1O9WA

F17-ag lectin domain from escherichia coli in complex with n-acetyl-glucosamine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
169
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17A-G FIMBRIAL ADHESIN
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 169
sequence length 176
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9wA00
2BS71 3F6JA 3F64A 1O9VA 1O9WA 1ZPLA 3FFOA 1OIOA 1ZK5A 2BSBA 1O9ZA 2BS8A 4K0OA 2BSCA
chains in the Genus database with same CATH superfamily
3GSVA 5D7LA 4FD0A 4WGVB 1HC1A 3VD5A 3WHXA 4LSSL 2VLJA 2WLHA 3K71B 2ICEC 3P4NA 4C56A 4BD4A 2BP0B 1FFNA 2F8OA 2IIJA 1G43A 2BZCA 2JIXB 1C16A 3LN9A 1CICB 1E28B 1EANA 3D9AH 4NJ9H 3MU3A 3F5WA 3CXHK 1NDTA 1W8OA 3CVHA 4FGMA 3HFFA 1IAIH 4EJ1C 1Q90A 4LOEA 4APXB 5JXED 1ZS8A 4LVOB 3UO8B 5TE7L 5IB1B 3ZDXE 4RZCA 5D7LD 2N1KA 4HSCX 4KOBA 4POZD 3FO0L 2VLJD 4KDVA 2AHIA 2ATKB 4RA3A 3EGXA 4C56D 2WYTA 2HTKD 1ETA1 1OZTG 2X70B 4TNWF 5E2VL 2Q6WB 1XD1A 1D5XA 2HRLA 2GK0A 3RTQC 3MMEB 4OLWL 3C6LA 5TGBA 8PAZA 4L0PB 4PRAB 5GGVH 3WFEH 1AS8A 1KBVA 3NRQA 2ZUYA 4NQVA 1ZLUK 5E08H 2BS9A 2A77L 3ZR6A 2P45B 3JV0A 1THAA 2C9PA 3OLGA 5E5LA 2QKSA 1XEUA 1FIEA 1OD9A 4FTDA 5CGBA 1OE2A 4DGWC 1KYOK 1IGTA 4ORGB 5DRZB 4W9IC 2XSKA 3C2AH 1E5YA 4LO9A 1SLWA 1YLBB 4MDIB 1IAOB 3C6LD 4O9HL 4F24A 2X1OA 5HYSG 1NGZA 2QVFB 4KO6A 1IL1A 3L5WB 1A7QH 3WYRA 1CL7I 2BMKB 4H0GA 5I0DA 4M61A 1I31A 2GTZB 3CDYA 1X44A 3INUH 4UDTA 3VSTA 2QFRA 4FI8A 1P7KB 2HN7A 3LEXB 1EXHA 3SDDC 2ZX6A 1PF3A 5HBBA 5CEZE 1ZCRA 2ZPKH 1CTNA 1MQKH 4UT9H 4V33A 1AZBA 1X4YA 4UZSA 3D9AL 4NJ9L 4DP5X 3LD8C 4K7FB 2UY6A 2ZSWA 5EOCL 5TDNB 4W68A 3TNMB 1IAIL 1ZLWK 3VDCA 2BVOA 2IEPA 1BGXH 5HI5D 5DWPA 3GMLA 3F7YA 3PP4L 4GIAA 4HDIB 4NQDB 4ZW6A 1JYNA 2X2IA 4HWUA 5DRXB 3QEHA 3TOPA 1GHFH 4KO9A 4P2AA 2EYTB 1T89A 2D03H 2BS8A 1IZJA 4RAVB 2HKFL 4HISA 4FXGA 1CR9H 1P4BH 4N2AA 4XNBA 4QTIH 3QFJA 3ZKNC 5AVZB 3WFEL 5GGVL 3HS0C 1L4IA 4FFYH 3STZA 4PJ7B 5FK9B 1WBXA 3MRBB 4PJGB 1BWWA 3BWUF 3KBHE 3V7MA 5GZOA 3ULVD 5FR3A 4FG4A 1HNYA 2JKLA 2CCWA 3HA0A 1Q9OA 4K94C 5BVJA 3U9PH 1DE4A 1RIVH 2UWEE 4NQEA 5GS2H 4KC3B 4QXGH 1Z32X 3N42F 2QSCH 4YSEA 1P2CA 3U25A 2CMRL 3C2AL 3D85A 3QFJD 3H1ZA 4H8QA 1QX1A 4NGHH 4PGEB 2XY2A 3Q2NA 3KXFB 4QXWA 3PPEA 2J55A 3CH1A 3U6RA 1A7QL 4OGAC 4XPHH 4PY8I 3QI9C 3TFKD 5GZOD 3KPSE 2FQGA 3INUL 3QUMH 3T77A 2CK0L 4BZ2A 3OHMB 2OMTB 5DK2A 2UV3A 4NQED 3WS3B 4PYGA 1F6AB 3DKHA 2ZPKL 1J5HA 2WY3B 1MQKL 4UT9L 4WI2A 3TESA 2I9TB 1UD2A 3D85D 3PPSA 2GHWB 5GIRB 1AO7B 5BQ7B 5HVFB 2O6DA 1YZZA 2FL5B 5CD5C 1QSEB 2CRZA 3BEWA 5TQ0H 1JI2A 1NFDF 1BGXL 2VZ1A 3QUYC 5TTRA 1BCIA 5A43C 1MCDA 2B59B 1VB9A 2L7EA 4WWKD 2YGVA 4B3EA 4MYWB 1JTOA 3LNHA 1HKFA 4Q9QH 4YAQA 1GHFL 3AG4B 5EA0H 2HX8A 3MFFA 2D03L 4XN1A 1CYXA 5AW1B 1BVLA 5C9JB 2ZUQB 2Z9TA 2DOCA 5EU4A 1CR9L 1P4BL 3L9RB 4NN6C 1X5LA 5AFAA 5EPMA 3UAFA 1UD6A 4QTIL 2VR3A 2Y1AA 4QY8A 4DP1X 2Q76A 4WI0B 5CKGA 3KWTA 5A40E 1G9HA 5E8EB 3RHWK 5TFSH 5DTFA 4AT6B 3JTTA 3KD4A 3GMQA 2R9HD 4B5ZA 3NZ8A 4XOAA 3VFRA 1XGRA 4BZYA 5AB0A 1KIPB 4Z7WA 2YAFA 3F2LA 5B21A 2VXSH 3FDWA 2Y0SA 2A38A 3LVTA 3I02A 4U6YA 4HG4J 1I9JH 4OFPA 1ASOA 1U8LB 1YN7B 3THMH 3NCFB 5AWNH 3U9PL 1JZDC 4GP4B 3C5JA 5JXEC 4QXGL 4C4KT 2VC2B 2QSCL 3RFZA 4BRVA 4XMUA 4JO4L 3W0WB 4PHXA 3L5XH 5F7UA 4RMTA 4ZQKB 5IQNA 2R2HB 1QAWA 1SLVA 2WHVA 1U9KA 1EFQA 1D7CA 3QDGE 3UYPB 4KOCA 3EBAA 4L4VA 3DIVA 4XPHL 4LCWA 5D7KE 1XGTB 1XCQB 3C2SA 5I74B 3POHA 2YBRA 4X6BA 4XGZA 3QUML 5DHVB 1BPVA 2H5UA 4XWGH 2B08A 4DT2A 3UAEA 5KVGL 4P3WA 1RPUA 3TURA 2Q2LA 3FFCB 3QS3A 1RURH 3VD2A 2GABA 5C07E 1J05B 4HS3B 3ZT5A 3ARSA 3NYKA 4JFUA 3S5LA 3Q3GB 1AKJA 5KJ4A 4D0BA 2JK5B 1PZ5A 1JZ3A 3VFSA 4EUPH 1HYRC 4L4VD 3U4KA 4LCWD 3G5ZB 2XFGB 3K4DA 2YAOA 3NJGA 1QBAA 2R69A 3ARTA 4M7LT 5FKAB 2YPVA 4Q9QL 1OCRB 3QCTH 3QQDB 2Y23A 3BT0A 4X8JA 5D7LE 1A66A 1LO2H 1V5JA 1JXFA 5EA0L 3RY4A 3DV4B 5TE6H 3L1GA 4JKPH 4P5MB 3WGVB 3IFNH 3ARDA 2FECI 3SO3C 2GY7B 1KJVB 3ALWA 2JKXA 3ESPA 1ICTA 4CSTA 5TFSL 1AKJD 2NX5B 2A9ML 1ZT4B 1ND0A 3LVEA 3V5HA 2X0VA 2VXSL 3OSVA 4FTVE 1I9JL 3UP6A 2YZ8A 1KGWA 1MN4A 5F0MB 3THML 5AWNL 3C8KA 4YBLB 5HI5C 3VFWA 4JL2A 5C0EB 3KBFA 5H4YA 3ARDD 2JCCB 2H32A 3L5XL 5EULV 2KBGA 3DYMA 2K4WA 3SYCA 1AQKH 4I0CC 3QR0A 4HC1A 2QQQA 3L08A 5SV3A 4HD9A 5EBLB 3P73A 3WLWD 2RB8A 5FGCE 2Y1VA 3GXFA 1MKFA 1T2XA 4FMVA 4XWGL 3MRFA 1GMEA 3DMMA 4M8QA 3WSQH 4UUJA 3S3BB 2NZ9D 1SXNA 3T2QA 5DJDB 1K3IA 3ULVC 4HEME 1OT1A 5INDA 5SWQA 3S9DB 3DUSB 1WA0X 3OKKB 3B8SA 1T89C 1UEMA 1CVRA 2FIKB 3FXIC 3LKNB 4X6DE 4GUQA 3HC0B 4UYPA 4FXGC 3VXOA 1MFVA 2DAVA 3JWDH 3PGFH 4UQCA 1Z9OA 4CVWA 4GXUN 1KNOB 3MREA 3QCTL 2E5EA 3QULA 3DMMD 3HMXA 1LO2L 4KKQA 2EDHA 4Q2ZB 3CX5J 5GZOC 1DBAH 4KUZH 1NCIA 4JKPL 5TE6L 3H4HA 2Z7ZA 3IFNL 3V79C 4L1BA 2K6ZA 4LLDA 4PQXA 4FNQA 1E5UI 4GSRA 1JGUH 1GW0A 4P5KB 2XU9A 4KY2A 1TMCB 1YYCA 1QLFA 2HJFA 2RCSH 2XN2A 1CLCA 2H41A 3BSHA 4ZMYA 5F97E 3QZWB 1I1YB 1V7NH 2DW5A 2YUWA 3AFLA 2D4FA 1X5YA 5FFOA 2I32A 4EI0A 5ICZB 1NGPH 5L4IA 4CC1A 5KS9B 2UVFA 3WN5B 2A99A 3QG6B 4XXDB 1ZLEA 2BC4B 1LVEA 4YE0A 5GRZA 4WFHD 1IFHH 2BH0A 3ZSTA 1AQKL 2BSDA 5HYJA 5IVXF 3U6XA 2X1PA 5KSBB 5IVZA 1BJ8A 1EX0A 4PY8J 2X9ZA 4Z77B 1MCQA 5FEBA 1A6WH 4NRYB 5F7DA 4LOUD 1UGNA 4UZUA 2R9HC 5E24E 3HG1A 1XZ0A 3WSQL 4FXTA 4OGYH 4HIEB 4Z3HA 2EO9A 4GMSH 5KN5A 1P53A 4RZKA 2BINA 4NHCH 5E8OB 5EN2A 1C5BH 1IMHC 2MNUA 5DFVD 4H25B 3PGDA 3D39E 5HYJD 3QUKB 4S1QL 5CF3A 1YUHB 3RJDA 1A1NB 3OR6B 4CN6A 3JWDL 5LN8A 3PGFL 5DJXA 5EBWB 3D87B 4AEIH 1G7PB 5E1HB 4RLDA 1JN6A 1B0WA 3FCUB 4PBWD 3HG1D 3RJOA 2HFEB 1A9BA 2ZOKA 4OIIH 4XN5A 1DBAL 4KUZL 5H2BB 1EJOL 1XR9B 2ZF9A 3RL2A 3BZFA 3VFVB 4CGUB 1FJ1B 2CA4A 1TZHB 3ARPA 3RBSA 5I6LA 1JGUL 3RFZC 2WSKA 3FSOA 2PO6A 3WNKA 1J8HB 2RCSL 2WMPA 4H88H 2GJ6E 2QADC 1J9CT 4PI2A 4R2GB 1O0VA 2WKGA 1JGIA 3F7PC 4WQOA 5DS8B 1V7NL 3GIVA 3PABA 5DA0B 3WUWB 2ZICA 1NGPL 4LSTH 5AW8B 1YAZA 5D2NB 3APNA 1NSNH 4NQDE 2HJKA 1CYGA 3HPJB 1HILB 3ILEA 1IFHL 3OXRB 4OQ1A 4EXPX 2WIMA 2WP3O 3DX2A 4JM2A 3TBTA 2PO6D 2X4TB 1CG9B 1CTMA 4PGCA 2A9AA 1KIUB 3N0PB 4F7EB 1A6WL 1QFHA 1J1PH 4PJGE 3P0VH 5LKNA 4A67A 2XV6B 4OGYL 1AKPA 3LV3A 4GMSL 3DARA 1UUSA 4X0KB 1NPNA 4NHCL 5FV1L 2F8VA 3M1BB 1C5BL 4D7PA 4MCNA 1IBYA 1G9NH 2VLLB 2YMTA 4JM2D 3BH9A 2P28B 1DZBA 1NEZA 2F6AA 5EZPA 1QUNA 1XB3A 1W0VA 1E3FA 2CM6A 4J6RH 4XOCA 3BP6B 4QNPE 2R51A 4AEIL 2HTLD 2QJDA 3KXFE 1CD8A 1PYWA 1JGDA 5I6PA 5HVHC 1TCRA 4HULB 4DO4A 1AIZA 1UWYA 3WLWC 3BAYA 1IZKA 3KWVA 4O58H 3T0WA 3Q1SH 2Z8SA 5T1MB 4E9RA 1IGIH 2CJUH 1KV7A 1X5JA 1XAKA 2BW4A 2ZAGA 3OM3B 1JXGA 4TUOA 5IOPA 4OTXH 2NY7H 2C1PB 4AV5A 1HCVA 3HBQA 2EICA 4TRPH 5IB5B 4HWBH 4ICWA 4H88L 3DXAB 3M86A 2QHLA 4KTEH 4UV4H 3OG4B 3P9LB 3PNWB 4GEJA 1LO0H 2FJFA 4E5XA 3VDBA 1N5YH 4ZMZA 4NLHA 3NGBC 2B77A 5K39A 4LSTL 5E5RB 5E8PB 5EU5A 3HVDA 3QEGH 3QZWG 4E41B 3VXQB 2QGCA 4DEPB 1UA7A 3DMMC 4NC1E 1F02I 2AQNA 4YNYB 1UC6A 3MLYH 4DKDC 5D4HA 1S7UB 2UZXA 4L4JA 4Y2OB 4I9XA 5IB2A 2GITB 5DJ8B 5D1XB 2WKOA 2ADGB 1NTDA 1OANA 2XZCH 2ZCLH 1NCJA 3K6IA 3P3SA 3I6KB 1J1PL 3UAJA 2ALAA 1DQMH 5I1DA 3P0VL 1JRHI 4U1GC 1KB9J 2Y6TE 4AYFA 1MI5E 1B0IA 1KXVA 1THCA 3F7KA 5SX5H 4N1CA 5AUMB 4QHUB 5HVGB 5MEQB 1BVZA 3U1SL 1G9NL 3BPCB 3KPRB 5AOJA 5ACZA 3NCBB 3BFQG 1DDHA 2VSMB 4X42A 3SCMB 3N04A 3MNWB 4WWOA 3T6VA 3W0WE 5I5RA 1ZSHA 3IGUA 4J6RL 3QYNA 4YLQT 2OYKA 4ODXA 4QRPB 3B3IA 5CP3H 1EFXB 3UAJD 5KVFE 3UTTE 4YIQA 2F9BT 5F6IC 5TDPB 1ZIBA 5C0ND 1A3LH 1CDCA 2A6JB 2V17H 3CFQA 1KY6A 4O58L 3SB3A 3Q1SL 2X05A 2AQRA 3C87A 1IGIL 5MERA 1FWXA 2CJUL 4GBXA 4UT6H 2XXGA 4OTXL 2NY7L 1GC1H 3TCLA 4B41A 4TRPL 5CJOL 4HWBL 2V5MA 3ZDZF 4EKXA 1E9OB 2Q0ZX 1YEFL 2V2WB 1AQMA 2VDMH 4KTEL 4U49A 4UV4L 3AU1B 1FNEB 2PPAA 1LO0L 1WFIA 2GSIA 1N5YL 4PWFA 1GKOA 1UH4A 4J39A 2WBKA 1JJUA 2R1WA 1ZSDB 1KCUH 5D7SH 3BGMB 1M7DB 1LHZA 3QEGL 1FVEB 2CWRA 2NY0D 2G5BB 4GBXD 1BIIB 4U1NB 3R1GH 2CALA 1D7DA 1MWAB 2KQMA 2VDOB 1R1CA 3BPLB 4HJSA 4LNRA 4OSUH 2VDQH 1N8ZA 5TPWH 4AY0A 5DQJB 3D4GA 1T0OA 1TVBB 1FNSH 2BFVL 2NX5E 2ZCLL 4H26B 3KPQA 3VA2C 4AC4A 1IFRA 3FUNA 3MRRA 5JOPD 1VGKA 2NY1D 3D7PA 3U2IA 4MQ7B 3OX8A 4ZW3A 2W60B 2FVNA 1JHTB 5ITBH 3BKMH 1FZKB 5TF0A 4Y8AA 2WQ8A 4BGLA 3LKPA 1OLZA 4YHPA 5G4NA 1EHLH 1SXAA 2RH0A 1XF5A 3QJSB 4XO8A 3HZYB 3LZFH 3MODH 5J89A 4KXZH 2C34A 2ADYA 3EYVA 1QTYT 4D9QE 2VERN 4AH2A 2V2XA 2CUHA 4PW3A 3EO0A 1N6VA 1KFGA 4Q6IA 3O8XB 1QFPA 1BVKB 1ZEAH 4G7YH 2PO6C 4IKKA 3HG1E 5E7BA 4DQOH 1FFPB 2EINB 1A3LL 5I75B 5IQOA 1OF0A 2V17L 3NIFF 1R47A 4Z1PA 4AGNA 4JJHA 3OGCA 1FA4A 4BSJA 3TYGH 3GSNH 3JTSB 1EUTA 1GAFH 1JCKA 2BWQA 1UA3A 3ZGIA 3VG9B 4WJG3 2VDML 3MO1B 2DKSA 1HH6A 4QPEA 2P8PA 2N7BA 3Q2WA 4JM2C 3TO4A 1AD9B 4J5VA 1MPAH 1TZ8A 2VN7A 1KCUL 3GS4A 5SX5K 2HRHA 5HGDA 1B0GB 1D6EA 1DQJB 2GT9A 5C0BA 2UYLA 3Q7JA 4OIBA 4WSJA 2HTLC 1EXUB 3S3SA 3VRJB 1HAUA 3R1GL 2GTQA 3FCTB 4JZJA 4EIZC 3DSNB 2H3NA 4ANKA 1S7XB 4OSUL 4MXVF 2VDQL 3KBEA 5DJ2A 2WLKA 5TPWL 1IE5A 5ANMA 3CE1A 5IFAH 1ZHKB 4TSBH 5E5MA 1FNSL 4MNQA 3RVTD 4PRNB 3H3BC 3TO4D 4KI5F 3EHBD 4ODVH 3MKGA 5KSAA 5SWSA 2C1OB 2WIIA 4GG8B 5B1AB 1TJMA 4ONHA 4M7ZC 3S7GA 3BKML 3BLBA 3BDXA 3WFBH 1CU4H 1EHLL 5EU6B 1BD2A 3Q8AA 4BFGA 3FHQA 2Y24A 4C4BA 2V9QA 4CILA 1TYJA 5C0JA 4JQXA 2Y07L 3IDIA 2AJXH 3MODL 5GGTA 1F2XK 4HUUA 1RZJC 2B20A 1HIMH 3GKZA 3V2AR 2EDEA 1AHMA 2CKBA 4MNQD 3DWTA 4UQDA 4K0OA 5KSAD 3SBRA 3GXTA 5SWSD 2OMYA 5KSBE 4G7YL 5FA3B 4DQOL 1PKQB 2DQJH 2K7PA 1C12B 1DQKA 1O6SA 3T8VA 2VLRB 3MRIB 4BCZA 1BD2D 5FFLA 5E94A 3JT2A 5D9SB 3SGEI 5GS0H 3FSZA 4N6QA 2ITCA 4U2ZA 3DV6B 4XODA 2HRGA 1W91A 2VM4A 5D7IF 1XF1A 2QHRH 5DEFB 4H8PA 3RRQA 3TLRA 1RJYB 3BI9X 4YSQA 5KBKA 1MPAL 2GUOA 5I6MA 3QS2A 2Z8WC 1R3KA 3IDYB 5B7EA 2EVJA 3B56A 3LYRA 4NXSA 5CKAA 5EF0A 3DVIA 2BLFA 3GHBH 3BUYA 4MYPA 3F58H 1R17A 1ZWIB 1CE1H 3KLDA 3UAJC 1P5VA 2RR3A 5C0NC 4N86A 3L3HB 2IPKA 3VTTA 4A6YA 3E6HA 5F3BB 5FIEA 4O00A 3EJQA 2KL6A 3BIBX 2CUAA 3QDME 1KLGB 5I23A 4TSBL 1T4KB 1RZ7L 1GTNA 3LCYA 4LEOA 3D8MA 4ODVL 5FUOH 1J8HE 4JFYB 4TQIA 1T1XB 3S5YA 3D0VB 1I85A 4IU2A 5ICYB 1CU4L 2IH3A 4N28A 5I6XC 3S37X 3PWPB 2WLLB 3HS8A 1XL6A 5C2BL 2O5YL 5D2NE 4LAQL 2J43A 2AJXL 4MLSA 3X11A 3EYOA 5A2FA 2E75C 3MV01 5T1KB 1MHHB 1HIML 2N01B 4GBXC 4NKMB 5I1CL 2E0PA 5I0YA 3CCHB 4U33A 4R26H 1U92B 4UAHA 1BBJB 2DQJL 5K9OB 4FXLA 4HJEA 4AEFA 1GR7A 3NFSL 4NP4H 4WNQB 3CPUA 3G6AA 3JV4A 2NY1C 4N0CD 1HJCA 5ILTH 5GS0L 3DLQR 4V1DA 1OV8A 3EH3B 2QHRL 4GKLA 3UMTA 3B9AA 1TPXC 4KJPD 1MH5B 3FQTA 4ZFFA 1GZQA 3GB7B 1FLRH 4MCMA 2D3JA 2Q7YA 4QCIA 3MLWL 4PTTA 3DVFA 4MFHA 5E23A 3HB3B 2NY4D 3LHPH 3TV8A 5ENWA 2AXHA 4HXBH 1ZLVH 1OP3H 4PP1D 2AJSH 1X5IA 2PCPA 1N9PA 2YPLA 3O41B 4LDOB 5K1JA 5JW4M 1TSRA 2F7QA 1SN2A 2ERJC 3CFBA 4X7CC 3KBPA 2CSPA 1UXLA 3RVVD 2G2NA 1FGVH 1FV1A 1URIA 1I8KA 1CE1L 3L7EB 4ANUA 1JNHA 4ECNA 4QKXB 4V1DD 4PRHB 4AQ8A 2BHUA 2XN0A 4MRBA 2L8AA 4G1EB 4UANA 4D9RE 2CR0A 3PJSA 3FT2A 4KKLC 3T1FA 4B9ZA 1Q72H 5D7JB 4N2IA 3GPSA 5FUOL 5IOKA 3LRHA 2YPLD 3FT1A 2C5DC 1XGYH 1YYLH 5B38A 4KK5C 5IEHB 3QZOA 4BFKA 5J56B 1E43A 4XBGB 2JTDA 4Q6IC 2Z4QB 3SGKA 3OB0H 4C47A 1A6TB 1INEH 3KG5A 3NRPA 1CFNB 4XMPH 1E6OH 3BEVA 4NYLB 5EB9A 4L0ZA 1DVSA 4P2QE 1CD9B 3QT2A 3ZYZA 5C0GB 4S0TD 4AQAB 1SOXA 4FQCH 5HDOA 4X7DC 2J72A 4P0DA 5K69A 2QPEB 3RDTB 1CE6A 4BKLA 2Z92B 5I8EB 3QPXH 1N68A 1JSYA 3T2LA 2V9RA 4I3GA 1UCBH 4IU3A 1ZT1B 2ZXAA 1PG7W 2BNQB 3EDJA 3NCJH 4PJ5A 3RI5F 2H2PD 4NP4L 1I8MA 3RVTC 5DYFA 5G5DA 2ZNWA 3EHBC 4OZ4A 2JXMB 5ILTL 4QRUB 1I8LC 4E9SA 1E8YA 2EXYD 3IU4H 3OKMA 1NFDA 1GPOL 3UACA 1E27B 1LQBC 3ZN6A 3PDDA 1FLRL 2NDGA 1B0RB 4JZJC 4NN5C 4QMEA 4X9HA 3LAFA 4PGBA 1J88A 3LHPL 5FCUH 4KNUA 1LMIA 1YUKB 4CW1A 2AJSL 3DX6A 4L9LB 1AXSB 3U46A 4NRZA 4UV7H 1YYMH 3IXAA 5KJ7E 4QRPE 1LE5B 3FB6A 1FZMB 1ZK9A 2MCPH 5CLTA 3QNFA 5TH2A 4UIMB 2DDQH 2F8XC 3CXDH 4U7KA 4NM4H 3UFIA 4Q52A 4JPIB 1T66D 2YD4A 2P49B 2YWZA 1P6FA 3QEQE 4F3FA 2F19H 4XCNA 5JUEH 5DRNA 4JB9L 1Q72L 3OKDA 2LU5A 1F41A 5ERWA 2MRYA 4YXKH 4OCXH 3VI4E 4M3HA 1FL3B 1I7ZA 1XGYL 2OQJA 1YYLL 5CLWA 4G7RB 5LG6A 5C0BE 1UVQA 3HN3A 1N4XH 4PJFB 4PAZA 4Z3TA 1INEL 5C0DB 1DQQA 4XMPL 3ZKSD 1E6OL 5CIPB 4HZ1A 2B4CH 1U4EA 4OCSH 4LLYA 4PIRF 1BA9A 3ECWA 1QMUA 4UQ2B 3KCPA 1ZLVK 3ARZA 1OP3K 1RK0B 4OCYL 2OXGA 5DD6A 1HWHB 3ATAA 1PBYA 4GUOA 2X41A 8CGTA 2GYSA 4ZI8A 4ZMPA 1UCBL 4APQA 4HGWB 1KDJA 3NCJL 5AW4B 3EDKA 2DD8L 4HVBA 1D5IH 4MMYB 3FS9A 5EBMA 1H5BA 3Q05A 1E9PB 1NAMH 1WC7A 1KXTA 1ZV2A 2BVYA 2YEZB 2W1NA 3E38A 3IU4L 2LLLA 2YKLH 3VXMA 3HAEA 4KDTA 4FMFA 1RAMA 1KIQB 5FCUL 2IDCA 1M6OA 4KKBD 1JV5B 1E4HA 4XVOA 2VXQA 1CGSH 4EVNA 4APQD 2BY1A 3OB0K 1RPQA 4Q14A 2XG5B 5AKRA 5TE4H 4UV7L 4WFFD 4WI9A 1A6AB 1YYML 1OSZA 2VDNH 5F93C 2D0HA 4L3EB 5IQLA 2MCPL 4PJ6A 1WGOA 2L04A 4KQ0A 2DDQL 3CVDA 3CXDL 1BJ1J 4NM4L 5FYLE 3VXMD 2WNKA 4MCYA 3B2VH 2WZPA 3QR2A 3LQZB 1JPGB 4G8IB 3JVGA 3F05A 5GRXG 4HG4K 3NZSA 4BCXA 2F19L 4WENB 1BLIA 1VF5C 5JUEL 1JZ7A 1M56B 3C5SB 2AJZB 12E8H 1RUQH 4YXKL 1S9VB 5HHOB 4OCXL 1F86A 2W0PA 3DX3A 3D05A 3L3GA 3G08A 3O45B 4KJPC 5I73C 3QXVA 3MNDA 4WY7H 4A2HA 5HYIA 1N4XL 4PVNA 1Y1UA 4JAMB 4YEEA 4PP1C 4AGOA 4DEUA 5FO8B 3MR9B 2B4CL 2WLJA 3LIUA 2EEBA 3AS0A 1EEZB 4OCSL 4YDLB 2WZPD 3L3OC 2WCSA 3RVVC 2GEEA 3SJVB 3KEDA 4P5TA 1S8DB 4AIEA 1UJ3B 4Q74A 1JHKH 1ACCA 4J3OH 4K8RH 4NI6A 5GPRA 1I1FA 3MYJA 3N41F 1HXYB 2DBLH 4G3YH 4PRPE 3DHMA 1W2KT 1GIGH 4Y1AB 1FSKB 3PXHA 1IEBA 1MAMH 3NABL 4N2GA 3HHMA 4PSPA 2BPBA 1I7RB 2FJHA 1D5IL 3FONB 2JKIS 1SPDA 3CDZA 3PUUA 1NAML 4GS7C 3SPGA 1AYOA 2YKLL 3RGVB 3GGWB 3RWDA 3HG0A 2AAVA 4P5TD 4RSVA 1IM3B 5EU6E 5DCCA 3SSGA 1WCBA 2D7TH 5CGTA 2EYSB 2R4RH 5E9DA 1YEDB 5F7LB 2FR4A 4AQ8C 5ISZB 4JEGB 4NQCB 3BFOA 1CGSL 3L5IA 4FRWA 4M6AA 5J57B 2AJUH 3BWUC 5TE4L 3S4SB 1ILUA 5HPMB 5DI8B 1PU0A 2GPZA 4PJBF 3BWZA 3DOHA 1M71A 3OAWA 1PKQE 3L7FB 1IC0A 2K78A 3ZKMC 4KK9C 5LXVA 2DQDH 1MCNA 1M1SA 3LKRA 1AJ7H 1I7UA 3D3VD 3SGKC 1CXIA 3IPFA 2XHNA 4JDEB 4NC0B 5E9DD 3EH2A 3I9GH 4MS8D 2EXYC 12E8L 4FXKA 4DP8X 2XG4B 3OJMB 4JMXA 4JHWH 3UYRH 4HEPG 5E9AA 3J7HA 3BFWA 3CPLB 3MX0A 1P5UA 4WY7L 3VJ6A 2EJ1A 2PPCA 3NJJA 4YHYB 1JYWA 1P0SE 2EUZA 1PMYA 2B3RA 2G9HA 3DRTA 1JK9B 4PRBA 1WF5A 2CDFB 8FABA 1HHKB 4FKKA 5IVXA 1KENH 5FB8A 4IMLB 5GGQH 4DGVL 5JXAL 1J9RA 3SKNB 3AXIA 2YOAA 4AMXA 2A9CA 1M7IB 4K8RL 5HYEA 3L3KB 1NC2A 2OZ4H 1KJ2L 4LQFH 2DBLL 3QDJA 1T66C 4G3YL 3BZEB 1T1WA 1ODAA 2WO3B 2ZKMX 1GIGL 3ETTA 2W5PA 3G6JB 3QO0B 4OFQA 5C0CB 1WLHA 2A2QT 3UZQA 1MAML 3ZO9A 4N2BA 4RQQA 1VIWA 4WTQA 1RSYA 3L2MA 2YGNA 3BESR 4Y5XA 4W6WB 1JWSB 3OKOA 2VAAA 2YC1B 3MV8A 4N2CA 5JOFA 3UZVB 3VVWA 4XNYH 3UIZA 3PWPE 2D7TL 3UADA 3PGCB 1S7RB 1J86A 2R4RL 1ZVSA 2X28A 3BVDB 3GD1C 1NC2D 4Z0XB 2OR7A 4K2UH 2EUWA 3QDJD 3CX5K 3QUMB 4GFTB 4LCCA 1U91B 2AJUL 2HX7A 2JI3A 5C3IA 5CWSB 4BE6A 1UB5B 4C83A 2VE6B 5LNEA 4PJ5E 5FKPB 2XWJB 4NN7C 3MV8D 2MNWA 3ILDA 2PYFB 4G7SB 3PL6C 4XVTH 1R19A 2XBDA 2XPGB 2DQDL 2CLZA 4KPHL 3UP1A 4AKOA 1AJ7L 2VGLM 5IEKA 1JZJA 3I9GL 4HJGB 2IH9A 2JB6A 3TM6A 4RMVA 3GMMA 2XTSA 3HE6B 4LVHC 2ETWA 3O6ML 1HFUA 4OZHB 3D4YA 3UYRL 5IMOA 2QVTA 4QWWD 3T4YA 3D4ZA 4P9MH 3RIFK 1VADA 1ES0B 2V9UA 2AJ3A 3K0YA 1KENL 4Z7IA 4PJAA 2Z31B 4APQC 5D6CB 5E1GA 1T20A 5GGQL 3G5XA 1AGBA 3D09A 3TH2T 3EG9B 1H5BC 1HWWA 2BJML 2QQLH 2VISA 4GXFA 4ZW7A 3SYQA 1S7VB 2OZ4L 5BW7A 4KDTC 2YS4A 4LQFL 3RWEA 4Q9RL 1ACZA 3P30H 3FN0H 5AW9B 5BZDA 4QHKJ 4HU2A 3UBHA 4GAYA 4WWID 4ZYKA 1P84K 3VXRA 4A2DA 2BWIA 1N7MH 5CU9A 1E2WA 5BV7C 1KZYA 4DW2L 5AENA 2EC8A 5I6NA 3IFPB 3SDCC 1DBKH 3KWXA 3BSZH 3NIGF 2V5RA 2NW3A 3VWKA 3I9IA 5DZ9A 4QF1A 1A4KB 2Z4TA 3UERA 1XF2A 4XNYL 3W11D 2A74C 1KJMA 1OSEA 4XVJH 2B15A 1N5AA 5IHHA 4F58L 2X1QA 3LIZH 4K2UL 1F42A 3B9KB 3ESOA 1I1CA 4I0KA 5CZXD 1KTKE 1SXZA 4HYTB 3DOSB 4OR1A 4AW7A 5ID0A 3VXRD 3BCFA 3RQ3A 4JE4B 2ZWSA 1IC5H 4M6NH 3W2DL 3U0PA 1CBVH 3VWKD 5IW6A 4YSCA 3QAQA 5DJ0A 3QUHA 2E9BA 2KQNA 2WGNB 3VSQA 3GM0A 4ODUB 5EFIB 4LEEA 3UC2A 4EUPB 2W9DH 4LPVA 4ZNCD 1S5IH 4UIKH 3H9HB 3ARUA 2JQZA 3CSYB 1NIBA 4NXKA 1YA5A 3FQNA 4L3FA 3VXSA 2FJSA 5GJTH 2XV2A 3B5GA 4P5TC 3RIAF 1ACYL 43C9B 2X44D 3UPRB 4P9ML 3N3EA 4X8GA 4X4YA 1I8IB 3FZUD 3VB9A 4R84A 1HCFX 3GRWH 4R96A 3TBVA 4DPBX 2ORBH 4AGPA 5E1IA 1YEWA 2KLSA 1WBYA 2QQLL 3GI8H 2PYEB 2ZP9A 1KV3A 1GRWA 2ZX5A 3K71A 3VXSD 4KRMB 3P30L 1Q4NX 4BDVA 2BP0A 4F15B 5IESH 1LNUB 1G7QA 3G04A 3MJWA 5T1LA 1CF1A 1N7ML 1CICA 1E28A 4WEEA 1JERA 3BH8B 4FMKA 4BSVB 1WJ3A 3BWAB 3C60A 4XHQA 3RBGA 3PDGA 1DBKL 1AXIB 3QNYB 1LJMA 3SQOH 3QJQB 4U3SB 1MHPH 4AXWB 4XNQB 1I3RB 1ZA3B 1WPCA 4FFWC 4PJFE 1HYSC 2NQ3A 4X5XB 2CO7A 1LWHA 2HT3D 3PRZA 4XVJL 4AQOA 2A4ZA 3IJSA 4Z5RB 3NFNB 2ZG1A 4LCUA 4R3SA 5DD5H 1E4XI 5GGSY 1A4JB 2DMCA 5J6HB 1XR8A 3SBQA 2JIXD 5T1LD 1J18A 1ZHLA 4K9EH 2IJ0C 1TTCA 1CICD 4AL8C 5AG8A 3MMEA 4AGLA 3N0AA 3C60D 4GRLB 4M6NL 3QNXB 1QLEH 4FXKC 4M93B 3RVUD 1KCWA 4JM4H 3TH4T 1HX0A 4GRWF 4X5PA 1CBVL 2VDRH 4L29B 3N1PC 1GOGA 1NLDH 2O1AA 5FGBC 4XMXA 4ZFQA 1P5UC 4C8XA 5E6RB 2W9DL 2WTPA 2OJEB 1S5IL 2C3XA 4UIKL 1ZGLP 4XBPA 4R4FL 2NY6C 3EO9H 4G6JL 1Z9SB 4AYBA 2AI0H 4GQRA 3FO9B 4ORGA 1KGCE 2HFGH 5DRZA 2B8OT 3DTDA 3C6SB 1JWMA 1FN4B 4U2YA 2VT0A 3QP3A 2CBMA 3N43B 3QNZB 4NQQA 2F1AA 3M8OH 3L5WA 1KFAH 3GRWL 1N64H 1BZ9A 1E5AA 4G42B 2BMKA 3L3IB 4L3EE 4H8VA 2AC0A 3SQBB 2GTZA 4Y5XC 3GI8L 2KPWA 1PG7H 4HWNA 3FTUA 4B9YA 4CBZA 3QXAB 1IC4H 5E2TH 3Q43A 4GPVA 1A7NH 2NY3B 4DVRH 2AV7A 2IPUG 5EDSA 4G80B 5IESL 2C4FU 4WI6A 3DYPA 5EEYA 2D7PA 3WEBA 5T5FH 4WFEE 4K7FA 2VQ1A 1TLKA 4LCCC 4Y9GA 3SQOL 1BFSA 1MHPL 1QBBA 4JLRA 5IVXE 3WKYA 3EJJX 4YSUA 4QWWC 3STBA 4GUPA 4HDIA 3NJIA 5FPIA 3ZDWA 5I1KL 3K5SA 3E1ZA 2VITB 1WT5A 1IBHA 3O2DH 1IKOP 4QHNB 1KBGL 2G75B 3ARBB 4IKNA 2E46A 4RAVA 3AMLA 5DD5L 4QYAA 5F96L 3NCYS 1X4XA 1YQ2A 1SUHA 4K9EL 1J9QA 3HR5A 2XCMC 5TQ2H 4EN2A 4YBQD 3AW5A 2NLJA 1AIFB 1SQ2N 1QLEL 3FQ1A 1R3LA 2ZXDA 4QXTA 4E0RB 4JM4L 4Y1AE 5K59E 2VDRL 3MRBA 1NLDL 3U6XS 3HI5L 3MYZA 1A47A 4RA0C 2K0RA 4ELME 2CDGB 4WTXA 3ZU8A 1ITCA 3F64A 4PJ8B 1INQB 5DZVA 3LZOA 2LTQC 4DPRA 1MFBH 1REIA 2EEAA 3IRPX 5FYJH 1AI1H 2AI0L 5HDBB 4EUPG 2HFGL 2GCYA 3VFOB 3HC4L 5GGRY 4Y4KC 1DUZB 4Z9KB 1UKSA 3TA3A 3CWGA 1KGIA 5BW7C 5ISZE 1G9MC 5EORH 1IGYA 3M8OL 5CZXC 1HQ4A 2O6PA 1KFAL 1VLXA 1N64L 1VZGA 3TBYB 4QOKA 3LNFA 3KR3H 4HUXA 3K2MC 5E4IA 5AOMA 2XOTA 1UT1A 3FRUB 1PG7L 3M88A 4TPRH 4CNIA 4JDZB 5LB1A 1OAJA 1IC4L 2XTJD 4I4WB 2CHWA 5E2TL 4XNXH 3VWKC 4DVRL 1KDIA 4XNZB 4JDVB 1V8HA 3DX9B 2UXTA 3MRCB 1ET5A 4N6RB 2P5PA 4WKZB 2GUYA 2P47B 2ZOTA 4UTBH 1AO7A 2BXZA 5GIRA 1BZEA 5T5FL 2HG5A 3TA3D 1S2EA 2FJUB 4AZ8B 3IM1A 1JPTH 1CIUA 2Z65C 2EIJB 4IHOA 2D9QB 4QOKD 1E8ZA 4LGRB 4N90E 1JVKA 4DN4H 1Q0XL 5CBAB 1P7QA 3JZ7A 3CIAA 4HIQA 2EH8H 4KI5D 2Y25A 3O2DL 3PHOB 4FDWA 3HRZB 3FW6A 2G3XA 1HSBB 4UOW1 1R3IH 1SJEA 2P4AB 3PAUA 4N5UA 4RGMC 1HXMA 5TF1H 3GXNA 5C9JA 3BWSA 3L9RA 5FCSH 4P2OB 5TQ2L 1JPSH 3SGJA 1AO7D 1V3MA 4WI0A 4YDJB 2VJXA 4AT6A 3AGWA 2KZBA 4JM0A 4NCC1 5D8JH 1P4UA 4ES9A 3G6JE 4GAGH 5LDSA 1DVXA 1HNFA 4Z7VB 2OBGA 1OB0A 5D7IA 4XPBH 3WJMA 1I1RA 1JVOA 1K2DA 1BMZA 1XSJA 2DWDB 1KPRB 1P7QD 5K9KA 4WI8A 4N4YB 2QPDB 1CDGA 1MFBL 4JZOB 1CXHA 1E6JH 5DDHA 4TQEH 1CFQB 2PXYA 4X7EC 4X7SH 4WW1A 4XCCH 5FYJL 1AI1L 4F5CA 2X2YA 2YGQA 5I18H 2XNAB 1Q0YH 2HT3C 3DBXA 1BZDA 4RNRB 1CURA 1Z0NA 2X6VA 4OCNC 3TO2B 2BCMA 5EORL 1HHJB 3QXDA 3IDGA 1S9YA 1JNLH 1X3DA 4L1HA 1XGTA 1BIHA 4KJYB 5JMRA 1DR9A 3KR3L 3LKSB 1CFBA 1WUNT 2UY7B 3C60C 4IGBB 4N68A 3PXLA 4PWJA 4TPRL 4Y4FA 3RVUC 5I0XA 2APXA 2W59A 2PXYD 4NQXB 4X7FC 1JNNH 1XMEB 3FFCA 3KWWA 2DQMA 3NA4A 4HIJA 4KO7A 4ZOBA 2LAAA 4RFEB 4HS3A 2VSDA 2EDMA 1I4FB 3WBDA 5IF0A 1YQVH 2YA2A 5C0FB 1QHQA 3T4AA 2NYYC 4XO5A 1JPTL 1KTBA 2JK5A 4FFZH 3BMWA 4OZHE 5EU3A 3GNMH 2I07B 4WEMB 5EEXA 3G5ZA 4J6IA 1XGUB 4NBZB 4DN4L 4X6CF 3X13A 1LEKB 1B2WH 4Y4FD 1CGWA 5FKAA 4LLUB 3AY2A 2YEQA 2EH8L 5H37H 3VQ1C 3QJFB 2O5XH 3FFCD 1BZOA 1OM9A 2GBAA 1EGJA 1HHGA 1R3IL 3GSQB 3DV4A 2WXHA 5TF1L 1MCEA 1JPSL 3UTZA 2OR9H 1CD1A 3S8GB 1X9UA 1UZGA 4G8GB 5D8JL 4JRXA 4OZIF 3FYIB 3WIHA 5IY5B 4LKCB 4BCYA 3HG2A 4N9GA 3BW9A 2AEQH 4XPBL 2F54B 2N4IA 2GTWA 3BYYA 1MG3C 2BIIA 2QV4A 4FQXA 2WB7A 5BUAA 5JORA 2YHGA 3L5HA 5DJCB 1E6JL 4PJHB 4TQEL 3PV6B 4XCCL 1J9TA 2XXCB 3CFTA 3S0PA 5C0EA 4IKLA 1AACA 1DJHA 1Q0YL 2JCCA 3GKWH 4HWEH 2AXJA 3E6FB 1MLBA 2X38A 4P46B 1JP5A 2F8IA 1JNLL 1U95B 3S97C 5EBLA 1ZAGA 1Z5YD 1I3GH 4I9WE 3MUGA 2ZWYA 4YBQC 3MVSA 4FQXD 1ERNA 1QHOA 3MJ6A 4XCYA 5J1SC 5AL0A 3PHAA 5EO9B 1YVLA 2VDMB 2G60H 3QUZB 3HC2A 3RL1B 1T83C 4PJ9B 2NNRA 3BD4A 3PY9A 2AXFB 1YN6B 4HZLA 3CIQA 1COBA 3SDXF 2L0DA 5F9JB 2V7HA 3CSFA 1N10A 4I1PA 5ID1B 2VN4A 3HOGA 3QVAA 1WT5C 2XXFA 4G6AD 4E36A 1GTFA 4I2XA 4A37A 1YQVL 3DUSA 4XXCC 4FFZL 1V7ML 5AYUH 2KDYA 2FIKA 2F7RA 3ZUNC 3GNML 3N50A 4DFHA 3WLBA 2BS71 3Q5TA 3AC0A 2P48B 4PVLA 1RZ8B 2AF2A 3A6BH 1GZPB 4JX0A 3RHWF 1KNOA 4NAQA 5AOIA 1R5VA 2EXWD 2O5XL 3JYBA 3MLVH 5LNGA 5DZAA 1QLRB 1HCYA 1YO4A 4NNXB 3N2JA 1KLFA 3GUTB 2OR9L 2PYEE 1FCCA 2XTJC 5HHNB 4A1RA 1L0QA 2AVGA 3DVGA 1AGCA 1BPLB 2YMXH 1UD4A 5FO2A 2WZ0A 4KV5E 2AEQL 3TA3C 4XB8A 2I26N 4ZSOE 3KAAA 3T8MA 5KS9A 4IM8A 4HUMB 1KT2B 4WGKA 2GG1A 5IBTH 5M95B 3EKCA 2CQVA 2KI6A 5F7MC 1YPZF 4D9LL 4KI5C 1DCLA 5F7KC 5IJKC 4XCEA 5BXFA 1TO4A 2H1PH 4I3RH 2EE3A 3GSNB 3EYFB 4LLMB 1NMBL 1EBAA 1KIRA 1I3GL 2BFGA 3DRQA 5DK0A 2HCZX 3EYSH 4B27A 5AYQA 1UQSA 2HG0A 3NJNA 3DGGB 3ZE0B 1SXBA 4N8UA 4WV1B 2XTJE 4LESA 2QELA 3GMOB 4GKZB 3EJRA 1KTRL 3ZRFC 5C97A 3Q2CA 4JQIH 3F7QA 4OFYA 1FL5B 1EVUA 2QKIA 3SHSA 5AYUL 1EJFA 1YUHA 1E4WH 2IAMB 1BAWA 1WISA 3A6BL 5EBWA 4DTGH 3H3PH 2WXOA 1M1XA 4XPGH 1D5BA 2VM9A 1A3QA 1SY6H 2X6MA 1QFUH 3MLVL 4YZFF 3REVA 3AS1A 4MNGA 4NHUA 4ZX6A 5B3NA 1CQKA 2X53A 4JFXB 5H2BA 3TEUA 1O9WA 3QCUH 1U33A 1ZV5A 3IDNA 4HOWA 2BK8A 1BF5A 1TZHA 2PXYC 1SZNA 4NZTH 1J8RA 5T3ZE 1RZFL 1CDUA 1W72B 5GGSB 2OJZH 1S7QB 1SYVB 2YMXL 3OPUA 4U3XA 1KYFA 3DPBA 1X6NA 4G6FB 4NCDA 5EIIB 3ILQD 3LNIA 4OI8A 5L0QC 4RAHA 1CO1A 4HK0B 1ETZA 1KTJA 2BY2A 4TULH 4ZUWB 1RZIA 4CL7A 4B3VA 2C4FT 2J44A 3MLSH 1GZHA 4Z3JA 5L2KE 3WUWA 4P8QA 2Y3AA 1MFEH 3VVVA 4DKTA 5CEYA 1NBVH 2CXKA 3HPLA 3D0LB 1NKRA 4RRPM 3UTSA 2DICA 4Y4FC 1J5DA 3OKLB 4P5SA 1N12A 2WWMC 3P0GB 2P5EA 4RFOH 5JHBA 2PP7A 3RILA 3P1VA 2X4TA 2H1PL 4I3RL 5D96C 5J1AB 2F74B 4ZFZA 1VFAA 4JFOB 4ETQB 3HLKA 3T4AC 1E5ZA 1KPUA 3EYSL 2H6PB 1KBBA 4HLJA 2YK1H 2P26A 4OJEH 3SKMA 3QXWA 5IZ7A 4HLZH 3UTSD 1ZGLA 4JQIL 5KZCD 1OZUA 4AYGA 5MEOB 4Q6KA 1Q1JH 5CEZH 4IRJB 2IF7A 2P5ED 5E2WH 3ZJAA 1UACH 3PIQB 5HDBE 2CBTA 4B53A 1E4WL 1HINH 2XZQH 4KROB 4OLZH 5HDLA 2XBTA 1HWGB 1W9XA 1YY8A 4DTGL 4YVUA 3RUGB 3H3PL 4XPGL 1SY6L 5B39A 1QFUL 5F0PB 1IAKB 4NZJA 3BT2H 1NINA 2OKMA 3P4MA 4FQXC 1TZIA 3QCUL 4NPJA 3MOBH 4X4ME 4MD5B 3CC5B 2W38A 4D8PB 1F2QA 4PS4H 4E9VA 1ZA6A 5FYJU 3BPNB 4NZTL 3HG3A 2PCFA 2OJZL 3VH8G 5FYKH 3FJTA 5A2BA 1J0KA 1L3NA 2NNXA 3DXAA 2FJGB 3MNZB 4MAYC 2EZ0D 4PEEA 5DHMC 5DVNA 1H3PH 3MA7A 4G6AC 3QJOA 1NIDA 4TULL 1A7BA 4GSQA 3BP5B 1I1AB 2ZKHH 3MLSL 4G8EA 3B9DA 3RVXD 1J5CA 1MFEL 5E8PA 3LHAA 1NBVL 3DVNB 3ET9F 5FM5M 5JW4N 2GC7C 1B88A 4E41A 3GMPA 2ICCA 5EO0B 4OLYH 5CBEA 3IK2A 3PG2A 2CCLA 1WFTA 1X7QA 5GSRB 2EXWC 2NTFA 3FSAA 2N56A 4YNYA 3NDYE 1DVQA 3GBNH 1BDYA 4JRXE 1W6WA 1S7UA 2PR9A 3B43A 5BOJA 4K5OA 3LXBA 3DXAD 4Y2OA 3ELAT 4FF9A 3AS3A 5BZWA 5D1XA 4FAAB 1FVCB 4CMHB 1LLAA 3V55A 3QIWB 4P05A 4HF5H 3VE0B 1OTSD 4NI3A 3CZNA 2YK1L 1RSFA 1QWNA 4OIFA 3D12B 3HR6A 2R56H 4E41D 2EDYA 1O6TA 4HKBA 4FYTA 4JUTA 2DLFH 1LP9F 3WFHA 1OVZA 4QHUA 4Y5VB 2P8MB 2C7UB 3BPCA 3QUXB 4KHXL 2FQFA 3TV3H 4KKCD 3EFOA 3ULSA 43CAA 4UDUB 5E2WL 2LFGA 3SCMA 4Z7OF 4BZ1A 3O6LH 2XZQL 4Y9EA 4OLZL 4JG0H 5C08A 2BSBA 5D1XD 4ONGH 4PW9A 2NXZD 1FG2B 4PJCB 5I6OA 3FQYA 4K94H 1TYRA 4FZEH 2R29H 2VQ4A 4RETB 3OJDA 4QRAA 4F9LA 4WWPA 2VRKA 3BT2L 5KYXA 2LU4A 4R9HA 2K6WA 1DSWA 3MOBL 4PS4L 3KPRD 3SKUD 3D33A 1YC7A 1XD0A 2WD0A 1NCNA 1A7RL 3SCMD 1PSKH 4BINA 1MCBA 1AGEB 1S3RA 5FYKL 5BZXA 1INDH 1E5CA 4FFTA 3OKEA 5DMGC 5C08D 3LPFA 2CA3A 4N25A 1H3PL 3AU1A 4ZS7H 3SDAB 3RWHB 3OQ3B 3E80A 4AVHA 1DANU 1ZS2A 2ZKHL 2BIQA 4BH7A 3MV7B 2RMNA 5EIIG 3QDAA 3BGMA 5C70A 4PU2A 1G4MA 2V33A 2HT4D 2DLEA 1DBMH 5A2KH 2J8OA 2R23B 5GRYA 3HZMB 1WZMA 5DFTA 1EZVY 5H94B 4F2FA 2IMMA 4DKFH 1Z3RA 2OV0A 1A1OB 2Y06L 3L81A 5F7BA 1VENA 5D2LE 4I18A 3CZGA 1BEXA 3QH3B 1G5AA 2J5LB 2F58H 5DQJA 1BVOA 5HJDA 2QKIC 4HF5L 3ZE2B 1RL1A 4MQ7A 2DI9A 1AR1C 5GGRA 2W60A 2NQCA 3G9AB 2F54E 3ILQC 2R56L 1SHXA 1TKWB 2WV3A 1B90A 1NBYB 2DLFL 1XH2A 3IDJB 4L2LA 3F00A 3FUEA 1Q38A 4PJHE 1ONQA 3HVNA 5EMYA 2J6EA 3HZYA 4NO2A 4UNIA 3R06B 3NTCH 4U1MA 2JJSA 4BYHA 4QHMB 4CJ1A 4JG0L 4WDIB 2MNJB 5AOLA 3WKQA 5A16B 1R0AL 4F7TB 4ONGL 3O81A 1BWMA 5HHQA 4K94L 3O8XA 4UU9B 4FZEL 3GI9H 1NGWB 5ABDE 4CVZB 4CVXB 2OTWB 4ZUVB 3H4FA 1QPXA 3MRNB 3VNYA 5FM5O 4GAJH 3KM1A 4J3XA 4TV3A 1EO8H 3AXLB 4QHLA 4FHJA 1USQA 3BDYH 4E9YA 3U2JA 3MO1A 4ZS7L 1R3JB 4UI2A 4PBXA 4I3SH 3VA6A 2GY5A 3O8XD 5IUCA 4YR6A 5MP6H 3ETBJ 5ACLA 2A7BA 3WENA 2AEWA 3VD1A 2WUCH 4W9JC 1K6QH 4FNRA 5AG9A 3WGUB 2IALB 3QZMA 4AENA 3HI1B 4XBMA 4MQTB 3WXVH 1TDQA 3DSNA 1P6AB 2J20A 5DK3A 1XSIA 4Q89A 4DKFL 5IM7A 1CD0A 2EDQA 2WXKA 4YE4L 3US9A 3F62A 3NRFA 4QYOB 3TVMA 2F58L 3ZTJH 1ZHKA 1CXLA 4NOBA 5GS1A 4OVVA 2V3EA 3CUPB 2H2SD 2IDTA 2ZXWB 1YSOA 5E56A 1S9WB 3VRIB 5L6YH 2C1OA 4WGWB 2RHEA 1ADQL 4FLQA 5DMKB 2Y2TA 5D93C 4QO1A 3V5KB 3DURB 3AAZB 2RGSA 3RVXC 4YSTA 4LSVH 1AGDA 2J1YA 2VDNB 3NJXA 1NDMA 4PD4J 1WFOA 3WEXB 1CT8A 5AKTA 4HX1A 3TVMD 3RWFB 3BX7C 4PG9B 4MB4A 5D7EA 2MCG1 1F3DJ 1XV8A 1AR1B 1PPIA 2XX1A 5JQ6H 3V8OA 3D18B 3LRLA 4OUUA 1S5HB 3BUIA 2BNRA 3G5YA 2IQ9H 5C7ZA 1TQCB 3IJEB 4NZ8A 3MRJB 2HKAA 2WSPA 4OI9A 2VLRA 3U7YH 4LP5A 3MRIA 1OTSC 4HJIA 1EAOA 1KTLA 3ZE0E 2IDUA 1C08B 1EO8L 4Y4HB 2R2EB 4WHCA 1R5WB 3BDYL 1YNKH 2V8MA 2IXQB 4OI7A 2ADJB 3ECBB 3ZKXB 2NRDA 5F71A 4I3SL 5DO8A 3L95B 3PFUA 4KKCC 4B5EA 4D7BA 1OSPL 2OSLB 4M1DH 5MP6L 3SE8H 1GGCL 1WAAE 2FO1A 1WV7T 2BNRD 2WUCL 1K6QL 3AWGA 3TN0A 1NCCH 3LZNA 3GEFA 2P5WE 5HGBA 2NXZC 3ULVH 2VLRD 3CDGA 1YEEH 3TGXA 3WXVL 1ZTXH 4BUQA 3C8HA 2CK2A 2ZOWA 1TSHA 4CUCA 2BP3A 3UGXA 4QJ5B 1IEHA 3CFEB 2FYYA 1G6RA 3C8DA 4PS3A 2EDXA 4OIAA 3OTTA 3UDWA 2GJZB 4DP6X 2MWCA 2AANA 1T4KA 4TUJA 3AROA 5CNHA 1XGPA 5L6YL 3FMGH 5C86A 4JFYA 1XVSA 3TN0D 1HESA 1T1XA 7CGTA 3CZFB 3D0VA 2X6UA 3O6FB 3OG6B 4XMTA 4LRIA 1EAJA 3RNKA 3L4WA 3UJJH 1A02N 1CWVA 4LMQI 4BFNA 3L17A 3KPOB 4LSVL 3DJZA 3ZW3A 3FB5B 4LSUL 1OXYA 4F9LC 3CFCL 4PJBE 5CP7B 1U8CB 5E4EC 1SXCA 3OC5A 4PJEF 5KSVB 1IJNA 1NDGA 5FO9A 1JZ2A 4GSXA 1JZEA 2YN5A 3P2BA 5ESVB 1JIBA 4Y88A 3TIDA 3CCHA 5CZVH 5JQ6L 5FM8A 4I87A 1OGAA 1U92A 1BBJA 1GYUA 4HLEA 2IQ9L 1BZ8A 3ES6A 4DZ8B 2BOBB 4L4TB 3U7YL 3ARXA 4KY1H 3UJTH 3SOTA 2DQFA 1JPFA 3NJMA 4F57H 2V2TB 1XCWA 1QBLH 3EJSA 4ZQTA 5KYUA 1BLNA 1YNKL 2SODB 3ASOB 4NWUH 3HNTL 1JDDA 3L3JB 2UXGA 3OHXB 2X4SA 5FF6B 4K71B 2DV6A 1M7UA 4M1DL 4ATWA 3SE8L 2F61A 2I24N 3IDUA 1OGAD 1BOYA 3GBMH 4J8QA 2IH1A 4H2AA 4I18C 1NCCL 3KLQA 4UQ3B 3ULVL 4Z7QB 4ADIA 2B2XH 4N0FB 1IAII 3BLPX 5FHAH 4FX5A 4A2EA 3KGRA 1HS6A 4GKNA 4JFEB 4Z18A 4PRHA 3CK0H 4XP4L 1ED3A 4HUVB 3ESNA 4QRSB 4A66A 4OFIA 4F33B 1A6PA 2J71A 3BUBA 1L0YA 4AUYA 1AANA 1JMZA 5D7JA 1JZ4A 3LH8A 1FYHB 4ZNEA 1AXTL 3FMGL 4YDVA 5JQIB 5AB1A 4LVNB 1HHHB 2XY1A 1NOAA 2ICWB 2W94A 4XH2A 4B96A 1CMOA 4XBGA 3MRDB 3UJJL 4XAKD 3K72A 4HPYH 2IANA 3T0EB 4PRHD 4RMWA 5IIEA 3FAWA 4NYLA 3MCYA 3H0TA 4OCRH 5J9PB 2V37A 3IGKA 5DUMH 3T3PF 5CFAA 4AQAA 5I16B 1UZ6F 5D7JD 4D0DB 3K91A 3O11A 5FYKU 3AREC 4OLVH 4MD4A 3WFZA 4XNDA 5CZVL 2Z92A 1G5GA 3CVIL 3IAQA 4TVPD 3REWA 3BAWA 4DO6A 5B1CA 3FBKA 1YMMB 5A6LA 5F89A 4MHHI 2BNQA 2YIHA 5KBLA 4GXVH 4KY1L 4B0MM 3AABA 3UJTL 2GFBB 2H2SC 5HD8D 4QRUA 4F57L 1QBLL 1WA1X 4J3BA 1OP4A 4ZUUA 5T5NF 2J1ZA 2OMUA 2JJVA 1B0RA 4W70A 3TBSB 2DS4A 3BUQA 1N67A 3OXSA 4L9LA 1AXSA 3CN2A 1X5KA 3GBML 5F1IB 1UWXH 2AERT 2K6YA 4OW6A 3WDJA 3TVMC 2R69H 4NO3B 1AP2B 2BNQD 3EJYC 4PJCE 5GS1C 4WW2F 2OW7A 4OJCA 2F18A 2B2XL 3WOVA 9CGTA 1FZMA 1JPST 5FHAL 4BFRA 4GG6E 1AH1A 3CQFA 3CK0L 2Q8BH 3CH8A 1YEJH 3KGUA 4JPIA 3CSTA 5E2JA 3EOBA 3HE7B 5F9WC 4E42A 2IWEA 1XGZA 3RX8A 2MSPA 3PF2A 1U8QB 4Q9CA 3M6DA 1T0MA 5GS3A 2F68X 2R7EA 4OD2B 4JFPB 1JD7A 1CXKA 2NXYD 2IOMA 4MA3B 5I1LA 1S6NA 3KPPB 4LLVB 3MRQB 3NK4A 4IW4C 3MV7E 4HPYL 5E0FA 5CIPA 2CPUA 4OCRL 2H32H 1DANT 2WVVB 5DUML 2FYVA 4UQ2A 3QQ9D 1RK0A 1Y7VA 4JFWA 3A47A 3MGTB 4Y16B 2Y9RT 4OLVL 1H15A 1RVFH 3VSUA 3WNNA 5K9QI 1D5ZA 4E2OA 3D50A 4HIHA 3T5WA 1EZVX 3ZL1A 3L45A 1PNCA 4GXVL 1II4E 3ZE2E 1YY9D 3S3CB 2YXWA 4IIZA 4OFKA 1OAYH 2XVKA 3P3UA 5JW5A 4PJIB 1E9PA 1JGVH 5KG9B 1XAUA 2B5IB 2A4CA 2YEZA 3FTGB 4TN9A 3TN0C 1QVOB 2R1XA 4PGDB 1WS7A 5JHLH 1Q9KA 4LRNL 3I84A 2ZSVA 2QTEA 2DWEA 1ZPLA 3KPLA 4DZBA 1MW0A 3EYQD 1CGUA 4KVPA 1KYOJ 2BNRE 2R69L 3UDWC 3BN9D 1LILA 1A6AA 3L4YA 3IWVA 4A7TA 4OZIA 1XH3B 5FOBA 4X80H 1VACB 4F92B 5L4FA 2P80A 2Q8BL 1YEJL 3O3UN 4GQZA 5FO7B 2CLVA 4ES8A 4LRIC 3D4CA 2C26A 3QXUA 3M1CA 1B4TA 3LQZA 4G8IA 2J3SA 2VABA 1F8TH 5SWZB 4I0PA 1MJJA 2VWEC 1YDPA 1DFBL 1QQDB 5C0AE 3LNDA 2TRYA 5HHOA 3D69A 5ITFB 2AVFA 5DT1L 1AZCA 4QRTB 4MX7A 1BG9A 3QQXA 5DJAB 5E6IB 5BO0D 4N0UE 1YCSA 2FB4H 4BV1A 2X7LB 3QWNA 3FB8B 4F20A 2CHZA 1H6EA 1MVUB 2GBUA 5AVRB 1PEZA 2P80D 1BHGA 3F65A 4HKXA 3FU6A 3VFNA 3VFTA 1EEZA 1CIDA 1QLEB 4GRWE 3T65A 2OMWB 3T0BA 1UJ3A 4JMNA 4I0PD 4J3UA 5JDSB 4UAOC 3L5JA 5HHVH 5I17A 1UWXK 4DO5A 5HHOD 1RVFL 4FYRA 3VGAC 5C6TH 4LP8A 4P4KA 5E51A 4R5VA 3QIBB 3CTTA 3AQDA 1IVLA 5LBSA 4PGJA 3SDXA 1J48A 2X1XR 5IFJB 5KVFL 1RHFA 4U6VL 4PLOB 1OAYL 2ZAIA 2ZOLA 3CFMA 1JGVL 2ODHA 2VDLH 4J27A 2PWFA 3UTOA 3GMNB 3RGVA 4R90H 3LSOB 5JHLL 4WO0A 1FFOA 2YGOA 3FQRA 4NQSB 1HU8A 2ZWNA 3KMDA 2XWTA 4P4KD 4NQCA 4DP0X 5HSFA 4ODWB 3ILPA 3DO7B 3S4SA 2X6BA 3ZYIA 3B37A 3MBWA 5DI8A 3L1FA 3ZX1A 4RFNC 1UXSB 4UT9A 3QQ4B 5CD3A 2BVPB 3K8LA 4JRYB 4X80L 1IGFH 2J12B 2ZYIA 3LZPA 3QWRA 4CSPA 2UX6A 1JFHA 2N0KA 3L7FA 3O0RH 4GW1B 5ALCH 3RGVD 3MRLA 5C92A 1OW0A 1KGXA 1HE8A 2NY5H 5MHSE 5D5MB 4J7RA 2RJMA 1A6ZB 3C09C 1KTDB 5EEUA 1EEUA 5JW3H 4NQCD 5BRPA 2XG4A 1UM5H 2VTFA 2FB4L 4KKZA 1BZ7B 4QLRA 2OMXB 1SEQH 3QHFH 4HUNB 4P2RB 1PAMA 4N2OA 2DWSA 1ORSA 3IDXH 4JR9H 2KZWA 1YPZA 5A1AA 5BJTA 1JK9A 4F2MB 3QWRD 5FUCE 2CDFA 4ZTPH 5AVYB 2R0ZH 4LKXA 2WYHA 3VXPB 1U8JB 2CRYA 4D0CA 4WU5B 2EDOA 4FLOA 4QRQB 2ZIDA 1JV2A 3L3DB 2AFNA 4FG0A 5C6TL 3BZEA 2A9NH 2EDJA 3CLEH 5DJ6A 4CADB 2ZQKA 1IBGL 3I6GB 4PREB 5C0CA 3NCCB 4JFDE 4HIXH 3SGDI 1NCWH 4K3EH 2KKQA 1EA9C 4LCVA 3U1QA 4FERA 4E9LA 5CINL 2VDLL 3QYCA 3WD5H 1HL9A 3KJ4B 2BSTB 2IANE 3MN8A 5B7FA 3WTXA 1URZA 4R90L 1R24A 4QIRA 2NXYC 4PRIA 4QGTA 2YRBA 3RVWD 2J73A 3GQFA 5JPNA 2ZCZA 4KQ3H 1TYEB 4F8PA 1QNZH 1L9MA 5CN3A 3IGLA 2PP9A 4Z0XA 4TSCH 3A4AA 5AW7B 1N6UA 1ZJBA 4OZFG 1U91A 4NC2B 5C0CD 5E4OA 5GGUA 1LO5B 4I48B 5EZIH 1U3ZA 3QQ9C 4X8XA 3ZPDA 4DK5A 5GS2D 5CWSA 4LAJH 2W80C 1L0PA 5C0RL 3U9UB 3APDA 2AEIT 2ATAA 2R83A 1IGFL 1IM9B 2EIEA 4FG6C 1NCTA 4IBSA 3O0RL 4WU7B 5ALCL 5DHEA 4POYA 2WQSA 2OMBA 4UQAA 4PRID 1R9FA 4L4TE 1DLHA 1R75A 1RZJH 2NY5L 4AYEC 1YY9C 1WZ1H 2CBPA 4OZGB 4LSDA 1XGQB 3QORB 4HJGA 5DZNA 4ZUTB 4RVBA 5JW3L 1UWGH 3ATEA 5CSZB 2FWOB 2Z93B 3OMAB 1UM6H 1F4WH 3NSFA 1U93B 2GAZA 1SEQL 1XF4B 2X89A 1ETB1 4MLIA 2PWGA 4MMZA 3IDXL 2DEWX 2EEFA 4FQQB 5MI0C 2DJMA 2YRZA 3MXVH 4UCFA 5FFGA 1ORQB 4ZTPL 3EYQC 3RPBA 2R0ZL 3WEAA 3BN9C 4DFIA 4Z7QE 4HUKB 2NW2A 4GKSB 4MJ6B 1KF9B 1ZE3C 4ODBD 4NPYB 1Q9WB 4ELKB 1I7TB 2XN1A 3ARVA 4IS6B 4YSDA 4L1DA 4DKEL 4Z7UB 4HV8B 3W9EB 3CLEL 3IKCA 1T7VA 1Z0MA 2K45A 3I6SA 3H42L 4HIXL 2X89D 1NCWL 3RNQB 4JKKA 3V4PH 1VCBC 4OKVA 4JVUA 3D0AA 4U1HB 3WD5L 5ETUA 2CCVA 3U83A 2CJTA 5I2IA 5SV4A 2DWTA 2P7TB 4Q6YA 4R97B 4XI5D 3BGFB 1H8SA 4KQ3L 1QNZL 1IO4C 4Q9RH 1IQDB 2OLDA 3QFDA 3T0EE 4ANXA 2G3ZA 3ULUC 2WXFA 4MBOA 1ZIAA 1AGFB 4NNYB 2PW2A 3FKUS 4M03A 2EVHA 4MZIA 3QA3B 5EZIL 4JFFE 4LL4A 4I0PC 1HE7A 1CXFA 2FZ3A 3LX9A 4JUSA 1Y6KR 5B22A 2CKNA 3WHE1 3QO1B 3GSUB 5D1QA 1ETJA 4WVRA 4UM9A 1DJSA 4O2CA 4FADA 1JWUB 1SFHA 1U3HA 1RJZB 4ODUA 1RZJL 4OD1H 1F90H 1WZ1L 5DUPH 2XQYG 4X6CE 3H9HA 3CSYA 3MJ8A 1UWGL 1NMCB 4X9IA 2Q86B 4AK2A 1MREL 1UM6L 1F4WL 1X5XA 3EOAB 3HLAB 2DWYA 4S1RH 4TLUA 2Y2WA 1ITBB 5KYYA 2CO6A 4PIBA 2X40A 3CFDA 1GXEA 3HUJF 2VSCA 5D1QD 1I8IA 1IBZA 2X10A 1RCYA 3MXVL 4P4KC 4UM9D 2ITDB 4EI5A 2IQAA 2H26A 3ZE1F 3ULUE 1U3HD 1XO8A 2XPYA 4LHJB 4M1GH 5T3XE 4AX3A 4KKAD 5F44A 5J6GB 4J4PA 3BQUB 5E6ZA 1R3HA 1EUUA 4JNXA 1TTRA 3R19A 5HP5A 1LNUA 1MZZA 2JNZA 4GSUA 4NO0A 2H8PB 3IPEA 1QA9A 1C7SA 4M4RB 3BH8A 3V4PL 3PDOB 4JFQB 4YC2C 3WFCL 4EI5D 4IBLT 5LQBL 4PTUA 4P48A 3ESMA 3IF1A 1Q9LA 5DS1A 4GP5B 4BH8A 2F7OA 3SKOB 5AD0B 3DHJA 1H9VA 3X17A 2YPKB 2EO1A 4P23C 4RCAA 3VWJB 2VYRE 4ZFOA 5L4MA 2F53A 3RKDD 1A1MB 2J8UB 3IFOA 3NFNA 4FLHA 2VLMD 2YR3A 32C2B 4J4PD 4J3OF 1A7PH 1H8OA 1A4JA 1XWVA 1OW0C 3FCBA 4WTWA 3MJ7B 1QR1B 4NO0D 4TL5A 5JHDB 4N2FA 1YHPA 4NDMB 2FEDC 1G1CA 4ADGA 4L29A 2VW4A 3RIFF 4OD1L 3US0A 1F90L 1Q94B 5DUBB 5BUPA 2F53D 4TS6A 2OJEA 4Q56A 1PCSA 1TU2B 3IETB 5DUPL 1L5GB 3TPUB 4HUWB 1HH9B 1QD0A 3RLSA 3ARQA 4NO5A 2X4QB 3T8XB 1LM8V 5TK2A 3P69A 4XMLH 5LAPA 3RWJB 3RWGB 2HB0A 4S1RL 4KK6D 3KL0A 2DQEH 1NIEA 1DN0B 3JZYA 1K8IA 2Y5TB 2DLHA 3B83A 4JPWH 3C12A 3WTVA 1SDYA 2WW8A 2V9TA 4EN3C 4JPKH 4G42A 4M1GL 1B4LA 1IUZA 3U36A 3V6FA 3K7UA 3Q1EA 4JCMA 5L88H 3QXAA 4NENA 1NM9A 3LZLA 2VR9A 1HCZA 2BCKB 3NA9H 1R4XA 5DEJA 4Q58C 4Z76B 5JPNC 1UOLA 5SWZE 1TCMA 2XQ0A 3ZHLA 3FQXB 1F13A 4AGQA 5IQ7H 1IIKA 1C5DA 3BKJL 4E9QA 2WO4A 4QRRE 1A4AA 1DQLH 3ZO0A 1NBZA 3B1TA 3TBBA 3P40A 4IDJH 4K7PY 2E7LC 4OBSA 4FJYA 2SEBB 2B39A 5IROA 4XNXL 3NPZB 5TDOB 3ZKQD 3ZDYE 3TTYA 4WO4A 5JLZA 2WTRB 4DSYA 3U1PA 1E0OB 1NPJA 4RGOH 3Q13A 4YS4A 3WE6A 3R4RA 1A7PL 3GSOA 3BXNB 3CHOA 3ARBA 4YZWA 1R6VA 3KYOB 1ACXA 5M7QA 5E8DH 4P9HC 2HMID 2WBWB 4HGKC 2CKBH 3LDBC 1RK1B 4MA8H 3V5DB 2I85A 2NY2C 1E67A 3TJEH 1DJIA 4IRZL 5JZ7C 4WRLA 2AZAA 2E74C 3BKCH 3EOTH 1JGEB 3B6SB 5DURB 4PV8B 3WJLC 1PLGH 1YNTB 2CDEB 4AIOA 5EC2B 4GY4A 1LTXA 3DUUA 3IGAA 1JF5A 1H8LA 2WBJA 4MMZC 4WO4D 2X4UA 2VB5A 4PJ8A 4QGYA 4PJDB 5FDWB 5FYLH 1KYDA 1FBIH 3EGSB 3ARBD 2PTUA 3I6LE 1W15A 4L3CA 3LN4A 2WQAA 4AIXA 1E7UA 5CEZL 5E7FA 2DQEL 1WWBX 3F7VB 5ESAB 1LD9B 1ET8A 2HAZA 3K2IA 1UB6B 4MA1C 5BRZA 2WCPA 3QPKA 5H37G 2R8SH 4W9DC 2AK4A 3FPXA 4R4BA 5A2LH 4HWZB 1N0XL 4JPKL 3T9WA 2WBJD 1UWEH 2G3MA 3H9ZA 5J12B 4PJ8D 1PQZB 3EDDA 4JRYE 3BZ4A 4N0YL 4RISH 5DEGA 5L88L 2DMKA 4JQVA 4I4WA 4MMXB 4PN6A 3SE6A 2P44B 3NA9L 4A6YH 4M6MH 4Z7NB 1I3UA 1Z2KA 2P24B 3FOMB 4TNGA 4AEEA 3I74A 3CZKA 3FQWB 1MWAL 5AOZA 5D5ME 2VDOL 2ICEB 3HJ0A 5IQ7L 4AZ8A 1G7JB 5BRZD 3IMTA 1ESOA 4G6KH 3DNKA 1QABA 4LCYB 1DQLL 2BRRH 2AK4D 2QZ5A 1BXVA 3QFGA 1HDMB 4IDJL 2I60H 4LFHG 4JG5A 1L7IH 1CDIA 2AMUA 4U6XA 4P2RE 1NEPA 3HJEA 5E6YA 1PJWA 1KBKA 1KULA 2ESVB 3HHSB 4F2ME 4JGJA 3QXTA 4RGOL 1K5NB 5D1QC 2E86A 3KPNB 4HCIA 3HRZA 5FWQA 3SPCA 1EK3A 2P9RA 3KE0A 1SMAA 2TSBA 1U3HC 2JVUA 4P3DB 5E8DL 5B1JC 1G7HB 2BM3A 1F3JB 2CKBL 1LYQA 4MA8L 4P2OA 3TJEL 5IV2B 4KXZI 3BKCL 3EOTL 2F5AH 4U7SA 3RTQB 1DO5A 2JKWA 1D6VH 3BRGC 5DSCA 5E00B 1DVFA 3ZGHA 1KWKA 1TG8A 1J5OH 1IILE 3WL9B 2DWDA 1IAMA 1JK8A 2RFXB 1KPRA 1G0DA 3QBTB 3TCTA 4JANB 5FYLL 1U42A 2BZDA 4HXAH 4EI5C 4JZOA 4MDRA 3Q8EA 3CZSA 4HOXA 4F91B 1HI6A 1CFQA 4YDZA 3O2VH 3H9YA 1BOGA 2XNAA 4P2OD 1K8DA 3L4CA 4PSRA 1BAGA 2A83A 4NKIH 1HZKA 3TO2A 1JFQH 3NSCA 2R8SL 25C8H 2Y7QB 3MBXH 4X99A 4KJYA 3VXUE 2FTAA 2I5YL 3BVVA 4KFMA 4Y5YA 1D9KC 1QRNA 1MHCB 1UWEL 2CR6A 3X12A 5H35A 1XF3B 2UY7A 5EEVA 4RISL 1RK7A 3F12B 1MCJA 1NKOA 4J1UB 4HPHA 1FL6A 4NM8H 4A6YL 1OF2B 4M6ML 4RAUA 4TTDD 3SDDB 2WXLA 4OZGE 2NUPB 2XVLA 2QSTA 4L8DB 1EEYB 2WLNA 4PJIF 1A2YB 3A4EA 3FH5A 2BRRL 1UHVA 1CLOH 4PD4K 2UWEB 2I07A 2D0GA 2I60L 4GMTH 2FX9H 4PJEA 3LD8B 5JIDA 1ZHNB 5F0LB 4KK6C 1QRND 3V4VA 4LF3B 4EDXA 1NLBH 4UYQA 3RZCC 1H3UA 5GRJH 2YXVA 2CIKA 1JZHA 4K4KA 3GHEL 5F8RC 4YO0A 2Y4SA 1E2VA 1GYVA 1U8PA 2Z8RA 5IHBA 3PU7A 1O5DT 5BPPA 3KPSB 5BS0B 2FO4B 3MGAA 5BVPH 1LP9E 4G8GA 3MKKA 2F5AL 4G7QB 4N8VB 1KXHA 1NCBH 1U30A 1D6VL 2GC4C 3N1MC 3HS0B 1DVZA 3TEYA 1YMHB 3JWOH 4XBEH 3U0WH 5DO2D 5LN4A 1BX2B 3TBWA 2F53E 4HXAL 7TAAA 2DEYX 4M00A 3IMSA 3PV6A 5HTSA 3AUVA 1ILSA 3ME0B 3O2VL 5CP3A 1JNJA 1CPUA 1XSKA 5D1ZI 4RSYA 4NKIL 4G8GD 1MCWM 1JFQL 3WNLA 4F8OA 5IREA 4OM0H 4IIQC 4P46A 5CMAB 1KXQE 1ZT7A 3DHUA 4IOIA 1U95A 3MBXL 4RDBA 2HMIC 1FZJB 3W1ZA 1SQMA 4S1DD 3APFA 3S37H 4QJ3B 2P8LB 3QI9B 1DTUA 3MRKA 4O2EA 3VI3F 5IFHH 2HVJB 3KYMA 1HSAB 2Q2EB 2BVUA 3VQ2C 5I0WA 1E9QB 2JKTM 4WO4C 2HLEB 2F7IA 3KVPA 4ELDA 4L05A 3CGTA 5FA4B 3IMBA 2XKSA 5EUKB 3ATBA 2A6IA 4P46D 2RQ8A 1CLOL 1CYWA 3N55A 4NIYE 2O61B 4LPWA 3ZTDC 4GMTL 2FX9L 1WG3A 3BVTA 3GEWB 1RZ8A 1BXAA 2HVKB 1NLBL 2TSAA 1P6WA 4U1IB 2BVEA 3QUYB 4Y89A 5DEZA 1JF1B 3CFJA 1CN4A 1BBDH 2VO8A 1DVYA 1NCAL 1PD0A 3QDGB 2WOBA 1PLCA 2WBJC 2C3HA 1WD8A 4N3UA 6FABL 3Q2LA 1OT4A 3WY3A 4NN6B 3TNNB 2YSTA 1FH5H 1NCBL 4XNMA 2GKIA 1QFWH 3JWOL 4XBEL 1F11B 4XO4A 1FIGL 3U0WL 4DK6A 1T21B 4M6OH 3K2KA 1D5RA 2AV1B 3HAEH 5DJZB 3O3AA 5HYSB 1T6BX 2VMEA 5C8JA 4G9FA 1SOQA 3K2UH 4WW2A 3QJUB 4JQVC 3WTWA 5BV7H 1N0LB 3DX8A 4OM0L 2CO3A 5MENA 3GSVB 3U2SA 5D7LB 2VXQH 3WHXB 4IEFA 2VLJB 3EYFA 4C56B 3P4NB 1EJ8A 4PI0A 4Y7OC 1FFNB 3S37L 1OEZW 2QSQA 1S7SA 1C16B 5L9DH 4Y0GA 2DF3A 2F2HA 3F85A 1MFAH 3UO1L 4PJXF 1NL0H 3L8QA 5IFHL 3H2PA 4G70B 3CVHB 3IPBA 4GKZA 3MPCA 1FNHA 2NNFA 4G9FD 2WK2A 1ZS8B 4HFWA 3R7RA 1W80A 4H0LC 4KHTL 1CVSC 1FL5A 1USZA 5EUOF 5MEND 2FBJH 4RZCB 2WGXA 3TT3H 2I9LA 2XV0A 5AAMA 2IAMA 4HT1H 3EGXB 4YHMH 4K3DH 4XR8C 4H8WL 3VCLB 4F27A 4JJ5A 1FORH 2W07A 4XHJD 2R0WH 1D5XB 2GK0B 3IVKA 3VFPA 2KUTA 3L6FA 5TGBB 1KZQA 1DVFC 1S7WA 4MJJA 4OF6A 4JFXA 2C9UA 3L4XA 2MQ0A 1SFDA 4G43B 3VD0A 1SUJA 2ARJB 1JYXA 3AITA 3SO3B 3WNJA 1FH5L 1S7QA 1SYVA 2IAMD 1QFWL 4EBQH 1N19A 4ZUWA 3ZUCA 4M6OL 4N8VG 1CF8L 3N44F 3LS4H 4TVUA 3W39A 3VGHA 3LPPA 4U4BA 4X6DB 1TFPA 4Y5YC 2ZKYA 5EZJA 3V6ZB 2VMDA 5HHXL 1YJDC 3K2UL 4DGYH 4NKOA 3T0AA 4EDWH 1OOWA 4K7PX 4ZUSA 1MRFH 5BV7L 4JZNA 4M61B 5IP4A 1OAZH 2OCFD 3CBJB 1U8NA 3IE4A 4UDTB 3NIDB 3SOBL 2VXQL 3KCWA 1QW9A 2Z3FA 4G6FD 4LDCA 1EV2E 5D1ZA 4U31A 1PZBA 5J1AA 1K4DB 4JFOA 4K07A 5L9DL 1FPTL 3ZQXA 1MFAL 1QRKA 3WNOA 2XN9A 1KUMA 4BQ6A 2UY6B 4CN1A 3FU7B 1EO5A 3Q01A 2BVOB 2P46B 2CR3A 4L3AA 2ZUVA 4R5XA 4AL8H 3MOQA 5EC1A 3S88H 2PR4H 4PJDE 5DO2C 3MACH 5MEOA 3GMLB 3F7YB 5HI4D 2APTA 4YX2H 2FBJL 1S7TA 3QEHB 1MCLA 1U8IA 3PIQA 2DIAA 1KCBA 4HT1L 4PWKA 5IK3B 1QR4A 5D1ZD 5GS0D 4YHML 4K3DL 4BSWA 2ZONA 1FORL 2OS7A 1QRNE 4FXGB 2R0WL 2QQNL 3VG0H 4Y9BA 2UX7A 1M2VB 3QFJB 5EOTA 5HHMD 1H3VA 4ZZKA 2HA1A 2XN9D 4O51A 1F4AA 4MJIA 2Z7WA 4K15A 3BAIA 4S0HA 3UPCA 3UJIH 3BUPA 2FEEI 1WBXB 4S1DC 3LRSA 4XP9H 3N6YA 3MLUH 3T3MF 4MD5A 3NAAH 4AVKA 4B50A 4D8PA 4YDKH 4KNSA 1HZLA 4W9EC 3P4OA 1EH9A 4Z7NE 1OHZA 1Q9OB 1AHWC 4CU7A 4L8CA 4KROD 2FUQA 1DE4B 2EAEA 4NUPA 3MGOB 2FJGA 2COVD 4GW4A 3WY2A 1P2CB 2XWRA 2FWLB 4KRPD 4PS7A 1N26A 3D85B 4JY6A 4IK7A 3GBEA 5EHFA 3D39B 3IU3A 4MJID 1GS8A 3VU2A 2UXFA 2YN3A 4Y2DA 3CH1B 1EO7A 4ABVA 4DCQA 1OD7A 1BXUA 2JSFA 2ESVE 4RRPG 5LGJB 5EO0A 1X5MA 3L1OH 1YEHH 4DEWA 4EDWL 3GSXA 1MRFL 2FNBA 3K6OA 1OAZL 3M07A 3DIFB 5AOKA 5BQDA 4B9FA 3T77B 3MV11 3KLKA 3RX5A 5DK2B 5IMLB 2BP8A 5KBNC 3WMSA 3MV9E 5IJVB 2YAMA 4LSQH 1FVCA 5J13C 1I1AD 3QIWA 3SKJH 2DQTH 1MG2C 4CC4C 3VRLF 1A14H 5F7YC 3T08A 4Y2DD 3RB5A 5IR1A 1T6WA 2X9YA 3BEWB 5LO7A 1TMQA 1U8KA 2DQ6A 3BC9A 3PQYE 2GJ6B 4X9YA 5LG1A 4AL8L 2FLBT 4LGSB 4Y5VA 3MACL 3V10A 4O2FB 4JY4A 4U4IA 3X3FH 3MFFB 1OB1A 2X6AA 3LKOA 3O6KH 1E8XA 1BVLB 3ZZSA 1FHGA 2XRAH 1N6QH 5EU4B 3VG0L 3QIWD 1U58A 4N5EC 4M8UA 4QY8B 2Q76B 3QJVB 4U1LA 3H3KA 4TXVB 4CBPA 5DTFB 2JELH 3EIFA 4Q97A 3GMQB 1AFVH 2RTTA 3NZ8B 3UJIL 3VFRB 3QYMA 1XGRB 5FWRA 3DGCR 5FYKE 3MLUL 3NAAL 4KKNA 4F8NA 1OP9A 3QDHA 3ZTJG 1KELH 1WFMA 4PV9A 4U6YB 4Z78A 3I02B 1G9MH 5JIQA 3U0TA 3HZVB 1AGEA 1WYJA 5EN3A 5E08L 1P4LA 4WUUE 3AJ7A 5DR5H 3C5JB 1F1GA 4WW2C 1FNFA 3RFZB 3K6SA 5DD0H 2RACA 3SDAA 1M3IA 3RWHA 3SPVA 2D2OA 2A0LD 2QADB 4ZMVA 1UZ6E 5ELIA 1BQSA 2W95A 3BE1H 5AZEH 3SZ6A 4HJJH 3TJPA 3NCEB 3TIEB 4L4VB 4LCWB 4XHJC 3QEUA 3L1OL 1YEHL 1OOAA 2ZP0T 5H94A 5C09A 3OSKA 1IRAY 4HS6A 3S96B 2YBRB 4X6BB 1F4HA 1CBJA 5ICXB 4MQXD 4KKPA 1A1OA 1RY7B 4PLNC 4HETA 5JIPA 2VZSA 1A6VH 1BFOA 2VLKA 2E4FA 4LASH 2IV9A 5GSVA 5BS0E 1Z6JT 3QH3A 4WWKA 3SDAD 2AQ2A 3BZ5A 3BVUA 1ET7A 3SKJL 2DQTL 5AAMC 1HHIB 3GSWA 4AYSA 5CJ8A 3S5LB 3IE9A 4L1SA 3OJ2C 4D0BB 1GYWA 3FF8A 1PZ5B 2IOOA 3VFSB 5I15H 4JKNA 4E9TA 1TKWA 4QAMB 3OR7A 3IDJA 3FTWA 1TF4A 4DOHB 3ZHFA 5C09D 1WK0A 3Q5OA 1SNRA 2B1OA 2FATH 2EIZA 4KXCA 5DVMA 3TX4A 3VXTB 3X3FL 4EEEA 4P06A 2VLKD 3KVQA 3O6KL 4DIXA 5A16A 4AGMA 1Q8MA 2XRAL 4DP4X 5LDUA 1N6QL 4L0YA 3M46A 3VXNA 5ESQB 4AITA 5I9QC 3DX1A 1JCVA 1IEAA 5C0IA 1ECZA 5IG7A 2XC8A 1FYTA 2JELL 4Y19E 3EJUA 1T2JA 1AFVL 1NGWA 2W9EH 3TF4A 1FE8H 1OE3A 1ND0B 5HVHB 4ZUVA 3K3QA 2MEJB 1BAFH 4KFZC 1KELL 4TUKH 3KWUA 4W9LC 1G9ML 4TNVK 4FFYL 2EVIA 3AXLA 3EJTA 3O4LE 1FC2D 5DR5L 3U7AA 3C8KB 5TJWK 1MI5B 1JD9A 2X2JA 5DD0L 3VFWB 2H32B 1PJ9A 4DHLA 1H0DA 2Q3ZA 1RIVL 1FYTD 5FS5A 3BE1L 5AZEL 1IT9H 5D1ZC 4HJJL 3NGBB 1V27A 2OYMA 1G7MA 2MPVA 4PY7A 3P73B 3ZDXF 4FYSA 3JQOB 2X4RB 5AKVA 3HI1A 4NGHL 4POZC 4DP7X 5HYQA 1OE1A 1JUFA 2E8ZA 1DZ0A