8D 4Y16B 3QUYB 4Z7VA 1A7BA 1YNKL 5M95B 4N5EC 4OV5A 1KJ3H 3HR5B 3ZKMC 3OBAA 4B7LA 4IMKA 5C0RH 5IWLA 3GSNH 5HGAB 4M9PA 4LAQL 3MOBL 4L4VE 1LO4H 2R2HB 4OCXH 1JWMB 4P2OB 4OLZH 1XCQB 5DRNB 3S3JA 3MYZA 3C8KA 5I2IA 1J0YA 4MS8D 1T7YA 4PP1C 3ARWA 3TCXA 3L9RA 1MRFL 5E8EB 5LGHL 5JOFB 4UDTB 1FVEA 3L1OL 1UACH 4D3CL 5BZWA 5HGBB 3RWFB 3SE3C 1ACYH 3OGCB 1GPOL 1FNEA 4NN6C 1CLYH 3BPCA 3ZE1F 4U7KA 3S36L 2NW3B 3QCVH 1IGTB 3MPCA 3QIWD 4JR9L 2DQIH 3NFNA 4G42A 1MHCA 4L8DB 3HPLA 1FC1A 2XNAB 3SOBH 2AJXH 5A3IC 3LS5L 4RNRA 3FFCB 5DYOB 2LU7A 3MJ9L 4NO3A 4NM8H 3DURB 1T1WA 1QQDB 2H45A 2VDPL 2CUMA 5T1KB 4CDGC 3QXDB 1K8IB 4Y16C 2XFXB 3QUYC 4Z18A 1I9IL 1CLOL 4EXPX 2BMKB 3RIAF 4UV7L 5IEKB 4WJ5B 4YIQB 4YHNA 4PREA 3U4EA 1ZHBA 1L0QA 3DIFB 3NCFB 3KPRE 3MOQA 1IT9L 1C08B 4PJ7F 1U3ZA 2A1WL 4F7MB 5EBLB 1DEDA 4P48A 5J11B 3H9YA 3ZL4H 1M7IA 1XF3B 4RMTA 4P2OC 4S1QL 4W6XB 3KPLB 2EYRA 5C08E 4CL7A 2D7MA 3WUZA 3K3QA 3ZT5A 5E8PA 1A9EB 2ITCB 1XF4A 4P0DA 4JFXA 1LO5B 1FZOB 4XBGB 3BJ91 3H0TB 4YGAB 4JPKL 5IHUH 5F9DC 1K8DB 1J0IA 3HI1A 4Y5YA 4CN6A 1T1YB 4P2QE 4KTYA 4ZXBB 4DZ8B 5IB1B 2DTMH 2Y6SC 3C6SA 5CJOL 3BDXA 1BFOB 2R2BA 1JI1A 2A6IB 3SQOL 2HYMA 4OLUH 4RZCA 15C8H 2ED9A 4KTDL 5I74B 1YEGH 1G7MA 5E4IA 3IETA 1WFOA 5D5MB 4OCWH 4RISH 4LSUL 1AFVH 1ZK9A 2ESVE 4LBEB 4DUWA 4NKIL 5M7QA 4JAMB 4ACPA 4XXCC 4U6XB 4Q2ZB 1KEGL 4NZUH 1QZ1A 3WFHB 3PHQB 2IH3A 5FGBA 3FMGL 1OD9A 3D0LA 1CFNB 4PJCB 2WWMC 2XN9E 4QTIL 1KCRL 4I2XB 2XZZA 3NPSB 4CKVX 4JFEE 3L3JA 4PJIB 1V7MH 1M05B 3CDGA 2YMXH 3CFCH 3P4MA 3QRGH 5HGGS 3SEPA 2HWZL 3VCLB 3TNNB 4Y0GA 3SDXE 5J11C 5CP3H 1OAXH 1K4DA 2XZQL 3PABB 4NQCA 4X5XB 5HHMB 5D1QA 3QISA 2YKLH 4UT7L 3DVNB 1CDIA 3JWOL 1OCWL 1IGIH 2VLKD 4ZXBC 3EDEA 3LMJL 4KQ3H 3C9NA 5JTWA 1CE1H 4JPWL 4ODWA 3NACH 5DK0A 3OZ9L 5D6DC 5I1JH 3CX5J 2AV1A 5DJ0B 1IAKB 4LLYA 1TENA 3GGWB 2P49B 3MRFB 5I74C 1KCSL 1KNOA 5DMKA 1JZ7A 1G6RH 2D9QB 5CEZE 1YJDL 4GUPB 1KTLB 1F4XH 3EJJX 4PP2B 4JZJB 1KCUL 5CEYB 3GJEA 2G2RA 2AK1L 2KH2B 4F7EB 5CILL 3IF1A 5HD8D 4NKDB 3KNBB 2HKHL 2XICA 4X99B 5EU4A 2OSLB 2BVEA 4OD1L 4JO1H 5BXFA 4R4ND 4QHKI 1U8NA 1HILA 1IAOA 3T08A 1AXTL 4Q0XH 5F3BB 3DRTB 4X5WB 1AP2B 1QLRB 3NPSC 2BCKB 4FFYH 1P9MC 3CX2A 3ARRA 1I3VA 1MY7A 3FT3B 4IOFD 3GMPA 1FFQA 4IDJL 7FABL 4TSAH 5LQBH 3LRSB 1J8HB 4CJ1A 3BW9A 1BMGA 3UO1H 1SJVA 4UMGA 1I1RA 4U1GB 1IGMH 3N1FC 4CU7A 1HEZB 5DEFB 3QG6B 1H5BB 4LHUG 3ALWA 5BCAA 4MJ2A 1FJ1B 3STLA 5MEPB 2JTDA 4FA8A 3RI5K 2X4OA 1N3NB 3QQ9C 4NQDE 3OJDA 5SWSA 5JW3L 1EXUB 1TJGL 4WHTA 5EUOA 3ULUF 4OJFL 2GSGB 4G8GB 4JZJC 1CD1B 3MRGB 4NSKA 1ZWIB 5E03A 4WV1A 5EZLA 3HHRB 4BH8A 5GGUA 3MJ9A 1CZ8H 1XR9A 3P30H 5C07D 2GJ6A 3JV4A 1UH3A 2PXYA 4LKCB 1I1AB 2ICWI 4KMLB 5DJAB 3MLRH 3BT2L 3FQWA 1BP3B 3QEHB 3QDME 3TT1L 5KN5A 3W2DH 2AJ3B 4N5ED 4PLOB 1F2QA 5IJKA 2EIZA 2VLRB 1NMCB 3TBVB 4N8VG 2X1PA 4CVUA 3D0VB 4U1IB 3O3EB 4NHCL 3PF2A 1NC4B 5TE6L 1CXEA 5KVEH 3NIDE 5IFHL 3TV3H 1RJLB 3S35L 1Q9WB 5GRUH 1T04B 1FG2A 4YGVA 5TFSH 4MLSA 2QQNH 3FO1A 1GGUA 3CSYA 5CZXC 4M5YL 3B9KA 4OD3L 3ZE0E 3PWLA 2F53B 1EEYA 1S7XA 4WEUD 1A7NL 1CLZH 1QLEL 1YY8A 5JUEH 4S0SD 2NX5B 2AJSH 4OLYL 1F90L 4HGWA 2P5EA 1QFWL 2KKQA 3I6LE 3W0WE 1W0WA 5KANI 2E6JA 2VXTL 4PJ5A 1JTPA 3BD3A 3VFNB 1MVFA 5DZOA 4L8SA 4U2YA 4JFFA 3N85H 4PJ5D 2ZCHL 3OWEA 1TNNA 4N1EA 1LO2L 3BYTA 4YEFA 1GC1L 1NGQH 3LIZL 3QXUA 4I77H 2FYYB 4FFZH 5A3ID 3RWGB 3O6LH 4KUZL 1NCWH 4WUUE 4WTZA 3GI8H 5F7MC 2ZKHL 5J8OA 1I1AC 4QRPD 3TPUB 5DJ6B 5DJCB 3VE0B 2UVFA 2PETA 4Y16D 1TVHA 3QUYD 1UXWB 1RHHB 4AEIH 5HPMA 1FZKB 1YEKH 4M62H 1J10A 2EICA 1U8KB 3VFSA 2D4FA 2AEWA 4QCIA 5I1HH 2OJZH 5DJYB 4ZDHA 1XCQA 3DX7A 4L4TE 5F96H 4A6YB 5EZJB 4Y5VA 5EFIA 4JG1L 4JHWL 5IM7A 5GS2D 4P2OD 3VXRE 5HGDB 2A9ML 5I71B 1FH5L 4G8EB 1EUUA 4LGRB 4KFZC 1A6AB 2ADGB 4O02H 2DQGL 1JMXA 3OGCA 5IVZB 5J6HB 5DJ8B 2OR9L 3N9GH 1A14L 1ORQB 2V2TA 4HUWA 4X8JB 4XCCH 2Y6SD 3OJ2C 5F1KC 2CDEB 4K55A 5IBUG 3HI6H 4IRSA 4XWOC 3I2CL 5FK9B 4YFDB 4DVBA 1MRDH 4LCYA 3BN9D 4PJ7B 3DO3A 2R8SL 4Q9RL 3ZLQC 5BRZB 2VLLA 2KQMA 2CDFB 4HXBL 2CGRH 5K33A 3S34L 1VPOH 3CX5K 4C83A 3FFCD 4QXUH 2I60H 5EC1B 3QXDA 4HIHA 5C09A 4NO2B 5CSGA 5E9DB 3WIFA 2YN5A 5T3ZL 4PJXF 4XNMA 5T1KD 4OM1L 3WIHL 5C09D 5F9WC 1FZJA 4V2CB 1GOFA 4OF6A 4POUB 4NWUL 2X4RB 1WWWX 4M93C 3HZMB 3RUGE 3GNML 1K6QH 5JNYA 2BY3A 1B4RA 1NUDA 2OP4H 1W0VB 4MLIA 3EOTH 3HMXL 3CC5B 2X41A 4MQXD 1ZLUH 2W9EH 1I4FB 1WBYB 3BP5A 5I1CL 3TBYA 1JYXA 4ZO7A 1W72L 1YEJH 2FEEL 2ITCA 4EUPA 4LKXB 5I71C 2EDRA 1CDBA 1I3RA 3TT3L 4Y1AB 4J3OC 1VFBA 3BO8A 4KK6C 3ZYOA 3SE8H 5D2LF 1UENA 1FL6A 3SDAB 3S96A 4ZXBD 5DHXB 2BHYA 1EMTL 4XCEB 4XVJH 1T7ZA 5I8OH 5IGXH 1H3XA 2EC9U 5EORL 3KJ4C 1GH7A 4JPVH 3WHXB 2EE9A 4WTXA 5KVDH 4LBEA 4OZIE 1L7TH 5HHVH 4ELKA 4OI7A 1HE7A 4J6RL 4L3AA 3DV6B 1FZMB 3X3FH 3KXFA 4B50A 2Q76A 4UU9A 2GK0A 2WMPA 5DT1H 1N5YL 1UZ8A 4WDIB 1KG0B 2MNUA 4LARL 4MNGB 3F6IA 4W4OA 1FIGL 2IALA 4CVXA 4R0LA 5SWZB 4M6OL 4JDZB 4YUEL 3QUML 4TVPH 4NBXB 2D9CA 3RAJH 4D2NA 4CU8A 3VCLA 5DC0A 2CIKB 4Y4FC 2FRGP 1T6WA 1EO5A 3MR9A 1H15A 2G75A 1U95A 3H2WA 2L4OA 5CINL 3V6ZB 3MZTA 3P4NB 3QULA 5HHPB 2HJFA 4DZBB 2P8PB 1NDMB 4XCFL 1UM5L 4UTBH 5KVGH 4NPYA 5HHMD 3AU1A 1L6XA 4UTAL 5JQ6H 2HLFC 3BRGC 3FQTB 3MV9E 1P7QB 2NTSP 2WW8A 2AS5M 3VXNA 4K3DH 4OFDA 5JIHA 5D7IF 1A6ZA 2VKWA 4PJFE 1RZKH 2EKSB 5EU7C 5SX5K 4HIXL 4AJ0A 1GHFH 3D1MC 2GITA 3LV3B 5D72L 3QQ9D 5JHDE 1IMHC 3ESUF 5HDBE 3UBXG 5CEYA 3B6SB 5IVXF 5GRJL 2HTLC 2Y5TB 3RGVB 3MLPA 2R56L 3EFDL 3NGBB 1OLZA 3ILQC 3FB8B 4X99A 3DTXB 2QJDA 1IGCH 1Y6NR 2XWBB 2CR3A 5FM4A 4IOSD 1OARL 3CDCA 5E6ZA 4L9DA 1R6VA 4X5WA 3BDBA 3BP4A 2NTFA 1P4BL 4PLJD 1Q0XH 2D0FA 4P9HC 1N0XL 4ORGB 3FONB 4N0YL 3QUXA 4QXTB 3ARBC 3TJEH 3KPOA 3CLEH 5CSZB 4JFOB 2PYEE 4Y5XB 4G9FA 5LG1A 2YD2A 4LMQI 5IMKB 5E56A 1J8HD 2E9WA 4JKWA 1FGVL 4LL9A 2R69H 1FRGH 1WWAX 4UUJB 3M8OL 1ZLWH 1U8HB 3QG6A 4APQB 3MA7A 3FRPG 2A6JB 3V5DA 4TSCL 3QPXL 1I7UA 3TVMB 2BDNH 4OZHA 5CZXD 1MCJA 1WIPA 4LDOB 2DLFH 2O5YH 1N3NA 3DNKA 2AJZA 3MODL 3MV8E 3I85A 3PP4H 4OLXH 1LNUB 5GQBA 3MREB 3BD4A 3VXQA 2X6MA 4NNPL 3T1FB 2AV7B 4EKXA 5EBMB 3PDOA 5IV2A 3K2UL 3DMMB 5GS0L 3MRGA 5E1AA 3TM6A 5D7KE 3RGVC 3UTSA 1ZS8B 1EX0A 4TSBL 1INEL 4G8GD 5DRWA 3NGBC 5IB3B 2X1WL 4MX7A 2AQ3A 2IFFL 4XNXL 4RBPH 1WC7A 4BSVB 2J8UA 3EOAA 5FYKD 5K9JL 1FYHB 1I1AD 2ZG3A 5FYJL 3QG7L 3G5XA 4X4ME 3TC9A 4U6YB 4PJDB 5C71A 1T20A 2VR9A 4NO5B 2ED7A 3MO1A 1QUNA 2A6KB 2OL3B 4OGYH 2NY2B 5GJTL 4Y5XC 4JKPL 1D5IH 5CBAB 1QSEE 1NCDL 1QFOA 2VLRD 4NOBA 2CKBH 2X42A 1KPUA 4FABL 1W72A 3GIZH 1NC4D 1RZKC 4QRRE 1MQKH 4PBWD 5CS7A 1GZQB 1CGWA 4Z76B 1EZVY 4NRXA 4APQC 4EDWH 3HFMH 1UM4H 1JFQL 4IMLB 4U1JB 1TQBB 5TQ2L 3TVMC 4K9EH 2YUWA 1KIPB 2NX5A 2F53D 2QQLH 1AGBB 1X7QA 1JCKA 2FB4H 1F11B 5H2BA 3EYVB 2NX5D 1IM9A 4DQOH 1JF5A 3WFBH 5ID1A 3HUJB 1JP5A 1AQKL 3JV5A 1BQHG