4POYA

Engineered dual specific vhh antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VHH-metal
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4poyA00
1EAJA 2WIIA 3FKUS 4HCRL 2NTFA 1NANH 3AREA 1FNEB 1U2CA 1J0YA 4JFDB 3MC0A 4XMPH 5IB1A 4JKKA 5IT2H 1MCHA 1YEJL 5HPMA 1JYNA 1BFVL 5EBLA 2A9MH 4J1UB 1AP2A 1BZ7B 3CFKB 5HVHB 3EZJB 3C6LA 3WUZA 5AD0A 5FO9A 4ZFZA 3UYRH 4NBYB 4HG4J 1DBAH 2EIZA 1QUNA 3LPWA 4DUXA 1DQML 4H0HB 1N59A 2ZCHL 4MS8D 5CJ8A 2CKBH 1K3IA 3KJ4B 3VW3L 2VH5L 3U0WL 1W72H 3RWFB 1IGFH 1JGUH 5L88H 4RRPA 4K8RL 3I3BA 5FA4A 4XPTH 4XPFL 4OTXL 2IMNA 4PJ9D 4WU7A 1VFAB 2BCKB 4LPXA 2C1OA 2LTQC 4WJ5B 1QFWL 4XCEB 1H3GA 3V8OA 1NGZB 4OZ4B 2DTML 3HHRB 1IGCH 4NO0A 3MTRA 1J12A 3DX7A 5IVZB 5IQ9B 1INEL 2PETA 5I16A 3C5JA 1QVOA 3MA9L 3B9EA 1LO3L 3OAYH 4K3JH 4NGHL 5JPMB 2EDRA 1S7TA 1OSPH 4ODXA 2QQLH 1WBYB 3LKOA 5TQ0H 2YA2A 2IALA 1HKLH 1OP3H 3TYFA 3ULSA 1R3LA 2AI0H 4XCYA 2XT1B 1K4DB 2VIRB 3I02A 3C2SA 5IWLA 4EXKA 5TE7L 2O5YL 4KRMB 5D7JA 1GZQA 3RKDC 3FQUB 3AAZB 1RUQL 3ZZ1A 4LBEA 1JPTL 3F7RA 3B2VL 2ZNWA 3TVMB 1UADC 2H32H 4UT9H 1AGCA 3O2WH 1KLGA 3HB3C 4M00A 3G04A 4M7LL 4YXHL 1W0WB 3PIQB 3IAGC 3NPSB 2WQ8A 2WP3T 1Z9LA 3WNKA 4LCIH 5KG9B 2H9GB 2Z8WC 2YD4A 4JN2B 1CR9L 1ERNA 3OKEA 5C0GA 3RNQA 2YPLA 2WUCL 4KPHH 2R69H 3O41B 1ZS8B 2HT4D 3VXSE 1I1AA 3MRDB 4ZO9A 4EUPG 4QHLB 4KRLB 4QXUH 1Q0XH 2DQIH 1JK8A 1I7RB 3UZVB 3O4LD 1QLFA 1QEWB 3P0VL 1NLBL 5ADOL 4CVXB 1EV2E 3LKPA 3LRSB 1D9KC 3WE6A 1CLYL 3CDGB 1REIA 1GGYA 1VADA 1R3HA 4PJEF 3HC4L 5I71B 1GRWA 3BO8B 3S4SB 5AAWA 3EFDH 4H1LH 4HC1A 5LJYH 3DV6B 3PP4H 4XCFL 5F9OL 4QOKE 4GMTL 1FQ9C 2PYEB 3W2DL 5A2FA 4Y4KD 2EXWD 1CFQA 2EDEA 5FIEA 1W8OA 1QPXA 1J05A 2N1KA 2R1WA 2BSTA 1U0QA 3GBNH 3PGCA 3S5LG 3N0PB 4N0CD 1OAZH 3MRPB 4FQIL 4FFWD 5J1SC 3IDYC 1DQMH 5I0ZA 1TZIA 3IU3B 1NCNA 2ZCHH 4LASL 5C07D 4ZFFB 1RHHA 4MMXC 1HWGB 1K2DB 2WW8A 3VW3H 1N26A 4O51B 3TPKA 2X44D 1S8DA 4XVSL 2YRZA 1MCEA 2CKBA 5D72L 1NH6A 4XPFH 4QTHA 3VXQB 4C58B 1W72A 4RIRA 5I8EB 1WC7A 5SWSA 3BW9A 5I6XC 2EE3A 5KVDH 5MHSE 1QR1A 4PRNB 2NNAA 5FK9A 2CGRH 3TFKD 3BSZL 2DTMH 1PFCA 3BP5B 2WANA 2Y5TA 4YFLI 5L6YL 3QDMA 3LN9A 2GY7B 4P23D 4F9PC 4NGHH 3VXUB 2YD5A 1V7ML 3QJHA 4UT6L 1HIML 4N68A 4X4YB 3GMRA 3VWJC 1KJVA 4OBRA 4ZNEA 4KU1A 3FO9B 4MD0B 4KY1H 3TBTB 2IMMA 4RWHA 1JZ8A 3K1KC 3JTSB 5TE7H 1XIWC 3DSNA 4KK6D 5IIEB 5C71A 3K4AA 4OGXH 2YUVA 2X4PA 1IKFL 1CZ8H 4PTTB 1BECA 1RUQH 1U42A 4M7JH 2WBJD 4LLUB 4I13B 4D0BA 2IEPA 1TJGH 5LGHH 3SKOA 4M7LH 5ESQB 3GSOB 5GZND 5IK3B 4V2BA 3T4AB 1YYLH 1HH6B 4DQOH 2R4RL 4ZMAT 1FZKB 4XCNB 4YHNB 1I1YB 2BK8A 4YBLB 2ZSWA 5JORA 5FUCE 4EDXB 5KVGL 4R3SB 4RA3A 3I75B 2GJ6E 4MCYA 4OIBA 3P4NB 1QQDB 4JQVC 4ONGH 1JF1A 4Y4FA 3OKOA 4F9LC 3ZKXB 4NC1E 5C86A 4Y5XA 4OI9A 1FVEA 3VCLA 5DJXB 5ADOH 2YXMA 1MF2H 3RTQA 4F7CB 4UQ3B 5FKPB 4HUVA 2WQRA 2WNGA 4IRJC 1T3FA 4GAYA 1CLYH 5T5NF 3UAJD 3P4MB 1EO7A 3GSVB 4RQQB 2X40A 3VXPB 3B9KA 3MRQB 4XWGH 4PGDA 2QR0A 5IESH 2X4RB 4OLYL 5C0BB 5C09D 1BOGA 3O81A 4JZOB 4K23L 1S7WA 3LKRA 1G7PA 2OBGA 4XCFH 4DVBA 4PRIB 4WHYG 2Y5EA 4G8FA 1GYAA 1K8IB 3V6BR 1P7KA 2J8UB 1OHQA 1K4CB 2R1XA 1JZ2A 5HHQB 4PJFE 3BD5A 3O6FB 2V2XB 3RAJL 1YC8A 1X5YA 5DEFA 4F37K 1HH9A 3ULUF 2BERA 1U8LA 4X5WA 5D1XD 1WT5C 1JGEA 4LMQI 3MO1A 4NBXB 5FB8B 5AUMB 2CIKB 4J6RL 2H3NA 3QHZH 4Z7NF 4AG4H 5DRNB 4WEUD 5HGHB 4LARH 5AYUH 5MI0B 2CDFB 3E8UH 3EHBD 3L3HA 1A3RL 3AU1A 3D25B 4JPWH 1FDLL 4H8WH 3LHPH 3C8DA 5EIQA 5CJOH 2B1AH 4TPRL 2X4SA 4M4RA 3F7YA 5L6YH 3ARFA 4PJ5B 5EULV 2EE2A 2FSEB 3BPCA 3MNVA 5E9DB 3HC3L 2JIXA 4W4OA 4NQDE 3VFUB 4P2OA 4PG2A 5JLZB 2MOVA 2VL4A 4F8QA 4OI8A 4HV8B 5B3NA 5EU6B 1XGYL 4NRXA 5DTFB 3P77B 4WCYL 3GHBH 3WCYA 2VXQH 3X3FL 4IDLA 1A7OL 5GSRB 5D2LE 1A2YB 5BVPH 4RFNB 4N1HB 4TN9A 3RWHB 1YNLH 4I48B 4LNRA 2OK0H 3T77B 1H3PL 4UB0H 3TO4B 1P7QD 5JA9A 3ROOA 4HQQH 3MGTA 3HN3A 5JHLH 4WUUD 3GEWB 5KSBB 2XN9E 4LSUL 2JJTA 4LHJB 4XVUD 2E6QA 3GMLB 3LRHA 1MIMH 1U9KA 2P47B 4NRZB 4CADA 4LCCC 2A1WL 1QKZL 4O58L 3NABL 3SDYL 2DLTA 4WNQA 3GSUA 3NH7L 1A9BB 3RY6A 4Q97A 3FMGH 3L3GA 4FQ2L 1KLUB 3K74B 4BUHA 15C8L 1U8MB 1ZLSH 4H5SB 4HIHB 4P59H 2J2ZA 5E6IA 3OAUL 1U91B 3GGWA 3PWUB 1CDBA 1NMBL 3IDJB 3AY4C 3RWDA 3I2CH 1JJUA 2F54B 2CRIA 1NBQA 2AJZA 4BSVB 1N6VA 4G8EB 2EKJA 5F9AC 4MJ6A 2A2QT 1X6NA 4OLYH 5I17B 4LSSH 5DR5H 4K23H 5BZWA 4V2CB 4G6KL 1OF2B 3U0PB 5E2UL 1EEZB 2ED7A 1DLHA 2PTUA 1LEIB 4M62L 1UM6L 4GS7B 2OTUA 1U8QB 4DEPC 4ZUTA 5KOVC 2Q76B 3QCUL 2ERJB 3SE8H 4YDLC 1N6QH 4FQ1H 3G5XA 3LB6C 2RQ8A 4J6RH 3OMZA 4WDIA 2J88H 4OLWL 5IKCB 1Z0MA 2JCCB 1QPPA 3GSRA 1XMWA 2ZOLA 3SCMB 5C8JA 1A3RH 5T3ZE 1FDLH 2R0KH 4JQXA 3RWIB 4P2QD 3BFOA 4CJ1A 1JGVH 4YPJA 3E6FA 5BJTB 5F1OB 3EJYC 1BQLH 1N0LA 4XRCA 4XPAL 1H3TA 2Q1EA 3HE7C 3LKQB 1TTGA 3CFJB 4DTGH 4FQXA 3V0AC 1SMOA 2P7TB 5GZOC 4Y1AE 1GHFH 3JV5A 3FHQA 1A1MA 1AKJA 2DLFL 5C1MB 4GKNB 5IFHH 1E4KC 1A5FH 4TYUA 4OGZA 5E03A 1HI6A 1VCAA 3PQYE 3KYAA 4MA1B 2VDOH 4PJGF 1MVFA 4I0CC 2A9NL 2ZCLH 1F3JB 3HZKB 2DB8A 5DRZA 4DJMA 1PG7X 3SDDB 3KPSD 3TZVD 1I9JL 4RSVA 4RGNE 3R4DA 4U1NA 2ENYA 1H3PH 3CGTA 5K59F 2XWBA 2VXSL 1MJUL 2IJ0C 3QIBC 1KTDA 4PJBE 2H2PC 3VFMA 3OXSB 4K7PX 2FX9L 4LSUH 3LV3B 2DWDB 3D6GA 3IXTB 4CVZB 4AT6A 3ULVL 4X7TB 5I1LB 1IZKA 5TDNB 1QKZH 1OAUH 3NABH 1EBPA 1I9IH 2EDWA 3CFCH 1FO0L 2CUIA 2FATL 4JAMB 5FEBA 3D0VA 1KJ2H 2H2SD 2CXGA 15C8H 3HG1B 1TQCC 3O9WD 3WHE0 4M1GH 1ZHNA 4HBQA 3CVIL 4PJFA 3MFFA 5F7DB 1DP0A 2FIKB 5T3XD 3G5YA 1P6FA 2AK4E 2VUYA 4GKOA 1G9NC 3IRZA 3WFBH 1MQKL 3KXFB 1R3JB 4EQ3A 2ADJB 2YMXH 5IVXE 4ODHH 3FT4B 2D03H 1KPRB 4WHTB 2YWZA 4B53A 2B8OT 2VQUA 5IV2A 5T3ZH 4JFED 5JOFA 4WI3A 1MOEA 3DVNB 4JPIB 4OFDA 4WO4B 4C56B 5ITBL 1NQBA 4KHTL 4DKAA 2P48B 4YO0B 4QT5B 2NW2A 4N0UB 1KB5B 2P5WB 2ED8A 3GIVB 4HWZA 4JFZH 1I8LC 4UIKH 1UA6L 5FA3B 3ROLA 3OZ9L 1CD1A 2BJML 4JHBA 3VG9C 3MJ7B 3HMXL 4JFOB 4HEME 4Y16D 4AYFA 4J3VA 4NQDA 5D7SH 3P9LB 4FS0A 1KB9J 4HKXA 1KEML 4X0KA 5I2IA 4TSBH 1WWCA 3U46B 3ULVD 4ZAKB 3G6DL 3BAEH 4G6FB 2ZUYA 3V52L 5HHPB 2WUBH 1U3ZA 1W8NA 2XI9A 1OOAA 4ZD3H 4XH2A 4JPVL 1GOFA 4L8BB 5HGAB 3GO1L 3KLSA 4MCZA 4U2YA 3NZ8A 4XX1E 3VI3F 4D0DB 1BFSA 4XPAH 2VQ1A 2RCSL 2OTPA 5T5NG 5HYQA 1A22B 1RJYB 2DQJL 4ODSL 4Y2DC 1NCTA 1H5BC 2XN9A 3EYVB 1RJCA 3MRIA 4U1JB 4S10A 4PJGB 3RUGE 4PP1D 3LQZA 4OBSA 4K3DH 1YNTA 4GW5B 2XA8L 1G7LA 2ADFL 2ZJSH 5CLTA 3ZKND 4RGMC 1QBAA 3TEUA 3ZTNH 3O3AB 3LIZH 4D9RE 2ZUXA 5TDOB 4DKDC 4G5ZL 1LVEA 2VXSH 2ZUWA 1I85C 4PB0L 4Y7MA 3OPZL 2FX9H 4X5XB 3MV9B 4N8CL 3B4NA 5CILH 3OB0H 1V5JA 4HPYL 4Z7WE 1RV6X 1AIFA 1F2QA 1FO0H 3JBG7 1XAUA 2X09A 3TNNA 2C1PB 3HI1A 3CNKA 2EDBA 2FJHA 1GVIA 1NFDE 3CC5A 4HKJA 3BZFA 1FPTL 1T21B 5I8OH 1KJ2A 3KPRB 1NC2D 4JM4H 5I75B 3GMQA 2OJZL 1RZFH 1NGXA 3TA3C 4Y5VC 4Q9CA 2ITCA 1XGTB 2NXZC 5D7KD 3LS5H 4K71C 2OYPA 3ZKMD 4PJHF 1T1ZB 1DEEB 4JJ5B 3V4UL 1C5CH 1XGUB 5ALBH 4OJFH 5I8CB 2VDRL 4HLZH 3L5JA 3L5XL 3NIDF 3L3OA 3TT3H 5FGBA 3FQRB 3O0RL 2HT4C 2L0DA 3I6LE 4IRZL 3O3DA 4K8RC 4LOUD 1TMCB 2VLJB 1ETZA 3WN5B 5EUOE 3HMXH 3HPJA 5T1KD 1JHLL 1X5IA 3RX5A 4Y1AA 3ZE0F 1IGJA 2LQRA 4S1DC 4XNYL 5C0JB 1K85A 3ARDA 5FCUL 2VDKH 3SEPA 1U41A 4AIZA 2BOBA 3MLPA 3BP4B 3TBYB 3QO1A 1L0YA 3DRTB 7FABL 4P2CG 1MFCL 4GBXD 4I18B 2VWEE 4LCWA 3U7WL 3V95A 3MROB 4Y4KC 4WENB 5D1ZA 3I6KA 4UIMA 2XWTB 4HX1B 2ICEA 2DQJH 2AAVA 4PJBA 3RDTA 3TH4T 3MRJB 3THML 3CLEL 4FFWC 2BVQA 4J12A 2AKRB 3MRMA 3MNZA 1P9MC 4OCMC 4RGOH 1OCWL 4L1DA 3DRQA 2XA8H 2M1KA 3LPFA 3FRPA 4PRPB 3DXAE 1RI8A 3CH1B 1A4KA 1G0YR 1JGLL 5D6CA 4MA7H 4MJ5B 4OF6A 3QDJE 3MCKB 4WUKH 4AEHH 4URTB 4E41E 1J8HE 3CVHB 3RVVC 1ND0A 3DURB 3NGBB 3TFKC 2AK4A 3OPZH 3Q5YA 4Z7UE 1AGBA 5IVXA 4MD5A 5DJZB 2VZ1A 4K9EL 4HPYH 4HDIB 3R06B 3IFOA 4XMLH 1RUPH 1FFPB 4ETYA 1BD2E 5EO0B 5T1LB 1G9ML 5HYSB 5LVEA 2E6JA 3QDAA 1WCQA 4TUKH 5EU4B 1MH5B 3BGMA 2XTJB 1T4KA 4CW1A 4JLRB 1FPTH 4P2RD 1I9EA 5ACZA 4KK6C 2EDXA 3OR6B 4FZ8L 1KPUB 3UJTH 2V5RA 1ROWA 2A83A 5LWYH 2E8ZA 1INDH 2OTWA 4C59B 3PNWA 2PTTA 5HJ3A 4GKSA 2WBJC 4X6EA 3BPNC 5J1AA 2R23B 1F5WA 4PJHB 2GCYA 4XTRD 4P49A 1BLNA 3QEQE 5GZNC 4KI5C 2WINA 3FN9A 4YHPB 4G9FB 1OAXL 2VDRH 2V9TA 4TVPE 4HWBH 3VMNA 5BS0B 2NZ9D 5BRZA 4L9DA 5C6TL 5DLMH 2Y7QA 3WLBA 1KIPB 4IRZH 5I1AA 4GUPB 3SDCB 4EI5B 3SE9L 3NTCH 4R0LA 4I77L 1J87A 4UMGA 5KN5A 4NZTL 4F33A 5I18L 3V0VB 3F65A 4UU9A 2EKSA 2FX7H 2WK2A 3TBSA 4GRLB 5IBUB 1CBVH 4LLDA 4JREB 2A6DB 5SWZD 3RUGA 1FCGA 1MFCH 3LD8B 1TNMA 4YHOL 4F3FA 3LKSB 4PTUB 3U7WH 4NQCE 1HHGA 4WI8A 4U05A 5FUCC 1A3LL 3BYYA 5HI3D 3AS2A 3RPIA 3QG7L 1TZGL 1O5DT 2EYSB 3W9DB 1QA9B 4D9LH 4L3EB 5IG7A 2VR5A 2FZ3A 4UT7H 2B1HL 3B3IA 3T0BA 1NCCL 5I1DA 3BWAB 1XF4A 2UY7A 5H35B 3WNMA 5D1XC 4BZYA 4O2EB 3RIAF 4Z7WA 1IC4H 4LSQL 5JNYB 1OCWH 4AENA 2IGFH 1CU4L 3VWJA 3V0WH 4LRNL 3GM8A 4G43B 3CMGA 1VERA 1E4XI 2Z92B 1NFDA 3EHBC 1VEPA 1IAOA 3M8OL 3GNML 2P4AB 3MGAA 3KPTA 4NQUA 4WV1C 2XWJA 1KIUA 1P4BH 1SJHA 1GGBL 4NFDA 2OSLA 1RZGA 4YPGB 5LQBL 3SDXE 2BFVL 4POUB 4AM0A 4U1GB 3HI5H 4OCYH 1YN6A 4TVPH 1ZHBA 5BMFL 1X5LA 3IYLW 1I3RA 2EIDA 3KGRA 1JV5B 2YRPA 5IROC 3Q5TA 4KGJA 3UCRA 4TULH 1JE6A 1G7IB 1BJMA 4Q6IA 4NRYA 3RGVB 5CP7B 4OLUL 1F00I 3TBWB 2C3VA 1Z6JT 1A7BA 5DZOA 3PV6A 3JUYA 4OZIF 1CGWA 4F9LA 2JELL 3PHOB 1EPFA 3QI9B 5EUOA 3FQWA 2GK0B 4ODTL 2HN7B 4TTGA 4P9ML 1FNLA 1A7QH 1T20A 1I1FA 1D5MA 2I9TB 3WFCL 1ZLWK 2DJ4A 4KUZH 4XVUC 4RNRA 5EC1B 3HE6B 2D2OA 2Z91B 3HG1D 4FZEL 4XNQA 4KV5E 4HWBA 1BFOA 5JOPE 1D7FA 4CRPA 2V2WA 2QQKH 5B3JF 3OKKB 3Q5OA 3IFLL 3QIUB 4PY7A 2CDEB 1CGSL 2IH3A 3MRNA 1PVHA 1INQB 5AG9A 4YE4H 1U6AL 2APVA 4L4TE 2MPAL 5E6ZA 2YN5A 1KIQA 4U6VH 3B5TA 4WFGD 1GGIL 3BEWA 1Y6MR 4LDOB 3QUXA 4KHXL 3KPQA 4WO4D 3DX9B 1Q94B 2OZ4L 4NM4L 1U36A 3BEVA 2IANE 5EOCJ 3DXAA 3NVQA 1A3LH 4L3CB 4ZDHA 2DQTL 4HHAB 1NLDL 2NY5L 4GAGL 1QRNE 3QG7H 3VRLF 1WF5A 4E41A 1J8HA 5MEQB 4QRUA 3AREB 2VAAB 4Z7UA 5C3LD 2MTPA 5ISZB 1NCCH 5J4MA 1A8JH 2Z4QB 4M6NL 4WFHE 5IHUL 3QP3A 5EOCL 4QY8A 1BD2A 3JTTB 3QQ4B 4LRNH 4U2ZA 2NY6B 3DGGA 4G6FD 2EIZB 4PFEA 3ILQD 1LEGB 3TLRA 1N59B 3FZUC 3LN5A 5AZ2H 1U3HC 1MCIA 3UX9B 1MVUA 5LGJA 3PL6D 2YOCA 4DGYL 1T83C 3DMMD 1MCOH 1RULH 4HK0A 3NZHH 4RFOL 5FA4B 4JM2C 5DFVC 2HT2C 4UTAH 1Z9MA 1N2RB 3X11A 5BV7H 5IBUG 1E4WL 2QL1A 1YEKH 4GFTB 1JWUA 4MJIE 4G80A 1FJ1B 5D2NB 1NJ9A 3QEQA 4ETQB 4QXTA 1CK0H 3S37X 4NC0B 1UWXH 2GSIB 1FNAA 4J4PA 2OCFD 2W0KA 3C5JB 5I16B 3NN8B 3TJEL 5C08B 4AEFA 4OLUH 2ATKB 2BRQA 1X5AA 1WBXB 4OZIB 5C3TA 3BD3A 4ODXB 3LKOB 5JO5B 4M8VA 1WCBA 1G9NH 1EZVY 3TZVC 4X6DE 5E2TH 3TYFB 3ULSB 3MV9D 4I5BA 4Q2ZA 3SPVB 5HHOD 2XTLA 5ELIA 4P9MH 1PDKA 3ZHKA 5D7JB 2YD7A 3HRZA 5B38A 3DUSB 4YXLL 4L29B 4M48L 4JO3L 3LQAH 4RAVA 4O02H 1CD0A 1IQDA 3SDAB 2R2CA 2QLVB 1JTTA 4QCIA 5HGDA 5CGMA 3IXAA 2LABA 2Q3ZA 4OCXL 2V5YA 4NQCA 3Q3GA 3WO4C 3BQUC 1JPST 2X10A 3MJ9L 4NNXA 3MGOA 1GZPA 2VLRE 5F7WC 3IU4L 3O9WC 3OKEB 5CHNA 1B6UA 3RNQB 3K3QA 1SBSH 3X13A 5E00B 4NQEE 1MFDH 1VFBA 5H2BA 4PRBA 4Q9QH 3KWWA 1KELL 3T2PA 1L7TH 1GGIH 2Z0BA 3NACL 1JGDB 3JSSA 1KCVH 3BZ4A 3TNMA 4KHXH 4DW2H 1UXWA 4NM4H 1ZT4A 3WHXB 2F53D 4P5KA 1X5JA 3CFIC 2YZ1A 4GAGH 1JBJA 3EUUA 4NPYA 3WS3A 5GGQL 1OD9A 1FLRL 4TNWF 2H8PA 2GHWB 1HHHB 2CDGA 1RIHL 4N5ED 3BXNA 2YR3A 4Y88A 4L8SB 5IEHB 4M6NH 2BNRE 3SDXA 3O4LE 4ZOBA 2ICES 5F72S 5EZJA 3PGCB 4N5UA 5HDQL 1D6VL 2GT9A 5IM7A 4Y16C 1T6WA 4NWUL 4ONHA 4UDUB 2OL3L 1TZIB 3L5WB 5ITFB 1AE6L 5HDBF 3RX7A 4JY5L 1RHHB 3ULVC 5FO8A 4MNQD 3QWRA 4H88L 5IJVA 4DGYH 2CR6A 5DD5L 1C08A 5CS7A 3U79A 1P5UA 3LKNA 4RIRB 4KMTL 1WC7B 3LY6A 4MB4A 4PY8J 3BW9B 1VACA 5DDHA 4QHKJ 1UWGH 3T0ED 3QIBA 3UMTA 1QR1B 5T33H 3AC0A 1IGML 2NNAB 2HWZH 4PLKD 2R39A 1DTUA 3G6JE 3WFEH 1S3KL 5C07E 3STLB 4HSQA 1E27B 2A73B 5FM5O 4KVNL 1JPFB 3F12A 1R24B 4EVNA 4PP1C 4AL8L 1SJEA 2I07A 4FMKA 3V7AG 4NP4H 2DM7A 3V8CA 2MHAB 25C8H 3K0WA 1NAKL 3ZKNC 3MBXH 1QSFB 4F7MA 5HTSA 1YY9D 5TGBB 4P3DA 4Z8FH 4ENED 2BVPB 4HW6A 4L4TA 5IQ7L 3UYPA 2X4PB 1S7SA 4R26L 1YDPA 4M48H 2AJSL 5FOBA 2FHBA 3HNSL 3IVKB 4KDVA 4CVUA 4P4RA 1AO7D 4LLVA 4NN5B 4Z5RA 2IANA 3O4OB 1YMHB 3MJ9H 1JNHA 5FHAL 4LK4A 1IAIL 1R5IA 4LAQH 4PJIB 3PWPD 4L9LA 1QRNA 2ZSWB 2HG5B 4NHCL 1GIGH 2DDQH 3UDWC 4MCYB 4I3SL 1WFTA 5KBNC 1JF1B 4Y4FB 1QSED 1KELH 3KYNB 1L6ZA 4MA3A 4UAOB 1A6TA 4S0TD 3SJVB 4MAUL 2X4TB 4G9FD 3RTQB 3ZKMC 4XVTL 5BS0D 1ONQA 2ESVE 3BH9A 3HNTH 4GAYB 2MNUA 3U0TA 2V7NA 2JJWA 1YYMH 2VXVL 4K2UL 1SY6H 5K9QI 2EZ0D 3S3JA 4PGDB 2LV4A 2RIKA 4F15B 2R2BA 3H7BA 3RWCB 1U8PB 3DSFL 3C08L 4I0PB 1UH4A 1UKSA 1Y18A 1WBZA 1VDGA 4IOIB 4PR5A 5B22A 1OP5K 1N5AB 4GRLD 4YK4C 1UYWL 3GKWH 3VU2A 1UFUA 3HZMA 1KTLA 3U7YL 2AP2A 4MJIA 1JF5A 1FAIH 3STZA 2AW2A 1YEIL 4KTYA 1PQZA 1JGEB 1KULA 2DQHL 2YHGA 3O45A 5E24E 4HPOL 2R2HA 3Q6FA 5I1IL 4YJZL 1DSFL 4B41A 1FFRA 1XGPB 1FGNL 3OF6D 1MRFL 4P9HL 4PJ9A 1N5YH 4X6DA 2QKIB 3L3HB 5GRXG 3AU1B 4L3ED 4FP8L 2PCPA 3GMNB 1I85A 4P2YA 2VB5A 1IAMA 4YDVA 1DR9A 2ARJB 5CD5C 1FNGA 1MFNA 2GTZB 3BT2H 2HFEA 4OUOA 2X4SB 5F7UA 3MXVL 4JFYB 4E9LA 4G9DA 4IHOA 1B90A 3F7YB 3ARFB 1G7HA 5L8LB 5EZLA 5FF6A 1ZVHA 4N8VB 3MNVB 4ZXBC 4K7PL 2G2RA 2Q7NA 4LKCB 5EU5B 4LEXH 4P2OB 3D2UA 3T4YA 4Z78B 4ERSL 1JWMB 3D9AL 3RIAK 1T7XA 3W81A 1F4YL 4AIOA 3EOTL 4ALAL 5C0FA 2P42B 2DWEB 3FFCD 1TCRA 4EIZC 1XCTA 4R26H 3BKJL 1G84A 2Y06H 3VFRA 1EHLL 3HNSH 1FNSH 4LNRB 5MP6H 5EBGA 1J1PL 5HHNB 4L4VE 1RIVL 3ROOB 4X99B 3RGVD 1T03L 4NOBA 1DQJA 5FHAH 3MREA 1EJ6A 2PO6B 3UTTB 4NHCH 3IRPX 3N1MC 1D5BA 4CADB 1T0MA 5IB3A 4WNQB 1QTYT 3MYJA 1BGXL 3VXRB 2BNRA 4E5XA 3O4LA 3P9MA 1FVDA 5E56A 4APQD 4JRYE 1AHWB 3QRGL 4PJFF 5C7XL 5E6IB 2C4XA 1A21A 5DYOA 5J13C 4KK5C 4XTRC 4YC2C 3EDKA 3KHQA 5H8DA 3VRJA 4OFIA 1EFXA 3PWLB 3RWEA 2NZ9C 5E8NB 4QXGL 1YEDB 4QRQB 5BZWB 4P57A 3DSFH 1FRGL 1SY6A 4PBXA 1OB1B 1EHXA 3RVXD 2I60H 4YR6A 1DLHB 4C4KO 1UYWH 2HJFB 1KG0A 4N9GA 3BP7A 5DC0A 3BPOC 1LHZA 2E8YA 1JTPA 2VDNH 3G6JA 5C07A 2XPGB 1P9MA 1U8HA 3T0AA 1NMAH 2DQHH 1S7RB 4ISVA 4K9EC 2BNUB 4WDIB 4G42A 3MBED 4NKMA 4NKIH 4NQTA 1DSFH 1CE1H 1FGNH 2XNAA 2DQGH 1G9MC 5ENWA 5C8JB 1ZA3B 1E6JL 2JB5H 5DS8A 5JXED 5HI3C 5ISZD 2PW1B 2DIJA 3BD4A 4U3CA 1XF5A 3CAFA 4W4NA 3MXVH 1QRKA 4P5TD 5I19H 1VGEL 5GGUB 4YHZL 4P23A 3GMOA 4LAJH 2PNDA 4DN3H 3LH2H 4FQXB 5I66B 4P5MB 2I27N 1MUJB 1AKJB 2ADIB 1NGWA 1KUMA 1CS6A 4PJDE 1HI6B 3D9AH 4JFDE 1RIUL 4OB5L 3QXUA 4M02A 4EUPH 1EEUA 4LKXB 3VDBA 1F4YH 3EOTH 4ALAH 5J11C 1UM4H 4FFYH 5AAMA 3GJFB 5CEZL 3FONA 4M7LT 1DDHA 3BKJH 4S11A 1FGVL 1DQLL 1UQSB 4G6AD 3MMEB 4DVRL 5IEKA 5GS2D 5JA8B 1J1PH 3NIFF 1SYSA 3SE4A 1VA9A 1IGTA 3QQ3B 1EGJH 2Z31B 1RIVH 2X1PA 1KTDB 1FC1A 3MACH 2ESVA 3U6RA 3K1DA 3NAAL 3H0TB 1BP3B 4NUJA 2DICA 2HLFD 4ZFGL 5F7HA 1T66D 4HXAL 1P1ZA 3REVA 5ESAB 1J0ZA 1IMHC 1MHHA 3LVEA 5E5UB 3QUZA 3VJ6B 4QRSA 3D0VB 5E0QA 4ZS7H 5HYEA 1AGEB 3D69A 3R1GH 5CEZE 5D1QD 3E6HB 1FP5A 4PJFB 2XKSA 5HDLA 3G5YB 1QOKA 1AR1D 3W11D 3SDAD 3VMOA 3VGDA 2ZP0T 4N8VG 3WLWC 3QHFL 4EZMA 2DN7A 1ADQH 2W9EH 3TWCH 4AEIL 3T1WA 5C09A 3EOAB 3P0GB 1RQ5A 1I8KB 5GS1A 4QXGH 5GQBA 4TRPL 4KUCF 4YNYA 3GSXA 3RVUD 1EVUA 4ZTPH 3FFDA 1GPOL 1J5OL 5CZKA 5T3XE 1BZ9A 3GHEH 3P9WB 1KCUH 4HWZB 5GGSY 2F5BL 5D1XA 2OR9L 3B5HA 3ROLB 2BDNL 5GRZA 4OF8A 3D18B 4HUUA 1LMKA 4DZBA 2CKNA 3LZFH 4U7KA 1IAKA 1NUFA 3BHBA 3IDNA 1IGYB 3K46A 5F7LB 3A6BL 4P99A 3BMVA 4X0KB 1HOCB 3AS1A 4HF5H 1CICC 2XXMB 5CJ5A 5ECJE 1ZK9A 2KZWA 3BUTA 4OLXH 4WTWA 3ZDYF 4MZ3A 4F2MB 4L5FL 5MEOB 4Y19B 3VWKB 5CJXC 1WITA 2SEBA 2Q87A 4MYWB 4HIIA 3I9GH 2HRLA 3NZ8B 3Q0HA 4HKZA 4KRNA 1L0QA 4MXQD 5KSUA 5LXGH 3P40A 5FYKL 4HXBL 3WNPA 5HYQB 4L4VA 2NQCA 2F58H 4QHUA 4PJBF 4GAJL 5BW7A 2Q7YB 2KH2B 2VE6A 3ILQC 4OB5H 3MRIB 1S9VB 2XZQH 1HZHH 3LQZB 1G7MB 1K5NA 3BWUC 1YNTB 4GW4A 4LFHG 4MAYD 3PL6C 4NN6B 1GC1H 3BVNA 2F5AL 5CEZH 3UTSB 1FGVH 1PZ5A 4CUCA 3EFFA 2NPLX 5JIPA 3CXDH 3TGXA 5A16B 1SEQH 2DQFA 2VABB 4JRYA 1AGFB 4O5LH 3U2SB 5B8CB 1IL1A 1NAML 1U8KA 3MV8D 4WUUA 3MOAL 1Z0NA 1I8MA 5E99L 3MNWB 2XKNA 1EGJA 5IVXF 3CFBA 4XZUA 3MUJA 3PGFL 4X7DC 4Y5YA 1AIFB 4FMFA 1LK3H 4JHZA 2AXGA 4YBHA 1A6ZA 1IBGH 3PXJA 3T1FA 5IOPA 1HHIA 5T3XH 2NX5D 1ZT1A 5DUPL 4FQCH 3DX6A 2FJHB 3MCLH 3S5LA 3CC5B 1L9NA 2NY5C 5FOJA 4P0DA 1KJ2B 3BIKA 1BBJA 1H0DA 3V6OC 3BOVA 3O8XB 4IM8A 5AWNH 1NGPL 1XCQA 3OSKA 1MLCA 2ITCB 3QHFH 3VH8B 2LFGA 3D3VB 2DI8A 3PWNA 4HUXB 1F58H 1QBBA 5FYJD 5JW3H 2XXCB 4HJGA 5KAQF 4M6OH 1ADQA 2P8PB 5EC2A 3DO3A 4ZUVB 2IQ9L 1UVQA 4XAKD 1GPOH 4QRTA 4YUEL 3M17A 2XZZA 3LEYH 5FYLD 5F6HJ 2GAZB 1D5ZA 4QRPD 3VFGL 1JRHL 1JI1A 4Y1AB 4W6YB 1T7YA 3WXVL 1IGJB 5LKNA 3FB7A 1MPAL 3A6BH 2HJKB 5L0QC 4PJDA 3DBXB 4U6TA 4JFDA 1HILB 4KVCH 1A14L 4FFVC 4I0PD 5CGYC 3VRIA 3S88L 3UEZA 4AH2B 1BZ7A 3CFKA 5I0DA 5T5FH 2M2DA 4LCWB 1GGCH 3U36A 4RGNB 4N5EC 2R0LL 5F1IB 2LTQB 5D1ZB 2D0HA 4HXBH 1QLRB 1WLHA 4PJBB 3RDTB 4AJ0A 2AEQL 2Z8VC 5C0BE 2BVQB 5C0IA 1FHGA 3RA7H 1CDUA 3KYKL 2BCKA 2J8UE 2BNQB 1JI2A 4OCWL 2NY0D 4XWOC 3WKML 4WJ5A 4WHCA 2UZIL 3KPSA 2FGZA 2NLJB 4OZ4A 1NFDF 1AXTL 1C5DA 4UNUA 35C8L 5IVZA 4HFUL 1X7QB 2ADGB 4N0RA 3T0EC 3BKML 4U1KA 5FDWA 4S0SD 5JPMA 1AD9B 3MRHA 5E99H 2E7MA 4GMSL 5EDXA 2VNCA 1AGBB 5IVXB 3ME0A 2VXTH 3CZJA 2X1OA 4OLZL 3PGFH 1MFBL 4I3RL 3CFEB 4OD1H 4FTVB 2DBJA 1K4DA 1ZT7A 4AQOA 1AGDB 5KS9A 1NCDL 1MI5B 3FQUA 3ALWA 1PEWA 3QEHB 4ENEC 2QQNH 2VDML 2GI7A 5A2JH 4PJ5E 3AS0A 5DHVH 5E9DE 3C60C 4D8PB 1MWAB 3PIQA 4ZUSB 4XAWL 3WIHL 2OTWB 1T5XA 3PNWB 5HJ3B 2YD3A 3MA7B 2H9GA 4NWTL 4JN2A 2R0ZL 5EU6E 4M03A 4JFEA 3I3DA 3GJFK 3LPGA 2PO6D 1FYTB 3UTTD 5DI8A 3O41A 1ZS8A 5TQ2H 3JVGC 2WINB 3G9AB 4U1MA 1A6VH 2J12B 2IQ9H 2DQCL 4J23A 4GKZB 2G75B 1KENL 2XZAL 5BRZB 3VXRD 4Q9RL 1I7RA 5F89A 4YHLL 1QEWA 4CVXA 1GAFL 4OI7A 1NCAH 3LRSA 4KK9D 3VFGH 1NGQL 4R0LB 2IAMC 4HFWA 1CTOA 3SO3C 3ZE1F 3CDGA 5KSBE 4R2GD 4KROC 5KN5B 2NY4D 4Y16A 1CE6B 4UU9B 4V1DD 3TBSB 3BO8A 3IDYB 1KSRA 3S4SA 3WXVH 4ZQKA 2YD1A 3H7LA 4JRXD 1G6RB 3DV6A 5GGTL 1A14H 3CLFH 1CI5A 4Q58C 3H9HB 1UT9A 1TJHH 3S88H 3W9EA 3PWVA 4F3FB 3OJVC 5D8JH 4UOJA 3MRCB 3ULUL 3LS4H 3PGDB 5I6XB 3TT1L 3RQ3A 3QUKA 3VFPA 1AQKL 3MRPA 4X9IA 4PGJA 3IU3A 3UZQA 2F54E 3F58L 5IHZB 1B6DA 3C5ZD 5DD3H 1G7QA 1K2DA 1LDPL 3QDGB 4JG0L 5SWQB 3VH8G 3QJFA 4O51A 5IG7B 1T1YB 4Z7UF 3AMKA 3VXQA 5KSAC 3H3BC 2HKFL 3QR2A 3HAEB 3B8SA 4QWWD 3WKMH 4Z0BL 3VWJB 4PRNA 3SOBH 4LVNB 5LGKA 2QADD 5GGRY 3O6KL 1UZ6F 3P30H 4NQVA 1NFDB 3CXHJ 3ULUE 5EIIB 1XIWB 4ORGB 5FGCB 3T8XA 2NY7H 3MRRB 3PXHA 3T3MF 4TQEH 1OQXA 4M5ZH 3CU7A 2MFNA 4A2MA 5LBSH 4Z7NE 4X4YA 2JCCE 1A1OA 5EOQH 1I3GH 4OLZH 1FV1A 1MFBH 4I3RH 3FO9A 4MD0A 1KN2L 5E08L 3B9DA 1MHEB 3TBTA 2MKWA 4XPBL 4D0CB 3MLSL 1ZHBB 3JTSA 1I3RB 5IIEA 4P3WA 5EBWA 4DKFH 4OGYH 4RMSA 4NRYB 1F3RB 1NC2A 1M6OA 1S7VB 2XFXA 5DSCA 4LLUA 2HT3C 1F97A 5F9JA 5ACLA 5ESQA 3GSOA 5IK3A 1ZVYA 4QTIL 4XAWH 1FZKA 2F74B 2OQJB 1CN4A 3FQWB 5HHVH 4YHNA 4L8CB 1HWHB 4YHML 1I1YA 4NWTH 5DHVA 4IRJB 5I30L 4PB9L 1UH3A 3DV4A 4LF3B 1QQDA 1F3DJ 4GRWF 4LEOB 2DQCH 3FRPG 3O11A 3KDMA 3C2AL 2QSCH 4OV5A 4Q0XL 2W9LA 5DJXA 4ZNCD 1BFOB 4XP1L 5F7EL 4F7CA 5J7CC 4UQ3A 3RL1B 2X4OA 4P9HC 3FB8B 1KCSL 3N1FC 4OGAC 2JF1A 3P4MA 3GSVA 3VXPA 4APQC 3LMJH 3MRQA 2IH3B 5DURB 3MRNB 5FUOL 5L9DH 4M7KH 2X4RA 1TQBC 3IS1X 1KIQB 5C0BA 4JZOA 5KW9L 4IMLA 4HH9B 5F7FA 1F4XH 1KB5L 4GBXA 2MJWA 2K7PA 1K8IA 4LIQL 5B4MD 3HG1E 2J8UA 3MUHL 3CSBA 4FOMA 1K4CA 4K07A 5HHQA 2DJSA 3DXAB 2V2XA 1RJZA 2AABL 3ALXA 1HNFA 2E27L 3KXFE 3B9AA 3QG6B 3F58H 3IJYA 2J1KA 2CIKA 2A6IB 4Z7UB 2DS4A 4WFGE 4XP4H 2VZVA 3IJHA 5HGHA 5KAQG 1OY3B 4C56E 2CDFA 3EDJA 3Q6GH 4XP9L 3D25A 5FO7A 3MBEC 4HD9A 3HLAB 3FT2B 4N0UE 3I3EA 4LIQE 1WFUA 3OJ2C 1CG9B 4Y19D 3VWKD 5J8OA 5FM4A 3JWDL 2FHCA 5JXEC 2X4UB 4CL7A 1MVUB 5F6IC 5JIKA 4XX1G 1ZV5A 3A6CL 5LGJB 4PP2B 5GRVK 3AB0C 4PD4J 4PJ5A 4JE4B 5GJSL 1PKQB 1LO0H 3K80A 4YWGL 1N7MH 1ORQB 1EEYB 5E9DA 4XBEL 3DOSA 3BE1L 2ICWB 3VFUA 4AMKL 3PDDA 4HV8A 1T7WA 4XPBH 1AY1L 5EU6A 1OVZA 3VGAC 4BA8A 5DTFA 2VYRE 3DI2B 3CPLA 4M9OA 4WEBL 4JO4L 1A2YA 3QO0A 3PDGA 2D3VA 4LCCB 4P2RA 3UTSD 4S1QL 3VFNB 5J6GA 4WGWB 3RWHA 4I48A 3QUYC 3T77A 1CD8A 2YPVL 3ARBC 1U8OB 1B4JL 4UUJB 1YJDL 4ZOEA 5KSBA 4OSUL 1HCFX 2O5XL 1BF2A 1D5XB 5I30H 3GMLA 4PJGE 4PB9H 2AEIT 1NCBL 1WFNA 4NRZA 3MOBH 3S9DB 3HRZB 5B38B 3PWJB 2YA1A 3HAEG 2BRRL 1BQSA 4GRWB 2EH8H 4RAVB 3WJJC 1DVFD 3GI9L 1KLUA 1T66C 1UXSA 2WWKO 4XNUL 2ZZUT 1U8MA 2MCPL 4H5SA 1DBBH 5K59E 4XP1H 2AEWA 3PWUA 5IHLB 1RU9L 4KKLC 3IDJA 4P4KD 1PD6A 3MV9E 4NQSA 3ZMRA 1RVFL 1MCWM 5CHNB 4DEPB 5D1QC 2BMKB 4YDLB 5F88A 3D3VD 1VFBB 1AR1C 3W11C 1DLFL 5I17A 3KWWB 2FRGP 5KZCD 1OF2A 5C0AB 1EEZA 3BZ4B 4LIQH 2ZPKH 1LEIA 4U7MA 4JFFD 1ZT4B 1ZWIA 3EYUL 1R3IL 3KPRE 2ZKHL 1U8QA 3W5MA 1AXIB 2AABH 1S9WB 2Q76A 3DJ9A 2C7UB 1SHMA 1W0YT 4TVSa 2E7LC 5ERWA 3VGHA 2QHLA 1FBIH 3SGEI 1CLZL 4Y4HC 2NXYC 1KFAL 2CIIB 5IKCA 1ED3B 3G5ZB 4NNPL 2AVGA 3HZYB 4YDIH 5F44A 3EYSH 2JCCA 3RWJA 1T7VA 3NA9L 1PSKH 4JFXA 5IBTL 4NJ9L 1X9QA 2DTSA 2BXZA 12E8L 2OMBA 3U7AA 2Y25A 3RWIA 4EN3D 1H8OA 4PY8I 4ONHB 1NMCC 5HY9B 5GGVL 3JWDH 5GISH 5BJTA 1QYGH 1BQUA 2BC4B 3VXOB 5DWUL 1V7NH 5F9WC 1S7QB 3LKQA 2AQ2A 4WFEE 5IJVB 3S3SA 3EDFA 2EDJA 4TSCL 3ZL4H 1PZUB 3LKNB 5IMOA 3BGAA 1DANT 4X6DF 3UBXA 5DDHB 3MLZL 4MXQC 2J4WH 3QIBB 4MVBD 2AQ1A 3TVMC 4JZJC 1S9XB 4PLNC 1EJOL 4PJ8D 2FD6L 3CIQA 3MV7B 5KTEL 5DD1L 2N7BA 5ETUB 4JJHA 4O4YL 3HZKA 4XXDA 4X9HA 5FM8A 3TCLA 2XV6B 1ZLWH 4WEBH 4DCQB 2BNQD 4JO4H 3SDDA 4FNLL 3VI3E 4ODBD 1A6AB 3F12B 4MNQE 1U58B 3CVHL 3VA2C 1SJEB 3MZGB 1ZHKB 4MAYC 5I15L 3GK8H 1BEYH 1B4JH 3O6MH 5JUEH 1TQCB 3OXSA 3RKDD 3D87B 5AG8A 4F7MB 3LV3A 1TJIL 2O5XH 4XPHL 4CVZA 1V05A 2VDQH 1P84K 3H9SB 4X7TA 5TDNA 1LQSR 1M05B 2VDLH 1YDPB 5FOBB 1KBGH 4FTVD 4PRPE 4FFZL 4YDKL 4JPKL 3TESA 5TPWH 3HG1A 4LLVB 3WIIH 3D85D 1MI5D 3BMWA 1JZ5A 1WEJH 5HI5D 4BZ1H 5F7DA 4EEEA 1JNHB 1PW3A 1RU9H 1W0VB 2R29L 4O2FA 1R3JA 4EDWH 3JV0A 1GJIA 2Q6WB 3TIEB 4UDTB 3KS0J 3C8KB 3FT4A 1KPRA 1FORL 1Z5LA 3QXWA 1D9KD 4YHKH 4HAGA 4MA3B 1KEGH 1ZAGA 3RVTC 3EAKA 4WO4A 4C56A 5GS0D 1A6TB 3MV01 4G3YL 1KJ3H 4YO0A 4NJAL 4QT5A 4YLQT 3RI5K 4N0UA 1KIRA 1XH3B 1ONQB 4GLRH 1JYXA 1OLZA 3NIGF 5FA3A 3O3BB 1CLZH 5DF0A 4WW2A 5CJXA 2ORBL 3MJ7A 5F3BA 5L2JB 2EDTA 5LG1A 4HJ0D 5HGGS 2R4SH 2P1YA 1RZ7L 4PJHE 1OM3L 1Y18B 1WBZB 4PR5B 4ZFOA 5IBTH 3AMLA 5B38G 4G9FE 3U46A 1KTLB 3FB6B 5IFAH 3PF2A 1H5BB 3U82B 1ORSA 4ZAKA 5BS0E 3NIDE 1TPXC 3AVEA 3G6JF 5D71L 3BP6B 2P8MA 2HKHL 4L8BA 5DWUH 2AJ3B 1CL7L 3PL6A 3L9RB 3BRFA 2LU7A 3DMMA 2PUQT 2BVUA 2FYYA 5DVLA 2R2HB 4RGMB 4TSCH 2D31B 2EYRB 1RJYA 3P11L 3U1SL 2APTA 1FVCA 4LVOC 4PJ9B 2R56L 3QDGD 1YZZA 5FV1L 3ISWA 5FUZL 2PCPB 4DAGL 4U1JA 3CDCA 3MLVL 2FD6H 2DBLH 3D39D 5KTEH 4NFCA 1XEDA 4OLVH 4ORZC 1UACL 1RZJH 3D0LA 4MQ7B 4OFYD 1U92A 2YBRB 4GW5A 2QHRL 4G9DB 1ES0A 1FNFA 4IHOB 3L7EB 4M7ZC 3CVHH 3IS0X 1QNZL 5DMJB 5FF6B 3T0DA 3O3AA 2LAGB 5TDOA 4HAFA 2B4CL 1A7RL 3HMWL 1XIWD 2NY0C 2FBJL 3MXWH 3HKFA 5ID1A 1V3LA 3L3KB 2HVJA 5DK2B 1VEMA 3IAQA 4L3EE 5EN2B 2B39A 1C8PA 1TJIH 2D7QA 3MV9A 4FQJH 3MV11 4TSAL 3IDXL 1OAKL 2NTSP 1IC5L 1M7DA 3TA3B 4Y5VB 2DOCA 1XCTB 2J8OA 2NXZB 5E8DH 2C1PA 4K71B 2K9UA 4YDKH 3BRDA 1NDGA 4JPKH 1BZQK 3SGKC 3DVGA 2ZOKB 4KI5F 1T21A 5JMOC 5DD0H 3V5DA 3RZCD 1MCBA 1H3WM 1X5GA 4QRRD 2A77L 2E9JA 1I8IA 1FL3A 2V9QA 4L8DA 1D5BB 4C57C 2OM5A 2VXUH 3QFDA 3HI6H 5HPOA 4JY6B 1QO3A 4IRJD 4UI2A 2VLMD 1T1ZA 1DEEA 1F4HA 4X5LA 4NKDA 4X4XB 5GRUH 4PV8B 3P9MB 1FVDB 1XGUA 4G3YH 1NPUA 2YEZB 1CFNA 2RJMA 5I1EL 1GSMA 4XNZC 4F58H 5FGRA 5DYOB 3AFLA 2I9LA 3FQRA 5MI0C 2IBGA 3HC0B 1BVKA 3VRJB 3WN5A 2JK5A 3CX5J 3X3GL 1VPOH 3F6IA 3UROR 3HFML 4Y4KB 5I1GL 4YR6B 1UB5A 2C3WA 4S2SA 3GUTA 1S5IH 4LSVH 4R2GC 2NY4C 3BP4A 3DRTA 1MCQA 3GI8L 2PXYD 4ELKA 4R8WL 3D48R 5C07B 3MLUH 4QHNB 5FCSH 1U8HB 3WXWH 4W6WB 1CL7H 4MNQA 4GW1B 4U3HA 1BIHA 3MROA 5AZEH 1WGOA 2XWTA 5JOEA 3RJDA 5ENWB 2R56H 4HT1H 1YQVL 1B4RA 4NYLA 4OUUA 3ZE2E 5FUZH 4PPTA 4DAGH 4CNIB 2AKRA 2AERT 4R97C 3C5ZC 3S35H 1OAQL 4JQIH 1D6EB 3P4LA 4OM0L 1QACA 4PRPA 4EOWH 4IRSD 4XP5H 1BX2B 3CH1A 4JO2H 4P23B 5F1SA 1HSAB 2OS7A 3WJLA 1QNZH 2HAZA 5DMIH 3J7HA 4LVEA 4MJ5A 2B4CH 4QWWC 1EIBA 3EYOB 2FX8L 2FBJH 1NGWB 5JHDB 1WVZA 5A1AA 3CVHA 4B7LA 3JWNC 3DURA 4XNXH 2W60B 2QADC 4NSKA 5ISZE 4EI6B 4MHHG 5DJZA 1UENA 2X6MA 1A0QH 2KUTA 1IC5H 4PREB 3UO1H 1FFPA 3FONB 1DDHB 5T1LA 2APBA 2NR6C 4TNVK 3QA3A 1WICA 1IT9H 2WBJB 3BPNB 5HYSA 3IDMA 1AXSA 5DVNA 4Z77A 5K9JH 1AO7A 5EU4A 2HJLA 2FECI 1MH5A 5EU7E 4JLRA 3X14A 3G6AB 3V2AR 2IBZY 2VC2H 4B7IA 2NY2D 5CJQH 3U6RB 1RPQA 1IKNC 3KPMB 3PWPA 5ALCL 1YEFL 4NUJB 3OR6A 5D96C 4YGVB 1KPUA 5EORL 2EC9U 1RFDL 2EDHA 2W65B 4POZC 1ZANL 2LAAA 4NO3B 5E4EC 1K3ZA 1MHHB 2KBGA 1AR2A 2EDKA 3V4PL 2IH1A 1QSEA 4PJHA 4TUJB 2UUDK 3UJIL 2IPTL 5C6PB 5D2NE 3EYFA 3RU8H 3D69B 5DA0B 2CXKA 1JHKL 1ZVSA 3KAAA 4G9FA 5IGXL 3C6LD 2IG2H 4OCRH 2E5EA 1IILE 5HHMD 5BS0A 3EO0B 5C08E 2P45B 1N8ZA 1MHCA 4OZIE 1KIPA 1J7VR 2D7MA 4F37F 2I5YH 4POYA 5TE6L 2X89A 5DMGD 4Q9BA 5C09B 4S1RH 1TVBA 4KTDL 3V0VA 3N9GL 2BHUA 4GRLA 5I1GH 4W70A 1YEEL 2APWA 4QF1A 4NUGL 4PGEA 5C0AD 3ZDZE 3GI8H 4JRWA 4DGVL 3QXAB 4B0MM 5D1XB 3MPCA 3LKSA 4MA1C 2CK0H 3EDDA 5C9KA 5M7QA 4HIJB 4GG6A 4HC1L 2FB4H 4DZBB 1FN4B 1IAKB 4DFIA 3W9DA 1QA9A 2DLGA 2XQYK 4PJDF 4L3EA 3EJYD 4XMPL 1RUAH 5IT2L 3BWAA 5H35A 3MYZA 4WV1B 3HE7D 3AUVA 2FR4A 3DI3B 1C16B 2SEBB 4JFHD 2BSSA 2Q8AL 3UYRL 3DETC 1DBAL 3MJ6A 1LO2H 3OAYK 4G43A 1HDMA 4IMKC 4KAQH 3AXLB 4ONFH 2ARJQ 2CKBL 3V5HA 1SVZA 1W72L 4DGIH 3VRLE 1IGFL 1JGUL 1EFQA 1Q9OB 5L88L 1UM5H 3DLQR 2CRMA 3GSNH 4XPTL 1WISA 4YPGA 1K5NB 5GS2H 1UKTA 5IB4A 3BVNB 3VXNB 4UZGA 3D5OF 1PZ5B 4CU7A 1CFSB 2V6HA 2GIYA 3KPOB 1JV5A 2W9DH 2DQFB 2BOCB 1YECL 1P7QB 3SBWC 4HMDA 3S8WA 1G7IA 3WUWB 1IL1B 3MUZ1 5CP7A 3RGVA 4K3JL 4WUUB 5EUKB 5M95B 1I8MB 1EVTC 1ZKAA 5ALCH 1OSPL 3PHOA 5TQ0L 4OF5A 2E9IA 1HKLL 2AI0L 1CDHA 2HN7A 3MRKB 2W91A 5CCKH 1XF2B 1A6ZB 5T1DL 5H37G 4YX2H 2IPTH 4YIQA 5KS9F 1ZT1B 1ZLUH 1A6UH 3FO1B 4APQA 2ZUSA 5FHBH 2DKMA 1DBML 1UJ3C 4M61B 3MV8E 1BBJB 3HE6A 4KQ3L 5A2KH 4UV4L 3BKYH 1KTKE 4UT9L 1XCQB 4M9PA 1WZMA 3OKDA 4BSWB 3W0WB 5IW1A 3CDYA 4LCIL 1QSFE 2YK1L 5DHYB 1FLTX 1NEUA 4HJGB 4KKCC 5F6HI 2VLKD 3QIUA 2CDEA 2R69L 1INQA 5EC2B 2DL2A 2FL5B 1PAMA 3OKMA 4P4KC 3WDIA 1W2KT 1UVQB 2W59A 4QXUL 1Q0XL 1J1OL 1M4KA 2DQIL 5BXFA 3M17B 3BDBA 4DGVH 1UGNA 1Q94A 3OJDA 1DQQA 1FSKC 2QEJA 4NCDA 3QDMD 3VFSB 1N0XH 4L3CA 4OF0A 4HHAA 4PJIE 5CGTA 4JDTL 1LP9A 2C3GA 3NPZB 5L2KD 4IIQC 3TH2T 5MEQA 3EFDL 3FB7B 4NNYA 2CPCA 4PJDB 5BVJB 5JZ7C 2VAAA 1MQ8A 1UB6B 1YN7A 2BX5A 2EO9A 3ULVF 2JJUA 2BXYA 3AS3A 1NBZB 3PP4L 4XAKE 5ISZA 4HG4K 2Z4QA 2YKLH 4P2QB 3VRIB 4QXWA 2MCG1 3CK0L 4JM2B 4P5TA 3GBNL 4OD2A 3SJVE 3V9FA 5I1CL 1OAZL 2BHZA 4X9GA 3JTTA 4Y2DD 2Q8AH 3QQ4A 3U36B 1YJDC 1LEGA 3FL7A 5DVOA 4Z0XB 2MSPA 3GBMH 4RISL 4FABH 3U9UB 2YA0A 1T89C 2D4DA 4OCSH 1YA5A 4EN3C 2FJGB 5C0IB 3ARVA 3QEGL 1N4XH 4YFEA 1JYVA 2C5DC 3CFDB 1N2RA 5KVDL 3IFPA 3GSNA 3KPSB 2CGRL 3TZVB 3ZLQC 1EHAA 1FJ1A 5D2NA 4ETQA 1C5DB 1YECH 2GSIA 3H3KA 5HDBE 4MVBC 1G1CA 3NN8A 4PJ8C 5C08A 4U1KB 1OLLA 1P2CB 2ATKA 3UTOA 5FDWB 4BQCA 5FV2A 3MRHB 1WBXA 4KK8D 4OZIA 1JFQH 1ODAA 3B9KD 3QIWD 5DUBB 5JO5A 4KY1L 3FCTB 1UWEH 8CGTA 3BQUB 3K4ZA 4PS4H 3SPVA 1ZT7B 1FZJB 4HKBA 5T1DH 5KS9B 2BVEA 1B0GA 3O9WB 1FFQA 3TA3D 4OGXL 1CZ8L 3DUSA 4L29A 4KGLA 1DBMH 2NXZD 4PV9B 4M7JL 1ZEAL 1KCRH 4KQ3H 3SDAA 4UV4H 1TJGL 3GIZL 5LGHL 4C4KT 2WLZA 1YYLL 4DQOL 1T5XB 4ODUB 1AI1H 2A74A 2YK1H 4HS3A 1HXMB 1YEHL 3NCEB 2DQUH 4JFEB 1M71B 5DI8B 1T6VN 5HI5C 2E7LA 2FGWH 3C09B 5E00A 3P73B 4K8RD 4U1MB 3DTXB 4ONGL 3H9ZA 5TF0A 4LP5A 3DNKA 1J1OH 1JGDA 2UVEA 3HNVH 1X5ZA 4I4WB 5F89B 1YEGH 4JN1H 1MF2L 3WHXA 4KKBD 4G7VH 4S1DD 1EBAA 1BBDH 4HFWB 3O6LH 1A02N 5GS0C 5EO9B 3IF1B 4Y16B 4JDTH 3R0NA 5CKAA 4LQ1A 3UTTE 4XWGL 3FQNA 4ZQKB 1Q38A 1SQ2N 5IESL 4JHAH 1RK1A 1V3KA 1HHHA 3O2DL 4ELMF 4L8SA 5IEHA 3VXRE 4YHYC 3RKPA 3VXSD 4F57H 3W9EB 2J8UF 3PWVB 3CK0H 5I1CH 4HJ0C 2OJEA 3QUKB 3KNBA 3VFPB 4WTZG 1XGRA 4UDUA 3L5WA 5ITFA 4RISH 2VKXA 4K94C 1G7QB 2FEDC 2ZUVA 4HLJA 5J89A 3QJFB 2B0SH 4L1HA 1X44A 3QHZL 4AG4L 3M45A 3QEGH 2XTJC 1FE8L 4LARL 5AYUL 5I76A 4NCC2 3E8UL 3IKKA 2EECA 4JPWL 2UY6A 3S98A 4H8WL 1DANU 3TF7C 3LHPL 1HSBB 4QOKD 4I9WE 5KVFH 5ABDE 3RVVD 1CFVH 5CJOL 2B1AL 5KVEH 2XRAH 4JCLA 3NMEA 2R0WL 4NQVB 3STLA 1E27A 2A73A 2IQAB 2R9HD 4NM8H 3T8XB 3MV8A 1JPFA 2GW5A 1R24A 1WAAF 4BQ6A 1NGYB 4OZHF 1A1OB 4DFHA 1FL6B 4BZ2H 2MHAA 5JHDD 1FV1B 1U3JA 3HUJE 1QSFA 3KYOB 1T0NA 1N64H 5TGBA 4M43H 1WTGT 1GH7A 3BESR 3GHBL 2VXQL 5HHXH 2BVPA 1TZHA 1GXEA 4MX7B 5EBWB 1A3QA 2CJUH 5MHSD 5BVPL 4XMKL 2EE6A 5FAAA 1HQ4A 4EBQH 1NC2B 1M6OB 1ZEAH 1YNLL 2XFXB 5DSCB 4JKPH 3IVKA 2OK0L 4UB0L 4X6FB 4A6YA 3GIZH 5F9JB 1YMHA 2P44B 4HQQL 4KI5D 2HLAB 3JWOC 5JHLL 5KSBF 3U9PH 2O93L 3MLRH 4ZS6C 5B39A 2HMIC 4PJXB 4PJIA 2OMNA 1YEHH 5DHVB 4CDHA 1MIML 5GJTH 1KC5L 2HG5A 5F71A 2AJVH 3DV4B 3WEXA 1HHKB 3RZCC 5JIIA 3KYNA 3FMGL 3FOMB 3O11B 3KDMB 4OV5B 1ZLSL 3QDHA 4C83B 3SJVA 2X4TA 5LCVH 4P59L 4QRPA 1RURH 4IOFC 3VFOB 2X4OB 5E94B 4U0RC 4F7EA 5T1KB 3I2CL 1MRDH 4G7YH 3TH3T 1LE5B 3BDXA 1IFHH 1BHGA 2HH0H 2O5ZH 4ZPTA 5TE4H 1PGRB 4LSSL 5DR5L 3RWCA 1U8PA 3O2DH 4IMLB 5E4IA 5TH2B 3IGAA 1L7IL 4I0PA 4ELMB 4GBXB 1BJ8A 2IFFH 4IOIA 1N5AA 3MLWL 2GJ6D 1KJMB 2D7OA 2H6PB 4Q6YA 3EOYG 3AROA 3SE3C 1RJZB 1Z3GH 3ZYJA 1B88A 4WWKD 2AJYH 3SE8L 4HWNA 2WWMD 1N6QL 4FQ1L 2ZUQB 3ES6B 4WWID 3IJYB 3OJMB 5IW6B 4U1GC 5F1NB 2J88L 2NCMA 2OP4L 2PXYC 3L7FA 3ARTA 2PR4L 2JCCF 4U31A 1NBYB 3W5NA 3LEVH 1XGPA 1RZKH 3IJHB 1DCLA 1FE8H 2UWEA 2DMKA 1RJLA 4ZXBB 2QKIA 2NW3A 5CINL 5FO7B 3GMNA 2J5LB 1YC7A 2R0KL 4ODWA 5GRYA 4U6HA 2ARJA 4Z18A 3GRWA 2GTZA 2JJSA 5IR1B 1JGVL 5CZXC 2R0WH 4JFYA 4JHWH 5CBEA 1BQLL 2QQQA 1Q72H 5BCAA 4DTGL 4N8VA 1GHFL 3KLHC 4LKCA 5EU5A 4OZHB 3P2TA 1EX0A 3S4SG 5IFHL 1A5FL 1KYOK 1NSNH 4IRSC 5INCB 4Z78A 1JWMA 1SEBB 1CXEA 2VDOL 3GJFH 5E5MB 1TVHB 4WI9A 1NKOA 1ZE3C 2ZCLL 2DWEA 1B9ZA 4NZRL 3CPLB 4XVJH 4HWEH 4Y19E 1KYOJ 2HTKD 1C7TA 3C6SA 1S5HA 4XMKH 3QO0B 4PJ7F 2NY1C 4P2RB 2VO5A 4JFPB 5J6GB 3FQTB 5HHNA 4X99A 4R4NC 1TFHA 1WZ1H 1AFVH 5J13B 2XZCH 1KC5H 2PO6A 4GH7B 3UTTA 5DQDL 1DJSA 1JN6B 2LVCA 2NY2C 1OAUL 3QUMH 4BFIB 5IJKA 4P46C 1I9IL 2KDGA 3CFCL 4XPGH 3S37H 3UTSE 3LQMA 3DWTA 1KJ2L 3QPXH 3VXRA 1OTSC 1UXSB 3AREC 3VXTA 2X70B 3N85H 3NIFE 4JDVA 4M1GL 3V4VL 1AHWA 3OKNB 3UXFA 5CJBA 5EWIL 1NBVH 3WFBL 5EIVA 4L4JA 3BPOB 4NQSB 2YMXL 4ODHL 3W39B 2PN5A 3C6LC 4OQ1A 2AXJA 3PWLA 5F88B 1G0DA 3W0WD 2D03L 3NCBB 4FXKB 4JRXA 1I1CA 1SYVB 5E8NA 5SWZB 1YEDA 4QRQA 5EZOH 5T3ZL 1F4WH 5GS3A 1L7IH 1OB1A 1T5WB 1G6VK 4RX4D 3EBAA 3MLWH 2VAJA 4X80H 2HJFA 3QCTH 5DMGC 3O2DA 4R9HA 1ZWIB 2H1PH 1EH9A 4CU6A 5A3ID 5BOPA 1QSZA 2X1QA 4LSTL 1LK2A 4JFZL 1VKXB 1T7ZA 3C5ZA 2IBZX 4UIKL 5ERWB 2XPGA 2FNBA 4GOSA 4WW2F 1S7RA 1CWVA 3F6LA 3D3VE 5CWSA 2BNUA 2OP4H 3RY4A 4HJJH 2PR4H 3EO9H 4M8QA 3KR3H 3RWJB 1QBMH 3ARWA 5D7SL 2UZXB 3FZUD 4JFXB 3HUJA 3MRBA 1U3HD 3QNYA 1ZA3A 3QAZC 4JFFE 4TSBL 4MLSA 5CINH 3RIFK 2Y36L 2YSSB 3EJZD 2VERN 3BAEL 2PW1A 4M6MH 1OARH 2WUBL 1R0AL 4ZD3L 4JM2D 5DFVD 2HT2D 5J11B 3OBAA 5GGUA 1A9EB 5IWLC 3WSQL 5SX5K 3QXTA 5I66A 2YD9A 4P5MA 1MUJA 5IMOB 2XY1A 2AGJL 2ADIA 3UBXB 3V6FA 4H20H 2VL5B 3G5VB 4LKXA 4OM1H 1ZLVH 3ZDYE 4K3DL 4NZRH 4XXDB 3TCLB 5DJ0B 4LCWE 3GJFA 2ZJSL 1H3VA 4PJ7B 4XNMB 2DAVA 1UQSA 2UYLB 3MMEA 5E2JA 3BH8B 2X9WA 2GSGB 3ZTNL 3LIZL 1I1AC 1K8DA 4G8GB 1JVKA 3QQ3A 4LLWA 3NOIA 3O3EB 2Z31A 1U93B 4OZGF 3H0TA 5CILL 3WO3B 3K2UL 1T22B 4N9OB 5ESAA 3ARDD 5DQDH 1JIBA 2BNQE 3PQYD 4KQ4H 3BQUD 1O7VA 3VJ6A 1AGEA 3QUMA 3WNNA 5I1HL 5EU3B 3E6HA 3V4VH 5I8OL 4GXVH 5EWIH 4JM4L 1JMXA 4KFZC 4KMLB 1RZFL 3U30C 4O2FB 3MOQA 4GG8A 3E3QC 1PLGH 5E8EA 3NCFB 4HZLB 3LS5L 3GMPB 3EOAA 1I8KA 1Z5LB 4ODVH 2KQMA 2M26A 4FTVE 2E9WA 1BM3L 4N0FA 2BY0A 2A0LD 1C5CL 1CL7I 5ALBL 4OJFL 5M94B 1MI5E 4U6YA 1KIRB 3TT3L 5D9SA 1CICB 3EOBB 4LSTH 4BK5A 4GRMA 2QSVA 1KB9K 4WW2B 5F3BB 2DMCA 3D18A 1I7ZA 4LCYA 4IDJL 1IGYA 1FYTE 3ZSSA 4ZFOB 3QRFM 5GXBB 2VDKL 5J9PB 1LNUB 1HOCA 4YXKH 4NT6A 2Y36H 3K81A 2FHFA 1ORSB 3ZTJG 3FOLB 4F2MA 5BRZE 5MEOA 1DFBL 4Y19A 3VWKA 2P8MB 1R0AH 3NFPA 2HFGH 4HIXH 4LSPL 4K3EH 1HEZB 3PL6B 3WSQH 2G60H 3DMMB 1M7IA 2FYYB 4OQTH 1CD9B 3DHJA 5DD6B 1FVCB 3BZDA 2AGJH 2Q7YA 1IVLA 1HKFA 1S9VA 1TVDA 3BDYH 2BVOB 1G7MA 4UINH 3MRLB 3D0LB 3MUGB 4RGOL 1U92B 1ES0B 3UTSA 3L1OH 4MA7L 1T0PB 5F7NC 5A16A 2VABA 3U2SA 1AGFA 4WUKL 4AEHL 5B8CA 4HH8A 5EA0H 3QDGE 5ID1B 3VFWB 2HVJB 4Y5XC 1R5VA 2VN4A 3MNWA 4OZGB 3LOWA 1IQWH 2V5SA 3K2UH 3WS6A 4D9QE 5HHOB 3KHOA 1D5IH 1H3UA 1M7DB 4XMLL 1KPVB 3VGEA 4QHMB 1RUPL 4HS6B 4BQ9A 1LO4L 1CGTA 4KK8C 2ITDA 1DVFA 1UH2A 3B9KC 3QIWC 4XC3H 1NDGB 3KJ6H 3QNXA 4TUKL 5I1HH 2LU3A 3DVGB 5FGCE 3MRGA 2J3SA 3HPLB 1MWAH 1BOYA 3V5DB 3I6GA 4JVUA 4BKLA 4RMWA 3O8XA 3CD4A 4D9RD 3T0VA 1I8IB 3UJTL 2L7JA 1FL3B 4X6BB 5LWYL 4L8DB 1INDL 1FCCA 3VH8A 5GS0H 3QFDB 3D3VA 4HUXA 3UBXG 1NUDA 2WZPD 2DD8H 4H25B 1QO3B 5FGSA 1BM3H 4N0YH 4NKDB 2P8PA 4ZUWA 1PKOA 3U4EA 4EXPX 1CFNB 4JFFA 5ADPH 1OTUD 4ZUVA 3RWGB 5IF0B 2F53B 4HWBL 5L0QB 4ZODA 3V6ZB 2CLVB 5GGVY 2I9LB 4PYGA 5DLML 4TUOA 4HUNB 3MUY1 1X6LA 1BVKB 4NZJA 2GAZA 2JK5B 4JO1H 3NTCL 1CFTA 5DRWB 3PABB 4JR9H 1QSVA 1J11A 1G6RH 4ZSOB 2VLME 2FX7L 4IDJH 1Q9KB 4OZFH 4KKBC 1DQDH 3VD9A 3ZT6A 1UB5B 5D93C 4S2SB 2HJKA 1CBVL 3GUTB 3DBXA 1T89A 2EDFA 4JB9H 1HILA 3ZT5A 5ILTH 4TOYH 3GSQA 3UTQA 3RGHA 1DZBA 4W4OC 3MR9B 1DFBH 4AH2A 4I2XE 4ELKB 4PRHD 4NQXB 6CGTA 5JR1L 2Q8BL 4LSPH 3REWA 4MNQB 1NFIA 5F1IA 4X98B 3ZE1E 4GG6F 3MLXL 2V9RA 3I6LD 5CD5D 1QLRA 3S6CA 4D9LL 3TIDB 1TCMA 4NYLB 4OUUB 4OQTA 4UT7L 1L9MA 2F8VA 4NZDA 1URLA 1YPZF 3T0EB 5D70H 3HAEH 4PRAA 1IC4L 3KG5A 3IFNL 4LHUB 3HR6A 1BVLB 4R4FH 2KQNA 4ZXBD 2IGFL 2BNQA 1QFWM 4K3HA 3V0WL 3PV7A 5ANMA 2NLJA 4ZYKA 4R7NB 4LPUA 1KACB 1UEYA 1X7QA 1SJXA 1F8TL 1Y0LA 2ADGA 2JKXA 4YDJB 3QB7C 4NSKB 1AD9A 1P4BL 1LD9B 2WWKT 5BOZG 1DE4B 2P5EB 1Z9SA 1U8JB 1EO8H 2R9HC 1DUYB 2FO4B 3CFEA 3OG4B 3C60B 5DK0B 2VRAA 3HI5L 1LO4H 4FTVA 1MFEL 4NDMA 4OCYL 4TVPL 3QA3B 1J1XH 1AGDA 1NCWL 3IDMB 5SX4H 4DWHA 3QCVL 2FWOB 1AXSB 4Z77B 1AO7B 2HJLB 1UZ6E 3X12B 1MI5A 4TULL 3WFDH 3OKLB 3X14B 3QEHA 2OL3B 1E6OH 3T3ME 5J56B 3PWPB 1PKQE 3QDJD 2PF6A 4OLEA 1BJ1H 2EE9A 3OHXA 4XHQA 4D8PA 1MWAA 4HMCA 1J8HD 4ZUSA 3A67L 3ARQA 1YMMD 2AV7B 3MA7A 1WV7T 1D9KA 5JIHA 2IH1B 1QSEB 2MQ3A 2IAMB 5DQJA 4KK5D 3SO3B 1DUZA 3EYFB 1FYTA 5E6YA 4KROB 1B2WH 1A7QL 1RUMH 1ZVSB 2ZG1A 1AJ7H 1VB9A 5KANG 5K9KB 4KUZL 4GKZA 3S34H 2G75A 1N8ZB 1MHCB 1NANI 1SMAA 5LAXB 1OAYH 1BVZA 4HGWA 4JQXC 5F7KC 2YPKA 2QQKL 1BAFH 3OAZK 1TVBB 1CE6A 4H8WC 1CDCA 1JZ6A 2F19H 4YE4L 1F90H 3ZE2F 5DUML 4QF1B 4U6VL 1G6RA 2GKIA 3VXMB 4BQ8A 4PGEB 2CLZB 4GRWE 2VTFA 3HS0B 4OZFA 4DKEL 3CH8A 3H9HA 1CF8H 5DJDB 1A7NH 4WW1B 5JR1H 2QTEA 3MRCA 2Q8BH 2DM2A 3PGDA 1OTTC 4D94A 3OQ3B 1XZ0A 2H26B 4Z9KB 4MA8L 4GG6B 1LP9F 3MLXH 4R96A 5IHZA 5C0RL 4ZPVB 2VSDA 1IZJA 3QDGA 5SWQA 4NC1C 4U6XA 1T1YA 1V3MA 1YPZB 4WWKC 2WWMC 4XCCH 1QFPA 5C0AE 3D39A 4F9PA 4X6CB 2FR4B 3IFNH 3VG0H 1PX4A 3HAEA 1UWXK 2UV3A 2BSSB 4H0GA 5EB9A 1HDMB 3VE0A 1SM3H 3MRFA 5AZ2L 4DN4H 5HDOA 5EIIA 5CD3B 1XIWA 3QQNA 4JANB 4ORGA 5IB5B 5DGRA 1F8TH 3OGOE 5ESVA 3V5HB 3MRRA 3QFJD 1MCOL 1RULL 2FEEL 4D3CL 3FT3B 3NZHL 2AK1H 4GQ9L 4KTEH 4UTAL 5DJ6A 1J0JA 1CVRA 2BVYA 3FFCB 5BV7L 4O9HH 5IB4B 1MHEA 1YEKL 4JFHE 4D0CA 5C6WH 4RZCB 3BIAX 5EZIL 1MFEH 4PRDB 5DJ8B 1NCWH 1CK0L 3KLAB 3QCVH 1J0HA 4GXUM 5BQ7A 4LSRH 4JQVA 3RZCA 3VD4A 1S7VA 2GFBA 5CSZB 4Z95H 4G8GD 1I7TB 3TP4A 2HTKC 1G9NL 1EDQA 2OQJA 2F74A 4QGTA 3A67H 4L8CA 1LDSA 1LILA 5E2TL 3ARGD 1JHTA 2N4IA 4IRJA 1T04B 4GRWH 3MV7E 4YIQB 4LF3A 4APQB 3WLWD 4LEOA 3LQAL 4O02L 3ZDZF 3R8BB 1TQBB 2CUHA 1JUFB 3DUUA 4I2XA 3CCHB 1AQDA 3OKDB 1N6UA 3RL1A 5IW1B 3FB8A 4RMUA 2AJXH 1B0RA 5E1AB 4ZO7A 1SBSL 5K9OB 4KC3B 3H9SE 5L7XL 1MFDL 1WT5A 5DUMH 3OKMB 4Q9QL 2QV2A 1QFUL 3QQ9D 4NOFA 1L7TL 4HH9A 4KJQC 4DKEH 5BXFB 1KCVL 5D6DC 5HYSG 4DW2L 3WD5H 3OJDB 1DQQB 3IDIB 5I9QC 1EXUB 2IF7A 1A7PL 5FYKU 1E28B 4MQTB 5IMLB 5FYJU 1XT5A 1CICD 3MBEB 5MEPB 4Z7VB 4MA8H 3QG6A 1M7XA 1CGYA 4MNGA 1LP9B 2VLKE 5C0RH 2RAMA 3PUCA 5A3IC 5CSBA 4NZUH 4NNYB 4PGCB 2DRUA 1CXIA 2J7LA 2A6IA 3GDBA 5F6IB 1YN7B 1MLBB 1VENA 3AB0B 5J1TC 4L4TD 5IB2B 4U1LB 1I9RH 3ZYZA 4P5TB 4OD2B 4YFDB 5F96H 3IKCB 4GSDL 3HLAA 3FT2A 2COQA 5H94B 2XQBL 1CG9A 1FAKT 4PUBH 3VGAB 2LE9A 2X41A 2IAND 5L2KE 2GJJA 2X4UA 1MAMH 2YC1B 1IC7H 1T2XA 3EJZC 3SKMB 4PP2A 1PKQA 4D3CH 1QRND 4GXUN 4GQ9H 1ORQA 1EEYA 4Y8DC 5F8RC 2Z93A 4MD4A 3ARBB 2ICWA 2V7HB 1UWGL 4IBLT 3IFPB 5T33L 1OGAD 2WMPA 3GSNB 2UUDH 4Z76B 2HWZL 5EZIH 1KN4H 4HGKC 4WFHD 3CMOL 3WFEL 4LCCA 2CR3A 4CKVX 5EFIA 3VFNA 4R90H 1IEBA 3WFZA 3TYGH 1U8OA 1EAPA 4KJWD 4NP4L 4UQ2B 4UUJA 2AJUH 4RFEB 4QYOA 25C8L 2N7AA 2Y1VA 3GKZA 3MBXL 5FGBC 4OKDA 2C26A 5TF1H 5GHWH 4Z8FL 1D5XA 4HKBB 4QKXB 3AY4A 4ACPA 5JDSB 1B0GB 4KRPD 3NFSH 3PWJA 5D1QB 3ZO0A 4MJID 5ICYA 3DYMA 1E0OB 2AXHA 4RA0C 4MQXD 5HBBA 3ARDC 2X4QA 5CBAA 1HYSD 4LL9A 1HQRB 1T2QH 3DUHA 3KYMB 5JDJA 1KT2B 2A74B 4PJIF 4HS3B 4LAQL 5E2WL 2JE8A 4CMHC 2GITB 1GIGL 2DDQL 1YNKH 4M5YH 4NO5A 2BMKA 2GJZA 3EYQC 4RGNC 4WY7H 5L7XH 3O2VL 2Y4SA 3ECBA 5D1ZC 4Y4HB 2G9HB 4D2NA 4OD3H 1QFUH 2NXYB 5C0AA 3RDTC 5GSVA 2W0FB 3UPRA 2XG4A 2BSRB 1A7PH 2W0PA 3P0YH 3HNTL 2A0LC 4FQLH 1S9WA 1YYML 2C7UA 3AM8C 4FFVD 4MDJA 5CGYD 2ARWA 3B5GA 1E4XH 1SY6L 1NMCB 3FQNB 3D2UD 4PJCF 4CDGC 2CIIA 1RK1B 1ED3A 2VLRD 3G5ZA 4KKAC 1UZ8A 3HZYA 5F9WB 3HE7A 3SQOH 3ABZA 3GSWA 4NQED 1DN0A 1MJ8L 5F93C 5FDYA 1MY5A 1UCTA 3GKWL 4LQFH 2EH7H 3T04D 3UJJH 4U49A 4GSDH 4X7SH 1E4KA 1FAIL 2OJEB 3RY5A 3KNBB 5IMMB 3BN3B 5E95B 1XGRB 1IEAA 4JZJB 2XQBH 5HY9A 4K3GA 1X5HA 3V7MA 3ZYOA 1ACZA 2BC4A 3NIGE 6FABH 3VXOA 1MRCL 1S7QA 4XWOD 1P7HL 4J3SA 2EDYA 5TDPB 2UWEF 2XIDA 4YEFA 5I76B 1EUUA 1N5YL 4MAYB 3PHQA 1S9XA 3MV7A 2BNRD 3BT2L 2IWGA 1CXKA 5ETUA 1KV3A 1PX3A 1JCKA 1RSFA 3CMOH 4LHUD 5C0CB 3ALPA 4DCQA 2CLRB 1KGCD 3MV8B 1A6AA 1U58A 4LRIC 1WZLA 5I74C 1ZHKA 5EO1B 2YUZA 2G5BB 4M1DL 1EFXD 4HCRH 4LEXL 2VISB 1T0NB 4GQPH 3VI4F 1CGUA 4X9BA 1KNOB 1YEJH 2NX5B 2P5ED 1BFVH 1TZHB 3H9SA 1BIIB 1U2HA 2VZOA 3Q48A 4R0LC 1M05A 3C60D 4BH7B 4IJ3C 2Y06L 5IHBA 1HQ4B 2OLDA 1FNSL 5MP6L 1BREA 4A6YB 4CN4A 5ID0B 3F5WB 4Y0GA 1T1XA 2VH5H 3U0WH 5JHDE 2CQVA 4MSWA 2OXGA 4LLYB 4K8RH 1W0VA 5B39B 5E2WH 1RZIB 2VLKA 3CU1A 5CIPB 3L3JB 4ZOAA 2Q6WA 3TIEA 4OTXH 1PYWB 4UDTA 3VDAA 3C8KA 1I8LA 3WEXB 4PG9B 3O2VH 1QFWH 1MCLA 2IAMD 4KROD 3EGSA 1XF3B 5D5MA 2GUOB 1INEH 4QRPB 3MA9H 4KI5E 1XH3A 1LO3H 2V17L 4F7EB 3QPQD 1O7SA 4UV7L 5L2KA 5FECB 1NAMB 1TPXB 1FZOB 1OTUC 3O3BA 1OSZB 4LVNC 2NZIA 4ZPTB 4LU5L 4PJCB 5L2JA 2DYPD 2W92A 1I4FA 3H2WA 4KWUA 1F6FB 3IGAB 4EQ2A 3EJJX 4XBPB 2O5YH 2I60L 1MJ8H 3OGCA 4LVOB 3FB6A 5MENB 3VXMD 4Y2DA 1MCSA 1H5BA 4RMRA 4M6AA 1JPTH 4YHIB 5KSVB 3B2VH 3B43A 2VDNL 4JGJA 2ZUUA 3BP6A 4LCUA 4YXHH 5KSAD 1G7JA 2EDDA 1NMAL 1CT8B 2X7LB 2AJ3A 2ESVD 1MRCH 3L9RA 3RHWF 2H32A 3L7FB 4N1EA 5C09E 1CR9H 4M7ZB 4NKIL 2D31A 2EYRA 2WUCH 3T65A 3QXVA 1CE1L 5H37H 4X7CC 2DQGL 2NY3D 2UWEB 4Q6IC 3S36L 3TM6A 3HUJF 1RJLB 2NW3B 5HVFB 3D1MC 2JB5L 2KL6A 2NY0B 3QUZD 4ODWB 4U6HB 3HA0A 5SV4A 3P0VH 1NLBH 4MQ7A 5I19L 2YBRA 5CBEB 3LCYA 1VGKB 3L7EA 4HBCL 2BP3A 2X4NA 3OG6B 4DN3L 3LH2L 1Z2KA 1PY9A 3P4OA 4HIEB 4PJEB 3HC4H 3QIWA 1AD0A 4ZO6A 4M1DH 4QLRA 3CSPA 3AGVA 3L3KA 1ZHLB 5DK2A 5EN2A 2DI7A 5C9JA 5F9OH 2VWEC 3PJSB 4GMTH 1CQKA 3UZEA 1NC4B 3W2DH 4HCRA 1RD6A 4H1LA 1UM4L 2ENSA 2HT3D 3GM0A 3MZTA 3TA3A 4FFYL 4Y5VA 5E1HB 3C6SB 1S5HB 4X8JA 3NBNA 2X9YA 3U48A 4M93C 2NYYD 4FQIH 1HHJB 4LASH 3T08A 4ZTOL 2O61A 1IM9B 1N3NB 1EGJL 2ZOKA 2Z9TA 2B2XL 3BGFB 3MACL 1ZGLM 3QUXC 4XVSH 4O00A 4XNZB 1MCRA 5IUSA 5D72H 2GK2A 1S9YB 4J8RA 3G08B 5GRJL 1EHNA 3QWOB 4JY6A 5IP4A 2L4OA 3GJEB 3ILPB 4OGAD 4ZS7L 3BSZH 4X4XA 4PV8A 3VXTB 3R1GL 3OR7A 2YEZA 4JDVB 4CGTA 1WIOA 2D7PA 2VZUA 5DJYB 4WUUE 2V17H 4R2GB 2NY4B 1V7MH 4UV7H 1FG2B 4UT6H 1HIMH 4L4VD 4CJ0A 5DJ2B 3WIFB 4YAQA 4V1DB 5IFJB 3HC0A 1ADQL 1PY4A 1U8IA 2W9EL 3TWCL 4LU5H 4JRXB 2WBKA 5F3HA 4Y4KA 3CX2A 4XGZB 3VXSA 1BMGA 1IKFH 2WSKA 4ZTPL 2E7CA 4WGVB 3GHEL 3IJSB 1KCUL 1LK2B 3HR5B 5HGBB 1H15B 1OT2A 4R97B 4JRYD 5DJCA 3C5ZB 1RAMA 4QHNA 4PGBB 2R1YA 2R4RH 1L6XA 2HTLC 5HYIA 4GW1A 1A47A 3W0WE 3BUYA 5CWSB 5B39G 2DQDL 3LZFL 4J4PC 4M8QB 2ICCA 4R4BB 5KVGH 4YFLF 1MJJB 3S36H 9CGTA 4AQ1B 3HUJB 3MRBB 4N90D 3QNYB 3EIFA 4HF5L 5ICZB 4QOKA 4M4PA 4OLXL 4CNIA 1HE7A 2QADB 1FFNB 3QULA 1D6EA 3OWEA 5CP3H 3I9GL 4HBCH 1BX2A 4BFEA 5LXGL 1HSAA 5C92A 1Q8MA 2F58L 3B6SB 3TN0D 3EYOA 4DUWA 5JHDA 1I3VA 2DLEA 1RZ8B 3V6FB 2W60A 4MB5A 5JQHC 2Q86B 3HCVB 4EI6A 1FFOB 4P2QE 2XZQL 4OV6F 1HZHL 3QUYD 3ARBD 5D96B 4PREA 1GC1L 2RB8A 3S35X 3CSGA 1S7UB 2Y23A 3BZEB 1JNJA 5E4EB 2WBJA 3RAJH 3CXDL 1SEQL 1K8DB 4ZTOH 4O5LL 4LLWB 3G6AA 2B2XH 1H8SA 3KPMA 4K55A 3QXDB 4OAWA 4YGVA 3P3YA 1CIUA 2W65A 1EEQA 1VESA 2DQEL 4NO3A 1LK3L 4JFDD 5GRJH 1LO5A 1FL5A 3RNKA 1IBGL 2WIMA 3KPSE 4TUJA 4TPRH 2J8HA 5T3XL 4KKLD 1ZSDA 2OI9C 3QUMB 4FQCL 4NFBA 5DO2D 3MCLL 5IW3A 3ARGC 3FO2A 3EO0A 1ACYL 4G6JL 1TETL 3EO1A 4GG8B 3HC3H 1IM3B 5AWNL 1MFAL 2V5MA 5E8EB 2ILLA 4BM7A 2FECL 1F58L 5EBMB 5JW3L 1XGYH 2R15A 4CVWA 4WCYH 4L3AA 4M6OL 4N0FB 3X3FH 2GJ6A 5KS9E 1A7OH