3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
3G5XA 1OHQA 4QF1A 3V6ZB 4JG1L 5IK3A 1L6ZA 2X4PB 1W72H 1MAJA 1I3GL 1UACL 1WAAA 5HYSB 2NW2B 2P5WB 5BS0D 2XI9A 1J0JA 1A1NB 1DE4A 4LKCA 2OR8A 4PGEB 4Z77B 1Q38A 5MEQB 4KRMB 3S97C 3C5ZC 3QG7L 4TQEH 3GSQA 1OQOA 5DUMH 1KPRB 4PS4L 4XCNA 1S7TB 5EIVA 2C4XA 3UAJC 2RBLA 4HS3A 5CBEA 5C2BH 3PHQB 5BS0E 5I30L 3I6GA 1LO2L 4HF5L 4HMDA 4OZFH 4U6HA 3ARVA 1DVFA 1AR2A 5FEBA 4P3WA 4FN0A 3VXNB 2CR3A 1JZ7A 1HINL 3U30B 5DJZB 3D87B 1CFVL 2KDGA 3G08A 2N7AA 3U7YH 3OL2A 1FFOA 3R1GH 1A2YB 4NM8L 5L2KA 1T03L 3KYOA 5DMGC 2ZOLB 5DVMA 1MEXH 2W0PA 4LLWB 3RVTC 5IB4B 3UPCA 4UQ2B 1KTKE 1Q1JL 4CN4A 1F3RB 5GRUH 4QRSA 3O3DA 1MUJA 5C0BD 5T3XH 1MJ7L 2MHAB 1NQBA 4IS6B 5JW4R 4XBEL 2OQJA 5AZEH 1JHTA 2Z9TA 3DX8A 1J8HE 1FBIH 5KN5A 3STBA 3NZHH 3VFMB 2VLJB 4NKMB 4XMPH 1CL7I 2OMNA 5DJYB 4O4YH 4HC1A 1A47A 1LE5B 3IDGA 2ESVA 1R3JB 2XZCL 5CFHA 5C0CD 3OF6A 5FYJL 1EZVY 3O4LD 4M61B 5CJXA 2DI9A 3O6KL 2D4FA 4M43L 2ADGB 4Z7UA 5C0BE 4I18A 5HDBE 3QAZB 1K8IB 2ZWLT 2EXWC 4WWKC 2F5AH 4WDIA 1KJVA 2JB6A 5JUEH 3DROA 4LLYB 3BUYB 4B5EA 1UZ6F 3BKML 5C0AB 2KBGA 4MWFA 2CIIB 1VHPA 3DIFB 1EH9A 5D7LB 4Y16A 4JO1L 5TGBB 2XG5A 3BW9A 1NAMB 4OLWL 1MREL 4MJ5A 5C0CE 1X5GA 4G8EA 4MX7A 3VFSB 3O4LE 3N1GC 3RX8A 4ELMA 4M9PA 4NOBA 1OSZB 4B41A 4MDIA 3BAEL 2WBJB 2PTUA 4IMLA 4JFOA 1AFVH 4U1JA 1MIEH 3T65B 4Y2DC 5D6DA 4XVTL 2HKHH 2AJVH 5I1LA 3GRWH 4FQXC 1EA9C 1YMMA 1U8OB 2JJWA 1IC1A 4RAHA 5IB5B 4DQOL 1W0YT 3G5ZA 1CD8A 3GB7A 1T6WA 2ZUUA 2YK1L 1SBBA 2CPCA 4D2NA 4IRJC 2EYSB 4PV9A 5I1CL 5E2VH 1F6LL 5IV2A 2XQBL 1T5WB 2QHRL 4NUJA 4M03A 3WD5H 3KPPA 1K4DB 3EYQD 1PY4A 4XAWH 1YN6B 5D7JB 4JDVB 1A14L 5L9DH 5EZOH 5DMGD 3X14B 1I1RA 4NO2B 2GFBA 2AAVA 2PTTA 1I9RL 2YKLH 3B5HA 4APQD 1ZWIB 4Y0GA 3G6JA 5EU3B 4EUPH 3S35X 3WFHA 2CSPA 4PREB 3QWQB 4NJAH 5E00B 1LO5A 4L9LA 3MOAL 5F7MC 3UTOA 4OQ1A 3P73B 5F9OH 3PHSA 5MERB 2X42A 4OZ4B 1RFDH 2HT2C 2ITDA 4LRIC 1UM4L 4HPOL 1P53A 1RJCA 4PJEA 1IGTB 1BOGA 1ZLWK 4Z76A 4FQJL 12E8H 1Z9LA 3SE8H 3KJ6L 2QR0A 2VABB 4UDUB 5KJRH 3TT3H 2R0WL 3MRKA 1HDMB 5LCVH 4PRBB 1XCTB 3HI1A 1HXMB 2YRZA 2FO4B 4QGTA 4HJ0D 4PGZA 4EVNA 2EXWD 4WWKD 4KQ4H 4JN2B 1IARB 4L9DA 2H6PB 1AQKL 5DRZB 1O0VA 5D7IA 1G7JA 4FQQA 3KS0J 5HVFB 3A6CL 3HMXL 1B0RB 3VDBA 1FO0A 3BP7B 4JFXA 2H1PL 1WISA 3HI5H 4MA8L 4BFIB 2A6JA 3RZCC 4Y7MA 4LLMB 1NFKA 4M4RA 1G7IB 1Q94A 2O5YH 1SY6A 4D0BB 3TZVA 4XVJH 3O2DH 15C8H 3IKKA 1GCFA 3JWDC 2HH0L 2F5BL 4D3CL 3TBYB 5AYUH 4Y4HA 1CS6A 2G9HB 5C08D 3HE7B 3VFRB 3RWDB 2XWBA 1WAAF 4TRPL 1NJ9B 1FL5A 3DXAA 5IHLB 5J6HA 3MFFA 4C4KO 3TA3C 2GTWB 3QDJB 2CKBA 1QKZH 4IRJD 2I9TA 2W92A 3O4OC 4H25A 3MBEC 3S88L 4HCRH 1B0GB 3GMRB 3RL2A 1OT1A 3MJ8A 4HV8A 4NQVB 3M8OL 4JRXD 2VDPH 1TQCB 1TETH 4UMGA 4GRMB 3D3VD 3BPOB 5DMJB 4ALAH 1U8JA 5HYQA 3BP4A 4OT1L 3IAPA 2HFFA 4DGVH 3ES6A 3I3EA 5C08E 1UVQA 1HSAA 3H9SA 2AKRB 2CLZA 1INQB 3U4EA 4XCEA 3QO0B 2RB8A 4BQ6A 1KENL 2NZIA 1C5DB 4U31A 1HHJA 3BT2L 4JG0H 5F6IC 1HOCA 4JRXE 4O2CA 5T1LB 3D0LA 1A0QH 4ODUB 3D3VE 1LE9A 4QRTB 1TCRB 4KZEH 1ND0B 3GO1L 4HS8H 3VI4E 3ESVF 4U49A 4GS7C 4Y5XC 2GJ6D 4XWGL 1AGCA 1YUHA 5GZOC 1EEYB 1MFBH 4J8RB 1FGNL 1AKJB 3DRQA 2IBBA 3B2UC 1KJ2B 5C0ND 3AMLA 2V2WB 1WFUA 3HCVB 3U30C 1IC7H 2E6PA 4Z9KB 5T1KD 5CD5C 1J5OL 5HD8D 2HLAB 2G60H 4MS8C 5IB3B 2DJSA 4D8PB 1ZVSB 3QQ4A 5I19L 2Q8BL 4Z7UF 3BD5A 3RZCD 1U8LB 4OZIE 4XAKD 3V95A 3L5JA 5ITBL 1XF2A 3C60B 1LDSA 4DCQA 3ARDC 1JWMA 4WFED 4YQXH 3BKYL 3REWB 2B39A 4Z7OF 2VMFA 3GIVA 3DGGA 4UT6L 3WS6C 5ICYB 5HPOA 2OL3H 1KXQE 2X89D 2D7TH 3BISA 3KVQA 5JZ7D 5D70H 5GIRB 1FVCB 4YXHL 1S7XA 4HIEB 5E8EB 4YDJA 1BJ1J 5DS8B 1NANI 1IKFL 2VOTA 4ELMF 1NLDL 5MEPB 4PRDA 4OD2B 3IVKB 1AJ7H 4H8WL 1KBGL 3OZ9L 4IJ3B 3HPJB 3NACH 4XAKE 1ZLSL 4ZO8A 3AC0A 2Q87A 3QAZC 4O9HL 3DTXA 5BRZB 5HHNB 2XOTA 3VXRE 1S9WA 1Q9WA 5JIKA 2OJZL 4EXKA 3U6RB 1PQZB 3I3BA 5E4IA 1FYTD 1JF1B 4M6OL 3WN5C 3VFGL 4KK6C 3C8KB 2VDQL 3D18B 1JPTL 5GS1B 4WEMB 4F7MB 4TVPH 1KEGH 5D5MB 1NC2D 4FABL 2DM2A 2P5WD 1A3LH 3IJYB 4KJPC 5HBBA 3RAJL 1RY7B 3VRIA 5JHDA 5F9JB 2GY7B 4OZHB 3HRZB 4QNPE 1KF9B 1GZQB 2WBJC 1RUAL 4LHUA 1IL1B 1RIVH 5IFHL 1XEDA 2NTFA 5HHOB 3BDYH 1XF3B 1UWXH 4I3SL 5SX5K 3ZDYF 2VLKB 3A0OA 1FYTE 1LO3L 1VGEL 3G6JF 2X41A 3S35L 4LRNL 3W39B 3D2UB 5H94B 4OM0L 3SDYL 3UJTL 3FQRA 1A7RL 4UTBH 2P5WE 3EFFA 3GIZH 4NQSA 3TWCL 3JV4A 1YNTA 3ROLB 3WCYA 4YZFE 1XF5B 4M3KB 1JZ6A 4X7CC 1CVRA 4S11A 1YEHL 1H3PL 4PJEF 3SDCD 1EAJA 1HWHB 4FZEH 3MLZL 1KJ3L 5IF0A 4GT7A 5D7JC 2GSIA 4HGWB 5DF0A 4PRNA 3VWJC 3SEPA 5KBNC 4UI2A 5KS9B 1OAXH 2R2EA 1KELL 3QDGB 1F11A 5F9WC 5C7XL 4KXZH 5TDNA 1NMAL 5IQ9B 4ZG1A 2XTJD 3KDMB 3JZ7A 1YQVL 4YGAB 5GJTH 2LV4A 3IDMB 5D8JL 4DEPC 5FAAA 3BZ4A 1DN2A 3MRCA 5DJ8A 5D7IF 3WHE1 1F3JB 2VLJD 4YO0A 1CE6B 1TIUA 1C16B 5HPMA 4JO4L 4F33A 1OY3B 2YZ8A 5IK3B 2JK5A 3RIAK 1ZT1B 4N5ED 5C71A 2O5ZL 4NO5A 3UYRL 2XPGA 2XTJE 1ADQA 3I3DA 2JIXB 2H9GA 3MRHA 2DICA 4LKCB 3VFVA 4Y4KB 4RCAA 4W4NA 5FO7B 5CEXB 1GOHA 1G0XA 3IFPA 4NZUL 1RURH 1V7NH 3ARTA 5C0AD 1OM3L 3T2OA 5IT2L 3SCMA 5JQ6H 5D7LD 3SOBH 4QHNA 3FB6B 2CLRA 2B1AH 1BAFH 1TZIA 4C59B 1YJDL 4ZFFA 3UJIH 4U6HB 1IGYA 1B4JL 1UZ8A 3LIZL 1WTLA 2WBJD 2BVPA 3ILPA 5A40E 4X4YB 2D3VA 3HMWH 5E8DL 4P4KA 3FRUA 5DFWH 5LQBH 5L2KB 3KYOB 2EXYC 3FB8B 4X6DB 5C0AE 1NCAH 1RZJL 2D7QA 3WLWD 3V79C 2BSSA 3WSQH 4DWHA 3TBTA 4QRSB 3O3DB 1MUJB 1CDGA 5EA0H 1D5IH 1I1AA 1JHTB 1E6JL 3DX8B 1T04B 1AQDA 3ARBD 3MBXL 4OAWA 5JPMA 3TGXA 3BPOC 1YY9C 1OP5K 1X4XA 3EBAA 4JCLA 5IMMB 5ICXB 3RA7H 5D7JD 1MHPH 3PXHA 3MV8A 4TNVF 3IDGB 2ESVB 5CWSA 4ZUUA 1RUML 2NX5A 4FQCL 4PD4J 3TO4C 4FFZL 4KVCL 1RD6A 1DBJH 3MJ7A 1K9TA 2Q8AL 4BQ9A 1I1YB 4NWUH 4JFYA 1SJEA 1H3GA 2AK4B 3GSUB 4GG6A 4Z7WE 3VMOA 3WNNA 3FFCB 2CO7B 4I0CC 1Z5LA 4UOJA 3F7QA 3QXWA 2DYPB 2C3XA 1KJVB 2E6JA 5EBMA 3N85L 5EC2A 1CT8A 3EZ8A 4C4KT 1QLFA 3VCLA 4QOKA 5INDA 4JFEA 1RU9L 1OARL 2GK0B 4XPTH 2WANA 3IETB 3SJVB 2GEEA 4HWNA 2RHEA 2EDTA 3C9NB 5E9DB 1Y6MR 1A4JB 2ICWJ 5ACZA 1ORQA 1I7RB 4IMKC 4EIZC 4NOFA 4JFOB 5D1XA 1D5ZB 1T1WA 4U1JB 4GMTL 1T20B 1M7DA 2VDNL 4GRWB 2EDWA 5I1LB 2A38A 5F3HB 2PW1A 4PY7A 1A3RL 1CFQA 4MVBD 1T7XA 1X7QA 2D9QB 3E2HB 1P9MC 1IQDB 1E4KA 1RUKH 4AY0A 3FONA 3TVMB 2OSLA 5ACLA 1H3VA 2ILLA 1J1PH 5IBTL 4R4FH 4M4PA 5IV2B 3C60C 1DBKL 3O8XB 3H3BC 1YEEH 3IDJA 4LCWA 4L29A 4G8FA 1NCTA 1QLEL 3U2SA 1CXFA 4M1DH 1U8KB 2Y72A 3IB4A 1LP9A 3HE7D 4XMLH 1OCWL 1CGTA 5EBWA 2XWJA 4MLIA 1DSFH 4FNLH 3QDJD 4Z0XA 1FCCA 4MGXA 2Y4SA 4NYLB 4IJ3C 1WWCA 3T3PE 1LVEA 1LO5B 2ICWI 3P4OB 4XRCB 3RGHA 3SY0A 4CMMB 2BFVL 5J7CC 3L5XH 3FB7B 3ALWA 1Z6JT 3QQ9C 3QIUD 5D72L 3X12A 5FOJA 3NFNA 4P2RB 4TUOA 2AP2A 3V4UL 1IM9B 4CW1A 3LOWA 4PJEB 5JQHC 1CGSL 1FAKT 1HSBB 3F7PC 5GS1C 4O02L 5L7XL 1BOGB 3O3BA 1LD9A 3QDJE 2NY2D 2FH8A 4NZRH 3MNWB 2E9BA 3MRKB 3U7AA 4I5BA 3BI9X 1S78C 3MGAA 1JRHH 4WHTB 1MCOL 4I9WD 3LAFA 5C70A 1JNNL 1IGFL 4QO1A 3RNQB 3IKCB 2G75A 2Y07L 1R3HA 4XNUH 4FQQB 4LVOB 5T5FL 1CD9B 4LCIH 1WWBX 4ODWB 3B3IB 1AKJD 4QTHA 1MRCL 1NKRA 3C6SB 3GMNB 4K7PY 5JR1H 3TZVB 5I71B 4JZJA 4WUKH 1FFNB 2BY0A 1DQLH 3B9KC 5BW7A 1YNLH 3ULVF 4I9WE 3VXOB 1KC5H 3QH3A 4IOFC 2OK0H 2Y06H 2DQFA 3GMQB 1ZLUH 3V52H 2NXZB 2HTKD 3JSSA 1E4XI 1FL5B 2PR4H 3DXAB 3OAZH 1YEDB 4PJ8C 5I74B 5DD1L 2I9TB 4ODXA 2FZ3B 5DTFB 3SDAC 3LEYL 2B7DT 4HV8B 4HWBL 5D1ZB 5EPMA 5EU7E 5IGXH 3O2WL 4Q6IA 3WUZA 2CXKA 4QXUH 1UM6H 1NAML 3NIDF 3NZ8B 3ZKXB 1RIUL 3BYTA 5DWUH 5DMYA 1U8JB 5HYQB 5ISZA 3TV3H 5K93A 4YHPB 1RK1A 2HFFB 1OGAB 1OAUL 1W72B 2CKNA 3E6HA 4OM1L 2FSEA 2IG2H 3GJFH 4HUVB 1IMHC 3QNXA 3SDDA 4NN5B 2MFNA 4PLOB 5E5MA 4LLUA 4HEPG 4K7PH 2YC1A 5IFAL 2XFXA 5ALCL 2DJUA 4Z7QF 4LLQA 2CK0L 3CC5A 1HOCB 3GMLA 3BJLA 1EDQA 3C5JB 3D0LB 4JFQB 4KJYA 5BRZD 4Y1AA 3K74B 1AY1H 1DP0A 1LE9B 2DM7A 1EV2E 3W2DL 2EH8H 3K3QA 1JTTA 2A0LC 4QRRA 2D7OA 2J7LA 4XB8A 4YBHA 1VENA 4OZFB 4F8TA 4N8CH 4LP4A 1Z9MA 2WINB 3PWJA 1DQJB 5I15H 5IQ7L 3GGWA 2R69L 3QUKA 3DRQB 3L5WA 5I1AA 2F74A 5DD0H 2VXUL 4PRAA 2DQCL 43CAA 4WY7H 4EI6B 3GNML 4GXVH 5AUMA 1X5YA 5F8QC 3WE6B 5I73B 1CR9H 1RJYB 5FM5M 2A77L 3V6BR 2VITA 1WBXB 1J1OL 2DBJA 2VLKD 4ODTH 5SWZA 3CFEA 2IADB 3T08A 3KYAA 2VZVA 1ROWA 2JELH 3ARZA 5LGJB 4N0UA 5D5ME 3QNZB 5L6YH 3MXVH 4ZPVA 3CXHJ 5IB2A 1FL3B 1CF8L 3G9AB 3FQXB 4GG6F 2NY3B 2EE9A 5F70A 1R0AL 2YN5A 4LNRB 5ETUA 1UJ3A 4IOFD 4LPCA 2R4RH 4BZ1L 3IF1A 4L8DA 1MJJA 1NGZB 1D5XB 4DUVA 3VFWA 2P42B 4Q9CA 3KPTA 1S7RB 5ESQA 1RULH 1QZ1A 5LKNA 4E41A 4PRDB 5CJXC 4PJAB 4BKLA 4Z0BH 2FD6H 4NFBA 1NEZB 3IRZA 2GTZA 4HBCH 4CN6A 2VXVL 3SKNA 4HKJA 1DLHB 3DTXB 2XZAH 4F7CB 1TZGL 1S9WB 5AAWA 3PNWB 4ZD3L 2W59A 2VZSA 1CK0L 1PZ5A 4D9QD 4QHLA 4OCWL 2C3VB 4NFCA 1F6AB 3JWOL 1EO5A 4P23A 2BHZA 1S7QB 4NQCB 3FO2B 1X5LA 1MAMH 4OGYH 1G6RH 3QUXB 5GS2H 4WUUB 2P43B 3PWVA 4JPIB 2APFA 3I6KB 2FEDC 2ENYA 2DF3A 2JIXD 1BECA 3VG9C 3VRIB 4Y4KD 4C56B 2E27L 2ZUQB 1LP9F 3AS0A 4MXWL 4C83B 4YHLH 3LKQB 1EGJA 1FV1B 2NTFB 4Z6AT 4V2CB 5GRZA 2BRRH 4K23H 2EDNA 3ZHLA 5TE6H 1TVHA 1E6OH 2AV7A 3I84A 4JO3H 4RMRA 3BRFA 4I77H 4RX4D 4WCYH 3TVMC 2ZCLH 5EBGA 2BNUB 1PSKL 3FQRB 5FK9A 4JB9L 4GW1A 4G7YH 4WU7B 4NRXB 1YNTB 2JKXA 1QUNA 5I1KL 3VDCA 1KNOB 4RMUA 1QLRA 4X9BA 1JZ4A 4Q9QL 3PDDA 1H8SA 4WFFD 1MHEA 2BSTB 5HHPB 3X11B 4NKOB 5IF0B 1OQXA 4PJCA 2GSIB 5JXAL 2WIIA 1GC1L 4UOW1 2NLJA 3P0VL 3OKLA 3MX0A 4PG2A 1N6QH 3LKOA 2R2EB 3WJLC 1XH3A 2ATKA 1F11B 3O3UN 5TDNB 1X5FA 4YIQA 2MQ3A 3KNBA 5E4EB 1FE8H 3LPFA 4L9LC 3BZ4B 4BFGA 2OZ4H 1ZLVK 1CDHA 1UC6A 5B3JE 2EDXA 4HFUL 1OW0A 5F1KC 4M8QA 3V0VA 4K94H 2O61B 4DN3L 4WFFE 2LU4A 3QWRD 5HPMB 1R5IB 3KPRE 2WK2A 3S3JA 3DETC 2H32H 2JK5B 1PAMA 2FHBA 3OF6D 4MAYD 4WI4A 5CIPA 5IEKA 3LKNA 2W65A 1B88A 3WKMH 2AABH 2KZWA 4I3RL 4G8GB 2AK4D 2B8OT 5DHVA 4CJ0A 2H9GB 2ID5A 3MRHB 5D6CA 3VFVB 3CMOL 4YX2L 5ABDE 3GSOB 2GIYA 3EDDA 1M4KA 2NNAA 1FZMB 3MACL 1Q9KA 1RZKC 3FFCD 3IFPB 4DW2H 4LCUA 1N2RA 2DYPD 4QHKJ 5B22A 3MJ6A 1NBYA 4LASH 4ZTOL 5E8NA 2FIKB 1B6DA 1EERB 3DYOA 3IJHA 3SJVD 3QISA 3W9EB 1TZIB 5CJQL 1FO0H 3QEQA 2HMID 5E9DD 1HZHL 4ZFFB 4KTEH 4X4ME 1P7QB 4TOYH 3CLFH 1IGYB 1PD6A 4U6XA 5TQ2L 4WHYG 1QYGL 5EBLA 3TZVC 4OGAC 5I71C 2BVPB 3ILPB 1SY6H 2FNBA 4FZ8L 4GH7B 1UCBH 3UTQB 4UUJA 4LK4A 3FFCE 4PJIA 1JF6A 4PJGE 2HN7A 1U3HA 4I2XE 4RBPK 3BMVA 1A3QA 2DOCA 1I1FA 5KTEH 1U8QA 4AQOA 3CSYA 5KVEL 3TVMD 2CJUH 3EJYC 2MCPL 4YHZL 1NCBL 2BSSB 5I74C 1GXEA 3Q1SL 3THMH 4PB0L 3W11C 3TBTB 3M17A 2IH3A 1F90L 5EUOA 2DTML 5E9DE 4QRPD 5FYKH 1I1AB 3O8XD 4FQ1L 1MIMH 3VXSA 5D1ZC 1BIIB 4HXAL 3T4YA 2A9NH 1AH1A 1AQDB 5SWQA 1ZGLB 3ZKXC 1N59A 5ESAA 1DL7L 5IIEB 4CVUA 5F9AC 1FLRH 4YR6A 1KFAH 2Z91B 4QHKI 3WFEL 1NFDB 2R15A 5CWSB 1YN7B 4G9DA 3UZEA 3MZTA 2DIAA 3MUGA 4R26H 1RK0A 4JFYB 1NL0L 4QRPE 4ZPTA 4XBPA 2A6KA 4ZAKA 2NY6B 3UC0H 4YXKH 1YY8B 4XXCC 5FCSH 2SEBB 4KQ3L 1Z5LB 4WW1A 3OTTA 1NAKL 1MFDL 3CDYA 2EIZA 4P2RD 1IM9D 2OBGA 1CT8B 2J6EL 3OWEA 1IC4H 3VCLB 3Q3GA 4ZSOE 2DWEB 2DB8A 1FG2B 1OWWA 2R2HA 5LGKA 4UT7H 1EO7A 5JOFA 4Z78A 2BDNH 5I1JL 3ETBF 1ZS8A 1Q0XH 5DYOA 2GT9A 5CJOH 4GG8A 4G6FB 3S34L 4DOHB 1DEEB 3C08L 4JZNA 5I73C 4CU6A 1VADA 1Q72L 1RJLB 4NQEA 4PY7B 4KROD 3QFJA 1SBSH 3K1KC 1UQSB 4I1NB 1CFQB 1X7QB 3T1FA 4Y8DC 5DGQA 1MCCA 3VW3L 3RWFB 3MJ9H 3V0WH 2AXHA 2EDEA 2OSLB 3AB0B 4JHWH 5BMFH 2VDLL 4HUWA 4ZUWA 2VH5H 1P6AB 2YSSA 3FQTB 2NY3C 1Q9OA 2FBJH 3ZDXE 3IDJB 4LCWB 2C5DC 4G8FB 1S7SA 1C7TA 3RDTB 1NUNB 5TFSH 3RUGB 4LPVA 4OI9A 4E5XA 2V2XA 3PGCB 4G9FA 5KW9L 4A6YH 2NXZD 2E7CA 4LAQL 5EBWB 4NZTH 2XWJB 5J06A 4U7SA 4F80A 3B83A 1ERNA 5C2UB 4EBQH 3W11D 4X99A 3NABL 1BVKB 3D9AL 4WU5B 4OLXL 5BJTA 4IIQA 3V5HA 5D1ZD 5I8OH 5JW4N 1GH7A 5DJ2B 2R8SL 3MMEA 4ZDHA 4EDWH 1SYVA 2HKFL 1CBVH 2FJFA 3X12B 1VKXA 1O5DT 3WLBB 3ZZ1A 1OGAD 1A9EB 4NQDB 3FZUD 4G6JH 5GGSA 3INUH 5K9QG 3F7YA 1N8ZA 3KLDA 3KPMA 1UWEL 3O3BB 1LD9B 5EUKA 3K80A 4LVNB 3RX5A 5D4QA 4W6XB 3QUXC 4JQVA 3GFUA 3HLAA 4BELD 2GQHA 4ZUTA 4LCYA 4NHUA 1FC2D 3RWJA 2XWTA 3PWNB 2Q76A 4Q9BA 2ZUQC 4PJCF 3EZJB 3BH9B 3LS5L 3T0AA 4AQ1B 2G75B 4XC1L 4LSPL 2DQEH 4R7NB 2UWEA 1OGAE 2EKJA 2RIKA 5DI8A 5F97E 3QEUB 3E3QC 5I1EL 5J1SC 3EOTL 2EYTA 4OLZH 2MKLC 4JFFA 4U3XA 5GSRB 3FTGA 4NSKA 3P9WB 3ARUA 3QUZB 4GAFB 1QRNA 5F7NC 4FG6C 1DANT 2Y1VA 4OUOA 3QHTC 3FO0L 1X5IA 4XT1C 3PL6B 4MSWA 2B1HL 4LFHD 2F8VA 4X6FB 4KHTL 1H15A 5HHQA 1J9CT 1K2DB 4MHHI 5T3XD 5JTWA 4G80A 3H9YA 4WV1B 2I27N 4PRHB 1F42A 4ODXB 3IXAB 4F9LA 1D5MB 4IOIA 1IAMA 2NY3D 2OXHA 5IVNA 4L8CA 5E4EC 3CX2A 4YBLB 2V5MA 2YD5A 1UB6A 4D94A 3TIEB 5IHZB 1L0XA 43C9A 4A2LA 4YDLB 1E28A 1RK1B 4GLRH 4HUUA 2YD1A 2FSEB 1RUPL 3T2NL 3GBNH 5E70A 3NCYP 3OKNA 3QNXB 5BQ7B 4LLUB 4XGZA 1KEMH 5EORL 1EAPA 4YPJA 5J56B 2XFXB 1P2CA 2YEZA 5HI4D 4ODSH 2YD6A 3RIFK 2EIBA 3E6FB 3VI3E 3CC5B 2ADJA 4PJIF 3GMLB 1G9NH 4KJYB 1TJGH 4WI2A 1LNUA 2AJXL 3LN5A 3QUMH 4Y1AB 1ZOXA 2W9DH 3EYUH 4HXBH 3CFCH 3FAXA 2Q86A 5DT1H 5CSGA 1II4E 2YUVA 4QRRB 2F19L 4KGLA 3SCMC 5EUOF 1YDPB 3K2UH 3PDGA 4HPYL 5DEFA 3CJJA 4NQCD 2DDQH 4YC2B 1LEIA 5CZVL 3QUXD 4WUUD 3DHJA 1L7TH 3V6OE 1KCSL 5IW1B 1AE6H 5T3ZE 4LVHB 4PRAB 4C56D 1P84J 1ZHKB 3QIWA 3WV0A 4PJ7A 43CAB 1CTOA 3FJTA 4HQQH 5D2LE 3HZYA 5EOCL 1HHHB 4O2EB 3TYFB 1FFRA 5SWZB 3U0PB 3G6AB 2CRMA 5HDQL 1EHLL 3WKNA 4JY6B 5IB2B 3F6IA 3CXHK 4KV5E 1F4WH 4ENED 2VLLA 4P3DA 4WUUE 1I1AC 1A6VL 1CFNA 7CGTA 1A4KA 2R0KH 5IEHA 2EDQA 4C56E 3HC0A 3RI5K 1W0WA 1UJ3B 3VMNA 1MF2H 1FIGL 3RTQB 5M94B 1A6UH 4ZFOB 4LVEA 3IF1B 4L8DB 3TFKD 5DUPL 4HULB 4ZMAT 1UWGH 4MQTB 4UINL 1I8KB 3J8F7 2VDML 3MV7B 2R4SH 4YNYA 5DDHA 2P46B 4ZFGL 4OZGA 4E41B 2QBWA 4Y19E 4BKLB 4O5LH 3SKNB 3P11H 4FMKA 5GZND 3S6CA 4YAQA 1V3JA 4XP6H 3QXAB 1G9ML 5I8KH 4P2CG 5TPWL 1G7QA 1MWAA 3RY4A 5CGTA 4KK5D 4OLVH 3E8UH 1JN6A 3MTRA 4R7DA 3BYYA 5LAXB 3VXUB 4QHLB 3LMJL 3L3DB 1PGRB 2QSCH 3CXDH 1KCRH 3DBXA 3BMWA 2UV3A 3TESA 2BMKA 4UNVA 1MH5A 1VACB 2MQCA 2YUXA 4HKXA 4Q58C 3PWVB 1QTYT 4G8GD 2PYEE 4J3UA 5CLTA 1I85A 3IDIA 1CDCA 5BV7H 4TSBL 3GSNH 5D1XC 4M1GH 2AS5M 2VLMD 1J86A 1NCUA 1YPZE 3BZDA 3RGVA 4ONOA 2AV1A 2VR5A 2ERJC 1HIMH 3G6DH 1SMOA 2AV7B 3U0TA 2W07A 1UM5H 1QBMH 1CU4L 3U7WH 1JGVL 4HUNB 3OJ2C 3GKZA 1E4KC 3BGFB 1CGYA 3AB0C 5FK9B 2P1YA 3CMGA 3QP3A 1W72L 4GW1B 1P7QD 3RVWC 3R06A 4JCMA 2KZ1B 1PY9A 5HHXH 4G8GE 5I75C 4DQOH 3I6LD 5DD6A 4C55A 1QLRB 3MYJA 1WIPA 2ADIA 3UTTA 3ZKSD 2C3HA 2VLME 1MHEB 5SWSA 5IM7A 3QIBA 3V6FB 5HI5D 2WIIB 2NLJB 2HAZA 2V7NA 3OKLB 2YRLA 3RU8H 4JJ5B 5DUML 1H8NA 4NKIL 2ATKB 2W0KA 5MHSD 3WFBH 4YIQB 2XN9B 2IQAA 3ILQC 4KI5F 5FOBB 3OV6A 5L2JA 5KSUB 5C2BL 3IFOA 1INEH 3CH1A 3JBG7 3H7BB 5CBAB 5FECA 3I6LE 2UWEF 4M8QB 4E42A 3ULUF 2IAMA 4ZUVA 3BEWA 2Q6WB 3RKDD 2KUTA 4I4WB 3U7YL 5E8OB 4DN4H 3R1GL 4K2UH 2BHUA 3V4VL 3X3GH 5E56A 4WEBH 3G04B 1MEXL 5GSVA 5MHSE 2V5TA 5DHVB 3DARA 2NY6D 4AMKH 4X6CA 5JHLH 1A1MA 8CGTA 3H9ZA 3OGOE 5AZEL 1P7KA 5MEOA 3VH8A 3DVIA 2X4QB 4LCUB 5C09D 1N2RB 3PWLB 5DJAA 1UT9A 3NZHL 2IFFH 4PGCA 1QSFD 4XMPL 4U1NA 4HKBA 4O4YL 1NFDE 2DLGA 3QEHA 8FABB 2VIRB 4MDJA 1U41A 5DMKB 1BEYH 3LV3A 4UZGA 2GCYA 4Z5RA 3AAZA 4U6XB 2Q7NA 4G6FD 4PJFB 4LEXH 3QUZC 4JZJC 1CFSA 5BW7C 3PL6C 1JGDB 4HHAA 5C09E 1EHAA 5T3ZL 2HN7B 4PRIA 4HFWB 1U3HB 3U83A 3ARGB 2F5AL 5I16B 1QSFE 3VD3A 1A6AA 5JUEL 2YOCA 3V4PH 4JGJA 3C6LA 4N1EA 3KHQA 2V5SA 1I9JH 3M17B 2IH3B 2ZUYA 3EDFA 5EUOB 4LAJH 3RVWD 2BY1A 3Q6GH 3T4YB 3BIAX 4Q6IC 4LCWD 4YBLC 1A5FH 3CZFA 5SWQB 3IXTA 1N59B 3RDTD 3CFKA 2DQJL 2ZKHH 1MPAH 4XTRD 1AFVL 4P4RA 3MOBH 4OB5H 2CDEA 1MIEL 4YDLC 3SGJA 2HKHL 1T5XA 2AJVL 3GRWL 1INDH 4X98B 1VFUA 3M8OH 2Z4QB 4URTB 3TM6A 3SDDC 3RWGA 1NCWH 3MOQA 4PJ7F 4U3CA 3H9HA 4I48A 3T09A 2AEIT 4H1LG 4ZPTB 2VZUA 4XBPB 2A6KB 1MNUH 4ZAKB 4R0LA 4QXTA 5IJVA 1OB1A 3M1BB 5F7UA 3WD5L 1QHOA 3RUGE 1DUYA 4TVPD 4POZD 2LE9A 2HA1A 4XBGB 4XAWL 5BOPA 1KLGB 4BZYA 4NQDD 1BQSA 5BZWA 1KULA 4RZCB 4PJ5B 5L9DL 1WFTA 3MYZA 1QR4A 5EZOL 4LCCB 3MRPA 3BD3A 1CQKA 2YKLL 5JOFB 5FXCH 4Z78B 5IVZA 2N7BA 32C2A 5ECJE 2FR4A 4X4XB 3GO1H 5DYOB 2GT9B 4ZOAA 1PZUB 3CCHA 4NJAL 4GG8B 1WC7A 4LVHC 1FVDA 4YHKH 3QUYA 1FGNH 2XG4A 5FYJU 1EXUA 1VADB 5F9OL 1IFHH 4TVPE 1HQ4B 3OKDA 2D7PA 4OCMC 2NCMA 4OZGF 1A6TB 4M7LL 4NQDE 1RFDL 2I9LA 5HJ3A 3S36X 1IQWL 3T1FB 5E8PA 1IM3A 5D93B 4CN1A 5FA3A 3QPQC 3QSKB 4ZUWB 12E8L 2YSSB 3SE8L 3ZE2E 3LVEA 5F89A 4S1DD 2OTPA 5KJRL 1FNSH 3TT3L 4U6VH 3QUZD 3OAYK 5LCVL 4W70A 3OR6A 5JO5B 2J3SA 2O5XH 4F8QA 1UJ3C 1XR9A 3PL6D 4E5XB 3ELAT 5GRXG 2V2XB 4KQ4L 4S10A 1Y6KR 2PTVA 3PQYA 4UNTA 5C0GA 3T4AA 5E99H 4U1LA 4PRHD 1KPVA 3OG6B 3HI5L 1R6VA 5AD0A 1F4HA 2F54A 4P46A 4NDMA 1AO7B 1A7OH 5B8CB 1YEIH 2O5YL 4Q9RH 3MMEB 4XVJL 1MLCA 3O2DL 2V7HB 15C8L 4ZDHB 5K59F 1DFBH 3TBVA 3ZKQD 5KSBB 1WIOA 4FP8H 4JM2A 2H41A 2QKIA 5AYUL 2R1WB 1PG7H 4QXWA 1G6RB 1QSEB 5IROC 5GHWH 3V8CA 4P23C 4FQPA 3CIQA 5EUKB 4OJFH 2ZUTA 3LPGA 3MCG1 4XNQA 4PRHE 3D25A 1FQ9C 4JLRA 2QEJA 1QKZL 4ZUTB 4HCRL 2X4UB 4LCYB 4MD0B 3SO3C 3RWJB 3PIQA 3O41A 4Y1AD 3KWWA 2VDPL 3HA0A 3NH7L 1TETL 4KKCC 4ALAL 2X6MA 1D6EB 1M71B 3QQ3B 5DQ9A 4P2OA 4QRRD 5DI8B 4DGVL 5JA9A 1WZKA 4PJHB 3AM8A 3L3OA 1I8IA 4JM4H 4QT5A 3BVNA 1XIWA 4P5MA 1FNLA 2W9EH 4M02A 4NZDA 4NBYB 4AIOA 4JG0L 1X5JA 1P4BH 1A0QL 3FAWA 1H15B 2ICWA 1K4CA 3NCEB 4KZEL 5HHMB 4LSRH 4ODHH 4HS8L 4PG2C 5BZDB 5HGDA 1A02N 1A7NH 3L7EB 3QPQD 2NY5C 3BPCA 1MFBL 1EEQA 1WFNA 2CMRH 3MA7A 4X6CF 5J4MA 5K9OA 4N0RA 4OCYH 1FN4A 2ITCB 1QFWH 5F93C 5AEAA 3ZTJH 1CGXA 1OW0C 2C3WA 3RTQD 3MRQA 1C7SA 4OF0A 1IC7L 4RFOH 4K8RH 4KMTH 4EQ2A 3MV7D 2G60L 3I2CH 1CE1H 3WYRA 2UYLB 5D71H 2BCKB 5F6HJ 3SE9H 4XGZB 5HYSG 1HEZA 1EAPB 2YEZB 2P5EB 1BFOA 5EOCJ 4WI6A 3B6SA 3BDXA 1ZHNA 1CG9B 1ORSA 2ADJB 4JN1H 4GKNA 2ZUWA 1PX3A 3LN5B 4PJ9B 3DUSB 4YQXL 1JBJA 1ES0A 4V2BA 3VXUD 2DLEA 1PEWA 2Q86B 4YDKL 2OL3L 2W0FA 2R2BB 3OX8B 5D70L 2BJMH 4KKBD 3QEGH 1KIQA 5DEFB 3HMXA 4RDQG 1LEIB 3TH4T 1OD9A 1M6OA 2EDRA 4ZS6D 2GUOB 1AJ7L 4K9EC 3HKFA 5FA4B 4JVPA 3VFPA 2EE2A 3NACL 1CFTB 4PJ7B 4TTDC 2ICEA 1R5WB 1P84K 2H8PA 1JYWA 4ZXBB 4LSTH 3HZYB 4RFNB 3QJHA 1VA9A 5EOTA 2VL5A 1NEUA 1EHNA 4P2QD 3SHSA 1UXWB 1U3HC 4BH8A 2KQMA 1S9VA 5BS0A 1L7IL 2AJZA 2PW2B 2VXQH 3HUJA 1VGKB 3MLXH 5CSBA 2JJSA 1T1ZB 5TDPA 2VZTA 1W0VB 4TVPL 4DK3A 4ELKA 1KEGL 5A16A 5F6HI 3OG4B 4J3TA 5IG7B 1HHGB 1CFNB 1A3LL 1YNKH 3FQUA 2F58H 3HN3A 1U8NA 4EN3B 4ZUSA 1NGYB 2VE6A 3EYOA 4FXKA 1WZLA 4X0KB 1C8PA 2A74A 4MHHG 1RIVL 2XTLA 4AH2B 2V6HA 1GL4B 4P2QE 3U48A 3BDYL 1F5WA 3MO1A 5ID0B 3CUPB 5I18H 2A6DA 1FNGA 1OAYH 1P4IH 3DVGB 3F12A 2BHYA 4H0GA 5ESVA 2XN9D 3BKJH 4Y5VA 4MCYB 4L5FH 4U0RB 3OKMA 4UTBL 4ZAKC 3GIZL 4ZQKB 4POUB 3ZTNH 1G7QB 1MWAB 4P9HC 4RQQB 4WNQB 4JPVH 3VRJA 1JN6B 4JO2H 5CD3B 1JK8A 4R7DB 4QHMA 4FZEL 2PYFB 3VJ6A 4L3EB 2VZ3A 5C0BA 3HFMH 1M7IA 3IJSA 3AREA 4LCCC 1EHXA 2BMKB 1H0DA 1PKQB 1OAXL 2C26A 2XN9E 2VR4A 2KQNA 3T3MF 3LN4A 2ZUVA 4LGSB 5GJTL 1EBAA 2VKXA 1BJMA 3FFDB 4MCZA 4MB4A 5C0CA 2AV1B 4WEUD 2JCCE 4PB9H 3C8HA 2LU7A 3O4LA 3S98A 2RFXB 2X10A 5A2IH 4ODVL 3FCTB 2EIDA 4RA3A 5F44A 4NT6B 5JW4Q 5D93C 1TTUA 2R9HD 1JPGA 5D96C 4TTDD 4X8JB 4UU9A 5DD6B 4JM2F 3MYJB 4A6YB 2DKUA 3UTZB 7FABH 1UADC 5A2LH 5IM7B 2FGZA 3ARGD 1AP2A 1RURL 4U4BA 1V7NL 3MRIA 4X9FA 4YUEH 4MJ6B 3UZVB 2FRGP 2M2DA 3T0BA 5JQ6L 3SOBL 5GQBA 4KMQA 2B1AL 1BAFL 5L2JB 3S5LB 1CXHA 3BKCH 3UJIL 4PJFE 4E42B 4PG9B 5LGHH 4JPWH 2IAMB 2BY3A 3BEWB 2GI7A 1G7HB 4M62H 1XGQA 4X6EA 1U3JA 3PP3K 4N1CA 3HMWL 4YLQT 1H5BB 1ZA6B 1OGTA 3E0GA 5LQBL 5ITFA 4EZMA 4PLJC 1NCAL 5GSVB 1OAZH 1JWUA 3WSQL 3QI9B 3MRMB 4JQVC 1BFSA 3VRLE 4GW5A 4R9HA 4U6YA 4ZAKD 1TNMA 5EA0L 1D5IL 4X6CB 1TLKA 1A1MB 4P9ML 1P7KB 5MEOB 3VH8B 1SEQH 3TO2A 1BLNA 2A83B 4N8VB 3N1PC 3MREA 4APQA 3WO3B 1BQHB 2GY5A 3ULUC 3RA7L 3WEXA 1MHPL 2HYMA 4PJ5D 4DAGH 4JFDD 1WAAE 1UB5A 4MDJB 5EFIA 5C3TA 4ZFOL 4IRSB 2GCYB 1TPXB 4DZBB 2AJSH 5F7EH 1DBJL 2BXYA 3SKMB 5A2FA 4NWUL 3BXNA 2IGFH 3VGAC 2K9UA 3KLAA 4GRLB 2VAAA 4QLRA 3LKPA 1U93A 1T4KA 4NZJA 2EDBA 5CJ8A 2PO6D 4NQUA 1JPST 3NTCH 1JWSA 1AGEB 4PJ5E 4CMHC 4JFDE 4XCYA 4DUWA 2C9AA 3O3EB 1SJHA 1GHFH 5CP7A 4XPTL 2F53B 5HDOA 4BQBA 1F58L 4F9LC 4TUKH 1GGBH 1ZSDA 2X4NA 4HK0B 4WWKA 3S37X 2X1OA 4LIQE 1T0PB 5C0EB 3PGFH 1Y18A 1T22A 3IXTB 3LRSA 1UEMA 4X7DC 2R56L 5DJXA 1ZT7A 1JIBA 1KN4H 4LU5L 1FAIL 2FHFA 4JKKA 1RUKL 1ONQA 3CFJA 5F21B 1AO7D 2DIJA 3TC9A 1IEBA 1RZ8A 4CVZA 1JFQH 4HJJH 1J1PL 4R0LB 4R4FL 3V5KB 4BSVA 2GHWB 1QACA 2DQTH 5C08A 1UFUA 3BIBX 4PJXE 4OGXH 1YEEL 3I75B 4FS0A 4PJ9C 1DUYB 1KIUA 1EPFA 4KK9C 1U2HA 1KB5H 3QWOA 4M1DL 3HUJF 4EI5B 4XHJD 3ULSB 4F7PB 2VWEE 4IRJA 5GS2D 4XMLL 1QSED 3GSVB 2OMBA 4KPHH 4PLJD 2YR3A 3IFLH 1DDHB 1NFIB 4JRXA 2HLFD 1DSFL 4FNLL 4Z7UE 1ZGLM 1TZHA 32C2B 3MA9H 3D3VA 3VFTB 1N5AB 4MD5A 2RGSA 1VFOA 3BO8A 4JQIH 2H3NB 3BQUB 2AGJH 4G6MH 3MRBB 4RFNC 1QPPA 3L5XL 3BWAB 2E3VA 4WWID 5KSBE 4Z7OE 1T0MB 3OKDB 3W9DA 4IEFB 3GUTB 3W0WB 3ZKMD 2FYYA 3U0WH 1V3KA 3W82A 2VUYA 1T1XB 5FA3B 3BSZH 2WP3T 3PE9A 4P3CH 1J1OH 4NZRL 3ARRA 5CKGA 1P6FA 1ZANH 4PTUA 4FFVC 1JRHL 4O2FA 5EZJA 5BXFB 3ARFB 5E95B 2APXA 4BSJA 3V5DB 1MRDH 1RIHH 4PTTA 5HHMD 3PQYB 4K71C 5BVJA 4KAQH 4LEOA 3VXPB 1DQMH 2FB4H 2X9XA 4XNUL 2DLFH 5C0GB 1B0WA 1KTLA 3VD5A 3MGOA 4YGVA 5CZXD 4U1LB 1ULVA 4LCIL 3A67H 4R90H 2F54B 4NDMB 3LSOA 3HRPA 2A6IA 4U0RC 3EGSB 5T1KA 1WBYB 3WDIA 1WLHA 4DGIH 5JR1L 3RIFF 4WUKL 2HVKB 3MUJA 4N0YH 1DQLL 4Y8AA 3WHE0 2QKIB 1KC5L 4GXUN 3ZE0F 3RZCA 2OK0L 1LQSR 2Y06L 3QG6A 3EDEA 5HHME 3CDGA 3OXRA 3V52L 5HHVH 1T89A 2FCBA 4F9PA 4U1IB 3D25B 1AXSB 3QRGH 5CEYA 4Y5YB 2P5ED 1JMZA 3IDNA 3EOYG 3CAFA 3PJSB 5DO2D 1I85C 3PIQB 2X89A 5IGXL 4PJ9D 1H3TA 1UM6L 4QXUL 3QNYB 2EO1A 4RAUB 5DWUL 5DJCB 5GGRY 3JV5A 3RGVC 1IT9H 3QJFA 4KH2A 4M7JL 5DQ9B 3TV3L 1N5YH 1HYSD 3VXQA 1BWWA 3F7VA 1JGEA 3BVNB 5FGBA 1XIWB 5DHXB 4DFIA 4AK1A 2IWGA 2MTPA 4K7PL 4HZLB 5C0IA 1FYTA 4UT9H 4ZXBD 1NGXB 5CSZA 1NANH 1BGXH 3V6ZA 2J8UB 2ICWB 1AY1L 3KR3H 1EEUA 3QIBC 4HK3J 1NC2A 2GYSA 4LLVA 2P5WA 4JFHD 2EH8L 5FYKD 5EO1B 5IVXB 5HGDB 1A1NA 4N8CL 2YD7A 4Y4FB 4L4VB 4P5KA 2XNAB 5I15L 5K9OB 4PGEA 1FN4B 4PIRF 4Z77A 3BUTA 5MEQA 1IE5A 4EN3D 4Z8FH 5DD0L 3U9PH 1JV5B 3MRJB 2IAMC 4RAVB 4GXVL 1CR9L 1S7TA 4LHQB 5IOPB 3MXWH 4R4ND 4OF3A 4ODTL 3PP4H 3PHQA 4JFHE 2Z8RA 3EOAB 5FYKE 4UILH 5EZLB 4NBXB 1BP3B 2EH7H 2JELL 1T1YA 4J23A 2ZCKH 4X5XB 1B9ZA 3RWHA 3VXNA 5L0QC 5L6YL 3MXVL 2B4CC 1DBBH 4WHYH 3QI9C 4D0CA 3SDCA 3QT2A 3B6SB 1ZHNB 2R1XB 5TH2A 5EN2A 3I9GH 4LLWA 5IB4A 5FKPA 4ETQB 3I50H 3O6ML 4TYUA 2R4RL 1JZ5A 1BPVA 4RWHA 4L3ED 2YD8A 3KPQB 3HAEH 2E7BA 1KIQB 1CIDA 5ANME 1RULL 2VTFA 4IRSC 4M48H 2DKMA 1TPXC 3VFMA 2VLJA 1MCBA 3N50A 4Z0BL 5DJYA 2FD6L 2ICEB 5F1NB 1A6WH 1FNFA 4HBCL 4GRLC 2WWKO 3L3GB 5CCKH 3QJHB 1R3JA 3CX5J 4WO4B 5J13B 2XZAL 2VL5B 4H0HB 3SPVA 5BS0B 4L3EE 2ADGA 1R5VB 4CBPA 3MGTB 1EO8H 1ZA3B 1K8IA 2XY1A 2FDBP 3C6LC 1MJ8H 2KH2B 4ELKB 5A16B 2ATPB 4JKPH 2OR9H 1KOAA 2ED8A 3SGDH 1MAML 4OGYL 1G6RL 3LCYA 5DFVC 5F7DB 4P57A 3TNNB 4LLYA 3BUYA 1X6LA 5C0AA 2VE6B 3UYOD 4FXKB 2F15A 3DIFA 2FWOB 5D7LA 4H26B 4OFIA 5TGBA 1NAMA 4YHLL 3SGJC 4XNXH 3H2WA 2WMPA 1AGFB 2BOBB 1RHHB 2BRRL 4K23L 3VFSA 2RJMA 5TE6L 1XZ0B 1CWVA 4CJ1A 5F72S 1E6OL 1OSZA 4JO3L 1J8HB 4I77L 1VEOA 4M6MH 2WBJA 5E5RB 5ESVB 1RJZA 4WFGE 4WCYL 2ZCLL 3T65A 3HC3H 2V9QA 1RZGB 4HDIB 4R0LC 4G7YL 4NQXA 1U8OA 4C54A 5IB5A 2YUZA 3HNTH 2X1XR 4JKWA 1Z9OA 4XNMB 4QHMB 3VGFA 4EI5C 3UTSD 1ZLVH 1T5WA 4JAMA 3AREB 4LDOB 2FL5B 1H0DB 2VDRH 4Z7WA 3VE0B 4HIIA 1N6QL 3ARBA 3EO0B 4K3EH 3QI9D 1K4DA 2KPNA 1YN6A 3LN4B 2Y9RT 4JDVA 5EIIB 5EDXA 2OZ4L 4L4JA 3BQUC 4ONHA 3QUYC 2BK8A 3FOMB 2EO9A 4K7FA 5I1JH 4K94L 5EU3A 1B2WH 3O4LB 2X4TB 1UH4A 4PREA 3WJJA 3UTSE 5A1AA 5E00A 2OR7A 3RL1B 5T33L 4BFEA 1LK2B 4KXZI 4IRSD 3P73A 1XGUA 4OQTH 1JPGB 2J88H 4H88H 5MERA 5D1QD 4UQ3B 3WKML 4OZ4A 1F2XK 2AABL 2R2CA 4UU9B 1D5BB 4L8SB 4GRLD 5CHNB 5DRWA 2VYRE 1MCKA 3FO1B 1IGTA 4BA8A 1F8TH 3NAAH 3ARFC 4DW2L 1GZPA 1AP2B 2VABA 5JW3L 4LASL 1HDMA 4ONFH 1XCTA 3OXSB 1HH9A 3L7FB 2F53D 3V7AE 1HXMA 3JUZA 2FO4A 1FO0L 1HCVA 5BVPH 3WHXB 4AIZB 2H6PA 4KTEL 4TOYL 3CLFL 4RBPH 2EDDA 2XT1B 1B0RA 1J18A 4LGPB 4M5YH 3BP7A 3NABH 1BREA 1SY6L 5E2UH 1XGQB 3L3IA 4BFIA 1UCBL 2P45B 2VERN 3QXDB 4QNPF 4MQXC 3FMGH 4LLMA 3KYMB 1G7IA 2IMMA 9CGTA 4X6BA 4D0BA 1QFHA 5KTEL 2CJUL 1B6UA 3F8UB 1JWUB 4N0FB 3DX9B 3THML 3TBYA 3CH8A 2G9HA 5FYKL 3HE7A 5SX4H 1MIML 1LEKA 1A7PH 3RX7A 3VFRA 3RWDA 2A9NL 5L88H 3GI9H 1NJ9A 3TO2B 1BLNB 4JJHA 4APQB 2GJZB 1HKLH 3ULVE 2GTWA 4EI5D 3QDJA 3NCFB 2C7UB 1FLRL 3P40A 1KFAL 4N9GB 1B0GA 3GMRA 5GGQH 2OS7A 3K4DA 4NQVA 1KPUA 3C87A 4ZFZA 4J2XA 5CJ5A 1OTSD 4WFHD 1MI5D 3AM8C 5CGYD 1WUNT 4GRMA 4R26L 1XIWC 3QIUA 1ZE3C 3T0EB 3PHOA 4NNYB 3EO9H 3RHWK 1WZMA 2G5RA 3BQUD 3VGEA 4RDQF 3UC0L 4YXKL 4MJID 3LKPB 3NIDE 2AKRA 4N90D 1T4KB 2QADD 3W0WD 2DQGH 2YS4A 3QO0A 2X4RA 5DZNA 4Q2ZB 1IC4L 5ALBH 1C5DA 5HY9B 1SJHB 2Q7YB 2IBZY 1RHFA 5K33A 3BN9D 1MI5E 4OF6A 3O81A 4UT7L 4ODUA 1ZSDB 2BDNL 4JREB 4QRTA 1Q0XL 3RY6A 5CJOL 3KLHC 2MMXA 2DQDH 3NA9L 1N4XH 4MJIE 3ARFD 3AY4A 4LLDB 4J8RA 5DJXB 1AKJA 1BX2A 1ZT7B 2VXSH 5DURB 3W0WE 3K8MA 1SBSL 4YFEA 3X13A 3MLYH 2BERA 2BVEA 3D1MC 3MJ9L 3V0WL 1LHZA 4CVZB 5BMFL 2VH5L 5CP3H 4DKDC 2B2XL 4X9GA 1SQ2N 4BSVB 3CNKA 1CQYA 5C08B 5C0DB 5FV1L 2FBJL 3U46B 1VSCA 4OIIH 4D8PA 4NC1C 1FZKB 1ZVSA 2FJGA 2VISA 3MV8E 3QWOB 4A2MA 5TFSL 4R97C 4HIXH 3A6OA 4TPRH 4JRWA 2NX5E 4A6YL 4Z18A 4OZFG 4NZTL 1WK0A 2GSGA 4MMXC 4EBQL 4PLNC 3REWA 4MD5B 1BHGA 4JDZB 4JKLA 4Q6YA 4B53A 4GG6E 3BO8B 1E4XH 2FEEL 1FVCA 5DJ6B 5JORA 4HIEA 5E8EA 4Z7NE 5DS8A 4EDWL 5J13C 4LFHG 3ZT7A 4HG4J 1QVOB 1CBVL 5MEPA 3MLTB 1NLBL 4JFEE 4ZNCD 2BNQD 1A1OB 4G6JL 5F1IB 3INUL 4XX1E 1WCBA 1I1CA 2JJSC 3LKSB 3MV9B 3D0VB 1I8LA 2WV3A 4PRPD 5HHNA 3UBXI 5EB9A 3U6RA 2AW2A 1PQZA 2R1YA 1JF1A 4NNXB 2IPKB 4OFKA 5EZJB 3D18A 5GS1A 1X5AA 4F7MA 5D5MA 1BOYA 4OZIB 5BVJB 4S1QH 2DQEL 4JEGB 4Z7WF 2BNQE 1MCNA 3UEZA 5F9JA 4OZHA 3HRZA 4M5ZH 4Y4FD 4L4VD 3JTTB 3DV4B 2YXFA 2VRAA 4PRPE 1NEZG 4OLZL 2BVYA 2WWKT 1UJTA 4J6RH 1XF3A 2ICES 2VLKA 1Q8MA 1QBLH 5GRVL 4RGNB 2FH6A 2CR6A 2VL4A 2P8MA 1UENA 4RMWA 5H94A 3QG6B 3WNKA 3FKUS 3DPBA 5IVXE 2J6EA 3AREC 1XF5A 1ZAGA 4E0RB 3VXRB 5CEYB 3PF2A 3BPLB 4QCIA 4CVXB 1NBZB 4HGWA 5KS9A 1HNFA 2DQHH 1IGIH 3RRQA 1ETZA 5FYLH 3IU4H 2ZPKH 5IQ9A 2R0LH 3KDMA 4OCSH 3VXQB 5I2IB 3IDMA 2GAZA 3F7VB 3IDYB 3GBNL 3RVUD 1ED3B 5FHAH 3KYKH 1JGEB 3LHPH 4PP2A 4UNUA 1CE6A 2NPLX 1KEML 1RPQA 1C16A 3KPSD 4L8SC 4ODSL 1S7UB 4CNIB 5CKAA 5CSZB 4CU8A 1WVZA 2NR6C 3TT1H 2UY6A 4WO4D 1G9NL 1TJGL 2QHLA 5J57B 3QUML 4FQ2H 5HVHB 4DTGH 1ZT1A 1X3DA 2D7NA 2W9DL 4AEFA 1NC2B 3EYUL 4HXBL 4LLVB 1MY7A 4YHNB 4EOWH 5TDOB 3CFCL 2PNDA 5DT1L 2HFTA 5IFJB 2JIXA 3VFUB 5EU5B 4Y4KA 3TJHD 3K2UL 2XQYK 1LEGB 2Z93A 4P5KB 5FO7A 1FC1A 5CEXA 2DDQL 2Q20A 5ILTH 1FRGH 2X2YA 1EBPA 1L7TL 1JI2A 4H8WC 1AE6L 3H3PH 1AI1H 3KPSE 5I1GH 5CAYB 4L1DA 4L4TB 2VJXA 4NKIH 4HQQL 3RWCB 4RX4A 3FB6A 4OSUH 1J0YA 5E03A 1BQLH 5ID1B 2APBA 1ACYH 2PKDA 3GM0A 4XVSH 1RZ7H 2ED9A 1J8HD 3PWPB 4G42B 1F4XH 2CDFB 1T1YB 4Q74A 3RWHB 2IC2A 4K3DH 3WIFA 3BGAA 2L7UA 4QHUA 3EYQC 4D0CB 4X4YA 3SDCB 1F4WL 2YPLD 3Q48A 5TH2B 3L3JB 3JV6B 2YPKA 5DUBB 3V4VH 5EN2B 2R0KL 3U4AA 1ACZA 3SGKA 3FB8A 4X6DA 4J4PC 4C57C 5FKPB 1MF2L 4APQC 1A6UL 2DQIH 4G3YH 2C1PA 2XTJB 4XI5D 1EJOH 1UWGL 1BZ7A 5DC9B 3WUWA 3ROOB 3ARED 4RMVA 3UPAA 2R4SL 4QXGH 1T04A 1U8MB 4LARH 2J4WH 5IMMA 4O5LL 5ICXA 1G84A 3QWRA 4MXVE 2YPLE 3P11L 3RVXC 1RV6X 1FNHA 3MRFB 4XP6L 5I8KL 2YD9A 2Y36H 1BM3H 4BUGA 3CX5K 4MAYA 4OLVL 3E8UL 3SPVB 4X4MA 2NY4B 1I1YA 5EU6B 2AK4A 5DA4A 2QSCL 4J1UA 3GSUA 3CXDL 1KCRL 2EEBA 4H1LH 2P8LB 25C8H 5T3ZH 3FFCA 1NGQH 1UYWH 4HJ0C 4JREC 2DYPA 2BOCB 4XPGL 4P57B 1RUQH 3WIHA 2NR6D 1FDLH 5BV7L 2UVEA 1TTFA 3GSNL 1YEJH 4M1GL 2GK0A 3EO1B 3P77B 3IETA 1DUZB 3SJVA 4WENB 4FTVD 3HZKA 2EKSA 3C9NA 5DSCA 1A4JA 5E9DA 5HYJB 1HIML 3G6DL 2I5YH 1I7ZA 1BVZA 1I7RA 1MFCH 3STLB 1UM5L 1QBML 3U7WL 1P1ZB 5FB8B 1OWRM 3MROB 2DQJH 1RJZB 1D5ZA 1T20A 3QPXH 1PG7X 5D2NE 5KZCB 3CSBA 3CDFA 5F3HA 1KB5B 5IBUB 5HHXL 3GSXB 4NQXB 5DVKA 1QO3A 35C8H 5ERWB 3D39B 3GMPA 3SKUD 3QDME 1IQDA 3TVMA 3T77B 1G6VK 2BSRB 4M7ZB 4PV8B 1Q9LB 4FTVE 2FX9H 4QRPA 1XF4B 4QRUB 1CLZH 3O8XA 2G2RB 3F7RA 4JAMB 3TJEH 2H2PD 4NN6B 3RU8L 4Z7WB 4HIIB 1BQUA 3ARBB 2EDYA 2RAMA 1XGTB 3WFBL 1U8KA 1HHIB 3B9AA 1YJDC 3MUHL 4H20H 5D5MF 5D9SB 3ZMRA 2ZJSH 1INEL 1AGBA 4ZSOA 4ONHB 1OVZA 4J4PD 5HGBB 3T2QA 4ZS7H 4K7FB 5CS7A 3TYGH 3WJLA 2Q1EA 5JXEC 4OZHF 2XQYG 3L1OH 2GKIA 1AC6A 4NYLA 3SKJH 4DN4L 3P4OA 4XRCA 4K2UL 4JFPB 2ARJQ 4CMMA 3X3GL 1WICA 4WEBL 5GRYA 3FB7A 1XGUB 4F3FA 1RZJC 4NO0B 3T0ED 1S3KH 2CUIA 4M7LH 3R8QA 1IQWH 4P2RA 1PDKA 5EIQA 3RVXD 3V2AR 1IM9A 5DRWB 1EFXD 4AMKL 2W38A 5JHLL 1HSBA 2OTWB 3CPLB 2XKUA 3JV0A 4MMZC 1GZPB 1AR1C 2IFFL 3MNWA 1K85A 3TIDA 2E7LA 3HNSH 1S8DA 5C0NC 4OTXH 3AVEA 1HH9B 1BJ8A 4XXDB 4MNGE 4NM4H 4WHTA 2QQNH 4PJDE 5H2BB 1BEYL 3RNQA 3ABZA 2VQ1B 4HLJA 3IKCA 3T0EE 3HI6H 5KS9F 5HI3D 2X1PA 4IRZH 5HD8C 1U6AH 3O45A 4MA1C 4LEXL 4G7VH 3OB0H 3CD4A 4PJCE 4ODWA 3L3IB 4AEHH 3B3IA 3J7HA 5DURD 3C6SA 3EDJA 3UZQA 3GMNA 2XV6B 3OAUH 1CD0A 4X6BB 1WBZB 5IMOB 1T89C 3DX7B 3GM8A 4GKSB 4KTDH 1AXTH 1FFNA 3V4PL 4F9PC 4BH7A 1JPFA 1I9JL 3BPLC 4J12A 4OFPA 5H37G 5DZLA 3VXOA 4IM8A 3JWDH 1LEKB 3GMQA 3KPLA 3Q6GL 5JZ7C 1A5FL 4U1KA 3BH8B 3KPOB 1YEDA 1D9KD 3KXFB 1ZK9A 2ZKHL 1MPAL 5DLMH 3MOBL 4OB5L 1WWWX 2LAGB 2FZ3A 5DTFA 1INDL 3ZDZE 5D1ZA 4QY8B 1KPUB 4ZFZB 4Z7VE 5DMIH 3IDYC 3MRDB 5F88A 3NH7H 2ORBH 4WTZG 3NZ8A 5FGBC 3QXUA 2Z92B 1NCWL 3QIUB 4YHPA 3F5WB 1AD9B 3PHOB 3DOSA 1OGAA 3TN0D 4P5TB 1W72A 1YZZA 1MNUL 4GAJH 3V9FA 1FPTH 4U0QB 2E6QA 3K4AA 2PCPB 5F7LB 4J3WA 4HUVA 5HVHC 5JXED 1PG7W 4WTXA 5B3JF 2NY2B 2X4RB 4TUJB 3MV9D 4LQFH 3C5JA 4JFQA 3WNPA 2ZNWA 4XXCA 3RWIA 1EVUA 1KXVC 1VDGA 5EOQL 3L95B 3FOLA 4X6DF 1CDJA 1L9MA 3DHMA 2BVTA 2MPAL 1U92B 4FFYH 2AXGA 1K8DB 3GJEB 1XCQB 3NA4A 4YHKL 4OZFA 4LBEB 2WINA 5GRJL 1BX2B 1DQJA 1AR1D 1VPOH 1IFHL 1MY5A 3R8BB 3X13B 1T2QH 4QEGA 2Z8SA 3MV9E 4EI6A 4YBQD 3WE6A 2HT3D 2IANB 3MC0A 1RJYA 4WI9A 3SDCC 1LDPH 3JXAA 1WBXA 5FM5O 2IADA 1FNSL 4LLAA 4RGND 4U6VL 3HAEB 5F7KC 2FJGB 2O5XL 4R96B 2VISB 5LGJA 2EEDA 3QNZA 5E1HB 1JGLH 2OI9B 1FL3A 1TTGA 2JTDA 2HFEB 3BIKA 3FQXA 2XTJC 1NKOA 2NY7H 4CAGA 3ESUF 1P69B 2GSGB 4NQTA 5E99L 3VXRD 4LNRA 2HJFB 5I0DA 4YDKH 1A7OL 1NGZA 1D5XA 3HG1B 3NPSB 5JORB 4HBQA 1XGRA 1NUDA 1YEIL 4RGNE 4XCFH 1BD2D 4Q9RL 1S7RA 3QZWA 3OJMB 5JOEA 1DFBL 1FZOB 4N5EC 4FP8L 4PJAA 3V6OA 2NY4C 1NEZA 1PG7L 1WCBB 5I8EB 4GRWF 3P9LA 5GHWL 1DLHA 4M8VA 3BP5B 4KJQD 5D2LA 4F7CA 4OJFL 1I9EA 3PNWA 3C5SB 3RWEB 1KCKA 5A3ID 5C6TH 3MQIA 2R1YB 1L7IH 1U58B 2KKQA 3IU3B 2NMSA 5DA0B 3NMEA 2XXCB 2XXMB 2C3VA 4NQEE 1F6AA 1BD2E 3BEVA 1S7QA 1GSMA 4NQCA 1LMKA 3FO2A 1QFUL 2ZOKB 2R0ZH 3OAZK 3L9RB 3QUXA 3MV11 3FN9A 4R4BA 4WUUA 4JPIA 3I6KA 5T1MB 1KYOJ 3GRWA 4C56A 2YUWA 3LZFH 4F7TB 4HWEH 3WXWH 2V5RA 2XA8H 5IHUH 3BGMA 2J5LB 4UB0H 4C83A 3LKQA 3O9WB 1FV1A 4JM4L 3OJVC 2J8OA 4XNZB 4JDTH 4OD1H 1V3MA 2W9EL 4L4TD 3DURA 1Z0NA 2YPVH 5DHYA 3RNKA 3MRLB 4G9FE 2P8MB 3WLWC 1P4BL 2BNUA 4TN9A 5HGHB 1T66C 1OL0A 4I0KA 4WU7A 4NRXA 4LSRL 3PWPD 5DZOA 4ODHL 4TSCL 4K3JH 3PGDB 4NN6C 5DD5H 1KNOA 2GJJA 1A7NL 3ARBC 3CU1A 1F6FB 1I3VA 1JTOA 4QCIB 2CMRL 2QQKH 5HHPA 2BSTA 3KYNB 3X11A 4NKOA 4OCYL 1DQTA 1DQQA 1IBGH 1QFWL 4KWUA 3GSWA 5ICZA 3STZB 4L4TE 2DKSA 1T7ZA 4EXPX 4YDVB 1LK3H 4QWWC 3ZDXF 1ETZB 3HHRB 4ZOEA 1KGCD 2VQTA 4RFOL 4K8RL 4KMTL 3WJJC 4NCC1 2GAZB 3LB6D 3PWPE 3WBDA 4UBDD 3I2CL 1CE1L 4ERSH 3RPIB 5D71L 4PP2B 1YPZA 3SE9L 2O61A 4S2SB 4KI5E 1XGPB 4RGMB 1R5IA 4JRYD 3ARSA 4ODVH 4BZ2H 4JN1L 4O51B 5CUSH 3L3KB 3IAQA 5ENWB 2K3TA 5TF0A 4GLRI 4AM0A 6CGTA 2NY4D 1KGCE 2DRUA 5EU6D 4G8GA 1I3UA 5TF1H 2BJML 3QEGL 2OXGA 2Z93B 3GSOA 4R2GB 1FZMA 1KJMB 5B38G 4MXQC 3TBSB 1UG9A 1GPOL 4OFDA 2PXYB 1TJHH 5AZ2H 4JRYE 3S96B 2FIKA 1TMCB 2P4AB 4MVBC 4OI7A 4LSTL 3DGCR 2JE8A 3O2DA 3QULA 3W9EA 2BY2A 5DXWA 4GQPH 2C4FU 3QHFH 5HYJD 4XH2B 4JY5H 1P7QA 4GO6B 5EU6E 5HGGS 5J6GA 2VXQL 2MNUA 3MLXL 4J3OC 4FOMA 3WXVH 3JWOC 4KKAC 3UJJH 3WIFB 5KZCD 3QHZH 4QHUB 3UTQA 2C1OB 1HI6A 2P7TA 1CYGA 5KSAB 3KPRB 2YPKB 3HE7C 1EJ6A 1YNKL 4HMEA 3D39D 4L8BB 2F58L 4HCRA 2HFGH 3UYPA 1IGMH 4PY8J 3VGDA 4AENA 4OLYH 3UO1H 2Z31B 3EYVB 3DSFH 3PWUA 2AXFB 1T66D 3NCJH 2C1PB 2EE3A 2B5IB 4NNPL 4D9LH 1BZ7B 3WNOA 5HYJE 3WUWB 4P9MH 1BIIA 4TULH 5I76A 5I18L 4RSVA 3VFOB 1OAYL 1P4IL 1TQCC 1ZGLA 1LO4L 3H6JA 5HGAB 3SDXE 5IIEA 2V17H 3QIUC 3BKJL 3OB8A 2IBGA 1GVIA 4L5FL 4P5TC 4HH9B 2Z91A 1CICB 1NFDA 1YN7A 4S0TD 3D39E 3B2VH 3ZTNL 5FUCE 4QWWD 1AHWB 2PF6A 4MAYB 1MCEA 4JPVL 4JO2L 5DEGB 2WNGA 5DGRA 3N06B 2NY2C 4ZYKB 2AK1H 2H45A 5C9KA 3B43A 3QBTB 4PGDB 4J1UB 1DBMH 2A9MH 1GC1C 3MR9A 3HFML 4YFLI 1YY8A 4ETYA 4M1CC 2SEBA 4NO0D 5C09A 4PJGB 4MNHB 4I2XB 4DUXA 1QSFA 4YPGA 3RY6C 4CKVX 2DWEA 3GKWH 3AY4C 1FG2A 4NN7B 1DBAH 4PY8I 1F58H 3VI3F 3G5YA 3HZKB 2EKSB 5DSCB 4PB9L 5IR1B 4WI8A 1ITBB 1I7ZB 5EU7C 3ALPA 4HGKC 2F8OA 1IC5H 3CDCA 1KJ2H 1DEEA 2R56H 4KUZH 4I0PB 4PYGA 4MXQD 2UZXB 3GHEH 1JHLH 5JNYB 4LU5H 1RJLA 5IESH 1FAIH 1QO3B 4GAYB 1UQSA 3O6FB 3MJGX 3CVHH 2EC8A 2HTKC 3GK8H 4V1DD 3GMPB 4PJAF 1K5NB 3RWFA 7FABL 1MCLA 2OI9C 3H42H 4HLZG 4HJGB 4QRPB 5D2LF 4GBXB 3FQTA 5DK3A 1YMHA 4FQHB 4YUEL 4KKAD 3RDTA 3RUGA 1F02I 3PP3H 2CLVB 5E5UB 3PGCA 3BKCL 1AGBB 4ZSOB 1JYVA 3NIGE 3RHWF 4V1DE 3REVB 1ZKAA 3KXFD 4JPWL 5LGHL 1NC4B 1BVKA 4M62L 4WU5A 1K3ZA 1XR8A 3OKOB 3EHBD 1FJ1B 1IGCH 2DIBA 5DJ2A 4KDVA 3D69B 1I8LC 3HB3D 4F3FB 1KB9J 2CRYA 3CK0H 1OAZL 3WLBA 1A9EA 4P5TD 1DR9A 4NQDA 4S1RH 2YXMA 1MCHA 1P5VA 3V8OA 1CLOH 3KXFE 1SEQL 1D3CA 4DVBA 5IBLC 2XRAH 1HNGA 1YEFL 3TIDB 2CGRH 1S8DB 4MNQB 4DAGL 5MI0B 3NCYS 3VGBA 3PWNA 3PDOB 1H3XA 4M1CD 3BH9A 3CFDB 3U4BH 2AJSL 4R7NA 4XNZC 5F7EL 4KROB 3P30H 5ELIA 1UKQA 3O45B 3UTTE 2IGFL 3DJ9A 5I0ZA 3QEUA 5SWSE 2NW3A 4NRZB 3DNKA 4U1GB 2DWDA 4WTZA 4HKZB 5GSRA 4OF5A 3NTCL 1H3WM 1YPZF 2WBKA 3QUZA 4LMQE 4WRLA 1NGPH 1REIA 4UAOB 3EYFB 4BH7B 1JPFB 1VFAB 1GHFL 2ENSA 2IAND 3PL6A 3MNVB 4PPTA 4X6FA 1JYXA 4TUKL 1GGBL 3KPLB 2MWCA 5C0JB 1S5HA 3LRGA 4UIKH 1B3JA 1K2DA 3PGFL 1I7TB 4U1KB 4OKVB 4WV1A 3W5NA 4PRHA 3BWUC 2NY1B 5JPNA 3OGCB 3IXAA 1D5MA 1KN4L 3PV6B 2LVCA 5F88B 5FDWB 3S9DB 1XF1A 1MFNA 3TIEA 3VGHA 4GMSH 5IHZA 4M7JH 2IANE 4UV7H 4RGMC 4QTIH 2Y6SD 3HG1D 1JFQL 4HJJL 1WEJL 2DQUL 5F9DC 4LOUD 2DQTL 3PABB 4OGXL 4XP5H 5BQ7A 2I07B 1KB5L 1PEZA 2HT4D 3P3YA 1MSPA 3E6FA 1OSPH 4Y4KC 2COQA 4KPHL 2BXZA 1KLUA 3IFLL 3RWIB 4R2GC 1W8OA 3FOLB 3MA9L 3RQ3A 3ZYOA 2AXGB 3HG1E 2Y23A 4JQIL 1YDPA 2AGJL 4PRIE 3RBGA 1NDGB 3GI8H 4G6ML 1KT2B 3ALXA 2DBLH 1PYWA 5IBLD 4XPHH 1VCAA 2JJTA 3QFDA 3JWNC 4ZODA 3U0WL 5IW1A 2BVOB 3ARXA 1ZHKA 3F62A 3P0YH 3QB7C 3BSZL 3O9WD 5E6ID 1FORH 1HHHA 1NFDF 2QQQA 4LIQH 4O2EA 3TYFA 3ZE1E 4P3CL 2Z0BA 3U0PA 5EWIH 3G9VA 3G6AA 3SGKC 2D31B 1FCGA 1ZANL 1QFWM 3GBMH 4JY6A 5ACMA 2FO1A 2WLYA 3BIKB 5DJDA 4XVUD 1MRDL 1PW3A 1RIHL 4GOSA 5J3HD 4KAQL 5C8JB 4U05A 3ZYIA 1DQML 2FB4L 4GKOA 4POYA 2DLFL 1OP3K 3BD4A 4AT6A 3OHXB 1KTDA 4OCXH 3DV6B 3RTQA 3O6MH 3A67L 4R90L 4B50A 4ZFOA 3OKKB 1A8JH 3BRDA 1XGRB 1I8KA 3N9GH 4DGIL 4HC1H 3MV7A 2D9CA 3QZWB 1AXIB 4N0YL 4MAYC 1VFMA 2ZUSA 2EC9U 4HUXB 4MQSB 2XA3A 2NQCA 3P9LB 3IDXH 3GEWB 3QXAA 2MSPA 5D2LB 5HHVL 4UV4H 3BOVA 1HKFA 1R3LB 5F7YC 5GRVK 3QRGL 2W60B 5LAXA 3VXUA 1BZ9A 1SVZA 3L3DA 3WNMA 1G7MB 3IGAB 5IROA 4FXLA 1FL6B 3BEVB 3WIHH 2VXTH 2VO5A 1VACA 1IT9L 3MLVH 4LKXB 2HMIC 3B4NA 4R4BB 4LPYA 3P4LA 1N5YL 1MHHA 4HEME 5GGVY 2QSVA 3RUGF 3NBNA 1L9NA 3OPZH 4Y2DB 1KYOK 4RISH 3BGMB 4R2GD 3CZJA 5CILH 5F7HA 4FQXB 2EDJA 4I0PC 4U7KA 3FRPA 1OF2A 4MB3A 4P2QA 2PXYD 4GRWH 4XZUA 3T3ME 3A6BH 3DURB 5DHYB 1Z2KA 4UT9L 3E2HC 2FECL 3RNKB 1LGVA 1BGXL 4Y19B 1IKNA 1BF2A 3KR3L 1F45A 3K0WA 5H35B 3O8XC 1CZ8H 2VZOA 3ECBB 5FYJE 5C0RH 4KFZC 4NO3B 4XPFH 1QR1B 4FRWA 5DEZA 5KSAD 3KPRD 4EUPB 3V6FA 1DQQB 4GKZB 3GSWB 5ICZB 1U0QA 3NOIA 2QSQA 3UBXA 3VXMB 5TJWK 2DMBA 3U9PL 4Z8FL 1SYSB 4JJ5A 5BO1L 2Z31D 4G6KH 4GSDH 4AEIH 2A73A 3I02B 2XN9A 2PYEB 5FOBA 5KSUA 2UZIH 3MXWL 4PR5B 5GGVH 5B38A 4HW6A 3PP4L 5K9KA 3T0WA 5KVGH 3TBWA 3H7BA 5CBAA 4UILL 3MLWH 2XICA 2EH7L 1OD7A 1YPZB 5LWYH 1QFWI 2ZCKL 4ONGH 4CDHA 2Q6WA 2JCCA 1DBBL 4I4WA 5IHBA 5CEZH 5E8OA 1U3YA 1CICD 5T33H 3I9GL 5FHBH 3AU1B 4G8IA 3G04A 1HE7A 4AM0B 3I50L 5IW6B 1EX0A 5EC1B 3E1F1 5TQ0H 2E7LC 5E2WH 5C1MB 3ZT6A 4LSQH 2WUCH 2FBOJ 2X4QA 3KAAA 4M48L 4TTGA 3S5LG 3PWLA 4W81A 5JW3H 4ISVB 4KROC 4LVOC 2RCSH 1A6WL 8FABA 2VIRA 1AIFB 1G9MC 5CCKL 3QULB 1RZFH 4U1GC 5DMKA 3DI2B 4WW2A 1BBJB 3FQNA 5E1AB 1KSRA 5J6GB 1C12A 4PJFA 4UTAH 1EO8L 1J05A 4I0PD 4P99A 1UA6H 1MJ8L 1HI6B 2P7TB 1JGDA 4JKPL 2OR9L 4HFWA 1NCNA 3ARGA 3O6FD 3QO1B 5I16A 1YQ2A 1IAKB 2NXZC 3VH8G 1GGYA 4OUUB 4AENB 3LQAL 4N8VG 3O4OB 1BQHG 3MBEB 3PWUB 5IJKA 2CO6B 5J1TC 3DX6A 2NY1C 4XNXL 2CUHA 1IAOB 4GBXD 2CKBH 3SO5A 3NPZB 1DEDA 5I76B 3V7AG 3RVVC 2VKWA 3ZYZA 4M6ML 1C5CH 2AI0L 5C07D 3GJFA 3HC3L 4NC1E 1BFVH 4X98A 3FZUC 2DLHA 3L5IA 5B4MD 2IALA 3KGRA 5I8CA 2Z4QA 1N0LA 2IFGA 1NC4D 2EYRB 1XGYH 3ZKND 3HNTL 1ZHBA 3AXLA 4NN5C 4PD4K 1E27B 1RI8A 3UXFA 1N3NB 5F6IB 4FQIH 2VR9A 3KJ4B 3SE3A 3MR9B 1N7MH 5A2KH 4F2MA 3M1BA 2VDRL 4K3EL 5CMAB 5C09B 5C07E 5DRXB 4GS7B 4KK8C 4XBGA 4Y5XB 1IAIH 1KLGA 1DTUA 2XZQH 2OCFD 1QSFB 3K4ZA 4YPGB 1TVBA 4KUCD 4XPAH 1GOFA 4RZCA 1NCCH 5JA8B 4PJ5A 4AG4H 4JFDA 4LCCA 3QR2A 3S4SB 1F2QA 3FT3B 5BCAA 3G5YB 4Y89A 1CGWA 3UDWA 5L8JB 3DO7B 2APTA 3G5VA 3HUJE 1B2WL 4X4XA 1JHKH 4MNQD 2NYYC 4YDIH 2R23B 1V7MH 3DVNB 3K8LA 3NA9H 4M3JA 1KN2H 3VFNB 1KIRB 4OQTL 1HQ4A 2J88L 4H88L 4NKDB 3WFCH 1A6TA 2PO6A 4FXGB 3CLEH 4HIJB 4BSWB 1IGJB 5F3BB 4DJMA 3IS0X 1F8TL 3ARDB 3NAAL 5DVLA 5I1HH 2B2XH 3U1SL 2B0SH 1NMBH 5DJ0B 4W6WB 2DD8H 1YMHB 4MNQE 2OL3B 3QXTA 3DRTA 4PJXA 5JO5A 4ONFL 1E4JA 1PVHA 1WT5A 2XY2A 1AGDB 1X4YA 2W0LA 3MRGB 1I3RB 4MA7H 5B21A 5FYLD 5BVPL 4JHBA 3MODH 2MCG1 1A6ZA 1JVKA 4M5YL 4QGYA 5BOZG 5E2UL 2NY1D 1XR8B 1AO7A 3V6OC 3FN3A 5B8CA 3FMGL 5HI4C 1MQKH 3RVVD 1ZT4A 3LKRB 3T2PA 2V7HA 1CD1B 1NLBH 1R3KB 4WIQA 5KSBA 1KB9K 3WN5B 4YHOH 1MHCA 1M05A 1NBQA 4RMSA 5TE4H 1FZJB 2R1WA 5FYLE 2DI7A 1GGUA 3QA3B 1G6RA 1QSEA 1A7PL 4Q7DA 5E08H 5B39B 5L88L 3GI9L 4DVBB 2X4OB 1TJIH 4KY1H 1HKLL 1ZVYA 2E5EA 3ZE0E 1HH6B 4MD0A 2X4UA 5GGQL 5LG1A 5AWNH 2M8XA 2O93L 3C5ZD 4KK8D 1D6EA 3LEXB 2OM5A 3AMKA 3DSNA 1M71A 3QQ3A 2HJKA 3C8DA 1HHKA 5FIEA 1U8PB 3EO9L 3RBSA 3UAJD 2DJ4A 2NW3B 5LXGH 3SGEH 2YA2A 2YD4A 2ARJB 2DWDB 4PJHA 4Q0XH 2DQGL 4ENEC 1A6PA 5EO9A 2NYYD 4XX1G 1C08B 5ALBL 2JCCF 1NBVH 4KRNA 3ZSSA 2D2OA 1PKOA 3VWJB 3TFKC 4PJBE 3RVTD 1OOAA 1G7LA 1S5HB 2FX7L 1Z3GH 1KACB 5F9WB 4LSUL 5BZDA 2HJLA 2DQDL 3L7EA 4HWZB 1P7HL 2OZ4A 1JTPA 1N4XL 5DRNA 1N6UA 5JPNB 4DEPB 1HK6A 2VXSL 2ITCA 3D5OF 5GZNC 3MLYL 4HSQA 2H32A 4KKNA 4DZ8A 4NRYB 4KK5C 5JW4M 5J9PA 2GITA 3CFBB 4ZTPH 4I3GA 1EEZA 4OIIL 3MNZB 3ULVH 2AEQH 2UYLA 4WW2F 2BCKA 2CK2A 4PJFF 5D7KD 5FYKU 5T3ZD 1U8HB 2P5EA 1KUMA 4HIXL 2IMNA 4CRPA 4TPRL 1C1EH 1CG9A 2FLRT 1ADQH 1KLUB 5HYFA 5GXBB 4PJ9A 3DUSA 1K3IA 4WI5A 5EU4B 1I7UB 4NHCH 4NJ9H 4L3AA 4MYWB 1MRFH 3OX8A 2R2BA 1E4XL 3VRLF 5INCA 2BP3A 4AYFA 1LWRA 1PYWB 1YYLH 3QFDB 2YHGA 3B9DA 3ZHKA 2GUOA 1WWAX 5D7KE 5FA4A 1FFPB 4OFYD 4Y2DD 1CFTA 1EZVX 1R5WA 4JR9H 4FQXD 4ZXBA 4W4OA 4AIXA 2LU3A 3S8WA 4MAUH 3MRNA 3EFDH 1UXSB 3MCLH 4YHIB 2DMCA 1UXWA 3DVFA 1SVCP 5HI5C 1TFHA 2PW2A 1U8IA 1VGKA 2HG5B 2BRQA 2X5PA 2G5BB 1T1ZA 4Y19D 5CINH 1W0VA 5DJDB 3SQOH 1Y0LB 1G0YR 5IG7A 4S1QL 1HHGA 4YFDB 4Q97A 1RZIB 4AT6B 4EN3A 1NGYA 1KTDB 4IDJH 2LAAA 4M5ZL 2APWA 4X0KA 1D6VH 1FGVH 2WUBH 3MUY1 4AH2A 4X7TA 4XP4H 1CDIA 1NDMA 3RKDC 1GGCH 1X5KA 4J6RL 5ID0A 3CUPA 3TO4B 3VXMD 4LSVH 1QBLL 5ANMA 3DVGA 1NGWB 3LDBB 4G43B 2PYED 4MCYA 1HYRC 3ZL4H 4O58H 2AJUH 2NY6C 3KJ4C 5MEND 4ZQKA 3ZO0A 2HT2D 2AJ3B 2OYPA 3S3SA 4RQQA 3D85B 4WNQA 5CD3A 3UPRB 1BZ9B 1QBAA 2ADFH 2PYFA 3HNVH 4S1SH 2X70B 4L3EA 2Y7QA 4X5WA 4Y2OA 3VXME 4K3HA 3MZGB 1F3DH 5J8OA 1PKQA 2DQHL 1IGIL 4PJXF 3BN3B 1QEWB 5FYLL 1MHHB 4XPGH 3IU4L 2ZPKL 4K3GA 3IAGC 2R0LL 4OCSL 3BZEA 1BF8A 5MENE 1QA9B 3FL7A 3CVHB 4XCCH 3BZFB 5FHAL 2VDOH 3FFDA 2ZSWA 3KYKL 3LHPL 5DQJB 2VSCA 3MJ9A 1OF2B 4P2QB 3I85A 3O0RH 2X1QA 4XZUB 3WIIH 2GJ6E 5LBSH 5J1AB 2RFXA 1VEMA 3FCTA 2WZPD 4NT6A 1EUTA 3TT1L 4NWTH 2YBRA 4FQ2L 4HGMA 4DTGL 3WL9B 5C6PB 5FO9B 1VFBB 2BNRB 4YWGH 4B0MM 4EOWL 4X8JA 5KSBF 4A6YA 1JPSH 3UTZA 4FHBD 1U91B 4WTWA 2AJYH 2WW8A 3EJZC 3RDTC 4XTRC 1GIGH 5ILTL 5T1DH 1FRGL 4CUCA 2FECI 1WSST 4RGOH 3TA3D 3UBXB 3H3PL 1AI1L 5I1GL 1R3IH 4MJ6A 4NPYA 2E9IA 3MBED 2A73B 4MD4B 4KC3B 4OSUL 4XNYH 2YA0A 1BQLL 4QYOA 5B38B 4WFEE 3S5LA 1ACYL 1F4AA 5K9KB 1VESA 3TBWB 4XVSL 1RZ7L 4KDTA 4PG9A 1F4XL 3RPKA 4LMQI 4K3DL 1G7HA 2JCCB 4POZC 2OTUB 1H5BA 1ZA6A 4PJHF 3UTSA 4GAGH 4G8IB 5JOPD 4IHOB 4LVNC 3HS0B 3QI9A 3MRMA 1MVUB 2DQIL 3NFPB 4G3YL 4EKXA 4PGJA 1OLLA 1EJOL 3N0PB 3BP6A 4RWYH 5HVGB 4EDXA 5H37H 2P8PB 4QXGL 2A83A 2L7JA 1J7VR 4N8VA 2IPTH 3B5GA 3BHBA 4U3HA 1BQHA 4LARL 3BJ91 2J4WL 4OCRH 5GJSH 4BK5A 5GZOD 4FA8A 1CXLA 5C92A 2WSKA 3B2UD 2Y36L 1BM3L 5JOPE 4IRSA 2VLRB 1W2KT 2Z35B 3VA2C 1T7VA 4DZBA