3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
3QXAB 4POZC 5IEKB 3IDJB 1EBPA 2A74A 3AS3A 5EC2B 1AHWC 5DJAB 5CAYB 3BUYA 3KDMA 4NC1E 4XCEA 4M6MH 3OR7A 1M05A 1NCBH 3RP1A 3GB7A 1JGUL 4NKQB 2IH3B 4GUPA 4P2YA 1JHTA 4RBPK 2GSIA 4OIIH 1W8OA 1MI5A 5ITBH 4KY1H 3DYMA 2CKNA 4M93C 3JVGA 2VDMH 5E4EB 4BH8B 1RZIA 1AD0A 5ADOH 1RHFA 3SDDC 1WFOA 1EAPA 1T03H 3TZVD 4RMWA 5FGCB 1Y6KR 1PLGL 4TSAH 3VGHA 3FO2A 4OZ4A 1KC5H 2ZNXA 3LS4L 1AJ7L 1VGEL 4X8XA 3EO1B 5GJTL 3ET9F 1ADQH 2BJMH 4JM2B 3BH9A 4ODHL 1PAMA 1WEJH 2OP4H 4EDWL 5CINH 4UUJA 5ECJE 1EBAA 5EDXA 4CBPA 1IC4L 5GGVH 2VXQH 1PEZA 2CRYA 3AB0C 1YPZF 1FL6A 5F7DA 2A6JB 2DD8H 4JKPH 1YY9D 3M07A 4ZS6D 5L6YH 3NA9L 3UPCA 3LEYL 3OF6A 3UBXI 4YGAB 5FDWB 1DJSA 1MWAL 4XPTH 3LPWA 4TOYL 3T2QA 5BXFB 1K6QH 2BSTA 3UZQA 4WUUB 3IDGB 4KRMB 5I1LA 5IB2A 5EU7C 3ULUL 3BSZL 1OAKH 1YMME 5ETUA 4HPYH 3ROOB 4RRPA 3FB5A 2FD6L 2YOCA 2E27H 5DS8B 3KPLA 4JFFD 5H94A 3RL1B 1N0XL 4OZGB 1OGTB 3KPMB 5LAXB 3OTTA 5D9SA 3VG9B 2AK4E 2VL5A 1CGXA 1AKJB 3QHZL 1QLRA 3EOAA 1HSBB 4TNVK 1AGCA 5I17A 2ARWA 5DUBA 4HW6A 3HUJF 1IGCL 5FHAH 2JK5B 3SKOB 4BJLA 2PYEB 4NQEE 4KVNH 1EZVX 3IJSA 4QRRA 2F53E 4YBHA 3C9NA 3QNYB 4P2CG 2HRPH 3FZUD 2K3TA 4OLUL 2J4WL 3RA7L 1Q8MA 3MRLA 5BV7C 4H5SB 3D18A 5ALBL 1ZVSA 2H9GA 5C6TL 3DIFA 1MCPL 2OSLB 4P2OC 1FFPA 3VWJB 2XIDA 2PN5A 3FRUB 3FO1A 3ARRA 1JZ8A 3D85B 1NFIB 3ARBA 5MP6H 2R2EB 3QDHA 4L8BB 4XP4H 3IFLL 1A4KA 1PKQB 1YEKL 3HPJA 2O5ZH 3G9AB 2W60A 3PHQA 2F15A 2VLMD 2EXWD 2MKLC 12E8H 3IB4A 5IEHB 3PGDA 2WBJA 5MERB 2QHRL 3C5JB 3G5ZB 3IETA 3QUZB 4NQXB 4TNVF 4Z95L 4KUZH 4YGVB 4YX2L 1YPZB 5CCKL 4EN3B 3NCJH 5DK0A 5GS2D 1OLLA 5C0GB 4LHUG 4E42B 1AQKL 4R6UA 3CFCH 2W0FB 1AGFA 4KUCF 5BS0A 1C16A 3X12A 3HPLB 4I13B 4TVPH 2HT4C 3BAEL 1LQSR 2CR3A 4XXDA 4YHOL 4F2MB 4UT6L 3SO5A 4DWHA 4G8GE 5AYQA 4AJ0A 1BHGA 2CDFA 1ZT7B 5DR5H 1QSEE 1BOGB 3MRHA 4WFFE 3ECBA 4HFUL 5T1MB 1Z6JT 1MRDL 4X5WA 1J0ZA 3KPMA 5D1XC 1MFCH 5LGHL 3TN0D 4PS4L 4XWGH 1CE6A 5IR1A 3EYUH 4G7VL 3EYVA 4JO3H 1PGRB 1T5WB 5F96L 1JPTL 5J12B 3IVKA 1JNHB 3GBNL 2H41A 4RDQF 3ULUC 1SEBA 4TSCH 3MRGB 3W0WE 5IW1A 1WT5A 1NDGA 3U4EB 2CIKB 3PWLB 2ZUTA 3B5TA 4U1NA 3ZKND 3VFRB 4XB7A 3KPQB 4M62L 5TE4H 3QUYB 2EYSA 2WBJD 1CTOA 3MRLB 3RNKB 4C55A 4H5SA 4LLQB 3L7EB 3DIFB 4XP9L 5FYJU 5C0JB 3W2DL 4LRNH 5IMKA 2Q86A 5SX5H 2AK4A 3FQTA 5HYJB 3FRUA 2Q1EA 3AU1A 1W0WB 1RZJL 2VXSH 1FGVH 1MIEL 1XF3B 5E7BA 4AEIL 2X9WA 4ZUTA 1A4KB 1PKQA 3HPJB 4NRYB 3MLVL 3DVGB 4M7JH 1OLZA 1TIUA 1FBIL 2YEZA 4F33B 5C07D 1A4JA 3TNMA 2AS5M 2M26A 4L4VD 2P5WB 3U46A 4G6JH 3RFZC 4X5XB 3JV6B 2K9UA 3G6DL 3WFEH 3IS0X 5C2BL 2R1XB 4O58H 2I60L 4JFYA 3OF6D 4PB0L 5DD6B 1I3GH 4WCYH 1FYTA 5FA3B 3HC3L 4O2EA 3MNWA 3H9HA 4S0TD 4O5LL 2E7LA 1RIUH 1AGFB 3RWHB 3VGEA 4Y4HD 1JTPA 2L7JA 4F7EA 4Y4FC 5L7XL 3QA3B 1UYWL 3MLZH 4IDJL 4F80A 4HDIB 5GGSA 4HX1A 2VAJA 3QJFB 5E7FA 1P9MA 3GEWB 4PGDB 4HUVA 1VPOL 4K3EL 3OAYH 2BMKA 1MCBA 4P4RB 1FP5A 4BQ8A 4NT6B 3BX7C 4IOFD 1CBVL 1N8ZA 4OD3H 4W70A 3WEXA 4LHQB 1AHWA 4KGJA 2IGFL 1UH4A 4HLJA 5LGKA 1GOHA 3D9AH 5KVDH 3M45A 2PO6D 3C5ZB 3VRJB 1TTUA 1MLBA 4JZNB 4ZPTB 3U0TB 3MRGA 5IW1B 4D3CH 3ARDA 1XCTA 5DHVA 2DQGH 1WLHA 3AY4C 1XH3A 3L5JA 1HYSD 1VHPA 4B53A 3KPQA 2Z9TA 1OW0A 3ARYA 3QFJD 3RVXC 5E1AB 4ODSL 2EC9T 1UZ6E 4I3RH 3PWPA 3CH1A 1K8IB 2VDOL 3CDGA 4FA8A 4QGTA 1KIPB 4K2UH 1ZWIA 3ZL4H 4APQA 1HSAB 4YAQA 2FWOB 4L9DA 1ZT4A 4KDWA 4GOSA 3BEWB 4Y4HA 5DO2D 3LQMA 3MRCB 4XAWL 3C60A 3NACL 2NY3C 3S3PA 2A0LC 4AEHL 3GSNB 2C1PB 5D6DC 5EU5B 5DQDL 2GITA 5DD5L 5D72L 2UWEF 1EJOH 1EEYB 3C2AL 4XVUC 5EOQH 3SDYL 2RAMA 4LARL 2BVQB 2K7PA 3G5VB 3SE4A 5B4MD 5ICZB 5JXEC 4U7SA 3FQNB 1MCDA 3OG4B 5BS0D 5CGTA 2VZSA 5GHWL 5J3HD 5GSRB 4DOHB 2Z92A 1U8LB 4HGWB 4PJGA 4JRYB 4M5YL 2R0LH 3U48A 4GKSB 4JFEB 4ZOAA 3RHWF 3T2NL 2KQMA 3LKSA 1VFOA 5D6DA 1NBYB 2Y1VA 3BIBX 4G6MH 1CD9B 1J5OH 1A7RL 4HIIB 3BE1H 1N8ZB 3SJVD 3GBLA 1J0IA 5I1AA 4HUUA 3PWPD 3V5HA 3U1SH 3CXHK 1N59B 2VLJB 2OTWA 2X40A 5E5RB 2BJML 1MLBB 1FPTH 3X14B 4KI5D 4F7MB 3UMTA 3FT4A 2VXQL 1DBAL 3VGAB 3UTOA 5IBUG 1PEWA 3NA9H 3QIBB 4MNGA 3MLYH 1GGYA 4UIKH 2MTPA 5T5NF 4HUMB 4YIQA 4D9LH 3ARBC 5JMRA 2E7MA 5ACLA 3FQXB 2FX9L 3Q2CA 3UPAA 3VFVB 2FZ3A 3TYFB 1U95A 5EU6A 5FYKH 2AJSL 5TFSL 3WFBH 1QYGH 5D2NC 6CGTA 3L3HA 2DQTH 5J6HA 5DMYA 1MHPH 2YPLE 1UA6L 5HY9A 4PJIF 2FL5B 3QIWB 4QO1A 1JBJA 3T0BA 3GJFA 2E27L 4Y4HB 1VFBA 3KJ4C 1R5VA 2DQDH 3C60B 3L3DB 3DPBA 1QA9B 3OGCB 4HKXA 3CPLA 4H26A 1R3KB 2GKIA 1I7TB 1LO0H 2C3VB 1OTTD 3O6FC 3TZVC 1KIRA 1ORSB 1CE1H 3TH3T 1FYTD 3KDMB 4XCEB 1A7QH 3GI9H 4GSDH 4NO5B 3V4UL 3AAZB 4WU5B 5M7QA 2AEWA 4XBPB 4P46C 4WEBL 3IDNB 4KK6C 3GMMB 4O4YL 1T7VA 1HEZB 3RA7H 1F45A 4PRHA 2YD1A 1UKTA 2MFNA 2UYLA 2J6EA 3T4AA 5FOBB 2XZAL 4GKSA 3HNVH 3B9EA 3RGVC 3C08H 5EC1B 4EOWH 2DQFB 1XR9A 2DAVA 4LVEA 3TT1H 5FB8B 5MHSD 3HAEA 4WI6A 3FT3A 4W4NA 4YBQD 4P4KD 5H35A 3TM6A 4X9GA 3UYPA 1BLNA 2PW1B 5DI8B 3S36H 2IG2H 3RDTD 1ND0A 1S9VA 3BD4A 3BMVA 4JRXA 4X7FC 1RVFH 4N8VA 1U0QA 4JO4H 5C0FA 2F8XC 3HMXA 4RGNC 4NKOB 1X4YA 1IE5A 3VXOB 4IRJA 4WGWB 1NGXB 4HWZB 3IJYB 4YHNA 4JRWA 1NAKL 1T80A 1KCVL 2BSTB 4WEUD 4OUUA 4N0YL 4NPYB 3CCHA 5JHDD 4OZIE 3AM8C 5CGYC 4EXPX 4KRNA 1CT8A 1FFRA 2VTFA 3QZWB 5E1HB 5GRUH 3VFVA 3TYFA 3RL1A 3ARUA 1EHAA 3L3HB 1MVUA 4UT6H 3WKNA 5HPMB 4PY8J 4OZIB 3QO0B 1YMMA 3LKQB 3NACH 1HSBA 5I17B 3BPCA 2ITDB 5A2LH 4OFIA 4NHUA 4MSWA 3QBTB 4OGYH 3IDJA 4MJ4A 3IJSB 4XWGL 1I7TA 4LCWD 4PUBH 4FQHA 3PV6A 1YECL 4HXBL 3GM8A 5I15H 3QB7C 1ITBB 1UWGL 5CILH 1JHTB 1L6ZA 2LU7A 5C6WH 4Y5XA 5ID1B 3N1PC 4YHYC 4PRAA 4HKBB 5CZXC 2IMNA 4X9BA 2ADIB 4X6DE 2XKNB 1A2YA 3PP4H 2C4FT 3HZMA 4OZ4B 1N64L 3FTGA 4WTWA 5L9DL 1TZHA 4FHBD 4J3OC 4N0CD 1K2DB 3QDAA 5D7LB 3G6AA 1GOFA 1EH9A 3H9YA 1FGVL 3FT3B 2EXYC 3DX6A 5T33H 4RFOH 1GC1L 4KKAD 1HQ4A 4UOW1 4WDIB 4QRQA 4PRNB 5FKPB 1AGEB 3ROLA 3T77A 5F7FA 1YPZA 3NCYS 3RZCC 4P2RA 1UT9A 5BXFA 1T66C 5KSAB 2R0WL 3D3VD 4R8WH 4NJAL 5TGBB 3RZCB 1C16B 5DGRA 4LNVA 1JNLH 1NCUA 4LCWA 4YHMH 4X7DC 4RRPG 5F7KC 3C2SA 3CVHB 5FYKL 3VFTB 4QRRE 4LAQL 1T1ZB 3UTZA 4K3HA 3NGBB 5DUBB 1WICA 3O6KH 1CE6B 5IR1B 2ZSVA 1DL7H 1R5IB 4L9LA 1VPOH 4K3EH 5B8CB 3OGOE 5DVMA 4HWEL 3PDGA 4MD4A 3MLWL 4X6EA 2H32A 4GRLD 1NDGB 3U4EA 4OKVA 2CIKA 5HI3D 4HT1L 3RAJH 1ZKAA 2EKJA 3VWKC 4H88L 4GG6F 2H9GB 3NPSB 4EQ3A 4LVNB 4NQEB 4P46D 3H0TB 1QSZA 2IQAA 4MS8C 1HWHB 1CF8L 5E56A 1JZ6A 3NTCH 3X11B 2X2YA 4EDXB 5JPNB 3QUZD 2AK4B 3Q1SH 4FQCH 3SO3B 3MYZA 4F3FB 3B5GA 1TPXB 2NPLX 1NH6A 1NL0H 6FABL 2R15A 5CBAA 3JWOL 1TXKA 4NRYA 1ZA6B 3EJJX 2WBJB 5HHOE 1VGKA 1A1NB 4JFHD 4AMKL 4PLJD 3ZTJG 1A6AA 1ACZA 3RWFA 2NYYD 4NQXA 3GRWH 1RZKL 2EECA 4WI3A 3O6FA 4Y1AA 4U1KA 5DK0B 1JWMB 4FFWC 2WP3O 3GHEH 4LSSL 4U49A 4KHTL 1EDQA 3QHFH 3UTQB 1DBBH 2X9YA 4LVOC 3P4OB 4P5KB 1SYVB 4MWFB 4OB5H 3W11D 3WL9B 2BOCB 4PLOB 4L3EE 2HTLD 4UQ3B 2BVYA 4FABH 5BRZD 2O5YL 3VE0B 5E6IB 5IROC 3MUJA 1TJIL 1YJDH 5DK2B 1L0YA 2VWEE 1JYVA 4OLZL 4P4RA 4NT6A 1C5CH 4ZO6A 2DQJL 2EIZB 1FG2A 1H15B 2NY0D 1G9MH 3H9SE 5DJ0B 3TA3C 4OZFB 2QADB 1RU9H 4JZNA 2P8PB 2B39A 3ULVF 1MFNA 4RWYL 3HR5B 1KIQB 2P44B 4XP1L 4LOUC 3BKMH 4X9IA 7FABH 4PB9L 2Z8WC 1NFDF 3RI5K 4KXZI 4CADA 1UWEL 3FFDA 4JHAH 4U1JA 2VLLB 5EUKA 2Z35B 2JCCA 1WWCA 4PJ5B 1A64A 1L0XA 4KK5C 4OCLC 3GI8H 1LK3H 2ADFL 4BFIA 5IOPA 5DF0A 4BSVB 4LU5H 4EDXA 3VXRE 4MNHA 3BZDA 4YDIH 1FNEB 1FORL 2W1NA 5C6PB 3VFUB 4APQB 4WFGD 4MQ7B 5HGDA 2YSSA 1DEDA 3GMNB 4ISVA 5ESAB 2HFEA 1K3ZA 3W9EB 3KPTA 4ZPVA 1IGCH 2APXA 3HB3D 4HG4J 1VGKB 2EDXA 4G8EB 1GC1H 1IAII 4HXAL 3LH2H 4M8VA 1QFPA 1BZ7A 4WO4D 4BSWA 5FA3A 4IEFB 2BVQA 2FYYB 4ACPA 5I76A 3WFCL 4Q9QL 4XPGL 4MJ6A 1OSPH 1F3JA 5TDOA 4C56D 5FFLA 1U91A 4J6RL 1RK0A 4QHKI 4AG4H 4NQVB 5DFVD 1A0QH 4JGUA 2Z92B 1MELA 5D96B 3BT2L 3TT3L 4JRYA 4HUVB 2I27N 3VE0A 4M1GH 1U2HA 3GMOA 1O7VA 5E6IA 4JDTH 4IRSD 1N4XH 4G8IA 5ITFA 5J9PB 1NCDH 5I6XB 4UU9A 3F58H 3LB6D 1E28A 3U6RA 5D1QB 1G6RH 1KTLB 3ARDC 4GT7A 1BQUA 2VLJA 5J6GA 2WM0A 1ZVHA 1RJYB 1U8HA 3L9RB 3V79C 3MROB 3V6BR 2FX7H 2AXJA 3EHBC 3FN0H 1RVFL 3PWPB 4JO4L 1D9KC 2JCCB 1K8IA 4WO4A 1NMCC 1JGUH 2ORBH 2GY7B 2D7TH 4QTIH 3I50H 1QSED 2CJUL 4MNHB 4CW1B 1NC2A 1IEBB 1UKQA 1I8KB 4IMKA 1ED3A 2V2XB 3LV3B 4QOKB 2ENSA 2IWGA 2ICEA 4Z7VA 4R4FH 1MFCL 4V1DE 4U6YA 4JM2C 4C56A 4JFQB 5T1KA 3NZ8B 3BQUA 4AMKH 2ILLA 2XNAA 2FH6A 4U6HB 3RTQA 2CUIA 1VADA 3EOBA 3MGOA 1DSFL 3LN5B 4ODWB 4OM1H 5GJTH 4JRYD 3OGCA 3WLWD 2DQHL 1NKOA 2AQ3A 4MGXA 4WW2A 2HYMA 5E6ID 4MJ5B 5F9OL 1MAMH 4NO5A 3VW3H 4UV7L 1P84J 1U36A 4GG8A 3H8NA 3MRKB 2FB4H 1AGBB 4IMKC 4WTZG 2VLJD 4MDIB 2AGJH 4OQTH 1MCWW 2Z4QB 2VXSL 2DLHA 4X98B 5IB3B 2PF6A 3GJFK 4MNQA 4OV5A 1ULVA 2XWBB 4WI4A 3HAEB 4X6CB 4Q9RL 4RGNE 1T4KA 3QDGA 1ZLVH 3HZYB 1L9NA 3IDYB 4NO2A 2OTWB 1HINH 3PUCA 4HC1H 5J57B 3DRTB 1IFHL 3QRGH 4PY7A 4APQD 4JRXB 3WNOA 4JZOA 4NM4L 1OM3H 3ZSSA 1I1FA 3MROA 4J2XA 4G42A 4GO6B 3AXLB 3C60D 2PR4L 5KSUB 2F8OA 3DI3B 4M03A 2QKIA 1S7RA 2FZ3B 5BQ7A 3GSWB 4QTHA 4IJ3B 5D93B 4W68A 4ODUB 2GJ6D 4OZGE 3QIWA 5KSVB 3CDYA 4ETYA 5F1NB 1OAZH 2QQLL 4YDLB 3KVQA 4OZIA 3QISA 2AV1A 1U8MA 4JFQA 2IGFH 2V5YA 1S7VA 2OJZL 4H26B 3WJLA 3BPNC 5DRXB 5B21A 4NHUB 1VADB 3C87A 5EBMA 2D03L 3DRQB 1HKLH 1KIRB 2VIRA 4URTB 2NTSP 4L8SA 5LWYL 4E41B 4F7PA 4MXQC 3HN3A 4S1SH 4HH8A 3W39B 2EZ0D 5K59E 2J8UF 3S4SB 2H45A 3S34L 4N0UA 1NGWB 3NFSH 3SY0A 4GG8B 4YLQT 1DQMH 3WIFA 1DANU 4DK6A 4X6BA 1X6NA 3TT3H 3MQIA 5A16B 4CVUA 3QAZC 3EAKA 4GKZA 4JPVH 1EGJH 5FUOL 1NEZG 4XCYA 3FTGB 3MV7D 2ZCLH 1Z5LB 5D1XB 3H7BB 2APVA 4D0CA 1R3LA 3HRZA 3VD5A 1KUMA 4PJ7F 2FLBT 5L8KB 3DSFH 3KLHD 2ZOKB 4PTTA 1SY6A 5KS9F 1QRND 5KW9L 4Y19E 2YBRB 2X42A 4X80L 5FKPA 5D71H 3E2HB 4MA1B 4JPWH 2GFBA 3D1MC 3VXOA 2R1WA 3EYSL 1N5YH 4N8VG 3DV4A 2DTSA 1EFXD 3DBXA 4LLWB 2J3SA 1Q9OB 4M7KH 3RIAF 1RZKC 3NVQA 5INDA 5IFJA 3T8XA 3UJJL 4M62H 4OLXL 2ORBL 5DD3H 1EHXA 4HGKC 1E4XI 1YY9C 4K7FB 4NWTL 4ZS6C 1QQDA 4C83A 4LCWB 3GSWA 3T1WA 1QPPA 1NGPL 4L3AA 3RUGF 2BC4A 4IRJC 4DGIL 2GT9B 2DI8A 1XFPA 2WANA 3CFEB 4OAWA 1B4JL 5KSVA 1UFUA 2H6PB 2R69H 3ES6A 4TRPL 4UI2A 2NY1B 1I85A 1D6EB 2ZSVB 5MEQA 4Z77A 3VGGA 2DRUA 3CU7A 2VDLH 1XGPA 4KAQL 5EBMB 2B1HL 4WNQB 3VWJC 4NNXB 1QLEL 3QXTA 4Q6YA 5EC2A 3BUYB 4OKVB 5D9SB 4M6OL 4F7PB 3SE8L 3F7YB 4WV1B 3VGAC 1AGCB 3RKDD 1ZV5A 1MRFH 1DANT 1QRNA 4TQEL 1MI5B 5LGJA 5C2BH 2BHZA 2BDNL 1MFDH 2QEJA 1RIUL 5ABDE 1V8HA 5A16A 3GBML 4HBCH 3WIHL 4MNQD 4RA0C 3UJIH 1U8IB 2DQTL 1WWAX 2GAZB 3CMOL 1IC7L 1UYWH 2EDWA 2NY4B 2R9HD 2AAVA 3VG9C 4JM2A 1FAIH 1FFPB 3VWJA 2X1PA 3TIDA 1A1NA 3I84A 1XGRA 4PTTB 4FXKB 3FO1B 3P2TA 1S9XB 4N0UE 1MI5E 1MCFA 3RY6C 3BP7A 3CJJA 4OTXH 3ZYOA 5A2IH 4Y4KA 1VESA 3SJVE 2HVJA 3H3BC 1JWMA 2FGZA 1QVOA 4RMRA 3T0XA 1EEZB 3ALXA 2BCKB 4LCYB 4CDGC 5IJVA 3EBAA 4EI5A 3HAEH 5I8EB 5B39A 5SWQB 3E8UL 3ARZA 3G9VA 4P5KA 3IETB 1YYLH 2P45B 2PYEE 4G80B 2QADC 1DQQB 5E5UB 1KCSL 4WI8A 1L7TH 4EN3A 5EZLA 4X8JA 5DD0L 1XF2B 4LHUB 4LK4A 4Y19D 3TCXA 4LLMB 4OCYH 5IB5B 2HJLB 2VR4A 5IVNA 4WHYG 1NFDE 4Z7UE 3T65B 5D7SL 1R5WA 4PG9A 2Q20A 4U1IA 4BSJA 3ETBF 5EOTB 3DV6A 5F6HJ 1F3DH 5TF1H 1H15A 1GGTA 2X10A 3BAEH 1NPUA 1NBZB 2DTMH 5E99L 3ECBB 1T2QH 4PJFE 2AP2A 2B5IC 5GGRA 2K1MA 4CAGA 3C2AH 4WV1A 3ULSB 4PRPD 5EOCL 1YNKL 2Z35A 5E00B 4G8FA 4U3XA 5DK3A 2ARJB 3CD4A 4Y4KD 4LARH 3E6FB 5T3ZH 5LJYH 4BSVA 5T3XL 1JPTH 4I9WE 1Q94A 2CUMA 2R0KL 3F65A 2ZJSH 5FYLL 1LEIB 4E0RA 4U0RB 3F5WB 1SVZA 3ARGD 4GAJL 3MV8D 4I0PB 4IM8A 4QY8A 3KHQA 2MPAL 2J88L 2YWYA 1K8DA 5AAWA 4ODBD 1EMTH 1DQDL 2GW5A 2VJXA 3RPIA 4M48H 2BERA 2W91A 5F1SA 3O6LH 4MZ3A 3ISWA 1JPGA 2XV6B 1JP5A 2F9BT 4JFFB 4ONGL 1CGTA 1EUTA 2CLRA 3MRDA 3AROA 4Y88A 3WXVL 3JUZA 3GSRB 3DVGA 1QVOB 1X5LA 5DJXA 3X12B 2NY1D 3ARSA 3P30H 4Z18A 1G84A 4MQXC 1LDPH 1LK2A 25C8L 4K9EH 4M8QA 4UQ3A 1AGDA 3T04D 3QUKA 1CFBA 4WWKD 4X7EC 1DQLL 1FO0B 3QNZB 4HF5L 1ZT7A 4RGOL 1BOGA 2HA1A 3K8KA 1P69B 2GHWB 1PFCA 3F62A 4XAKD 4NQDA 5T1MA 4DK3A 4X5WB 1B4JH 1XF4A 1AR1C 4JN2B 5D5MF 3MLYL 5IVOA 1PVHA 2NLJA 2AJSH 1CZ8L 1F6FB 1QYGL 1E28B 2HLAA 3KPSA 3W82A 1R5WB 4K23H 5DJ0A 5J12C 3B9DA 1FH5H 5HYJE 4J3SA 3ARVA 3HR5A 3S9DB 4P57A 1HWGB 3UJTH 5KBNC 1E6JL 1UB5A 3WDIA 3VXRA 5C0BD 3TBYA 1HH9B 5KG9B 3KPPB 4P4KB 1B0GA 5DUPH 2VKWA 5BW7C 4PLKC 5F6IB 8FABA 3MV01 4NUJB 4OM0H 1UC6A 2Z8SA 1KB9K 1JNLL 4JY5L 3E0GA 1QUNA 5E2VL 1OL0A 4TN9A 2EYRA 4OGXH 4A6YA 3TWCL 1XCTB 5DHVB 5KVDL 4ZD3L 1Q94B 1F8TH 1U8QB 5LBSL 3U36A 1NC2B 2YPLB 5HHNB 3CMOH 5JA9A 1T3FB 2HFEB 3W9EA 3SDAD 2WWKO 4C56B 1U8KB 2ZCKH 4Y2DD 4I0PA 5T1KB 3HA0A 1T1XA 3ABZA 4PJHB 5D7IE 5CZVH 1PY4A 1I8LC 4QRTA 4YWGH 4Z7VE 2D3VA 3BWAB 1GC1C 2AV7B 1FDLL 3SQOH 3S36L 2R8SL 4HIXL 4JFYB 3VRLF 4LF3B 4EUPH 1NAML 2FSEA 3ESVF 4O2EB 4XXCA 2IH1A 4GAYA 4B0MM 5D1QD 3BXNA 4OT1H 1RUML 2PXYC 1NCWL 4PJXB 2ZKHH 4LLAA 3S34H 4NRXB 1JV5B 5DQDH 4HX1B 1C5BH 1FO0A 1NCAH 3RNQA 4OCYL 3W5NA 2D7NA 1CVSC 4G8IB 5ADPH 2EDYA 4CN6A 3IS1X 1H3PH 4ONHA 3PNWB 2P48B 2PCPB 4JFEA 2BP3A 3KNBA 4JFDE 3UYRL 2MHAA 3IU3B 1LEGB 1NBYA 4QOKD 4I77H 1JPST 1I8IB 2WZPD 1YUHA 5DVOA 3FMGH 4TYUA 4HH9B 2Q8BH 3SBWC 4OZHF 2V2WB 4MXWH 2Q8AH 1AE6L 1YYML 4YDKL 5DC0A 1G7PB 1G1YA 1F02I 1IAIH 5A3ID 4L4TB 1R3IH 3GUTB 4S1RH 4MQXD 1JNNL 4LPXA 4KDVA 2D4DA 2YD2A 4ODUA 3UBXG 2YPLA 1U8OA 4OCXL 3CFKB 1T66D 2WK2A 1VSCA 4HPYL 1F4XL 4PJHA 4ODWA 1NGYA 2C1PA 3CK0L 4AENB 1MFAL 3GNMH 4PBXA 3FAXA 4UV4L 3MOAH 3OWEA 2Z31B 1JZ3A 1M7XA 5J6HB 4XP1H 3BKML 7FABL 3U4AA 4WW2F 3I9GH 2XFXA 4CNIB 3FQNA 4KAQH 3ARGC 1OP3K 4DGYL 3VRIA 1R5VB 4KVNL 3L3GB 4MDIA 3B2UC 2PO6B 2VITB 3CVHL 3INUH 4WWKA 1ITCA 2HFFA 4KTDL 1KACB 1CDUA 4R8WL 3ZDXF 3IT8D 1GZPA 1RZJC 5ALBH 2DWEA 5IMMB 2XWBA 5C0RL 1Z5LA 1EJ6A 2YZ1A 4NQED 2FHBA 1F6LL 4P46B 4D0BB 2ZOKA 1BX2B 1I9JL 4DTGL 1FE8H 2PW2A 3BP5A 5I1AB 5EORH 1YA5A 1ZLSH 2DM4A 1MHCA 1KN2L 2VDKH 3JZ7A 2C3XA 2P5EB 4X4XB 4ZYKA 2G75B 5HGBB 4DUVA 1QR1B 5M94B 4WFHD 2MHAB 3IU3A 2YPLD 3W81A 3P4NB 4NRZA 5BOPA 5C0BA 3WJJC 1LP9A 1AI1H 1SBSH 4NZRH 3ARQA 1YUHB 5T1KD 5FO7A 5IW6A 4LLWA 4Q6IA 1WTLA 5FKAA 3BQUD 3PQYA 3HMXL 4DW2L 4RX4D 3HE6C 3KXFA 5INDB 2OTPA 2YXFA 3MR9B 1H3UA 4JY5H 3TZVA 5CGYD 2VC2H 1J7VR 1H8NA 3OKDA 1CF8H 4F15C 3WS6C 1YYLL 2R56L 3FB6A 4M00A 4QRSA 3SKNB 3MLRL 4Y2DA 4LCCA 3LKNB 4HPOH 2NXZC 3RGVA 5DR5L 3QP3A 4IJ3C 4IIQB 4OZGF 5HHVL 5FGCE 1R3KA 4I0PC 5K33A 1CD0A 2O61B 3FKUS 3MV7B 4HIXH 3S4SA 5KVGH 3U30C 1WZMA 2ZUQC 1E4WH 2XFXB 4FOMA 3F7YA 1CXFA 2JKXA 2E7CA 4PYGA 4D0DB 3LS4H 2DBLL 5EZJB 5T1LB 3GRWL 3VD9A 1JHKH 1QRNB 2EDKA 3VRIB 1EHNA 3GHEL 4LSSH 5DJ8B 4WUKH 1WEJL 2OP4L 1UKSA 2CMRL 3NCFB 4GKZB 2MOVA 1J86A 2CJUH 4WFHE 1CG9A 2UYLB 4KK6D 4D94A 1IEAB 3QCVL 1EGJA 3ZE0F 3F7RA 4YC2C 4AT6A 1DZBA 2GEEA 4YHIA 3VXPA 2E7LC 4HKBA 5T3XH 4KDTA 2DL9A 4ODXB 2DQEH 3PE9A 3OB8A 4OZFH 4BYHA 1GSMA 3TIDB 2GUOB 4UNVA 3FAWA 43CAB 3QT2A 3BP5B 3UDWC 4AM0B 4U2YA 3KYNB 3VI4F 1IM9B 5DLML 3UZEA 5GS1C 3BP7B 3UYRH 4XTRC 4X4XA 2HN7B 2GJ6A 4OFVA 3T0WA 1WBYB 2QQKL 1I1AD 3DBXB 4PRHE 1G9ML 5KS9E 2J8OA 1QBLH 1Q9OA 5IK3A 4H1LB 2WUCH 4YHNB 2ARJQ 2YRZA 1RULL 1AE6H 4KV5E 1P6AB 3MZGB 1K5NA 3QEGH 1SY6L 4PB0H 4WHDA 4JFXB 3ARBD 1CT8B 4P23B 4P2RB 2UZXB 1TQCC 4JZJA 5FECA 1Q0XL 5KSAA 5A2JH 1IBGL 1PKQE 2I26N 2J7LA 3RUGA 5FA4A 1ZHNA 1CXKA 3RZCA 1J1PH 3SKMB 2C4FU 4Z77B 1D5BB 5TE7H 4DAGL 5CD5D 3BKCH 1MUJB 3HHRB 4MSWB 4O2FA 1NGZA 35C8H 5E8EA 3QH3B 4IIQA 4UV4H 1DLFL 1DBML 3H42H 4LL9A 4LHUD 5EO9B 4M6NL 1IILE 3KXFE 4R3SB 3N1QC 2ZCHL 4U2ZA 3UTZB 3MV7A 3I9GL 2GSGB 1RIHH 4N0FB 4RFEB 4GXVL 2W65A 5LGJB 3KPRD 3G6JF 3ME0A 5I1GH 5IWLA 1AC6A 2ADIA 5EWIL 2KQNA 2P8MA 1C08B 2OTUB 5TPWL 4KU1A 4HWBL 3ZZ1A 3OXSB 5F7EL 1CG9B 2GK2A 3A6CH 3UAJC 4GUPB 2IH3A 2VZ1A 1BJ8A 4Z7UB 2NNAA 2QQLH 5I8KL 5BZWB 4YHIB 3MSPA 4CMHC 4HV8A 4R9HA 1SHMA 4FXKA 2FNBA 1BWMA 4KVCL 1LO2L 2Y23A 5JIHA 2Z8RA 5D1ZB 1T89C 2HTKC 4WDIA 3ZT5A 2H3NA 3ZO0A 4Y4KB 1QSEB 3HNSH 3UTSE 1W2KT 4HS8H 3PGFL 3QWRD 5MEPB 3U79A 4K94H 1S9YB 3MA9H 3EYQC 2WBWB 5FYKE 2QHLA 3QNXB 1A6AB 1FDLH 1OGAE 3SQOL 3PQYD 1DQML 4L4VB 3KXFD 4Y5VC 3EYUL 4G7VH 2VMFA 4U1KB 1IT9L 2A9MH 1NANH 2FIKA 5E8DL 5I9QC 2HJLA 2IFGA 4OCSL 4HWBA 5FDWA 1EEQA 4M7LT 3VH8A 3H6JA 4JZJB 2MCG1 4RISL 5FECB 4Q97A 4YFDB 2FECI 3KPRA 1WVZA 5C07A 1ZLWH 1T2XA 5IB2B 3SDAC 1SYVA 2VDRH 4MWFA 3PWNB 3JWDC 4XNYL 4YQXL 4PV9B 3DV6B 2R0LL 3QI9B 1X9QA 3MO1B 4HKZA 4LSPL 5EUOA 2HLAB 4HQQL 3LZFH 1J0HA 4P5TA 4ZSOB 4OFDA 5DHVH 3I85A 5FM8A 1T0NB 1G7HA 1WF5A 2ZG2A 4FTVD 5GGRB 4LCIL 1QKZL 5DK2A 5I1KH 1CDYA 1J8HB 1MREL 3EIFA 5KANG 1II4E 5E8PB 1W72L 3MBED 1MLCA 5D7LD 5SWZE 1CK0H 3GSNH 5IHBA 1G6RB 5E5MA 5KG9A 1TJIH 1YJDL 1FG2B 3SKOA 4X6FA 5DRNA 2IQAB 4X6DA 43C9A 3TVMC 1VFMA 1RURH 4TNWF 1S9WB 1BPVA 3RVWD 4QHKJ 4G6JL 1HYRC 5K9QG 2VB5A 4A6YB 3B6SA 2X4NA 5F3BB 3OXSA 5FM5O 3RWCA 4QY8B 4XMLL 1RUAL 1F90H 1ZVSB 1JRHL 4Z7UA 1K8DB 2JB5H 4OLYH 5B38G 9CGTA 1FGNH 2CPCA 3L95B 1SJHA 2AGJL 3A0OA 4OQTL 2J6EH 4U6XB 4YHLH 2VDLL 5D1ZA 3VFMB 3WFBL 4QRTB 3O6FB 4Y1AB 5KJRH 1NFIA 3ARBB 1DN2A 1QOKA 3QR2A 3DETC 2ED9A 4JDZB 1T6WA 5CWSA 3GMRB 3LOWA 3BPOB 4M7LH 3TH4T 4ISVB 1S9YA 5ESAA 3QFJA 5DEGA 3S97C 4Z7NE 3ZHLA 2IH1B 1CLZH 3DXAE 1CFVH 3V4PL 4KFZC 4GLRI 4M8QB 3D0VB 3QUKB 2YMXL 2BDNH 4KK8C 2XI9A 4KTEH 1Z3GH 4LSQL 5C0GA 1QO3B 1WQVT 1FZKA 4MDJA 3UJIL 4M61A 4GH7B 3RNQB 5C0AE 2NQCA 2V9RA 5BS0B 3DJ9A 1U91B 1RK0B 4XPFH 1G7QA 2KDGA 5ICYB 4MLSA 4BZ2L 4HUWA 5ID0A 4PGEB 1OSPL 4NZTH 2HRLA 1OY3B 3MNVB 4LSTL 3QI9A 4HKZB 2EYTB 1BAFH 5HHQA 5A40E 4P5TB 4ZSOA 4FZ8H 4YFEA 1HOCB 2P8PA 1T0NA 3BGAA 3T0EA 1QFWH 4Z7QF 3TBYB 5TE6L 2WLYA 4O51B 5E8PA 4NQUA 3EYVB 1T5WA 1P7HL 5C0AB 2V2WA 4RMUA 4WIQA 4N8CL 3RDTA 4OQTA 2V5TA 43C9B 4BFIB 1IKNA 2EYRB 2WMPA 1JZ2A 4U1NB 2OQJA 1BJ1J 1QD0A 3VFUA 2HT4D 4JY6A 4MQ7A 4Z5RA 4N0YH 5I8KH 2YSSB 2K7QA 1FCCA 4KPHH 5I0ZA 3K7UA 3O45A 4RZCA 4N0RA 5JORB 1FZMB 1SJHB 1MQ8A 1FIGH 1OD9A 2XG5A 4PBVC 5I1CH 1N3NB 2V5MA 3IRZA 2Z31A 2R4SL 1R0AL 2ZPKH 5L2KB 3CUPA 4NGHH 5EOCJ 1D5MB 2NY6C 3GMRA 3LN4B 2I25N 2EXWC 3ZYIA 1OCWH 3TNMB 5KW9H 2ZUXA 4ZNCD 4P48A 5DZNA 3QI9D 1BQHG 5J11C 1PSKL 4LIQL 1ZA3A 4UTBL 1TETH 1YEEH 2IANE 1CGYA 1Z9LA 2VITA 4I1NB 4XX1E 2WIMA 4FP8L 4DQOL 2UWEE 2F5AL 4OF3A 5DD6A 4RSVA 3IXAA 1JMXA 1FO0H 2YK1H 1RIVH 1IAOA 1XGYL 4HFWA 4P3DB 5F8QC 4M6ML 2A2QT 3BKYL 4BFBD 3QA3A 2Y9RT 2PCPA 3IFOB 1QSFA 4NWTH 3H9SA 4HDIA 3WBDA 5GGSB 1IGFL 5L9DH 4UIKL 2P5EA 1X44A 3ZTJH 4NNPL 1KV3A 4ODVL 4PJAE 2AJYH 5DJ6B 1VB9A 5DLMH 3P73A 5IG7B 1MVFA 5FF6A 4WRLA 2B1HH 2DWDA 4PRHD 4WO4B 4Q9RH 3MRNB 3L3IA 4XVJH 4XP6L 2BY0A 1K4DB 4WU7A 1IC4H 4PJEA 1RULH 1I7RA 3D3VA 4HC1L 4YH6A 5GGUA 2OQJB 4JKPL 3V0WH 3FB6B 4ZUVB 1OSZB 2BOBB 2XG4A 3GBMH 4HBCL 3U4BL 4YHYB 2ED7A 1MCQA 3BQUB 5E9DB 4WUUE 2NY2C 1A6TB 2EDLA 2APBA 4FZEL 5JORA 3BSZH 3FQUA 2NYYC 5SX4I 5HDQL 4HHAB 2Y07H 4TPRH 1D5IH 2AV1B 4ZTPL 3PL6C 15C8H 2VO5A 3L3GA 4WTZA 1BQHA 4JKMA 3T0AA 5GGTA 4M6NH 2GITB 3OKOB 4DKAA 4LNRA 4TULH 5IESL 5JHDA 1AGBA 3OV6A 1F6AB 3DRQA 2OXHA 5GISH 2OXGA 4TTGA 2DMBA 1GZPB 5D7JC 2MCPH 3E8UH 3OAZK 1OB1B 4XH2B 2YR3A 1BFSA 1D6VH 3MPCA 4P46A 1YN7A 4FQQB 1IAOB 3VXPB 3KLHC 2PW2B 2YC1A 1BFVH 3S98A 4QXTB 4S0SD 2GUOA 1KCVH 3HZYA 4KKCC 4YO0B 2G75A 5HGBA 1QR1A 4HIEB 3FO2B 3V6FA 2A73B 3X3GH 6FABH 1X3DA 5HYQB 4PY7B 1I85C 4QXGL 1RZFH 3B9KC 3MV8B 1EGJL 4UBDC 4HSQA 3QIUA 1PG7X 3K4AA 1FSKB 1MF2L 4G42B 4PLNC 1KTDA 1YQ2A 3VFPA 4AEFA 3OAUL 2AK1H 2YBRA 4P2RE 3BGMA 2L4OA 4FFZL 1IM9D 2Y06H 3RX7A 4MA7L 1HKFA 1MEXH 2CR6A 4F7MA 2KPNA 3GO1L 5F89A 1K4DA 4MLIA 4WU7B 2VKXA 3FT4B 1DE4A 3D3VB 32C2A 3IDGA 5I1LB 1RK1A 2AEPH 4OD1L 2AQ1A 1XIWD 1MCIA 4ZO7A 3K4ZA 1R24A 2F53D 3OAZH 4Y1AE 5BRZA 3IDIA 4M43L 1NKRA 2C3WA 4NFCA 3WJLC 5F7NC 1WAAA 1JVKA 4HCRL 3T2OA 4HK0B 2H6PA 3W39A 3NA4A 4RFEA 3HR6A 4DGIH 4N5UA 1D6EA 3D3VE 3L3DA 5AYUH 3GSUB 3TPUA 1GXEA 4GKOA 3ARWA 3KYAA 2QSCH 3C9NB 1OARH 2FO4A 3TBVB 4RFOL 2OZ4A 4JFDA 3W5MA 3THMH 4K9EL 4LCUB 2I5YL 1OW0C 1WC7A 1CD8A 2XY1A 3P30L 1A21A 3HRZB 3WV0A 4RGOH 3RIAK 2ADFH 3GSVB 4DKFH 4JY4A 5KVFL 5C8JA 1HHGA 2IPUK 2AK4D 3SDXA 3G5XB 3ZT6A 4XZUB 4HWUA 1PG7L 3W2DH 2GJ6B 1MWAH 4XPTL 5IBUB 1MFDL 3JTSA 3KS0H 4HJJL 4KDTC 3RWEA 3L6FA 4ZTOH 1NBVL 3NCCB 5H35B 2WLZA 2QSTA 2BHUA 1K5NB 2IC2A 3ESUF 4IMLA 4L4VA 3QUZA 3FB8A 4JFXA 3UC0L 1U3HC 2VLRE 5JR1H 3L3KA 4KTDH 5JPMA 4N1EA 3CLFL 4GBXC 2W0FA 3Q5OA 1LMKA 1HDMA 4LSUH 3P77A 1BEYL 4RCAA 4G43B 5HDBF 4HWZA 3STLB 1VEPA 2DQUL 4ZUWA 3CAFA 4JVWA 5I71C 2DOCA 4PTUA 4Y16A 5SWQA 3RAJL 5B39B 1LNUA 1KIUA 3RGHA 4P99A 3S4SG 5MEQB 4L4JA 4WW2C 3O3UN 5EUOB 1R24B 3SE3A 1JGLL 4AEEA 4FZEH 3VXMB 5L7XH 4R26L 4RFNB 4K8RC 4OLUH 4R3SA 5CZVL 1U6AH 4F9LC 1D9KD 3QO0A 4P4KC 1CFNB 2W65B 2VNCA 2IALB 4JE4B 2DKMA 3IVKB 1TLKA 4ELKA 3V7AG 1TVHA 1ZHBA 4PJ9B 4UZGA 2OTUA 5FCUH 3N9GL 4LFHG 1FNSL 5H2BB 5EZOH 3IFLH 1RZKH 1EVTC 5FYJH 1CFSA 1WCBB 3HC0A 3BZ4A 1U8JA 3NIDF 3RNKA 3LB6C 3L5WA 2VQTA 3MRIB 5C0BE 2DQGL 1EO8L 1WC7B 4I2XE 5JLZB 1LE5A 3CFJB 1NQBA 5BO1H 2ARJA 4NN6B 1S9XA 2QL1A 5I1IH 4FQPA 3SDXB 1NDMA 3HS0A 5HDBE 3VXUD 1MCNA 4DKEL 4ZUTB 1MCJA 2F58H 1K2DA 3WO4C 1XCQA 3EUUA 4F33A 2KH2B 1KB5A 4WHTB 1A4JB 1H3PL 4MB3A 4LCYA 4O02L 3KPOB 5D2LB 3OKLA 4LVOB 5CLWA 3QUXA 3QUML 1JPGB 2CMRH 1ACYH 2J88H 4G9FE 2V6HA 4DN4H 5DFWH 3IDYC 3LCYA 4X8JB 1S7UA 3RJQB 5CP3H 3SKUD 5IV2A 3VH8B 1FZKB 4LLMA 3GSRA 1CLCA 4N9OB 1IAIL 1FZJA 2X1WL 5EA0L 3V0VA 1IGYA 3VH8G 4MXWL 3A67L 3WXVH 1JNNH 4JLRB 2OMNA 4BUHA 4EBQL 4Y5YB 1LK2B 1FL3B 2F53A 4S1RL 4ALAH 2P7TA 1O5DT 2X70A 3MNVA 1MSPA 4N5EC 3BKYH 4I3SH 2NZ9C 4PGDA 1ORQA 5HYIA 4B5EA 4NWUH 5F88B 3T0EB 5DUMH 2BY3A 3S88H 3B3IA 2HKHH 3RX8A 1WFNA 4FNLL 2IALA 1A6VL 2EIDA 2VL4A 3QQ4B 5B8CA 2R4RL 1MFAH 3WHXB 5E00A 5F44A 2B0SH 3RDTB 2YPVH 1YQVL 1TVHB 1ZHBB 4ENEC 2HMIC 3RWDA 5F3BA 5JOEA 4JFDD 1S5IL 2ADJA 3PDOB 2V7HB 4R90H 3F5WA 1HHIA 1CFSB 1FPTL 3HC0B 1HIML 1VKXA 1KB5L 3H0TA 4MCZA 4A6YL 5JXED 2P43B 3UTSD 1J87A 3EJZC 2ERJC 3BDXA 4U6XA 3UO1L 3CFJA 5CP7A 4XP5H 2IAMA 1KF9B 5C0RH 4RZCB 1NAMA 5FK9A 4J6RH 2O5XH 2DKUA 4Y19B 2Y7QB 1MIMH 1T3FA 4PJBB 4JREB 4LVHB 1KN2H 2VDKL 2OJZH 4U1LA 1KB5B 4WHTA 2DLEA 1ZLSL 3RWFB 4UIMA 3ZHKA 1SM3H 1PY9A 2R23B 5GGQL 1TNMA 4NN5C 1NCDL 2X4SB 3HI6H 4P5TD 1T0MA 1ROWA 1FNHA 4S1SL 3ZE1F 2XTJB 5ICZA 1QNZL 4TULL 5BMFL 1UM5L 3LQZB 3UTQA 4MA3B 1TQBC 4HUWB 3P4OA 3T0EE 3D9AL 3CIQA 3V6OC 1U8LA 4JLRA 5GZOC 2R39A 1P5VA 2GTZA 4YR6B 2P7TB 1A9EA 3O4OB 4S1DC 4N9GB 4XPBH 4U6TA 3MLRH 4K94L 1OD7A 4BQ6A 1FHGA 4IOFC 3VGBA 3FB7B 3KPPA 4P4KA 2HT2C 4M7ZC 4ZFGH 4PJGF 3PNWA 1KENH 4U1GC 1RI8A 2E6QA 4FFYL 3WHXA 3L3IB 2HP4A 4BZ1H 4JRXD 4JY6B 1EFXA 1I1AB 2M1KA 2VLLA 5EUKB 4KMQA 3O45B 3QDGD 1SVCP 1G9NL 1ZLUK 3CVIH 1PYWA 5GGVY 5IOPB 5JQHC 3HLAB 1Q9KB 4NN5B 3GRWA 4V1DD 2OJEA 5C09A 3K2MC 4N90D 4OD1H 3HUJB 1RMFH 2AV7A 3FQUB 3QSKB 4LCIH 5I1KL 1MREH 2R69L 3IFPB 4JO2L 3OMZA 3BDBA 1U8OB 4LF3A 3G5YB 2EDEA 2DQEL 3QDMD 4PJBA 2SEBA 2EDTA 1DUZA 3IDUA 2C3GA 5E9DD 1MPAH 2ESVA 3L5XL 1YC7A 4WHCA 1MHHA 1CDCA 3VFSB 1FRGL 4F7TB 3IKCA 1CGVA 4RMSA 5I30L 1UCBH 1MY5A 2ZWLT 5FV1L 2FYYA 5I8OL 5I76B 1B6DA 5FYJE 3T0ED 3WYRA 4ENED 4XH2A 1F3JB 2EXYD 5TDOB 2GCYB 5EZIL 2CKBL 2UVFA 3D6GA 3DX9A 4KKBC 2PTTB 5AUMB 5MEOA 2PO6A 4ONHB 3HZKA 3JV0A 1OGAB 3T4AB 3MRBB 3OKYA 4NHCH 3OQ3B 5KSBA 4HIEA 4DAGH 5DJ6A 2DM2A 4XNUL 2HH0L 3TN0C 2NX5E 2UUDK 4U6VL 5GRVL 3ZDZE 2HKHL 2Q76A 3IAGC 3FB7A 3VFPB 3B9AA 4CU6A 5HXMA 1ND0B 1S9VB 5KTEH 4H0GA 4FQJL 5C0FB 3SE4C 1EX0A 2BY2A 1S5IH 1URLA 1LP9B 4GXVH 2EC8A 3QIBC 3ARFA 5FO7B 5IW6B 32C2B 5FKAB 5SV4A 5CKGA 4QYOA 1AI1L 1SBSL 3KXFB 4KI1A 2NX5B 2IAMD 4KRPB 1KTRL 4NC2B 1OAYL 4HWBH 4XHQA 2DQUH 4P0DA 5DD1H 5H37G 4L5FH 5BRZB 4IS6A 1I8KA 2XTJD 1IM3A 2OJEB 5C09B 2HLFD 2H2PC 5HPMA 1HE7A 4NM8H 3UEZA 3SKNA 3OB0K 1XGUB 3LKQA 3PHOA 4XB8A 4FMKA 4I18C 4JQVC 1J0JA 3BPCB 4RQQB 3OKOA 1C7SA 2F74A 2ITDA 4C54A 4ZXBD 3BHBB 2ATPB 2A83B 3LN5A 5JDJA 2N1KA 1SJXA 1BMGA 1RUQL 3U9UA 4HPOL 3VFSA 2VAAB 2O61A 4GRLA 2HFFB 3MXVL 3L3JB 1IGTA 5DT1H 4F57H 1S78D 3SGJC 3ZKMD 4JR9L 3LEXA 1UM5H 4XC1L 5EZJA 1WZLA 2AJXH 5T1LA 2GCYA 2C4XA 3KAAA 1KN4L 3OG6B 5KVGL 4D0BA 1KTKE 4OF0A 1PG7W 5AUMA 2G5BA 4L4TD 2Z4QA 3V6FB 1YY8B 3UJJH 2NY7L 4MNQB 1NCBL 4XZUA 3SGDH 1TZHB 3RIFK 3UTTB 3U7YL 3WNNA 2W0LA 1KNOA 2ZPKL 4ZFFB 5BW7A 3JTSB 4X6CA 5I1IL 3BESR 4I5BB 1DQDH 1X6LA 5HPOA 4Q6IB 3BFOA 3VCLB 3KYNA 4UTBH 1V05A 1YN6B 5DMGD 4OBRA 1OTTC 3O6FD 3AM8A 4Y1AD 4HZLA 4JHZA 3BRFA 4GG6B 4MB5A 3R0NA 5JPMB 4Y8AA 1RURL 1U8NA 4CVXB 1BVLA 1QLEH 2BFVL 3FN9A 1LDPL 1OAUH 3U0WH 4PTUB 3CVIL 4QYOB 1JGVL 3E3QE 5HHOD 1JI2A 2WIIA 5BQ7B 2WINA 1F3RB 1U3HB 3IDIB 4L3EB 4RAUA 1NFDA 5E08L 4ETQB 2RIKA 1CDHA 4P5MA 4V2BA 3LMJH 3CNKA 3LKPA 4XI5C 5DMJB 5ESQA 4ALAL 4QRPE 4FABL 1T04B 2YUXA 1P84K 2YRLA 3TH2T 3PHOB 4K23L 4Q9BA 1OAKL 2ESVD 5EUOF 1KLFA 5D7IB 4OLZH 1P4LB 5DA4A 1I3VA 3VMNA 1NGZB 5IEKA 3QH3A 1N6QL 1N0XH 2A74B 2W38A 3OR7B 4C57C 3O3BB 1U9KA 4DKDC 4PJEF 3TFKC 2RB8A 3KLSA 1IGTB 3BZ4B 2ATKA 1SMOA 4KTEL 4WCYL 4UAOB 1JWSB 2NXYB 3MRIA 3WIFB 5JW5B 5JPNA 5DDHA 5E2VH 1I7ZA 3PIQA 1XGQB 5DXWA 1IM9A 3HE7B 3MRQB 2VZ3A 3BKJH 5AZ2H 3R4DA 3ZKXB 4WFED 3SDAA 1ZA6A 2FGWH 5TPWH 4U05A 1L7IL 5BZWA 4WV1C 4HV8B 1IL1A 2BRRH 2JJSC 2XWTA 4R97B 1GL4B 3QCTH 1W0VB 4NZTL 2E6PA 3ZKXC 3MYJB 5GSVA 1XIWC 4NOFA 3RPKA 4KK9D 5GIRB 4FZ8L 5HJ3A 2ICES 5GISL 2D7QA 1BP3B 4NIKB 4P23A 4IOIA 4NCC2 4OGAC 5IWLC 1IC5H 4FFVD 1UVQA 3STLA 3VXQA 1HZHH 1TTGA 2A0LD 2NY6D 1YEGL 1MJ8L 4P2QE 5D2LF 4NN6C 5JW4R 1LNUB 4BZYA 3SKJH 4L1DA 2DIJA 2H2PD 4FQXC 3QZWG 5I2IA 5D2LE 3GHBL 2XTJC 3MNZA 4GAGH 1D5BA 2A1WL 4EIGB 4NZJA 1F4WL 1TTFA 5DS8A 1A6UH 4UBDD 4O2FB 2FIKB 4I3RL 3K81A 4MJIE 4ETQA 3S5LA 2VL5B 3RBGA 1JPFA 3VI3E 4ZAKA 4Z78B 1SJEA 1JF5A 4R0LB 2PYEA 4PJ9A 4QRRB 4UDUB 1U92B 5D2NE 2EE2A 4OZFA 1P4LA 4NNXA 1LP9E 1A3LL 1MRDH 4UTAH 1T2JA 2PO6C 3HI5L 4ZFGL 1IGJB 1LVEA 4H8WH 1LGVA 2NNAB 1QKZH 3BD5A 4X6FB 5DRNB 5IW3A 2HJKA 3K1KC 1A14H 4K55A 3IXTA 4XMPL 1FFOA 2JLLA 3LS5L 1AJ7H 1B9ZA 2H3NB 5KOVC 5TF0A 1DVFD 4PV8B 3SGEH 3TO4A 1N6VA 4P2RD 2X4NB 2CDEA 2VISA 1NC2D 3MRQA 4YK4B 3VXRD 3GM0A 4D9QD 2X1OA 2XA8H 3LRGA 4PREA 4WI9A 4EI5C 4HF5H 5DVNA 3SDAB 1HNFA 1WAAF 3PGDB 5TE4L 2A6IB 4ZS7H 2ZNWA 2LU4A 2PYFB 3IRPX 1UJ3C 4KKNA 2XWTB 4PJ8B 3OKLB 4AZ8A 1IGFH 4UIMB 2XTJE 5HGHB 2EDJA 4LCWE 5J7CC 4XBEH 4L3ED 5HJ3B 3BPNB 4XRCB 4KZEL 3HG1D 2JCCE 4YFLI 3MJ7A 1BQLL 3DUSA 2JCCF 1ZSDB 4KZDH 3KPRB 3LQZA 5J8OA 3JSSA 3O2VL 3SN6N 3U83A 4Z0BL 4G80A 3PWNA 2C5DC 1KYOK 1H3TA 3C09C 5C3LD 3QPQC 3MNZB 2J8HA 4WW1A 4BH7B 1JZ4A 1X4XA 5EZLB 2XWJA 5L2JA 2Y6SD 3MLSH 1C1EH 1UH3A 1A9EB 5F88A 5IB5A 3OKKB 3KJ6L 4PRBB 4QRPB 3B2VL 3GMOB 3WSQL 2H26A 1PW3A 5J9PA 1JPFB 2APWA 4LCCC 3EHBD 1FE8L 1UM6H 3I3DA 4GRMB 3T65A 3MCLL 3V4VL 4L8CA 5D1QA 3WCYA 4NHCL 3AS2A 3MBXL 5JIKA 4PGEA 4U1IB 2H1PH 2X6MA 5J1AB 2F5BL 1W0YT 4D8PB 1D5XB 1NBZA 2ICWB 2VSDA 2FJFB 4XX1G 1JF1A 4YWGL 2AERT 1DP0A 3B6SB 1AR2A 3TBWB 4LSRL 3T3MF 1A1OB 1UH2A 3MXWL 1X5FA 4FQJH 5C0CA 3Q0HA 5EIIB 3SHSA 4EJ1C 5MP6L 4S1DD 5HYJA 1NCCH 4YDVB 2VXTH 4ODTL 5C08D 1YEFH 3H3PH 5L8LB 5DQJB 2YZ8A 4E0RB 2J5LB 3LV3A 4QOKA 3SOBL 4Z7VB 1KXQE 2YEZB 1TVDA 4XAKE 3ILPB 1GZQA 4HMCA 4JFOB 5CCKH 3NZHL 4O9HH 3VA6A 1JK8A 3MGOB 3LRHA 3MOBL 2P47B 1KCRH 1XZ0A 3DYPA 1NMBL 4N8PA 4Y8DC 4WW2B 5I1EL 3U9PH 1FYTB 2P42B 4QGYA 4MDJB 1CWVA 3MBEB 4QF1A 1MQKH 1JHLH 3QXUA 3RWHA 3UBXA 1KULA 3WKMH 1YNLL 3X3FH 1S8DB 1UZ8B 2FEDC 2GTZB 4F57L 4ZFOL 3PXJA 4X98A 2Q8AL 5DMIH 1MFEL 4G9DB 4OV5B 4DKEH 1HOCA 1NGQH 2FEEI 2H26B 1DN0B 1KCUL 4O51A 2NY5H 1T4KB 3QDGB 4GRMA 5FGBA 4KJQC 5JXEA 2Y72A 3UTSA 5C0AA 3MOQA 5HHME 4BK5A 4L8SC 3QUMH 3VD7A 3U0TA 1PD6A 1V5JA 4IIQC 1FJ1B 1G0DA 1M6OB 4FN0A 2XRAL 3ARDB 4AQOA 3GKWL 4E9LA 5F7YC 4D8PA 1XH3B 3TYGH 2VZVA 4JJ5A 5GRJL 3O4LA 3VXRB 2NTFB 3E6HA 3M8OH 4JCMA 4UNTA 1T7XA 3P73B 4M4RA 3AXLA 4BUGA 2W9DL 4Y5YC 8FABB 5FF6B 1MCHA 2NZ9D 1MCRA 4K7PX 5F7UA 2ICCA 4JFEE 2ADGA 4POYA 1KIPA 2D0HA 2IFFH 4G7YH 2EH8H 3LPGA 2J2ZA 3IFPA 1GRWA 1JYXA 1ZS8B 5AWNH 3P4MA 4HZAA 1U8KA 1D5MA 5TE7L 2Z93B 4F37F 4QHUA 3WDHA 2R4RH 3ZLQC 5BV7H 2A83A 4OIAA 2ITCA 5HI5C 3VXMD 3U9UB 4RNRA 4PFEA 3G5VA 2ZCHH 4JKLA 4QEGA 4R4ND 4R2GC 1G9MC 3RVTC 2ZP0T 3L3JA 2XQBH 1HIMH 1VACA 5E0QA 3KWWB 5C0AD 4M6OH 2Y07L 4TPRL 3TJHD 4PJXA 3K3QA 1XGTA 3IFOA 1OGAA 4JVPA 2VDQL 2X41A 4J3TA 1SMAA 5SWSE 1LILA 2O5XL 3KJ6H 4NN7C 1OB1A 2I24N 3X17A 1NMAL 1R3LB 1JGLH 2Y5EA 1JIBA 5K9KA 3BIKA 3AMLA 4WEMB 3CSPA 2CQVA 3VXSA 5I66B 1N59A 1FFNB 2BVTA 5IVZB 4MA8L 5C08B 2OZ4H 5EO1B 3MRNA 1YN6A 4KJWD 3UTTD 4PJEB 3TV3L 5L2KD 1I8IA 3QULB 3RTQC 2XZAH 4GW1A 3VRLE 4R0LC 5DC4B 1M71A 1TMCB 1U8NB 2XZCL 4CVXA 4J4PA 1OSZA 5DC9B 1KTDB 4OF7A 4XVSL 3PABA 4KQ4H 5E9DA 3RI5F 4KMLB 1KPVA 5EZOL 5JW4N 2Y25A 2NW3A 1DUYB 4QXUH 4OI8A 3EYQD 1H0DB 1ONQA 5D2NA 2NXZD 1DLHB 4X4YA 3WNPA 1RUPH 5FGRA 5DEZA 1ZAGA 3LKPB 1A6UL 1BBDH 1T04A 3SCMD 1A7NH 2X7LA 3SGJA 4RBPH 4GBXD 4H1LH 2HLFC 2JJTA 4GQPH 1KBGH 1XGPB 4JPVL 3F7QA 4WNQA 3CSBA 1U3HD 2NMSA 1FYTE 2ITCB 1OTSD 4GRLB 4FTVA 5ICXB 3ILQD 5ALCH 5GGSY 1AQDA 2EDBA 2IF7A 5DRZB 1OPGL 3AAZA 4OD2B 4CNIA 3L5IA 4JM4H 1E4XL 3PG2A 4TSBH 1OF2A 4M5YH 3GSUA 3FRPA 1QBBA 4ODHH 4DOHE 3D69A 1ACYL 4N0CC 1YDPB 2AVGA 2ZUUA 5JZ7C 1I4FA 4PRHB 5D71L 4UNUA 3TBVA 1G0XA 1YNKH 5JW4M 5DSCB 5JA8B 1T83C 1T83A 3HE7A 3HE7C 4JFDB 2AXFA 1A7OL 3NH7L 3B43A 3K4DA 4I4WB 4XMPH 3A67H 1V3MA 3WO3B 1UWGH 2NXYD 1W0VA 4LLVA 3WFDH 1WIOA 5D1ZD 5GS0D 5IF0A 5KJRL 5F6HI 1J1PL 3BGMB 3IDXL 1ODAA 2YD8A 5D6CA 1UCBL 2YD4A 3F6LA 1BJ1H 3IJHB 1XF1A 1DQJB 5D5MA 4IOIB 4Y2OA 3RWEB 4YXLL 1DE4B 2OL3B 4XBGA 4WY7L 1BJMA 5TQ2L 1CXHA 2MJWA 4KZEH 3K8LA 4HJJH 4RGMC 1BGXL 3CCHB 3FB8B 3PABB 3OKMA 4G3YL 3QJHB 4PJDF 2IADB 1EUUA 5E4IA 1KB5H 4QRSB 5KSBF 5IBTH 5L88H 2HH0H 5I1JL 4BZ2H 3LKNA 4E41E 3KYKL 4UQ2B 4Z78A 5F7EH 1RZ7L 5EIVA 2H8PA 5EOTA 1SEQL 3UP1A 3KLAB 4QLRA 1RV6X 3VXMA 2JELH 3EGSA 3HE7D 1FLTX 4XCNB 5I1DB 5T1DH 4LPTA 5FOJA 3GK8H 4LAQH 2BHYA 2RFXB 3MBXH 1AQDB 1ZTXH 1J8HD 5I18L 5FM4A 1CI5A 1CFNA 4O4YH 4G8GA 4I48A 1E6JH 1MCLA 1SM3L 2KUTA 4G6FB 4XPGH 5CIPB 1S5HB 2B2XH 2CO6B 4HK3J 4P3WA 2CLZB 1IEAA 4PV8A 3TO4B 4KUZL 5BMFH 2YWZA 5D7LA 3VGDA 5E8DH 4ELME 5B3JE 3H3PL 4KV5F 3L6FB 5GSVB 1OAXH 2PYFA 4LPYA 1F58H 3CLEL 3UPRB 5D7IF 3DUUB 2ZCKL 4IMLB 5HGHA 3T77B 5IF0B 3PP3K 2YXMA 3SGDI 4CDHA 1IAKA 4UT7L 4NJ9H 4FQ1H 4U4BA 5D6CB 5KN5B 1XCQB 5GZOD 1WZKA 5C0EB 5DJXB 4CVWA 1Z2KA 3MLUH 2AXGB 3O3EB 3DUSB 5LG1A 3T08A 4XCCL 1QFWM 4PJ8D 4W81A 2FR4A 3FHQA 3BQUC 4XVSH 2XTLA 1JYWA 4TNWK 1TFHA 1JZ7A 1WIPA 3OKMB 3GBNH 4JANA 4P2QD 3QJHA 1MOEA 1WAAE 1H8OA 1RHHA 3OX8A 1KGCE 1XF4B 2OLDA 4GRWB 5GGVL 1T20B 1R5IA 4L9LB 5F9WB 2Q87A 3LQAC 4Y5YA 4HAFA 2DD8L 5D8JH 4UOJA 3CDFA 2H32B 5CZKA 3VFGL 2P5ED 4TOYH 5H2BA 1ORQB 3EOTH 2ICWA 3IKKA 3TO4C 1OPGH 4NQCD 1CLOH 5F1IB 5C71A 3DWTA 4G8GB 4I48B 2AI0L 2DS4A 2OR8A 4X6DF 2OYPA 1FBIH 1V7NL 3QQ4A 3QFDA 1INDH 5C0CB 3IXTB 3X11A 4C4KT 4H20L 4YK4C 5AZEH 4AL8L 1CLZL 3FJTA 3I6LE 5ENWA 1OP5K 3RKPA 2X4OA 4ORGB 1U8QA 3PDOA 2ADJB 2XXMB 1OVZA 2V7HA 1NDMB 2YUWA 3NH7H 3HS0B 4O58L 5HI5D 1HHIB 3O11B 3G08B 4RGMB 5FYKU 2BVOA 1U8PB 3WN5A 3CSGA 4PJ8A 3ILPA 2EH8L 3TPKA 2COQA 1UM4L 3FFCD 2IAMB 4KRPD 5CEYB 3WJJA 3BWAA 4ZOEA 2J8UB 1YEHH 4PG2A 3UO1H 3J7HA 4Y19A 4BM7A 3QI9C 2A6DA 4Z0XB 5MEPA 1MCPH 5CEZL 1D9KB 3O2WH 4UOW0 4TTDD 2FSEB 3QNXA 2GIYA 3BXNB 1IGYB 3ZKQD 1CIUA 5J1TC 3V8OA 3L1OL 4RMQA 5HVGB 4O00A 1Z9OA 3QEHA 4PJ9D 5L2JB 4CUCA 3EDKA 4DGYH 3QQ3A 3VDAA 4YDJB 3UJTL 3LH2L 1VFAB 2M2DA 5MI0C 4S11A 4AK1A 2JJTC 3MUHL 3MFGB 1ZANL 3CVHH 4UB0H 5EU4A 4UDTA 1WIUA 3QO1B 4MA3A 5HYEA 1QNZH 1NJ9B 4TVPD 4PV9A 2J1KA 1OAZL 3VFWB 5JIPA 1RUKH 3KNBB 3BZEB 4H88H 1LEGA 4NM8L 1J8HA 3I6KA 1PQZA 2EDHA 4JJ5B 3TBWA 1RZ8B 1AXSB 3D39A 1NFKA 5EIIA 5C92A 4X7TA 2EKSB 4OBSA 4QRUB 4H8WC 1G7PA 3DUHA 5D1QC 1TPXC 5D7KE 1NAMB 1VERA 4ZSOE 5FK9B 3O8XC 3GMLB 2IBZX 5DT1L 1ZEAL 5E2WL 4XPHL 1S7QB 2X4OB 4FFYH 3QPXH 1ZS8A 3S37L 2CXGA 3GMNA 4JREC 3CFKA 1XIWA 2BNUB 3ZYJA 5E6YA 1T22A 4QHUB 4AENA 4Y2DC 4LEOB 5DJYB 3WUWB 4E41D 4JDZA 3QPQD 4MNGE 5MI0B 1UQSB 4LRNL 1OP9A 2XZQH 1P2CB 4F7CA 4K07A 1B90A 5F1KC 4W6XB 4OCWH 1VA9A 1MIEH 3LEVH 4LMQI 4MMZC 2OR7A 1MHHB 2Z8VC 3TCLB 3QEHB 3REWB 2HJFB 3RZWA 3KS0J 2GJZA 4Q0XL 5IFHL 4I77L 2VLKE 5HD8C 5EU7E 5IMMA 5HHMD 1DN0A 3SPVA 5F9OH 5FAAA 4HUXA 3LKRA 1G7QB 3IU4H 3QQ9D 2GTWB 3UTSB 5C0CD 5MEOB 3VD3A 1NC4A 1S3KL 1YNTA 5DZLA 4TRPH 1AR1D 4R2GB 5LXGH 5E08H 5IVXE 5C08A 3MRBA 3PV7A 4KMTH 2JE8A 4K8RH 1I1CA 1RJYA 1U8HB 2GK0B 2LVCA 3S96B 1VENA 1EFXB 1I1AA 1UWXK 1N6QH 4ESKA 3LAFA 4JQIH 1FQ9C 2VXUL 1A22B 2QQKH 3ARPA 3PQYB 5CD3B 4CRPA 4XMKL 4AL8H 2X4UA 3HLAA 4FQIL 1HINL 4BK4A 1C1EL 4HMDA 5EBWB 4CW1A 4NM4H 4X7CC 1H0DA 1WFUA 1BECA 4G6KH 1RPQA 1YMHA 1BGXH 3QRGL 1DLHA 4DGVL 2IJ0C 4LCCB 2W9EH 3V4UH 4OLVH 3G5YA 2F19L 3WE6B 4LMQE 4H0IA 2V9TA 2WWMC 1XIWB 1AFVL 1DUZB 4NC1C 1CVRA 4ZFOB 4M6AA 4X99A 1FL5A 3IKCB 3SGKC 4CN4A 5HHXH 4MJ5A 5DJYA 4ZMAT 5BVPL 4PJ7A 5CSGA 4JHWH 4H25A 3UROR 3S35X 1N5AB 5HGAB 2PETA 4F58H 2JELL 4RQQA 4BQ9A 1IGIH 4XNXL 4LP4A 1OWWA 4QRRD 8CGTA 1KPUA 4HUKB 4ODTH 1YDPA 3DI2B 2HTKD 4JKWA 2HJFA 4X5LA 4PGCA 1IC5L 1YPZE 5KSBB 1RUQH 3JBG7 1A6WL 5H37H 3ALWA 3BIKB 4P3DA 5DD5H 4MX7B 4K3DL 3MXVH 3U82B 2Q76B 1DBJH 2V17L 5DURD 4EQ2A 4IRZH 2AJXL 2G5BB 3TN0A 2YN5A 2RJMA 4LVHC 3TNNB 1CN4A 1DVFB 3VXUA 4R7NB 4KVCH 2X4QB 3QULA 2R56H 3ZDYE 3U9PL 4ZFFA 2PKDA 4L4TE 4WGVB 3DSFL 3S96A 5ACZA 3D39D 1ES0B 2OL3A 4XBGB 3U7YH 2D7TL 4QTIL 3R1GH 5JMOC 4QHMA 4CVZB 2EEBA 4HCRH 3VCLA 3TFKD 3DURB 1S7RB 1DUYA 2NX5A 3SGKA 1JE6A 2XOTA 2I07B 3NGBC 1CLYL 4FS0A 1QG3A 3ZTNH 1D7FA 4GMSL 3HG1B 4IS6B 1IM3B 3QPXL 5F1NA 1BVLB 4KK9C 3MV7E 3OZ9H 2ICWI 4NO0B 2VN4A 3A6OA 1X5ZA 3LS5H 2F74B 3QWQB 3FT2A 5D7JA 3VFOB 2ATPA 2WIIB 1E4KA 2WINB 4FRWA 5L8JB 1MFBL 2VIRB 3AGVA 5JOPE 4E41A 4X99B 4OD2A 1X7QB 2VDPL 4Z7UF 4N0FA 1GIGH 3EFFB 2V2TA 3NABH 1JUFA 2F54B 4XBEL 5E8OB 3D69B 4NBYB 3MRFA 4EUPG 1PLGH 1CTNA 3GZKA 4TSAL 5HDLA 1F6AA 4NOBA 1CL7I 3FN3A 2YKLL 5C86A 1S7WB 3W0WB 3G04A 4XCYB 1INQB 3SE8H 1M7IA 4KZDL 3ARXA 2F54E 1KNOB 4D2NA 3P9WB 2ATKB 4LPUA 2V9QA 4NUGH 3EDFA 4MX7A 1LO4H 5IGXH 1NC4D 4HBQA 2NX5D 3SDXF 5EO0A 1QEWB 2JB5L 4OLYL 4YXKL 4MJID 3S3JA 1YEDA 5IJKA 4YZFE 5BZDB 1J1XH 4POZD 3VG0L 4OZHE 3VXUB 1IC7H 1IAKB 4YHLL 3SDDA 3P40A 5F93C 5E8NB 1S78C 3QCUH 3OJMB 3VGFA 3R06A 1QQDB 2AEQL 3O4OC 1U3HA 1TCRA 4HWEH 2BC4B 1TJHH 5FHAL 1ZXQA 1NCCL 4J8RA 3ES6B 3VXUE 4U7KA 5CBEB 4PGBA 1WSST 1HKLL 2VWEC 5JW3H 3KLAA 4YNYB 3QUXD 1L9MA 2E8ZA 4UB0L 3FT2B 5INCB 2OZ4L 4XPBL 4IDLA 5I1DA 5T5FH 1BF2A 3P0GB 1P4IL 4P2QB 3DTXB 1ZVYA 5DD0H 1F4WH 2PXYB 3MOBH 1F5WA 4QNPE 4JEGB 1RUKL 1G6RA 1KELH 3HMWH 2BVPA 1ADQA 3BH8A 1JF6A 1JWSA 1NMBH 4P23C 2V5SA 5JW5A 2R2HA 5E70A 1I7ZB 2J12B 1XGQA 3PIQB 3QDJB 5FM5M 3W0WA 3ARDD 1IGJA 4MXQD 3G04B 3LVEA 1JN6B 5DRWA 4LCUA 2E7BA 4IRSC 3F7PC 1IRAY 1U8PA 3I6LD 4M1DL 5I73C 3GSVA 3L95A 2UY7A 3DUUA 1HHGB 2DYPD 5EOCH 3VFMA 2C1OB 2ZJSL 1N2RB 5FYLH 4JRYE 1NCNA 5KN5A 4H1LG 5ALCL 5EN2B 1P5UA 4OJFL 4UINL 1K9TA 4HUNB 1QSVA 5C0EA 4CJ1A 1GJIA 2R2BA 2O5YH 4PREB 2BCKA 2R1YB 3QDMA 4JN1L 4CKVX 3STBA 5DEGB 3VXQB 3H7LA 4OLXH 5I8EA 3P9LB 2UZYB 1B0RB 2JIXA 4NGHL 3FFCB 4GS7B 5I2IB 1JWUA 4S10A 1WWWX 5ADOL 3S6CA 5F70A 1UXWB 3GKWH 5C0DB 4LHUA 3R06B 5LGHH 4JZJC 4XRCA 4M61B 2YPVL 3RBSA 2NY2B 4G43A 5GS0C 5D1ZC 3ARFC 2IFFL 3WD5H 1EHLH 2NXYC 5IFHH 4PGBB 3O0RH 5BVJA 1FN4B 2EYTA 1OAQL 4AY0A 4UDUA 2XWJB 5A3IC 3O2VH 5HVWA 4Z0BH 5SX4H 2QQQA 4KRPC 4KK5D 5IQ9A 2UZIH 1ZHKA 4C59B 1JRHH 4M5ZH 2IANB 1CZ8H 4GG6E 1RZ8A 2HFGH 3TBSB 4LLYB 4ELKB 5ANMA 1AXIB 3ZE0E 1TVBA 4MJIB 3PXHA 1FFOB 2IPUG 4BQCA 5IKCB 4RMTA 4OZIF 4X9FA 1FH5L 3BN3B 4ORGA 3RVWC 1FNAA 3ILQC 1Y0LB 3C8HA 5I8CA 4PIRF 3QG7L 3SDCA 1U8JB 4NKMA 5KVMC 4WJ5B 5DUPL 3HNTH 3MACH 5JLZA 1RJZB 3G6DH 4Y4FA 3MBEC 4OFPA 5M95B 3RPIB 4J3WA 2J8UA 3MXWH 4DVRH 3DX8A 4V1DB 1N3NA 1J1XL 3MRDB 1YEFL 1HHHB 1MH5B 4Z76A 4MA8H 3Q6GH 1UQSA 3ZKSD 3D25A 4ZXBA 5D2LA 4GBXB 4GQ9L 3HUJE 1D5IL 5JIIA 3QQ3B 4JHWL 4LLUB 4ZTPH 5GRXG 1WBXA 2D31A 2VYRE 4FQ2H 3SE9L 3QNZA 2B8OT 3REWA 4I2XB 1UACL 4DZ8B 4CL7A 2GJZB 1KEGL 5IV2B 4XWOC 5MENA 1T6VN 3MBEA 4QF1B 4XC1H 4QKXB 4HFWB 1DEEA 1TITA 2WQRA 2NLJB 3N50A 1HNGA 4JDVA 2D0FA 2FX7L 4MYWB 4L8CB 5JDSB 3H9SB 1E0OB 4JFZH 4OT1L 5LCVH 1C5BL 1NCAL 3F7VB 1P1ZA 4G9DA 1UXSB 2M8XA 1LHZA 1ZHLB 5HHVH 3O8XA 5ADPL 1JF1B 4RA3A 2QLVB 1VEMA 4OB5L 5C7XH 3B3IB 2IANA 4PJIE 2DQCL 4QRUA 2FATL 5IG7A 3N85H 1KBGL 1E6OL 5CJBA 1RZFL 3U7WL 2DWDB 1YEJL 4YDVA 4R2GD 3WS6A 2HMID 5C70A 4PJIB 3U36B 5DQJA 3O4LB 2NTFA 3E6HB 4Z7WA 1IGML 5I8CB 4MA7H 4ZUVA 3IF1B 4MCZB 4WO4C 3MX0A 4W6YB 2NY5C 1T22B 4M1DH 2G60L 4U3CA 4LKCA 3MZTA 1A6TA 1VDGA 1GGUA 4Y4FB 5DQ9A 5HHOA 4X4ME 4JO3L 2EE6A 5F96H 2ADGB 1K85A 5MEND 3O2DL 4TSCL 2P8LA 2Y7QA 4HD9A 4QRPD 4HHAA 2NY1C 3AUVA 1HHHA 4HLZG 4PJ7B 2N56A 3ARFD 4H25B 1F42A 5LQBH 1BQHB 4LASH 4LU5L 3UBXB 3P3YA 1UB6B 3MC0A 3QUYC 3D25B 4ZXBB 2LTQB 1H3GA 1UZ8A 3WNKA 3C6SB 3KLDA 4CMMB 4LLUA 1JV5A 3CK0H 3MA7A 1T89A 3UZVB 1HILA 4XPAL 3C8KB 4U0RC 2QSCL 3V6ZB 1CGUA 3TP4A 3SEPA 1YN7B 2IAND 1VACB 4YE4L 1DEEB 3UDWA 5TH2B 3DHMA 2X05A 2XXCB 4HJ0D 4Y5XC 4QXTA 1KG0A 4XT1C 2CRIA 2C7UA 3CSYB 4CGTA 4UILL 1I9IL 3O3AA 3RY6A 3BKCL 5ISZD 3C8DA 5SX5K 4N5ED 1KEMH 1QHOA 1NLDH 3MMEB 5HYQA 3V0WL 5CEZH 3I3EA 1B0WA 1ZHLA 1DLFH 4L5FL 3DSNA 5JUEL 3D2UA 2MWCA 3NIFF 3FOMA 3GK8L 4F37K 3QRFM 3O9WA 1KYOJ 5IVZA 3KYOB 2H32H 4L4TA 3I02A 5EORL 1U93A 4MA1C 5CJXA 3WLBA 4GJTB 5SWSB 3DARA 4P23D 2RBLA 3SDCD 1ZANH 3MCKA 1A47A 1UGNA 1MJ8H 3QEUA 4PP2A 2CKBB 1ZOXA 1RK1B 2AEQH 1FYHB 1J88A 2A1WH 2N7BA 2B7DT 2Z93A 3A6CL 4OD3L 4PJ7E 4XNQA 2JJSA 4JR9H 4XNMA 5JOFA 4P59L 4N1CA 5DQ9B 5HHOB 1R3JA 3OJDA 4QHNA 3QAZB 3QUXC 2BX5A 1KJ3H 1BM3H 4PRIA 3MRRA 4ONOA 4RNRB 4Y5VB 3CLEH 4H0HB 1W72B 5CJOH 3D0LB 3P9MA 3CZFB 1I1YA 1BFVL 1J05A 4MHHG 3QUZC 1JCKA 4BQBA 2Q7YA 1NCWH 2X7LB 2WUBH 4RGND 1UEMA 1GGCL 3EOYG 1AD9B 2EO9A 5KVEH 1C7TA 1U3JA 4YPGB 3RU8H 5ACMA 5IBLD 4OLWH 5DRZA 5K9JH 1PDKA 3ULUF 5CUSH 2DWEB 1IT9H 2A9ML 1E4WL 2NZIA 3S37H 1WZ1H 4OCSH 3MJGX 3HCVA 5TH2A 4JY4B 4JM4L 5IIEB 4LHJB 5C8JB 4GMTH 1AP2A 3IDMB 4QOKE 1ETZA 1AO7E 3CSYA 1MAML 2HWZL 4JG0H 5EO1A 1FV1B 3MJ8A 3OJ2C 2XA3A 4K3GA 1F11A 4JFHE 3GSOA 4LLDA 1JYNA 1HCVA 1LD9B 3N1GC 5FXCH 3LMJL 4GLRH 1T03L 4OJFH 4UINH 4O2CA 2APFA 4AQ1B 3LHPL 5E8NA 5GRUL 1OOAA 1WFTA 4PD4K 4F9PA 3NPZB 5HYSA 2I9TA 1YEJH 4QCIA 1F00I 3CFIC 3L3KB 3EOTL 1QACA 2MQ0A 3I02B 3HG1A 5TDPA 2XYCA 1TCRB 5T3ZD 3EYOA 2DDQH 3QDJE 3P77B 1DDHB 4PJFA 1CLOL 4NO0A 2CXKA 4HJGA 3MJ6A 4I0KA 1U42A 3TF7C 4YHZL 5CBEA 4YXLH 2OM5A 3CX2A 5DYOA 4XMLH 3VD4A 5IB1A 5GS1B 1SY6H 1T1YB 2L7UA 1Q9LB 1R3JB 1WBZA 4TVSa 3LDBC 4FTVB 4NN7B 1Q0YL 1TJGH 3O0RL 2BNQB 4HGMA 5ERWB 5DMKB 3CGTA 3PWVA 1EIBA 3MCLH 3V4VH 1IAIM 5E8OA 2FJGA 3V7AE 4NWUL 1J05B 2QJDA 3LQAL 5DVKA 3BHBA 4C58B 3GSQB 4M7LL 3BJLA 1L7IH 35C8L 4WI2A 1S7WA 1YEHL 1JJUA 1J8KA 3B9KA 4LQFL 4P3CH 1CFVL 3V4PH 1J0KA 3LY6A 5C9JA 1WCBA 4MB4A 1CGWA 5TFSH 4MZ2A 2I9LA 3L5WB 1MNUL 4FTVE 3L1OH 1IARB 4OCNC 5E03A 4UT9L 5I18H 2VXTL 4RMVA 1S5HA 1HZHL 5F9WC 4LLVB 4IRSA 5JR1L 4YC2B 3BRGC 4G9FA 5CSZA 1I9IH 3QDJD 1AD0B 5T5NG 4MAUH 2NXZB 1WBYA 1BEYH 1EAPB 1QR4A 5DA0B 1BD2B 3IJHA 4JB9L 1OTSC 5IK3B 4LAJH 3QDMB 4LDLB 1CFQB 2E8YA 3GSOB 3KPNA 3O9WD 4KHXH 3QUXB 1YEIH 4O2CB 3NBNA 4FFVC 3WO4B 1M1SA 3RVUC 3T0VA 3MGTA 1UXWA 1S7UB 2QTEA 3IAPA 2EDOA 3HNSL 5BCAA 4A2LA 2PXYD 2X1XR 2NY3D 1A3RH 1IKNC 2FECL 1ZHNB 2VLRA 3O3EA 1HHJA 1HCFX 1CYGA 3MREA 3PL6D 1LWRA 2W0KA 4DCQA 3RJDA 4F9LA 1N0LA 5INCA 3N9GH 2V17H 1FNSH 3B9KD 2H8PB 5GS1A 2J8UE 3UX9B 2R9HC 4WUUA 3VWKB 4L3EA 5E94A 4JANB 4OZHA 5EO9A 3RTQD 2DBLH 5ETUB 5DGQA 2RFXA 3B9VA 4TVPL 3FB5B 2NY2D 5ESQB 3VXTB 2BNQA 2BVPB 4QT5B 3HG1E 4XXCC 3DO7A 2HKFH 1XMWA 1OGTA 3TBSA 4LPVA 4LPWA 5CIPA 5E2JA 4HFUH 5FUCC 3MLPA 4MJIA 2XZZA 3LZFL 3RWDB 3JWOH 1J1OL 2F58L 4GMSH 1I8LA 2VDML 5JHDE 3UYOD 2CLZA 5DRWB 1YC8A 4LEXH 1VKXB 2ZSWA 3OZ9L 5F1IA 2W9DH 1G6VK 1SYSB 1QHPA 1VGEH 2C1OA 3K8MA 5HDOA 1QSEA 3EYFB 5LVEA 4EDWH 2DJ4A 4G9FB 5CSZB 5C09D 3L7FA 5B38B 3G08A 2HG5B 3SQBA 1CU4H 4JGJA 3P9LA 2R2EA 3T0DA 1S3KH 3MYJA 3NMEA 4TUJB 2R23A 3E3QC 3F12A 2KBGA 2FR4B 5E2TH 1UM6L 2Y6SC 3WLWC 1I1RA 3K74B 1G7LB 1WBXB 4I3SL 4WWKC 4YUEL 2A6DB 1FNLA 1ZLUH 5KS9B 1D9KA 3MJ9L 3MV9A 5ISZE 5DMGC 4NZUH 3S88L 3WIIL 1RHHB 3I6GA 5A2KH 2EE3A 1MJUL 2IBBA 1T20A 2NW2B 5JQ6L 4TVPE 4G6FD 5GS0H 1FN4A 4DCQB 3OB0H 4Z9KB 2G2RA 4YR6A 3HPLA 2LFGA 1VFAA 5CJXC 2F19H 1FZOB 1Y18A 4YBLB 4O5LH 1D3CA 4DGVH 2X4RB 2X4PA 3RWJA 4PJ5E 3S5LB 1HXYB 2GI7A 2FDBP 5F9JB 4UDTB 4GXUN 3GGWB 2Y5TB 4JGMA 4HIHB 2J4WH 1AFVH 4LLYA 1NJ9A 1QPXA 4X6DB 5BV7B 1KLUB 2FH8A 3HZVB 4RAHA 4ZOCA 1U92A 3GSXB 3O4LE 4POUB 3EFDH 2BY1A 3ULUD 4O9HL 5D5ME 2AXHA 4XVTL 1MIML 1RFDH 4PJIA 3I6KB 1O7SA 2EH7H 5JXAL 3D39B 3IF1A 2ZSWB 1H3WM 3NN8A 1C5DA 3PWJA 1SYSA 2RCSH 2CDGA 1Q9KA 1CIDA 4HG4K 3REVB 3EYFA 4JO1H 3HUJA 4G5ZH 1OHQA 2CDEB 1S7QA 2VISB 5FYKD 5DJ2B 1EPFA 5IQ7H