3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
3SJVA 3LKQB 5D1QC 5KVGL 2JB6A 2X4UA 4LSQL 2DQFB 1TZGH 4L4VE 1T6WA 3C5ZD 3QIBB 3QG7H 2RCSH 1AI1L 3PDGA 4HLJA 4QRQA 3RZCC 1L0XA 1UZ6E 4PJBF 4LCWB 5AD0B 3QCTL 1XGYH 3NCJH 5FF6B 4HUXB 1AXTL 4PB9H 3TT1H 5A3ID 3B6SB 4L3CA 1SEQH 3ZDYF 2RQ8A 4Q74A 3WFEH 2KPNA 2H9GA 3QIWC 4JPIA 1RHFA 5BOPA 3PV7A 1QFPA 3V4VL 2CDGA 1V3MA 1O0VA 2HN7B 3KGRA 5FEBA 1BOGA 4OCXH 2D7MA 3C9NA 4K7PY 5TGBA 3C6SA 2A6DB 2E9WA 2HFEA 5IB1A 1WWCA 4FFWC 4M8QA 4M43H 5FO7A 5HSFA 5INDB 3SDXE 1AGFB 3FT4A 4XP1L 1P84J 3TBWA 3SJVB 4NWTH 2JB6B 1LO4H 2X4UB 2HTLD 2NQCA 2PW1A 3S3JA 3DMMD 4NZTL 4LLWA 3PDDA 4QRQB 4OIAA 3VXUA 1BFOB 1OTUD 4NQVA 2A1WH 3RNKA 2FHFA 2KZWA 1KOAA 4R0LB 3GBMH 4CUCA 1A8JH 2BVQA 2OCFD 4OD3H 4PJHE 3TJEH 5D1ZB 3AREC 2QADC 2H9GB 5FKAA 4C56D 2UWEE 4JPIB 1M7IB 4OFDA 4MA3A 1P9MC 3BZDA 1LGVA 1OPGH 2CDGB 4LPCA 5FHBL 4KZEL 3C9NB 4PY7A 5TGBB 1OTSC 3C6SB 4PJCE 5IB1B 5JOPE 4WUUA 3FAXA 1L7TH 4M8QB 4UT7H 1LDPL 5FO7B 5GS1A 1DBKL 4JE4B 3HZKA 4ODHH 4XC1H 3FT4B 5MEPA 1NMBL 2YD5A 3ESUF 4B50A 2APWA 2W0KA 3TBWB 4YDKL 1NC4D 4LSVL 3LKRA 3HE6B 2CGRL 3PXJA 1N0LA 4M7LT 4FXGA 2PW1B 5IJVA 5D7LE 1UACL 4LLWB 4YXLH 4GXUN 3SGEH 3EDFA 3VXUB 5JMOC 1OLLA 3OSKA 5K9KB 4NQVB 1NBVL 1GJIA 4WI2A 2OXHA 4KH2A 3MJ7A 3GIZL 2NLJA 1VACA 1CFQB 2BVQB 2O5ZL 3F62A 1GPOH 4GG6F 3MGOA 2R0LH 1UWGL 5FKAB 3O4LD 4HMCA 3IDJA 2NY5C 3NN8A 1BVKA 2MPAL 3VGFA 1F6LL 4J3SA 4ZS7L 4NNYA 5IESH 5BS0E 4KI5E 4M3KB 4WUUB 1MFAH 3K3QA 5FO9A 2VXQL 2VB5A 5GS1B 2XFXA 3W5NA 3HZKB 3U9PH 1BJ1J 5MEPB 5GGVL 2VJXA 3ROLB 1SBSH 1U91B 1A1NA 4OT1H 1H8SA 3NPZB 2V2TA 1DUYA 4UILH 4XVUD 3UJIH 3RVUD 3U79A 1CR9L 4FXGB 3D39E 5IJVB 4LVNC 5T3XL 5K33A 5CJXC 5AWNH 3VD5A 2ICCA 3E6FA 3QDGD 1QSEB 4Y8AA 5IP4A 1O7SA 4KK5C 4WFHD 1RZKH 3MJ7B 1IMHC 4NO5A 2GHWB 4Q7DA 3FZUC 4Y4FC 3S9DB 4OSUH 1YY9D 3UROR 1QA9A 2CK2A 1FYTA 1DQMH 2FHBA 3IRPX 2C9AA 3H42L 3IDJB 4XCCH 3NN8B 1BVKB 3HC0A 3ZYOA 4JFXA 2BHZA 4MCYA 5DWUH 4NNYB 1D5MA 4IBLT 1MFCH 1LEGA 4YIQA 4U1NA 4RFNC 4LSTL 4R4NC 2XFXB 3DVIA 3MUY1 1HWHB 1YEDA 2O5YH 5C6PB 3OBAA 1CVSC 2V2TB 1DUYB 4C57C 3WO3B 3FT3B 2NW3A 4C4KT 3JSSA 3FL7A 3GK8L 4O5LL 4U0RB 3PWLA 2ZPKH 2J4WL 4KRNA 1GCFA 1JGUH 3KR3L 3E6FB 1ZLWH 5J0BA 2G5BB 4EI5D 5DC0A 3KXFB 3MBXL 2E7LA 3B9VA 4R26L 1INEH 2DQTL 3ULUF 5E99H 3F7QA 3NIDF 4NBYB 4HIJB 1KCVH 2PO6C 5D2NA 3WBDA 2H6PA 3PG2A 3TJHC 4U1SA 1QA9B 4OCWH 3FRUA 2AQ2A 3NIFE 1CDGA 2AJVH 5HYJD 3GBNL 1PBYA 5TE7H 4A2MA 3HC0B 2NY3D 4NGHH 2ICEA 5E1HB 4JFXB 2YKLH 1X5HA 2B1HH 4NFDA 4WHYG 4JFFD 3GHEL 3U2SB 1CDCA 2EKSA 1TZHA 4RAVA 1LEGB 3D85D 4XCEA 3GJFA 3RVXC 1DBJL 4QRUA 4JB9H 5GGTH 4APQC 1YEDB 1CZ8H 1NCCL 4KMQA 4X7SL 5SV3A 1IQDB 5GGRY 4EUPA 4MNHA 3P9WB 2NW3B 3TA3C 4JG1L 3JWOH 3FQTA 2Z91B 3P0YH 4HWUA 4JM4H 5KG9B 2AI0H 5KSBA 3LD8B 5I73C 5LCVL 4M9OA 3SDAA 5CEZL 4NQCE 4IDJH 4KQ4H 2EDBA 5HHPA 1FNAA 1OSZA 5KTEL 4QNPF 5HGDA 1TIUA 1A4KB 4LCCC 1XH3A 3A6BH 2H6PB 4WNQA 4V1DB 1NDMA 3NZHH 4MS8C 4KWUA 5EORH 3HI5L 4U1SB 5C2BL 2JIXA 4P46A 3FRUB 4D2NA 2AABL 3HC3L 4ODVL 2HH0H 5DQ9A 3BIKB 4ZQKA 2NYYC 2R2HA 2ICEB 3HCVA 1GGCL 1JWSA 3CFKA 5GRUL 1XAUA 1DLHA 2HJFA 2IFFL 4O02H 4PTTA 2EKSB 1NGXA 5DDHA 2DLIA 4C54A 1TZHB 1T2QH 4RAVB 5ACLA 3B8YA 2JF1A 4XCEB 3BAEL 3RL1A 3GJFB 5BMFH 3MRPA 4XRCB 4NHUB 4QRUB 3P11L 4MXQC 3BD5A 2R0ZH 2VXTH 4EUPB 4WUKL 3FQTB 1K9TA 4KHXL 3VG9C 1FBIH 4BELD 3NGBB 5KSBB 1OAXH 5GSVA 2DBLH 4WFGE 1A14L 4AMKH 3DRTA 3UTSD 1P69B 3QDMD 5C0EA 2CMRL 4Z95H 1D6VH 3TN0D 15C8H 1YECH 5HHPB 1OSZB 4LAQH 2VIRA 2NY7H 4QCIA 1LP9A 5HGDB 1XH3B 4XX1E 5CP7A 4WNQB 4UINL 5HY9A 3ELAT 4I2XA 1D9KA 2NMSA 3W11C 4G9DB 4OM1H 2XZQL 1F5WA 5E7BA 1NANI 1WCQA 1QRKA 4IEFB 5DQ9B 2ZOKA 5F1IB 4C83A 4ZQKB 3MJ8A 4LU5H 2BDNH 1BP3B 2R2HB 2VDNH 3BGMA 3HCVB 1D5ZA 5L88H 3CFKB 3QI9A 4PGBA 1DLHB 2HJFB 1CGSH 2HKHH 5DDHB 2XG4A 5C08D 4BH8B 3RL1B 3MRPB 5IW1A 1TQBB 5D1XC 4M6ML 1WBZA 3U1SL 1JZ8A 1ZANL 1J0IA 4D0DA 1S5HA 1AR2A 4JZJA 5CLWA 2FX9L 1ZWIA 2QHRH 1AJ7L 4YR6B 4P2OA 1P4BL 4OZIE 2W9DH 4BSWA 1TLKA 5BO1L 2Q6WA 5C0EB 3MLXH 4LVOC 1YEKH 3TLRA 4EQ2A 5L0QC 2VIRB 4F7PA 4QCIB 1LP9B 1IAIH 3GZKA 5CP7B 3A67L 5HY9B 3E3QC 2GK2A 4I2XB 1D9KB 1ULVA 3GKWH 5L2KD 1J8HA 2C3WA 2I60L 3HAEA 4C83B 2ZOKB 2VL5A 3MJ8B 1A1MA 5D7JD 1W72H 3BGMB 3TT3L 3IAPA 4WHYH 4XP6H 3I3BA 3QI9B 1UM6L 4PGBB 3PL6C 2LVEA 3UDWA 3T0VA 1JFQL 2YZ1A 5IW1B 2BNRE 1WBZB 3O6FC 2ZG1A 1QFHA 1M6OA 3QXTA 3VXQA 1CD8A 1LP9F 1JE6A 4WV1A 4GAJH 4PS4H 4PREA 3QFJD 4D0DB 2IAMC 2X9WA 1S5HB 4XNQA 4D9LH 2BNUB 4JZJB 4X6FA 3ARXA 2QSQA 4MAUH 4HC1H 1OSPL 5D9SA 1ZWIB 5SWSA 1RIUL 5ISZE 3B9KA 3HRPA 4P2OB 1RULL 4BSWB 2Q6WB 5J12B 4JRYD 2XNAB 1QG3A 3KHQA 4BH7A 3RA7L 1UH3A 2AJ3A 4R90L 2UZIH 4F7TB 2AEQL 3BP6A 5F9OH 2NX5E 4QOKD 3SKOA 4Z7WA 2EE2A 5DUML 4LRIC 3HAEB 1FLRL 4R3SA 1KJ3L 1HINH 2OZ4A 2VL5B 4OD2B 3VXSE 1A1MB 1HHKA 1A6VL 1DQLH 5D7IA 3MRIA 2DTSA 4DAGH 5J6HB 4CVXB 1FZMB 3BPLB 2EDXA 4C55A 1ZAGA 5H37G 1QBAA 5JZ7C 4KJWC 1Q72L 1M6OB 4NKIL 1AHWA 5C6TL 2R29L 4FXLA 3N1GC 3DXAD 4GRWE 2DL9A 1PX3A 3PQYD 3QRFM 2JB5H 2KQNA 5F1KC 4PREB 3QUYB 2OQJA 1EEUA 1I1AC 4XNQB 4ONFL 4FQJH 5JDSA 2C3GA 2Z31C 5SWSB 1VB9A 3B9KB 1S7UB 5T33H 1EPFA 4M7LL 4JZNB 4BH7B 3WXVL 3BUYA 1YMHA 2IAND 1F3DH 3BP6B 4QRSB 4Z7WB 4HKZB 1MCDA 4N90E 2C3VA 4R3SB 2R0KH 3TZVC 4F7MA 2GSGA 3FQUB 4UIMA 5BQ7A 3ARSA 1HHKB 4WEBH 4NZUH 5D7IB 1TZIA 3MRIB 3B2VH 4UDUB 1QRND 1I9EA 4WY7H 1KIPA 1FSKC 1FCGA 5E2WH 4LSPH 2WK2A 4QRPE 4HQQH 1A3RH 1TJHL 5MEND 3RGVA 1AHWB 4PJIE 4P5TD 4Y4HC 2X1PA 1HNGA 3REWA 2OQJB 5DMIL 5T5NF 4L4VA 3KYNA 4Z7WF 2X1XR 3CH1A 2OP4H 5JDSB 3U83A 3ZKXB 1W8NA 2A77H 5MHSD 3VXPA 3ZO0A 1SJVA 3T0BA 3BUYB 1YMHB 2Y9RT 1DEEA 4NC2B 3IJYA 2OK0H 3PHQA 4M5YH 5DJCA 5F6HI 2X7LA 1T7WA 3CFBA 5DFVC 4JN1L 3TH2T 1ADQA 4DOHE 2C3VB 4F7MB 4L4TE 2GSGB 4UIMB 1YMMD 5BQ7B 3EOAA 1FDLH 1TCRA 3N1PC 1TZIB 5AYQA 2DYPA 3FFCD 5GZND 3JTTA 1KIPB 4HDIA 4NIKB 2NZ9D 3BEVA 2YUVA 4M6NL 4LOUD 2WBJC 1S3KL 4JGJA 3EFFA 3KPOA 3GB7A 3SDXA 3ZKSD 4ERSH 1AO7D 2YPLD 5CZKA 1EA9C 3RGVB 4LPTA 4YHZL 5F6IB 4YBLB 4XAKE 3AB0C 3E3QE 4L4VB 4CJ0A 1Y0LA 3KYNB 2FSEA 3CH1B 5JXEA 3I75A 3T2OA 4LHUG 1RJZB 5FYJD 3FO2A 5C09E 3HZMB 4UIKH 4W81A 2DQDL 3VXPB 3T8XA 4M9PA 3U4EB 1NFDF 1EK3A 1CL7H 3MRGA 1EDQA 1NAKL 3PHQB 5DJCB 5I17A 4GSDH 3T2NL 4WCYL 2WBWB 3CFBB 5CD5D 4LEOB 4S0SD 4JAMA 2K7PA 3AAZA 1H3TA 3EOAB 1TCRB 5J1TC 5HDQH 3L7FA 4NP4H 3BP7A 4RGMB 3JTTB 1WCBA 4HDIB 3Q6GL 1BVZA 4PJCA 3DX7A 5H37H 3BEVB 3ZKMD 1YEHL 3DROB 2C5DC 3DI3B 1S7RA 2L7UA 5D5ME 1UZ6F 4I0PD 3GB7B 5GGUA 3SDXB 1K4DA 4DJMA 1FVCA 2Z9TA 4XPAL 1MCBA 2JJWA 4R97C 3LH2L 2X89D 3KJ4C 4PRNA 5GJSL 4HJJH 1BBDH 5I18H 3I84A 3EFDH 4KRPD 1Y0LB 3HC4H 4OFYD 4LCUA 2FSEB 3DX9A 1YY8A 3I75B 3RIAK 3FO2B 2E9JA 4K8RH 3T8XB 5DEGA 1CGTA 3QH3A 3MRGB 2B5IC 1NEZB 3IS1X 2OL3A 5I17B 4P99A 1DL7L 1VEPA 3SDXF 5BVJB 5I74B 4F15B 5F71A 2C4XA 2UWEB 1KPUB 4JAMB 2E9IA 3JWDH 3UPAA 3AAZB 4UTBL 3ULVL 3HMXA 1S5IL 4XMKL 4F58L 1QSFA 1XCQB 1WCBB 4KJYA 5HHVH 4GBXA 4PJCB 4GMTL 1FGVL 3PWVA 4Y5VB 1KJMA 1S7RB 3GI9L 4MGXA 5L8KB 3VRJA 3F5WA 5GGUB 2FLRT 1OAZL 4Y7MA 5DD1L 3S4SA 3SQOH 3S3PA 4BSVA 1BM3L 4GT7A 4K94L 3CAFA 3BRGC 1RY7B 4PRNB 1KIQA 1HHHA 1LK2A 2D2OA 3L3KA 1A7PL 1MWAH 3EYQC 5F6HJ 3C2SA 4PJHF 1DVFC 1ZVYA 4JREB 3QHZL 2UWEF 1EV2E 1YY8B 2VE6B 2NY0D 3DX9B 4TOYL 5GRZA 1H15A 1RZ8A 4W4OA 5E2TH 5J9PA 1E28A 3I6LE 5DEGB 1WITA 3HFMH 3HNTH 1DBBL 3Q1SL 3M17B 5IFHH 2OL3B 2MCG1 2BK8A 2N7AA 5KVFH 2GJZA 5HHXH 3MROA 2ZOLB 2IPTL 1V3KA 2GITA 1DSFH 1QPXA 4ZDHA 2YWZA 1F4WL 4I48B 2B2XL 2CDFA 5E94A 1A7QL 3O6MH 4KJYB 1QBBA 4GBXB 3LRHA 3CLFH 4M5ZL 3S5LG 3O8XD 5BS0B 3D48R 3PWVB 1JL8A 2YMXL 3V6ZA 4HW6A 4UT6H 4HT1L 3F5WB 5B22A 3S4SB 5BZDA 4JHAL 4F37K 5E2VL 2F8OA 4BSVB 3TIEA 1E4JA 2CD0A 3E2HC 4HMDA 4YX2L 1KIQB 1HHHB 3CLEL 3L3KB 1TETH 2YPKA 3ARWA 3KHOA 4OTXL 4ODXA 1RV6X 4DFIA 4FQ1L 3R0NA 2QSVA 3EGSA 3D39B 5C0DA 2VLJA 1C7SA 4FABH 3QXAA 2NY3C 2QR0A 4LBEA 2UUDH 5D70L 1R24A 1H15B 1RZ8B 5I1JL 1IGFL 4KJQD 3BOVA 4XP4L 1SY6A 1E28B 1RURH 3ARFD 2A6IA 2BCKA 4A2LA 1KG0A 1S9XA 1NMAH 4KI5F 3DO3A 3QIUC 4HUNB 4M61A 4MX7B 4RMUA 2N56A 5A2JH 2GJZB 1Q9LB 4U1JA 1UEYA 2OR9L 3JVGA 3TCXA 4AT6A 2XQBL 4TSAH 2GITB 5D1QB 4KZDL 3QUXC 1UYWH 1T66D 4KUZL 4TRPL 3JXAA 3W0WE 3LMJL 1MCEA 2CDFB 4PBVC 2Y72A 1QFWH 3LIZH 1CFVH 5E94B 3GHBH 1ZLSH 4DW2L 4JKWA 5D71L 5BZDB 2HG5B 1JNHA 1SYVA 1BQLH 3TIEB 3VMPA 3ARQA 1GHFH 1VFBA 1J18A 2EDWA 3SGJC 4OI7A 2YPKB 4EDWH 4ODXB 4GW4A 1DBML 3IT8D 1T21A 3EGSB 1GOGA 5C0DB 2W0PA 1MY7A 4HBQA 3QIWB 3KG5A 3QXAB 4N1CA 5FYLH 2QR0B 4WFFD 4LBEB 5GSRA 2P5WE 1P9MA 1R24B 2FIRT 2WAHA 1B4JH 5F9JA 5IIEB 1I9RL 2EZ0D 1QOKA 1T3FA 2A6IB 2BCKB 2Z0BA 3DVFA 2PKDA 4KRLB 1R5WA 4ORGB 4R2GC 1P5VA 1ADQL 4U1JB 2Y4SA 3DIFA 4XNYH 4AT6B 4WU7B 1N8ZB 5IMMA 2CJUL 3AS2A 3O2DA 4LSQH 2R2BA 2V5TA 1DLFH 1EAJA 1MCWM 1AI1H 1I9JL 4XPFL 5B38G 3V0VA 2FEDC 1QSZA 2XICA 2LFGA 1YNKH 2DI7A 3H9SE 2P5ED 3GMOA 1L4IA 4GQPH 1AXTH 4UMGA 4O2FB 3IKKA 5E4EC 5E8NB 1VFBB 3BWAA 1A22B 1MREL 5F8RC 3E8UL 4BFEA 4YHIA 4FZ8L 1WIPA 3AREB 4HMEA 2QADB 3SCMA 5E0QA 3NIFF 5GSRB 1JZ6A 1JGDA 2R9HD 3LZFL 4NQCB 3VDAA 1E4KC 4UNVA 3OZ9H 5L9DH 4P9HC 4WFHE 5EO9B 3HI1A 3VWKD 1WIOA 3WD5L 4HKJA 5DO2C 1U0QA 4L5FH 4DGIH 3R06A 5E8OA 5KJRH 1MIEH 4OGYH 4H1LA 5EC2A 5IMMB 4JDVA 4LLQA 3NBNA 2R2BB 2AXFA 1NCAL 4NZTH 3CU7A 2CDEA 3QEQE 4GAYA 3O6KH 3U30C 4NOBA 3V0VB 3K80A 4EIZC 1G6RA 2EDQA 4ODTL 1WVZA 1WV7T 1QQDA 3CVIL 4HS3A 4BM7A 1NLBL 4YDLC 3MOAL 3BWAB 3OF6A 1EERB 4ZAKD 3S8WA 3D2UD 3T0EC 4YHIB 1IKFL 4CDGC 3VI3E 3BXNA 2R23A 1F6AA 2MFNA 3SCMB 1EXUA 4NO3A 4X4ZA 2J8UE 4UBDD 3BKYL 1JGDB 3CH8A 4G6AD 4JFYA 1RZKC 3IDXH 1P1ZB 5FHBH 4PJ8D 3BN3B 4GRLD 3VFPA 2QSCH 3C6LC 3AS1A 1OW0C 5CCKL 3HI1B 3FN3A 3UPCA 4HKJB 1NMBH 5DT1L 5DZLA 3OWEA 2F58L 3QP3A 1P7QD 4KPHH 5E8OB 1MI5E 4N0UA 4M03A 4NZJA 3FO0L 4H1LB 3HMXL 5EC2B 1EH9A 4JDVB 1VPOL 4S1RL 2AXFB 3UTTD 1UACH 3JUYA 4LVNB 4P2YA 3MYJA 3S36X 3NACH 4GAYB 5DJAB 1U36A 1G6RB 3GIZH 4S2SA 3U7AA 1QQDB 1WISA 4OZFA 4EIGB 2NY4D 4Y4FB 3OQ3B 3GRWA 2W9LA 2X42A 4DGYH 1FIGH 5EU6D 2BNQD 1RZFL 4JJ5B 5CJ5A 2R23B 5DJXB 2P8MA 2G2RA 1F6AB 4K3DH 1EXUB 4NO3B 2W65A 4I3RH 2O5XL 2FBJL 3EAKA 5JORA 5ISZA 2ZG2A 1E0OB 3DYPA 4JFYB 4FG6C 1T89C 4NUGH 1I3UA 4TNVK 5IVXE 2FYYA 4M6AA 4JFOA 1JPTH 1FGNL 4RFNB 4AK1A 4WI5A 3OKDB 3S35X 2XRAH 2NX5A 1N64H 5GGVH 4APQA 4FQHA 2VSCA 3LS5L 1G7QA 1MVFA 1IEHA 5DR5H 3FCTA 3UXFA 2GJ6E 3PGDA 5I1CH 4LHUD 5I1KL 1CR9H 1TQCC 4I77L 4G8IA 4WWID 3SE3C 3S37X 2A0LC 1FFNA 1WTLA 3DETC 3KJ6H 3O9WA 4S2SB 4OZIF 2VLMD 1CFTB 4JRXA 4OZFB 1WLHA 1NKRA 2WLYA 1KXQE 1KTDA 1G7MA 4J8RA 4M48L 4LCCA 4OLWL 3JWOC 5EUKA 1C1EH 4KHTL 4Y2DC 2P8MB 4XT1C 4FP8L 3R8BB 4BFBD 2DQUL 3EO0A 5CJQH 2W65B 3H42H 2R69H 1JMZA 5JORB 5ISZB 3MRKB 3G5XA 3O3AA 1XT5A 1SY6L 4P23A 2H3NA 1MHHA 1LMKA 3UTSE 2FYYB 3QDME 4JFOB 3MV01 4HSQA 3BE1L 3AXLB 4JGMA 2NX5B 3MRDA 4Q9BA 1CDYA 4APQB 2FX7L 4FQHB 1TJGH 1G7QB 2JJTA 1DZBA 3FCTB 3PGDB 4GUPA 1HEZB 3VXSB 1G84A 3TA3B 1CLOL 4OQ1A 4UV4H 3R1GL 1CQYA 1XGQA 4G8IB 4MD0A 3KR3H 5I73B 1FFNB 4MA1C 3U36A 4N8CL 1UZ8A 5T1LD 4R26H 2DQTH 4JRXB 4PP1D 4DVBA 4X98A 5LXGH 3OAYH 1KTDB 1G7MB 1U3HD 4GRWB 3MRHA 4LCCB 4RWYH 2EEBA 5EUKB 1PKQA 3K4AA 2OR8A 1FAIL 3F7PC 3TWCH 3VFVB 3QG6A 3EO0B 4YNYB 1YEEH 1G0YR 2OLDA 4HPOH 3G5XB 4OF8A 1UH2A 5FKPA 2ZNWA 3GHEH 4P23B 2H3NB 1MHHB 2R56H 3NFSH 3MQIA 5EO0A 1GZPA 3MRDB 4X7SH 1NCCH 3ZYJA 4L4TA 2YUWA 4J2XA 4GRWF 4GUPB 2YD7A 5FA4A 3T0EE 4KTYA 4YFDB 1J87A 3SDDD 5FUOH 2Z8VC 3CFCL 4MD0B 3MXWL 5I1HL 1HN1A 3U36B 5LCVH 1UZ8B 3IF1A 4QRPB 5F88A 4DVBB 4X98B 5D93C 5I8EA 4PJIB 5KTEH 1WBXA 3IYLW 2OJZL 1CLZL 5C2BH 1PKQB 3HI5H 7FABL 5C0AA 1NH6A 3QG6B 1OARH 4X6CE 5LWYL 2F9BT 5JHDA 2QQKH 2DIAA 5E03A 2AXJA 3WKMH 1GGCH 4TUOA 5J89A 5GRUH 4OLUH 3C08L 2C4FU 2IFFH 4OM0H 3WS6C 4P4KA 1QNZL 2BRQA 3KLAB 4OLZH 5D1XB 1GZPB 1JI2A 3O6FA 2DIJA 4Y5XA 4PJIF 2YRZA 2WIMA 4L4TB 5FA4B 2APVA 3MJ9A 2X4NA 5IMKA 3W9DA 4RSVA 2XWJA 1X5JA 2D31A 3SKNA 4AH2A 5HHOE 3V7AG 4ZG1A 4JPVL 2DWDA 1GOFA 3IF1B 1X5YA 5D5MA 3OHXB 5F88B 4LVOB 3WV0A 3BT2L 5I8EB 4MXVE 2VUOA 3TBYA 1E6OL 5L0QB 1WBXB 2VUYA 3O0RH 3TM6A 1N5YH 2IQ9H 3G5YA 1QBLL 4RFEA 4X4ME 3VFWA 4Y4KC 4XMPL 4Y2OA 5DMKB 6FABH 2XZQH 5JA9A 1FNHA 4LRIA 5JHDB 1U3YA 3BDBA 5EOTA 4TUOB 1R3KA 3SKMA 5ECJE 5FM8A 4P4KB 4XP9L 3HR5B 3SOBL 1G9EA 3QDJA 1IGML 2HFTA 1GC1L 3VGAB 4A6YA 1UXWA 3O6FB 3UTZA 4J6RL 4ZUWB 5T5FH 25C8H 1ZANH 1IM9D 3QUZD 4TULL 4S1SL 1H3PL 2Y36H 1UG9A 1C12B 5IBUB 4LDLB 2ARWA 2IAMB 5IMKB 1I1AA 4LQFL 5ALBL 3UAJC 4EEEA 2XWJB 2NY0C 2FX9H 1YA5A 2D31B 1MHCA 3SKNB 1P6FA 1YN7B 1PSKL 2Z31A 2J7LA 1I1FB 3V8CA 5EG6C 1VESA 4XC3L 2DWDB 4M7ZC 3KPQA 5D5MB 4RX4D 3JV6A 1U2CA 3WEXA 3TBYB 1BEYL 5J3HD 3NCYP 3L6FA 4NRZA 1IVLA 2BY1A 3G5YB 4RFEB 3OB8A 5SX4I 1L0YA 4B41A 5CFHA 4YC2C 5C07D 4XVSL 4DKFL 3O2WL 1HXYA 1PLGL 4RGOH 5T3XD 5HDBE 4X4XA 3UTOA 4XBGB 1RUQH 1UADC 4ZUTA 1ACYL 3EOBA 3T4YA 2P42B 5EOTB 3MACH 4HIIA 3PWJB 1R3KB 3SKMB 3T3PF 2HMIC 4L8DB 4PRBA 4YHKH 5C0CE 3FRPG 4EBQL 3ARVA 2RB8A 3FN0L 4Q2ZA 1JFQH 3C5JA 5TQ0L 5T1MA 5D5MF 1KEGH 4X6DE 3UTZB 5A2LH 4HK3J 3MV8E 3LQAH 2E8YA 2OTUA 4TQEH 1DFBL 5KSUA 1V3JA 1G9MH 1I1AB 4XWGH 4UI2A 1MHCB 5FGCE 2NZIA 1OSPH 2Z31B 5BV7L 1RIUH 4NSKB 1LO3H 2FJFB 1ES0A 3KPQB 4GXUM 2VDQL 4K3EL 4XTRC 3JV6B 3NMEA 3WEXB 2DQCH 2CKBA 5DJ2A 1HXMA 4NRZB 5A2FA 3GSRA 1NSNH 2AEQH 4HG4J 4NJ9H 3NCMA 4Q9QL 4YK4C 4M1DL 1HXYB 3QIBD 1FLRH 3TZVB 1KJ3H 3H0TA 4ZFGH 1BD2E 4ZUTB 1XF1A 1GXEA 1UWXH 4HIIB 4LCWD 5GPRA 3LEYL 4PLKD 1FSKB 1T5WA 4PRBB 2WBJA 4Q2ZB 3C5JB 3L5HA 2J6EA 3U7WL 5T1MB 4ZMAT 3LKOA 2HJKA 5SV4A 2AJYL 5C0FB 4K23L 1CT8B 1Q9WA 4NKIH 4Y4HB 3U4BL 2R29H 4RIRA 2VDOL 2F15A 2APXA 2Y7QA 2OTUB 4CADA 1QBMH 1RIHL 4YHOL 3TH4T 4U6TA 4U1LA 1KUMA 5L7XL 4XNZC 5F3HA 4JDTH 3AU1A 5C8JB 1CYGA 4Z7UA 1NGPL 1XIWC 3DECA 3BZ4A 5DJYB 1E27B 5FUZL 1MHPH 3PWPE 2CKBB 5DJ2B 1HXMB 5MEOA 5FDYA 3GSRB 3SJVD 5IFJA 3GMRA 4U3HA 2BFVL 3E1F1 4L8SC 2PN5A 3HAEG 3H0TB 1CLYH 5IGXH 3VE0A 5EIIB 3X13A 2AEIT 2DB8A 3C2AL 4EI6B 1T5WB 2WBJB 3INUL 4MVBC 3WFDH 1IAOA 2DQGH 3LKOB 1BREA 4OIIH 1TJHH 5D1ZD 4G7YL 4RIRB 2Y7QB 4JHWL 5A43C 1WAAE 2M1KA 3RWDB 2ZJSL 5TH2A 5C0IA 3AB0B 5I1DA 2X4SA 4CADB 1FO0H 1QHPA 5DMIH 3W0WB 1JF5A 4U1LB 5ACMA 2QQLL 3G9AB 4WTXA 2R9HC 3AU1B 4Q6YA 3MYZA 1IKNC 4Z7UB 2LQRA 4F7EA 5GS0H 2A9NL 1BJ8A 2EYRA 3H9SA 3BN9D 1N6QH 3RDTC 4G6KH 1RZJC 1P6AB 5IOPA 5SX5K 5MEOB 1WBYA 1K4CA 1DQJB 3IDNB 3UYOD 3HE6D 2Y5TA 4JGUA 4JM2C 2MCPL 2VDPL 2H8PA 4IIQC 1YC8A 2ZUVA 2P5WB 4ZO6A 3WDIA 3VXUD 4BKLB 4CAGA 4K8RC 3D69A 3HZYA 3X13B 4WHTA 3IAGC 2BSED 3W2DH 3VXOB 1AQKL 1LO2L 5ESAA 5F9DC 3N50A 1S3KH 4JQIH 3OGOE 1NGWA 2VZUA 1WTGT 1IAOB 5EZLA 4Q9CA 3JWDC 3Q5YA 3KJ4B 4HJGA 5C0IB 3MJ9L 5I1DB 2X4SB 1KACB 4KK8D 5KW9L 1DVFA 3DBXA 3OR7A 3QEQA 4G6AC 5IHLB 3B3IB 3T0XA 5IT2L 4LDOB 4F7EB 3L5XL 4YXHL 4KKLC 2WQRA 2EYRB 3H9SB 4CNIB 5IOPB 2B5IB 1K4CB 4JQXA 4LVEA 1JGVH 2GAZA 5F1NA 2H8PB 3MLYL 4GKZA 4QF1A 3ARGC 4JFDE 1K6QL 3ORJA 5K59E 1QSED 1ZE3C 4YUEH 1N6UA 3D69B 3VI4E 2HWZL 3Q6GH 5ESAB 4XCFH 4PG9A 5DD3H 2W0FB 1YEHH 2NY4C 4A6YL 4XXCA 1XF2A 5EZLB 3WNMA 4MMXC 2Q86A 1F3JB 5JNYA 1MI5A 4YLQT 4RZCA 3NFPA 5GJSH 4HJGB 1ACZA 3LRGA 1PFCA 1DVFB 3DBXB 1I3RA 3ULUD 3BH9B 2DTML 3ET9F 3V7MA 1MAKA 1UCBH 3QEQB 5ABDE 1KJ2H 2NXYB 4WRLA 2APTA 4RBPH 5E7FA 2KQMA 3QIUA 1UM5L 1J10A 3RWHA 3QCVL 5CINL 2GAZB 3NA9H 4MQXD 5F1NB 4HWBL 4GKZB 1GGBL 2J8UB 3MLPA 4PJXE 4FFZL 3QUXA 1WGOA 5I6XC 2XA8L 3KXFD 4F58H 2VL4A 5EPMB 2R15A 5IVXA 2J88H 2BRRH 4Y19A 4PG9B 4PRDB 1EO5A 4NKMB 3ROOB 1UGNA 4JQVC 1UXSB 1OAZH 2EXWD 1ZT4B 4K9EL 1R0AL 5GGSY 2Y6SC 2Q86B 1YEFL 3E2HB 3KPMA 5JNYB 1MI5B 1HSAA 4RZCB 5DF0A 3NFPB 1J5OL 2GJ6A 4F9PC 4QHMA 3ARYA 1IRAY 3VI3F 1I3RB 1IBGL 3SHSA 3WXWL 3QHZH 5D7SL 4NN6C 2J8UF 5D2LA 4TOYH 3P2TA 4X83A 4ZD3H 5IMOA 5JR1L 4M93C 2VITB 1JJUA 4X7TA 5CIPH 2IBGA 1MIML 2CKBL 4X8XA 3ZYZA 3Q1SH 3DURA 2CH8A 1RFDL 3QIUB 2VLLA 3FHAA 2QL1A 5F9WB 5HXMA 1JZ3A 1BECA 3VXME 4MSWA 1S7WB 5DLML 1T03H 4JY4B 2DM4A 3MLZL 1V7ML 3QUXB 1ZLUK 4E9LA 5A16A 2J1KA 4N5UA 1F4WH 1PG7X 2BXYA 4AIZA 5IVXB 4Y19B 1Q1JL 4RMRA 5L6YL 4Y5YC 2J6EL 3IDIA 1Q0YH 2NR6C 4V1DD 4WGVB 5AYUH 3I2CL 3KPMB 3MODL 4WGWB 1HSAB 3VFNA 1AR1D 2GJ6B 3SGEI 5J1AA 4OTXH 4QHMB 3PGCB 5EZOL 4FQ1H 4Y88A 2FEEI 1CFNA 2LE9A 4WI9A 2FGWL 3OAZK 4XPGL 4B7IA 4DKDC 5D70H 1SYSA 1T5XA 3D6GA 5IMOB 4X7TB 4RMWA 3M45A 2HFFB 2AJUL 4URTB 1CFSA 3DURB 1HH9A 2J2ZA 2PUQT 2R2EA 5DYOA 5B39A 4G5ZH 5J1SC 5IM7A 4R2GB 4K7PL 4MSWB 1TJIL 1IM3A 4QXWA 2OR9H 4LLVA 4K2UH 4MB5A 3ISWA 4N8VG 4KUZH 4TRPH 4IOFD 3LEXA 4U6VL 4X6BA 3LMJH 1T0MA 4HX1A 4AIZB 5TPWL 2DOCA 1QP1A 4XPTH 3MRNA 4GMSL 3TVMC 5E5MA 3IDIB 1OP5K 1A7BA 3MUGA 3L5IA 5E4IA 5BW7C 2FJHB 4XH2A 5E4EB 2VZOA 2XG5A 2D4FA 3VFNB 3K0WA 5J1AB 4O51A 4X7CC 3T0EA 2B20A 4OCSH 1QKZH 1VENA 1WZ1H 3MLRH 5IK3A 5FOJA 3BGFC 3G6JE 2MQ3A 1T5XB 2H1PL 3UTTE 4AEIH 5F89A 2I24N 3RU8L 4KJPC 5I15H 2NY2C 1I9RH 1I8LC 3BQUC 4KVNL 4DN4L 3C6LA 2ESVE 4M7JH 2B1AH 3FB8B 1OW0A 4NWUH 4PYGA 1CFSB 5L8JB 1HH9B 1I8KA 4Q9RH 2R2EB 5DYOB 1XCTA 1U8HA 2P45B 5IM7B 4OD1H 1U9KA 2P4AB 4X6CA 3LEVL 3BPOC 1T20A 2VN7A 3UJJL 1K8IB 3F7YA 4S1DC 5JIKA 4X6BB 2CJUH 3LEXB 3BVNB 4ENEC 2I07A 4HX1B 3ZL4L 3VG0L 2WWKT 2VLKE 3MRNB 4BYHA 4PLJD 6CGTA 5I1AA 5E5MB 1P4IL 1MHEA 1KN2L 3MUGB 3FO1A 4YDLB 3KLHC 1UM4H 1D9KD 3EOTL 3EDDA 3GSQA 5JW4M 3GKZA 3BIAX 4XP5L 1BVLA 4O51B 3T0EB 3E8UH 1ETZA 4FZ8H 1DN2A 3H6JA 4HLZG 4DQOH 4MQ7A 4OLXH 3P4LA 2CKNA 2OTWB 3QI9D 5FGRA 2CIIA 3BSZL 5DVLA 3LZFH 4RFOL 5F89B 4JCMA 4NZRH 1A7NH 3NIGF 1FJ1A 3HNSL 3RWCB 3RQ3A 3C6LB 4KKBC 4N0RA 4PJ5E 1I8KB 5C1MB 3V6FB 4X4MA 5D8JL 1XCTB 3X3GL 1U8HB 5F21B 5CAYB 2ADIA 2P8PA 4FQCL 4X6CB 3SE4A 3CSBA 4GLRI 3F7YB 1KEML 2EC9U 2XZCH 2X9XA 4P2OD 2I07B 1S9WA 2Z4QA 3MSPA 3SE3A 1CXHA 1LO0L 3GO1H 2PETA 2FX8H 4NOFA 5GS2H 2EC8A 4LARL 5GGTA 1MHEB 3QRGH 5CWSA 3N85L 3S98A 3GSQB 1BVLB 4B0MM 5FYKE 1MJ8H 1I4FB 1TZGL 1ETZB 2RCSL 3REVA 5FYLE 1KB5L 3QXDA 4HBCH 4MQ7B 4HXBH 4X6CF 1WJ3A 2CIIB 5I9QC 5HHOB 3BKYH 4MJ6A 5CJBA 5F44A 4MWFA 5DA0B 1MLBB 1XGYL 5HDOA 4QRRE 4PBWD 1FJ1B 2YSSA 1EHLH 3KPRE 4PB9L 3TEUA 3Q5TA 4LRNH 3TT1L 1NGYA 1SEQL 3SY0A 5CCKH 3Q2CA 3WFEL 5C9JB 2VNCA 3TFKC 2ADIB 3QUYD 4OFPA 5HYSG 2F58H 3GSOB 4OZ4A 2VKXA 1AXSA 1RU9H 1ED3B 3FO0H 3HMXH 5SWSD 3B9KD 4JO1L 4OCXL 1TQCB 4NCC1 2VYRE 2Z4QB 1S9WB 1BGXL 4ONGH 4M43L 1G7HA 2C26A 5CWSB 4Y1AE 2BMKA 4MXVF 1D7FA 3OGCA 3MV8A 4AEHH 5BRZE 3RKPA 1PAMA 4QWWD 1RZFH 2E27H 1N0XL 3UBXI 2XN9E 4HZLA 3S7GA 5E00A 2A1WL 4G8EA 4MJ6B 1KN4L 3MNVA 4MWFB 1ZXQA 1A3QA 2H45A 1QTYT 1KBGL 2L7JA 1KIRB 4F37F 3GBML 3H8NA 3TPKA 1NGYB 2D7TH 3SY0B 3TJEL 1FG2A 2BC4A 2GTWA 3ALWA 3SO5A 3LS5H 4GKNA 3F7VB 3PV6A 1KLFA 1RZGA 4OZ4B 3WDJA 4PV9A 2ORBL 1OPGL 3UTPD 1BD2A 4H20H 5DRWB 5I1KH 3R8QA 3MLUH 5C0CB 1L7TL 4F8TA 5TE4H 4MA1B 1HK6A 1G7HB 3CFEA 4ODHL 2X4RA 2DMBA 2CO6B 1CGYA 2BHUA 1AXIB 4QT5A 1RVFL 3OGCB 3MV8B 2DLHA 3GJFK 4OLWH 3QUKB 3SKJH 1NLDH 5E8EA 4I9WD 1OP3K 4YXLL 4HLZH 5FGCB 5E00B 5CBAA 2FEEL 5HDBF 3FOMA 4G8EB 3DYOA 3MNVB 3GDBA 1EFQA 1P2CA 1ZHLB 3SDYL 3RGVD 2IH1B 3BE1H 3G6AA 4S1QH 5DUPH 1GPOL 1FG2B 2BJMH 1VHPA 3BFOA 3OXRA 2BC4B 2GTWB 5E1AA 3UJTL 2FX7H 4GKNB 4X6DF 4L4VD 3PV6B 5E8DH 4PV9B 4U4BA 3HUJE 1GIGL 3I3DA 2A74A 1BD2B 2BVEA 1CLOH 1LEKB 5TDPB 3R1GH 2WWMC 5IESL 1J12A 3CMGA 3WHE1 3ILQC 3HG1A 4W68A 4LKCB 4WJ5A 3VFGH 5C7XH 3CFEB 3U9PL 1Q94A 1AGCA 2X4RB 3VW3H 1SBSL 2Y5EA 4M1GL 4OT1L 5D93B 4QT5B 2H2SC 1OTTC 4MZ3A 1WAAA 3UJIL 3AM8A 2EXYD 1UWEL 4YHYC 5E8EB 2WANA 3CGTA 3KPPA 4Y4KA 5ALCH 5FCSH 1WIUA 4HC1A 5AWNL 5CBAB 5HYFA 3FOMB 5DJZA 1RZKL 5F7FA 1QLEH 1MCPH 2VRAA 4XXDA 1FLTX 3PWPB 3B2UD 4PP2B 1CFBA 1P2CB 3RJQB 3L3IA 1FZOB 3EO9L 1CG9A 1R3IL 3HN3A 1G7PA 3OXRB 1IGCH 3GMQA 5E1AB 1DQML 2QV2A 1UFUA 4NNXA 4KI1A 3V4UL 4XCCL 3C8HA 4KK8C 1W72B 5C07E 5L8LB 5INCB 4NFBA 5F7EH 1GGTA 2FL5A 2HT4D 5T3XE 3AUVA 2SEBA 3CFCH 1BOYA 1MFCL 3SE9L 3MXWH 5DK2A 4WJ5B 4NKOB 1GH7A 3C60C 1AGCB 2DD8H 4EVNA 4R4FL 1G1CA 1TXKA 1QPPA 3JWNC 5C0BE 1NUDA 1ZGLP 2LAAA 4XB7A 3BEWA 4PV8A 1FORH 3KPPB 4Y4KB 4P3DA 2ZPKL 4OKDA 5LWYH 3UC0L 32C2B 2YZ8A 4IDLA 5JOPD 4Z5RB 1INEL 1MFBH 4I18C 5E99L 4XXDB 3WFHA 5C92A 1UEMA 2VLRA 1FC1A 1KCVL 3C08H 4FFVD 4MQTB 5EUOE 3NCEB 2VXSH 4GOSA 5DSCB 1QLRB 4EXKA 1CG9B 4NZDA 1G7PB 2V2WA 3GMQB 1T22A 3PE9A 1PD6A 2AJVL 4NBXB 3ILPA 4NNXB 3PHOA 4IS6A 1JPFA 4JFDA 3QO1A 3GFUA 3IU4H 5TE7L 4NGHL 1WAAF 2YKLL 2B1HL 2FL5B 2C1OA 5I66A 3ZKND 2GYSA 4JZOA 2SEBB 5DK2B 5CGMA 1FZJA 4M7ZB 4LCWE 3N0PB 5JO5A 1YN6A 2PYFA 5GGTL 3CMOH 3ZHLA 3KLSA 1KYOJ 2YC1A 1CZ8L 1G9NL 1E6OH 3HTLX 3LQAC 1LQSR 1BPVA 1YEGH 2DQHL 1OQOA 3BEWB 4PV8B 3LDBC 1G9MC 1QBLH 4YC2B 2AI0L 4P3DB 3RBSA 3CU1A 1N59A 3PP3H 4BQCA 4MNQE 5BS0D 4GBXD 4KI5D 3GEWB 4U05A 4IDJL 3WFHB 3TBVA 1U8MA 2EDRA 4RQQA 2FO4A 3HI6H 4XP9H 1U3ZA 3BESR 3NZHL 4XWOD 2DM7A 4YDJB 5EORL 3A6CH 1IGMH 2V2WB 3RKDC 5H2BA 1GC1H 1T22B 5EULV 5F3BA 3CSPA 2HH0L 3D39D 4WW2C 3PHOB 4IS6B 4MJ2A 4JFDB 4S1SH 1ND0A 4PJXA 5AEAA 2C1OB 4LQFH 3CFDA 5ALBH 5I66B 4QTIL 4O02L 4JZOB 2XQYK 5ESQA 1EAPB 2ZSWA 2VOTA 4TNVF 4FQXA 3RWGB 1AGBB 4KK9C 1FZJB 2QSTA 5CEZE 5JO5B 2G9HA 1YN6B 2PYFB 3KPTA 4XHJC 2YC1B 2R0ZL 4JG0L 1J9CT 2IPUG 2VXTL 3VRIA 1VKXA 5D1QD 5HGBA 1FBIL 4XVSH 4YK4B 3LD8C 4QYOA 1G7IA 4Z7OE 1N59B 3AROA 4L8SA 4DKFH 4DN3H 1NL0H 3C87A 2DBLL 1RUAL 3MRCA 5K59F 4PJFA 2VERN 1K3IA 15C8L 1YECL 4NKDA 1HH6B 3TBVB 4LAQL 3VI4F 2ADFH 2FO4B 4RQQB 2NY7L 3UZQA 5D2NC 1NFIA 2OSLA 3DSNA 3FN0H 4EBQH 5LGHL 4PTUB 5H2BB 3VXRA 1S9KC 1Z3GH 4MCZA 4JFPA 2VTFA 5EU7C 1ND0B 3QIWD 4LU5L 1NGZB 3EJZC 4HXAL 4PJXB 2BDNL 1E4WL 1DFBH 5L88L 4U7SA 1JF6A 3QEGH 4XNZB 1CGSL 2FGZA 5ESQB 2HKHL 1IKNA 5J06A 5FV1L 1LK3H 3AC0A 4L8BA 5E95B 1XIWB 5EU4A 3SBWA 4FFWD 2AJZB 5GZOC 1CD1A 4K3EH 5F1SA 2WIIA 3RDTA 3L3HA 1B0GA 2BY2A 3BGAA 4AJ0A 1DJSA 3TO2A 1VKXB 4PLOB 4MJ4A 4OZHE 5HGBB 1R3LA 4QYOB 1G7IB 4M1DH 4L8SB 4IIQA 2QHRL 1A0QH 1NBYA 2IFGA 4IOFC 3LN9A 4PJXF 5GS0C 3MRCB 1EHNA 2W9DL 3SDAC 4DKEH 2JJUA 3MLXL 4MLIA 4CMHC 1YEKL 1KB9J 4WEMB 4NKDB 4WUUE 4P5MB 1NFIB 4MD5A 4QTHA 2X40A 1HWGB 4P46C 3GKWL 3VXRB 1I3GH 2AJYH 4MCZB 4JFPB 3OB0K 3ARED 3VXMB 2QADD 3U4BH 5ICYA 1A3LL 3T04D 5T3ZH 4IRJC 1RUKH 3PP4H 4L1DA 1TVHA 1YEIH 4NQCD 4H25A 2OXGA 1A21A 5FK9A 4ETQA 1OTSD 2E8ZA 2DICA 5EA0H 2E6QA 4L8BB 5EU4B 4ODUA 4F9LA 5JLZB 3RDTB 1WZKA 4G6MH 2ADGB 3VH8G 4GAJL 1MWAA 1OLZA 3TO2B 5D72H 4D9LL 1NGQH 4JM2B 4K3GA 1R3LB 1RIVH 2BFVH 4MAUL 4HC1L 1A47A 3KYKL 1VADA 3ARGA 4IIQB 3MJGX 3G6JA 2CRYA 3BPCA 2APFA 2AK4A 1U93B 4P2RA 3BX7C 1X5XA 5K9JH 2ESVA 4HF5H 4QTHB 2UZIL 1D5BB 5F9OL 4DKAA 3INUH 4UNUA 4V2BA 1NPUA 2P24B 3LN4A 1HINL 2BVUA 2KKQA 3SCMD 4XZUA 4JHWH 4POYA 2ZJSH 4WFGD 4DAGL 5I2IA 3OPZL 4JM2F 4H25B 3IFOA 5FK9B 4ETQB 3B9EA 4X5WA 1D5XA 4Q97A 1CLCA 4N0CC 1NAMA 4ODUB 2EYTA 5DHYA 1RI8A 3T09A 1RZIA 2DMKA 2JB5L 3DX8B 4YPGA 1MWAB 2OI9B 4MMZC 5DRZA 4HULB 4PY8I 1F4YH 1FYTE 1Z2KA 2VDPH 4FQJL 4YE4H 2E3VA 3ARGB 4NQTA 3G6JB 2ENSA 4Z78B 3MLVH 4O2EB 2AK4B 4KK5D 4P2RB 1Y18B 1DUZA 4TVPL 4KFZC 1I85C 1A5FH 1AQKH 2ESVB 1K2DB 4Y4FD 2XI9A 1INQA 1YDPB 4PJ5A 1TFHA 3L1OH 3OF6D 4JQVA 1F2QA 4LSUL 4R6UA 2NY1C 2IBBA 3LN4B 1JGLH 3ULVC 4NZUL 5D96C 3ULUH 3PXHA 3MJ9H 1KCRL 1BZ9A 3B2VL 5I2IB 1L9MA 3V4PL 1YYMH 5CS7A 4WY7L 1BBJB 4XB8A 2VLKB 1ZEAL 4LSRH 5GJTL 2YPVH 4C4KO 4X5WB 3HPJA 3L5XH 1E4XI 1A3RL 4R4ND 2EYTB 5DHYB 3V52H 2D4DA 4D9RE 5D2NE 1RZIB 3OG6B 2XTLA 1CN4A 3CZJA 4YPGB 2YRPA 4WV1C 1LWRA 3TNMB 2VAAA 5DRZB 1SEBA 5FAAA 3WHXA 4DWHA 1FFPB 2OP4L 2CLRB 3MLYH 5FGBC 4X5XB 1DDHA 5EU7E 1K6QH 1PY4A 4ELKA 2A77L 5I6XB 1B0RA 4NYLA 1BAFL 4JLRB 3K1KC 5E24E 2BNRD 1JK8A 3K1DA 5H94A 1UA6L 3KPRA 4G7VH 1OF2A 1FN4A 2OK0L 2HRLA 2YBRA 1INQB 4PJ5B 1CE6B 4X9BA 4ZFOA 5SWZA 4K3HA 1F02I 4A6YH 5JW5A 4I3GA 35C8H 5DURB 1FDLL 3DMMA 4H8WH 4NDMB 3UYPA 2HAZA 5DFTA 1BZ9B 2W92A 5HI4C 5ISZD 1T7XA 5KSBE 2DTMH 4PPTA 4KAQH 2W1NA 4XNUL 4NN6B 2PTVA 4ODBD 4M93B 3RVXD 1XZ0A 1AHWC 2NX5D 4Y1AA 4APQD 5BRZA 4C56A 4RMQA 2EDLA 3LS4L 5ITBL 2VAAB 3VXSD 1SEBB 1UM5H 3TA3D 1KTKE 3WHXB 4HWBH 1DDHB 1JPSL 5SX4H 4OI8A 3BZEB 2F5AH 4ELKB 3K2MC 3DSFL 1B0RB 4NYLB 3V0AC 4QRRB 5DS8B 1JK8B 2JCCE 4JRXD 5H94B 1CL7L 3M1BA 1Y6NR 3KPRB 4GXVL 1FN4B 1MELA 4CU7A 4GAGH 4Y5YB 4GSDL 1XFPA 5KS9F 4ZFOB 2ICES 5SWZB 3CDYA 3JBG7 4K9EH 4MS8D 5JW5B 1NC4A 4X0KA 1OP9A 2CO7B 4CL7A 5HGHA 4C58B 2F8XC 5HDQL 1ZHKA 4NM8H 4NP4L 3G9VA 1MJ7H 2NYYD 3GSUA 3S35H 3QA3B 4PY8J 3S5LA 4JO3H 5EB9A 1DEDA 2DM2A 4P23D 3X14A 2GQHA 1I7ZA 2W38A 1I8LA 1XZ0B 5FUCC 3BQUA 1A9BA 1MIMH 4G6JL 4Y1AB 4CBPA 1HOCA 4MXQD 5F6IC 3O4OC 8CGTA 5H35A 5BRZB 4YBLC 4N90D 4HJJL 2EYSA 3IFPA 3S37H 3O4LA 3MR9A 3EFDL 3HC4L 1CU4H 3BD3A 2XN9B 3SKUD 5CD3A 3GMNA 3RWFA 4L9LA 1GRWA 3LSOB 4KV5E 4OCLC 3O41A 1ZT7B 1MAMH 2WBKA 1V3LA 5DRNA 4QRPD 5F96H 4PR5B 4YXKH 3M1BB 3P4NB 3QQ9C 1HQRA 5L6YH 3TVMB 5T5NG 1NC4B 4X0KB 2DAVA 4YEEA 3W11D 3MODH 5J4MA 2YUXA 1MCHA 2Z93A 4DGVH 5EZOH 5BVPH 2AXGA 3GSUB 3S5LB 5HHVL 4XPGH 4XI5C 2XPGB 3BGFB 4NC1C 4GRMA 4NM4H 3X14B 3FQXB 3SQOL 3TO4C 1J88A 1I7ZB 2NY2B 5D1XD 1FNGB 3BQUB 1A9BB 5H35B 4QY8A 2DLFH 4G9FA 2EYSB 1FFRA 3IFPB 3O4LB 4RNRB 3HB3C 4L4TD 3CSYA 1J8HE 5F9AC 4K7PH 5CD3B 5JXEC 1JNNH 1TJIH 3BPOB 3GMNB 3RWFB 4L9LB 4L8CA 3ULVE 4JKPL 3O81A 3O41B 4X6EA 5E2TL 1T1XB 5DRNB 4Z0BL 1PQZA 3HFML 1HQRB 1C08A 2A2QT 5GHWL 3KS0J 5I74C 5KVFL 3ARBC 2XA3A 5HHXL 3CXHK 3DHMA 5JHDD 3RVTC 1DSFL 2Q7NA 1LHZA 2Z93B 3HUJB 4LGSB 5CEYB 3RJDA 3O6LH 1Q8MA 1JPGA 3O6ML 3CLFL 2XYCA 5B38A 4Q0XH 3PL6D 4JCLA 4P4KD 4TUJB 1NAML 1ZTXL 1A6AA 3O6FD 1C8PA 4DN4H 4LLDA 4QY8B 4XGZA 5MERA 4G9FB 5C0BA 5IVNA 3QHTC 1A4JA 3BDXA 5HYJA 3MFFA 12E8L 3CSYB 4HIEB 1WZMA 3P9LA 4FABL 2IAMD 4JREC 3IDYB 1F4XL 4KC3B 3LEVH 1NCNA 4L8CB 4ZUSB 5D7IE 1B2WH 5F70A 3HUJF 2DF3A 4PJDE 5DD6A 1BZQK 1HSBA 2Z35A 1RURL 1RJLB 3D85A 2ZUTA 1PQZB 1IGIH 3ZL4H 4X99A 1NMAL 1J0KA 5CSBA 3MRQB 1WUNT 1L7IH 3DVGA 5DRXB 3VRLE 1WC7A 1RUML 3STZA 4GH7B 4Z7VE 3EOTH 4P48A 1F2XK 4U2ZA 4TSAL 3T77A 4CU8A 3SO3C 3QXUA 5DMJB 4NQEA 1QFWL 3LIZL 1CFVL 4YJZL 3T2PA 1ZLSL 1S9VA 5B38B 5KZCB 4XNXH 3GI8H 3RPIB 4Z6AT 1BQLL 3HNSH 4HGWA 5JZ7D 1E4XL 4XWOC 1GHFL 4KJWD 4XGZB 5MERB 5C0RH 5C0BB 4EDWL 1A4JB 1OAQH 5EBLA 3MLTA 3IGAA 1HDMB 1ZA3A 4PGCA 2O61A 5B39G 3MFFB 3X3GH 2JELL 5LJYH 1HYSC 5FYLL 1I1AD 4YHNB 4FQCH 5KSVA 2B7DT 4I9WE 2Z31D 5JHLH 1B4JL 4W4OC 1MRCH 5DD6B 1X5ZA 1XEDA 4KXZI 4NQSA 2Z35B 1X44A 1NDGA 2ZCLH 3IDMA 2B4CL 4KGLA 3PF2A 2MNUA 2E7MA 4ZFOL 3DVGB 1WC7B 5FUCE 3STZB 3N85H 4XNYL 4LPWA 3DRQB 5DJDA 3T77B 1F42A 3TZVD 4OF6A 4JHZA 4NQEB 1DLFL 2Q76A 4JKMA 3UPRA 1S9VB 2ZUUA 1BWMA 1KB5H 3I6LD 1INDL 1OHQA 4XMLH 4UQ3A 1EGJH 1YNKL 2Q20A 3O3DA 2ID5A 3MV9E 1EUTA 3PNWA 4HGWB 5B3JE 1MRFL 2C7UA 5EUOF 4Y4HD 4JO4H 4ZUUB 3MLTB 1AGEA 1ZA3B 4PGCB 5DI8B 4MNQB 4DUXA 1JZ5A 1TENA 1MSPA 1IGTA 4LCYA 1AIFA 1S7TA 4JO1H 4NQSB 2V7HA 4KDVA 1Y6KR 3RRQA 3OZ9L 5IG7B 1BGXH 5L9DL 3QJFA 1NDGB 3IDMB 4NC1E 5LKNA 3DI2B 4ODWA 5CKAA 3OKKA 1A6ZA 3LHPH 3NTCH 2Q7YA 4L5FL 4DGIL 3HE7C 2FATH 5DFVD 5KJRL 1MIEL 3JVGC 5K9OA 4OGYL 2FD6H 5DJDB 3B5HA 3ZE0E 2G60H 4BK4A 2Q76B 1N0XH 3UPRB 1IEBA 3O6KL 1JYXA 4KUCD 3SDCC 5EBMA 2HT2C 4WEUD 1QR1A 1KN4H 3KPSE 1J0HA 4UQ3B 2WBJD 3JV4A 4YO0A 3WN5A 2IJ0C 1KBGH 3FT2A 3O3DB 3PNWB 5DJ0A 2CXKA 2C7UB 5JIPA 2VMFA 3MGTA 3GMMA 3LB6D 4RRPG 4L3CB 5DZNA 3LOWA 1AGEB 4XVJH 2H32H 4OZHA 2MHAA 1PEWA 5B8CA 2DLTA 1CXIA 3W0WD 1SJEA 4U7KA 2C3XA 2ORBH 4OF5A 1SJXA 4WFEE 5CZVH 4LCYB 3IDXL 1AIFB 1S7TB 1BOGB 2HFEB 3QJFB 2QSCL 1S8DA 3I50H 2P44B 4JFZH 3C60A 4ODWB 2BOCA 3OKKB 1A6ZB 2Q7YB 4KPHL 3NVQA 2OS7A 1RVFH 3V2AR 3S34H 5K9OB 2BSSA 4YHML 2ED7A 1AFVL 1M71A 4YHYB 2P5WD 1JIBA 1X5LA 3NACL 1IEBB 1F58H 3ABZA 2J8OA 4Z7OF 5CILL 3RNKB 1ERNA 3UZVB 4JRYA 1QR1B 4UT9H 1QO3A 4I18A 5GGQH 4JHBA 3JV4B 4YO0B 3NCFB 1HKFA 3FT2B 4I1NB 3SDYH 3MGTB 4QOKA 3GMMB 4DGYL 1LE9A 3ME0A 1FIGL 4ZYKA 1X5KA 4OZHB 2MHAB 3UJTH 4K3DL 5FYJU 3SCMC 5IW3A 4U2YA 2F54E 1SJEB 4I3RL 4YH6A 1HZHH 5EBGA 4EN3C 1SMAA 4MA3B 1J1OH 1GIGH 4PB0H 5CZXC 1QSFE 4PY7B 4NUGL 3T0WA 2DI9A 1S8DB 3H9SD 4HPYH 1JPTL 2K7QA 2XRAL 3C60B 1BLNA 1N64L 2BOCB 4UDTA 4M1GH 1XGRA 2ZCHL 4MJ5A 5DR5L 5I1CL 3LKRB 1H3VA 4CVZA 2EE6A 1UWEH 2FNBA 4OZHF 1ZVSA 4R96A 1FFOA 4HUMB 1MFDH 3UBXG 3KJ6L 1QO3B 3AVEA 4I18B 3FFDA 4Y0GA 2IANA 4M1CC 4D9QD 2NLJB 1X5FA 3BHBA 1VACB 5I1EL 2IADA 1LE9B 3EO9H 4ELMA 1C1EL 1R3IH 3MGOB 4ZYKB 4U31A 2VDML 3EYQD 2RJMA 5CJQL 3DLQR 4OCMC 1DVFD 4KQ3H 4WW2A 4RMSA 2R69L 4GS7C 3V4UH 1QRNA 3QEQD 4YFLI 3EYSH 2ICWI 4QRTA 5KSAC 4YQXH 3W81A 5EZIL 3SE9H 2NXYD 5FO9B 3TCLA 2ICWA 2CUMA 2OX5A 5A1AA 4W6WB 2R1WA 5E56A 4EKXA 4G8GE 1J8KA 1GC1C 2R0WL 3C09C 4UDTB 5ADPH 1A1NB 4XPBH 1TJGL 3HLAA 4R4FH 1XGRB 1BMGA 1CDBA 2PYEE 2NTFA 5J8OA 4JFHE 4OF7A 4CVZB 4UV4L 3LDBB 2VLJE 1ZVSB 4R96B 1FFOB 5DMGD 4FZEH 3UC0H 3AMLA 1MY5A 4NO5B 5GRXG 2NNAA 3FFDB 5LXGL 4CU6A 3BHBB 2IADB 3KPNA 4DUWA 2GCYA 1WFOA 4ELMB 4RWYL 1MI5D 4RA0C 1MCIA 3TWCL 1FYTB 2EDYA 5C0GA 1YEEL 1U58A 4HKBA 4WW2B 4HPOL 4E41E 5FHAH 4TUKH 4Z77A 1U8JA 3ZHKA 4MCYB 4QRTB 4GLRH 1ZLVK 1D5MB 5GGSA 4LSSL 2KH2B 2YPLA 2R56L 1CI5A 3NFSL 4XX1G 4YIQB 3O11A 4U1NB 2R1WB 4IMLA 4ONOA 1U8OA 4WIQA 5I76A 3QIUD 3ZDXE 2Z8WC 3HLAB 1F45A 5CHNA 2WLZA 1B6DA 1G9NH 3BISA 5IHZA 4LDEB 3QQ4A 2DQHH 4XPHH 1FO0A 3FQWA 3QUXD 5FUOL 4Z7QE 3PWLB 2BSRA 5EO1A 3TBSA 1QLFA 2EIEA 4RGNC 4WW2F 5BV7C 1UKTA 2R1XA 2YOCA 1KCSL 3O9WC 1CTNA 2NNAB 5JQ6L 1SQ2N 3QYCA 1PDKA 3CVHH 2YWYA 4P3CH 5D2NB 2GCYB 5EOQH 3H9YA 3IU3A 2GJ6D 2R2CA 1OARL 3RIFF 5C0GB 1U58B 2QQKL 4HKBB 3IVKA 4N5ED 1H8OA 4KTEH 3RWJA 4HS8L 4Z77B 3WKML 4IRJA 4FMKA 4OLUL 4QTIH 1VCAA 4P23C 2JCCA 4OM0L 5TF1H 5HTSA 43C9A 2BVOA 1REIA 2GJJA 3FRPA 5TFSL 2NCMA 4OLZL 1U8PA 2EDTA 2YN3A 3IETA 1U8OB 5I76B 5FM4A 2LU4A 4JG0H 5CHNB 2JJTC 2VR4A 5IHZB 4R2GD 4MNHB 3QQ4B 1JNLH 1KF9B 1FO0B 3DPBA 3FQWB 1S7XA 1CTOA 1S78D 2XZAH 2BSRB 1QLFB 2VAJA 3QSKB 3IFNH 1CGXA 1RUAH 2R1XB 3SDAB 4J4PC 2FEDD 4OFVA 1KT2A 4CMHB 2X05A 3BJ91 2ICWJ 1MF2H 2YK1L 1UKQA 3O0RL 1W0WA 1NDMB 1N5YL 2IQ9L 3D18A 4LNVA 2JIXB 4P46B 5LGHH 6FABL 1I1CA 3P4MA 1FNFA 3IVKB 3FJTA 4HXAH 1AC0A 2N1KA 3RWJB 3SE8H 1E4WH 3QAZC 4IRJB 4JDZA 1JWSB 3EZ8A 4PTTB 2JCCB 3VFSA 5KSBF 1MCOL 1NGXB 2BVOB 3L3OA 4IRSC 1U8PB 3ZYIA 3IETB 3IRZA 4JPKH 4G3YH 5T5FL 4HJ0C 5DO2D 1PG7H 25C8L 5JDJA 1FH5L 2Y36L 5C3LD 3VFUA 1JUFA 3VA6A 2NXZB 1UT9A 4NN7C 1S7XB 3PGFH 5GSVB 1FL5A 4QHUA 3DRTB 1KJ2A 1IC4L 4N68A 3DX6A 2CUHA 1I85A 2JCCF 2A6KA 1W0WB 4EXPX 3D18B 2D7QA 2P48B 3T0ED 4CGTA 3GSVA 4IOSD 3H7BA 1NCDH 3P4MB 4RGOL 1IAMA 4N0UE 2ITDA 4PJBE 2NY5H 1CD0A 5D7KE 1Z9MA 1MAJA 1A3LH 1RUQL 3TIDA 2D9QB 2WNGA 1D5ZB 3MACL 4JDZB 4KROC 3IJHA 3WSQH 1I9IH 3LN5A 4BJLA 4YHKL 4P4KC 3L3OB 2MSPA 1C16A 4XAWL 3C6LD 1J1PH 2HP4A 1KEGL 3VGAC 1JZ7A 4Y5XC 1QUNA 2I25N 3UCRA 4E0RA 3P0GB 2A6JA 2CR3A 4N0YH 3LQAL 4J3UA 4TQEL 1G9ML 1A1OA 2W60A 3U0TA 1LD9A 1YJDH 4X8JA 4XWGL 3SGDI 2J12B 5FGBA 3KYKH 2ZUYA 3RP1A 1FL5B 4QHUB 1LO3L 1HHJA 2IMMA 3WLBA 1CXKA 1KJ2B 4W4NA 4KV5F 3K8MA 2VZTA 5HD8C 3DX6B 5CIPA 5HVFB 4FQLL 4TSCH 2DQCL 4F7PB 4KY1H 1NSNL 2EIDA 4ISVA 4JN2A 4NJ9L 4RDQF 4FQIL 2FCBA 4LLYA 1J8HB 1EEQA 5TQ2H 2P8LA 3GSVB 3H7BB 3U82B 2NY1B 2ITDB 4ZFGL 4U0QB 3TIDB 5D96B 4POZC 3V5HA 5M95B 5HHOD 4PJDA 3IJHB 3OPZH 3LN5B 3HKFA 3ZSSA 3DGGA 4FG6D 4U6YA 4RGNE 4TSBH 1N3NA 1C16B 4TYUA 4OQTH 1RK1A 4JRXE 1PVHA 2LU7A 2A6JB 4Z7VA 3VXQB 3OKEA 4P57A 4WV1B 1QBML 1A1OB 2W60B 3U0TB 3IKCA 4X6FB 1LD9B 4X8JB 3QULA 4JDTL 5D9SB 3BMWA 3F12A 4L9DA 1HHJB 3ULVF 2A0LD 4W6YB 3EDJA 4LIQL 1MHPL 3GJEA 3DETD 5CIPB 3ZSTA 1C5CL 4OZGA 4TVPH 5F8QC 5HGAA 2AJ3B 4UZGA 1KCKA 5CP3H 2VR9A 4NN5C 4ISVB 3BP4A 4JN2B 3THML 1EHXA 3SKOB 4LSUH 4LLYB 4HH9A 4H0HB 2P8LB 1IAKA 4Y2DD 4G6FB 3IXAA 2OJEA 4JFQA 5IUSA 1CLYL 5T3ZE 5IGXL 3V5HB 1KCRH 4PJDB 3V4PH 4LFHG 1P7HL 3DGGB 4U6YB 4RISL 2X70A 1ZEAH 4KKAC 2EH8H 1N3NB 4NQDE 5GJTH 4GG6E 2P5EA 4PJGA 2HKFH 2HJLA 4MLSA 3WFDL 2DQGL 4K9EC 2B0SL 3RPKA 3M8OH 4OIIL 2IALA 3B4NA 4Z7VB 1ZMYA 5LBSH 3OKEB 4P57B 3DUHA 4TTDC 1OWRM 1PKQE 1FO0L 5I8KH 5IB2A 3IKCB 2VQ1A 5FYJL 3QULB 2ZSVA 3F12B 3ZT6A 3CZFA 1RHHA 4OCRL 5GS0L 4ZO8A 4LHQB 3WKNA 5C0CD 5D7IF 3ARUA 3LPWA 1BAFH 3GJEB 1N6QL 4G6KL 1XF4A 1YYLL 2N4IA 3MV9A 1UA6H 2C3HA 5HGAB 1BQHG 5FA3A 3MV8D 3BP4B 3EKCA 4RWHA 3RUGE 4HH9B 3VRLF 1IL1A 1IAKB 4Z7VF 3KLDA 4QKXB 2OJEB 4JFQB 3VXNA 5F7YC 2FZ3A 4CMMA 3D1MC 2R1YA 3W2DL 1MPAL 4XNUH 3MRFA 3VMNA 1T1ZA 4JQIL 1KENH 2P5EB 4PJGB 4PUBL 3V9FA 2HJLB 1GAFH 3TO4A 3S88H 3BKCL 2AJSL 1ZOXA 4ZAKA 3LB6C 2IALB 5C2UB 3O4OB 3OAUL 4JFEE 2B8OT 1K85A 2V5SA 3REWB 4MYWB 3LS4H 5ITBH 5C0AE 1BD2D 3OXSA 5MP6H 3WE6A 4IOIA 5JHDE 1JPSH 3CZFB 1RHHB 5GRJH 4YDVA 4OV5A 5IKCA 3N9GH 3KPSA 3OV6A 3DSFH 1DP0A 3LKSA 3MRBA 3NH7H 2YXMA 1TITA 1XF4B 3H9HA 3MV9B 4GXVH 4WENB 1DEEB 3IJYB 5FA3B 2EDOA 3OKLA 3RX8A 2X09A 2X7LB 4L3AA 3EYOA 3GM0A 1IL1B 1JGVL 1GSMA 1R3JA 3ARBA 1NFKA 3JV0A 4ZXBA 4M4PA 4PRIE 4YDIL 2AQ1A 4NCDA 2LABA 5IQ9A 2BVPA 4YUEL 2DYPB 4CMMB 4LMQI 2R1YB 1AH1A 1ZGLA 4XCFL 2WUBH 3PWPD 4PRPA 5DD3L 5JW3H 2XWTA 3MRFB 1PY9A 1T1ZB 1T6VN 4G8FA 3MRJA 3EFFB 3KPOB 3TO4B 2JJVA 1TCMA 3MMEA 1UH4A 2MMXA 4G6JH 4PJEA 5B3JF 3BKML 1GYAA 4GQ9L 4UQ2A 4R8WH 4WI4A 2DWEA 3FQRA 1DANU 3OXSB 1VERA 4IOIB 3WE6B 1WICA 1UCBL 5I71B 2PTUA 4FTVA 2CIKA 4OV5B 2ZUWA 4YDVB 1KJ2L 3KPSB 5GISL 3MRBB 2CLZA 3H9HB 1N5AA 3ZE1E 2UZYB 3OKLB 3QDJE 3EYOB 5CJOL 3NA9L 3ARBB 2Y06L 2F54A 4Y4KD 4ZXBB 4PGEA 5I30H 4N8VA 3WNKA 3L7FB 4WI8A 5IQ9B 2BVPB 3BP7B 3QZWG 2NTSP 5EU3A 3ZE0F 3D9AL 1B90A 3RAJL 1ZGLB 4OUOA 2J88L 2BRRL 3DX7B 4PRPB 4ZNEE 2XWTB 3B8SA 1PX4A 4G8FB 3UTQA 2XKNA 1FIEA 1K4DB 2GEEA 1FVCB 3U46A 3ARZA 1CF8L 4UAOC 3RI5K 4M62H 4PJEB 4UQ2B 4Z8FL 1H3GA 4HCRA 2DWEB 3FQRB 4P59H 4LCUB 3UAJD 3E0GA 1VEMA 3T3ME 4FTVB 4P3WA 2CIKB 4U1HA 1AGDA 4AYFA 3MFGB 4JKPH 4ZD3L 3QPQC 2O26U 3MV11 3MOQA 2CLZB 2NXYC 4Z0BH 1ZLWK 3QH3B 4PJCF 5I1IL 1A9EA 4MNGE 2HTKC 5GHWH 4J12A 5JOFA 5FB8A 5CGTA 2HVKA 5BXFA 4JQXC 2F54B 1PZ5A 4PD4K 5IBLD 1T03L 5B4MC 4N8VB 1YUHA 3LKPA 4WWKA 4MQSB 3SO3B 5EU3B 4H5SA 1W8OA 2M2DA 1QSFB 2VXVL 1PZUB 4HUVA 5DMGC 5T1LA 3U0WH 2BP3A 2HMID 1KJMB 4P49A 2XZZA 3UTQB 3VRJB 1Q0YL 4G8GA 3BDYH 5L2JA 1NAMH 4XXCC 1ZTXH 2ZG3A 5CSZA 5AYUL 3U6RA 2XTJC 4FQQA 2PYEA 1LK2B 4YAQA 3VGBA 1IE5A 4JFDD 4AQ1B 2ATPA 1F8TH 12E8H 2XXMB 3LRSA 5J11C 3BO8A 5BZWA 43CAA 1F4XH 1NCBH 3F58H 2I5YH 4CN4A 3WYRA 2IPKA 5DQJA 5J9PB 1CDJA 1G0DA 4XTRD 1Z9LA 3NZ8A 1A9EB 4MA7L 1ZS8A 4Z9KB 2GW5A 4G5ZL 5F9WC 5JOFB 2DQEL 5FB8B 2HVKB 5BXFB 1RUMH 3P0VL 1ZLVH 3HE7A 4OFIA 1PZ5B 3MROB 2LAGB 4OCYL 4K2UL 1IC7H 4E41A 2PNDA 1YUHB 3LKPB 4WWKB 4ZDHB 2HRPH 4H5SB 2NY6B 4HUVB 1T7VA 2EE9A 1FL3A 1EO8H 3V6ZB 4XPTL 2RBLA 4Z7UE 3SDCA 1FVDA 3GSNH 4G8GB 4OLEA 1X9QA 5L2JB 1U8LA 3U6RB 4ZS6C 1KNOA 1E4XH 2PYEB 3GMPA 4YAQB 2FHCA 4U6HA 4OCSL 1QKZL 2ATPB 1WZ1L 2VLJB 2Y07H 3MLRL 4N5EC 2JELH 5BZWB 43CAB 5I75B 1EZVY 2Q87A 3RTQC 4UUJA 4AEIL 2IPKB 5DQJB 4LSDA 4MD4A 5I15L 2BXZA 1JV5A 2AJXL 3FONA 1XIWD 4ZTPH 1BF8A 4M7JL 2B1AL 4OCNC 4NWUL 1KG0B 1S9XB 2B4CH 5HI3D 3ZDZE 3SGKC 4Q9RL 4QXUH 1ZS8B 1JP5A 4M61B 1T83C 4H0GA 1X5IA 4OD1L 5HYSA 5IEHA 3HE7B 2IMNA 3MLSL 4QEGA 1D5IH 5TF0A 4E41B 5IHUH 4MDJA 1S78C 4WDIA 1A7RL 2KUTA 1HHIA 4IMKC 4D3CL 1A7OL 2DKSA 2ITCA 4MZ2A 1PG7W 3SDCB 2QBWA 1INDH 1FVDB 1FNEA 1Q0XL 3IFLL 1KCUH 1U8LB 3MA7A 1JNHB 4X9HA 2IG2H 1SYVB 1UM4L 4MVBD 3ZHDA 1KNOB 3VXRD 3KS0H 1MRFH 3WUWG 4U6HB 3VXMD 3OKYA 4JEGB 3UMTA 4GW4B 3IAQA 2APBA 5KOVC 4UU9A 1T21B 3CIQA 4DQOL 4OLXL 5E08L 4EN3A 1HILA 4UUJB 5F9JB 4MD4B 5I1LA 4NZRL 1A7NL 3FONB 4CW1A 1T3FB 1H3UA 1ZHNA 4DK6A 3RDTD 1R5WB 2OR7A 4D9QE 3QUZA 2VZVA 3QXVA 4BZ2L 5HYSB 3B5TA 5CJ8A 4HWEH 3ZDXF 5IEHB 4JM2D 3DIFB 2VQUA 2XZCL 3L3GA 4WDIB 1KTRL 1HHIB 4K8RD 1MVUA 4ZO7A 1B4RA 5HPMA 4Z7QF 2ITCB 3GO1L 2FX8L 4RX4A 4H88H 3U0PA 3X17A 2DQIH 5ACZA 1FNEB 2G75A 1CICA 1R3HA 3QRGL 3MA7B 3GMOB 4X7EC 1EFXA 2BSTA 3F65A 5DQDH 3TBTA 5ILTL 1MJ8L 2X4OA 1KFAH 4UU9B 4KVCL 3VGGA 4HBCL 4HXBL 3TH3T 1JHTA 4EN3B 2YD3A 2GK0A 4U1GB 2R39A 5I1LB 3CXDH 4KKLD 4CW1B 1EHLL 3G6DH 3P9MA 5KSAA 4LRNL 3JZ7A 4J7RA 4YPJA 1U6AL 3U9UA 2VDKH 8FABA 1B9ZA 1KELH 2XTJE 3R06B 2ZKHH 5EOCJ 5SWQA 4PJBA 1RU9L 1SJHA 3ARGD 5JW4Q 4YHMH 2BHYA 4LLQB 1AFVH 3L3GB 5C0JA 5ENWA 1MVUB 1YNLH 2AK4D 2CK0H 5HPMB 2ZZUT 2CDEB 4P2RD 3CFIC 5CLTA 1OD9A 5CILH 4ONGL 5E70A 5HHME 3WFBH 2DJ4A 2ESVD 5TE6L 2X5PA 4EQ3A 5CBEA 2G75B 1CICB 2VZ3A 4HS3B 2ZCKH 4LLUA 1CIDA 3F6IA 4OLYL 1EFXB 3N06B 4AEHL 1JYNA 1UJ3A 4JRWA 2X4OB 4HCRL 3BXNB 3QIBA 2E27L 4ZO9A 1CGWA 1IT9L 1C5DA 3I6GA 1JHTB 2DMCA 4WHDA 4GS7B 4OKVA 2GK0B 2VLKD 5AD0A 2E6PA 4HUXA 4OF3A 3VFPB 3P9MB 3O3BA 5KSAB 4Y19E 1MCLA 4BQBA 4Q58C 2D7TL 3A0OA 5C86A 5JUEH 1NBZA 8FABB 3C09B 1II4E 2ZCHH 3SE4C 4N0UB 2AERT 3N1MC 4PJBB 5SWQB 3L7EA 2NW2A 1SJHB 1MNUH 4H20L 3MXVH 2OMBA 4PRHA 5ENWB 1H9VA 3MYJB 1GOHA 1DR9A 1ZKAA 2R4SH 3MLUL 5D2LE 5TE4L 2EKJA 1AGFA 5D4QA 5CBEB 4O9HL 1Q38A 3OJMB 4PJ5D 4LLUB 4PJ9A 4JO2L 1G9NC 1M7XA 2Y6SD 3K74B 5I1EH 1TTUA 1UJ3B 4PJAE 1CXLA 4NNPH 3SKJL 5DURD 1AC6A 1DQTA 1NLDL 2G2RB 2VDMH 3LAFA 1C5DB 4DTGH 3I6GB 1BFOA 2EEAA 3WIIL 4OKVB 2FO1A 3VD3A 1L6ZA 4R0LA 5GS3A 3O3BB 3NCCB 1FL6A 5EZIH 2L4OA 4S1QL 5DUPL 1J1XL 4NRYA 1NBZB 3K8LA 5I0DA 5D1ZA 2BJML 5AAMA 2R0WH 5FYKD 1M7IA 5E8DL 4YEFA 4ZOBA 5FYLD 3L7EB 2NW2B 1H0DA 1CK0L 1NCWH 1ZT1A 4PRHB 1XGUA 4BA8A 1JTTA 4QRRD 1CGVA 4RGNB 5BV7B 4D0BA 4NQDA 3VFGL 4OGAC 1GVIA 1Y6MR 3KPRD 1PGRB 3S6CA 2M26A 5C7XL 4GG6A 2EDDA 4J4PA 3O9WB 2JK5A 3VW3L 1BHGA 5I8CA 4RA3A 4PJ9B 1RMFL 1N7MH 2NR6D 5EIQA 5SWZD 2FR4A 4IRZH 4J8RB 4BQ6A 3HE6A 1A6WL 5EOCL 2PR4L 5ALCL 5T1KA 1HYRC 5K9KA 3HPLA 2LU3A 1QLEL 1MCPL 3O3AB 4LQ1A 3QUMH 1GGIH 3WNNA 2COQA 4LSSH 1FL6B 1EVTC 1CFQA 2PXYA 4ZSOE 4KXZH 1QFUH 4IRSA 4Y1AD 4ZPVA 4NRYB 5BRZD 3RHWK 3S3SA 1IGCL 1PW3A 3ARDC 4TPRL 2A38A 5IQ7H 3RUGA 2A73A 2EECA 3QHFH 5JTWA 1JHKH 2XN9D 4MAYC 1H0DB 5F7EL 1ZT1B 1F90H 1XGUB 1XGQB 1IQWH 3DHJA 1FPTH 4D0BB 2V7NA 4NQDB 2F5BH 4GG6B 1VSCA 2DD8L 1KCSH 2JK5B 1U91A 3ROLA 5I8CB 3TVMD 1HNFA 3JV5A 5JQ6H 1HKLH 1W0YT 2AK1H 3WJJA 2FR4B 4LCIH 1A2YA 4EJ1C 3MRHB 4JFEA 4QLRA 1UB6A 1EEZA 3T08A 1FORL 2VC2L 4PGDA 2V17H 5T1KB 3EIFA 4HIXH 1QSEA 5KANI 3T1WA 3B9DA 3HPLB 3BP5A 4QXGL 4HS8H 4J3OC 1MFBL 1MUJA 3QAZB 5FKPB 1U8QA 4P9HH 4KJPD 2NY2D 5F7UA 2VXSL 2PXYB 4OGXL 3BQUD 4IRSB 1UQSA 4WTZG 3JUZA 5TFSH 3G5VA 3WIFA 4ZPVB 5EO0B 2F8VA 2YD8A 2VH5H 2QLVB 3NAAL 3R4DA 4LLAA 2A73B 3RUGB 2WWKO 2YD6A 3VWJC 3IU4L 3K2UH 4PRIA 1MCJA 4S1DD 3GNMH 4NN7B 1DN0A 1FNSH 5C70A 2C4FT 4ENED 2V7NB 3T1FA 2GSIA 3CMOL 4XCYA 4MA8L 5HHQA 1A2YB 2YK1H 3KLHD 5MI0C 4JFEB 3FT3A 1YEGL 2F19H 3AM8C 5IV2A 1UB6B 1EEZB 5FIEA 2D0HA 5C0AB 1YJDC 3RVWC 4PGDB 3RUGF 2G5BA 4DK3A 1B6UA 3KXFA 4KMTH 1EVUA 1U92A 3BP5B 1OCWH 4LPUA 1FC2D 1MUJB 4WO4A 4KROB 1U8QB 4HIJA 2DKUA 1GZQA 1MCOH 3H2WA 2KL6A 3HI6L 4JPWH 1UQSB 1WWAX 1N6VA 3G5VB 3WIFB 3A6CL 4KKBD 4G9FD 4HH8A 4ESKA 4Y5XB 3CK0L 3HRZA 4Y89A 5DFWH 3HMWH 1FH5H 2IGFH 3X12A 5M7QA 4PRIB 3MA9L 4WI7A 4MJIE 1J0YA 2X4NB 5J57B 3W9DB 3U2SA 1P53A 1DN0B 3CX5K 1MCQA 4NHCH 4ZNEA 3V5KA 4AH2B 1O5DT 3T1FB 2GSIB 1IC4H 4XCYB 1PJ9A 5HHQB 1IQDA 3K7UA 4ZNCD 5BOZG 3VH8A 5IV2B 2Z91A 5IROA 5KG9A 3VFWB 4KK6C 5IBLC 4DN3L 4HWBA 1NL0L 3BW9A 1I75A 1MCFA 5DD0H 1U92B 4LF3A 1Q9KA 1FYHB 4WO4B 5KZCD 2UZXB 1GZQB 1B3JA 2ADFL 1WWWX 1OWWA 2UUDK 1A4KA 1RSFA 3L95A 4V1DA 4XAWH 3LQZA 4MNGA 3QDJB 3DTXA 5C0BD 4NO0A 4A6YB 1UXWB 3HRZB 1IJ9A 1Z3GL 4AEFA 2AQ3A 3BIKA 3TFKD 3BPNC 3X12B 3BIBX 3BJLA 3ZTNH 2ZUQC 5FCUH 1RJCA 4P9ML 3QEGL 1IAIM 2XKUA 2DM3A 4YHPA 3V5KB 1LK3L 4XRCA 5C6WH 3GMLA 1G6VK 1MRDL 4NHUA 5CGYD 1T2JA 4YBHA 4FQLH 4ZOEA 5I1GH 3L6FB 3VH8B 4NN5B 3ZE1F 5KVDH 2P1YA 4M4RA 4FQIH 1M05A 4NQED 2AAVA 1A0QL 4XBPA 3BW9B 4X4XB 4LF3B 1FZKA 5ID0A 3EOBB 3T4YB 4DKEL 1Q9KB 3QWOA 2H2PD 4ALAH 1OGTA 4AQOA 3L95B 2GFBA 3LQZB 4MNGB 3DTXB 3MV7E 4NO0B 4M00A 4G9DA 1I3GL 5JPNA 5C9KA 2D03L 5AZ2L 4FNLH 5F1IA 1EMTH 1HHGA 2I27N 4MNQD 5KSUB 5T3ZL 1RUKL 3PP4L 1YEIL 5IWLC 3EJYD 1TMCB 5K9QI 2OYPA 5EA0L 4YHPB 4BH8A 4FQXC 3T3MF 4UNTA 1ES0B 2CPCA 3GMLB 4YGVA 3GSWA 3V0WL 4LIQH 5HI3C 3BRDA 1C5CH 4X9GA 4WVRA 4G6ML 2D0GA 1WFUA 5I8OH 3THMH 5D72L 1M05B 1NGQL 1RIVL 3MZGB 1FE8H 2V9QA 5E6IC 1WQVT 4XBPB 4YR6A 1XMWA 1FZKB 5ID0B 1BQSA 3QWOB 1MCKA 3ZTJG 5DC9B 5CEZD 1CXFA 3HNVH 3IJSA 5K9JL 1OGTB 3O3EA 2ARJA 3KNBA 3HG1E 4HGMA 4HF5L 1HIMH 4RISH 4CKVX 3T0DA 2GFBB 4UB0H 4HD9A 3V8OA 2FDBP 5JPNB 2HJKB 2B0SH 4FRWA 1Q9WB 3BD4A 1HHGB 1IFHH 4NJAH 4QGTA 4BUGA 3CCHA 4P2QA 1OAYH 3D0VA 5FYJH 5F3HB 5IR1A 1ZV5A 2WWMD 2HLAA 2RGSA 3ILQD 4OCRH 3BZ4B 4YGVB 3SBWC 3GSWB 1V5JA 1RPQA 5ANMA 3LVEA 4KUCF 4AEEA 1YYLH 2UYLA 2B39A 4Z7NE 2H2SD 1OTTD 2BNUA 1F4YL 5IFJB 3GMRB 1IARB 4YE4L 4L3EE 2L0DA 2XACC 4YFEA 1T80A 1FAKT 3MLVL 3VE0B 2XNAA 5EU5A 3MCG1 4Y16A 3L5WA 2J8HA 1CBVH 3IJSB 1RK0A 1F4HA 2ARJB 3KNBB 3O3EB 1A5FL 1Z5LA 2ZUSA 1JI1A 4YBQC 1MPAH 4F3FA 3OX8A 2D7NA 4Z7UF 4F7TA 3L1OL 4PUBH 3BYYA