4POYA

Engineered dual specific vhh antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYQLRDRTYGHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VHH-metal
publication title Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site.
pubmed doi rcsb
source organism Lama glama
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4poyA00
4DZBA 3WJLA 1JRHH 4HLZH 3M1BB 4EVNA 2D2OA 3WNKA 5L6YL 3H9HA 4MXVF 3RJDA 1URLA 4IIQA 3RVXC 1NCDH 4PRNB 2R1YA 4BJLA 4DGVL 3EYSH 3U30C 1WZ1L 2V7HB 5I1DB 1A7RL 5HGAB 1UJ3A 4E5XA 2C3HA 5CSZA 1BBJB 1DQMH 1BECA 4JFDB 4NO5A 4XXCA 2XRAH 3G6AA 1I9RH 3QUKA 4DAGL 2YD5A 4CN6A 2WUBL 1UB5B 1U95A 1LQSR 1HHHA 3FCTA 5I1GL 2YWYA 2NY4B 2BSED 4JHAL 4D0DB 1ODAA 3C09B 4PJIF 3VXTA 2OTWA 4Y1AE 3WIIL 4OGYH 1K5NA 1IGYB 2BHZA 3VGFA 5T1KB 1U6AH 3CSPA 5FAAA 4KC3B 1UM6L 1YNTA 3E6HA 4JVUA 4OGAD 2X4TA 4QNPE 2NLJA 3SGDI 4HKZB 4UTAL 1JTTA 2EIEA 1JPSH 4R2GD 3AC0A 2PYEA 3D39B 3JUYA 4P4KB 2G75A 1I1AA 2P24B 3Q2CA 5EZLB 3VFTB 1A6UH 2EDTA 3C08H 3T3PE 1J12A 1JGVL 3BKYL 3MV7E 4XMLL 4I48B 1JHTB 1BVLA 5DZOA 4JPWL 5ISZB 2ADIA 1TZIA 1G6RL 1MH5B 4KGLA 5HGHA 3MRIB 2NYYD 3PGDB 3SDCA 4HKXA 1MJ8H 2PXYC 3TJEH 3KNBA 4FQXA 4PFEA 4P3CH 2WBJC 5EZOH 1J8HE 2EC9T 3C2SA 1ES0A 5DEFA 5HHOA 2CPCA 1OSZA 1FG9C 1QFUL 4HCRH 4KPHH 3O8XA 4Z76A 2XTLA 4JZJA 3DETC 4ELMB 3W2DL 2XZQL 5CEYB 2G9HB 1JHKL 5DQ9B 5IBTL 1RHHB 3TIDB 1A9EA 3UAJC 2ADFL 1G6RA 1S78D 2HKFL 3QJFB 4U7MA 5E4EC 4ZFGL 1N8ZB 2HKHL 5A1AA 4OFDA 4WO4A 3ABZA 3VRJA 2QLVB 3KXFB 3KPLA 3O81A 4N90E 3HG1E 3PL6C 1P2CA 1ZOXA 2X10A 1MPAL 4LLDB 2EYRB 3K1DA 3VXNB 4QO1A 3L95A 3SDCD 3MBXL 4ZFFA 5CKAA 2HVJB 4FQXD 1PYWB 1EZVX 3QXAA 4PJ8B 5IBTH 5C1MB 4EI5C 2BVUA 3LS4H 4XZUA 4MQTB 5HHOD 5FO9B 4OKDA 4ISVB 3K81A 5FA3A 3O8XD 1T20B 1YMMA 3OAUL 4ZFGH 5D2NA 2E3VA 4P2QA 1H3TA 1D6VH 2F5BL 1JIBA 2FB4L 1T0MA 1T89C 3DTXA 3RWIA 4E41B 4UOW1 4WI5A 3CFCH 1AXIB 8FABA 4X7TB 1FIGL 2BY1A 2XY1A 4U6HA 1TNNA 4PLKC 4E9LA 1CDIA 4WV1C 4YFEA 2AJVH 4WO4D 3ULUE 5EIIB 3CLEH 4JLRA 4FXKB 4L4TA 2OR9H 3BWAA 2VLRD 1GGCL 1CK0L 3DX7B 4BM7A 4HZLA 4DZ8B 5IFJA 4TOYL 1NGWA 2SEBA 1LO5A 1BX2B 3MR9B 1JZ8A 5K9OB 1R5IA 2AJ3B 5AD0B 3MRJB 5D8JL 2Z93A 3QUZC 3FRPG 1REIA 3MUY1 4A2LA 1M7XA 5HHPB 5C3TA 1EAPA 3IJYA 1K8DA 5MEOA 4G9FB 3BP7B 2NY3D 2XZCH 2XZZA 3RUGA 1Y6MR 4CVZA 5KBNC 1RUKH 1KPRB 1FZKA 1JN6B 2VAJA 1ZKAA 2AK1L 3JV4B 3MJ8B 4UV7H 3ZDZF 5J0BA 3WSQL 5HHXH 4EQ2A 4JKLA 2CXKA 1J0ZA 1CK0H 1HSAA 5J13B 4OLWL 5KVFH 4ZDHB 1FAIH 3OKDA 1NKRA 4ZXBC 1N6QL 3B6SB 5CIPA 1OT2A 3UTZB 4DZBB 1OVZA 2GJZA 4E42A 4L4TD 4PPTA 2X4PB 4EVNB 1NCAL 4PUBL 3H9HB 4LIQE 5E6IA 4UOW0 4NKQB 3BI9X 3IFOA 4IDJH 4IIQB 1HXYA 3QDMA 5E2UH 4Y2DA 2R1YB 4WUUA 3SE9H 2NTFA 4QHKI 1EUUA 4JGMA 2W9EH 1UJ3B 4E5XB 4R2GB 3ARWA 2BXYA 5CSZB 5IVOA 4NO5B 1EBAA 1MCPH 4MNQE 3QWOA 2HT3D 3G6AB 3RY6A 1YUHA 3QUKB 1CDYA 4P3DA 4WHTA 2IPKA 5CJQL 1MI5E 1U95B 5ECJE 3V6BR 1NAKH 4JFXA 4MAUH 4F15C 1HHHB 3FCTB 4KVNH 3C6SA 3VXTB 1KCSL 1KTKE 4U1IA 3VD7A 3GDBA 3PGCA 1R6VA 2J4WL 3HMWL 4GUPB 4PS4L 4KZEL 5CD5D 1K5NB 7FABL 2XTJE 3RKPA 3BUYA 3KPSE 3T0VA 4OCWL 3QDMD 4Z7WF 1YNTB 3E6HB 3MNVA 5EC1A 3U7YL 4WUUD 3CSYA 3AMLA 1FG2A 1SYVA 2NLJB 4ETQA 2J12B 5AEAA 1CYGA 1F5WA 2DQCL 3WXVL 5HVFB 4XPFH 3A6BH 2CDFA 4LCCA 1UFUA 1MCOL 2G75B 2AI0L 3PF2A 1DBBL 4RMVA 3OPZH 3WHXA 5ACLA 5LBSH 1HQ4A 2BERA 4PS4H 3MRDA 4M6NL 2E27H 5TPWL 1CF8L 2YD6A 2FH6A 3NACL 4JRWA 5GGVH 7FABH 1BVLB 3ZMRA 3HR5A 4M6ML 2ADIB 1TZIB 3Q1SL 5HGHB 3SDCB 4X7DC 1YYLH 3RNQA 4HKXB 3KNBB 4FQXB 3EHBD 1V7ML 5DUMH 3HUJF 4WW2C 1ES0B 5F71A 5DEFB 5HHOB 1GGBH 1OSZB 4R4BA 3O8XB 1DBBH 5JQHC 4NNPH 3HCVA 4Z76B 5FYKE 4PJIA 1OF2A 4LL9A 4BA8A 4QRRA 2DQTL 1U3HA 1BEYL 3Q0HA 4X4ME 1A9EB 2WP3O 2DI8A 4ZUWA 5SWQA 4N68A 1N4XL 3RGVA 1G6RB 4P2CG 4M6MH 4GJTB 4UAOB 1IARB 3MRFA 2Y5EA 3RVVC 4KRPC 3N1MC 4WO4B 2MFNA 3VRJB 3GSNH 4P5TA 5F72S 3W82A 3KPLB 4K71C 4N0UA 5E8DH 1P2CB 1HNFA 2NXZD 2XG5A 4MS8C 1Q0YH 5T33L 1PFCA 3QIUC 3MRKA 5I1EL 3L95B 3HI6L 4X9GA 2J3SA 4LHJB 4ZOBA 4JN1L 4XVUD 3SKOA 4ZFFB 5IFAL 3ARYA 4JEGB 1YY9D 2AEPL 3QXAB 1CBVL 3WNNA 4X5XA 4GW4A 1H3VA 1K6QL 2IBZX 4XZUB 1IAII 1N4XH 2NY3B 4G42A 3H9ZA 5FA3B 4K9EC 1YMMB 2P48B 5DJ8A 3QFDA 3IU4L 1BD2E 2EE9A 4P59L 5D2NB 4QRRD 4LOUC 1U3HD 5BXFA 2R69L 4FQ2L 5DI8A 5IIEB 4MZ3A 1IGIH 1T83C 4RWHA 2V17H 1T0MB 3DTXB 3RWIB 4K23L 4GAFB 1T7XA 5D7IF 3ZHDA 3QHZH 5FCUL 8FABB 2OMNA 4U6HB 2RAMA 3NTCL 1R5VA 1T22A 1J9CT 4P5TD 5I9QB 4JLRB 4L4TB 3BWAB 4OM1L 1J5OH 1MHCB 5DD3H 5IFJB 1HI6A 1NGWB 2SEBB 1LO5B 4L4VE 3ZE0E 1QLFA 4P59H 1R5IB 4X4XA 1MRCL 3SDAA 1EAPB 3IJYB 1K8DB 5MEOB 1T03L 3RUGB 4CVZB 5I74B 2YSSA 1EFQA 4QRUA 4KV5F 3NCMA 4NFDA 5C2BH 2JK5A 2H2SC 4HIJA 1CVRA 3VXRE 4RBPK 1ONQA 1HSAB 3T77A 5K33A 2AV7B 1WZLA 1A5FH 4JO2H 3OKDB 5HHVH 1NLBL 4B50A 4XH2B 3BDBA 5CIPB 5I8KL 1SMOA 4CMHB 1MFNA 2OX5A 3F8UB 4E42B 3ORJA 1ITCA 3RWJB 1HZHH 4KMLB 2DLFH 4Q9RH 4PJ7F 4LARL 5E6IB 4G5ZL 1OP5H 2R2CA 3U36A 4PD4J 3IFOB 3VE0B 5EZJA 1OAUL 1N7MH 1HXYB 5F1OB 1OPGH 3QDMB 1CLOH 3SDAD 4WUUB 1CXKA 4LSDA 2JE8A 3PWVA 2NTFB 1T4KB 3U4AA 3ARFD 3WFCL 4GRWE 4M1DL 1CDBA 4HFWA 4XPBH 1MCKA 3QWOB 5DJYA 2KL6A 5GS1B 1YUHB 4P3DB 4DCQA 4WHTB 2DQJL 5B8CC 3NFNB 2IPKB 3TGXA 4U6VL 4M4RA 2R0KH 5E70A 3KYKH 1N5YH 4JFXB 2AJYL 3MLVL 4TULH 4M5YL 1UA6H 2HJKA 4HX1B 4NQUA 3C6SB 2BRQA 4U1IB 3PGCB 4KKCD 4FFWD 4OT1H 5A16A 4APQA 5GRXG 4Q0XL 2VXVH 2EXYC 4MB3A 2CRIA 1CQKA 3BUYB 1XGYL 2ILLA 1HEZA 4WFED 3MNVB 5EC1B 4G3YH 2EEDA 3CSYB 1FG2B 1SYVB 3A6CH 1QR1A 5ENWA 2EE2A 3F7VA 4GXUM 4U6XA 1X5IA 2XXCB 5TGBA 4PY8J 3EYUH 3EDJA 3SBWA 2CDFB 2F8VA 4LCCB 5IVXF 3BJ91 5EO1A 4XVJL 5C70A 4C56E 3MC0A 4PP2A 4AMKL 1HQ4B 3IAGC 3ZYZA 3MRDB 3UROR 5KTEH 3HAEG 5F9WC 4KI1A 1KNOA 4Z0BL 2MQ0A 2PO6A 4W70A 5HVGB 4Z77B 3BRGC 3HR5B 2NXZB 4MMXC 5I15L 3EKCA 1CTOA 4GAGL 4JO4L 1EJOL 2J88H 4HC1L 3RNQB 4OFYA 2AJUL 4Y2OA 4NDMA 2GJJA 4APQD 1I85C 5ACMA 1H3UA 2WLZA 4DGIL 4R4BB 4NQDD 3W5MA 3HCVB 4NQEE 1ZVHA 1OF2B 4PJIB 5CCKH 4QRRB 1CIUA 1U3HB 1BFVL 2UZIL 4A6YL 2YUVA 2DM4A 3FOLA 3TH3T 4TQEL 4N8CH 5FM8A 4ZUWB 3NCEB 5SWQB 2IPTL 3ZDXE 2Y5TA 4Z0BH 5KOMC 3MV11 4Z7WA 2QHRL 5D70L 3MRFB 3RL1A 3S36L 4OD3H 5FM5M 1J1XL 2VDOL 4JQVA 5FKPA 4P5TB 3W0WE 2OTUA 1BWMA 3LN9A 3MOAL 4N0UB 3P4OA 3PJSA 4G7YL 5DMIH 4KHTL 4O5LH 4G6KL 3ZKND 3MRKB 3BZ4A 5JW3H 1T5XA 4P46C 3SKOB 4XCCH 4OFYD 4GAJL 4MXWL 4TQEH 4GW4B 4X5XB 5L2KA 3QAZB 4OJFH 1CZ8H 4G42B 1DEEA 1QPXA 3O2WL 4JQIH 2DTMH 4NQSA 2QHRH 4MB4A 5DJ8B 3SJVA 3QFDB 3CMOL 1J1XH 5DI8B 4I2XE 4PJFE 4X6DE 3HUJA 5T5NF 1K4DA 2ZCHH 1MFAL 4G7YH 5IG7A 1WCBA 1MRDL 3D9AL 4XPHL 4H88L 2G5BA 4WWKA 2GTZA 3HC0A 2QEJA 1JZ7A 1R5VB 3V7AG 1T22B 3WUWA 3DRTA 4ZUVA 3RWDA 2X7LA 5I71B 2FX8H 2EIZA 1T66C 4XNUL 1HI6B 4ZQKA 3P30H 3TNNA 2WM0A 4ZODA 2X70A 3CMOH 3E2HB 5I66A 1QLFB 4CUCA 2OJEA 1GXEA 4X4XB 5EPMA 3MODL 1K4CA 3NH7L 5CAYB 5C0AD 4YAQA 3SDAB 5E95B 5L2KD 1HH9A 1T2JA 3IAPA 2YSSB 4N0YH 4QRUB 3SJVD 3ARFB 4OZGF 1SBBA 2YD7A 4UT7L 2B0SL 1CGVA 2JK5B 4HIJB 1T7YA 1FNSL 3QCUH 4DQOH 1ONQB 3T77B 2FCBA 3S34L 1B4RA 2YXMA 5JW5A 1OP5K 4Y5YA 4WWKD 4MVBD 1QEWA 5JDSA 5M95B 1NBVL 2W9LA 2DIJA 1QRND 5D7IA 2AJZA 3DVNA 3TWCL 4EXKA 2FL5A 2MWCA 3U36B 5EOCH 5I73C 5EZJB 5E2JA 3UDWC 1BJMA 4Z7UE 4RAHA 1QUNA 4PJCE 3DVFA 3KJ6H 4NZUL 5SX5K 3QCVL 4PJDE 2B7DT 3SDXE 3PWVB 4MB5A 3K7UA 5EBWB 3N06B 5F89A 1KCVL 3AM8A 3ZE1E 4CJ1A 3HE7A 1NL0H 4YBQC 5I8OL 4HFWB 25C8H 5JW4Q 5B38A 3VGAC 1P5VA 2VLMD 5KAQF 2ZSWA 5DJYB 1KJ2L 2Z4QB 1CD9B 2BJMH 4Y8DC 3V4PH 4DCQB 1IMHC 3DJ9A 3TWCH 2JCCB 4EUPG 3MLUL 5C0CD 1MIEH 1HINL 1G0XA 2HJKB 4JKKA 5D7JA 1KBGL 3RWGA 4MD0A 5C2UB 5A16B 4YPJA 4APQB 3IU3A 3MV9A 4OD1L 1RUMH 2XT1B 4CNIA 1HEZB 1KJ2A 4NQDB 2QSQA 3QDGA 3NPZB 4YXLL 2VNCA 3ZTNL 2EICA 1KJ2H 1N0XL 1QR1B 5ENWB 4PJ7A 3F7VB 4N5ED 4U6XB 2VJXA 5TGBB 2Y06L 1MFDH 5DHXB 1UZ8A 4YC2B 4PGJA 1WQVT 2IH3A 3HE7D 5SX4I 4FXGA 4FRWA 4FTVE 1JZ6A 1FIEA 3V0AC 2PTVA 3TA3A 3PWPD 3ILQC 4PP2B 3LEVL 1RZFL 5LQBH 2AEQL 3CFIC 5EWIL 4OZHF 2ZOLA 5IB2A 2AERT 1KNOB 2HFTA 3SE3C 2PO6B 1ZXQA 3IRZA 1A3RH 4DKEH 2AXFA 2FJFA 4X6BA 4BZ2H 4YDIH 5I1CH 1IM3A 2D3VA 1C7SA 3F58L 4NDMB 4M00A 5EORL 4MWFA 3VD3A 3MV9D 3BGFB 4OCRH 1JGEA 2ESVE 2QSTA 4QRQA 4ZNEE 1TJIH 3QDGD 1UGNA 2LV4A 4S11A 1AC6A 4JHZA 5EWIH 3FOLB 3HZVA 1XIWC 1G9MC 3IFPA 2BDNL 1X44A 2HTKC 1ORQA 4RGNC 2Y5TB 1UCBH 3FN3A 4OIIH 2F15A 4Z7WB 2WUCL 5MENA 3FRUA 3RL1B 3TA3D 4L5FH 3CFEA 2V6HA 2FBJL 3MCKA 5FKPB 1YECL 3GI8L 3D87B 2E9IA 3B8SA 2OTUB 1LEGB 2DLGA 3RPKA 1JZ5A 2AS5M 3P4OB 3PJSB 2JJTC 2QV2A 2UZYB 5IVXA 4ENEC 2XN9A 4DOHE 4A6YB 2ZJSL 1XGUA 3BZ4B 3OAYH 1T5XB 3LKNA 1SVZA 4XPAH 5F44A 4LASL 3ME0A 3FZUC 5L2KB 4FN0A 4YE4L 3JWDH 2W9DH 4XMKH 1H3WM 5FYLH 4GSDH 1DEEB 2WUCH 4NQSB 1W0VA 3SJVB 5EIVA 3I2CH 1IGFH 2ICWJ 3DHJA 3O2DL 4QNPF 1YECH 3QFJE 1ZAGA 3FT2B 3HUJB 2C3VA 3MLXH 1K4DB 3FMGL 4KI5C 3ALWA 5DJZA 5IG7B 1WCBB 4NKIL 5MEND 1FZJA 2G5BB 4WWKB 2GTZB 3HC0B 4H1LG 1P84J 4KTEH 5FOJA 4J4PD 3T3PF 3WUWB 2GHWB 3DRTB 4YDLB 3MLWL 1JRHI 3RWDB 3NMEA 2Y07H 2X7LB 5I18L 1B0WA 3T3ME 4RWYL 2EIZB 2YPLE 1D9KC 1IAMA 2YD4A 3WLWC 3L9RA 1VADA 4ZQKB 3O2DA 3TNNB 4RGMC 2X70B 2J6EH 3TV3L 5I66B 4M48L 2LTQB 1G1CA 2OJEB 1EEZA 4YXKL 5EPMB 3O2DH 4MJ5A 3P0YH 3WFDH 1K4CB 1F4WL 4YAQB 2W0FB 5HXMA 1HH9B 1MREL 1VEMA 3FMGH 3P40A 4NJAL 2UUDH 4XP5H 4KMQA 4NBYB 5EU6E 4JFFA 4NJ9H 1NJ9A 4OIAA 5GSRA 4F33A 2P4AB 4IRJC 1GVIA 5SWSE 3MLWH 4TUKL 5I18H 2PR4L 4RWYH 1INEH 2CJUL 5K93A 3ZKXB 1GOGA 4Q74A 4QYOA 4XHJD 5JW5B 2Y36L 2VERN 1QEWB 5L88L 4M48H 2Q87A 5JDSB 5IR1A 1OP3H 2AJXL 1BF8A 1GYAA 4WW1A 4XCFH 5E2WL 1U42A 3AS3A 5D7IB 2AJZB 3EOTH 5D1ZD 3DVNB 5K9QI 4YBLB 4N9GA 4QOKA 2FL5B 3QIWA 1DBKH 3S88L 1JGUL 3GMOB 1DQLL 2BVTA 1X7QA 5E56A 2GAZA 2NZ9C 4MA3A 4WFHD 4KHXH 1IC7L 5F89B 1MFCL 2Y36H 4JFFD 1QBAA 4N8VA 3HE7B 3MACH 43CAA 1OQXA 1P4LA 2DAVA 4JN2A 3HZKA 3U48A 3PWPB 5B38B 3B8YA 4M1CD 3R0NA 1FJ1B 2X41A 2QSCL 1H8SA 4OZGA 4HWZA 3LHPH 4TTDC 3V6ZA 4XVTH 3ULUF 3H6JA 3DOSA 1U93A 2Q7NA 3PP3K 4P2YA 5D7JB 3RWGB 4MD0B 2NY1D 4QOKD 1OAZL 4PJ5E 4JFQA 3QIWD 5B3JE 1X5AA 3MV9B 2PW1A 1LEKA 1F45A 3S7GA 1KJ2B 3QDGB 3QQ9C 4FQ1H 2DF3A 4BQBA 4G80A 1KEGL 3QG6A 4PJ7B 2Y6SC 4D9QD 5C0IA 3OB0H 4JFHD 2B2XH 2QR0A 1UZ8B 3NGBB 2IH3B 5JR1L 4HJ0D 2O61A 2IQ9L 3TA3B 5HVWA 2HRPH 5E2VH 3STBA 5E2TH 1F2QA 4XP9L 3T08A 2ZOLB 5IB2B 1CXHA 4HWEL 2NNAA 4IM8A 4G8GA 2AXFB 2FJFB 4TUOB 4X6BB 5FHBH 1ZGLA 4PRPE 1IM3B 4NQCA 1M05A 2DI9A 1MCQA 4K3JH 3X3GL 3PP4L 3VFGL 3CX2A 4MA7L 4MWFB 1U8NA 5GS0C 1NAMA 1F58H 1OAQH 1JGEB 2A77L 4QRQB 1IILE 3GM0A 1JYXA 1NAMH 1GHFL 3O6FA 5GS2D 3WHE1 3HZVB 3VH8G 1V3LA 3IDMA 3IFPB 4PGCA 1ORQB 4LLQA 1VGEL 4NO3B 1ZEAL 5MENB 3FRUB 3OAYK 4X6CE 5EO9B 3CFEB 2NY6D 2IJ0C 3PP4H 3V8OA 5C7XH 3RL2A 4N1HB 1WTGT 3GI9L 3OKNA 3ZT7A 4G8GD 5IVXB 4J23A 2XN9B 3ROLA 1GAFL 1XGUB 1J1PL 2FBOJ 3LKNB 2BCKA 4NQCD 4ELKA 5CILL 4TPRL 4OZHA 4S10A 1J0HA 2NY4C 1C1EH 3QRFM 3MUHL 1I1YA 1II4E 3DX6A 5BZWA 3C09C 2BY2A 1W0VB 4W81A 5E6ZA 3O6FD 3G6DL 1DE4A 1FE8H 1KOAA 2PYFA 4JO1L 4OQTH 1CGSH 1B2WL 2C3VB 3SGJA 1PG7H 3GI9H 4YXHL 3O6ML 5DJZB 3BE1L 4JM2F 2IFGA 3FT3A 1FZJB 3CDCA 2CH8A 2DQGH 2DMKA 1QFWM 5DFVD 3BN3B 2I5YL 2HG5A 4P4KC 2YWZA 5DO2D 3V0WH 3WHE0 1DQJB 2XQBH 5EU7E 5D1ZB 1EVTC 4JRXE 3UZQA 1VADB 1RZKH 2BNRE 3HE6D 2IMMA 1EEZB 4MJ5B 1A7PH 1IGTA 1U41A 4JO1H 1UENA 1KCLA 2G60L 3FQXA 3OQ3B 4M5ZL 4JFFB 1X5HA 5KVGL 3X13A 1NJ9B 5GSRB 1S7TA 4F33B 1OP3K 1IC5H 3OXRA 1QBMH 4LSPH 3LRGA 3BH8A 3OKKB 4HK3N 3UYRH 4F9PA 4Y1AA 1IM9A 3K2UH 4WUKL 2O5ZH 2EYTA 5IK3A 4QYOB 2B4CH 4WY7H 3J7HA 4PIRF 5AG9A 5GS3A 1VENA 4LHUG 1D7FA 1X5JA 5IR1B 1VHPA 2R56L 4P2OD 1K3IA 4WW1B 5DK2A 2DLIA 4PRHE 3QUXD 2G60H 2NY1B 2D31A 4N9GB 4QOKB 1YA5A 5TDOA 4BKLB 3QIWB 4MDIA 2VLKE 4M3KB 2XWTA 2DJ4A 3EO1A 4MAYA 3MV7A 2CR6A 1NUFA 2FECL 2QQKH 1M6OA 3JWOC 1X7QB 2GAZB 4MA3B 3T2PA 3S36X 5LAXA 3S5LG 3QWRA 4PJ8C 5KW9H 2RB8A 4IJ3B 4MNHA 4LCWE 4N8VB 5EOQL 43CAB 5T3ZH 5I76A 1P4LB 2A6DA 3RHWF 5GRZA 3O2VL 3T65A 4JN2B 1CT8A 3HZKB 1WWBX 1A21A 4UI2A 1J8HA 2OJZL 1J87A 2DQUH 4GRLA 5KVDL 1DFBL 4WU5A 4ALAL 1PW3A 4OZGB 4HWZB 1ACZA 2Z92A 3HAEA 3JVGA 5C71A 1KG0A 1SYSA 4RRPA 1ZTXH 3X3FH 3BOVA 4ZAKA 5F3BA 3HAEH 1U93B 4FQIL 1CVSC 4F57L 2KPNA 3OB0K 1BQSA 4JFQB 5MEPA 2OR8A 2PW1B 5IHLB 1LEKB 3IGAA 3ZE0F 5L0QB 3OGCA 4MAYD 2HJFA 2OR7A 4O4YL 4G80B 2OJZH 3HG1A 4AG4L 5KVDH 1J05A 3QG6B 3QWRD 3HI1A 1SJHA 5C0IB 5AZ2L 2V5YA 1CXIA 1A0QH 2ZPKL 2Z8SA 3OJDA 1FH5L 2O61B 2OXGA 2QBWA 1J8HD 2NY6B 4XP1H 3ULUL 4WFFE 4GRLD 5BVPL 3MFFA 5MEQA 4Y4HA 4PB0L 4PJEE 2DTSA 3IS1X 2EDEA 2NNAB 4G8GB 1VA9A 4FQPA 1RJZA 4H8WL 5J13C 1ZGLB 3R1GL 4ZAKD 4O4YH 4NQCB 1RY7B 1DQDH 1M05B 4AG4H 1YC8A 2WANA 2D7TH 1FLTX 3GKWH 4CN1A 1LO0L 3WJLC 3OJMB 2VIRA 1CDUA 1G0DA 1U8NB 4PREA 5AZ2H 5F9OL 5IFHH 1NAMB 2ZPKH 2WBKA 1FH5H 1A4KA 2DQFA 1RUAH 4Z7OE 6FABL 3O6FB 1EHLL 1FFQA 1JFQL 3WIHL 3K4AA 4DN4H 4LVHB 3HG1D 4N90D 4K3HA 1B88A 4RMWA 3IDMB 4PGCB 5BV7H 1DJSA 4ZOEA 5DVLA 1H3PH 4OGAC 2XA8H 2VXSL 4GRWF 4LBEA 2Q7YB 4F8TA 1JNLH 3DUSB 1K3ZA 1UJ3C 4R2GC 2H32A 3MOBH 2MKLC 4S1RL 4JDVA 5FDWA 1VPOH 4XXCC 3RL2B 4Y4HD 3DWTA 1PDKA 2LU7A 3OKNB 1JHLL 2FHCA 4LIQL 3WIHA 4RFOL 3ZDYE 4QXUH 3ROLB 1N26A 1G7PA 4ZYKA 2D0FA 3HE6B 1EHLH 4H20L 4R96A 1YEGH 2BCKB 4ELKB 1Z9MA 1XGPA 2IFFH 4OZHB 5AAWA 1I1YB 2ADJA 2NYYC 3DX6B 5BZWB 3BPCA 1N6UA 1OSPL 4KDWA 3ULUD 4CDGC 5E99L 1AHWA 1MCLA 1UXWA 4ZPVB 3ZHKA 1DE4B 1QBLL 2PYFB 3L5WA 3SQBA 1R3IH 2OLDA 4DN3L 2V2TA 3FT3B 4LIQH 3CJJA 4P9HH 4RFOH 1JNNL 5GGSY 2HG5B 1S78C 2ED9A 4HWBL 4P2OB 1FDLL 1X4XA 5DMGD 5DC4B 4HT1H 1MCBA 3B2VL 3QUXB 4UMGA 4PGBA 1C5CH 3TT3L 4HQQL 4MNQA 2D0GA 3RNKA 3IDXH 4PG2A 4K94L 1WGOA 1QLEH 1IGTB 3N1GC 5C09E 4R8WL 1MHPL 5J9PA 3SDCC 2NY5H 5D5ME 3T4YA 1MI5A 5CP3H 3VFVA 3FQXB 4FQXC 3X13B 4HWBA 1S7TB 3EO9H 5D2LE 1ZANL 1WZMA 2DKMA 3OXRB 5LVEA 5T3XH 3SDDA 3BH8B 3I6KB 3O8XC 4Y1AB 3MJ6A 1IM9B 2JJUA 1D6EA 2EYTB 4DVRL 3ZDXF 5IK3B 3LKOA 5I1LA 3KPSA 3IDYB 5JMRA 5DMYA 1ZHLA 3UJIH 1CGXA 2W59A 3TO4D 3EOBB 3MGTA 4EUPH 2P5EE 1IT9L 4OBSA 4R8WH 4UAOC 5DK2B 4JM2A 4WO4C 3MGAA 3VWJA 3U1SL 4MDIB 1BVZA 4XNYH 4HPYL 4MNQD 1E4XH 2XWTB 3EO1B 4MAYB 3MV7B 2VR5A 5FYKL 1EHXA 3K46A 1M6OB 4Z6AT 5BMFL 5CBAA 4XAWH 2NPLX 3P73A 4S1DD 1MI5D 5LAXB 3BZEA 3F7RA 4MNHB 5I76B 2NY3C 2A6DB 1KLUA 3SDDD 1BOGA 3T65B 1CT8B 1OAYL 1B0GA 1KCUH 1J8HB 4PJFF 4X6DF 1NQBA 5D2NC 4GRLB 2XTJD 4BELD 5DD0H 4WU5B 3ET9F 3KPSD 4HAFA 4ZOAA 3MLRL 5FGCE 3GBMH 1KYOJ 1KG0B 3THML 2DDQL 4ZAKB 4LP4A 4X4MA 4XPTH 3IDUA 4KRNA 2MSPA 5HPOA 1IGML 1P7KA 1Q9LA 5IWLA 2QQNL 5I9QC 3VWJD 2NMSA 1I7RA 4BQCA 1G7QA 4KQ4L 2YN3A 3IGAB 4RZCA 4NOFA 1IAKA 4MJIE 3OGCB 4YGAB 3B5GA 2HJFB 4F7MA 3UTQA 3HG1B 4HJGB 1J05B 3V5DA 3HI1B 1SJHB 1N2RA 2VUOA 3LOWA 4JM4L 5JHDE 3OJDB 2P44B 2OP4L 3THMH 5I74C 1INQA 3QHFH 4JFED 5IQ9A 1IGMH 2QQNH 3MFFB 5MEQB 1L7TL 4Y4HB 2NW2A 4LPVA 2EEBA 3AS2A 1BD2A 2HT3C 5FYKD 1MJUL 1RJZB 3EDKA 5A40E 5C0JA 1DR9A 1MJ7L 3B2UC 3MRRA 2EDKA 4QXWA 4NN7B 3GK8H 3AUVA 1YNKL 1NDMA 1F8TH 1OB1A 4Q9QL 2HMID 5I75B 3RX5A 4CMHC 4PREB 4D9LL 1CDCA 4GKSA 4PJ9A 4AT6A 1A4KB 2DQFB 3KYOA 5CD5C 4Z7UF 5E6IC 4PJCF 3OZ9L 4PJDF 4K3DH 3SDXF 5KS9E 3D18A 4IMKA 4BUGA 1X5YA 4OTXL 1IKFL 2NZIA 4L4VA 3V9FA 1MJUH 3ZE1F 3EYOA 5FECA 2FIKA 4LBEB 4OLEA 4S2SA 2P46B 2IANE 4GKOA 4M8QA 2H32B 2Q3AA 4FMKA 1C5BH 1ZHBA 1GL4B 1OCWH 4JDVB 5FDWB 5JA8B 2VQUA 3LN5B 5FV2A 4H1LH 1BD2D 1UWGL 1NEZA 5JHLL 1A6ZA 5GS1C 1OLLA 4LPUA 1G7PB 4ZYKB 4CW1A 1UB6A 4NT6A 3VXRA 4HXAL 1TPXB 1XGPB 3QB7C 4X80H 3MYZA 1I7ZA 4RAVA 4OTXH 1R0AL 3LQMA 2ADJB 3O0RL 4G43A 3BPCB 4PY8I 4PJ9D 3IVKA 3EHBC 5GJTH 2W38A 1AHWB 2ZCKL 2EIDA 1UXWB 4R4ND 1EXUA 3L5WB 3TP4A 4HLJA 2IAMA 4L4VD 4ERSL 4YHLL 5IMMA 3OKEA 1MELA 2V2TB 1U91A 3E8UH 3S37H 3ARDA 4LCCC 3TO4B 4LSTL 3FO1B 5ICYA 1CL7L 3I9GH 2XKSA 1INDH 2M1KA 2OYPA 1LDPH 4PGBB 4LVOC 1TJGH 3GMMA 4I3GA 5JXAL 3MLSH 4MNQB 4OZFG 3VXRD 2YPKA 4GRWH 4QCIB 3RNKB 4N5UA 2NXZC 4PTUA 3B9AA 1AQKH 5J9PB 3KYMA 5TH2A 3T4YB 1MI5B 1G7IA 4XVUC 4P3WA 5HYFA 3RX7A 3VFVB 1YY9C 1YEIL 4IOFC 1IC1A 3QPQD 2V2XA 3SDDB 4LSRH 2VRAA 2IAMD 1SHMA 1D6EB 1XF4A 2XTJB 1U3HC 3LKOB 1CE1H 3KPSB 1ZHLB 3BXNA 3MLYH 4OKVA 4CADB 4I9WD 3ARDD 2N7BA 4JAMA 4EQ3A 1ZVYA 3BISA 1AP2B 4FFYL 3MGTB 5E00A 3MCLL 2R8SH 1QSFE 2JLLA 4JM2B 3TO2A 4OM0L 4MCYA 4P5TC 3VWJB 4RISH 4C56A 2VZ3A 1EERB 2XQYG 3VW3L 1UM4L 5CBAB 5JMOC 3P73B 4S0SD 4BFBD 5ITBL 2B1HL 3BZEB 3DX8A 1VERA 2K7QA 3QAZC 1G84A 5I19L 4WI6A 5E8EA 1ZLUH 2ATKA 4Z95H 1EH9A 1KLUB 2MOVA 1BOGB 3QQ3A 4FFYH 5HDQL 2O93L 5JDJA 4YX2L 2YEZB 4YHZH 3GFUA 1KELH 3AY4A 1JYWA 4NQEA 1TITA 4IDLA 1FZOA 5BO1L 2H9GA 1UM4H 1UM5L 4JKWA 1P7KB 1Q9LB 3T3MF 1T2QL 5IGXH 3WDHA 2FRGP 1I7RB 5EBMA 4C56D 1BF2A 1G7QB 5I71C 3LMJL 4RZCB 3RDTA 1IAKB 3CK0L 5E5UB 5IB4A 1PG7W 5ESVA 3W0WA 4F7MB 3E2HC 3UTQB 3FONA 3V5DB 4L8CB 1RULL 3KJ4B 4HIHA 1N2RB 2VZ1A 5E5MA 5L7XL 2UVEA 1FCCA 3SDAC 1I9IH 4FQLL 1R3LA 1YEFH 3EJZD 2XIDA 2HLAA 5F7DA 5IUSA 3BQUD 3RHWK 2EH7H 1A2YA 5IQ9B 1UM5H 5E0QA 1EO8H 2KZWA 3ARFC 1DCLA 4M7JH 3P0VL 5J57B 2NW2B 5GRJH 1AJ7H 3QUZA 1BD2B 4NQED 4JG1L 2YKLH 5C0JB 3MRRB 4I2XA 3VG0H 4HEPG 4ODHH 4PJFA 5F7LB 4X6DA 1NDMB 3MGOA 2WW8A 3T2NL 3GB7A 1OB1B 3VDCA 5CZXD 3DSFL 1OW0A 3QDHA 3ECBA 4FQLH 1V5JA 3UTPE 3RDTD 2Y7QA 4GKSB 4FFWC 4KKCC 4PJ9B 4AT6B 1A14L 3BIBX 3KYOB 5IROA 1OAKL 4QXGL 3S35L 3W0WD 5T1MA 4X8JA 4LLVA 3CNKA 3MXWH 3F6IA 4WWID 1UH2A 1XGRA 3P0VH 3ZE2E 1Z0NA 5DTFA 4L4VB 1DLFL 3HNVL 3EYOB 5FECB 1U0QA 2FIKB 4GBXA 3TEUA 3V4VH 4OI7A 4S2SB 2ICEB 2R4SH 1ZHBB 5IEKA 4R7DA 1XF2A 4C4KT 1NEZB 1A6ZB 1J0YA 4HW6A 3MNZA 4UIMA 1VACB 3LRHA 4NQTA 4BQ6A 4CW1B 1UB6B 1LE9A 3S35H 4NT6B 3VXRB 4XBGA 5LWYL 2MCPL 1LE5A 4RAVB 4XP6L 5IHUL 2H1PL 1DLFH 5B3JF 4G43B 4HWUA 3EFDL 1TZGL 1LO2H 3CLFL 3IVKB 1YEKH 4APQC 2W91A 3TBVA 5CJXA 5I2IA 1F90H 3DMMA 3KWWA 3BKCL 1EXUB 3DV4A 3HNTH 2X1WL 1WTLA 4LCIH 2ZUWA 2IAMB 4NNYA 5IMMB 3OKEB 1U91B 4GBXD 5JNYA 1VKXA 2IPUK 3SQOL 4PJCA 2E6PA 3ARDB 2FWOA 1MNUL 4PJDA 1RVFL 5LWYH 1A7QH 2LVCA 3HFML 4NZTH 5TQ2H 3GSVA 5ICYB 5EBLA 3CXHJ 5EIQA 1U8MA 2H1PH 2ZG1A 1QOKA 1TZGH 4GRWB 3CLFH 3GMMB 1QTYT 1SM3H 2A0LD 3KPPA 2PO6C 4KAQH 2VMFA 1UG9A 4IBLT 2C26A 4X6EA 3ZKNC 4I0PA 3S98A 3L6FA 2OL3L 5TH2B 1U8KA 2VLRE 3QXTA 3W9DA 2IALB 1N5AA 1KEML 1N6VA 3S96A 1MNUH 1RK1A 2V2XB 1C5DA 3DMMD 3GBNH 3HFMH 3GJEA 1XF4B 4JFOA 3FFDA 1Z9SA 3T0WA 2MTPA 3UO1L 3BXNB 4JPVL 4OKVB 5JZ7D 3KLDA 4JAMB 4X6CF 1DBMH 4HZAA 4OCXL 2OL3A 5GQBA 5E00B 3EZJB 4GG8A 4MNGE 4DGYL 2OL3H 3TO2B 5FUOL 4JQVC 5DHVA 4MCYB 3OG4B 4FTVA 1JGLL 2JKXA 4UU9A 2EH8L 3FT4A 3KYNA 4C56B 3MRPA 4FHBD 5DWUL 4ONOA 2HH0L 1PLGH 1TTGA 3EO0A 4HKJA 5CJOL 4I0PD 2ICWI 3WKMH 5TE7L 4JPKH 1JGDB 3HMXH 4HUMB 5IEHA 3DX8B 1DDHA 3WXWL 4C55A 1U8LA 4UT6L 5E8EB 1I1RA 1IBGL 2ATKB 3QQ3B 5HVHB 3BQUB 1A4JA 4QHNA 1LVEA 4UB0H 3O3UN 3CVHL 3R06A 5C0BE 1JGLH 2ESVA 5C0RL 4JG0L 2R29L 4ZNEA 1T5WA 2JB5L 3IXAA 4NQEB 4Z7QE 1FZOB 1WF5A 4ZUTA 2H9GB 2I26N 4WWKC 3UC0H 5JW4N 4MVBC 4FTVD 4K9EH 1MFEH 4U2YA 2CO6B 5EC2A 4YDLC 3ZYOA 5EBMB 3RJQB 1IGJA 3RDTB 4QRSA 1MFBH 4AM0A 5FHAL 4P0DA 5IB4B 4JRYE 5ESVB 3W0WB 4R0LA 1OTTD 3FONB 2LTQC 4OLUH 4K7PY 3NCJL 4AEIL 1QQDA 4HIHB 5I8EA 1AGCA 5E5MB 4EBQH 2DKUA 3R8QA 1FPTL 2IF7A 1R3LB 1SMAA 2M26A 2HLAB 2NXYD 2DQIL 3CC5A 5F7DB 1I9JH 3UJTH 1A2YB 4R26H 1MHHA 2ORBH 1OLZA 3MZTA 3GO1H 2FEDD 4OCYL 4ZTOH 4U1LA 4X0KA 5IOPA 4JFZL 5AWNH 3ZKXC 3UTSE 4I2XB 4PJFB 4X6DB 3MGOB 3BPOB 3GB7B 4JGUA 1CGTA 5HSFA 1WFOA 4GT7A 1U8PB 4UQ2A 3ECBB 4DUWA 2Y7QB 3BYTA 4HKBA 4YBLC 5IVZA 2DQIH 1NDGA 5T1MB 1CDGA 4LLVB 4X8JB 4MZ2A 3RZWA 3DARA 2YPLA 2AXGA 1GPOH 1XGRB 2FATH 4OCYH 5DTFB 1S5IH 4M7LH 1UVQA 5ADOL 4LCUA 1FVDB 4GBXB 4PYGA 4N5EC 1EEYA 2ZCLL 2ZOKB 3R4DA 4LU5H 2E7CA 4XMPL 3AM8C 4TVPH 4P5MA 3HE7C 5IEKB 1J86A 4R7DB 3ULVE 5EU6A 1XF2B 3KYAA 4NM4H 3L5HA 2DJUA 3MNZB 4UIMB 3QFJD 5SWSA 1LE9B 4XBGB 1M7IA 4U3XA 4JKPL 1LE5B 4K8RL 2X2YA 3F7PC 1TCMA 4HFUL 2WIMA 5D7JC 1DUYA 2IBGA 3IFNL 2VR4A 4J3TA 3G5XB 1IQDA 1DSFL 4YUEL 2ZCLH 5KVEH 3FFCE 4XMPH 3TBVB 5I2IB 4EIGB 3DMMB 3KWWB 2YPLD 3CXDL 3DV4B 4JANA 4DK3A 4GXVH 1N64L 4NNYB 3RPIA 1Q72L 4KKBD 1BFTA 4Z7UB 2WK2A 5JNYB 1VKXB 4PJCB 5IW6A 2FWOB 4PJDB 3NGBC 3SDXB 4NKMA 5CZKA 3GSVB 3MRGA 1HWHB 4K8RH 5EBLB 5JTWA 4X8XA 3TA3C 5EU6D 3SKJL 1U8MB 3CVIL 4PJEF 1R5WA 2HJLA 4JCLA 5CD3A 3P4NA 3MXVL 4MLSA 4X6EB 4I0PB 1NC4D 4LAQL 3L6FB 1SQ2N 3W9DB 4FOMA 4F37F 5F7EL 2EDQA 1IFHH 1N5AB 3L7FA 3S96B 4JY5H 1RK1B 3VXPA 3CDYA 4Z7OF 1I8LA 1C5DB 5TF1L 3VDBA 4Y19E 1YJDL 4PJ5A 4XC1H 1AQDA 3GJEB 3SKJH 5C86A 1ZT4A 3FFDB 3L5XH 5T1DL 1HHIA 3K2MC 1PY9A 4LPCA 4K8RD 3GBLA 4R6UA 1B4JH 1I85A 5BJTA 3MXVH 2OL3B 2FECI 4L8SC 3MJ9H 4GG8B 4OB5L 5FGBA 5GISL 5DHVB 4FTVB 4J4PC 2E8YA 3Q5TA 4UU9B 3ZDYF 4NC0B 3FT4B 3KYNB 4OUUA 1L6XA 1JPTL 4ZPTA 3EO0B 4HKJB 1RIHL 2MKWA 2YXFA 3B9DA 2CIKA 4HBCH 1BREA 5IJKA 5IEHB 1DDHB 3UCRA 3H3PH 4HXBH 4JDTH 3VRLE 4LNRA 1U8LB 2EDJA 4PRPA 4K71B 4Z7VE 4U3HA 1ULVA 2NXYB 5E08H 3O6LH 4PJ5D 1A4JB 4QHNB 5DR5L 1G9NL 3D0VA 3PWUA 3R06B 5GISH 1CXEA 1TTUA 1T7ZA 4NCDA 3VI3E 3Q48A 1T5WB 3IXAB 1JPTH 1U3JA 3D25A 4FQCL 4XHJC 4ZUTB 3V79C 1MQKL 4S1SL 1YYMH 4WI3A 4M02A 2VDKH 5EC2B 4X6CA 1IGJB 5JUEL 4QRSB 4AM0B 5D1ZC 1X5LA 4XBEL 1RZ8A 5CWSA 3ZSSA 1P69B 1OHQA 4Z18A 4R0LB 4YO0A 3VFOB 4KZDL 2VQ1A 3K8LA 3CXHK 5D5MF 1QQDB 5I8EB 1AGCB 5L9DL 1EHNA 2N1KA 4DOHB 2H26A 4PRPD 5D2LF 4UINL 1IL1A 3IJSA 3OBAA 4FQCH 3P9MA 4G8IA 3CC5B 4Z8FL 5MI0B 3E3QE 1J1OL 1MHHB 2GKIA 1HCFX 4U1LB 4X0KB 5EDXA 5K9QG 1OM3L 4Y89A 5IOPB 4M1CC 4F80A 5GGQL 5F97E 4Z0XA 5DD1H 2ZUSA 3QFJB 3HZYA 2OS7A 3PDOA 2J8UE 2VH5H 1WIPA 2OZ4L 3QXWA 4H25B 4MQ7A 2JCCE 1DN2A 4UQ2B 3RU8L 5JIPA 2MPAL 2NY1C 4HKBB 5IVZB 3RVTC 1C12A 1NDGB 3PHOA 3QIWC 4I3SL 4X98A 3GEWB 4DVBA 5D96B 2X1OA 2YPLB 2AXGB 1X4YA 1AY1L 3JV6A 1NGZA 2VC2L 5GPRA 2BNRA 1AR2A 1UVQB 5ALCL 2VWEE 1EEYB 2YD2A 3SOBL 2JB6A 2OZ4A 4NQDE 4IJ3C 1VGKA 4P5MB 2VE6B 2OZ4H 4HJ0C 3GSOA 2HAZA 2BOCA 3L1OH 2ZUVA 3NCYS 5EU6B 3QG7L 3RU8H 3FO0L 3QZWA 4HJJH 3U2SA 4Z7NE 5SWSB 4I3SH 4V2CB 2CO7B 1M7IB 1JF1A 2R9HD 3T0AA 4NFBA 3D1MC 3KAAA 1NC4B 4YQXH 5TDNA 3UX9B 3WLBA 4R3SA 3BSZH 1DUYB 3LKRA 3N1FC 3UTTA 1IQDB 4OSUH 3FQUA 4WTWA 4TSAL 2X1QA 4PRHA 1YZZA 4JRXD 1KFAL 5L0QC 4JANB 2BNRD 3RPIB 4HUXA 1MCHA 3U9PL 1MCNA 1T1WA 1KSRA 5F96L 5C0NC 1FBIL 5IW6B 2CRMA 5IW3A 4FZEH 4NKMB 2VDQL 4RDQF 2Y1VA 3MRGB 5T1LA 2GT9A 4XPGH 4LCWA 2NY6C 4POZD 1R5WB 3J8F7 4OF6A 4XP4H 1LO3L 2HJLB 2BVOA 4HGKC 4ODUA 4X9IA 2CKBL 4NUGL 3F65A 1NMBL 3P4NB 2CGRH 3MBEA 3N1QC 1IAIH 2QL1A 4TVSa 2VDMH 1F3DJ 4ZO7A 1WCQA 2WWMD 4JY6B 1YMHB 4XI5D 2FEEL 3CSBA 1H3XA 3VXPB 1KTLA 3SE3A 5I1IH 4LQFL 5DJDA 5KS9F 4PJ5B 3QQ4A 4S1QH 5TE4L 3O6FC 5C0AE 2VLKD 1ZT4B 3N9GL 4LVHC 4JKMA 1HHIB 2VXQH 1KTRL 1BGXL 1B0RA 4YHYB 2YUWA 2AABH 2FJHA 5BJTB 3BUTA 5DT1L 3JBG7 3HPJA 1NCWL 5E9DE 5T1LD 5DJ6B 5DFVC 4LCWD 4IRZH 3S35X 1XF3A 5DO2C 3OXSB 1CS6A 3BIAX 4OUUB 1A6VH 4ZPTB 3MBED 1NH6A 3I3DA 4RAUA 1G9MH 4RMSA 2OCFD 4D0BA 3D5OF 5ILTH 4M93B 3HE6C 4PJEA 4U31A 1ZLVH 1QRNE 3TJHD 3N9GH 1F2XK 4QGTA 4HV8A 4LGRB 1TJHH 2Z31A 4BFGA 4JQXA 2PW2A 3HLAA 4LNRB 2BHYA 4PRPB 1YEHL 5EU5B 5K9KA 4ONFL 3NCBB 4WHCA 4NWUL 1KJVA 1TDQA 4NPYA 3D0VB 4AH2A 3H9SE 1NPUA 3PWUB 3E6FA 1QYGL 4ZFZB 1PGRB 3T0EE 3INUL 3LCYA 1TVBA 4WHYH 1UYWH 3OAZH 5D1QA 3S3SA 3SGJC 3D25B 3WO3B 4ODXA 4DTGH 4UIKL 2LQRA 3PWNA 1W0YT 4ZTPH 2FO1A 1E6OL 3NAAH 4P2OC 3CD4A 4X6CB 1Z3GH 1N0LA 2FX7L 2EIBA 5CHNB 2Q8BL 3QUXC 4ODSL 4GMTL 4L3EE 4WFFD 5C0CE 5CWSB 3U0TA 1RURL 3H7LA 2VISA 1A6AA 4YO0B 4YNYB 5ESQA 1FGVH 2VQ1B 4E0RB 1QSEE 4V1DE 4UDTA 2Z31D 5IV2A 2H26B 3FB8A 3IKCA 1IL1B 3IJSB 1KIPA 4G8IB 4MA8L 5GZND 3KPQB 1HE7A 1RUQH 4ZSOE 1XFPA 3FL7A 1J11A 1LDSA 1WFUA 3WS6A 4F9PC 5D1QD 3ZYIA 4DKFL 4M7KH 4LP5A 3QO0A 4GMTH 1KN2H 2IGFH 2W65B 3PGFL 4Z0XB 3G6JE 3IDYC 2GSIA 3HZYB 1DP0A 3PDOB 4QTIL 2VKWA 3BFOA 3PWPE 5J3HD 5DDHA 3IRPX 4IRJA 4MQ7B 1F3DH 2B5IB 3HTLX 4XNQA 1OQOA 1RJYA 4CAGA 4HS8H 2BOBA 4I3RH 5GGRY 1TZHA 4X7SL 5D7KE 2X4OA 5DZNA 3TT1L 3PHOB 4X98B 1HKLH 1L0YA 4DVBB 3EOAA 3OL2A 1MCSA 3OKYA 2VXTH 4JRXB 3VXOB 4MAYC 3JV6B 1NGZB 3BPNB 2BNRB 1FORL 2DS4A 4HH8A 1QKZH 3EAKA 1MEXL 2JB6B 5DQDL 5GHWH 5I17A 5C09A 2ZSVA 5JO5A 1VGKB 5D5MA 5ELIA 2AJSL 3GSOB 2BOCB 4J2XA 3EYFA 1ZS8B 5D2LA 2P8LA 3QZWB 1ROWA 4GRLC 4Q6IA 3U2SB 4RMUA 4NBZB 3JV0A 5I1KH 1JF1B 3GMNA 1KPVA 3MA7A 1LD9A 4AYFA 3RVWD 5TDNB 4ZAKC 1L7IH 4NWTH 1NCUA 3WLBB 4R3SB 1M1SA 3CX5J 3UBXA 4AENA 3LKRB 5EH1A 5DC0A 1VESA 1D5BA 1S3KL 2P5EA 3FQUB 2YD3A 3WYRA 4WFGE 4PRHB 2EDRA 1RU9H 4M1GL 4Y5VA 1CL7I 4UV4H 4HUXB 4DUVA 2VLKB 3HNSL 1RZ7L 1MIML 1UACL 4EOWH 2CK0L 1T1WB 5C09D 1O7VA 5HI3D 2R1WA 2YA2A 1BZ7A 1TQCB 5T1LB 2GT9B 4LCWB 4YHKH 1EAJA 3W11D 4Y4HC 3FHQA 2BVOB 4ODUB 4F7CB 2X4RA 3MBEB 4ZUUA 1B3JA 4NN7C 2BRRL 1NCNA 1IGCH 3TBSA 3HNSH 2A9NL 2DBLL 1WAAE 1OD9A 3CFDA 5I75C 4DUXA 3U0WL 1DBJL 2P5ED 4LK4A 1KTLB 1YDPA 1SBSH 4HK0A 3ULUC 5DJDB 3QQ4B 3K74B 4KMTH 1CU4L 3ZE2F 2IC2A 3U9UA 5F7MC 2R4RL 2FHBA 1B0RB 4MJIA 3DGGA 2AW2A 4H8WC 4M62L 1A47A 4MQXD 2FJHB 3A0OA 3FB5A 3HPJB 1UC6A 4AL8H 5F8QC 2V9TA 1PKQE 5JHDA 1F13A 1XF3B 5H2BA 3D48R 3AMKA 3QNYB 5DMGC 4EZMA 1Z6JT 4XX1G 1DBJH 3BD5A 3CGTA 4RAUB 3FN0L 4D0BB 4IOIA 1LK3H 2VDPH 4PJEB 5F1IA 2PN5A 5FYJH 4HUKB 4JJ5A 4KGJA 3DRQA 4HV8B 1TPXC 2Z31B 5C08E 3MA9H 3DPBA 3HLAB 4F37K 3OAZK 1RMFH 2FGWH 5K9KB 2ENYA 3O11B 2UVFA 3O3BA 5DD6A 1KJVB 3EUUA 3DYPA 4NPYB 4AH2B 1TTFA 1AHWC 2J1KA 3GIZH 2ZNXA 3E6FB 5JPMA 5K59E 2A6JA 4MJID 1TVBB 1OARH 5D1QB 3T8XA 4ODXB 5KS9A 4XT1C 3PWNB 5ADPH 4CKVX 5JHDD 3OTTA 1IGYA 3TO4C 4U0RB 4CN4A 3BX7C 3ARBD 2IANA 4LEXL 2D9QB 3WJJA 2X05A 4PRDA 1E4JA 3B5TA 3U0TB 1AI1H 2ZUQB 2VISB 1JPFA 1A6AB 5ESQB 4Q9CA 2X4NA 3GMQB 4PG2C 4UDTB 1NMCB 5IV2B 1QLRA 1RIVL 3FB8B 3NFPB 4S1DC 3IKCB 4UUJA 1KIPB 5LGKA 2WINB 3HC4L 1A7NH 1S7UA 3BO8A 1U3ZA 1T6VN 1RK0A 4RGMB 3GNML 3SDDC 3EDEA 1PY4A 1KJ3H 3QO0B 5DJ0A 2XTJC 4TSCH 4Z5RA 2GITA 2DYPA 4K94C 2GSIB 2R2BA 1FLRL 3WD5H 4KK8C 5DDHB 4XNQB 1I3VA 4EDWH 1RFDH 2XI9A 2YC1A 4LLAA 1K9TA 1RJYB 2IAND 2HFGH 2BOBB 5LCVH 1TZHB 4M43L 2F5AH 1NFIA 2X4OB 3V7MA 3VWJC 1D5XA 4J6RL 2G9HA 1MQ8A 1E28A 3C8HA 3EOAB 4ESKA 4U1GB 1T3FA 2Q8AH 5SX4H 4FQJH 3WFEL 5CEZH 2VO5A 2E8ZA 2IWGA 5I17B 5C09B 3D85A 5E94A 3FQNB 5JO5B 4GFTB 1CLYH 3VXUE 1FLRH 4GKZA 3ETBF 1SY6L 4D3CL 5D5MB 3TYFB 1RIUH 3CH8A 3L7EA 3BKML 5D2LB 2P8LB 4Q6IB 4Z7QF 3JWOH 1KACB 2DYPD 1PYWA 3QHTC 2GYSA 3GMNB 3MA7B 1KPVB 4UT9H 1LD9B 2GJ6E 5KN5A 2DM7A 1LNUA 3RAJL 3UBXB 4AENB 5IWLC 4O02H 1ADQL 2RCSH 1SY6A 2HMIC 3LKSB 1D5BB 1MHEB 2L7JA 2P5EB 1QSFA 1XF5A 2F58L 1CICA 4E41A 4HS3B 2IG2L 4Y5VB 1S9XA 3PHQB 4NCC2 1DUZA 1TETL 3ZKSD 3KJ4C 2YD8A 1JI2A 3D85D 2R1WB 1BZ7B 2VDNL 3ARGD 5GGSA 1ADQA 1LO4H 1F4XL 1ZLWK 3STLA 2NY0D 5AD0A 5JQ6L 4I4WA 4J3XA 3C2AL 4G7VL 1KCRL 1VCAA 2F58H 2BNUA 5F7KC 4WEMB 3QPXL 2IG2H 1BM3L 1NMAL 5FGCB 3TBSB 5IB3A 4O9HH 2ZKHH 4XBPA 3CFDB 2PXYD 1CFTA 3G5VA 1QSFD 1V7NH 1YDPB 1CICD 4PJ9C 4HK0B 1YEEL 3H9YA 4GW5A 4K2UH 3U9UB 4R4NC 3BW9A 1D5IH 1UKSA 2NTSP 4M6OH 4MJIB 4KFZC 4IMKC 3DGGB 3WUWG 3UTZA 1MLCA 1VDGA 3U4EA 3FB5B 1X6LA 2A83A 3QPXH 3O45A 2X4PA 1BM3H 3TBTA 3F7YA 3O6KL 3ULVF 2YOCA 1Q0XL 1R3JA 5JHDB 3VFUA 5H2BB 2HWZL 1F42A 4LF3A 5GGVY 5CLWA 3ARBB 2J8OA 4JFYA 2RJMA 3VGEA 1HN1A 4NKDA 4X6FA 3H2WA 1YEEH 4HD9A 3MUGA 4IOIB 5F1IB 1XMWA 3KVQA 4JJ5B 3PDDA 3DRQB 2VZUA 4OD2A 4DEPC 5E5RB 1EGJL 2X9XA 3VGHA 2R0LL 3ZKQD 4BK4A 3LQAL 3MNWA 3FN9A 3O3BB 5IQ7L 1GGIL 2UY7A 4XWGL 32C2A 5DD6B 1G1YA 5FUZL 5A2FA 4X4ZA 5L6YH 3BYYA 5DRXA 3QPQC 2CMRL 5JPMB 1SJEB 2I07A 2A6JB 4JDZA 3CIQA 3CX5K 1XH3A 2IAMC 4G6AD 3T8XB 3K4DA 4DGVH 5KS9B 3DECA 2AEWA 3L3DA 1MAJA 1S8DA 1WZ1H 2B20A 4GUPA 2ZUTA 3H42L 3ARDC 3T1WA 4XC3L 1A7RH 1EGJA 1QFWL 5A2JH 4O2FA 1G9EA 1FVCA 1EGJH 4GQ9L 4OLZL 2IANB 3LQAH 4PRDB 1GGIH 1FFRA 3SHSA 2DQEL 4DAGH 2JJSA 4HPOL 1AH1A 1JPFB 1M4KA 4Q9BA 2A1WL 2X4NB 2WUBH 3GHEL 3DHMA 1QLRB 5B38G 3NN8A 5I1GH 3ARVA 4KVCL 1NSNL 1RHFA 4JHAH 4UUJB 3GUTA 5IESL 4GO6B 3ARPA 4U2ZA 5ITFA 1S7UB 4GKNA 2FSEA 4OGXL 3TNMA 2OTPA 4RX4D 3BO8B 2HT2D 1RK0B 3WIIH 2C5DC 3ARTA 4LSSL 3UTPD 1QSZA 1T7WA 4U33A 4O58L 3D2UA 1UM6H 3V6OE 5DJ0B 4Z5RB 2GITB 2DYPB 1AGBA 2R2BB 1C7TA 4UTAH 4PLJD 2YHGA 4MA1B 3STZA 3BEVB 4DK6A 2YC1B 4NYLA 5HY9A 4NO2B 1NFIB 4BK5A 1D5XB 3H8NA 2EDBA 1JGVH 3BKYH 2CD0A 4I0KA 5H37H 4YFDB 1E28B 4TSBL 4XMLH 1T3FB 4JPWH 1I1FA 4OCSL 2K1MA 4FP8L 3VRLF 1G6RH 5I1HL 2V5TA 4Z7VF 1YQVL 3D85B 4M61A 5E94B 4GKZB 3SGKA 1KUMA 2ARJQ 2VLRA 3ARGB 1S7SA 3EJZC 1V05A 3LB6D 5HVHC 3LEXA 3BQUC 5JORA 3L7EB 1QFUH 3VI3F 3D2UD 2K9UA 2L7UA 4DW2L 2NY0B 1NGPL 2N56A 2DQHL 3W2DH 2XZQH 1CFSA 1MAML 1JHKH 2Z8WC 2X4SA 3AY4C 4ZMAT 2ADFH 2HKFH 5KN5B 4OCSH 1LNUB 2HKHH 3T2QA 5CZXC 3LIZL 5IIEA 3IKKA 1QSFB 1XF5B 4MNGA 4P2QE 4LHUD 4FNLL 1CICB 3RDTC 3RQ3A 4EKXA 1S9XB 2HLFD 1MPAH 4NC1E 1DUZB 2WAHA 1CTNA 1QHOA 3MBXH 2DLEA 2AQ1A 4KH2A 1JF5A 3RKDD 2K3TA 1MHCA 5GGSB 1UH4A 2FJGA 3OAUH 4PRIE 3STLB 4KKAD 1JTPA 3LIZH 4I4WB 4JGJA 4Y0GA 1FFOA 2F5BH 2FB4H 2BNUB 2J8UF 4FNLH 1N3NA 4FFZL 5C07E 1KGCD 5ID1A 2P42B 1FIGH 2CIIA 2JCCF 5IB3B 4JHWL 3BPOC 4XBPB 1CFTB 3G5VB 1JP5A 3ZL4L 1BFSA 1OW0C 3EGSA 2XACC 3TM6A 1MCCA 1GGCH 5CSGA 3SEPA 1CLZL 1PSKL 3C6LA 4GW5B 5IROC 2AV7A 1CCZA 4TOYH 1B9ZA 1AIFB 3HN3A 2F54E 3BW9B 4XH2A 2GY5A 5D6CA 2R2EA 4JRYA 4U05A 1I3GL 5D8JH 1MLCB 3U4EB 3VFRA 3SPVA 5CIPH 3L3IB 2A83B 4GBXC 3O45B 4RBPH 2PETA 5HI4D 3TBTB 2D7MA 3F7YB 3RWJA 1PX4A 1R3JB 3VFUB 3VE0A 3QDJE 4LF3B 4GMSL 3ZL4H 1W0WA 2AK1H 4Z7NF 5IT2L 4JFYB 4IS6A 3CU7A 3WSQH 2ZUYA 3TN0A 4NKDB 4X6FB 1KN4L 5C0BD 3MUGB 4OLWH 1T4KA 4XXDA 2A0LC 1N6QH 1U8OA 3PE9A 4R97B 1JTOA 1P53A 3UTSA 4OD2B 1I3GH 4MJ4A 4X7EC 3HRZA 3MNWB 5HYSA 4YWGL 3P0GB 4PRBB 32C2B 5GS1A 3NFSL 5FFLA 3C6LD 3WV0A 3E1F1 1NCAH 4PUBH 5DRXB 3NFNA 5CJXC 4LSUL 2I07B 4M8VA 3DMMC 3ULVL 4LLWA 4ONGL 4JDZB 5T5NG 4JRYD 1XH3B 5AYUL 4HX1A 3UEZA 3GRWL 1U2CA 3L3DB 4XWOD 1S8DB 15C8L 2O26U 5JZ7C 4YHNA 2QADD 4O2FB 2E6QA 4D2NA 4QHMA 1FVCB 2MNUA 4YZFE 3D69A 4LSQL 3TN0D 5K9JL 4OLXL 4N8VG 4RA3A 1BIIA 3GMLA 1M7DA 5CJQH 3ULVH 3UTSD 4FG6D 4I0PC 3GRWA 3NN8B 3GUTB 1FYHB 4UQ3A 2WMPA 3I3BA 1KCSH 5ITFB 4GKNB 2FSEB 3QSKB 2J4WH 3HMWH 3TNMB 4KZEH 4WRLA 4YEEA 4Z77A 5AUMA 5D71L 1MCDA 4OCWH 3FFCA 3D2UB 1GH7A 3U7YH 2VDRL 4JZOA 1AGBB 1A9BB 3BKJL 2DQCH 4JFEE 3WXVH 4U1NA 1KTDA 3STZB 1MCOH 3V52L 2AI0H 4NYLB 5HY9B 3N50A 3AS0A 4OGZA 5E8OA 1LHZA 3ULVD 5EO0B 4M6NH 4LHUB 1F6LL 4XVSL 1IZKA 5TPWH 1CF8H 3NACH 2AP2A 5JIHA 3HI5L 3TBWA 4NP4L 5D71H 1JPGA 1I1FB 1Q38A 2H8PA 1OTTC 3U82B 1NLDL 3Q1SH 3L3JA 4M61B 2H3NA 3TPKA 1V7MH 3GMPB 2VLRB 4ZS7L 1S7SB 2NXYC 4P9ML 3LEXB 5KAQG 5JORB 1F6AA 1MWAL 3FFCD 4KQ3L 4TYUA 3RGHA 4OZIE 2DM2A 3Q6FA 4KK6D 4ODBD 4OCMC 2DQTH 2FEDC 1CFSB 1BEYH 4Y19A 5KANI 4P4RA 2X4SB 4MD4A 4PTTA 1H5BC 5BOZG 3VXQA 4J3OC 4NNXA 4NP4H 5DLML 1UWEL 2EE6A 3CFKA 1NLDH 2EECA 3A67L 4MNGB 4HEME 5IB1A 1MWAA 3FQWA 3DO3A 3QI9A 3IB4A 5FO8A 5T33H 1MWAH 2PKDA 4R0LC 4F58L 5I1EH 3HI6H 1KB5L 4JN1H 5JPNA 5IFAH 4HIEA 3MLZL 1Q1JL 1FL6A 1TVHA 2AEPH 1CBVH 3MLTB 2YMXL 1K6QH 3VFMA 4RIRA 2G2RA 3V2AR 3KPRE 2FJGB 5MI0C 3IU4H 4D9RE 4Z7VA 5DYOA 4LRNL 2EXWD 5EA0L 1ND0A 1UQSA 2FEEI 2R69H 4FQ2H 1E27A 1FFOB 4Y19D 3G6JF 5CP7A 1N3NB 4K23H 3JTTA 2O5XL 3G9VA 5ID1B 5C0BB 5FCUH 1KB5A 2CIIB 2HFFA 4M7ZB 3ARFA 3NTCH 3WS3A 1KB5H 4R7NA 3ZSTA 3EGSB 5HYEA 4OM1H 2XPGA 1DEDA 2BVYA 3C6LB 3QI9D 5I0ZA 2NR6D 5D96C 5D6CB 2R2EB 4UTBL 4JRYB 1MRCH 2DICA 3VFRB 3SPVB 3M8OL 1E4WL 2P1YA 4KKBC 4LVEA 4DJMA 1T03H 1FFPA 5IBLD 2VZOA 4NHCL 5DGRA 2QADB 3GGWA 5C0EA 1VFUA 4XCEA 3VFWA 3BZFA 3GHBL 1R24A 1U36A 1W0WB 4LDEB 4IS6B 4I9WE 1KC5L 1MOEA 3TN0B 3DROB 4RMQA 5EBWA 1EVUA 12E8L 4XXDB 1NLBH 3H0TA 1U8OB 5CMAA 3UTSB 1PQZA 5I8KH 4O2CA 4YDKL 5TDPA 4LMQI 1OAXL 3HRZB 1NFDE 3LKPA 2J8UA 4Z78A 5KSAA 5HYSB 1WITA 1E4WH 4OF3A 5SX5H 1E6JL 2Z4QA 1NC2D 2JCCA 4NHCH 4LARH 1P9MA 4G5ZH 3K3QA 4MHHI 3UJJL 4X7FC 4LLWB 1OAUH 2KQMA 2X9WA 1WIOA 4LLYA 1J18A 4J3VA 5FCSH 1QBBA 1IC4L 1ITBB 4K7PL 1AE6L 3QH3B 4K8RC 4YHNB 2YA0A 2QHLA 4QHMB 1FNFA 3WFCH 1UKQA 2HN7B 5HPMA 3SN6N 3NIDE 4M1DH 4NQDA 3DV6A 5D72L 3D69B 5DSCA 2A9ML 1E6JH 2DQDL 1OTUD 4NZRL 2DQJH 3MREA 1BIIB 3GMLB 2D7PA 1M7DB 4U6VH 1GIGL 2P8MA 1WAAF 2P7TA 5J1AA 2AJYH 3Q6GL 1VB9A 2VDLL 3MLVH 4M5YH 5KSAD 4UQ3B 4W68A 5E7FA 3U7WL 1IC4H 5H35A 5CINL 4LVOB 2K7PA 3U83A 4Q0XH 1I8LC 2AAVA 4G6ML 2VAAA 4RRPG 5AUMB 1XGYH 3FFCB 4GQPH 3L3GA 1G7HA 2A9MH 4JZOB 5DA4A 1QVOA 1HNGA 4YHYC 4U1NB 1KTDB 5HJ3A 3DVIA 2I60L 1AXTL 3HRPA 4XVJH 2VN7A 2D0HA 5FGBC 1E0OB 4AMKH 2YK1L 5E8OB 5FM4A 1YJDC 2CKNA 4PJXE 4ODVL 1DVFD 1CDHA 4M3JA 2H45A 3TBWB 5F6IB 1JPGB 5I15H 3X11A 2H8PB 4HC1A 4M93C 1Y6KR 4KDTA 5IJKC 3PWJA 1A6WL 1F02I 4GAGH 4JO4H 3BRDA 1EJOH 3L3JB 4HC1H 2H3NB 2AJUH 3QWQB 2AV1A 1LEGA 4NRXB 1I7TA 3CZFA 4DGIH 5K59F 3RFZC 5CUSL 1F6AB 4WEBL 4A6YA 3C8DA 3Q6FB 4CVWA 4J3SA 1BFVH 2UZIH 4N0CD 4Y19B 4A6YH 4Y4KA 4P4RB 4MD4B 4PTTB 5C0AA 5D7SL 2IPTH 2VL5B 3S4SA 3VXQB 4QHUA 4NNXB 2H6PA 4P99A 4BZYA 1AD0A 2CUHA 1GOHA 5D70H 3S36H 3CFKB 1NCBL 4W6XB 2W0LA 4GXUN 2VDOH 5J11B 1LP9E 1XCTA 2YZ8A 5E9DA 1LMKA 1NGQL 3QRGL 3T1FB 3FT2A 5IB1B 3PQYE 1G9NC 2XKUA 1MWAB 3MOAH 3FQWB 1W2KT 3QI9B 5D6DA 3VGGA 4MLIA 1LK2A 4KHTH 4FABL 5FO8B 4G6KH 5JXEA 5ALBL 5JPNB 4HIEB 4UILL 3MROB 1FL6B 1TVHB 5EBGA 4GAJH 4MXWH 1QRNA 4K3EL 4LAJH 3VFMB 4RIRB 3G04A 4G6JL 2G2RB 4HF5L 2DLHA 4ODTL 3O2WH 1DBAL 1CI5A 3ELAT 3L3KA 3B83A 4YLQT 2BFVL 5INDA 3I3EA 4Z7VB 5DYOB 3KS0J 1MCWW 1V3JA 1ND0B 1UQSB 1E27B 4Y4KD 3WN5B 5CP7B 3H9SA 2W0FA 1SEBA 1CWVA 3JTTB 4W6WB 4HIXL 5BQ7A 1MFAH 4NQXA 2ZP0T 3T0EA 1KB5B 3T4AA 1MRDH 3D9AH 35C8L 4H88H 4XPHH 4BYHA 4FABH 3LH2L 2HFFB 2R9HC 3LS5L 5ALBH 3WS3B 1KIRA 4NKOA 2B5IC 4R7NB 5E9DD 5DD5L 4DFHA 2XPGB 3KR3L 3WNOA 2WQRA 4Y4FA 1U8IA 1NC2B 1X5ZA 3MJGX 4XNUH 5HHNA 2FZ3B 3ZTJG 2EDWA 2QQLL 5JXED 5EU7C 1XT5A 1KENL 1VFAA 2BNQE 5C0CA 5A2KH 3BPNC 2PTTA 3MODH 3NH7H 4WI2A 3AS1A 4LHQB 1QSEA 4V1DA 1FFPB 4Y16D 1FZMA 2AK4E 3GGWB 3LS5H 5C0EB 4XCEB 4UT7H 1IRAY 2B0SH 3BZFB 3VFWB 1R24B 3GMOA 4ZSOA 3G5ZB 4ETYA 1FNSH 4POZC 3UZVB 3H9SD 5F7UA 3CUPA 3T0ED 3S34H 1WC7A 3H0TB 1CLCA 5F93C 5CMAB 1MF2L 5TFSL 1PQZB 5JOFA 3G6JA 4O2CB 5TDPB 1NBVH 3LKPB 4YHPA 2J8UB 4Z78B 5KSAB 3PWPA 1FRGL 4X5WA 2WWMC 4Y4FD 1ZLSL 1NCTA 1CFVL 4TRPL 4XI5C 1FJ1A 3V4UL 4V2BA 1YPZE 1AFVL 3TLRA 1HIML 1KB9J 4L3ED 4PR5B 4LLYB 3QA3A 4NZUH 3QCVH 1QSED 4V1DD 3VDAA 1KCKA 2V5MA 4B0MM 1KCVH 1S7QB 2VR9A 2ITCB 2R0WL 1MF2H 1TQCC 5HPMB 2CSPA 4YHIA 5I8OH 3DV6B 1XR9A 3RBSA 2V7NA 3PP3H 4U4BA 1FRGH 5DSCB 2HT4D 3MREB 5F9AC 4BSWA 3MLUH 1DVFB 4FS0A 3NA9L 2P8MB 3MBEC 4GAYA 2P7TB 3R0MA 2H2PD 5J1AB 1HINH 5EUKA 2NCMA 3F7QA 3TJHC 1UT9A 5H35B 1KBGH 1QNZL 3HS0A 5F70A 3F6LA 2GUOA 2EDOA 3BAEL 4KJPD 1GJIA 3ES6A 4MX7B 4OD1H 1X3DA 2VAAB 2EO1A 2R0WH 5D7KD 3IDGA 4TUOA 3L3GB 4YXLH 3EOYG 1G7HB 3IDJA 3ZTNH 1N0XH 4RNRA 1FYTE 3U4BL 1QVOB 3N85L 2Y06H 3WE6A 2NX5D 2CUIA 4O51A 5HJ3B 4PB9L 3AGVA 3LDBB 1P7QA 5JIKA 3ZLQC 2CDEA 2LFGA 3LEVH 1RZFH 1A1MA 1ZE3C 2AEQH 4EIZC 5B39A 2E7BA 4PG9A 4NO3A 3NZHL 3X11B 4L8SA 2NZ9D 1Z2KA 3PWJB 5EO9A 2JTDA 2Z31C 4JQXC 1YN7A 4J4PA 2YZ1A 2AV1B 3F58H 3KHOA 4ONHA 5EORH 1I7TB 1WAAA 3CZFB 4TTGA 5GZNC 1DQQA 2VN4A 4WFGD 5DA0B 4D0CA 5E8NA 4Y4KB 1WWAX 4EN3A 3L5JA 5D1QC 5C0AB 2BDNH 1UADC 1DANU 4TTDD 3S4SB 4QHUB 3RWFA 2H6PB 1CR9L 5FYLE 1RZJL 1AD0B 2WWKT 3RX8A 3QP3A 1P7QD 2HA1A 5J3HC 2FH8A 4LPXA 4U0RC 2FD6L 2FBJH 1XCTB 3GSWA 5E9DB 3GI8H 5EB9A 4C57C 3AVEA 5FUCE 2AVGA 4HWNA 3P11L 4AEHL 3NABL 1LK2B 2ZUQC 2PUQT 3SKUD 1NBZA 4ACPA 2ZJSH 3U46A 5EZIL 4PV9A 3BEWA 1NMCC 2Y6SD 4LASH 1NEZG 3IAQA 4WENB 1QRNB 4YE4H 1DQJA 3G04B 5D1ZA 5C08A 4Y16B 1RZJH 3L3KB 5DJAA 5INDB 4XNMA 3P4MA 2F19L 3OHXA 1AXSA 2FD6H 4FZ8L 3WS6C 4LVNB 3T0BA 4EN3D 3PUCA 3H9SB 1SEBB 5BQ7B 3LZFL 1BQHA 4NQXB 1G0YR 3T0EB 4NKIH 3T4AB 1NCCL 2GSGA 3BZDA 2EE3A 1BIHA 4KY1L 5GGUA 1KIRB 3RVWC 4NKOB 3OKKA 1WFTA 4ORGA 3SE8L 4Y4FB 1U8IB 4HUVA 1QFPA 4OF5A 1YEJL 5ERWA 5HHNB 4M9OA 5AZEL 5F6HJ 3LN4A 1ACYL 3TV3H 1FCGA 4L3EB 4AIZA 3GJFA 1VFAB 4U1GC 5C0CB 4YXKH 2PTTB 1F4WH 2VOTA 3GJFH 3QCTL 5BZDA 2IPUG 4X9BA 1MREH 4LKCA 5IBUB 1EFXA 1QSEB 3MRHA 4V1DB 5C08D 4CGTA 5HDOA 4NJAH 2D03L 3GSRA 1FZMB 4BKLA 5F9JA 1SJXA 5HI3C 1ZVSA 3GSXA 4LSVL 1K8IA 4ZSOB 3MSPA 5B21A 4TUKH 4Q6IC 2PR4H 3W11C 3CUPB 2CJUH 5EG6C 1YEJH 1WC7B 2ICCA 1EMTL 3DVGA 5HGDA 5L88H 2FHFA 1NEUA 2AJXH 1WK0A 4RGOL 3G6JB 5JOFB 5BOPA 2HP4A 2BXZA 1JNJA 4YHPB 5MP6L 5E2WH 4X5WB 4MJ6B 4AQ1B 3A6OA 4KTDL 2YRZA 1FO0L 3L5IA 4ZOCA 1QFWI 4Y5VC 3S88H 4LDLB 1JGUH 1V3MA 1CN4A 2XZAL 1DQLH 3QA3B 4X7CC 3RZCA 3QEGL 4Q58C 1EFXD 5F7YC 1IC7H 4NN5B 2VLJE 2YRLA 1MFCH 4MQXC 1VFBB 2ZZUT 4WHDA 1G7LA 1ZHNA 4YHIB 3VXUA 1E4KA 2C4FU 1XR9B 4N1CA 2V7NB 1FO0A 4L9LC 2R0ZL 4BSWB 5GS2H 1WVZA 2QSCH 3DYOA 3TVMD 4AEFA 5C6TL 4M6AA 4GAYB 1RSFA 4Q7DA 5EUKB 5D7LE 3BIKB 4CL7A 3GKZA 3REWA 3HS0B 1EUTA 2GJ6A 4XNXL 2UY6A 1MRFL 1OAZH 1GZQB 2GUOB 2V2WA 2V5SA 3ES6B 1YQ2A 3FO9A 4WCYL 3IDGB 3RZCD 5I30L 3IDJB 1Q8MA 1KEGH 3BDYL 4QXTA 4RNRB 1BAFL 3CMGA 2DL9A 1T1XA 5C6TH 2JJVA 3WE6B 5JR1H 4O51B 3OF6A 3VXUD 1P7QB 2IQ9H 2VXUL 2CDEB 1A1MB 5B39B 5GGRA 1A3LL 3ARBC 1F00I 4PG9B 4XP9H 4N0FA 2F53E 4HWEH 5IM7A 3LEYL 4WCYH 5I1JL 2BHUA 2FIRT 4NM8L 4L8SB 2Q7YA 3Q5YA 3DUSA 5I30H 3QISA 1RJLA 2GJ6D 3X3GH 1YN7B 3VFGH 4ONHB 1JRHL 4MA7H 2LAGB 1EIBA 1CXLA 2A77H 5DS8A 1GHFH 1DQQB 4WNQA 4GW1A 3HE6A 2XICA 4D0CB 5E8NB 1NCDL 1TENA 5J8OA 1MCFA 4EN3B 1D5MA 3EYSL 5MHSE 2W1NA 1VGEH 1U9KA 3RWFB 4BH8A 1ZEAH 1KB9K 3OF6D 1LEIA 5CGYD 1ZA3A 1S7XA 4YZFF 1DQML 4ZPVA 3GSWB 5ICXA 1PKQB 2XRAL 3WJJC 2KH2B 1AGEA 1I9RL 3KLHD 3LD8B 5KOVC 1L6ZA 1NBZB 4K7PX 1GAFH 3U46B 1J1PH 4PV9B 3BEWB 3RY5A 5CILH 4TPRH 4OV5A 3JZ7A 4P2OA 2HTLD 4G9FD 3QUXA 4YR6A 5C08B 4OGYL 2LVEA 5DJAB 4XNMB 3P4MB 1QHPA 3G6DH 1GGTA 3OHXB 1AXSB 1U6AL 4U1MA 1OTSD 1RZIA 1B2WH 2AQ3A 1BQHB 4N0RA 3O6MH 4YXHH 3BE1H 2VB5A 1JPSL 4YDVA 1R3KA 2GSGB 1QFOA 3DURA 5GGUB 4MA1C 1U8HA 3VA2C 2I5YH 1DLHA 2MHAA 4GLRI 3GJFK 3N0PB 3I6KA 4HGMA 3VMNA 4ORGB 1A6UL 3C08L 5FB8A 4NIKB 2A6KA 5KZCD 4HUVB 5ERWB 4UNVA 1MSPA 2PNDA 3LN4B 4AIZB 3GJFB 4HS6A 4OV6F 5DQJA 2J7LA 3EOBA 3MYJA 5BZDB 3JXAA 2X4UA 4LKCB 2I9LA 1EFXB 1MJ8L 3MRHB 3TJEL 1RZGA 4P3CL 3GSRB 5EZOL 5F9JB 4M5ZH 4J12A 1ZVSB 5FEBA 5KVGH 3GSXB 3ARGC 4OZIF 4HCRL 2CLRA 2FLRT 4KPHL 1K8IB 2XV6B 5DK0A 4WUKH 2NY0C 5KSVA 1HKFA 3DVGB 2GEEA 3TVMB 5FDYA 5HGDB 3V6OA 2R1XA 5T3ZE 2R56H 2KKQA 2DOCA 3RWCA 5HHQA 2DBJA 3FOMA 1YC7A 4GH7B 3ZT5A 1J0IA 3QNZA 2FO4A 4HCRA 5E03A 1CICC 5A3ID 8CGTA 4KJQD 1A3QA 4JVPA 1FL5A 3M17A 3RZCB 1WBZA 2YBRA 1W8NA 3H3KA 5IVNA 5J7CC 3LS4L 3LRSA 3MV8E 2PYED 1G7LB 1FSKB 2BVQA 2L4OA 5EOQH 1ZHNB 1BLNA 3MX0A 3WNLA 3SKMA 1I1AD 3O2VH 3P9LA 3VXUB 1UEYA 1FO0B 1D6VL 4HJGA 1K85A 2Y9RT 5A2LH 1DFBH 4ALAH 1D3CA 3CFCL 4PJHE 2AJVL 3JUZA 4FQIH 3REWB 4F57H 2GJ6B 3CLEL 3IXTA 3TC9A 1H9VA 2OR9L 2V2WB 4YK4B 2EC9U 1NUNB 3FO9B 5I8CA 5F7FA 2C1OA 2A6IA 4GG6E 3PABA 4QXTB 4HAGA 3TH2T 5DEGA 4HULB 5L8LB 1AR1D 4G6AC 1T1XB 2XZCL 1VEOA 5C9JA 3DSNA 1RV6X 1RUKL 3ULUH 4UV7L 4C59B 5BVPH 1G7JA 5HHXL 5GGRB 4NBXB 5BW7A 4N0FB 4PB0H 5IM7B 4PRIA 2FDBP 5KVFL 1I1CA 1FAIL 1I75A 5F3HA 4H8WH 3EDFA 3R1GH 1NFDF 2QQQA 3ARRA 4R97C 5C07A 1RJLB 5ESAA 2H32H 4H26A 1LO0H 3LN5A 5F9OH 5EOTA 2BSRA 3V7AE 2DIAA 1YMMD 1A7OL 5DS8B 2HT2C 4WNQB 6FABH 4P2QD 4GW1B 5D1XA 1JFQH 4IDJL 3WIHH 3U7AA 5E2UL 5KSBE 3IT8D 3QIBA 1D5MB 1T21A 3SE9L 2F54A 1L9MA 4BH8B 2VXSH 2W9EL 1LEIB 3IETA 3NIDF 5M7QA 3VI4E 4PLJC 1F6FB 2WP3T 5E8PA 1RPQA 1ZA3B 1S7XB 3LQAC 4JPIA 4S1RH 5ICXB 1MCPL 3LPFA 1AGEB 5KZCB 4PRID 1JHLH 1KIUA 3QDJA 2JJSC 1JV5A 1A7OH 1ZHKA 4H20H 3BT2L 1NAKL 5HYQA 2NY2D 2YD9A 1X5XA 4MAUL 5C07D 1IVLA 4OV5B 3TO4A 4KVNL 3UP1A 3FO1A 3ZTJH 2X1PA 1BBDL 4YR6B 5JOPE 4LFHD 1OSPH 4O00A 3G08A 1GGYA 5E99H 1MVUA 5D1XD 5CBEA 4QCIA 3LB6C 3O3EA 4U1MB 1QZ1A 1RZIB 1QBLH 3L3HA 3QIBD 3LSOA 2F54D 1YN6A 4DN3H 1MY5A 5CJ5A 3B2UD 3QUML 4YDVB 1R3KB 5DFWH 5F7WC 4XPFL 1JNNH 3A6BL 3DURB 5AAMA 4Q97A 2EKSA 1U8HB 3BT2H 1DLHB 4WI4A 5T3XE 4HWBH 1OOAA 2MHAB 3CSGA 3OPZL 4XRCA 5LBSL 1FDLH 1BBDH 5FB8B 2A6KB 4PJXF 3B2VH 1CD1A 4JE4B 2OTWB 2E27L 3QDJD 5E6ID 2WQ8A 4PY7A 5GGVL 3TT3H 4HQQH 4CADA 2DI7A 1EPFA 4HS6B 1AP2A 4K94H 2HLFC 4Y2DD 5DQJB 3MYJB 1MVFA 1MHPH 3QUMA 2X4TB 1YYLL 2X4UB 2I9LB 4P23A 1HCVA 1RZGB 3OG6B 3QUMH 5DUML 3SGKC 2PYEB 1WBYA 3RKDC 5LKNA 2FX9L 1GGBL 1ZANH 2CLRB 3ALPA 1I1AB 4NNPL 4KU1A 4PJGE 5DK0B 1Y0LA 4H5SA 5KSVB 1D5ZA 4DVRH 4KKAC 3KG5A 2MQCA 2J5LB 4YH6A 1DZBA 2R1XB 4YFLF 1LP9F 3RWCB 1IT9H 4JFEA 5HHQB 3FOMB 2YEZA 1HILA 3GSNL 3QNZB 2FO4B 4YHOL 5E8DL 3U1SH 4HPYH 2FX9H 4LKXA 4HG4J 5GIRA 1F4YL 1Q0YL 1FL5B 3M17B 4QTHA 5FYKH 4JZJB 4OZ4A 5BMFH 4P23D 1WBZB 2YBRB 1ED3A 2BVEA 2CXGA 4LPYA 3WIFA 1OGTA 3LRSB 2XA3A 2BVQB 3MRQA 5HI4C 1BLNB 3SKMB 3P9LB 3GSNA 1OAYH 2W0PA 1IGIL 4L8CA 2EDLA 2V17L 3QUYA 5SV3A 3MLRH 4YHOH 4OZIA 3QHZL 1F4YH 4KROD 2DDQH 2X89A 4KWUA 3TZVA 4X4YA 4M7ZC 3VCLA 3VU2A 3IXTB 3CH1A 2EYSA 2BSTA 3OV6A 4IOFD 3VA6A 4AQOA 1J5OL 3QXDA 5DD3L 2NQCA 2LU4A 4KQ4H 1I8MA 3C6LC 5HI5D 5I8CB 2MMXA 2C1OB 4URTB 2A6IB 4P2QB 3PABB 1JCKA 3V5KA 4KJWD 5DEGB 2KZ1B 3GZKA 4JM4H 3RGVD 2E7LA 5EN2A 1Q9WA 4XWOC 5C8JA 5C9JB 2OP4H 3R8BB 5C2BL 3B43A 2QADC 1NGXA 4KK5D 2YUZA 2DWEA 1G7JB 4XAKE 3QUYD 3KPRA 1L7TH 1WEJL 1LWRA 4HZLB 5J6GA 3TN0C 4PRIB 1A5FL 4JO2L