1O9WA

F17-ag lectin domain from escherichia coli in complex with n-acetyl-glucosamine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
169
Chain Sequence
b'AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17A-G FIMBRIAL ADHESIN
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 169
sequence length 176
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9wA00
3FFOA 1OIOA 2BSBA 2BS8A 3F64A 1O9ZA 3F6JA 2BS71 1O9VA 2BSCA 1O9WA 1ZPLA 4K0OA 1ZK5A
chains in the Genus database with same CATH superfamily
1AIFA 2PPFA 1GYAA 3C60D 2UUDH 4RA3A 3RNKA 2CK2A 5E6SB 3T2NL 3O2DL 4E41A 4R9HA 3L3HB 1K2DA 4LLVB 3U4KA 4M93B 3SYPA 1NAKH 1I9JH 2VMCA 5E7FA 1RUQH 3WEMA 1VFBB 4PWIA 4BFGA 4PJDF 4F8NA 2FJFA 3DJZA 1DVQA 5F89B 1BVZA 2IF7A 2EIKB 2MMXA 4XMPH 3RIFK 1VFAB 5FECB 5ANHA 2DAVA 3A0OA 3DBSA 2M26A 1V3MA 1A4BA 5JW3H 1J05B 4E9VA 3OR7A 1MCJA 3C5ZA 1JPTL 2VXVH 3GQFA 4ZZFA 4KJQD 2CUHA 5JIIA 1E5CA 2XG5B 4O02L 3PY9A 3IE9A 1KN2L 4M6MH 5A2IH 4G6MH 1G4RA 1P84K 4GQ9L 1XXFC 1RUPH 5CIPB 1DL7H 3WS6C 2VUYA 5F9OL 3A4EA 5D1QA 4ZS6D 1NIBA 1ZKAA 2OL3A 4GRLB 3FU8A 3HR6A 5C92A 4H26A 3UACA 4KAQH 1HCFX 4LGSB 4M6OL 4R5TA 2ICWI 1RJZA 1XB8A 2HYMA 5GS2D 5GGSY 3UJIL 4ADJA 4D9RD 5BXFB 5CF3A 1DBAL 2QMJA 3BFOA 3MNVB 4QXWA 1WBYB 2FZ3A 4Z9KB 2ADGB 2XWJB 3A6BH 1XMWA 1FYTD 2VN5A 4HS8L 1D6VH 2VDPL 5KJ7E 2MCG1 5ID0B 2ESVB 1A2YB 4U3SA 1ZRUA 3WY2A 3BO8A 4HQQL 1HZLA 1FV1A 1R46A 2EYTB 1KYUA 2VH5L 3C2AL 4H25B 1KGXA 1JVKA 3CLWA 1BECA 4JGJA 5BV7B 5IB5B 2ATAA 3S8FB 5BZDA 3SO5A 1J0HA 1XF5A 2WKOA 3ILEA 3RVTC 3BZ4B 4K55A 5HYJE 2NY6B 4P4RB 1U91A 3EW3B 3FPYA 3T09A 3L3JB 4LVNC 5CEZE 3GSRB 2IMNA 4L9LA 3VB8A 2EDRA 2Y5QA 1NCUA 4N2HA 2ZKXA 2H0JA 4L4JA 1M7UA 5D5MF 5LBSA 5L2KB 2FR4A 4B9KC 4J6RL 2I25N 5EA0H 2FB4L 3ZX1A 4QRBA 3EJZC 3N0AA 1GYWA 4ADGA 1MNUH 3GB7B 2AV7A 2BFVL 1N70A 3CFJA 1CD8A 3F58H 4JG9A 1SN0A 3KPPB 3SDCD 2E7LC 4X7DC 1GYCA 2B77A 3JWDH 2HLFC 5HBBA 1WD9A 3QE5A 2ZKMX 2ATKB 1QFPA 4U1KA 5SWZB 1KY6A 2HKFL 2YAPA 5K9JH 4J1UB 5GSRB 4DKAA 5KYUA 4TQIA 4FQQB 2Q1EA 4HWEH 1J88A 1W16A 1P7BA 3PAVA 1BQRA 3II2A 4MNQB 3SJVA 1BEXA 4HALA 4L3ED 4NCC2 1A4AA 4ONHA 3EFOA 3FB8B 3H2WA 1BWWA 4OFDA 4Y7MA 2E56A 3RY4A 5DFVC 4KMTL 2X0VA 5LXGH 4QO1A 1NH6A 5E6YA 2EE0A 4DVRL 1P5VA 1VFOA 5IFAL 4OZ4B 5I1GH 5C0RL 1MY7A 1YUHB 4NPKA 2G5RA 2GK2A 1OOAA 4MJ5A 3A24A 2X7LA 4Z7WB 4X9FA 4OJCA 3TL5A 1C1EL 4N8CL 2EEXA 4DW2H 3KPNA 4B9GA 4IGBD 3TX4A 1XH3B 1SLUA 4FQPA 2YPLB 3D3VB 4M7ZB 5K59F 4NENB 5I19H 5FAAA 2JCCA 4Z7VF 2BMKB 4WDIA 3ZDXE 3TBCA 4OGZA 4A2LA 2ITEA 2OFQA 1ZLWH 3NDZE 4LLWB 1FBIH 2VN3A 1SLXA 1IARB 4XWGL 4EI6A 2LV4A 3BP7A 3VWJA 4YHOH 1MREH 5DS2A 5A40E 5F9JA 1BBDL 1I31A 2VDPB 4MB4A 3ZZSA 1HEJC 2JB5L 4X4KA 5DD5L 1JPEA 3SDXF 3NUKA 1IC4H 2B16A 3BN9D 1XF1A 1X5ZA 3V0WH 3WHE0 1QSFE 1BZ7A 4X4ME 1A9VA 5ISZB 3BKJL 4HF5H 2BP3A 3D2UA 3LKSA 3V0EA 4BSWB 5C0CD 1CICB 3Q3GB 5C2BL 1AKJD 1T03H 3ARZA 4MYWB 2C9QA 1OSZB 1J1OL 2BIIA 1K8DA 2VRAA 2GTZB 3UTTA 2JJTA 4PYHA 1EHLH 5ADOL 2BP0A 1MCKA 2GABA 2Y7MA 2XRAH 4OKDA 4ZOCA 4X9HA 4ATTA 2OJ1A 4B5EA 1WPCA 5CJOL 5TJWK 3MGTA 1HXYB 4M1CC 1EERB 3PXHA 1J5CA 4YVUA 4ZAKA 1AQMA 1YRKA 4WW2B 1EO8L 1KNOB 4Q9CA 2BCKB 4IDJH 1N8OE 2JJTC 2VLJB 3DSNB 5IFJA 1BYPA 3FTGB 3HHMA 2VDKB 1OARH 3ARFA 2D7QA 3O6LH 1KC5L 4L05A 2VZSA 4R3SA 3TZVA 4EIUA 5FA3B 5KSAD 2C1PB 5DJXA 1RZKL 2AANA 1G43A 5E2VL 5JUEH 3WTTA 1TEFA 2VAAA 4H8VA 4WK0B 5HI3D 2G30A 4AKQA 2IANB 3D48R 2EDXA 2VAJA 2EILB 3GXNA 1KULA 1Z3RA 3ARFC 4TL4A 5L8JB 4WFGE 1LO2L 2YC1B 5CP7A 1F6LL 4P46B 2I07B 1BFOB 4HIEB 3OHXB 4PY7B 4K8RL 4EKJA 4FQIH 3SZKC 2MCPL 2Z1KA 3BP4A 2P8LB 1UOLA 3V6FA 3OQ3B 4FTVE 5HGDA 1ZK5A 2H9GA 4PB0H 3BJ91 2OMBA 3GO1L 1IJNA 2NTSP 2XFGB 4XCFH 4JRXD 2J44A 4AYID 4ZG1A 2JIXA 3D1MC 5FO7A 4ZMLA 3KYOA 3F7QA 1QSEE 3DX4A 2AXJA 3TH3T 3U7AA 4ZS6C 2ZF8A 1EAOA 1FPTL 3QIUD 1OGPA 4QYOA 3UIYA 4EI5C 4DKFL 3NIGF 1GW6A 2F7PA 4R26L 3CZJA 4PWKA 4JFDB 5FKPA 5HGGS 3BH8B 3MGOB 4U1MB 5L88H 2WXJA 4BFIB 3ROLA 3L3KA 4JQIA 2DLIA 4MCYA 5C09A 1CR9H 3KPQB 1L9RA 5EC2A 4ZFFB 1IGIL 1ODAA 5CZVH 3P4LA 1YC7A 4X6CE 1YAZA 3ABMB 4YDKH 5C0FA 3X1NA 2XUWA 4JG5A 3H6JA 2HUHA 2IXQB 2NYYC 1BCIA 1MCCA 2R7EA 2VABB 5DQJA 4PG2A 5FR3A 1KB5A 3EJTA 3QQ3B 1G0XA 1WIPA 4JFZL 1TJIL 1T5WA 5SWQA 1N7ML 1R24B 4OLZH 1MJ8H 2N1TE 4XC3L 1HKFA 1E9PB 3BEWA 1WIUA 1NCGA 3ZBMA 2ZUVA 1WWBX 2QJDA 5TF1L 2BVPB 3LS4L 35C8H 3VGFA 3MRGA 4O9HL 2FIRT 2G75A 4HLZH 5JYLA 1UD6A 3MA7B 4K9EC 4C56A 3F7LA 3V7AE 4QCIB 3WIFA 4XO4A 3BGAA 4AV4A 3ZO9A 4GKLA 1KJMB 3H42H 2A9CA 3FB7A 4LSSL 5CN1A 4EO5A 5AAPA 5CJ8A 1RHHB 5I74B 1IBYA 5D7IA 1MFAH 1E28B 2Y5TA 5J1SC 1PZAA 3EDFA 2XN9D 1FVEB 3VGGA 2APVA 3HKFA 2ITFA 3LKRA 2LTQB 4X98B 4DUWA 3OPZH 4WEMB 1E6OL 1B4TA 1XD0A 3ERXA 1LDPL 3SE8H 2P7TA 5FHBL 2Z6FA 3M1CA 4B9ZA 3GEFA 3C9NA 1YY9D 3T0WA 4PJ5D 3PWPD 3FB6A 4CKVX 1H8SA 3REWB 1GGTA 4UF7C 2PR4L 4F7TA 5E7BA 1G9NH 3L1GA 3MRIB 1Y07A 4PRNB 4YHZL 4WWKD 5HJ3B 4KKCD 4PS4H 3GHPA 4AGPA 4HCRA 5DVPA 3FTSA 3LNEA 3MRQB 5C9KA 2WSDA 2B7DT 3NPSC 3MBEB 1F4HA 2A6JB 1PNCA 1LWHA 4GW5B 5HHVL 1I75A 4J3UA 4XCNA 2EEBA 2BJML 1IAIH 4Y2DA 3RU8L 1OZUA 4YR6A 4MNHA 3SO3B 1CXHA 4KNQA 2D03L 4K5LA 1U8LB 2BSSA 4POZC 1N64H 4HHAA 2J56A 4NJ9H 3GMQB 4FFVC 5EZJA 3T3ME 3FCSA 4OZIE 2UY6B 3N43F 3OXSB 1A9EA 2HJLA 4HU8A 5CCKH 1LVEA 4FQHA 4Y2DC 1K4DA 2CO7B 2GIYA 4JFHD 5JHLL 4W6WB 2V3FA 3MJ8A 1DQTA 1TZGH 2BRQA 1A8ZA 1X7QA 4G80B 3KXFB 5GS1C 3T65B 3VGBA 3BP5A 1LO0H 1SN2A 2W80C 4HIXH 5FLUA 4DK5A 4P2RB 3RGBA 4HCGA 4C4BA 2CBQA 4G8IB 2GJPA 1NMCC 3KVQA 3DVIA 1FZMA 4YE4H 3TO2B 3MHZA 1CBJA 4Z1PA 5E2TH 1Q0EA 2EIBA 3S3BB 5DYOA 5E5LA 3AAZA 1N18A 3QEQE 3QGVA 4W9EC 3STZA 1XZ0B 2P28B 4FFWC 3LD8C 2YD5A 4U3HA 3BN9C 4HWZA 4I0PC 1LK2A 2IQ9L 1MWAA 2VZVA 1I8LA 3HFMH 4J3OD 1MIEL 4X5XA 5GGSB 2X4RB 4Y1AD 3IGAA 1CG9A 3OZKA 2AJYH 3CQQA 1AGFA 2H1PL 1I85A 1NEZA 4HMCA 5HDLA 2ADYA 4S11A 1RIUL 1ZEAH 1Q1JH 4TNWF 1G1CA 1A4JA 3TBTB 3ZZQA 1FZJA 1PYWB 1FVDB 2ZCLL 2X5PA 2BLFA 4Q0XH 3LPGA 4IHOA 1FL5B 4TNEA 2P5WE 2K4AA 5BO1L 5EN3A 4OCRL 3WJLC 2K8QA 3B9AA 2IVFC 2F19L 5C97A 5J5EA 2Y2WA 1S3KL 1L4IA 4YHIA 3I9PA 1I7RA 2DN7A 4LIQH 5AVVB 3GHEH 4ZUUB 4OSUL 5FM5O 1UD3A 2IGTA 3GSUA 1BQHB 2RA1A 4GAJH 5KEZA 1PEWA 4EUPH 5FGBC 4AZUA 1WHPA 4IMKA 3TT1H 4IBVA 2MQ3A 5KSAC 3ROOB 5E8NA 1LEIA 4J12A 3QUYD 3SYQA 3GMNB 1CF8L 3GK8L 3HBZA 4PGCA 5T1DH 4JZOB 3OAWA 5KVGL 3TP4A 3C60B 1IAOA 2X3CA 4IIZA 1YEGH 4XXCA 2K8MA 3L4WA 3PAYA 3G5YA 4I4WB 2AJXH 3FRPB 1OD9A 3DV6A 4IMKC 2R0KH 3GXMA 4N68A 4NNYA 4AYDC 1TPXC 4YL4A 3JSSA 2GY7B 5E4EB 1KG0A 1UM5H 2VITA 4OGAC 3FQWA 2SODB 5DHYA 4JN2A 1S9WB 2GCYA 3CFKB 4YAQA 4MA1B 5A2AA 2AK4B 1ORQB 4ELMA 3T8MA 3GUTA 2HCZX 1RZIA 1DJHA 3DOIA 4XRCA 3UYPA 3C6EA 4CN4A 4KMQA 1PX3A 4ENED 2UZXB 1FFNA 5BW7A 1BOYA 1BQSA 4X7CC 3O45B 4LESA 3BWSA 1NKOA 4AK1A 1OHQA 3SN6N 2PYFB 2Z8SA 4X6DB 2PWHA 3M8OL 5DR5H 4P5MB 3T6ZA 3DRQA 2HFTA 2AJSH 2DQUL 3DK0A 3EKCA 1HQRB 4NKDB 1QRND 3T0DA 5BZZA 1JRHI 1VGEH 2FEDC 4ZW8A 5BW7C 4MA8L 2HFFB 3UBXA 3X3GH 4K7PL 4XTRD 4UNIA 4P2QD 3P11H 4H13C 3CD4A 2JJSC 1EWHA 4LHUB 4Q8BA 3ARGD 4PR5B 3RWDB 4XP6L 1FYTB 3RWJB 2HMID 3MUGB 1IGMH 4G11A 1OKEA 4FXGB 1T2QH 1UOWA 4I48A 3GDBA 3T8XA 3US0A 1DQMH 3CTTA 4S0HA 1EGJA 1WZ1L 3MR9B 5C6TL 2B0SH 2J57A 4HZLB 1R5WB 2R2HA 4OJDH 2CWRA 3VFOB 3E7JA 4G1MA 2KPNA 4HCFA 2WTRA 5HYQB 3GJFH 2Z34A 4IIQB 2P48B 4LIQE 3HE7D 3OBAA 3DUUA 4MX7A 4L8CB 3BVUA 3MXWL 3VG9B 4NWTL 1AZNA 4X8XA 1S5IL 1KT2A 3ATBA 1ZSDA 4ETQA 2WK2A 4UTCA 4HPHA 5IMMB 1KJ2L 5T33H 3SPVA 3PCYA 3BP6B 1P4IL 5D1XA 4RAHA 4L4TA 3LXCA 5T1JA 4JO4L 1J8HA 2WBJD 4UWQB 2FBJL 3SDCB 4M56A 1TCRB 4LPCA 1P9MC 5CGMA 3MU3A 4MTMA 4LB8A 3UTOA 1CPUA 4PHXA 3VM5A 1F11A 3WKYA 2QVMA 2VWEC 1E67A 3IBOA 1T0NB 3HMXA 2W59A 4M7KH 1NBVH 5D1XC 3QDJE 2AQ3A 5DF0A 1THCA 4TRPL 5ITFB 5IHLB 1MHEB 3WN5C 1YN7B 2O26U 2L7EA 2AJ3A 5A16A 3OKKA 5HHQB 5BMFL 4L3EB 1FQ9C 3UZVA 4OGXH 3WFDH 3U79A 4JDVA 1QWHA 3IJSA 1XGRA 3QZWA 5LQBH 2IPTL 1T80A 4LLDB 4LDEB 4HIPA 3CAFA 3E9TA 12E8H 2K6YA 4RETB 3US1A 2MSPA 1XF4B 1HL5A 4TNVK 3O41A 3S48A 4APQA 1FH2A 2XKNA 3WNIA 3K5SA 4DP8X 2NZ1A 1IC5L 5E8EA 4OZIF 3FU5A 4MSWB 4WO4A 4N5EC 1ZVYA 3KPMB 4IGBB 1SYVB 4I18A 4MA3B 2DWEA 3BLKA 4U1NA 5GZOA 1QNZL 4GS7C 4P4KC 4QT5B 4BV1A 4QRFA 4ZBJA 3C8HA 5GS1B 2NNFA 1MRDL 1FE8H 3RHWK 2CMRH 3PGFL 5E1QA 4ERSH 2WNKA 1IILE 3CZEA 4WO4C 2WZ0A 4G1EA 4X9IA 4PJHF 2JELL 2OJZH 1ZOXA 1LE9A 4MQ7B 2ZONA 3QPQD 4GP4B 4XP1H 3VE0A 4XODA 3H3BC 3AM8C 3D07A 2VC2H 3FQUB 3NCJH 1HYRC 4ZFOB 1S7SB 3QC5X 3GTNA 3VCLA 4XNYH 3VMOA 4EOWL 1J5OL 2H0PA 3BWZA 5EF3A 4HAFA 4J3OC 3EJQA 1T1XB 2WVVA 1XSIA 2IOOA 3K72A 1CL7I 3HRZA 4GKSB 3HLKA 4LT7A 1DJZA 3RWEA 5CILH 4H2AA 4RMVA 1TSHA 3HOGA 2DBLL 2FQFA 3FO0H 1UH2A 5C0DA 2BNRB 3H9SA 5CIPH 5C0CB 2DLHA 1AKJB 2XQ0A 1HHIB 4KKAC 3L4VA 4JE0A 2WLIA 4JREC 1U8NA 5T5FH 2OTWA 3HG1D 1CVRA 3HRZC 3B2UD 1DSFH 5CEYB 3PYCA 3PRZA 3BWUC 1KB9K 5MENA 1M4KA 3AZUA 2PLTA 4F5CE 4KKLD 1BVKA 3FFDA 5CFAA 4KRMB 4AUYA 1D5ZA 3BHBA 4HH9A 4JFOA 5KUMA 4FA8A 4MS6A 4YH6A 3U46B 1KJ2B 1KLGA 3I84A 5JA8B 1E2ZA 2WZ5A 3IF1B 3OR6B 2ZE0A 3GMOA 5IR1B 1HQ4A 4N90E 4V1DD 3EFDL 4NJAL 2CD0A 4K7FA 1JIBA 1Z9SA 4KY1L 5BPPA 2DQIL 3FSOA 2CLVB 2YPVH 4PP1C 1TYEB 3SPGA 2QR0A 4IU2A 3BIAX 1VCBC 1IFHL 1ZT1B 5DFWH 5KSAB 1XTLA 2ZWKA 1OZTG 43C9B 4PJ6A 3VXUD 4U49A 5GS0D 5BV7H 4NDMB 3QG7H 5AD0A 1KIQB 4AI7A 1CDCA 4E9YA 1THAA 1KWGA 4OKVA 1SMOA 5DQDH 3TEYA 2AI0H 3K6IA 4F2MA 5GRVK 1JTTA 3IFLL 3PWNA 2AJZA 3OZ9H 1NFAA 1BQHG 2ICCA 3MC0A 1TPXB 3D4YA 3LSOA 4GXVL 1N2RB 4NNXB 2NW2B 5I16A 4M62H 3T6VA 4D0CB 4BA0A 3GNML 5GGTL 2DKMA 3WS3B 2H4EA 4OQTH 2C26A 4M5ZL 1SYSB 3QJVB 5IB3B 1XX9C 3FRPG 4GAYB 2A2QT 4DGIL 4B3EA 3TIEB 2G9KA 2Z0UA 4WCYL 1RU9H 1P7KB 1HI6B 1R47A 2DI7A 2B1OA 2A6DB 2HSIA 1X6NA 1RK7A 3DUSB 1OK8A 4H44C 3QNXB 2V17H 4G70B 5I8KH 4NZJA 5EF1A 3QR0A 4KPHH 2A9NH 2CSPA 1IBGL 1RUKH 4FKKA 3WGVB 1NA8A 3QDAA 4Y2NA 2BM3A 2ZG2A 3ARGC 3UJJL 1ASQA 3MCYA 5DMKA 2Y69B 4GT7A 3BIBX 1F6FB 2CNYA 2FSEA 3NJHA 1HL9A 3REVA 1S9KC 4KJPC 3O2WL 3FUFA 4N24A 2AK1L 4W9HC 4WJ5B 1AZBA 4RFNC 1UA7A 2BK8A 5CLTA 4LAQL 1RJLA 3DSFL 1B0RB 1CK0H 5T5NF 4ADIA 1FH5L 3UCQA 5KYXA 3CC5B 1E8YA 3P9WB 4GFXA 1RIVL 3A4AA 2EXWC 4GLRI 1VEPA 3EYQD 3KJ4C 4LHUG 4A2HA 4UNTA 4ZMAT 4NYLB 4HJUA 4YEFA 1VADB 1MJJA 3FAXA 1GY1A 2FK9A 5DT1L 3KLAA 1NGPL 4H5SB 3CFDB 1HJBC 2G5UA 2Z8RA 4U1GC 4YUEH 4ZW3A 2R1WB 2JQAA 1EEZB 4P5RA 3RVXC 3V4PA 1QKZH 2ESVE 2XY2A 4EVNB 4Z0XB 1MFCL 5HJBA 1JYXA 5ALCL 4KUZH 1XIWD 5I5RA 1ZWIB 4FXLA 1NDMB 3K8MA 4HUWB 2FQDA 1N26A 1OOWA 4XVOA 5IB4B 3MX0B 4PJBB 4F57H 3NK4A 5K1JA 1TTRA 4LNVA 1O9ZA 5HHOD 2A83B 2GJJA 4S2SB 2GT9A 3GM8A 1K3IA 3GXPA 4MQXC 5DRZA 3TCLA 4A63A 2PCXA 4PJCA 3PWJA 4OFIA 3BUTA 1P7HL 4PJ5B 1FNFA 3MCG1 3QDGE 3QNZB 3EF7A 3WNMA 1SOXA 2DD8H 3EDKA 1YEJH 1LILA 4WWKB 3FT3A 2NZ9D 4PU2A 2FWUA 3VXRA 3CVIL 3O3EA 1LP9E 1KIPB 4XBEL 1UD4A 5L2KE 1KEML 1WS8A 4Z0BH 4Y4KD 3GSQB 4ICXA 3HPLA 3H3PH 2IGLA 2QHLA 3B37A 5F1NA 1AI1L 3HNSH 5DO2C 4EZLA 5ESVB 5FM8A 4FLQA 3IU4L 2PCPB 4NQUA 3SGDH 5HXMA 4JHUA 1YEWA 3G08B 1KFGA 4D7BA 2B5IB 3I6LD 2CUMA 3J7HA 3OJ2C 1YC8A 3QBTB 5SWZE 3ZL4H 3U0PA 4X8JA 1OSEA 1OWWA 1WEJH 1WQVT 2X87A 2BC4A 4N0CC 2CQVA 3DX6B 4OGQC 5IESH 5I0ZA 4MNQE 3KZ8A 3BGFB 3OJVC 4OJEH 2IADA 2VDKH 2XPGA 1LDSA 4O2EA 3U2SA 3GXDA 1CXEA 4HUXB 3NSYA 3ILDA 3WD5L 2FYYB 1ZA3A 3V4UH 2WQAA 3BPOC 2NY5C 3HS0A 3NEXA 1YEDA 3NZUA 4GS7B 4F7EA 2CDFA 4P4KB 3ATEA 4M3KB 4Z6AT 2DMCA 5KYYA 1KTKE 4G9DB 1LM8V 4OIFA 4DKTA 3ZTCC 4WV1A 3WFBL 3IDYC 5F7HA 5ESQB 4GSDH 5TDNB 4I77L 4JKLA 1Z5LA 5HDWA 3D34A 3D50A 1ED3A 4Z7WE 3HS9A 2N0MA 2WWKO 5ACZA 3JBG7 4NSKA 4OLYL 1N59B 4P49A 3S34L 4PJGB 4Y9BA 1FO0B 3FT2A 2BIOA 4B27A 3D3VE 4R7NB 3TF7C 1IGTB 2FGWL 3QQDA 1T1YB 4LXFA 4HGWB 5E56A 3DYMA 4Y1AB 3WTVA 3O2VL 3DGGB 1JUFB 4ZOAA 3D4CA 1QBBA 4MLIA 1FHGA 3GBEA 5E1GA 1IGYA 3MODH 1HWWA 4IKJA 5EBLB 4D8OA 4BWWA 4X80L 1FN4A 1CL7L 4HGMA 4MFHA 3AVEA 2XFXA 5SV3A 3DXAA 3LAFA 3KBEA 4JREB 3SYCA 3SOBH 3US9A 1T66D 1HXKA 4KX7A 4HVBA 4DHLA 2QT6A 4GAFB 3DWTA 2UZYA 2OL3H 3FUEA 1TR7A 2YRZA 4JLRA 4ZT1A 3VFVB 3UH8A 5JXEA 5ISZE 3LV3B 4YJZL 1YNTB 5C6WH 4WU5B 3S96B 1WZMA 5E94A 5LGJA 3QUYB 2FO4B 2B08A 4BWUA 2HA1A 5EBWA 3IWVA 4MJJA 4LNRB 3V6OA 1OPGL 3I3EA 1MCOH 3MLWL 2WNGA 4KKRA 5DJCA 1P7QD 4FQXD 5C2UB 4JM2A 2XJLA 3QJZA 1IL1B 4TULL 1JN6B 1F1DA 4XBPB 3S35H 2ITDB 4IBUA 4LCWD 3KM2A 5DS8B 5E1IA 3U9WA 1Z9MA 4KXZH 4BHUI 4PRHD 2CLRA 4UQ3A 1CE1L 1ZLSH 2VLJE 5TK2A 2HFGL 4KKNA 5D6DC 2X70A 1Y1DA 5ENWB 2ZTBA 5CR8A 4ZUWB 2B59B 4JM2C 4LLVA 5DEFB 1ZHBA 4XO9A 2DS4A 4XPAL 4NZFA 3QIWC 4EIBA 5HD8C 2QVTA 4BQ6A 5F89A 3X3FL 4X4XA 3PXJA 2IANE 1KOAA 3PS6A 3VDCA 1JWSA 3WXVL 1OB1A 4GO8A 5J8OA 3ABKB 2J12B 3A4DA 1J9CT 2X28A 4AMKL 4IK7A 2WQ8A 3BRGC 1TIUA 1AQKH 1TEGA 3FSWA 2AHIA 1INEL 1QRNB 5IVXE 3KWUA 4X7SL 3QRGH 1F2XK 2AVFA 5F7YC 5IOPB 1T4KA 5CS7A 3U9PH 1IU1A 5HPOA 4W9LC 4GG8A 1JYVA 3I75A 2XIDA 3N55A 2KZ1B 5KSBE 3ARGB 5IREA 5FUCC 4LK4A 5JQ6L 4XAKE 4M4RB 3FL7A 3KR3H 5FHAH 4K5OA 4UT6A 1GZHC 2R0ZL 5BJTB 3VM7A 1LO3H 4GMTL 5DUBB 3SCMD 5SX5K 1N67A 3EG9A 5IP4A 3A4FA 5AYUH 3MNVA 4YHKL 4KUCD 3THML 3MLPA 2DQEL 4JFDE 4QLRA 2ADGA 2XWJA 2QPDB 3EYQC 5L9DH 3IDXL 1EZUA 4XE5B 3T1FB 1R3KB 1ZDSA 4RMUA 4NO5A 4KVPA 2C9VA 4YSCA 1A2YA 1CFTA 3JTSB 3HE7B 4IW4C 4JL1A 2QSVA 5ESAB 4LRIA 2KERA 4PJ9A 2VM4A 5IQ9B 5BQDA 3PJSB 1QW8A 2EKJA 5CU5A 3BD3A 3ZTDC 2MH4A 1Z3GL 3ABLB 2MQ0A 3GSXA 2EYSA 3TYFB 3SQBB 4NN7C 3OKDB 1S9YA 2L3BA 1MVYA 3QJHB 2Y6SC 5BS0A 2M2DA 2KPWA 4AMWA 3L4XA 4LRIC 4ANKA 2CCWA 4PJ9C 5KBKA 3Q6GL 1EO5A 3NFSL 4XB8A 4AJ0A 4HJJH 1DJSA 5I71C 5E08H 2DH3A 4HIHA 4F92B 2NSXA 4JY6A 1IKNC 2HJKB 2W38A 5GS0L 1SDAB 4K3JL 1FNAA 3TVMA 1UXMA 4D3CL 1F8TL 4YGAB 2BSRB 4AJVA 1BSIA 3OVUB 4PGZA 1J9RA 3BKYL 3IVKB 5FOJA 3DROA 3KPRA 1JDDA 4XMZA 1X9RA 4GJTB 5CFHA 5AOZA 2ZNXA 4AM0Q 1T21A 3ZTJH 1LP9F 5EIIA 2DQTL 2ZAHA 2VXSH 2J73A 1UENA 4JPKL 4PD4J 1C8PA 5E5UB 4A37A 5TK4A 3ILPB 3PWLB 2GSIB 4JHVA 5GSRA 3ZIMA 2F8IA 3ARBD 4FDWA 1KBGH 4PLKC 1WH0A 1JCVA 1PLCA 1XSJA 3QHZH 4JW3A 3O2DA 3N1QC 3NIDB 4K7PX 1JGEB 4LLMA 3PUCA 4FULA 3FB8A 4Z3GA 2EDMA 4M8UA 4ODTH 5TH2B 1EAQA 2XXGA 1G5AA 5HJGA 2ZD0A 3IMUA 3EYVB 3N44F 4JFEB 4P05A 1N9PA 1YUHA 2EO7A 4NHCH 2Y3NA 4IRJC 2KZKA 3NCYS 1B6DA 4O02A 4U4BA 1FORL 4XPTL 5GGUB 1M6OB 4J39A 4TSBL 1AGDB 4KO5A 4Q58C 1C5BL 2OTPA 1MRFL 2YPLA 5FXCH 1IM3A 2CO2A 2QGCA 4ZD3H 4TUOA 2BVEA 4ICWA 3ZRFC 3T0AA 1W9XA 5I8CA 4K3EH 1DQJB 1YEIL 5J0BA 1A66A 4EDXB 3RUGB 4Z7WF 1NJ9A 1JGVH 5TTRA 1EJ6A 1XHHA 3OHMB 5EEYA 5E1HB 4P2RE 1HL8A 2ZWZA 3D0VB 5C0AD 3QI9C 4LLWA 2PPCA 1IAIM 1B9ZA 1X9QA 2EH7H 2OKMA 2OMUB 3PGDB 3KPSA 1DZBA 1MJUL 3B9KA 4WEUD 4M5YH 2BZCA 4AGQA 4Q9QL 5I5MA 4LL4A 1F41A 4H20L 1AGBA 6PAZA 2IO5A 8PAZA 1RKRA 3C6LD 3BQUD 4NN6C 4J3OG 4GW4A 2WYHA 1F58H 1DSYA 4U7SA 2OR9H 1FG2B 3HNVL 2WXIA 1P5UA 2WXGA 4BSWA 1G9ML 5DK0B 3AXLB 3AG2B 4OFQA 3SKJL 3ZDZF 4EBQL 2UVEA 4KJWD 5DEGA 1BPVA 2NY1D 4BK8A 5CWSB 1F97A 3V9CA 1CU4H 3D8MA 3LMJH 3VYOA 5KTEH 3LZOA 3AQZA 3MBWB 4TSAL 1CTMA 1Z9LA 1P5UC 1WFIA 2Z4QB 3HC3L 5GRJH 4A7UA 1BM3H 3KBPA 3VXUB 2Z91B 3CH1B 4NXKA 4WW2A 1KNOA 4YMPA 5IT2L 4HHGA 1NZRA 1OCWH 3IMBA 7CGTA 3DSNA 1OAQH 4J23A 4QF1B 3RWHA 5DLMH 5IMLA 1TVDA 1IQDB 1NGYB 2C5DC 2ZUSA 1FLTX 1N0XH 1U2YA 4XWOD 4K9EH 1A14L 3N6YA 1KB5H 4W6XB 4BGLA 4UIMA 3C12A 1BREA 2BDNH 3ZZLA 4R7DB 4JR9L 1EXUB 3WFEL 4PJ7A 1NCTA 1D9KD 2X9XA 2WHVA 5EU3A 3FB5A 2HT2D 5D7HA 4WHYG 2YC1A 5K39A 4WZ9A 5IHHA 3Q8AA 4P46A 3QIWB 3BZ5A 1G7PB 1SY6H 3INOA 3N1FC 3C5SB 1CTNA 2FVNA 2JSFA 5EPMA 4J6IA 3U9UA 5I2IB 1JJUA 2BHUA 2LFGA 1MXDA 4NRYA 4NKMB 2DM7A 2Q87A 5JLZB 1PZBA 2VGLM 2AK4E 3EYSL 2PO6C 3QFDB 2EDEA 5IVXF 3J2PA 1ZGLA 1G7JA 3D9AH 4BFEA 2V6HA 1J8KA 3MRRB 3PQYD 4XVTL 2VO5A 1OF2A 2Q6WA 1M7DB 5KSBF 5J3HC 4W9IC 1EEYA 2GJ6B 1ETB1 4BFIA 4X6DE 4PRBA 4MDIB 3BOVA 3RJDA 3D39A 3JUYA 1IBBA 1TOXA 3L7FA 3WDHA 2WC7A 4MAYA 2BWIA 3EFFA 2F58L 2J20A 2H2PC 1AGEA 3K6NA 3FU9A 2HT4D 4H0GA 3QPXH 3Q7JA 4UQ2B 1Z7JA 4WI7A 1C5CL 3CFCL 3H54A 3D69B 2C9RA 3Q2CA 2YBRA 2B1AL 3PWVB 2YXVA 1E42A 4MAYC 5CCHE 1S6NA 1FYTE 2FX7L 2XZCH 3RPKA 2HT3D 2APBA 5GPRA 2R69L 2NW3B 3MV9B 4LCCB 1RJYB 3G6DL 2MPAH 3MV8E 3T6QC 1HL4A 1OF0A 4HJGB 2BVPA 1T7VA 1EDHA 3MLXL 1XIWB 3WY1A 2ALWA 3MA7A 3GMPA 4LQFH 4NN7B 3BVDB 2CM6A 3V5HA 1BOGA 5C6PB 1U3ZA 5HHOB 4R4FH 3S5YA 1UADC 4PJFA 4CC4A 5G4OA 3TBWB 3HI1B 4TNGA 5CLWA 4UB0H 5I76A 3L6FB 3QORC 2LU3A 5I71B 2BIPA 1RHHA 1UWGL 1TQCC 1E9QB 3EADA 3TEWA 1W8EA 1NANH 2IBBA 3LRSA 2Y06H 2Q2EB 1QNIA 2NCMA 5EO0B 1FVEA 4Q2ZA 2Z92B 1KCSH 1HEZA 4NIYE 1YPZA 1JFQL 4LKCA 4LSTL 4HG4K 1UVQA 4GSXA 4HJSA 1CBVH 1VZHA 2YHGA 3APMA 1CS6A 3QXAA 1I4FA 2BPBA 4XPHH 3B6SA 4KWUA 3MRKA 5F7LB 2D4FA 1A6ZB 3MRIA 2WKOF 1TLKA 4LO9A 4Y8AA 3AJ7A 2PYED 2EDDA 3PABB 4L0ZA 2EZ0D 4QHNA 3SBWA 4NGHL 1DEEB 2J88H 2K7QA 4FF9A 1ZLUK 4A6YL 2A6JA 3NCMA 4PREB 3IJHA 1EZVX 1VERA 4AC2A 2CM5A 3BW9B 5F6HI 1HX0A 3EYUH 2YUVA 3LPPA 3GS7A 1RHFA 2F7OA 2WNXA 4JRYD 2BSEA 4AIEA 1ZLEA 4NQDD 2H26A 2VJ8A 1U8LA 1I1FA 3RGVA 4JN1H 1KTDA 1NCWL 4OD2B 4M1GL 4NQSA 5AVQB 2AW2A 3OXSA 1DVFC 2PW1B 3KNBB 1RV6X 1YA5A 1BIIA 1FC1A 2O5XH 1MJ7H 5AAMC 1HHGB 2YBGA 4Y4FD 5JO5A 1WJ3A 4KJYB 2ZUQC 1R3JB 2C4FT 4DKEH 3ULAB 1UCBL 4TSCL 5MI0C 2JI1A 3KXFA 4G80A 2E7BA 1AD0A 1RXLA 4AG4L 3NA4A 3D05A 4TOYL 3BAJA 4WIQA 4MMXA 2WIIB 3U2IA 4AGMA 2UYLB 1CDBA 4ZO7A 3W0WE 3AS0A 4MB1A 5I1AA 4MB3A 2Z8VC 3QWOA 5IVXA 4KKPA 3MBXL 1UJ3A 2GITB 1DVUA 3ARSA 5I1DB 2ICWA 4EJ1C 4YX2L 3OGCB 2X0WA 4JE4B 2ZCKL 4MMXC 3L9RA 1AACA 3I9GH 3U48A 4G8EB 5EZIL 1TTFA 1BAFL 1WFUA 1DP0A 4RRPA 2VLKD 2X4RA 3QEUB 3IU3A 1R19A 1F3JA 1JPFA 4NN6B 4ELKB 3F83A 3UAJD 1UJ3C 4U6YB 3V79C 5GGQH 4PTUB 1JG9A 1X4XA 4MXQD 1SJHB 4XPFH 4N2KA 4MMYA 2O6CA 3B1TA 5CM1A 5KSVA 3MLTB 4XHJD 1EUTA 1FVDA 2LE9A 2BNRE 3CVHB 5EOQL 5C0CE 1R0AH 4QRSA 1XGPA 1BV8A 1FL5A 1LD9B 3MO1A 1UTDA 1ZPUA 3CH8A 2J8OA 2IALA 4H1LB 3RB5A 3BI9X 3RTQD 1UA6H 5J1AA 5SWSD 4UI2A 4M00A 1P7QB 4ECNA 1SHSA 1DQQA 3MJ9A 4UOW0 2CRYA 4WI5A 5JDJA 1S7TB 4MMZA 3CFBA 3CNKA 4EDWH 1EFXD 3DTUB 2G4GA 4NFDA 4LQ1A 3V8CA 1AJ7L 1TZHA 4JANA 5EF2A 3BD4A 4PRHB 2CNZA 2CRMA 2JF1A 3I50L 3GMNA 5DURD 4KZEH 3G04B 2OW7A 5B1JA 5CXPA 3AS1A 5LLIC 3C60A 5IV2A 1H15B 1SLWA 1EGJH 4X5PA 4EPSA 4BZ2L 4MMZC 3P3UA 3A21A 2I69A 4CDGC 2LHAA 4A6YB 1JZ2A 1IGJA 4C57C 3I2CH 3IYLW 3QSKB 5FGCB 2H5UA 5AQ0A 1CFSB 3WEAA 2PR9A 3MVSA 1BWMA 1ORQA 1LEKB 3LHAA 3AWGA 1ASOA 3AGWA 2IFFL 4HDIB 4YLQT 1X6LA 3UYOD 2UZXA 3NJGA 4NQEB 5DC2A 2A4CA 1UATA 4LMQI 2FWLB 2HB0A 5JHLA 3VRIA 2DLFH 2EYRB 3J27A 1N6QL 4P5MA 5DC9B 4ZFGL 2XWEA 1OB0A 2IQAB 3EUUA 2GY5A 2DQCH 3KPLB 5EU5B 4LSQL 2F53D 3SCMB 1Y18B 1P2CA 1HSAB 2HFFA 5HHXH 5FYLD 5AG8A 2XDHA 1WG3A 2MNUA 3CX5K 5INDB 1RZ8B 5HYEA 3SBRA 5HYSA 4PR5A 2CO1A 3RWDA 4F24A 2FJUB 4POUB 1H5BC 4Y5XC 4HBCH 4K5MA 1ZT7B 2OZ4L 4OF5A 5GHWH 1SFDA 1P1VA 2WZPA 1PS3A 1HH9A 3EZ8A 4FXGA 1TTAA 4XMKH 1RCYA 3HZVB 3NGBC 1FA4A 1X4ZA 3D85A 4S10A 2VW6A 1NPNA 4FI6A 1OCZB 1WICA 1M7IB 1UACH 3OKEA 1Q4NX 4ZK8A 5IW6B 3MR9A 2VQ1B 3EO1A 4G59C 1WFMA 1U8KB 1L7TH 2Y1ZA 1D7DA 3DX1A 1BD2B 1HWGB 2JQZA 1A1NA 1YN6B 1T7YA 4IIQA 3PFQA 4ZSOA 1KCUL 3WIHL 3FQYA 3I9IA 4L8CA 3X17A 4L2LA 4KVNH 1L9NA 3VFNB 4HWBH 3L5XH 4ZDHB 1MFBL 3QHTC 3QORB 1QUNA 1WZAA 3GIZH 1FO0H 1XO8A 2OXHA 1FGNL 3P9MB 3X14A 4J3OH 1DBMH 2YAFA 2A77L 1DE4A 2XTJC 4U3XA 5CHNA 3WLWC 5JOFA 4MASA 2CJUL 1HOCA 3EF4A 3FUNA 4Y19E 1UJTA 3SDCA 3L3DA 3X2QB 3DJSA 1XQ4A 4PJBE 1O75A 2PKDA 2XU9A 1JNLL 1BMGA 1TVBA 5JPMC 2VDNL 4NPYB 1A6WL 3ARBB 4L8SA 3QEHB 1YN7A 5CD3B 3U6RB 3TA4D 1FLRH 1SOKA 2ERJC 2YMXH 5A7EA 2Y7NA 3N3EA 2JK5B 2G2PA 4HV8B 1IGCL 2VWEE 1CTOA 5FUOH 2A0LD 2K6WA 5D1XE 2NY3D 3F7VA 3FRUA 2QQNL 4LLDA 3V55A 4ISVA 5CSZB 1YJDL 1D5XB 4L8SC 1MOEA 4N25A 4YXLH 4I3RH 1KIRA 1OGAA 2RBLA 1XCTB 1XF4A 4M1DH 4R90L 3IEAA 2F8OA 4JFYA 3VXSD 5IQLA 4CMHC 4XVSH 4Y4HD 1GJWA 2DLGA 3NA9H 2KL6A 4QHUB 2EH8L 1F5WA 1OAUH 4P3DB 4DTGL 1JGLL 3O0RH 4H8WL 4HPOL 5CZXD 2ZUQB 5GGVY 1MAJA 2E8ZA 3T4YA 3GUFA 4J27A 1GR7A 1ACCA 4GMSH 4X5LA 4F7PB 2DQJH 3VD7A 1KBKA 2X05A 1O5DT 4N20A 1HZHH 1RERA 4RAVA 1G7MB 1DVYA 4OB5L 2ATPB 5CINH 4NX0A 6FABH 4MQ7A 1JL8A 2MIZA 4F9PA 1ZIAA 3V6ZA 4L4VA 3L16A 4HK3J 1VHPA 3EOYG 4W6YB 5F96L 3WIIH 3OL2A 1PZUB 5JHDD 5DWUL 1XR8A 1ASPA 4P59L 5G4NA 1F1GA 3QJRB 4Q4EA 2WLMA 3BUIA 1H19A 2V7NA 3SSGA 3AROA 2AABH 1DN2A 1M1XA 5IROD 1LE5A 1T1XA 4LBEA 3F12B 1W72L 4F9PC 1S7QB 1BDYA 3TN0C 4YO0B 3ZE2F 4NQCD 3FT1A 1RVFL 4IMLB 3QVAA 2Z1PA 2Y7OA 3W2DL 1H0DB 3GRWH 1NGQL 3WEOA 2PMZA 5TPWL 4PJAA 1EUUA 1OAZL 2XQBH 3LNGA 4Y1AE 2VTFA 4MBOA 4MS8D 3IAQA 1S8DB 3BAWA 2OS7A 2X2IA 3PWUB 3CN2A 5H2BA 2FWSA 4DN4L 4M7JL 4NQQA 4AKPA 3SB3A 5B8CA 4GY4A 4KQ3H 2JLLA 3PNWA 4FA6A 1MLCB 4OBSA 1OO2A 2OMTB 1HKLH 1JHKH 5J57B 4WHTA 5HJDA 1N19A 2OQJA 2JI2A 4KTGA 2CLVA 4PJXB 5H4YA 4PB9H 5I1JL 1ZT1A 3QCVH 43C9A 1XR9B 3WTSA 4FNLL 1LMKA 2YXWA 4ODSL 3WV0A 4H1LG 3O81A 4HIJB 5C7XH 4XZUA 1MNNA 2VDNB 1MCWM 1TJGL 2DMKA 5LAXB 3FNKA 2YFOA 2B20A 3ILQC 2RGSA 4UQAA 1YMMD 1MFEH 1ET7A 3N40P 1I3VA 4MXWH 4QD2E 1CLZH 4YWGL 4A7TA 3LKNA 5BVPL 1N2RA 5I8OH 5IJVB 3N42F 1N10A 2W0FB 4K0OA 4K23H 1ADQA 3CSYB 4G8FA 2H2SD 4JRXA 3SE3C 3CN4A 1F42A 2X1XR 3CFEB 2Q0ZX 4XNXL 2EIJB 4N2FA 1OHZA 4GAYA 1YNLH 2DTML 1E2WA 4EF3A 4R7XA 2YK1L 4WI2A 3BVNA 3QIUA 3B34A 4F7CB 4YFEA 3IXTA 4F8LA 1BZ9B 2GSGA 1NTDA 4YDZA 3SDDA 4ZNEA 3DUSA 1MIML 4WVRA 3BT2H 3NACH 2V9RA 3L4ZA 4NUJB 1OQXA 2EIDA 3D33A 4QRUB 1I9IH 1ZLVK 1Q0YL 2FL5B 1RULL 1MPAH 1PDKB 3SKOB 3C2SA 4J3VA 2H6PB 5F7UA 3SDDC 4PPTA 1FIEA 1QRNE 2X0UA 2R1YB 3W11C 1ZJBA 2IG2H 2VW4A 7PCYA 3VXNB 1I8IB 3MYZA 4QXGL 2UWEE 2WINA 4PV9A 2APTA 4WJ5A 2X10A 4GEIA 1QFUL 4LCVA 5E6ID 3U30C 4ALAL 4ANUA 2R23B 3APFA 1MI5A 5D4JA 3WJJA 4TYUA 2ZOLB 1J18A 1LQBC 1GAFH 3AU1B 4Y2OB 2NOYA 3NGBB 3QG6B 1ROCA 5F72S 3MV7A 5A6LA 1GY2A 2X1PA 1HH6B 1NKRA 2DYPD 4Y9CA 5EFIB 4H7VA 1HXMA 2NY5H 4HPYL 4U6VH 5C0IA 1LEGB 4NYLA 5K9QI 1VADA 3E3QE 4NBXB 4MD0A 2X4PB 3DECA 4L23A 3WJJC 4K9JA 4EZJA 2CLZA 2BRRH 3CLFH 1NLBL 4JG1L 4JX0A 5I1IL 1XGTA 3R0MA 1QQDB 4MJ4A 1KEGL 3K4AA 4EVNA 4Z0XA 4RDBA 4UTBL 3SDAD 1ES0B 3V9EA 3VSVA 3TO4C 2XN9A 3MUY1 1M53A 1CGUA 2FJGB 4HUCA 4PJEA 3G6AB 2A83A 1PZ5B 1PFCA 1U8MA 2XTJB 3EJSA 3RNQB 5KBDA 3V5DA 2P24B 3Q6FA 4IKLA 3WJMB 3WFCL 3HPJB 3IJEB 4E9LA 4PN6A 1UZ6E 2A6IA 2QSTA 4PJ5A 1A3RL 3MROA 3PWPA 4V2CB 4KTEL 4HXAH 4XP5L 2H8PA 4PFEA 3A3YB 1R3IL 1U92B 2DRUA 3CSBA 3LRLA 3O8XD 4X83A 2R2BB 3KLLA 5EG6C 4ZI8A 3CDGA 2VQ4A 2X4TB 5FCUH 5JPMB 3VI4B 3KCPA 4JFXB 4BK5C 4GQRA 1ZPLA 1X5JA 4UM8A 5T1LD 5MP6L 2X09A 1A7NH 2GK0B 4YXKL 5AVWB 3IN2A 1MF2L 4JFPA 1CFNB 2COVD 3QRBA 5HYIA 4XP9L 1K8IB 2Q9OA 4Z7OE 4BINA 4PBXA 2Z31D 3X12B 1RZGB 4DP0X 3SYOA 4TNVF 3G08A 3JV4A 3DURA 2I60L 1YECH 4X5WB 1B4LA 1SF3A 4RGND 1RFDL 4ONFH 4Y4FB 2QVFB 1GGIH 2NRDA 3II1A 3VXRE 2J8UB 4CMHB 1MLBB 5EU6B 3RI5F 3STBA 4NHUA 4LSVL 3NIDE 1YEFL 1P0SE 4TQEL 1XF2B 4G6JL 1PJ9A 3PHOA 4HUXA 3S37L 2ZZUT 2HWZL 3UTSE 3UEZA 1KBPA 3O3DB 4WU7B 3FH5A 3GBMH 5KJ4A 3VD9A 4EI0A 3UZQA 1COBA 3RL2B 4N9GA 5J89A 1B2WH 4G9DA 1OAXH 1QX1A 1TZIB 1EXGA 1TENA 4JFEE 1WO2A 4DK6A 5ESQA 4GUOA 1MHPH 4WFFE 5GGVL 2MQCA 1I82A 5D9SB 4CADB 4JQVC 1MG2C 1JK8B 4NRZA 3AQDA 1B88A 2B14A 3G9AB 3FUMA 2N56A 3KG5A 2AEPL 4YK4B 1U8IA 4PJGA 4Y5YC 3IRZA 4ODWB 1TUPA 4GRWH 4OUUB 4S0SD 2D7MA 1HCYA 2VLKB 3NP3A 4XH2A 5AW5B 3DGGA 4ODUA 8FABB 4NQXB 3PF2A 2E7MA 3BVTA 4MWFB 3RUGE 1M2OA 1E27B 4I85A 3V5KB 3ZDYF 1Q9WB 1KDIA 3SKNB 3FMGH 5EBLA 2CKBL 2XIBA 5EOCJ 2GFBB 1OLLA 4JRFA 1QHQA 3VNYA 1KJVB 4ZYKB 5F9WB 4PW9A 4S1DD 1NCCH 4G72B 3RAJH 4KK9C 3L1OL 3TT3L 2YXMA 2X9WA 3NCEB 4G9FD 2UZIL 2ZCHL 2GW5A 1WAAE 4K3DL 1S46A 5C9JA 1NCOA 1GC1C 3GT6A 3RTQB 4N6QA 4JKMA 4NZTL 2ZKYA 3BE1H 5C0JB 5I17A 4MXVE 4JKKA 4FFZL 1BX2A 4OFVA 3WOVA 2XWTB 4UT6H 1EFXB 1BFVH 4WU5A 4UIKL 2DWYA 3RDTC 3FHQA 2YAEA 4TUKH 2DOCA 3U6XA 3BWUF 4YSAA 5DURB 3EJCA 3FOMB 1EVUA 4QLWA 3W9DB 5CNHA 1GZPB 3FZUC 3K80A 3IGKA 5LHDA 1IEBA 1IL1A 1FC2D 2K6ZA 3T0EA 1XXDC 3BZFA 1WBXA 3H1ZA 3SBPA 4E9XA 5A2JH 3QQXA 1T6BX 5INCB 1XCXA 1NUNB 3EOBA 3NSDA 3K6SB 4M3JA 1BGXH 1A6TB 1E7UA 1KCKA 2VLMD 4IRZH 4JKPH 4XNUL 3H6AA 4PGJA 3MLUL 5IWLA 4ZUWA 1RPQA 4QJ4B 1FZOA 4GSRA 5DEFA 1BAWA 5IFHL 2RIKA 1I3RB 1NDTA 2E0PA 1E4WH 4P9HL 4Z78B 5I1KH 3SGKA 3HN8A 1RPKA 3VFGH 5DGRA 1B4JL 3GSNA 5E8PA 3ZKMD 1T1ZB 1EAJA 4I0CC 4Z23A 2P9RA 2VN4A 5HI5D 5JPNC 3APNA 2E59A 2XG4A 5F7AA 4GQZA 4M3HA 4M8QB 4KNSA 3RZCD 1KGWA 4LEOB 4TVUA 1M71A 3MLSL 3OXRB 1N4XL 3SGKC 1AO7B 5C70A 2F53B 4Y16D 5D70L 5E9DA 2H45A 1AQ8A 5GQBA 4R5VA 1G1OA 5FUZL 4P2QA 4GRWE 1PKQB 1WA2X 4WRLA 3WTWA 4JM4L 4LOVA 5EUKA 1DQLL 4OJFH 1DUYA 5C07B 4YHYC 5HYJD 4PRAB 5JZ7D 4U33A 4WFEE 5I5IA 4F3FB 4DN3H 5BJTA 4M48H 3B4NA 4NO0D 2XWCA 3DIVA 2RTTA 1Y0LA 2G60L 3TWCL 2UWEF 5TFSH 2VUKA 4XE0A 4WAFA 1NGXB 3U30B 5GJTH 4NO3B 3DPBB 3MCLL 3VFMB 5JIQA 2DM4A 1QOKA 4Z77A 2GJ6E 3T1FA 1R3KA 3FUJA 4RMQA 5B1BB 3WXWL 1S7WB 3BKMH 5LDSA 4NBYB 3QJUB 2WGNB 4D94A 3JV5A 1HN1A 3EAKA 2NNRA 2QLYA 3EYOB 5I6OA 3IFOA 1KFAH 1IQWL 4MRCA 2CKBB 3VFRA 1M05A 1JFHA 2QZ5A 4AMXA 3D87B 4NNPL 2VT0A 4KROD 2O5YH 1GH7A 3DOSA 3TYFA 2CR6A 2J1KA 3SQBA 1O7DE 3OKDA 1INQB 4FG4A 4LOUC 4XMXA 3GI9L 5FIEA 3TV3H 4O02H 5BRZE 1ACYL 3MV9E 3NCYP 3HN5A 1TJMA 3R4DA 3WL9B 3QUZD 2WBJA 2VNCA 3QUKA 4GKOA 2QKIB 1TVHB 3VXPB 2NY2D 2B15A 3CMOL 4K5NA 4PLJD 1L3WA 2HJKA 5E5MB 4QKXB 1UH3A 1ID2A 4GKZA 4LLUA 1L5GB 2QGBA 1UZ6F 5E99L 4ODHL 1R75A 3IDGA 3OWRA 3SQRA 3IVKA 2ITCA 3WMPA 3T4AC 1G6RH 1XGYL 4L29A 4OAWB 2H0FA 4KDTA 3SPHA 4M8VA 3U1PA 4ZS7L 1H9VA 1H6UA 3V4VH 2OMNA 1ZT4B 1Q72L 5KJRH 1OY3B 2NY3B 4JNXA 4M7LL 1CYXA 1MDTA 4RMRA 3V0JA 3X13A 1GSKA 3VVWA 5AVXB 1QZNA 2GSIA 5G55A 4TM9A 4FCAA 2HVKB 1BVLA 3LOWA 5IHUH 3FO2A 3IETB 1GJUA 2AJUL 2ZWNA 3C2AH 3H7LA 4HW6A 4XCCL 5KVEH 1GHFH 1XVSA 3WDIA 3VXSB 3NCBB 43CAB 4Z7OF 4BEIA 3F7YB 1DFBL 4OR1A 4Y4HB 4LEXL 5MERA 1DANU 2EIZB 2K70A 4FKHA 4A2GA 2V2TB 3C6SA 5A2CA 4M9OA 2L7QA 3H56A 3ETTA 2GAZB 2X6UA 3RBSA 1BHGA 5IHBA 1CGYA 3TURA 1DQVA 5LCVL 3NYKA 1ZE3C 4EN3C 3ZMEA 1FNGA 4RFEA 2CA3A 5EU7C 5EOTB 5A2FA 4HX1B 3O6FD 4UDUA 5D6CB 4G3YL 3FTZA 2JKWA 5CLXA 1M6OA 1QSFD 3ULVF 1AGDA 4OIIH 5T8IA 5JHDB 3P9LA 4BZ1L 4OZHB 4FP8L 3H0TA 2A73B 4JFVA 4ABVA 2FCBA 4PTTA 3A6CL 3R18A 1OGTA 3QCTH 2P47B 4LE8A 1DCLA 1DQJA 5DJ6B 2JH2A 4F58H 3HHRB 1PLGL 3P0YH 3QULB 1V7ML 4Y5YB 3PV7A 4N0YL 3EJUA 5J6HB 2G0KA 4NQCB 3CFMA 3D0VA 4ZTPL 4ZPTA 2WB7A 2D31B 5EEWA 4Q6IC 2GTWA 1MCDA 1C5DA 5TE4H 2APFA 1K4CB 5D72H 5C0GB 1LJMA 4QHLB 4X6FA 3EH1A 1BXVA 1MCEA 2WBXA 3OLGA 3TBYA 1G87A 3HG1A 2XZQH 1EJOL 2JJWA 3HC4H 4PUBL 1JE6A 4PRPD 1OSPH 5I1CL 4J3XA 1NBZA 2GIXA 4XPBH 3VWKD 3HE6A 2BZDA 4GH7B 1MQKH 3SQOL 5F7EH 2ZP0T 3CVDA 2CO3A 3RVVD 4YQXH 1QR1B 3UYRH 2FYVA 4H40A 2WP3T 2CG9X 4MVBD 5DZLA 4OQ1A 5K9OA 1IBHA 4XMWA 2ZPKL 4TQHA 4V1DA 4WFGD 4FG6C 4YHML 3CXDH 1K6QH 4O2FB 3U7YH 5MEQB 3HE6C 3ZR5A 4NLHA 5AW4B 3R19A 1HHKB 2Z4QA 3QIBD 2A9DA 15C8L 3KW8A 4OGYL 3RDTB 1ZXQA 5DJ8B 5J9PB 2IV8A 2Z91A 4FEMA 4FTVD 4AQ1A 1NMAH 4G6FB 4N28A 5DGQA 3VX0A 4OLXH 3ZHFA 2WYZA 4AM0B 3RZWA 5KVEE 3DO7A 5HDRA 5JIMA 1KSRA 3GMLA 1YMMB 5DC4B 3HR5B 1NGYA 2FEEI 4BH7B 4I7ZC 4QHKJ 4A2MA 3IK2A 4YGVB 3MUUA 3L5WB 4S1RL 3BGMB 1CDHA 1RK1B 1DLFH 3D06A 1AGCB 2OMVB 2X12A 2YIHA 1EXUA 3FFCD 4R7DA 4JJHA 5IHZB 1VCAA 3ZGHA 2DWDB 1FL6B 4ZFZB 2Y3AA 3IS0X 1ND0A 3ZSSA 2ZAIA 5I0DA 1SEQH 4Z3HA 1PCXA 1PF3A 4UAOC 1KCRL 2NXZD 5DD0L 2X9YA 3DV4A 1BF5A 2VDML 5JPNB 3C8DA 5J56B 5D55A 2D73A 1JF1B 1SJMA 1PZ2A 4JM2F 5FGCE 1QBML 3CSFA 5EORH 2R2CA 2DQFA 1OTUD 2RD0A 3MRHB 2JKIS 1W8OA 1MCRA 3QFDA 4LDCA 4JZNA 3DTDA 1JYWA 1EH9A 4WQOA 4LASL 1KB9J 3RKDC 2AEWA 1S9XB 1SUHA 3N50A 5DD1L 4D8PB 3RE0A 5J6GA 1SHMA 2VR7A 3I3BA 3LRHA 4GRWF 4NQEE 2OMXB 1P4BH 1R17A 3SE4A 3HAEB 4PGEB 4YHYB 2EP6A 2D7OA 2R4SH 3CFNA 4PAZA 5IW1B 1DO5A 2QQKH 1ZHNA 3MA9H 1URZA 3DMMC 1QW9A 3IDJB 4QRQA 5IVOA 1FP5A 4XN1A 3ASWA 1D2PA 4QHMB 5E2VH 1NCBL 1E50A 1AAJA 2J71A 2I9TB 3ES6A 2VLRA 1R3LA 5JDSA 4GUCA 3RB7A 5IW3A 1M42A 4JDZB 1A1MA 1YEHL 1U8HB 4U7MA 3D69A 2QQLH 4R6UA 5TQ2L 2R1XB 3Q13A 1G1YA 3BSGA 1MVUA 2FH6A 4Z95H 5CUSL 2HLAB 3DA0A 3RY6A 4LCCA 1M9SA 1IT9H 3TBVA 5KAQF 1ZANH 3AUWB 3SDAB 3I9AA 1DO6A 1XIWA 3K6DA 1KXHA 1EEUA 1HNFA 4FJYA 2YUXA 5C0BB 4RESB 4YSQA 1AHKA 5E2UH 5DHVH 5HHOA 2E46A 1YQ2A 2VXQL 3LS5L 4HKBB 2VDRL 4Z7IA 3MKKA 3TBWA 4FJZA 1BD2E 1FF5A 1ONQA 2GQHA 1JHTB 3HI1A 3HNTH 3L6FA 4UBDC 5AVSB 1N5YL 4L48A 4AQ8C 1OM9A 5E8OA 5HHNA 5JNYB 2UXTA 3O8XB 2O5ZL 4U6XA 4JL2A 5EO0A 5F97E 3MACH 2XT1B 3H8NA 4XX1E 5JHMA 1UM6L 2ZJSL 2AQTA 2C9PA 2VMDA 4UINL 2L7UA 2OXGA 3EJPA 5T3ZH 2WVTA 3UFIA 2X2JA 3T4AB 4Y4KA 1FCCA 5B38B 5I8EA 5T1LB 5L2JA 1GRWA 3PJLA 3KCWA 4G8GD 3VI3A 3U7WL 4GB9A 3SDYH 3LZNA 3EHBC 3MLRL 3EGSA 5E70A 4HOXA 2Z31B 4HP5A 3U0TB 4Q9RH 4M43H 1JZDC 4Z7VB 1IBDA 1PTZA 2WCGA 2WO2B 4PREA 4RGNB 4FZ8H 2WCSA 3ZQWA 4JKNA 5IBTL 4F8QA 1QLEH 4XC1L 4A2FA 2WMPB 3LRGA 2YMOA 4P2OD 1UWXK 5AZUA 4A1RA 3HTLX 2GJZA 2E3VA 3R06B 5IJCC 4OD2A 1YY8A 1P6AB 1Q0XH 3QJFA 4OY9A 3W81A 3QEQD 1IEAA 4YPJA 3QDME 2HTKC 1U3NA 1BXUA 3SDXB 3KNBA 3W9EA 1U8CA 3O6MH 3DX7B 4DPBX 1HHGA 4IS6A 5C1MB 3TYGH 1SQMA 3M7FB 5F1OB 3NCWA 3MJ9H 5TGBB 1HINH 5CGYC 1UWEH 2NY0C 4P23C 1FJ1B 3O3AA 4XP4H 5CEZL 4JFFD 1GGBL 2ZOTA 5FHBH 5I0VA 1SM3H 2W81C 5EOCL 2B9AA 5CD5C 3VD4A 4JB9H 3JWOL 4ZUSB 3DIFB 1HS6A 5AB1A 2VDLL 4CGTA 1V10A 4NFCA 2P5WD 5AENA 4R4BB 3TJPA 2CGZA 3V6BR 2ZYHA 3QA3B 3W39B 1JPGB 1NAKL 1I9JL 2J4WH 1NCAH 5HDQH 4I1PA 1RUQL 2DEWX 3OGCA 3SODB 3TIDB 4GG6A 1H3VA 3ARDA 1G7QA 3RU8H 2VN6A 4G8EA 4XMPL 4TNFA 3PAZA 2JFCA 3F7RA 1I9EA 5CZKA 5GRWA 4G9FB 5JW3L 2F54B 2R69A 5DZ9A 5J6SA 4ELKA 2XVLA 3BH9B 3LZQA 3N85H 2VXVL 4IOIA 5AOMA 4WNJA 1UKTA 1C9SA 2H3NB 3ARDC 4FC3E 1UOVA 3P0GB 4DK3A 4NC0B 4IDLA 4M6ML 3CZSA 4G6ML 5T3ZE 2MCMA 1A6AB 1GA2A 3F65A 2OMWB 1RUPL 1DL7L 3UZEA 1JK9B 1OAYH 4RFOH 1OP5K 1OT4A 2LAGB 4JPIB 4WLCA 5AKTA 4JGMA 1Z1WA 3GSWA 4K07A 5FK9B 3GMMB 4KAQL 1CDIA 5K9QG 5DRXB 4U6HB 4BRJA 2XWBA 3UPAA 3VO0A 4FQXA 3ZPDA 1BJ1H 3ZRCC 3MRCA 2GC7C 1JNJA 1OALA 3NIGB 1VGKB 1KLUB 4LCWA 3A6BL 4F8PA 4PRHA 5FOBB 1LYQA 1NWOA 3CZKA 5AAWA 1D6VL 1UM4H 4PRIE 5HVHC 1NGZB 4N2NA 4NKOA 3NCCB 2AC0A 4AK2A 2A3TA 1H3GA 2I9LB 4FLSA 2BXYA 3ASNB 4A6YA 4QTIH 1HEHC 1T1WB 2JTDA 4WF7A 3OAZK 4AVJA 1J0YA 3T0VA 5FO9A 2EC8A 2LR4A 2RACA 4LP5A 4N0UA 5KVFH 3OGOE 4MA7L 3ZHNA 5CGTA 3WHXA 1RZPA 1CQYA 3FTUA 1T0PB 4OM0H 2P8MB 1S3RA 4I2XB 2XZAH 4P5TD 2WXKA 4AZ8B 1WHOA 1WUNT 1PBYA 4N2CA 5EA0L 5IVZA 3RKPA 2DTSA 5HYJB 4KK8C 1MNUL 4G7VH 1I1CA 3BZEB 1P69B 4EEEA 5CJBA 1FVCB 1GS8A 4RAUB 3TA3D 1OCCB 3KPLA 3F58L 4NO0B 3O9WC 1AHWC 1JTPA 1UQSB 3SCMA 1CURA 3S9DB 5L0QC 3INUH 1I8KB 3RWGB 4PJIA 3RWIA 5INDA 3JWDL 1T83A 1CDGA 1F3DJ 2ZX8A 4R4NC 4WK2B 5K9JL 4OLVH 4QKTA 3SY0A 1JGDB 4HWEL 4ESKA 1LO5B 3MPCA 2A1WH 2C4FU 4Y0GA 2WXHA 3HZMB 2XXMB 3HZKB 3FOLB 1UZGA 2Y2YA 3HAEG 1T83C 3AG3B 3MQIA 1DUZB 1F86A 1AFVH 2EJ1A 1OE1A 1M7IA 1KTLA 3PHQA 5K33A 3TOPA 2EXYD 1FIGH 3DTXB 1U58A 3UPCA 4YDVB 3EGXA 3GPSA 4BSVB 5LXGL 1RK0B 5DDHB 2BVOA 5I1GL 1OTTC 3C5XA 3N5AA 3UABA 1R3HB 3QUZB 3V95A 5DJDB 3RVWD 2ARJA 1H6EA 1NLDH 2NY2B 2WVUA 4DW2L 2YEQA 4C4UA 4ES8A 2LU5A 5TDOB 2R8SH 3N43B 1ETJA 3MJ7A 2YJLA 4APXB 2C3VB 4NUQA 4FKEA 2Q2LA 5HHPB 4FQLH 3BX7C 2QGEA 4A67A 2FRGP 4KBPA 2P80D 2M83A 1U8QA 3L95B 5DMIH 4DO5A 1U8PA 1FBIL 2ZUTA 2XTJE 3ENEA 3CXHJ 2MEJB 4YHOL 1MREL 5KVFE 5IF0A 3VA2C 2XV2A 4WNQA 3ARBA 3SPIA 1SUJA 2X4OB 3H85A 3EHBB 2NY4D 4JY4A 3QUHA 5KW9H 2FJHA 5FA4A 2O6FA 3CG8A 3U36B 3V0WL 3ZR6A 5B38G 1XF3B 2V9QA 1C12A 2E7CA 2GBAA 3OZLA 3QZNA 1JVOA 4HJ0D 4FS0A 4HF5L 4KO7A 2MNJB 5CSZA 4JPWH 1D5XA 1TNMA 1CGSL 1LL1A 2YGNA 1CIUA 4W1TA 1YPZF 5MEOB 1VDGA 1XCTA 1ZTXE 1ORSB 5DMJB 1TSRA 3P4MA 1EHLL 4GUQA 1QAWA 1S78D 2XRAL 3RA7H 5MHSD 1A9BB 3MCKA 2ILLA 4CGUB 4R7LA 4BQBA 2ENJA 4AL8C 3ARXA 4P3DA 4P2YA 1QSFB 4PGDA 3QRFM 1D3CA 2GEEA 5A7BA 2P1YA 2XICA 3QNYA 4JJ5B 3D0AA 4KHXH 3O3UN 3QUXC 2HVBA 3LN4B 4F7PA 2J8UE 4P23B 4Z7UE 5EU6E 1U8OB 3ZVVA 3LEXB 5GJSH 3AGVA 4K94H 1OARL 1QLRB 2BVQA 2WXPA 3O6LL 1Q38A 4YDJB 1D5IH 3MRJA 4IBZA 1Q1PA 3CDYA 4B41A 1XD1A 3B83A 2ZXGA 4XXWC 1GZQB 5ITFA 4OZGA 1E4JA 5C0AA 1E0OB 3VFSB 5JUEL 2EVGA 1S9VB 1FNLA 1XCQA 1TG8A 2BNUA 3KLHD 4YEEA 2JB6A 4FERA 2OZ4A 4R96A 4ABQA 3F12A 1ADQH 5A6MA 2NY7H 3C6LA 1BQLH 4WHDA 4HEPG 3RWCB 3WO4C 3BQUA 4PRPB 5EUOA 3IDMA 4Q7DA 4Z5RB 3PPSA 5DRWB 1CGWA 2E9WA 1NBYB 4JY5H 2ZYIA 3WU1A 3ZKNC 2QVKA 3VWKB 1ECYA 4MJIB 5FYLH 1U3YA 1H0DA 5CN2A 1DYZA 1WC7B 4PB0L 3B7UX 3L45A 3UOAB 2HXAA 4XCFL 1WE5A 4OFYD 1DVZA 3TNNB 2BOCB 4G5AA 2X3AA 3MRMB 4PRDA 3RDJA 4K3GA 4LSPH 4R2GD 5D7KD 4P3CH 3WIHA 2MJWA 2VDOB 2IIJA 5E95B 2DQMA 3DX9B 2XX0A 3WUWA 5I30H 1JBJA 4YHPB 4HETA 5BQ7B 2DQGH 4QY8B 3NZSA 3Q01A 2WKLA 2HVJB 4LSRH 1IC7H 1ROWA 5L88L 1RZFH 4FXKC 2DQDL 4NFBA 2JELH 4JAMA 1CR9L 1E4KA 3BPNC 4DZ8B 4W4OC 3KH3A 3SE6A 5I1LB 5ICZA 4TVPD 5CZVL 4PJXA 5E9NA 1S5HA 4YDKL 4OV5A 1AR1C 2UX6A 4M4PA 3C8KB 2ISDA 2J2ZB 3HBPA 4B9YA 4HIJA 5DCCA 3FFCB 4AH2A 5HVHB 3KPOB 1JZ4A 1D9KA 2NR6D 2H32A 4AGNA 3IWUA 4OFKA 4OLZL 1MJ8L 1SJVA 5JORA 2E9GA 2OMYA 3O3BA 3S3DB 3KHOA 2Q76B 4H8HA 4HZ1A 35C8L 1Z5HA 2W0FA 3NT0A 4W9CC 2NXZB 2VCOA 3AS3A 4E0RB 2WNWA 3ECBB 3QXVA 5A1AA 5BVJB 3M1OA 2YKLH 5IBLD 2X2UA 3B2VL 3H42L 4ODXA 4QOKA 4GRLD 4PJ8C 1NM4A 1D6EA 4AUJA 1U21A 4LCUB 5H94B 4F7CA 5KBPA 2XKSA 5KS9A 2A9MH 1BZ9A 3NVQA 2F7IA 4J8RA 4F9LC 4LF3B 3PQYA 1DCEA 5AOKA 1SXNA 3OPZL 3F64A 1RZJH 4F80A 3SE8L 1C08B 1SVCP 5TDPB 3O9WB 1AHWB 1CFQB 5IB1B 2H6PA 3S3PA 2JJUA 1G9NL 5E2WH 1AO7E 1CIDA 2ZF9A 3CPLB 3QZLA 4U1SB 4PS4L 3VXNA 4H8WC 5FYLE 3STLB 3WTXA 2M1KA 3LQAC 2IMMA 1O0VA 3FPXA 1PKQE 2PXYC 3G6JA 5E6ZA 1AXSA 2CDGB 4N8VB 1DFXA 1KJ3H 4RCAA 4LARL 5ANMA 2MOQA 3IB4A 3PIQB 5C07E 1GS6X 1I3GH 3EJRA 2ZOLA 1IAIL 5HGAA 3AU1A 2LABA 2V7HB 5I1HH 3RFZC 4QR7A 1W72A 3VRJA 1N64L 2VZUA 3QDGD 2IJ0C 5EFIA 5JW4R 4NJ9L 2EEFA 4HU2A 1LEGA 2ADIB 2FIKB 1QTYT 4PHZA 4RGOH 2TRHA 2W65B 2FT7A 5D1ZA 4O58H 5D2NC 2KLSA 2X4PA 5CCKL 1HHHB 4ZXBD 1AY1H 5L2KD 1TYRA 3FFOA 3TPUB 2DIBA 4G5ZH 5D7JA 1MWOA 2UZPA 1XL6A 2TAAA 1TZGL 3Q44A 4URKA 1D5BB 1ES0A 2ZXDA 4KKBD 3GTVA 4ABUA 1MI5E 5D1ZC 1EAPB 1LO0L 4HGKC 4HIXL 4JGNA 4CSPA 3PJNA 4RNRA 4OZIB 2ZXWB 3B43A 1JXDA 5D7JC 1NC4B 2P24A 4YE4L 4WGWB 2F1EA 3IJEA 3EUDA 4FFYA 5D96B 3HLAB 2ADJB 4G8GB 3O6KL 4ODVH 5E2TL 2AXHA 4MNQD 5FW7A 5C0EB 2R2BA 1NFDB 2PYEA 2XV0A 1P53A 4YHNB 4HEME 1MH5A 5DO8A 3FQRB 1IJ9A 1PEZA 4ZTEA 4PJHB 4KK5C 1P6FA 4Z76A 1I7ZB 2CXGA 2N3JA 4YNYB 4AX3A 2G0LA 3HFML 4J2XA 4IRSA 5CR1A 2ZAGA 4HJ0C 4JRYA 4PCSA 1GC1H 4NQDA 1U36A 3NRFA 4P2OB 1JI1A 4RDQF 1OP9A 3U6XS 2AGJH 4QRPD 4KZ0A 4XGZB 5DT1H 2RJMA 2XJKA 4AV0A 3LYRA 3QEQB 1ZEAL 1Q1JL 4RWHA 1IIKA 4HK0B 3BCFA 4CSZA 3D0LA 4IRSC 5F6IC 3WE6A 3TBSB 5KBMA 2X2YA 4Q0XL 4R0LB 4WJG3 4FX5A 4W4NA 3D3VD 3ARWA 1HESA 1ID5I 3FQTB 4UUJB 1MLBA 5CMAB 4PBWD 5DUPH 1WCBA 5E00B 2CIKB 3QJTB 1CQKA 2VSCA 1XF2A 2IAMA 4BM7A 4LIQL 2DJMA 3GHEL 1N5AA 4JFFB 1PGRB 3VGAB 4MNGE 4UDTB 2L04A 4GAJL 3QUXB 5LXVA 1FHNA 4GBXC 1ZVHA 5JIKA 4BUHA 3TT1L 4XN4A 3I85A 2WB1A 4NPJA 4Z7UF 1Q9KA 3ZE0E 3PGCB 3LZFH 2AMUA 2P5WB 2IAMC 1HK6A 1G0YR 5T1DL 3CVIH 5EU4B 5D9SA 4OZFB 2ZOOA 1YEGL 1JK8A 2VKWA 2AJXL 1OTSD 3FQ4A 3QYNA 2R0KL 1ZIBA 2E47A 2JLPA 5JHDE 2KT6A 4A55A 5TE6H 4AEIH 3VNZA 1UM5L 5LNDA 1CICD 3ETBJ 2VLKA 1Y6KR 3ZT6A 8FABA 2W9EH 5KSUB 4MWFA 3UAJA 5JIDA 2P42B 5AKSA 3GSNH 4DAGH 2TRYA 1WFOA 4QWWC 3Q5TA 4ALAC 3QW9A 3LQZA 4NLAA 3CFQA 3D09A 2BNQD 2O1AA 3T04D 3TEUA 3E9UA 3VSTA 1CLOH 2IEPA 3I6GA 3QFJA 1EMTH 3OX8B 1O7SA 3WD5H 3QXDA 2VLJD 5DR5L 3PP3H 1XZWA 2AJSL 4UTBA 3QK0A 1U95A 3QJSB 4N1EA 3RTQA 4BBWA 5SWSA 3NRPA 1PD0A 1VGEL 4NP9A 3JTBA 3X3GL 2PWDA 4CSTA 4BK4A 2OI9B 2LOEA 5HDBB 1EFXA 3P11L 2A38A 3EJYD 4FXKB 3UCRA 2FO1A 3P77B 4I77H 4G2AA 5H35A 1NCNA 2IAND 3FUHA 4RBPK 4BFBD 5EEXA 4I87A 2EAEA 4OFPA 1TZ8A 3IDNB 1IGML 5DJZB 2CIIA 4PJAF 1ZHKB 4IEFB 4I89A 2AQ1A 1T2QL 3GTTA 4CVXB 2WBKA 5DK2B 3V0HA 1RI8A 1DQML 1SJEB 3GKZA 2IWKA 4GQPH 2B0SL 4MBRA 3P3TA 1XSOA 5CCJA 1A6TA 1AXTH 3KS0J 3LEVH 5DFAA 5DVMA 5M95B 1CT8A 3U0WH 3KGUA 3GSOB 3H7BB 3RIKA 4DPRA 2FE0A 2DWTA 4N2GA 1QSVA 1OL0A 4EAEA 4P5TB 1MHCA 1J0KA 3NEOA 2YRBA 5L7XH 3IDIB 4HZAA 4JFDD 3UTQB 1SEBA 2YD6A 4ZQTA 3VDBA 2G2RB 4PSRA 2OSLA 5DTFB 5T33L 1SF5A 2QKSA 3BIKA 2EVIA 5L4MA 2XLLA 4LEOA 3H9HB 3PHSA 3OXRA 1EZLA 3BEVB 1AKPA 2XY1A 3UAFA 4G43B 1F6AA 2GG1A 1YCSA 3ZK0A 2V2XB 4EUPB 1R9FA 1YMHA 3S6CA 3ZXAC 5L8LB 4M7KL 1NBVL 4X6EA 3MLWH 2Z7ZA 4FCHA 4RLDA 3H2PA 3E2HC 4JPVH 3SY6A 1NAMH 4M6AA 1TQSA 3C08H 3ULSA 3SGDI 4L3FA 3MRFB 4A7GA 1HILB 4KXDA 3DETC 4HWNA 4OGXL 3WFDL 5I66B 1JWUA 2ICWJ 1N3NB 3QISA 1EXHA 4NO3A 2FLBT 3DPBA 5LQBL 5IK3B 3RVTD 1A7RH 3L3IB 1ZE3H 5AFAA 1JV2B 3RFZB 1FI8C 4JO5A 12E8L 5IB2A 4S1SH 5DD6A 3H4FA 3NEEA 1G9EA 3DOHA 4N8VG 2TSAA 5D2NB 2CKBA 2R56H 3HMWH 1HSBB 4FL4C 5IOKA 1RMFH 3FQ1A 2NQDA 4L8DA 3ZDWA 3CK0H 4Q97A 3EJZD 3H9YA 4WI0B 1RAMA 2QHRH 2BS71 2D3VA 4NCDA 1F4XH 1FE8L 2ZQKA 2CMRL 2OP4H 2ZXBA 1JD9A 4ERSL 2BY3A 2QKIA 3N06B 3VXPA 1ODUA 3VMPA 2HLFD 2OJZL 3Q9PA 3NFPB 4XP1L 4FFZA 5C0BE 3UAAA 2R29H 3CDCA 5LGYA 2VL5A 1DLHB 5GZNA 1K5NA 1L5GA 3NCJL 1R5VA 2F68X 5ERWB 5IY5B 1A1OB 4XNYL 5F7MC 5FGSA 1YSOA 2NY4B 3HB3C 4JG0H 1OEZW 3TEXA 4DO6A 3OF6D 5BUPA 3RL1B 5CILL 3QEGH 5GZNC 1GOHA 3JVGC 3EBIA 3MNZB 3VXME 5L8KB 5DFVD 1S2EA 3FO0L 3H3KA 2ZUYA 3SJVD 1TYJA 2IBGA 3P69A 1F90H 2HVKA 2DM3A 4PJEF 2VRKA 4JZJC 4YBHA 3RIAK 1JZ5A 5DA4A 5T5FL 5GXBB 4ZUTB 3IPBA 1NPJA 3VXSA 43CAA 1DSFL 1L3NA 3A5VA 4Y4HA 2VE6B 2MCAA 3L3OB 5IQMA 4Z7VE 2EXSA 1T5KA 4P2RD 4M29A 1LMIA 2CJ3A 1BXAA 1G9HA 1MW0A 3AACA 4RGNE 2Y9RT 4G7SB 1P4LB 3FU7A 3TJHD 2D9CA 1CD0A 2GAZA 3TS8A 3GI8H 3K8KA 2R0LH 5EN2A 4HLZG 4YZFE 2EKSA 4QRTA 3MSPA 3X1GA 5EOTA 4ZMQA 2JVUA 2YPVL 1RZ7L 3C09B 1T0MB 4FZEH 1A6PA 1A21A 5F2FA 2OYKA 1UC6A 4Y1SA 4KXZI 2YAHA 1Z0MA 4MDJA 5BV7L 3QG7L 3MUZ1 2X4NA 3ZE0F 4LGPB 5DHXB 2AMGA 2DL2A 5DQDL 1WT5A 2AI0L 1X5AA 3LRKA 4N0RA 3X11B 4HKXA 3LKOB 4N5UA 3OZ9L 5IROA 2X4SB 2ZSVA 4L3CB 4C83B 3Q8CA 3S3CB 4RQQA 4NO2B 4L8BB 3T6WA 5IG7A 5J6HA 4NQCA 1A4KB 5C3TA 4U1HB 1F1AA 1XGQB 2D31A 2MOGA 4XXDB 4G7QB 1JPST 2FO8A 2UV3A 4OQTL 4OZFG 2IDQA 3SKUD 1GIGH 3MDJA 2WQUA 5I18L 4KX8A 4Z8FH 1HAUA 4L37B 3QWQB 4BCXA 2XBZA 1KV3A 3GMRB 3VGDA 4R2GB 3FTVA 3AMLA 5AKVA 5EBMB 4M1CD 1RU9L 3MMEA 1N8ZB 2AERT 5GGRY 3KYNB 2PW2B 5DA0B 2EDLA 3S5LB 3UTTD 2V17L 4LVHC 4PJDA 5FGRA 2PP8A 2QMKA 5I8KL 4G9FE 4KPHL 1NOFA 2A9NL 3QO0B 3J8F7 4OV6F 1RUKL 2F54E 2MQGA 2APWA 3B5GA 1P1ZB 2F6AA 5G5DB 4E5XB 2VR9A 5D7LB 3HUJA 5MEQA 1IMHC 3VA6A 1S7XB 2ALAA 2YEZB 4BQ8A 3VXTA 2OK0H 4U1LB 3S4SB 1D5MA 2VC2B 4Q14A 2LAAA 2I32A 4X0KB 3ARFD 3CZFB 2FLRT 3IS1X 5DVLA 3TZVD 2CH8A 1CK0L 1YMMA 3GIVB 5AWNH 1JCKA 3BVVA 3KMDA 4F2EA 1VSCA 2AK4D 2Q3ZA 3GJEB 4BH7A 1F00I 1LTXA 4PVMA 4E36A 2VO8A 3L5WA 2YD3A 3KL3A 3NIGE 2Q8BH 2XN2A 5IMOB 3FQNB 4M8RA 3HC0B 3LN5B 5LNGA 2XTSA 1TT6A 2A9BA 2BHYA 4BQCA 2VLME 4U1JA 1JNHB 1LWJA 3C5ZC 1S4IA 3V52L 3VXQA 4EI5D 1QKZL 4LLAA 4TUJA 2BIMA 2P8PA 4KUZL 2JIXD 1ZD6A 2C1OA 2BP8B 5CLZA 5CBEA 2RMNA 1ECZA 1SN5A 5D1QC 3HHSA 3FULA 4Z3IA 3EBGA 1JZEA 4A7VA 3UC0H 4PGBB 4LHUD 5T5NG 1M3JA 5J13C 5LCVA 3QXWA 5ILTH 1QUPA 4N2DA 5BOPA 2ZXQA 1PG7X 3MV8D 3WFZA 2DD8L 4M5TA 1YEJL 2NYYD 2PPAA 3M46A 1TCMA 4X9YA 3EBAA 4FHKA 4JFQB 4I2XE 1DQDL 5IT2H 1XH0A 2R9HC 4W70A 5C09D 3RVUC 3HAEA 4BZ1A 4OF8A 4UNUA 4KQ4L 5E6IA 4Z0BL 5IW1A 1TETH 4LCYA 3H3PL 5D5MA 1NC2A 3IDJA 1KIUB 3HNSL 3NSFA 1CD1B 1B0IA 1MUJB 2W60A 3LB6C 2I9TA 4Y5VB 4EUPG 1PG7W 2W07B 3B3IA 3BAIA 3FYEB 3QDGB 4GNKB 3TNMA 2DYPA 4JDZA 1QA9B 4QTHB 5F3HB 4ZUVA 5B22A 3F6JA 1BZEA 1HDMA 1RUMH 1WRFA 1IFGA 4N1CA 4NN5B 4ONGH 4B50A 4OF6A 1JOIA 4S1QH 3NIFE 3ZL4L 1LP9B 1ZHLA 4FNPA 5ITBH 1M56B 4ZXBB 2NX5A 4JQXA 4TTDC 5JOPE 1WEJL 5KG9B 3T77B 4HAGA 1OP3K 3HZYA 4UYPA 5IESL 4FG2A 3DHPA 4UM9A 2VDKL 1LNUA 4L9LC 5FWRA 4MCMA 1T22A 3LDBB 3V0VA 3KDMB 3B7RL 5CEXA 4JQXC 3MLYH 2BHFA 3T71A 4J3TA 3V4UL 2C4XA 4WUUB 3MYJB 3D52A 4Y9GA 4NQVB 5JW4Q 2Z35B 2VLRE 1UG9A 3JV6A 4A38A 1JHTA 4XVUC 4GUPB 4RISH 3MRBA 1PIFA 1QO3A 3WKQA 1FUNA 4UNVA 2AXFB 1GGCH 4LLQA 2WLYA 3IXAA 4GSDL 4O2CB 4HMDA 4KZDH 1LHZA 3MUHL 1NMBH 3N44B 4PBVC 4YIQB 3D25B 5ACLA 1QLFB 3OAYK 4Z3FA 1IM9B 4JO2H 1TFPA 3P1VA 4POZD 4ZOEA 5DRNB 3WNKA 2CHWA 2ORBH 1J0ZA 4QRPB 1W6WA 1REIA 3P4NB 4FFVD 5TE7H 2VDOH 3BUYA 3NTCH 3MODL 1DTUA 3D4GA 1ZS2A 4Y2DD 2XYCA 4HKZA 1ZAGA 3DVNA 3L81A 1QZ1A 3RTLA 1KPRB 3KYMB 4HS6B 5K93A 3CHQA 1L7IH 3SOBL 5IJBC 5H37G 3TJHC 3W0WD 2QDWA 4DJMA 5EB9A 4ATWA 1SBSH 3SDXA 5FF6B 2OL3L 5IIEA 2WANA 3OKOB 3Q1SH 1UGNA 1JTOA 3M45A 3DX7A 5HPMB 3TCTA 4HUVB 4OD3H 3UTZB 2VZ1A 1UXSB 4NT6A 2APSA 5D2LA 4YZFF 2XCMC 1WSST 2EDYA 4FFWD 1J12A 1KXTA 1U93B 2GYSA 5CP3A 3ZDZB 5KBLA 1MCOL 4HD9A 4WW1A 3SKMB 2BSBA 2HH0H 1DN0B 3LH9A 2QLVB 4I0PD 1FNSH 1RL1A 2BSDA 3S35L 3VWJC 1GGYA 3U4BH 4QRRB 4L1HA 5ECJE 2BNRD 4RX4A 5A2BA 4LVOB 4EZMA 5IGXH 1ZLSL 4QDGA 4CU8A 9PCYA 3MRPA 4GRMA 4LCIH 5HGHB 4K2UH 1FGVL 3CCHA 3IDUA 4HAKA 1FFOA 2YAQA 5GIRB 3MZTA 1JNNH 3IJYA 4EQ3A 3FC8A 2XWDA 2RFXA 4AW7A 4ORZC 3O11B 3UO1H 4HUUB 1R6VA 1W91A 3L9YA 2BNQB 2FEJA 3P73B 1B3JA 5CGBA 2YPKA 5IM7B 3WNLA 3JYCA 2X4QB 3DRTB 1UCTA 5AZEH 4BKLB 4MQTB 3FN0H 4KQ0A 3BH9A 3CFTA 4UQEA 4DVBA 4PRPE 4UV7H 5T1KA 4GKNA 3EGDA 3NAAH