1O9WA

F17-ag lectin domain from escherichia coli in complex with n-acetyl-glucosamine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
169
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords F17A-G FIMBRIAL ADHESIN
total genus 44
structure length 169
sequence length 176
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9wA00
3FFOA 1O9VA 2BSCA 3F64A 4K0OA 2BS8A 1ZPLA 1O9ZA 2BS71 1OIOA 3F6JA 1O9WA 2BSBA 1ZK5A
chains in the Genus database with same CATH superfamily
2K4AA 2EKSB 3BW9B 3P4NA 3WUWG 1KY6A 4XE5B 3LPWA 4Q97A 3FKUS 1BWWA 1EZLA 5GSRB 1J5IA 1U91B 3WIIL 3PWPE 1OEZW 1XZ0B 4OM1H 1EPFA 1HOCA 4LARH 1Z7JA 4QY8A 4WY7L 4BSWA 3WE6A 4PJHF 1ZGLM 5F89B 4GJTB 3ENEA 5DC2A 4P3DA 2K3HA 3ZO0A 3MLTB 2EYRA 4G8EB 1A6ZB 3HG1A 4I1NB 2VZVA 4OKVB 4G1EA 2SODB 4P9HC 3WN6A 2C3VA 4JDZA 4L3CA 4WJ5B 2H3XC 4BUHA 2CD0A 5DJDA 2D31A 1TVBB 1H3PL 5FV2A 3BP5B 5CNHA 2HVJB 1N3NB 1JHLL 2J72A 1R3LB 3CTTA 1IC7L 3TEXA 3IKCB 3BHBA 3AACA 2IQ9L 4IIQC 3US9A 3H42H 2H8PA 1YEIH 3C8KB 4UQ9A 5FW7A 1HKLL 3SDXE 1JZFA 2EDHA 4PM1A 1ECYA 4JK0D 3F6LA 5DFTA 1XB8A 3C60D 3HC3H 4DZ8A 3VXNA 5DJAB 4LPWA 3T1FB 4XN4A 1QSFA 3GMPB 2XXFA 3KR3L 1U8MB 4KOCA 4YDKL 5I6XB 1CD9B 1AAJA 1BBJA 5B7FA 4UAOB 1CDCA 4X7DC 4CMHC 1F4WH 3JTTB 4DOHE 4DQOL 4ZNCD 5LJYH 3BQUD 1CG9B 4TYUA 1AS7A 1WF5A 3C87A 4J3OD 5DXWA 1INEL 2V17H 3EFDH 5ECGA 4WFHE 1G7LA 1ODAA 1QEXA 5CUSH 1OKEA 4GO8A 4KRPC 3QC5X 3NESA 2X2UA 5D7IF 3NFSH 1X5JA 2EDEA 1WBXB 4PAZA 2A9ML 4HCRL 4AW7A 4ZMAT 2I07B 3MX0A 2XI9A 5DZ9A 3MFGB 3UJTL 2VH5L 2HLFC 2NT1A 2R4RH 2YRPA 3G5VA 2V9UA 1N59B 3BVNB 4M8UA 4YHKL 1MFDL 3QEGL 3P77B 2IG2H 2PWEA 4JKPH 4PRPA 1QYGH 5IFAH 4JN2A 1EK3A 4NQDD 4HXBL 5D4IA 1QKZL 3ZK0A 1J5OL 4AEHL 1VEMA 3CBKB 4OLWH 4XPTH 1YY8A 3UBGA 4LSSH 1TJMA 3FTVA 3A4AA 4TS6A 5I0XA 3LS5L 3AJ7A 2E9GA 3D6GA 3RVTC 2J8HA 1Y18B 1KXVC 1RY7B 3AS0A 3TO2A 1A6AB 1QRNB 5JQ6L 2NPLX 2RH0A 2H47C 1T2JA 2JELL 3ULUC 3G6JA 4OF8A 3RBSA 3LEVL 1YJDH 4O5LH 5E8PA 4X4YA 4IKIA 3MJGX 3VFTA 5CEXA 1UOWA 3BKMH 1YNKH 4MDRA 4KK9D 4DETA 2FX7H 3PWLB 4AH2B 4JGNA 4DP9X 5C1MB 3NSCA 5DRZA 5KSBF 4WW2C 3ERXA 1JG9A 4U6YA 1E9OA 3T6VA 4LGRB 3SCMB 4NZUH 5E1HB 1QEWB 4BGLA 2IH1A 3CHQA 3CVDA 3MREB 5DEJA 3TLRA 3MUHL 2ESVA 1W8EA 2XT1B 2H1PH 1O6VA 2Y7NA 3K1KC 4PGBA 3BQVA 4X4KA 4YL9A 4KZ0A 4WHTA 3HR6A 5BUGA 5IB1B 1O6TA 4YDLB 3T0EB 2VL5A 5B1JC 4GRMB 3HI5L 3VTMA 4F9PA 4KJPD 3SGEH 3EJTA 4TQ8A 3FQRB 1IGYA 3MLXL 4FLRA 4RFNB 4RGNB 5IOKA 3F65A 4GQRA 4IS6B 3TJEL 3NGBC 3MMEA 5E1AA 3GSXA 4YGAB 5GRJL 3ZDYF 4EZJA 2HP4A 1F42A 5MENE 5FGCB 3IFNH 3WJMA 1AMYA 1ETZB 4WNQA 2O61B 3D4GA 2V8MA 1KB5H 4NO0B 4QAMB 3F5WB 5F2FA 3C09B 3L1FA 1FZKA 1MLCA 2P5WB 4WUUB 2F58L 4XO3A 3B4NA 3WNOA 4UTAL 1DEEB 2VWEE 5BRZD 1MHPH 1FDLH 1N9PA 2LV4A 5DJZA 3OC8A 3L95A 4UI2A 1JERA 3D2UA 3PRZA 3ULVE 3T3PE 1H15B 4A2LA 4WWPA 4J2QA 5HYSB 3RU8L 3M88A 3NCEB 3JWOL 4JQIL 4MA1B 4X83A 5CJBA 3JWNE 5TE4L 4NHUB 3V0HA 2XXCB 3CVIL 4FMVA 1S7QB 3QFGA 4LSUH 1GGUA 2J73A 4PQXA 1MJJA 4PWFA 2E0PA 1JJUA 3HUJF 3FFCA 5AZ2H 3BVXA 1H6EA 1I3RA 4OGAD 2XQYG 4XNUH 3CLWA 3QNYA 1IGTB 5C2UB 3EBIA 4A68A 4PJFE 3MV8B 1E65A 2JJSC 2AK4E 1U21A 4H40A 4NSKB 4PJ5E 5E8OB 5EUOA 3VFRA 1WFJA 4F3FA 3HFFA 1V3KA 1SMDA 4N0RA 2APWA 5GGVY 1OWWA 3SOBL 2W91A 1BF2A 4LP8A 5AL0A 5DO8A 3C5SB 3MPCA 2BCKA 4CVUA 3D33A 4HS8H 4GAAA 1IJNA 3UTTA 2CJ3A 1I9JH 1FFNB 1PD6A 2LT9A 2R2BB 2BHUA 3UG3A 4ZTPL 5I18L 2DOCA 1DQLH 4PN6A 2IAMB 4XWOD 2Q8BH 3QUYA 2BOCB 4UM9D 4HMCA 4XRCB 8PAZA 2NY3C 2OP4L 3G08A 4TUKL 3LHAA 3FTZA 3HZ3A 1G7HA 5I1LA 4GUPB 5ENWA 5TDPA 1MSPA 4NKIH 2Y5TA 4YHLH 1TENA 5EPMA 1A6VL 4JM2A 1PAMA 1E28A 32C2A 4N2MA 4M7KH 5AZUA 5BVPL 4PBXA 1YMMD 1OZTG 5DJ2B 1CD1B 2EKSA 3BW9A 1ZLSL 2O1AA 1HHJA 2F1AA 5ADPL 1UACL 4G7YH 3CN4A 2CKBL 3EKCA 5AVYB 1F3DH 4PRAA 1DVXA 5L2KE 4KDTC 3TIEB 4ZS7H 3OKNB 2IDUA 4K2UH 1RZ8A 1J11A 3ZGIA 3OAYH 4FNTA 3LPOA 4ODWB 1IAOB 3CDYA 3IFOB 4RFEB 4U6HB 5EU5A 4Z18A 1OF2B 5C0GA 2Y06H 1NCBH 1TJGH 3E3QC 3NCFB 3HOGA 4HZAA 4PWJA 1U95B 3CXDL 4JDEA 4AQ8C 4Z3FA 4R7LA 3P30H 4FXGC 1UCTA 1NFIA 1LNUB 4NZ8A 4ZW8A 4AGOA 3A5VA 1U58A 3DARA 1WAAE 4O02H 4TNGA 5D2NE 2K7PA 4JQXA 1KEGL 5GS3A 1LEGA 1SY6L 4WHDA 1S7SB 3MYZA 5DD3L 4ZD3L 4LOVA 3L4UA 4PJCE 1HHGB 1Q9WA 3GGWA 2ZWNA 4KROB 4F33B 1OCWH 3FFCD 2GSGA 3L5XL 4ODHL 2IFFH 4OAWA 4Y4HB 2IBZY 3GDBA 5D2LF 5AOJA 3S0PA 1J5CA 4OQTH 3F7VB 5CMAB 4PTTB 2R9HD 4NOBA 3PQYD 3AQZA 4XMVA 4HS6B 1A3LH 3C8HA 3B34A 4YQXL 4JO5A 1MF2L 8FABA 5KVDH 3POHA 1C5BH 5F96H 4OZIA 2WQWA 1ED3A 2IC2A 3L3GB 1IAMA 1NJ9A 2ZWYA 2QMKA 4LL4A 4MMXC 5M95B 4JVPA 3S8FB 2CPCA 1IBYA 1MI5D 2VJ0A 2VLRE 3GXNA 1JXFA 2CK0H 4W93A 3IU3B 3BFQG 3MUY1 3RNKB 5LWYL 2Z1PA 1TTUA 1FE8H 4NQXA 4R4FL 5E2TL 4MRBA 3DKHA 4ZMNA 1WE5A 4CN1A 3LS4L 3IGUA 3D85A 3QO1B 1JF1A 3MJ8B 3Q5YA 3Q2WA 2V7NA 2WYIA 3U4BH 2AV1A 2NY7L 1MVUB 2BNQD 3EF4A 3H54A 2WTRA 2J5LB 3WHE0 3NUKA 4MAYD 2F8XC 3IE4A 3RIFK 1LK3L 2XFXB 4N2IA 4NZJA 4Q9QL 3NJLA 4WV1B 3EH1A 5C97A 1BG1A 2L8AA 3MV8E 1CGSH 2DQGL 2A6KA 3TYGL 5IFHH 5L7XL 2AI0L 4YHML 4WWKC 4PSRA 2FJFB 2QQLH 2KKQA 1USZA 2X4UB 5LAXB 5IJKC 2ARJA 4LHUG 4V1DB 5LGJB 5CP3A 4YSRA 3AG4B 5CO1A 2BC4A 4YS4A 4JRXB 1RKRA 1ES0A 5TH2A 5E9DE 2XVBA 1RZGB 3FRUB 1BVKB 3MR9B 5KG9B 3F6IA 4YXLH 4OU3A 4YFLF 5I8EA 4AQOA 4YSQA 3INUH 3I02B 3RIAF 2IH1B 4Z7AA 3I85A 4K7PX 1BAGA 4FEIA 4X4XA 4PGBB 1CBVH 3DIFB 4JBSA 5ALBL 1KBWA 1JGLL 5DT1H 4Z7NF 1LQBC 1G7PB 3L4TA 2DTMH 4XVTL 4JFQA 3BPOB 4TLTA 4WY7H 1FN4B 3HG2A 2NXYC 3MUUA 1RMFL 3S37H 2JKSA 5BVJA 4HV8B 5CLZA 3BQUB 4Z7NB 3QQ3B 1DBKL 5DURB 2VDLB 4ZZKA 1UKSA 4JREB 4AIOA 2R0LL 5LG1A 3OL2A 3LHPL 4UNVA 3CFKB 1TNNA 1KBGH 1IAII 1CDHA 5FYKU 2R69L 2X6CA 4JZNB 3RG1C 3SGJC 3T2OA 1MPAL 2XBTA 3QXVA 4TQEL 4HPHA 4G82A 4M1GH 4FG6D 1IC7H 4E36A 3K2IA 1FZMA 2JJTA 3GSRB 5KW9L 1TZIB 3JV6B 4YR6A 4XODA 2WWMC 2RQ8A 1EEQA 5C08E 1QSFD 2Y4SA 2P49B 3RHWK 1OE2A 2YN3A 2AHIA 2PNDA 2Q87A 4DZBA 5JOFA 5DUPL 5B3JE 1G1KA 3TA4D 5D1QA 1V3LA 3TN0C 1C12A 4CU6A 1NPJA 1ONQB 3PNRB 3P4OA 3KD4A 2NSQA 3LKRB 4WSJA 1EGJA 1SJHB 3OC5A 2F19L 1XR9B 3BWAA 4MXWL 2NNAA 4ONFL 4G8GA 3SE9L 4L4TE 1PL3A 1HL5A 1MCOH 3D06A 3GK8L 4FQHB 4HBQA 2Q86A 4WCYH 4LDOB 5GJSH 4NNPL 3AADB 3NDZE 2DAVA 2HRHA 2PCFA 4FXTA 3TA3A 4B97A 1MNNA 1T7XA 5SWSD 2GBTA 4MAUH 3QSKB 2YUVA 2FRGP 5IBLD 1G7IA 1SUJA 1QHQA 1PZDA 2N01B 1T0NA 3GMNB 4P4RB 3CH8A 2UY6A 2YD3A 5AG9A 1BX2A 2BLFA 5F0LB 3RTLA 4AM0A 1C5DA 2VDKB 1QI5A 3AS1A 3BUBA 4MD5A 5CD5C 4BCZA 5AUMA 2GABA 5HHQA 2AQ1A 2XV6B 4JJOA 3FUDA 4HXBH 4N0CD 1SYVB 1NMBL 4AEHH 2DIBA 1PX3A 4R2GB 1OY3B 4XPTL 1CFSA 3L3HB 1AYRA 4JCWA 2DDQL 4RFOH 4HK0B 2OSYA 3OR6B 4YBQC 4UDTA 3QRGH 3V9CA 1OZUA 3MLYL 1KJ3L 3VRLE 4JM2B 2ZD0A 4XGZB 5IFJB 2Q7YA 1NEZA 3CIQA 2XZCH 2SEBA 4RDQG 4X6DB 1EAPB 2BVTA 4XPFL 1GAFL 3Q48A 3WFEL 5CZVL 1L0QA 1PY9A 5EBMB 1JMZA 1VGKB 2VDRB 3V5KB 1NM4A 1NAKL 3S36L 1NGQL 3QAZC 1VPOH 1KZQA 3CUPB 3PWPA 1O9VA 4MA3A 4H1LA 2C1PB 3PHOB 4HISA 3ZPDA 4X7CC 3RURA 3PV6A 4NNYA 1D6EB 4PGCA 1T4WA 1WS8A 2ZONA 3PIQB 2H1PL 1KV7A 1XGPB 2H0FA 3C6EA 3CK0H 4P46C 4A7SA 3D4ZA 4K8RH 1XEDA 4N25A 1J9RA 1KNOA 4DP5X 5LVEA 1CPUA 4HEPG 4Z7IA 1DQQA 4KKCC 2A73B 2AS5M 1NANH 2WLIA 4GEIA 4XBGA 3BWUF 2NY5H 5I1EH 1IUZA 1M3JA 2QVFB 3PXLA 1U8CA 2ZIDA 1BBDH 1FVCA 3MLXH 3QUXA 4I77H 4G6MH 4X6FB 4AC4A 4IRSB 4DN4H 1FAIL 4O2EA 1ZE3H 2FEJA 3JWNC 4Q74A 2WB7A 2Z31B 1R3KB 1GZPB 1P2CA 1TYRA 1FFOA 1WEJH 4XWOC 4I1PA 2QSVA 1L5GA 5F8QC 1PZUB 4ZOBA 4NPYB 1SNRA 1F3DJ 2AW2A 1F02I 3OHXB 4DKFH 3GGWB 2ROXA 2H3NA 4F33A 5KS9E 1IKFL 3W2DL 4XMTA 5D9SB 1I8LC 3T4YB 2XVLA 3QULB 4Y16A 4JVUA 1S7WA 3UGEA 4LCYB 5AD0A 5BW7A 2VJXA 4JQIA 2ENJA 2NXZB 4K8RC 3NPSB 4JQIH 5FFLA 3B9KD 4Z7WB 1NUFA 3QWOA 4PJ9A 1ND0A 4RQQB 3HNVH 5SWSE 4F57H 4LSUL 4N87A 4XTRC 1RV6X 4N8PA 2HCZX 3X14A 1HINH 1KN4L 4OKVA 5C07E 4XXDB 3VG0L 3IM1A 4ZMLA 2KL6A 3BZ4A 3ZMEA 3S34H 4JFDD 1E40A 2I60L 4LEOB 4A2HA 2B1HH 4IQHA 2VISB 2DQUL 1RI8A 4HMDA 3F12A 5I19L 2GY7B 1B0GB 1A5FH 1UB5B 1WWBX 5EU6D 1TSRA 1XF3B 3F85A 4FQIL 1NDMB 4NQSB 2X2HA 5LKNA 2EEXA 3AU1B 5IHHA 4GOSA 1G9EA 5DSCA 1BECA 3GLDA 4ZAKD 1LLAA 2JKLA 4P23D 4WWNA 3MGAA 1GXEA 5DJ6A 3V9EA 4NQVB 5GGRB 2QHRL 5HDQH 4KUZL 4X7TB 3BGAA 4XI5D 5T1DH 2ZG2A 3NSDA 1CBJA 3G6DL 3ZHKA 4BFEA 1SM3H 3T09A 4ZFFB 1Z32X 2X6VA 3D8MA 2OV0A 4LQFH 2Y3NA 5LAXA 4XT1C 3IB4A 1GW0A 3CFMA 2K45A 5I9QB 3U0PB 2AK1H 3OV6A 1I1CA 5AKVA 2L7QA 1MRDH 3Q6FB 4P2RE 4E9WA 2AK4A 4HFUL 3ARDA 4PJ5A 5D7LB 3N44F 4UOW1 3EYQD 4DUWA 2FD6L 2UY7A 2IPUK 2OW6A 4DKEH 4I0CC 1R9FA 1X5MA 1QG3A 3RWIA 1HHKB 2BO0A 3I75B 5EEYA 2ZG1A 2R8SH 5IQMA 4FG4A 3HC2A 4M3JA 1ZLSH 2VJ8A 1EANA 4CN6A 2W59A 2W60A 1ILUA 1C16A 1LMIA 2XUWA 3ETBF 4AQAB 5ADPH 1WC7B 1U8HB 1S4IA 2FX9L 3KL0A 1FORH 1KDIA 1A14L 1FO0B 3QPQC 4L8DA 4BUQA 1U93A 3GHEH 1G6RB 4OCYL 5HVGB 1KYFA 1TNMA 5F88A 4Y4HD 3CMGA 1BM3H 3IPEA 3VQMA 3H8NA 1WGOA 4M4RA 3WY4A 4YPGA 4IMLA 4HIIA 3ABLB 3U6XA 1GCYA 1P5UB 4N9OB 3G6JB 3BKCL 2BMKA 4MAYC 4LHQB 2BVQA 3FAWA 4TXVB 4KFZC 4N2DA 4PJ9C 4DCQA 5F1IB 2R4SL 2BK8A 1NC4D 2YEVB 2P4AB 3EOTH 3WKML 2WXPA 3IDUA 1T7ZA 3AS2A 4O02L 3ZDWA 5JW4N 3KLDA 4LLYA 1KCRL 4M7JL 2PLTA 4ILDA 3RGVD 4HZLB 5JZ7D 4AC2A 3WXVL 2NRDA 2OYMA 5AW2B 4ZOEA 4LLQB 3UYRH 3DX9A 1LVEA 5T1MB 3C08H 1JGDB 1T03H 2XTJD 2WKOF 4KO9A 2K78A 5E6ZA 3ZKXC 5I66B 1OT4A 4PLKC 2CIKB 2HLFD 3OR7B 1GGCL 1TMQA 1K5WA 2Z91B 5HDWA 3T0EA 4H8UA 3CSGA 4P2QE 1DCEA 2LVEA 3PHQB 3X12B 3MCG1 2N7BA 4B60A 2I5YL 2FWOB 2VSDA 3I2CH 3B9EA 4P3CL 3EYVB 4BSVA 4XB8A 3W37A 5J12C 4KKLC 3QO0B 4Q2ZA 1ETZA 3HMXH 1MNUH 1M71B 3UAJA 1UA3A 1T0NB 4M7LT 4OJCA 4V1DE 4K7FB 4ZAKC 4QIRA 5HHMD 5T3XD 3ZRFC 5J6HA 4X9FA 2BRRH 5HHME 3HRZC 1OOWA 1QPKA 4X5PA 2DKUA 4KHTH 1P1VA 3NCXA 4U49A 4EVNB 3LD8B 3O6FA 4G59C 1JYWA 4XN1A 1JZ5A 5ACZB 4JDTL 5A7BA 2IDCA 2IDSA 1A21A 2VDMB 4EQ3A 4L29A 5GISL 3TBYA 5ISZD 3VNYA 4Q9QH 2QDVA 1Q1JL 4YZFF 1EJOH 3NCYS 4A04A 1WSST 4WFED 4DPCX 4Y2NA 3B2PA 4C8XA 1YQVH 2BY2A 2KYIA 5IW1A 3QE5A 1YPZB 5GXBB 4F7EA 1CS6A 2NY3D 4NUJB 1WDAA 4KQ4H 4PFEA 1RIHH 3FN9A 4HJ0C 4FNLH 4PG9A 4QRTA 4ZMPA 3QA3B 1NMAL 1JGVL 5E8NB 4BSWB 4KJPC 3RTQA 3R06B 4YXLL 1ID2A 1BGXH 4J6RH 4A2FA 4JGJA 1D6EA 5CN2A 5J4MA 5DUBB 3WD5L 4WKZB 3HPJB 1ORSA 3E2HC 4LT7A 4X6CA 1L7IL 3D7PA 4G8EA 3HG1B 3KYNA 3OAYK 4NUGL 5DRNB 1KCUL 1V55B 1JGLH 1ML0A 1ZRUA 5DT1L 1LD9B 4BQCA 4HUMB 3W0WB 2XY2A 4XVTH 4HEMA 3FN0H 1IZKA 4KRNA 3S37L 1JP5A 4HIEB 4GFTB 1IIKA 1P9MA 3WTXA 3N2JA 4FNPA 2X9YA 1TFPA 3TVMB 3WFZA 2Q9OA 3WLBB 2AEQH 2QSTA 3NZHL 3HN3A 4F27A 3CHRA 5DD5H 1YECL 5B7EA 4PLJC 3QCTL 4KKPA 1EBPA 2GITB 4XP5L 4JFZH 4TOYL 3QG6A 4DN3L 3IFPA 5JW4M 4JFXA 2K4WA 3T1FA 1UVQA 3CN2A 2IAMD 2QQNH 4OI9A 4Y5XC 3KYOB 1U6AH 2BZ7A 3CN1A 5D70L 2VDLH 1K8DB 1F4XH 1EIBA 5A16B 2HAZA 1DJZA 3DVGA 4A63A 1QNZL 2X4RB 3NABL 4LLDB 4KQ0A 3WY3A 4XCEB 2QADD 4Z7WA 4AV4A 4HKXB 5JO5A 4PP2A 4CU8A 4MQ7B 1RU9L 2J1KA 5FR3A 4FJYA 4DP4X 1CDYA 7CGTA 3IDMA 3MOAH 4LK4A 5HVFB 3V0WL 4AMXA 3DDFA 4NQDB 5JHDA 3VE0A 3V5DA 4OJDH 2F19H 1ZDQA 2R1WB 2E9JA 4X9YA 3GSVA 4CGUB 3PFUA 4FQJH 1MCOL 3UO1H 3DTUB 3P77A 3PWNA 2J1WA 1FPTH 4IMKA 4JM2D 3HCVB 4Z7QB 5IW6B 3SE4A 4NNPH 5CAYB 1QX1A 4AYMC 4AZUA 5F7KC 1UYWH 2AERT 1JRHH 3ABKB 4NRZB 3HG5A 4JPWL 5IVNA 5TDNA 3VSUA 4J3WA 3AREC 1JVKA 4WW2A 4HJ1A 4K23H 2HLAB 5TTRA 2OMYA 2VDRL 3LKSA 3PDOA 4ZUTB 2EP6A 3QH3B 2Z7WA 3WS6A 3VFVA 4F7TA 5JORB 1S78C 2OXHB 4KXCA 1I3VA 2G2NA 3HE7A 3IDIA 4ZFOL 1JZ8A 1T22A 5M7QA 4I2XB 1ROCA 4IOFD 4EAEA 5G2NA 2Y9RT 2ITDB 1QSED 4WTZG 2DDQH 3ZR5A 2JCCF 2YA0A 1XAUA 1IBBA 4FXKC 4JZJC 1DR9A 5IHBA 2WNWA 1HHIB 3VNZA 3HI6H 4O4YL 3MLYH 1KJ3H 1DL7H 3SODB 2UWEA 2ZWKA 3TJPA 3MA9L 4RMTA 2XLLA 2W0FB 2YSSA 2QV2A 2VM9A 3UTQA 1GYAA 1A8JH 3APCA 1E4WH 1TVHB 2XKSA 3MBEA 4JCMA 4JO4H 4Y0GA 1OGAA 3U7AA 4OGAC 1AHWC 3P4MA 4OBSA 4S1SH 4PJ7F 5EC2B 4F92B 1PU0A 2C9PA 3EDFA 3QXTA 1MLBB 4OFYD 2WJ7A 4JCLA 2OMUA 4R5TA 5T3XE 2YFNA 4Y4FD 2HWZL 4U4IA 3STZA 1U3HC 2ZUSA 3T0VA 4K3EL 4UTBA 1HZLA 1AXIB 4CNIB 4WSGA 4MQXD 2CO7A 4YSSA 2AJYH 1P84J 3M17A 3IU4H 1PZCA 3NPSC 3RKPA 3L3IA 4A2EA 3QXAB 2YR3A 2LLLA 1EDHA 3AZUA 2XPGB 4DCQB 4LLUB 1G6RL 3T4AA 2AC0A 1VFOA 4B9IA 3KNBB 5T1LD 3TT3L 2BDNH 4NQEE 3LX9A 3N42F 2D7TL 1LO5B 2BXYA 4MDIA 2X41A 3JWDH 3OG4B 5EUKB 3L4ZA 5KJ7E 2IH9A 2E7BA 3QIUB 1BDYA 5J3HC 2NY3B 3CFBA 4URKA 4FG6C 3BO8B 1S7QA 2VC2L 4DKFL 2LVCA 2HFFB 2EDJA 4G1MB 3LQZB 2DQJH 1CB4A 1T6VN 1ZTXH 4JRYA 3MRMA 3SGEI 4M7LH 4F8PA 5FYJU 1MXGA 5F3BA 1ZVSA 3WMQA 3VXRE 3SOTA 1JN6B 2HT2C 3W9DB 1FUNA 3ZE1B 1YMHB 4AZ8B 2FWOA 3RDTB 2IQ9H 5INCB 1DBBL 5G5DB 1WZ1H 3ARBA 1QFPA 3P69A 4OCWL 2ADYA 4Z78B 1D2OA 1RP9A 4CSZA 4FYSA 4M56A 1KENH 1FFRA 3BWZA 4OCMC 2EXWD 3VXSA 1MFBH 2UV3A 3C5SA 3QDAA 4H88L 3S34L 3UOAB 4B95C 5D8JL 3MLRL 1OTUD 1ET7A 3TV8A 2OJEA 2IDTA 5DRXA 3AXLB 4XCYB 5I19H 1FLRH 1OM3L 5KVDE 1V7ML 2R56H 4ANXA 4OLZH 3WN5B 1RQ5A 4P23A 3RZWA 1M7DB 3CDGB 4Y5VA 3CVHL 1VHPA 4NUPA 3D07A 1EBAA 4HG4K 4P2OD 1KTLA 4OSUH 3VXMD 5LDSA 1WHPA 1K5NA 3MO1B 4FQQA 4XZ4A 3GXTA 3Q2VA 3NZUA 2XN0A 5C0BE 4TSCH 4N90D 1AZNA 1Z9SA 2IXQB 1CVSC 1P1ZB 4XVUC 1BD2D 1E9QB 5EIIG 2OTWB 2CKBA 3KPRD 1FIEA 3FB8B 4QCIA 4KTYA 1T0MB 4AIEA 5HYSA 4OLXH 3LIUA 1RZJL 3WTYA 5FDWB 1J1PL 2XYBA 4YBLC 4GBXA 5D1XB 2FYYB 3U36A 2OZ4L 4IKLA 1SYSA 4WAFA 3V8OA 1S3KL 3BPCA 3M8OL 4GUOA 3TA3B 3D2TA 4RMQA 1XSKA 3RTQB 1DVUA 2UUDH 4KUCD 2Q0ZX 3L3DB 3NK4A 4JHVA 2Z9TA 4OZHF 2IWGA 4ODWA 3IJSB 4PRIE 4XNYH 4AIXA 5B3SB 1IRAY 3S2CA 3GYRA 4PHXA 4WF7A 1UWEH 1E3FA 3ARQA 1MWAB 2BNRA 3DBXB 3PP4H 2G75B 1DQMH 1U9KA 2GEEA 2V7HA 2PW2A 4GXUM 1EXGA 2N0MA 1MFCH 2PTTB 5C9KA 1U8OB 1YJDL 1CFTB 4MYPA 1A14H 3MUZ1 3S4SA 3WLWC 1U8JA 5IB5B 4ZTOL 1IGCL 1G9NL 3GHEL 5IR1A 1GSMA 2YPLA 5SWZA 3FCUB 4OCYH 2RR3A 3P02A 4YDJA 4AGNA 3QIBA 2ROYA 1BM3L 5C9JB 2DWYA 2DJMA 5D72H 4RISL 2UZIH 3DHJA 4YSUA 4F5CE 1KXTB 1FG2A 2UX6A 2JKNA 4O2CB 4A7TA 2CZNA 2EACA 4TPRL 4WNSA 2UZXB 4Z76B 4P59L 4ZMYA 4JO8A 3ZTCC 4JFXB 1SMAA 3D39A 1LGVA 4R2GD 1JK9A 1BM7A 3ISWA 5E7BA 4HIQA 2GJ6A 2UUDK 5A2IH 5GSRA 4BH8B 5TE6H 1RJZB 1XZ0A 3GJEA 2XC8A 3HB3D 1N0XH 4LLDA 1TTCA 2PO6C 5I17A 2Y5TB 3QBTB 3G5XB 4JMNA 3KS0H 5E5LA 3ULVL 1MCNA 2E74C 4PJAF 4TVPD 1HN1A 1T03L 2A74B 2VR5A 3FFCE 4FZ8L 4ACTA 4IOSA 4YX2L 2VLME 3DUSB 4J6IA 5D1QD 3F3HA 5LUMA 1KB5L 4FHKA 2YA2A 4JFFD 1EERB 4PBDA 5C0EB 2BNQB 3AGVA 4LSVH 4ZX3A 4UTAH 1EX0A 3KGSA 1LDSA 4KVNH 3WTTA 4W9DC 3UP6A 4IYKA 5D1XD 3HG1E 2YXVA 2W5PA 1QFUL 1PLGL 3RU8H 5E56A 1BVNT 2CLVA 3HMXL 3ZDZF 3UTOA 2V9RA 4TUOA 2E59A 3FT3B 1BD2E 5B3JF 4OFVA 2V9QA 4AUJA 4LLWA 1X5LA 1QUPA 5DZLA 3W11D 3T4YA 3VG9B 5DUML 3U2JA 2EUZA 3WIFB 1I1AA 3FQTA 1HI6B 3FRPB 4W6XB 4GS7C 4NAMA 3N04A 4KHXL 3ESVF 3O6KL 1BEYH 3MV7B 4U2YA 3AG1B 1WA0X 3B2XA 5FFGA 2BNUB 2RTTA 4JDTH 4OCSL 2ZCLL 3PDGA 4E2OA 4LMQE 4RRPA 2OQJB 5ERWB 2X4SA 4QHUB 3TWYA 3VXQB 3ZL4H 4XI5C 1NH6A 3WFDL 1T7VA 3UEZA 3QZPA 4HGWA 2ICCA 3N1FC 1YQVL 3P0VH 2XXMB 2ICES 3QNZA 5JQIB 4UIKL 2ED7A 3R1GL 2EDDA 2DWEA 4KQ4L 2RMNA 4UOW0 5DQJA 1X3DA 4FNLL 4PIBA 1K8IA 5F93C 4QRRB 3BZFB 3WTVA 3Q01A 2JJTC 1OP5H 5CIPA 4RGNE 2OYPA 1G43A 2BXZA 2EIKB 4ZTEA 2NR6A 4X8JA 3NEOA 4JM2C 2WIMA 3HZMA 3SPCA 3QIWC 5A43C 3N91A 4TUKH 1ZLVH 2WXRA 1SJMA 3DOSA 3GSNB 4Y1AE 1L3NA 1R5VB 1KCUH 4GPVA 4PV8B 1G7MA 2HH0H 2NY6D 3PS6A 3MKGA 1F97A 2AABL 3MJ8A 1F3JB 1U8IB 3ABGA 4LVOB 3QNXB 3BPOC 2WUBL 3TV3L 2VB5A 4KJQC 4MGXA 1VADB 5HGHA 4RAVA 4PRIB 4YHPB 4WLCA 3UZQA 5CGMA 2Z7ZA 2M26A 4X8CA 1A65A 5IMLB 5IWLC 2XFXA 4K2UL 3RIKA 5DD5L 4XBEL 5JXED 1E9OB 4DZBB 1EZVX 4HAFA 5D4QA 2DYPB 4C58B 4QYAA 3LRHA 3GSUB 4FJZA 5TPWL 3ARFC 4Z7QE 5FDYA 4AVKA 1GGBH 2ZF9A 5H35A 2EYTA 5D70H 2VDLL 3B2UC 4UM8B 3TF7C 2F6AA 4FYTA 3KDMB 3HUJA 2W38A 5IB1A 1IM9A 1QNZH 4QXWA 1R3JA 3MJ9A 5GGUA 1CL7L 3KWTA 3ZRCC 4OT1H 2Y7MA 4DGIL 5CBAB 3V6OA 4G7VH 5F9OL 5HYJE 5IV2B 5F88B 3SKMA 3VSVA 1WFIA 4HLJA 5KYNA 1RU9H 4FQXC 1NCWH 1PKQB 5K33A 3MOAL 3CG8A 4KKAC 4ELKB 1SY6H 1XB6A 1OD9A 4N6RA 3QCVH 1U3HD 1YYML 4NI3A 5D7KE 1ZT1A 1GY2A 5LBVA 4JFQB 4MQXC 5KS9F 1E6JH 2WIIA 3DK2A 5HD8D 2CIIA 5ESAA 5E00A 1TUPA 2DQIL 2VLJA 3TX4A 3WN5A 4NM8H 3RVTD 2LAAA 1XX9C 4OQTL 2A9DA 1HXYB 1PVHA 5GS0H 3F7YB 4RAUB 1H8SA 2C9AA 1UJ3B 1YC7A 1EUTA 4XNXH 4YQXH 5J5EA 2KUTA 4HXAL 2D0GA 1B3JA 5SX4H 1UD5A 5FUCE 2BVUA 5MEOA 1GGYA 2WUCH 5I66A 1ZEAL 2CGYA 1PD0A 4HC1H 2FR4A 3U4AA 3NFNB 4ZOCA 2Q7YB 3QJRB 1P7BA 5IFHL 2LLGA 4R4FH 5KN5A 2PYEB 1C1EL 2C3HA 3CFCL 5ID1B 1BP3B 3W3BA 5ALCL 1F6LL 3QPKA 4GW5B 4PJFB 3PYCA 4Y9GA 5T1KD 2YQBA 2GB2A 1AQDA 5E8OA 1ACZA 3CSYA 3HC4H 3VCLB 3ARGB 2J71A 2HT3C 2E7DA 4W9KC 2X9ZA 2GTWB 1A7QH 4IRJA 1DL7L 4ADJA 1KGCD 4KNSA 2A4ZA 2XVKA 5IQ7H 5CCHE 5AAMA 2C9XA 1B4TA 2P46B 1S5IL 4P46A 4R0LB 2YPKB 4MFHA 2ZXEB 1IGIL 3EGDB 5FB8A 2YD1A 4F5CA 1TQTA 4M48H 4F1SA 4YXHL 1U3ZA 1QO3A 1UC6A 4R3SA 4Y16C 5DMIH 1KJVA 1W2KT 4U3XA 2VXUH 5D96B 5A2CA 1MCPL 4M8QB 5EORH 5DJYA 3SGDH 4V11A 3CZNA 1AVAA 2GJ6E 2RGSA 1ZSDB 2R29L 3G08B 4NJ9L 3V0AC 1Q72H 2BFVH 1IEBB 3IU4L 4M5ZL 5T1JA 5IB3A 1TF4A 1YUHA 1PD1A 3Q1SL 2YS4A 5HHQB 3GJFH 5IMOB 2DIEA 2B2XH 1G6RH 3DXAD 5EEXA 2ZXBA 1EZSA 1CBVL 3MNVB 2XJLA 4PJGB 3ZE0E 5HVWA 3TT3H 3OR6A 3GPEA 5DMYA 4CSTA 4DEPB 3Q2LA 3UTZA 1CLOH 3ZQXA 5TF0A 1AOHA 5T5NF 3SY0A 3I3EA 3VXPA 4AYFA 1EFXA 5D1QE 5F3HA 1O7DC 5TDOA 1LEIA 4IK6A 3H0TB 2DQJL 2HJFA 1ZTXL 2AEOA 2B59B 3C5ZD 4Y2LA 3LHPH 2VW4A 2WZ5A 4M7LL 2BRQA 4ECNA 4GYBA 1BZ8A 4G8AC 4EEEA 1WISA 1QBMH 4LU5L 3TM6A 5CP7A 3R7QA 5HYQA 4XPHH 1I7ZB 4U1HB 3CVHA 1DFXA 4IK7A 4M1GL 4QOKB 3SDDC 2VR7A 4GSDH 4PGCB 1A1NB 5E9AA 3HHRB 3PY9A 3TONA 1URLA 1DBBH 3DV6B 1ZGLB 3KM1A 1R3HA 4H8VA 1YAIA 5C8JA 4Y9FA 1LEGB 2MH4A 3IGLA 3G9AB 3VACA 5E99L 4BWWA 1KENL 3TEYA 3WTUA 4KJWD 2A73A 3ZY7A 5D8JH 4YE4H 1ACYH 5D1XE 3WHXA 1FL5B 4X99A 4AI7A 4IBQA 3Q9PA 4UU9B 4N2BA 4OIIL 3UPRA 3JYCA 3FUJA 5C09E 3IEAA 2ZPKL 5LCVA 5DI8B 4LRNL 4M1CD 1OCRB 2WWNA 3PAZA 3QR0A 1F4YL 4FI6A 4EZKA 5FYKL 1R3KA 3DJSA 3CVHH 2O93L 4UIMA 2F9BT 4XPAH 3SE9H 1BW8A 3GK8H 5HY9B 1FL3B 1XGUA 2V0AA 4U6XA 4YDLC 1I8MB 2CM5A 1XT5A 4TSCL 2WQVA 1S9WA 1MUJA 2FGZA 2VDQH 3MRCB 1DVFA 3L81A 1U8LB 1G0YR 1W91A 3VXUD 4RNRA 4JM4H 4PEEA 4PJFF 4MMYB 4OFQA 2YAPA 4BELD 4PJIE 1DQDH 3LZFH 4LLMA 5DEFB 1AZVA 3QAQA 1QAWA 3HE6A 4NQXB 3GM8A 3G5YB 3NIFF 2QSCH 5FM4A 1TJHH 1HOCB 4QY8B 3VUAA 3ZE2E 4LOUD 3IN2A 3MNWA 3WEXB 1E8ZA 4MVBD 1QA9B 3Q7JA 1Q9KB 3BESR 2MPVA 1KYOJ 2AV1B 1SHXA 1G6RA 3DROB 3MV9B 4AYID 2VXQH 4AENB 3ILQC 4XNYL 2F53B 3QRGL 2OMYB 1E5UI 3ZRSA 4CBPA 2DMKA 1JPTL 5EC1A 1BJ1J 4ORGB 1SVBA 1UWEL 3PP4L 5FF6B 3ZQ9A 4L3EE 2H2PC 1N5AB 3H9ZA 2XZCL 1IGCH 4BFNA 3UBXI 1OAKH 2C9SA 3RP1A 5I71C 4IIZA 4IGBD 2JB6A 5JLZB 1EVTC 1KYOK 5D7HA 3CX5K 3HUJE 1G4RA 3VFSB 4MWFA 2B08A 2EDRA 1DYZA 2UZIL 4FLHA 4AEIH 1QZNA 2F54A 2EE9A 2QADC 2E86A 3HBZA 1J8HB 4K94C 2UWEB 1BF5A 4ABWA 2GJZA 2G5BA 4NN7C 2XG4B 4W4OA 1IQWH 2FEDC 4MMZA 1NGYB 2XSKA 1E6OH 4LRIC 2WLKA 1Y1UA 3CD4A 4AGPA 1WAEA 2Y0SA 2IH8A 2VN7A 2VR4A 3FO2B 4HUXA 3Q6FA 5J3HD 1JPEA 4I8DA 4AV0A 4Z5RB 4LF3A 3I9GL 1A7BA 5BVJB 4PCYA 4HV8A 1CZ8L 2VLJE 3CZGA 1QEWA 3UBXG 4DK6A 4CSSA 3UC0H 2Q3AA 2YD2A 2VE6A 1QFWM 1CICC 2C5DC 4KVPA 4PRBB 1L9QA 1N0LB 2VLRB 3WCYA 4QHPA 3FUMA 4EZMA 1RCYA 1Z5HA 4I9XA 2GK0B 2MCPL 1HH9B 1HX0A 2W0KA 4TVPH 3NVQA 1Q38A 1XGYH 3VWJD 4GP5B 4I1RA 1R6VA 2NLJB 1MCFA 5GRUH 4CJ1A 2AZAA 3Q9QA 2W92A 3T0WA 2AVGA 4JEGB 3TZVB 4ZAKA 3DSNB 4PJCF 2MTAA 1DP0A 4GW1B 1HS6A 2P8LB 4YC2B 3RE0A 2PWGA 3SKOB 5E6SB 2YRBA 3K2MC 3L9EA 4BWTA 2F5BL 3EDKA 4FQCH 4WFGE 2I24N 3CLFL 4XO4A 1M4KA 4QR7A 2WCGA 1LO3H 3LYRA 2J2ZB 1VFAB 4KRPD 1J12A 1ZT4B 2AF2A 4FYQA 3P4OB 3BRFA 3D39D 4GFXA 4R90H 1THCA 1AOZA 3UCQA 3G04A 3Q44A 5DGRA 5KJRH 2Z31C 2EUXA 3O6KH 4E41D 4J23A 1AZCA 1YEGL 2VXSL 3KGRA 3N1QC 3NJVA 4G6AD 4XH2A 3V0FA 3RPIA 1LP9B 3B2VL 4H8WL 3F6JA 3CZFA 3GBNL 1A5FL 1H6UA 4GIAA 4PG9B 4PY7A 3M45A 4QRTB 1X5YA 3QA3A 2ZAHA 4LSTL 3G6AB 4PW3A 3SCMA 3A67H 4A1RA 5G5DA 3BGFC 4G7RB 3FCTB 2P5EB 4B3EA 1WBYA 4AXWA 5IVXF 5JNYA 1USQA 4X0NA 2VL4A 1F1DA 3QQXA 3BVVA 1JPSL 2ISDA 4I9WD 2CHXA 3FZUD 3B6SB 3DX8B 1X5ZA 3GMNA 3HMWH 3LIZH 4P4RA 4WHTB 1UB6B 1A3RL 3R1GH 4I0KA 5AAMC 3VW3H 2QVIA 1JXKA 4RMWA 5BV7L 2AJUH 2FB4H 5E6IC 4N8VA 5C7XH 1LO2H 1SM3L 1SYVA 4C4KT 4IS6A 4DWHA 2B3IA 5I1JL 1HCVA 2DQ6A 2P24A 4MMZC 5EO1A 5ICYB 1O7VA 3JVFC 4MS8C 5IEHB 3CC5B 4KMTL 3KWUA 4GQ9H 3RZCA 2AK1L 5D7JC 2E6QA 1WGVA 1MCQA 1U41A 2A6DB 2YQ3A 4WUKH 2ZKHH 5EG6C 1Z9SB 2VKWA 3ZSTA 2DQTH 3OKEB 5D2LB 2A6IB 3KPLB 2HH0L 4QRFA 5HHNB 4OV5A 1QTYT 1BAFH 3QG6B 3MGOB 4K9EH 3T8XA 3DHUA 2R8SL 4L8SB 4MYWB 1H9DA 3OJ2C 4K3DH 2VRAA 4P07A 5C0IA 2WM0A 4E41A 3U6XS 1QZ1A 2HPOA 3FB7B 2FX9H 4H5SB 5AOMA 5F7YC 3U82B 4HOXA 5BCAA 2JMRA 1SF3A 2QQQA 2R0KL 4GUPA 1CD0A 1HNGA 2PYFA 1J8RA 4EKJA 3FU8A 1DSFH 1NDGB 2O5ZH 3HZYB 3D0AA 1X9QA 2DMGA 4BKSC 3K0WA 5IW3A 4HJGA 5IOPB 1GGBL 4QAWA 2O6CA 2VKXA 2BIPA 2IPTL 4N0YH 1QSEE 4PGDB 1WHOA 5A2JH 4YH6A 2CALA 1U8OA 1CL7H 1H5BA 3T08A 4DGIH 5B8CB 2O5YL 2QVKA 3SDDA 5TGBB 5EUOB 3WO4B 3EOTL 2NUTB 3WKMH 2JJUA 4KQ3L 1IAOA 3IFOA 4I0PD 2XV0A 2ATPB 4NKMA 2ZUQC 3IMRA 4KRMB 1BCIA 2B0SL 2FSEA 2N1TE 4P2OC 4WSKA 5FUOH 1KTDA 3ARVA 1JZJA 1YYMH 2ZX6A 3HAEG 3U1SH 3CFDB 4PJXB 3AUVA 4YDIH 4IOIB 3ZHNA 1WZAA 3C08L 5BV7B 4ABVA 4XP1H 4ZG1A 4JL1A 4OCNC 4EI5A 3WS3A 1Q0XH 1AD0B 2LOEA 2ZOWA 1T22B 3MGTB 1JV5B 3S5LG 3UADA 5FC9A 3VAEA 4WO4D 4POZD 3MRBA 2B5IB 7FABL 1KFAL 3EOYG 3CV5A 3KYMA 1WH0A 3H3PL 4KI5E 2EXSA 2P8PA 4NGHL 4F7PB 2YD6A 2H6OA 1Q9WB 2G9KA 4G9DA 5F7DA 4DKAA 2WUCL 5FFOA 3RX8A 2WN2A 3FH7A 4BYHA 3MQIA 1UT1A 1ZEAH 3H9SA 4LSRH 4OAWB 1FO0H 2ITCA 5JHBA 1XF2B 2X4RA 3WDJA 2MNWA 1DFBH 1T21B 3L3OA 4NERA 2AJXL 4ENED 4NC0B 2X6BA 2Y1YA 4GNKB 1R24A 4IIQA 4JY5H 3MA7B 1B0WA 5B4MC 5JPMB 1J5HA 2Y1VA 4H20L 5EC2A 3TBSB 3QDJA 3MRPA 1HNFA 3B7UX 1DTUA 1E2VA 2F7OA 3S35X 1CCZA 1HAUA 2CLVB 4JPKH 1SJEB 5ACMA 1NC2D 4P99A 1NEZG 3PHAA 2EVHA 5FO2A 1ZA3B 4MB1A 5J13C 5GISH 3KPTA 2QKIA 2O30A 3UTSD 4Q6IC 5GGRA 2Q8AH 3ZN6A 4Z77B 4M48L 5FF6A 2WKGA 2R1YB 5IF0A 2GSIA 4HEME 4JZOB 3HW7A 1EV2E 5G4MA 3T71A 3A23A 3RUGF 3A6BH 2ZP0T 4XO9A 4APXA 1WUNT 2HFTA 1MHEB 1J05B 5DMIL 1UXSB 3LSOB 2RCSL 2WLNA 3SO3C 1MCPH 2HJLB 5EORL 3UBXA 5KYYA 1RIHL 2BIOA 3EH3B 1I3UA 2XBDA 2H6PB 3I3BA 1NMAH 1OD7A 1S9XA 3MCYA 4C57C 1VDGA 2LTQC 3ETSA 3KPPA 1BZ7B 1ET5A 2GUYA 5FM5O 2VZUA 3SJVA 1JZ6A 3ATFA 1BXAA 1JHKH 3F2LA 4P5TA 3Q1SH 2GSGB 12E8L 1AIFA 4JFEB 5EBGA 3BH4A 4NKOB 5BXFB 3BLPX 1I82A 2HFEB 4PU2A 2AKRB 2QV4A 3QDGB 1IGJA 1WC7A 2X4PB 5KSUB 1P4BH 4CADB 4OLVH 2ADGB 4CRPA 5F9WC 4QHMA 3RWEA 1AGEA 4AOFA 3ILPB 3GXMA 4JRYD 1DN2A 1D9KB 2WBWB 5G4OA 2ZAIA 3HZMB 4FQLH 1MQKH 2EDQA 1F11B 2ENQA 3IJHA 3MOQA 5ANMA 4AYGA 4NOFA 5INCA 3BCFA 4GRLD 4KXZI 1MY5A 3D30A 4UQBA 4Q9RH 2ZNWA 2DTSA 3DJRA 4QRRD 5CJOH 3GMQA 1I8IB 4OTXH 1NSNL 4OIBA 1KC5H 4FFYL 1MAML 1L7TL 1TQWA 3WNMA 2NSXA 2BOBB 4CGTA 4KKAD 1FBIL 1PF3A 5SWSB 1QSEA 2BZDA 4RCAA 5DZAA 1NC2B 4Y9EA 3B9KB 4R7DA 3GLZA 1L9MA 5C0ND 3VI3B 4P9ML 2BJML 4WW1B 4Y5VC 4I85A 3BKYH 1CLZH 3L2NA 5JW3L 1HIMH 2WLYA 4NN7B 4YIQB 5FXCH 4RX4D 3L3KB 3T4AB 3BVWA 2IGFL 3O4LB 4DPRA 3OAZK 2W0PA 1OHQA 3HUJB 4IGBA 2FJHB 2WZPA 4J8RA 2J1YA 2PN5A 2C7UA 5AVRB 2F53D 5AW1B 3RVUD 4A7GF 4WK0B 4ZUWB 3QIWA 2BC4B 2F8IA 2YZ8A 4OFYA 2WXNA 4TRPH 1PTZA 1LEKB 2NDGA 3CZFB 2ITFA 2DYPD 4Y5YB 1KJ2A 2O6PA 3QIBC 5L2JA 1N7MH 1A4AA 3S8WA 1M3IA 5C3IA 3NSYA 1RK1A 4ANKA 1VCBC 3BAKA 3DX7B 5FM5M 4WZ9A 1ZHKB 4NFCA 2OTPA 4P5MA 1VACA 3D3VB 5EUOF 2QSCL 1JN6A 4DVRL 4C47A 1KXQA 3BLKA 2DBLH 2G75A 2KC0A 4F9LC 3PL6A 2WXQA 3EYOA 3FONA 1KG0B 5F97E 4LXFA 1YNTF 2J20A 4MRCA 4FTVD 3SKNB 4LASL 3ARBB 3K6DA 1A4JA 2FECI 1JTPA 4ZI8A 3AUWB 1NLBH 3GBEA 3VX0A 3M6DA 4H1LG 3L4XA 3TBYB 3V7AE 4BZ1A 3HI6L 3ARZA 2CJUH 4OJAA 1NPNA 1MIML 5D5MB 5DU7A 2GTZA 3PGFH 2CLRB 3X11A 1ZV2A 2F5AL 5FYLD 3VWKA 2PPFA 1E4WL 5IW1B 3H55A 3D39B 2ADIB 4M62L 4P4KC 1JK9B 4LGPB 5DQDH 2VDKH 5E4OA 3MN8A 2EE2A 4GP4B 3CAFA 1BZEA 1JZEA 1T66C 3VFWA 1XIWA 2BIQA 4Y9CA 4NJAL 4BD4A 3CSYB 2QELA 1I3GH 2DI7A 4ZPTB 3F7LA 1P1ZA 4HT1L 4PYGA 5D1QB 4LPYA 5D71H 2XZQL 3IJ9A 4MAZA 3UAFA 1FNEA 3HFML 5EO0A 4BZYA 2AFNA 2HUHA 4K3EH 1IQWL 1LWRA 3L9BA 4HJGB 5HI3C 1U4EA 5IOPA 2ATKB 1K3ZA 4MDJB 1BHGA 3REWA 5J1AA 2P5WD 4WUUD 3ES6B 2WBJB 2R2CA 3N1GC 3S88L 2QT6A 4R4NC 1KT2A 4FJ6A 2EH7H 1KWKA 2FBOJ 3EJRA 4RBPH 1OAYL 4KGJA 4ES9A 1SGKA 5JIPA 3C5ZC 2BWIA 4NO3B 2CO4A 3EXLA 4PJHB 5IM7B 5C2BL 2D7TH 1RH8A 3FHEA 4U3SB 4WHYH 2GAZB 4HULB 3STBA 1H3WM 4Y19D 3S96B 2WWMD 4R4BB 1OP4A 2HA1A 4RMBA 1M1SA 1SXZA 2XNAB 1X5FA 1J9CT 3FSAA 3GD1C 3QUXB 2NOYA 3VWKD 4Y88A 3Q8FA 3HE6D 3TN0D 4DK3A 1U92A 4QRPE 3GRBA 2QPUA 2G60H 3BD3A 3M07A 1LJMA 2IGLA 1GTFA 4U1KB 3UBFA 2FJGA 2F5BH 4JKWA 5LQBH 5EULV 3U30B 2EIDA 2H41A 3PUUA 1LO3L 4RLDA 1WZ1L 2HJFB 1NEZB 2B59A 5MEQB 2XX1A 3KW8A 1M56B 1KLFA 5C07B 4N8VG 4LCYA 4RBPK 5AD0B 3MLRH 3MDJA 4KZCA 2A83A 2XRAL 3JVGA 4BFFA 3B2VH 1T7WA 3MA7A 3PWNB 1KEMH 2IWKA 3KPNB 1ZLDA 1OM3H 3F62A 1V7MH 2R56L 1KIRA 1H0DB 4EN3D 4OLZL 5HGDB 1FQ9C 2R23A 4RH4A 1EZUA 2FQDA 1MFVA 3RVVC 3QS2A 2WGNB 1RLBA 4UCFA 4I0PC 2IQAA 1A7NH 1A3RH 4L5FE 4XCCH 4YNYA 4YVUA 3NZ8A 3PJSB 2D31B 5F0JB 3TYFB 4DP8X 4Z3EA 3L8QA 4PPTA 3UPRB 5E95B 3GTTA 2XWTA 5BV7H 2AJUL 2FB4L 3TFKD 1ASQA 1W6WA 2XPYA 5C7XL 2FAUA 4R97B 5J1TC 3EOAA 4O2EB 3A22A 4A6YL 2YXFA 4A66A 1UXSA 3T0EC 3WELA 4KMTH 4RWHA 4XCNB 5JDJA 1VB9A 3T3ME 5GGQH 4FE9A 2L7EA 4TL4A 4I13B 3VGFA 2PXYD 2DQTL 3I6KA 3S2AA 3OHXA 3U4EA 1AHMA 1II4E 35C8L 4QHLB 4P5TB 2YAOA 3GMRB 2JCWA 2KQNA 4L3ED 3HE6B 5FWRA 3EJYC 3FQNB 4U05A 3SDAC 2XWEA 2TAAA 3X1FA 1HYSD 2FT7A 1YEHH 3VXQA 1TZHA 1Q9KA 3AM8C 2VM4A 3H4FA 3MJWA 4NCC2 5HYSG 1CK0L 4WU5A 2ZTBA 1G9NH 3ARDB 5D7LA 3RRQA 3N50A 5BV7C 8CGTA 1A9BA 3P3TA 5HGBB 3F84A 5IV2A 5SX4I 3HHSB 4DQAA 3DX6A 4TM9A 3IJHB 5ANMB 1A02N 2CA3A 2XICA 1QFOA 5DK3A 3OXSB 1NC4A 2AQ2A 2KQMA 2EDKA 1L6PA 5GRXG 4K7PL 3V9FA 4ZNEA 3OZKA 4OVUA 5EZIH 5I75B 4J3UA 1ZT1B 5IHZB 1UXMA 4BE6A 2PO6A 2I9LB 2GJRA 4YHIB 2DKMA 2Z35B 4D0BB 3FK3A 2WANA 4KQ3H 4OCLC 2WYHA 4GAJL 1DJGA 5HPMB 1RK7A 4MWFB 3UAJD 1WAPA 1J18A 5IBLC 5DCCA 1EEYA 5JPNC 5FUOL 4H26A 4PCSA 1NIBA 3BOVA 4U33A 4XNMB 2XG4A 1HQRB 4PYHA 3S8GB 3OKLB 3EBHA 5LBSH 3SZKC 1PLBA 4B5ZA 2GEQA 4YDIL 3B7SA 1Y6KR 3FO9B 4PMFA 2JJWA 4NO5B 4MJIA 1QD0A 3ATEA 2NW3A 3BJ91 3QK0A 4JFED 4QRQB 4QOKE 5T1KB 1U2YA 1NLDL 4F8TA 3INOA 4BGDA 4IBTA 4J8RB 2OAAA 2CRIA 2FL5B 3IFLH 1LHZA 3LV3B 3PWLA 4AKQA 4ZYKA 2EIZB 4DPBX 1IILE 3OLIA 3U46B 2XKNA 5CBEB 3SO5A 3Q0HA 1MCRA 4XCFL 1E5YA 5DRZB 2OK0H 3L5IA 3MODH 1JOIA 5FECB 3FS9A 4PJFA 4U1GB 1KCVL 1UM5L 4TKWA 4P5TD 1MRCH 1JWMA 4XP9H 1NFDE 4AITA 3ULAB 4ERSL 1QFUH 1T5XB 5I0WA 4QRPA 1HH9A 5I15L 3HAEH 5I30L 3LIZA 4HLZG 1UZ8A 5ADOL 4BFOA 4BXSV 1BMZA 3KL3A 1U8HA 5CGTA 1DQJB 1ZV9A 1W80A 4GRLC 1S8DB 4C56A 2CDEB 3GNMH 2PPDA 3NIGB 3PNWB 1OAXL 3X17A 2ZZUT 4N2LA 3SDDD 4HFWA 4AM0Q 3NIDE 3EYOB 1BYPA 3FQRA 4IBYA 4V1DD 2EDWA 3IMBA 4FZEL 4PRPD 1XZWA 3EFOB 1EHNA 4ELKA 3PPSA 3FF8A 4OCSH 5DJYB 2A9NL 5E23A 4KJWC 4DTGL 4G70B 4AIZA 2J2ZA 4PTUB 1BQUA 2IADA 5F71A 3OSKA 4ZMXA 3IVKA 5KVGE 3ZE2B 3FNKA 2OCFD 4RRPG 4B3VA 3QYMA 2X4OA 3O3AA 1OT2A 1NWOA 4PVMA 1UXWB 1BXUA 2Y24A 3MV9E 1DUZB 3VFWB 2IPKA 1PZBA 5C0BA 2CRZA 2VN3A 3E3QE 3UTZB 4Q9CA 3LXAA 2FGWL 4FQ1H 1IL1B 1VZGA 1UCBH 3AMLA 1FNSL 2MPAL 3FTXA 3HAEB 4OLUL 4MCYA 3KL5A 4OLYH 5EO0B 4QF1B 4LEXL 5IHLB 3NFNA 3B6SA 3DX8A 1BQLH 2MJWA 3IGFA 1XSJA 3H0TA 4NP4L 3P3RA 3EFFB 1BOGA 3PWJB 1CF8L 3O0RH 3TIDB 4B9CA 2H7WA 1RZIB 2WVUA 4ICWA 3VXRB 4K71C 2DW5A 5L9DH 2TRHA 1GKOA 1OB1A 1QLFB 3ARGA 1KT2B 2GTWA 4IRJB 3VH8G 5DLML 1JDDA 5MP6H 5C9JA 3KCPB 4Q2ZB 3KW7A 3C60B 3EYFB 2J6EL 2DM7A 3GB7A 1WAAA 4CC0A 3JV4A 1QUNA 1YY9D 4XP4L 2NZIA 5IVXA 1GGIL 2ZSVB 2A6IA 3KPLA 4FXKA 2BCKB 3QZNA 4JZJA 4FRWA 5HHXH 3IYLW 5AEAA 4BA8A 1C5CH 1LD9A 3T8MA 2WTPA 3QAZB 3WKYA 2H2PD 2WNGA 3GZQA 3OWRA 1OWRM 5TPWH 1JVOA 1FL5A 2JTDA 1AY1L 4ZUUB 5EF0A 5I8KL 4CBZA 3BPNC 4JKNA 3LN4B 1M7XA 2ICWA 1YDPA 1IC0A 4JFDA 4ZDHB 4XMPL 2YSTA 4UBDD 4OZFH 2VUOA 3GI9H 1F6AA 4ZUSB 3RWGA 1SDYA 1XF5A 3T77A 1OV8A 5IKCB 1FJ1A 4PLKD 3OQRA 1NDTA 3CZUB 4QXUH 3HG4A 3ZUNC 1IM3B 1E0OB 4G9FA 2OR9H 3DIDA 2G4GA 3MUGB 5ECJE 1NOLA 4CA4A 2X4NA 2IGFH 1TT6A 2A74A 4OVVA 3SPGA 5JOEA 2BS9A 4G6JL 4RNRB 4X5WA 4DKTA 4W6WB 4D9LL 3VI3E 1DJXA 5JR1L 1I1AD 5BPPA 2NUTA 3VD0A 1E6JL 2VR8A 4AMWA 4XN7A 5GS0C 3K3QA 4LVNC 3VXPB 5E6ID 1EHKB 3CXHJ 1J8SA 2UYLA 4NM8L 3OZ9L 3A6CH 4C83A 1YQ2A 1F18A 4U6HA 3GXDA 1ASPA 2KI6A 4MLSA 4TLKA 4D9RE 5CIPH 2Y22A 4XNXL 4LDLB 2D03H 1S7UA 2ZG3A 1EXUA 3GIVA 4XNQB 5I1AB 1K4CB 1LE5B 3TCTA 3FH5A 1AKJD 3GSQA 4G42B 4JE0A 5DS2A 3FSVA 2QDWA 2VDPH 3QR1A 2EE3A 4JM2F 3QPQD 1FHGA 3F01A 4HC1L 3HZVB 5GRZA 2O72A 3U0WH 1NFIB 4YSCA 3X1BA 4HLZH 3TCLB 3ML8A 3EOAB 3PG2A 2AZUA 1Z66A 1IKNC 2BNUA 4P2QB 1DBMH 2NY4B 4OGZA 2JB6B 5TJWK 1Q9OA 5JLZA 3P9LB 5HGAA 3IGKA 4D0DA 2MHAB 3BSZH 4NB7A 2E7LC 2H32A 4OUUB 2COQA 3EHBD 3IJ7A 3HC4L 1AIZA 4YBHA 4LKXB 1EMTH 3BP7A 2X12A 5AW5B 1T7YA 4HJ0D 5K93A 1U3JA 2YD7A 4KZEH 1MIEH 4BQ6A 4MXQC 4JFEE 3GKZA 1FYTB 1AH1A 4F8NA 5EU4A 2HUEA 4GKSB 5CKGA 2VMCA 4XPGL 5L8JB 3FQNA 4WI0B 5DQDL 6TAAA 3VM7A 4AMKL 1N68A 1MW3A 1W0WB 2JF1A 3TS8A 4NRYB 1XF1A 1IKOP 2ADJB 3S3DB 4G7QB 1NJ9B 4F80A 3L6FB 3D39E 3CPLB 1YEFH 3QQ9D 2FX8H 1O6SB 3B7YA 5DEFA 5JIIA 1Q72L 3LKOA 2ORBL 4N5EC 3OKDB 1JWUB 1IGFH 1PY4A 2AJZA 5FLVA 2J8UB 4M5ZH 1AG0A 5IMMA 4H0HB 5GS1A 4UOQA 2OULB 3MLZL 3BX7C 3VYOA 3ORJA 4ZMQA 1QBLL 4AW4A 1FNHA 3N1MC 4U3HA 3K8KA 5IQOA 3PP3H 5F0PB 1KTRL 4L3AA 4S2SB 1OAYH 2ZOUA 2K0RA 1Y6NR 4JFPB 4RAVB 4YHPA 5LXVA 5H8DA 3DSFH 1R75A 1QWHA 1NQBA 1UWXH 4XXCA 4CNIA 5I5JA 1AR1C 1Q94A 4UWQB 4A7GA 4YL4A 4POZC 3A4FA 4N1EA 1MZZA 1FRGL 1IFGA 3VRLF 4OJFH 3JWNH 4UT6H 4WV1A 4JHBA 3DHMA 4N8CL 3C6LD 3VO0A 4MBOA 3VFSA 1MEXL 1UZ6F 3GBML 1Z6JT 4GMSL 4PJAE 1KV3A 4D9RD 5F6IB 5GGUB 1FNLA 1QBML 1MJ8L 4K07A 4YC2C 4N2KA 4OZGA 3WNIA 2Y72A 3ARBD 5EUKA 2PXYA 4GLRH 1RD6A 4L5FH 4N2HA 1BD2B 4WFGD 4M8VA 1QQDB 4YHYC 4G1MA 1S7VA 4HH8A 1S5HB 2EH8L 4N6RB 4P5RA 2FDBP 3ECBB 3H4HA 3N41F 1Q1PA 3GMQB 2XV2A 4FXLA 4GRMA 2GIXA 3UXFA 3QUMA 4E68A 1IVTA 4Z5RA 2DF3A 4TTDD 3SYCA 3PLYA 3CFIC 3BUYB 5IB2A 1ODUA 1KGWA 1KTKE 3MXVL 1AI1H 1Z5LB 3BSHA 4KDVA 3QIUC 5D93C 5EU3B 2GK2A 1N8ZB 4B0MB 4L1HA 3TPUB 1OP3K 4DIXA 2XN9B 4N85A 4PWHA 1TMCB 4LHUD 4JN1L 3EYUL 4YFLI 1A8ZA 1BZ9B 1V3MA 3RWCB 1YEEH 1YN7A 3KH3A 3K2UH 1BJMA 2OJEB 4JRLA 4PSPA 5DRXB 2B15A 1Y18A 4JGMA 3AXLA 4XCYA 3G5ZA 2GC7C 3V6OC 3O3BB 3OMAB 3UPCA 2IIJA 3L1OL 4NO2A 4J5VA 4N2FA 2C7UB 2X4OB 3B7RL 1TQBC 1I9IL 1FZMB 1M42A 4JREC 2HKHL 3L08A 4JFYB 2EDXA 4CVXA 2PABA 5DFWH 4PV9A 4U7SA 4D3CH 2ZUXA 3BD4A 4LSQH 4Z7OF 1UWGH 4CKVX 1SDAB 1ZANL 3F05A 1HEJC 2BSCA 3FT9A 1ZT4A 4HEPA 1GYCA 1JAEA 1DCLA 3B7TA 1O9ZA 4NDMB 2A99A 3FB8A 4UT7L 4TSAH 1J86A 3D69B 1IBDA 1RIUL 3GEFA 4R0LA 1Q0YH 1DZ0A 1EAOA 1Y07A 1T0MA 3IMVA 5F9AC 3FUIA 1BOGB 4MJ5B 4GKOA 3CFJA 4WJKB 3QJUB 4PGZA 2VZ3A 1I7RB 4UT9L 4GW4A 1J8HE 3SDDB 4DP0X 1JGEB 3L2MA 3K74B 2BFGA 2PCFB 5HHPB 2D0FA 1XQ4A 2A1WL 4HKZA 3H6AA 1CJYA 3EG9B 5AWNL 4DAGL 4F2MA 2QHLA 2DD8H 1A6TA 4I18C 5TFSL 1R5IA 3IBEA 5EZIL 4FXGA 5DRWB 3OKMB 4CC4C 2BVOA 5DWUH 4BK5C 5KAQF 5MHSD 1R5WA 2F74A 3VFGH 1M7DA 3GDCA 3RVXD 2KLTA 1G87A 1IAIM 2MIZA 2ZCHL 1HJCA 5HHOE 4LPXA 5DJZB 2C8NA 1GZHA 2NX5A 4BZ1H 4XO5A 5HI5D 5MI0C 4EF3A 4J3BA 1VZIA 3V4UL 4GQPH 1QLEL 2Z7YA 3HLAB 1BYNA 4BEIA 5EN2A 5HJBA 5E9DD 1MZYA 2QADB 5LBSL 3IF1A 3O8XD 4I3SH 1CQYA 2L3BA 4HSAC 4R96A 4XBPA 3PQYA 4G6FD 4K9EC 1GPOH 2NXZD 1GRWA 4DVBA 3FB7A 4PJIB 1QR1A 1G9MC 4I48A 2J4WL 2IMNA 5DZNA 3FFCB 1NCCL 2CO6B 3QJQB 3W57A 3MFFB 1KBVA 4OD2A 5H4YA 1COBA 3VD4A 2V2WB 1QRNE 3N41B 1NA8A 1L4IA 3G5XA 4RFEA 3SQBA 2CHNA 2IDQA 3EADA 1CXEA 4BZ2L 3MBXL 4L1DA 5H94B 1KY7A 1AC6A 1DN0B 3KMDA 1MCIA 3RUGB 3L5WB 4JG1H 5AAPA 1KIQB 2FT6A 4HK3J 3ZE1F 1E4XI 3LJ3A 3JBG7 5B8CA 1GKEA 1AGBB 2CH8A 1JF6A 1FG9C 2WLIB 2DLHA 1X44A 3F8UB 2DBJA 4Z77A 4FAAB 2ZSWB 5FA4A 3QJFA 3CH1A 5CJXC 2P5EE 3IPFA 3V4VA 2C34A 2VXSH 1MHEA 4Z3TA 3L3JB 4P2QA 2V33A 2VCOA 4X5XA 3MVSA 4FKEA 2DI8A 1G9HA 1Q9OB 4AG4L 3UMNA 1TQBB 3D5OF 4IM8A 2VQTA 2WZ0A 3A67L 1MUJB 1AGDA 2W80C 1EO5A 1G7QB 1DVFB 1J8HD 1IU1A 3OB0K 1MH5A 1NFDA 4GKNB 4FC3E 5DEGA 4J3TA 5IGXH 3E80A 2FZ3B 3FW6A 5BO1L 4HBCH 1CGVA 4B96A 3HMWL 2I9TA 1JV5A 1TVDA 3S36X 5CR1A 1S7WB 2HFEA 3VW3L 4GAYA 1OXYA 2Q2LA 4GKLA 3C2AL 2AKRA 3QDGA 2B4CL 5KYWB 1T2XA 2Y25A 1IGJB 3ARTA 2AEIT 3CBRA 1M6OA 4DGVL 4E42B 3IDNA 3Q13A 5HDBF 4H2AA 1CGXA 2F1EA 4NIYE 5E6RB 2R23B 4LFHG 3MXWH 1CGWA 4FQ1L 3IRCA 2ADJA 4RZCB 4OLYL 4Y2DD 1L3WA 3ZBMA 3JUZA 2WZPD 3DLQR 4XMZA 5TQ0L 1W72H 3QNZB 4PB9H 4J3OF 1D5BA 1A4KA 2BIIA 1CF8H 3O0RL 5A2FA 4JPIB 4O9HH 5DDHA 5KANG 3EBAA 2XV3A 5GRVK 4JDEB 4S0SD 2Y5EA 1PFCA 4I18B 2K6WA 4HHWA 2DB8A 2HX7A 2J3SA 4JRYE 1SEQL 2YAQA 4HJEA 5DSCB 3BCDA 4QI3A 3NTCL 4PJAA 4AUYA 1PZ2A 3RWHB 1JZ2A 3L45A 1OOAA 1VCAA 5HHXL 5E51A 4PWIA 3X3FH 2EDYA 1C5CL 3NPZB 5EH1A 2O5ZL 4CW1B 1RPQA 3L2LA 4HGKC 4HW6A 2K9UA 4JFHD 1YYLL 1ORQB 1CWVA 4KC3B 3SGKA 3O3UN 3K4DA 2X4UA 5I8KH 3MRRA 4ZRGA 1CVRA 4YDZA 5D2NC 3BFWA 3F7QA 1U8QA 5T33L 4LPVA 3SDXB 3NOIA 4JKLA 4KMQA 4Y4HA 4MNHA 3KBHE 4I3RH 1RZ7H 4GXFA 1DZBA 3U0PA 2WQSA 2RACA 5JHLA 5EZJB 4QXUL 3D0VA 3HHSA 4JNXA 3ZE1E 4OBRA 4XZUB 3WSQL 2K8MA 3C75A 2HT4D 2ZUUA 1U3NA 3CX5J 4FCHA 1KJMA 4YSAA 1MDTA 3R8BB 1NBCA 2BSBA 3U1SL 4PW9A 2DMCA 3NCJL 3K72A 4M3KB 1IAKB 4Z1PA 3QDMB 3DETC 1GIGH 4BFJA 4PMEA 4HJSA 3QR2A 4YLCA 4PH8A 2ZKWA 1Z5LA 3EGSA 1KZYA 2CRYA 3FL7A 1RJLA 1H3XA 4GW1A 4PS4H 4B7LA 5L4MA 4MJ4A 2XIBA 5HHMB 4LCVA 3JQOB 4EUPG 3ABMB 2W07A 2XWDA 4FI7A 3SDAA 3HC0A 4ISVB 2AK4D 4HUKB 4PJ5D 1TG8A 5GPRA 4A55A 5DHYB 5GGSB 3ZT5A 2B3RA 1OARL 4JE4B 1KUMA 4LSRL 5IESH 4GG6A 1I75A 1VADA 3I74A 3U9PH 4PRIA 5HGHB 4H0GA 5JHDE 1D5MB 3F7YA 4RAUA 4F7KA 4PG2A 5KUKA 4PJBB 5F9JA 4GY4A 2NTFA 1EAQA 2BNRE 4AL8C 5DZJA 3BSZL 5KOMC 1I8KA 1ZKAA 5AB0A 1UA6L 3RX9A 4CJ0A 4Q6IA 2GI0A 4LIQH 4P05A 1IC1A 4KZEL 2W65B 2G9HA 2ZUTA 4QRAA 2P47B 3P3SA 3NCCB 1SN5A 1GYVA 1EZVY 2JNZA 3K5RA 1Q0EA 4G5AA 2BPBA 1KB3A 5AVUB 2CIKA 3MNZB 3SE3C 3U9UA 4XPGH 2ATKA 4E9SA 1I7UA 1OP5K 5KTEL 2XZZA 5EU7C 5T1LB 4ORZC 3ZTJG 4OF5A 1LTXA 3SKMB 4CSPA 4DUVA 4FMKA 1NBQA 3FDWA 1ZS8A 5C0AD 1XMEB 2VDNL 2V2TA 2I25N 2CWRA 1CFQA 1NBZB 3LKNB 4UQ3A 3V6FA 1C08A 3VWJC 4BBWA 2VOTA 4UV7L 2A6DA 5FUZH 4HCFA 2X1XR 3DPBB 5T3ZL 1IGFL 3EGDA 5FB8B 1QVOB 1CR9L 1IMHC 5F7WC 3BDYH 1OCZB 1FA4A 3SDYL 5L8LB 2V5TA 1WZMA 3PL6B 4PJ8A 5K9JL 12E8H 2XNAA 1QBLH 4HU8A 1ASOA 3TBWB 3SCMC 1VKXA 2XTJB 2Q7AA 4JLRA 3O2DL 4RGMB 5C0AE 1NFKA 4KKBC 1P4BL 5C08A 1F4WL 3N9GL 2OMWB 4L0ZA 3ZR6A 1ZK9A 2J8UE 2A38A 4X9HA 2NX5B 2JKXA 5F7FA 4ZW7A 2R2HA 1NL0H 2ATAA 3CNKA 3VGHA 1I8LA 2Y7QA 1YZZA 1N6QL 3AGWA 1A6UH 2H5UA 4N8CH 1SN0A 2CLZB 4OQ1A 3PQYB 5JA9A 4AT6B 1ONQA 4F8QA 1VGKA 3MNVA 4H2CA 4Q9RL 1S7TB 1MEXH 4GMSH 1MREH 4PCTA 5CHNB 5EOTA 1U91A 4OGQC 5CJOL 4RIRA 5LGYA 4NBXB 1UEMA 2C1PA 4YHKH 2DL9A 5E8NA 4K5OA 4GS7B 3NEXA 3VI4E 1JUFA 1V5JA 4L5FL 3C60A 3EYFA 5AOLA 5I73C 5IY5B 3DO7B 2XX0A 1NMCB 1Z9NA 1LWJA 4WO4A 4EI0A 3LXBA 1QKZH 1J5OH 1T83A 4P46B 1OQOA 3HPJA 3RDTC 3L5WA 2X9WA 3MACL 3M46A 5AW9B 1OGPA 3APMA 3TBBA 1R17A 3WFHA 3D4YA 4LKCA 5CM1A 5F7UA 1Y0LB 3ULUF 1BX2B 2YMTA 4F15C 2YGVA 5D7JD 1P7QD 1WITA 1XB3A 1AI1L 3PUCA 4MD5B 1O5PA 3RZCD 2WHVA 3ATAA 4X6BA 3SPIA 3AFLA 5IKCA 3BUIA 1DANU 5C08D 1CGTA 3MRJA 3EYUH 5K9QI 4XCNA 4F1ZA 3ULUH 5F6IC 2EIEA 5F3FA 5ANHA 4ZQTA 5DJAA 4N9GA 3O45A 4TNFA 1T4KA 2P26A 4L8SC 3BEWA 1LO4H 4FMFA 1N7ML 4XNZB 1E4KC 4HIPA 5AZEL 1FF5A 2B1OA 4WQOA 2NYZA 1E4XL 1UGKA 1ZV5A 3Q5TA 3B9AA 3GEWB 4XGZA 5IFJA 3FB6B 2XN2A 3PWPD 2NXZC 4GAYB 1R24B 3K7UA 4IU3B 4Y1AA 4DVRH 2WTOA 4Z7VB 2FJSA 4G3YH 4R26H 5AKRA 5CSZB 1J10A 5MENA 1ND0B 4RQQA 4C4UA 1RUKL 3S3PA 2JQZA 3B3IA 5D5ME 2P5WE 4LASH 4WUUE 4JQVA 1VA9A 2RALA 3MLTA 1OE1A 2EYRB 3P9WB 4U1GC 2DQMA 4P3DB 4TSAL 1RIUH 5BZXA 5FO8B 5I1AA 1YY9C 4Z7OE 2PW1A 2A83B 3ZX1A 5J06A 4O51A 1LE5A 4JFVA 4G42A 3KLHD 5GRJH 3V5DB 1YAZA 1NC4B 3AC0A 1GCFA 2Y6SC 1GL4B 5HDBB 2DRUA 1Z3GH 5E2VL 3PGFL 2YMXL 5CU5A 5C71A 1OK0A 3CVHB 1DQQB 1BQHB 3OJDB 4F7CB 4UT9A 4JGUA 4FLQA 4M62H 4LO9A 2FH8A 4NNXA 3L4WA 2HJLA 2V3FA 4UBDC 2YAFA 2Q76B 2V5YA 1FDLL 3AXIA 3TO4A 2H6PA 4HUCA 4PRID 3CHOA 3EJPA 3IMTA 3MRFA 3SYAA 1QTPA 3JUYA 4PD4K 1SN2A 5D71L 3Q8BA 3LKSB 3SKJH 2GC4C 2XZQH 4ZUTA 1VJSA 3HFMH 3JWOH 5TE4H 3DJ9A 4K71B 3WEMA 1AANA 1KTCA 1YO4A 2ZOOA 3FU7A 3BT0A 2F1BA 3OKOA 1JGUH 1AJ7L 2EAEA 3VFGL 3SYPA 4UDUA 3BIAX 1YRKA 4ZOAA 2DLFH 1FV1B 5D2NA 1D7CA 5AZ2L 3ZZ1A 4BZ1L 1BF8A 1RUPL 1X5IA 2OL3A 3OGOE 2EH7L 3STLB 1S9WB 1J8HA 3BMVA 3LRMA 5DC0A 5FYKD 5C6WH 4IDJH 2AJ3A 5DZOA 1U8LA 3UTTE 3VXSD 4WW2F 3QJHA 4G8FB 3RGVB 5C2BH 4LAJH 2Y23A 1WUZA 3OD3A 4XO8A 3S3CB 1HFUA 4J1UA 1CN4A 3G5YA 5KVFE 5AW0B 3WIAA 4M6OH 3DV4A 3SOBH 2N59A 1O0VA 2JI2A 4PRPB 4FFZA 3FO2A 4HUXB 4J4PD 1U93B 1N59A 2LU4A 4GXUN 2APTA 3FAXA 4S2SA 3O41A 2WO3B 4X4ZA 1G9NC 2P5ED 3QUML 4GMTL 4OY9A 3T5WA 1HWGB 3BUDA 3FJTA 1KJ2L 1EO8H 4HHGA 4M61A 5DJXA 1J5DA 2G60L 4KXDA 4MKMA 2DLEA 3VXUA 5LQBL 4AKOA 3ETTA 4YMPA 1YHPA 4YIQA 2OP4H 4HWNA 3QPXL 4OZFB 4ZJ9A 4C55A 4GG6F 2YUZA 4YDVA 4HOWA 1A6VH 1ETA1 1YEKH 2EINB 1NAMA 1TITA 4R8WL 1PLCA 5A2BA 4FEMA 4XHQA 5EIQA 1YN6A 2EVJA 4UILL 3W39B 1TU2A 4E0RA 4HSCX 3QHFH 3R0NA 5I1CH 1R0AH 1JD9A 3LRGA 3ET9F 4HUNB 3SIKA 2ENSA 2C7FA 4NO5A 4F91B 1QFHA 2DIAA 2NW3B 2X6UA 1V3JA 4WTZA 5FYJH 1JWSA 3QGVA 1E9PA 2EC9U 4QF1A 4HBCL 4FFYA 4HF5L 1CFNA 4XCCL 3D3VA 3I75A 2DS4A 1IT9H 4FLSA 1LP9A 1ZT7A 2LU7A 3FOMB 3QB7C 2Y06L 3KBEA 3ECQA 5A40E 1OK8A 5I0DA 1A2YB 1ZHBA 2QGEA 5HYJB 1YMHA 3BXNB 3CXDH 1R19A 3MMEB 4KWUA 2P48B 2ZYHA 3UTTD 5LXGH 4A6YH 5L2KD 1WBYB 4AXWB 1ZHLB 3IDGA 4JO3H 2X70B 4P49A 1RIVL 1P0SE 1YN7B 3MLUL 4TNWF 1HSAA 1U0QA 3VXSB 2JV6A 3Q8EA 3WUZA 3QWNA 1FNAA 1K4DA 4XVOA 1PQZA 5E70A 3JWNG 2H9GB 5KYUA 2JKTM 4XXWA 5TF1H 4IKNA 3DSNA 4BRVA 3TBWA 1UH2A 3MRNA 1TCRB 5SWQA 5AQ0A 3VX1A 2PKDA 5ACZA 3AB0B 4PRNB 1BA9A 4YHNA 5J6GA 4DESA 5ES4B 4ODHH 1F58L 1JPGB 5D96C 4L1LA 1RUAH 4AE0A 2DYSB 4LLAA 3T77B 2KZBA 3D87B 1EA9C 2ZXQA 2CUMA 3L16A 3LNDA 4HH9A 3RY6A 1AKPA 1MCBA 3AY2A 3G3LA 3QWRD 1TQVA 2Z8SA 5DZVA 5EF2A 3COOA 5BZDA 2QGBA 1UWYA 3O3DB 4TNVK 3VA6A 5DLLA 1MJUL 2HT3D 3MRLA 1UURA 4PI0A 5LB1A 3LAFA 3BEVA 4LLVA 4MCNA 2FQGA 5FCSH 4N0FA 1VF5C 4M5YH 2E7MA 4GB9A 3PHQA 3FCTA 3RHWF 3QQ4A 1NDGA 2J6WA 4WRLA 5HJ3B 43C9A 4U1SB 2Y69B 1O7DE 4WKZA 4ZPVA 4FQPA 3OVUB 3VD2A 3KWVA 4NZDA 3VQLA 5B1BB 3FQWB 6PAZA 5J89A 43CAA 3R8QA 3TIDA 1WT5A 4HZ1A 4Y4HC 5JHLH 5C70A 1P6FA 1CDIA 1G1YA 2C4XA 2OMZA 3A3YB 1G9ML 2V2XB 2J43A 2NY4D 5HI4C 3S3SA 2O5XL 4IRZL 3HIZA 5HTSA 2HX8A 3UTTB 5E2UL 3I84A 2XVGA 1NGWB 4UINH 3KCPA 3AREA 1B4RA 1BMWA 1HNYA 2ED9A 5IROA 2CNZA 4X6EB 2VAJA 1KCVH 4Z7UE 1KCSH 2GCYB 3KPSD 3HKZA 1QASA 1UOVA 1OARH 3E7JA 4FNSA 1E8YA 4L8SA 3WS3B 2B39A 4AX3A 3DC0A 3Q8CA 1E28B 32C2B 1DHKA 3B43A 3KH4A 4KO6A 3ULVD 4L4VA 1B4JH 4JO1L 3FH8A 1OAXH 2CBMA 4KVCL 4R9HA 1PS3A 1XR8B 4L4TD 1CE6B 1M2VA 2J8UF 1UA6H 2DTML 5H94A 5J6SA 5EF1A 2ZXCA 1DN0A 2UXTA 4ZQKA 1RZQA 3A24A 1BV8A 4X5WB 4JQVC 4QRUB 4Z23A 3BYTA 5F1KC 1A3QA 4BJLA 3H1ZA 4ATTA 1DJSA 1DBKH 4LNVA 3X13A 2QJDA 1H5BB 3LH9A 3RY6C 1ZLUH 5CCGE 5C0EA 1J87A 2R0LH 5IW6A 2GBUA 3QJFB 2BP0B 1FCCA 2WLJA 2A6JB 1B9KA 3ZMNA 4GG6E 3B2MA 4N86A 4V2CB 5FUCC 3I9IA 1MPAH 3TO4C 5I24A 5ICZB 4M1CC 4ADGA 2WTRB 4G1EB 1S7XA 1S7UB 2X3CA 4UV7H 5FUZL 4L9LB 2AQRA 3Q2CA 1U58B 5AW8B 4X98B 1G7QA 1JK8B 2D4DA 2FGWH 1BFVH 5D7EA 2BSDA 1FNSH 3CLEH 3HE6C 5I76A 3T4AC 3EOBA 3CHSA 3T6XA 1BQLL 3RWJB 4DEUA 2AXWA 4OI8A 4KGLA 4QO1A 2VDML 4N4YB 5HYFA 4NP4H 1K6QL 3SBWA 1XVSA 3HS0B 1K8DA 4LVEA 1IVLA 5JXEC 4C4KO 5A16A 2JK5B 4YHOL 1UWFA 4CMHB 1E43A 3F7VA 2PPAA 4WU5B 1E5BA 4MXVF 3D0LB 3R7RA 5DS1A 4PJ8C 1TZOA 5AENA 5MP6L 4DEPC 3ZT7A 3GRWH 2WXJA 3ZIYA 4PGEA 1AQHA 3UJIH 3QORB 5F1NB 1GGIH 3K6SA 2ESVD 2YOAA 3J8F7 4N0UE 2K6ZA 1IBFA 3VXUE 1TR7A 3IU3A 2MWCA 4MJ6A 4U1LA 2EC9T 4G8IB 3K91A 5FYLH 1AY1H 1FN4A 1E30A 2ARWA 3VQ1C 1MJ7L 4FQXD 1W8NA 2WLHA 4CVWA 2KZ1B 1Y7VA 3HCVA 1F8TH 4LFHD 3RI5K 4X8JB 4WIQA 1WAAF 5B39A 1NCGA 3LNIA 3VRIA 3M17B 1NMBH 1EGJL 3NGBB 4YFDB 3ZTNH 2J8UA 3FU0A 1MG3C 3VH8A 3DMMC 2XETA 4XNMA 2PPCA 1AD9A 1BSIA 2EDBA 2F15A 4HUWB 4K3GA 4XPBL 2DPKA 2NCEA 4JQXC 3L4VA 2CGRH 3T0ED 3MCLH 5KVGL 4XX1G 2YC1B 4MX7B 4MZ2A 3H9HA 5H2BA 3R18A 3WUWB 4NO2B 4KV5F 3V8CA 2XWXA 1CFVH 3NIFB 4R7DB 1A7PL 4Z8FL 3VJ6B 1D5IL 1LP9E 3KPPB 2DLGA 2ZNXA 2XQYK 3S36H 3OZ9H 5TE7H 2UWEE 4LCUA 3L3KA 1HHIA 1TEFA 4WWID 3IAPA 3TEUA 4IRSC 2RFXB 1UM4L 3HG0A 4NQQA 3UPAA 4JG5A 2YXWA 2D03L 4JHAL 2E9WA 2WVVB 1KTBA 3K72B 3QZWG 4EBQL 5F3BB 4CL7A 2WWKT 3QDMA 3WAKA 2XTSA 2WY3B 3GHBH 4I5BB 4FQHA 5DD0L 2YPVL 3SE8L 4V2BA 4U1JB 1N26A 1JZGA 4K8RL 3GMMB 1FZOB 2XTJC 3T65A 2E7LA 3ILPA 3MLVL 2F8OA 2G0KA 1RVFH 1F1AA 3BXNA 4J4PC 2EQDA 4ODTL 3O6LH 3ASOB 3CBJB 2NY5L 5I1EL 3U79A 4Z78A 1QMUA 1S5HA 1WCBA 4PJGE 3U0TA 3ZE0B 2EVGA 2RIKA 2E7CA 2X1WL 4MJHA 4P5MB 3NAAH 3NRPA 4PRHB 4ZFZB 4AIZB 4OGYH 2KPWA 4NQUA 5E2VH 3HVDA 1KYAA 2NY1D 3FOLB 2CU9A 1FSKC 4GBXC 3GSRA 3FUEA 5DUJA 2DWTA 1IB5A 2WZAA 3F00A 5I1DB 5I5MA 3JTSA 1PSKL 1TZIA 3ZYJA 3AY4A 3AT8A 2K7QA 3V2AR 3GTVA 4K5LA 2CM6A 3AW5A 4Y1TA 5D5MA 2HG5A 4P2RD 1JHLH 4WFFD 5E03A 5SV4A 3LZOA 2FJHA 4ODXA 3MRLB 1EJ6A 4FNRA