3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
4PR5A 4HUUA 2HN7B 3QDJE 4UTAL 3SDCD 3VGAB 4WWID 1FE8H 5BJTA 1DQQB 3ZDYE 2P46B 4CVXB 5DJXB 5DEGB 2B4CC 4A6YB 1LHZA 5AD0A 1ORQB 1G7MA 1DQJA 1XGPB 4NWUL 4YGVA 4UNVA 4OI7A 5CSZA 1D6VH 1QP1A 3DUSB 3N9GL 5D6DA 1DLHA 5EUKB 5CD5D 3MA9H 1EHLH 2YZ1A 3CFCH 4KUZH 3KXFB 2EIZB 1R3HB 1IAII 1Z9SA 4XMLH 3PWNA 2JJTA 3WE6A 4P5KA 5IBTL 1H5BC 4LLMA 1H3TA 3LV3B 3U4EA 1G7JB 4NO2B 3WDJA 4D0CB 3CD4A 5D5ME 3ZYZA 1CDCA 2WLZA 4WFGD 4MLSA 3NCFB 4S2SA 4NZDA 2B7DT 1WBXB 3C5ZA 5EBWB 4RCAA 3NPSB 3K80A 3HPJA 5CMAA 4UQ2A 4RA0C 5I19H 4NFCA 3VXPA 5DJCB 1YNKH 3MBXL 1TZHA 4QHKJ 4JJ5A 1CICD 2K7PA 2OQJA 4GMSL 1U2CA 4FQ1L 4XAKE 4LSTH 2FATL 2KZWA 4FZ8L 1NCBL 2CH8A 4G9FA 5DA4A 3K2UH 5LJYH 4OB5L 2AV1B 3HCVB 5ESVA 5FYJD 1F8TH 3JWNC 2H2SD 2Y36H 1EFXA 4N5UA 4HWUA 5EO0B 3L3OB 4FXGA 2AI0L 2DLIA 3BEVA 3QZWB 3OX8B 1MJJB 1O7VA 4LRNH 3TYFA 1QFWM 4HQQH 3VFNB 4YBLC 5C70A 5T5NF 2EEDA 3WEXA 5DEGA 1UWEH 4K8RD 4Z7UB 1S7TB 3TFKD 4P23B 4Y5XA 2QSCL 2OR7A 3B9VA 3K0WA 3MV01 2V2TB 5I1DB 1CFBA 5JXAH 5CEZH 1UG9A 5JHDA 5EUOF 4CRPA 2YK1H 3QJHB 5IW3A 2Y5EA 4Q9CA 1MEXH 4WTZA 4AQOA 3ULVF 1YECL 4PRNA 2VWEC 3DI3B 4NZUL 5GS1A 2BMKA 4XAKD 5BO1H 1CGYA 5F9JB 4JFPA 2NXZC 2AJZB 4RFNB 4HC1A 1BPVA 1FPTL 5D7IB 3GBLA 4DGIH 5HHQB 4FFYH 4U0RC 3HPJB 4KJWC 3CCHB 5DFTA 2YPLB 1S5HA 3F62A 4ODUA 1R24A 4MA1C 5TFSH 5D7LE 2Q7YB 3MMEB 4WI6A 5C07B 1X5GA 3RWEA 2X4SB 5GGTA 4G3YH 1NCWL 2A9NL 2UUDK 3DRQA 1J0YA 4LCWE 4YHPA 5L9DL 5GS2H 2FIRT 2ARJB 3BE1L 3FRPA 5EO9A 4QRSA 2J6EL 1BFSA 1L4IA 1QPXA 4ZAKA 4ZAKD 2DLEA 5TQ2L 4MJIA 4EDXA 2UY6A 5E6YA 1PSKH 1DQML 1J8HB 2ZCHH 2PO6D 3QIUB 3TN0C 2V5MA 1LEGB 4KK8D 2FEDD 2CKBL 1KIQA 3HZMB 3DX7A 1IEHA 5EULV 5IHZA 4CW1A 1RZ8B 1YEFL 3T0ED 2OZ4L 4HFWB 1UA6L 4A6YL 1OD9A 4KUZL 3MYZA 2NY4D 4FABL 3OV6A 2DM4A 1R3JA 1WLHA 2FATH 1DSFL 4LPUA 1AH1A 2NY0D 5E9DE 4XNYH 5TPWL 1KNOB 5FCUL 4EDWH 3RDTB 4M62H 1YY9D 4F7MA 4OZIB 3ET9F 3QHFH 1EA9C 1FFQA 4I18C 1WTLA 5DD0H 2J8UF 1YA5A 3H9SA 1QEWB 4HGKC 2HT2D 4H20L 4L9DA 3X3FH 5IEKB 2EKSB 3IJSA 4AMKH 3P4MB 1AR2A 1XCTB 3QZWA 2B1HH 4WHTB 1QKZL 1AR1C 5HYSA 1NLBH 3O6LH 4AG4L 5C0BE 3X3GL 2K1MA 4ENEC 5JW5A 5BRZE 3IDYB 4TQEH 4F8TA 5I71B 4J2XA 3S97C 5D7JB 5KVEL 5IR1B 4M1CC 2UWEF 2J8UA 5DYOA 4KAQL 4NNYB 4HUVB 4PJ7A 4BSVB 1XFPA 3I02B 3LSOA 3AU1A 1JVKA 2MPAL 1R5VA 3TJHD 3STLA 1UVQB 4MD5B 4WO4A 3MFFA 3HMXA 2HMIC 4KRPB 5T1KA 1C1EH 1XR9A 2F5BL 3S35L 4OLWL 4OSUL 4F58L 3DRTA 3QBTB 4RX4D 1UZ6F 2NR6D 2GJJA 1I85C 1UXSA 4P3DA 4HDIA 2A77H 5IMKB 1G9MC 4JM2A 1KLUA 1DFBH 4FQJH 1S5IH 3WXVL 5IVOA 2GK0A 5IBLD 1HN1A 2R0WL 3LKNA 1CL7I 3GSUB 3QUYD 4FXKA 3BISA 2B39A 2HKHL 3MMEA 1MWAB 4OLZL 4I3GA 3VGFA 3W2DL 5KANI 2Z0BA 3MCG1 5CCKL 1X5ZA 5TF1H 4UILH 5TGBA 2A74B 4V1DE 3CFIC 2NY2D 3T8XA 1YNTB 2PNDA 3O4LE 3CSPA 4LU5H 3U0WL 5FYKD 2DMBA 5J1SC 5FYJU 3MBED 5D1ZD 2VABA 5SWZA 1G9EA 1IFHH 3IFNL 4U7SA 5SWZD 5I74B 5D8JL 4YXKH 3WNMA 4NT6B 4OCXL 2EDXA 1S7XA 2OYPA 1LO2H 4MVBD 2QHLA 3WD5L 3QEUB 1JNNL 2BNRB 4JZOB 3ZE2F 5KSUA 4O2CB 1DCLA 1KIQB 5I74C 1BX2A 2CRYA 2MFNA 3IJYA 3S96B 1KEGH 4ZTOH 1H0DA 1F4XH 5F3HA 3ZSSA 1P7HL 4XRCB 4U1NA 2W0LA 1DP0A 1AI1H 2YUZA 4PP1C 4R2GB 1E27A 2COQA 1VDGA 4S11A 1MAJA 3H9YA 4QGTA 4OD3H 4AEEA 2F19H 2XY1A 1ZVSB 3T0WA 3PGFL 2NY3D 5C2BH 2AV7B 2V5TA 3NH7L 1G84A 4PJEE 2GSGA 1YEHH 5K9JL 3HCVA 1FFOB 1DLHB 5JOPD 2DQDL 3LRSB 5JNYA 2A6KA 1SJHA 4MAYC 2GJ6D 3BPLC 1Z3GH 3ZHDA 3G9VA 1Q9WA 1T03H 2VLRB 2HVKA 3P0VH 4P46B 4YUEL 1YN7B 5DLML 3TH2T 3FB6B 1G7LB 3QA3A 2BRRH 4JY5H 4Z78A 1F5WA 4JREB 3K8KA 4JZOA 5EUOB 3KPSD 2VDQH 4MA8H 1URLA 4WHYH 4KRPC 5CBEA 1N4XL 3LQZB 2HH0H 4OZGA 4W68A 1KEML 3VFTB 3OKKB 3V52H 4A2LA 3P3YA 3ZSTA 2V9TA 3S6CA 5T1MB 3U4AA 4DVBB 2Z31D 2EH8H 1U3YA 3WHE1 1JGDB 2XACC 2Y7QA 4E42A 5FHBL 2LTQC 5I17A 3RWHB 1HH9B 4WWKA 3IDYC 4LVHB 3Q5YA 1RZKH 1YYML 3K1KC 2PYEE 5AD0B 3CU7A 5IVZB 4OKVB 4XZUA 5C9JA 4R2GC 2CKBA 4F58H 4LF3B 5EU4A 2PR4H 4YXLL 3DSNA 2VXVH 5CUSL 1QSEA 1BD2E 1MHPH 4QRTA 3E6FA 1OW0C 5IUSA 3LPFA 2V7HA 1BZ7A 5L7XL 4O02H 3DO3A 2XA3A 4R2GD 3EYVB 4XH2A 3SDDA 1BD2B 1J86A 3K7UA 3OZ9L 5LVEA 5D8JH 1SYVB 4M6MH 4PRDA 5DD5H 5D71H 1U92B 4NRYA 3SDYL 2GAZB 3EOBB 4GBXA 4LLQB 4FQHA 4PJDE 4MD5A 2JB5L 1TJGL 1CWVA 5GZOC 3F12B 1X5XA 3MUGB 3NFSH 3FJTA 1CXEA 3D6GA 4MNQE 1QO3B 5BO1L 1ZLWK 3TVMB 1NCWH 1YMHA 3R1GL 2YKLH 3D25B 1R6VA 3D87B 2EECA 5I1EH 2DMCA 5SV3A 5C2BL 1DQLL 1G7QA 4DAGH 5B4MD 3RWIB 1QRND 4FFWC 1HDMB 4N0FB 3BEWB 2EKSA 3IJSB 3T1WA 2YBRB 4RMUA 1Z9LA 3TO4B 4X6CA 1QG3A 3L7EB 3VFMA 3OX8A 1N0XH 5CJQL 1FYTE 2CD0A 3TZVB 4BZ1L 4JRWA 3MCKB 4EI5A 3U79A 4YUEH 2FX7H 4NN7C 5ELIA 3PL6A 1YMMD 4H0HB 4LQ1A 1RIHH 1KENH 1RFDH 1KCVH 5D2NC 1P6AB 4HH8A 1FFPA 4AEFA 2Q8AH 2WQRA 1F3RB 3TT3H 1BM3L 1NGWB 5EZIH 3DHJA 4LSVL 4BQCA 2X10A 5C08E 5HI4C 4HZLA 5HPOA 3EFDL 1R5WA 1RUPH 3QXVA 2VZSA 3VXOA 5ISZE 1A2YA 1U3ZA 2A2QT 2CO7B 1IAIL 1KTDB 2VISA 4MCYA 2C5DC 5HXMA 1EJOL 4GRMA 4I18B 1CDYA 4D0CA 3MV9D 2MJWA 3CLFH 2IWGA 4HIJA 4J7RA 4PJFA 2ZOLB 4YBLB 1WFUA 2NX5E 3DRQB 4XP1H 5D7SL 2YN3A 2WWMD 1NBYB 5B38B 1P7QB 4OLXH 2VLJB 1U93A 5DZNA 2DD8L 2DQCH 3EYFB 1IGJA 2VLJA 3AMLA 4NGHL 4XNUL 3P11L 1CFSB 1GC1H 4CVXA 4QXTA 1WWCA 2Z8WC 1NBYA 3P30H 4N0YH 2RB8A 4BYHA 3U46B 4PRIB 1MFNA 4UB0H 3B83A 1FZJB 4WRLA 5T3XL 1RK0A 1OGAE 1IEBA 1SEBA 4HWBH 5HHMD 4MHHI 2AK4B 2CIIA 5B39G 2FL5A 1ZA6A 5KSBB 4KKAD 2EDEA 4HKZB 5GSRB 4DFIA 4Y5XB 3IFLH 1H3UA 2MQ3A 2XG5A 5I6XC 1WCQA 3L6FB 2VN7A 3MX0A 4FTVA 5IFHL 5C0FA 1BBJA 2QQLH 1MI5D 3C5ZC 4HMDA 3N1GC 3WNOA 4IS6A 2EC9T 2X89A 4X5WB 2WWKT 2NY4C 3NCYP 5F7YC 5I66B 3BIKA 4JPVH 1JNHA 3DXAE 5GZND 2OJZL 3P40A 3HE6D 4M8QA 2VO5A 5MERB 2X4PB 2D4DA 4KJYB 2BVYA 3C5ZD 4YHYB 4OD1L 1K8IA 5HPMB 3B3IB 4PJAE 3UBXG 1ZAGA 5FV1L 3IFPB 3H9HA 2N4IA 2DIAA 3TA3A 3RWGB 5F7KC 4FQLL 1EO5A 3MCLH 4P2RB 3D85B 4LSVH 1TQBC 2XWTB 1Y0LA 3UTSB 2V5RA 5SWSB 4JRYB 2G5BB 1VFUA 3U7AA 3RVUD 4M5ZL 2AXJA 1EO8H 5TDOB 4LAJH 1P4BL 2MTPA 2GJ6A 1RJYA 1SJEB 3ARVA 2WAHA 4TUJA 5KOVC 1ZV5A 2HFGL 4JGJA 2D03L 4AT6A 5DJ6A 3RUGF 1MIML 4PJ8B 2ZUXA 2OR8A 3V5KA 2R29H 3D0VA 2NZIA 5HGBA 5TDPB 1OWRM 2LU4A 4YR6B 3ULVD 4X5LA 1BJ1H 1ZLSL 1I3GL 1T1XB 3SCMD 1IVLA 1KPVB 2NR6C 4AEIL 4U1JA 1K6QH 3RJQB 5JIPA 1P9MA 2VXUH 3UJJL 3FQUB 3GUTB 3K2MC 2W0PA 4I1NB 1CS6A 1C5DA 4G6ML 2E7HA 2HJFB 3GHBL 1LE5B 4U1SB 5CZKA 3E6FB 3FAWA 2VZ1A 4Z7OF 2XNAB 3ZTNL 2AXFB 4YXHL 3X14B 3SBWA 3C2SA 3DVGA 3P77A 1EXUA 1ZHLA 4W70A 4KXZI 4LARL 3M17A 2O61A 5HHNA 3QXWA 2ZCKH 1DDHA 3TT1H 4HJJH 1AGFA 3JXAA 1UACH 4HS3A 4FFVD 3NGBC 3Q5TA 1KJVA 4FG6C 1YEDB 3H7BB 4JPWL 5F7EL 1ZA6B 4K7PX 4QHLB 5CEZE 3L3IA 4LIQE 3MBEC 3QUMA 3D39D 5E2UL 4YXLH 4F7CB 3TYGH 3DWTA 4PJ5A 3QO0B 5KSBE 3FFDB 4YO0A 2AJSH 3DGCR 1XCQB 3QDJD 3LD8C 4Y19B 2X4UA 5ENWA 2EXYD 3VGAC 4JQXC 1F3DJ 4JGUA 3QT2A 4ZO8A 3VFPB 2OTUA 3F7RA 2R15A 3ESUF 1S7VA 4HH9B 5DD6B 3DXAA 4X83A 4QHNB 5T3ZD 4BH8B 5GRUL 4AENA 1RZKL 2BVQB 4M1CD 5SV4A 2J5LC 4GKSB 2NW2B 5IJVB 5HPMA 3MLWH 3TIEB 1NUDA 2VXVL 5CUSH 1RULH 3TO2A 4E5XB 4GG6E 3TJHC 4Z7VF 5DRWA 3VD9A 1AQKH 4YFDB 2CKNA 1ETZB 3DBXA 5GGVH 3UBXA 3BHBB 4W81A 4QRRE 3ROOB 1WITA 4RNRA 4O2EA 1M71A 2HFFA 2HTLC 1IM9D 1HHJB 3BVNB 3HG1B 3L3KB 1C7TA 4LGSB 4J8RA 2Y7QB 5IT2H 1D9KC 4CUCA 3WIFB 2GUOA 4OFYA 5SX4H 1UB5B 4QTIH 3IVKA 2CPCA 2YRZA 3BPOB 3GEWB 5FECB 2GJ6B 4UU9A 4M1DH 4KPHL 5DJZA 5E6ID 4XPTH 1MCEA 4QYOB 3PXHA 1HI6B 4XVUD 5GJTH 4S0SD 3BP7B 3KPMA 4ERSH 4WO4C 1LEIA 1EAPA 2VTFA 3H8NA 1A3RL 1Q0XH 1MI5A 1MJUL 4FHBD 1B0GA 3TO4A 2CLRB 3DVFA 1E4WH 4WFFD 5C0CB 1J0JA 1FVCA 2A73B 3CJJA 4JFDE 3FQXA 4HJJL 1YQ2A 3ZDXF 1SJVA 4PJ8D 1LE9A 1HWGB 3OB0K 5KTEL 4EN3C 3EYUH 1MCJA 2Q76B 3VXME 1ADQH 1A6UL 4I0CC 1K2DB 5T3ZL 4GAFB 4TVPE 3MRKA 3RQ3A 1RU9H 4CL7A 4JHZA 5GGTH 3R06A 3FONA 4YNYA 4EN3D 4DKEL 1NCDL 3H3PL 3VXOB 4L3CA 4N90D 5IGXL 4KAQH 1RZIA 3EDJA 4KMQA 3RVWD 2YRLA 2X7LB 5JW4M 3O9WD 5AAMA 5C0NC 1CFVL 4F9PA 4O58H 5F1IB 3P4NB 1TMCB 3B9KA 4GXVH 1HXYB 4WWKC 1ZWIB 1WAAF 3H42L 5CZXC 2H32B 5GRZA 4WU5B 5INCA 3MREB 2V7HB 3MOAL 5C07E 4KMTL 4NQXA 2JCCA 4BFGA 4P59H 3BZEB 1FLRH 1JYWA 3BQUD 2XQBH 4RRPG 4MXVE 1A6AA 1Z5LB 2H2PC 1RUAL 1WBZA 4XP4H 1KG0A 1NGPL 2AKRB 1T22B 1YECH 3FQRB 4NDMB 3V4PH 4AH2A 2BNQE 1DANT 5IKCA 3L3OA 4FXGB 4XWOC 1VGEH 2NY6C 2OP4H 1R3KB 5TF1L 3PDOA 3QNYB 1UM6L 3WIHA 5F72S 4HIHA 2JK5A 5CAYB 4H1LA 2VL5A 1ODAA 4HPOH 3KDMB 3ETBF 4CW1B 1JL8A 4KHTH 4UINH 2M8XA 3VGEA 4I4WB 1AIFA 4E9LA 1RZFL 3O0RH 2ED8A 1V8HA 4WI7A 1UKSA 4Y2DC 1AY1H 4Y0GA 2Q7NA 4OD2A 4LBEB 4CU8A 2AEPL 2FLRT 1Y6NR 4PTUB 3QDMD 4B0MM 1LQSR 3VXMB 4HJ0C 5JXEA 5F44A 5KOMC 3B3IA 4R96B 1A7NH 1IEAA 3NCJL 1T7VA 5I0ZA 4GFTB 1HIML 4D94A 5GISH 4UTBH 5DSCA 3WYRA 5E00A 3PL6B 1LK3H 2ADIA 2H3NA 3QRGH 3QEQE 3DMMD 2YMXL 3MBEA 1DBKH 2AERT 1RHHA 3X3FL 4ERSL 4ZUVB 4OAWB 4TVPD 2Z92A 1QYGL 43CAB 2F54A 3FKUS 1HHIA 5L2KB 4RMSA 4L3EA 4BFBD 5DQ9B 2V7NA 4HT1H 1ZGLM 2A6IA 2YPLD 1WWAX 4L5FL 3TPUA 3DURA 3UO1H 1T1WB 2GJ6E 4Y5YA 5IEHB 3QI9D 3F58H 4P23D 4PJ5E 5KSBA 2ZUQB 3TBSB 5JDJA 3L5HA 1C5CL 5C6PB 4XB8A 3MJ8B 3OKKA 1DQDL 1U8NB 5EN2A 1OHQA 4OFPA 1D3CA 4H5SB 4IRSA 1QD0A 1YMMB 5J9PB 1J1XL 2DBLL 1LO5B 1I7TA 2HFGH 4R4FL 4CAGA 4JHBA 5I1DA 4B7LA 1SYSA 2NXYD 4HWZA 4EUPG 4G42A 4GRWF 3SDCA 5DMGD 3MRNB 3NN8A 2Q8BL 5FB8A 5DI8A 2A74A 3NAAL 4WVRA 3F7YB 3D9AH 1ZT7A 4QRQB 4YR6A 3KWWB 3ZE0F 1FORH 1LNUA 1LWRA 3QHZH 2IFFL 4GG6B 5EO0A 2ICCA 4WGWB 4NRZA 1BQUA 4X7CC 2FNBA 5ESVB 2NZ9D 3HR5B 2ZSVB 5CP7B 3VCLA 3RZCA 4QWWC 4QRQA 2A77L 4K2UH 4WFEE 3KHOA 4DKFL 3BGMB 2ADGB 1KELL 3GMPA 2UZYB 5K9KB 1N5AB 2ARJQ 2KUTA 5E95B 1NFDA 3EOBA 5DHYA 3KPNA 4ODSH 1N6QH 4QWWD 4QRPE 3RY6A 3S3PA 3QEUA 5ESQB 2BSSB 1GGBH 1NGWA 3HI6H 1AD0A 3RY6C 1U8HB 1P4LA 4GKOA 3VFTA 5LWYH 1I3UA 4NT6A 2L0DA 4EXPX 3VA2C 1JN6A 5GHWH 4WTXA 4K23H 1EGJL 4UI2A 3BD3A 1X7QB 2GFBA 4NZTL 1IC7H 2W65A 5MP6L 1DFBL 5J12B 5C6WH 4X5WA 2C4FU 4Y16C 3GMOA 2XIDA 1KJ2H 1DL7L 4APQC 4L1HA 3WSQL 4IMKC 4Z0BH 1S3KH 2WINB 4NQSB 5CCKH 3L3JA 1NBQA 4J6RH 4OIIL 5I1GH 4L9LC 3RTQB 4JR9L 1IGML 1XGYH 2YS4A 3QUKB 5EZIL 1GZQA 2OS7A 3ORJA 4R4NC 1V3LA 2VB5A 1X5KA 3UO1L 4JFDA 4LVOB 4TVPL 5TE4H 4OZGB 1BWWA 4RZCA 4NWUH 1TETH 5E9DB 4IOFD 2F8VA 4D9RE 4XCEA 3KYMA 5BRZD 1GGCL 4L3EE 1AQDA 1JTPA 3QUXB 5I0DA 3N1MC 2NYYD 3QA3B 2P5ED 4M9OA 3I9GL 5I8OH 1BX2B 4I4WA 3QIUA 5KVGL 3WHE0 5IBLC 4BUGA 3IGAA 1OTTC 5GGQH 1MHHB 2EDLA 4D9QD 3ALWA 3C5ZB 3WJLC 1R5VB 3BYYA 1YNLH 4DUXA 4DQOH 1LP9A 1PY4A 1RUKH 3QUML 4ZFOA 3BRDA 4CDHA 4PJ9B 4ENED 4JRXE 4JVUA 1F3JA 4MNHB 4P5TB 5I19L 4LLWA 1IAIH 4OQTA 3VFVA 1NC2D 4YZFF 5GS0L 4W4OC 5FGBC 4DTGL 4WW2F 1OGTA 5B3NA 3GNMH 5H8DA 3NA4A 5EZOH 5K59E 1MCSA 4JRYD 4MA8L 4PLNC 3WV0A 3VW3H 3RVUC 5IVZA 4F9LC 4Z7WB 2EC8A 4WI3A 5ID1A 4FQ2H 4KH2A 1DN0B 4QHMA 1AO7D 1KB5L 3QZWG 5JMOC 4D3CL 4QGYA 2PTTA 5D2NB 3I50H 3UP1A 3SGEI 3U1SL 2R9HD 2DD8H 1XGTA 1Q9KB 2IALA 1MCBA 2W9LA 4DN3H 4XHJD 5D1ZB 5DJZB 2FLBT 2X05A 5CBEB 3B8YA 3SJVA 3PL6C 3MJ8A 2OI9B 4MNGB 5DHXB 4UB0L 4XPHL 1GXEA 5HYFA 3WMSA 3AXLA 2AK4E 1NFDB 15C8H 2BSTB 4JDVA 1MLBB 1AHWA 4HGWB 5L8JB 3NZHH 1QA9B 2HFFB 2G9HA 3R0NA 2UZIL 3VWKD 5B3JF 2WW8A 5DC0A 4PRIE 1HOCB 5D7LA 4LP4A 1KACB 5EORH 3VXQA 4Z7UE 2AJVH 1QR1A 2EXWD 4L4VD 4PJBF 1OTUD 4GUPB 1F6LL 2UYLA 3RPKA 3RGHA 1W2KT 4NQXB 1CE6B 3D25A 3RGVA 1B2WL 4OCLC 4NKOA 4G6KL 2KBGA 1M7XA 2Q7YA 5FK9B 3QQ3A 3T2OA 4G8GE 4YHIA 5C0CA 2KPNA 1F4HA 5D5MA 4XP4L 3T65A 3HMXH 3M8OH 3MR9B 1H5BA 5FOJA 4FQHB 3LEVL 3MRRA 3R0MA 4NN7B 3IS0X 3MGOA 1N7ML 1TZGH 3DVNB 3N9GH 5T3XE 1KXTB 5F7DA 3KPRA 2P8MB 3D18B 5CMAB 1ZSDA 3SDYH 4L1DA 1OCWL 1DQLH 3FONB 5J11C 1UVQA 3MXVL 3RVVC 4GS7B 2WP3T 4RZCB 4TULL 4RWHA 5KN5B 4X4YA 5D96B 2Y07L 3HS0A 1NCCH 4NJAH 2AAVA 1A0QL 3GSVA 1ZXQA 4QHLA 1X5AA 4Y4HD 3T4YB 3GGWB 5FF6A 4NBZB 1MCQA 3VXRE 3ARBC 1JPTL 4HWNA 3TBVA 4FA8A 4IRSC 1NEZA 2RHEA 1MQ8A 1IC4L 1ZT7B 5AYUL 1IM9B 1KG0B 5I1CL 4LLYB 1KBGH 3C09C 3ULVH 1PG7H 4IIQA 5HYQB 5I30L 2ZPKH 1CT8B 4F7MB 2X9XA 4XP5H 5KZCB 2CUIA 4HAGA 4P4RB 5C0IA 2HJLB 3O3UN 3TBYB 3BUYB 1XGQA 5HTSA 5C08D 4XCNB 3BESR 1I4FA 3NFNB 4G9DB 1DBKL 5C0EA 5JLZA 3X12A 3TBTA 5D1QC 3V7AG 1RMFH 4RMQA 4RWYL 2N7BA 4K3EH 3P4LA 3WUWG 2ED9A 2ADJB 3ZTNH 4O51B 4RISH 2HVKB 2D7NA 4P46A 1HKLL 3UYRH 5DQ9A 3AM8C 1WCBA 4LIQH 4RNRB 4ALAH 3ZE1E 5HVHC 3W9DB 1JGUH 2NCMA 1RUML 3MRKB 4YDVA 3HNTL 3ZT5A 1YEEL 4EI6B 1NAMH 1TJIL 1R5IA 4FTVE 1OLLA 1VESA 4JO2L 4Q9RH 3BN3B 2ITCB 2F15A 5IFJB 1OM3L 3P4MA 2XWJA 35C8H 4ORGB 4OQ1A 2WNGA 4LHUB 1YJDH 4PUBH 1WSST 2CLRA 1F6FB 1D9KB 3E2HC 2XA8H 4PV9B 4DUVA 5F93C 1RQ5A 5IB4B 1K8IB 4HIXL 3MLVL 2JE8A 3DO7B 4EN3B 1X5JA 4TNVK 4IM8A 3FOLB 1U8KB 1EO7A 2FGWH 2FX9H 4YHNB 4Z95L 1S7QA 5E7FA 3W0WB 3OGCB 3BDYH 4M9PA 1INDH 5F8RC 2XN9B 1BQLL 4RBPK 3UJIH 2J1KA 4P2CG 1XGTB 1XZ0A 3OPZH 3U36B 4I77H 3DX7B 4LU5L 4EZMA 3IJHA 2GUOB 4UBDD 5DHYB 5L6YL 4J12A 3TPUB 3I6GB 3LN9A 5HGBB 1PLGL 4WHDA 2HLFC 3W9EA 3B6SB 4CMHC 5DJDB 5HGGS 1S7RB 4AT6B 2QR0B 2YC1A 4IRJD 5HYEA 3LQAC 3TWCL 5DJ8B 1HZHL 4NQVB 2ZUWA 2ESVA 4MJ2A 2Q86B 4M5YL 3NFPA 1IZKA 1H8NA 1QLFA 2CK0L 3QXAB 5I30H 1OGTB 4XVTH 3JV4B 4XC3H 4DW2H 3ES6B 4P2QA 4WGVB 3B9EA 4WJ5B 3VG9B 2VXTL 1NGQL 2HTKD 4Y89A 3GI9L 5IMKA 1BVLA 2P5WE 3CFEB 3ZKMD 1P7QD 3D69A 3CK0L 3P0YL 4ODUB 3FCTB 5CINL 1T6WA 5DHVH 5I8KH 5E8OA 3MJ7A 4X7TB 3PNWA 4XMPH 3KPSE 3O2VL 4I3SH 4M7KL 4YPGA 5ICYA 3BN9C 4H0GA 4P3WA 4LPTA 2BNUA 1FO0A 4PJCA 4Z0XB 3CSYB 4XNYL 4OCRH 5E99H 4ACPA 3RUGB 3RPIA 4D0DA 1FCCA 3IDJB 2J7LA 5CWSA 4J3TA 4LLUA 1BJMA 1IKFL 1I1AD 3L3IB 5GS0H 2E9JA 4DKDC 1R0AH 5JW5B 3RWCA 4PJIA 4JFEE 1TTGA 4KY1L 3S98A 4WI2A 3WFCL 5E5MA 5A3ID 3V6OE 2D7MA 3CVHB 4OZFH 1U3JA 3RHWK 2OMNA 1IT9L 1A02N 1HHKB 3DUHA 2FDBP 2AK4A 3QFJA 3GBML 3AUVA 3MRBB 5ESAA 1FL3B 1U8PA 1MI5B 5CD5C 2NNAA 3QHFL 4X9FA 3UTSD 2XNAA 5AUMA 1KCLA 4PJAF 1MPAL 2BJMH 1X7QA 2GFBB 4RGNE 4XNMA 3SY0B 1VFOA 3HMWL 4KJWD 3C2AH 4XCCH 3O3EB 2CQVA 5D96C 5JHDD 3QWRD 4I0PB 1K4CB 4B50A 3TIEA 5HYJB 4YDLC 4ZO9A 1VKXB 4IS6B 2R1XA 4WDIA 1DBJL 3RVXD 4JN1L 3C5JB 3EO0A 4Q9RL 2Z31B 5L88H 1GGUA 2HLAB 4F37F 3GIVA 4QRUA 5T33L 2VAJA 5MHSE 1OTSC 3PGCB 5EO1B 5B8CA 2P43B 3EZJB 1H8OA 4LK4A 5JIIA 1FZKA 4HMCA 4QXGL 4RFOH 2FO1A 4YE4H 1LO0L 4ZAKC 3BGMA 3VD4A 2NXYC 4Y1AD 1FNHA 2IPTL 1F45A 4Y19A 3QDGE 4OGAD 2G5RA 2G75B 3RX5A 2Y23A 5JOFB 1ETZA 1PW3A 4OLYH 4GRLA 4JHAL 4I3RL 1CD9B 2ATKA 4ZO7A 3P9MB 3OJVC 5J1AA 4ZFZB 1NH6A 5DWUH 2C1PA 2ESVD 3QDMA 3OMZA 4JQXA 1A2YB 4I5BB 4IRJA 4HLJA 2D4FA 1AHWC 1NGXA 4OF7A 1UWGH 4KJPC 4Z7VA 4K8RC 3MRIA 4UIMB 4F7TA 2NY3B 3ESVF 5I1KH 1D6VL 1Q1JL 4K7PL 1UYWH 1WFTA 1CTOA 3MRMA 2EDOA 1EDQA 1T83C 3I85A 3FT2A 3VXSA 5HGAB 3V0VB 2IC2A 3MXVH 1X5IA 1CL7L 4PRHE 5C0IB 3VXSB 4FFVC 1P7KB 1YEKH 4ZTPH 3V0WH 3VFGL 3TVMD 2APXA 4JB9H 4LLDB 4HFUL 1NL0L 1TPXC 2PCPB 1UB5A 5A2KH 4DGVH 3KYNA 1Y6MR 3UTZB 4RAUA 3N50A 3IJHB 3KYNB 4IMKA 2E9WA 1GH7A 3T04D 2KZ1B 4MA1B 5CHNA 3BH8B 4GMSH 1XZ0B 1T83A 3R06B 3BX7C 4O2EB 4LLDA 1J18A 3HS0B 2VH5H 3P9LA 5KS9B 4XP5L 2VC2H 1EZVY 4MJ5A 3NPZB 5JW4Q 4PRHB 3HPLB 1U8OB 2X1PA 3GHEL 2DJ4A 3REVB 4KKLC 3EFFA 4GT7A 1Y18A 1FG2B 4QOKD 3LEXB 2DS4A 3ARUA 1SVZA 1O7SA 5GRVL 3EO1B 2XKNB 1ZTXH 5FYKU 5HHOB 4PTUA 4XI5D 4Z76A 3V6ZA 1SY6L 2XWJB 3EO1A 2LFGA 2A6KB 1N64H 3U7WH 1VKXA 3HNVH 3RNKA 1FQ9C 2IPKB 3IDGB 2OTUB 1A4KB 2DWEB 4Z77A 1BZQK 3QG7L 1BJ8A 5DO2D 3MROB 4C56E 5I2IA 3ELAT 1M7DA 2APWA 4PJDA 1S8DA 5EH1A 4E41A 3VMPA 4MSWA 4LCIL 1S9KC 2PETA 4M1GL 1NKOA 4X0KA 4XNUH 1CBVH 4KZDH 1YYMH 3WBDA 4JN2A 5DD5L 4U6TA 1WZ1H 2BXZA 5EOTB 2MHAB 5ETUB 3H7BA 5E6IC 3B6SA 4LCWD 3WFEH 4M4RA 5EUKA 3MRLA 2EZ0D 1IMHC 2BNRA 2PW1A 4M02A 4P2OD 1IJ9A 1NDGA 4XXDB 2A6JB 1OGAB 3JV6A 1K5NA 2V2XB 3VFUB 3SGKA 1OSZA 1MEXL 3REWB 4OUUB 3SEPA 1OQOA 5IVXF 4AM0A 3FAXA 2GCYA 4FMKA 3CZFB 4QT5B 3HHRB 2HN7A 2DQHH 3FFCE 2X89D 3MREA 3JUYA 4R0LA 1HNFA 2IBZX 1JTTA 4K7PY 2DWEA 4Z77B 4J6RL 4Q6YA 4PJEF 3B9KB 3MACH 1E28B 1X5FA 4PG2C 1CL7H 5E8DL 4X6CB 5IJVA 3PNWB 4MA7L 1JRHH 1OF2B 3Q3GA 3WS3A 3GIZL 3X11B 3RKDD 5F1KC 4UIKH 1N2RA 3LRSA 4UT9H 4DJMA 1G7PB 5JNYB 2DLGA 3FRPG 2J8UE 2KL6A 3UXFA 3H6JA 5FAAA 1GVIA 2G60H 4U1IA 1VGKB 1WK0A 2V9QA 3U4BH 3VH8A 5KW9H 3DX9B 2FZ3A 5CWSB 1YZZA 3BD4A 1BGXL 1RFDL 1UB6B 3IF1A 5TDOA 1K2DA 2G75A 4JHWL 5K33A 4BJLA 3N85H 5FGCE 1KTRL 2W9DH 4JRYA 3V6FA 2NLJA 2FO4B 3QQ4A 4YH6A 3DRTB 5IQ7L 3B2UD 1YEDA 2JJSC 3MNVB 3QDGA 5C08B 4FQXD 5FYJE 4KQ3L 3IDIB 3TIDB 5CILH 4KRPD 1A7RH 3MZTA 4ZXBC 3WS6A 2LE9A 1PZ5B 1MAML 1NDMB 2DL9A 4NQDD 2AEQL 4MX7A 5ILTL 4PGEB 2R69H 4OI8A 3PJSA 3LDBC 2D7TH 1KLGA 3Q6FA 3MODH 3P4OA 4P4KD 3RBGA 4LSTL 4HT1L 5C0AA 4OLUL 3FOLA 3TT3L 1BLNB 4YIQA 3OKEB 5HGAA 2QQNH 3V4VH 1T3FA 3O4OB 4WO4D 2FECI 4LRIA 1KC5H 3E3QC 2ZUQC 3OKNB 5HYJD 1KPUB 5LAXA 3BMVA 3RA7L 1FSKB 4G6FB 3VWJC 4GRLC 1F4YL 1YEIL 4PJ7E 3RY5A 4PBWD 1VCAA 2HT4C 3OAZH 4WUUB 2AEWA 2XKUA 4HKZA 1N64L 4IHOA 3U7WL 1AGEA 4FZ8H 2JJWA 4HJGB 4ZNEE 3FZUC 4XP1L 5D7SH 3WNKA 1S7XB 1FFPB 2YD7A 5DS8A 3JWOC 5DMKB 2WANA 2PW2B 1G9ML 5E2WH 4QCIB 3VWJD 1FZJA 1C5CH 3GK8H 2ZOKA 1UXSB 1C5BL 1JHKL 1OWWA 5ESQA 4RIRA 3MA7A 1WICA 2QADD 4KVNH 1OARH 1ZOXA 1JZ4A 2DBLH 4O51A 5J6GB 4P2QD 9CGTA 5BZWB 3TV3H 5CGTA 3IFOB 1IGYA 1J8HA 2HLFD 1XF1A 3O11A 1PKQE 4UILL 5DJAB 4OZHB 1QQDA 5I16A 1TFHA 1A7PL 4OIAA 4WDIB 5C0GA 3MZGB 3MLTB 4CVZB 1BZ9B 4U6VH 4C83B 2X4PA 3EDEA 4OZHE 3EAKA 4Q6IC 1PVHA 2ERJC 3ULUE 4EOWH 5I66A 2QSTA 3HR6A 1QLFB 3MLRL 3BPCB 3EDKA 3DV6B 2PYEB 4MB5A 2W9EL 5DMIH 4LSDA 4D0BB 1AXTH 2H2PD 2I07A 4JHWH 5GJSH 5E56A 5EB9A 2VDPH 2R2EB 5E8PA 4G6KH 5E5MB 3L3HA 3WO3B 3CXDL 1L6ZA 1OW0A 2ADJA 4EUPA 1IAOA 2ERJB 4H1LH 4WO4B 3KYMB 3U36A 1QRKA 1QFUH 3GSXA 4WUUE 3VRIA 4PJ7B 4BSVA 4YK4C 5BS0A 2Y06H 1CTNA 3IDJA 4JFQB 1T20A 2A6DB 1MFEL 2BSRB 3MRQA 3TBWB 4K3DH 4PBVC 2D31B 1B6DA 4HBCH 1S9WB 2QQKL 4FQQB 4ZTOL 3C60A 2WBWB 4L4TE 1FFRA 2JJVA 4PJBE 1UEMA 3EJJX 3BH9B 1F97A 2CSPA 3V9FA 1I8KB 5ICXA 1K6QL 5FK9A 3K1DA 3LIZH 4LPCA 3SDAD 4A6YH 1YPZA 1CXHA 2EC9U 4XTRD 3IU3A 1KTLB 1Q9OB 1V3MA 4JZJC 4LNVA 4WW2C 4ZOAA 3QXDB 4GRLB 2WSKA 4YXHH 4RISL 1KT2A 4N5ED 5H35A 3FHAA 1B9ZA 4KUCF 3UJTL 1L9NA 4ZUTA 4M7LH 2BX5A 5MEQA 4LCCC 3MV7E 4LLQA 3T0VA 3MJGX 4RGMB 3LHPH 1EVUA 5ICYB 1UWXK 1JPSH 4OUOA 1N5AA 1V05A 4L8DA 4MMZC 2CUMA 4XX1E 1QFHA 3G6DL 5FEBA 4N0UB 2VDMH 4CKVX 2X6MA 4X6DF 4RX4A 5EC1B 1FDLH 1BOYA 2WK2A 1P4IL 4DZBB 3MOBH 4MZ3A 4J3UA 1J11A 3BRGC 4Y4FC 3U9PL 2O5XL 3G5VA 3FFCA 3UAJC 4B7IA 2A1WH 1PKOA 1D5ZB 2VXUL 1BREA 3LKQB 3HAEH 1MHEA 3AS1A 1KFAL 3MLRH 1D9KA 5GRUH 5BQ7B 3BIBX 2YPLA 4J4PC 4D9LL 1W72L 4OLWH 3HNVL 4KROB 3MLWL 4IOFC 5CIPB 5EU7C 3QG7H 4WW1B 3CFJA 4I77L 5DVKA 1G1CA 3OKYA 1CE1H 3I50L 3JTTB 4FQJL 5ALBL 3H9SD 3GI8L 3EKCA 1J0IA 4LCIH 5D1ZA 2IADA 3S4SA 4ESKA 1P84K 2VABB 3K46A 3TBSA 5I1HL 1FO0B 2DQHL 3E8UH 4W6YB 1OP3K 3ZL4H 4EUPB 3QIWC 3G5ZA 1CQKA 1DN0A 4QHMB 4M5YH 5MEND 1RULL 3VXUE 5AZ2L 2MSPA 4JM2C 1Q9WB 2ZUTA 1FP5A 3L7FA 3O3DA 5IW1A 3SKOB 4F80A 1WEJH 3GMQA 1CIUA 1FJ1B 1OAQL 4S1RH 5B22A 3LZFL 1X4ZA 5IFJA 4M1DL 1SM3H 3LEVH 2CR6A 3L3DA 4R4ND 1WT5A 2GSGB 5FYLE 4LLWB 2C3XA 1OCWH 5CJXA 3VRLF 4F9PC 2JCCF 4S1SL 5CSZB 2OI9C 5F1NA 5DD1H 4M6OL 1T21B 5IEKA 3LEYH 1A6WH 4A6YA 4U1KB 1KV3A 1U2HA 2YRPA 4CN1A 3JUZA 1T7ZA 2HVJB 1RZGB 3F7PC 5IG7A 1NC2A 1I8IA 1FH5L 1LEIB 1HILA 4TUOA 3L9RA 4HUUB 2IBGA 1FN4A 4HPYL 1QLRB 3CFCL 1Q94A 3VD7A 3QPXL 3MYJA 2XN9A 4KY1H 1DVFC 4K9EC 4ODHH 5IP4A 1NAKL 1U8NA 2QLVB 4Y2OA 5GZNC 1Q94B 4ZNCD 4TSCH 4MJID 2NTFB 4JG0L 2A6JA 4WHCA 3ZHKA 4DEPC 3PWNB 3WE6B 4WEBL 1R3KA 5GSVA 2EXWC 4H25B 4PB9H 3KPNB 1G7IA 3CVHH 3DIFB 5KVFL 1JIBA 3HZMA 5EU6E 4RDQG 2Z35A 3G04A 3VXSE 2R39A 2DI8A 4WNQA 3BVNA 4BQBA 4LSSH 3PWLB 5IB2A 1MRDH 4PJ9C 1CYGA 5DVMA 3EDDA 1OB1B 4MAUL 4ZQKB 4LRNL 5IVXA 4R8WL 4JFHE 1IAKA 3S88L 3JWOL 1BVZA 4PJXB 3RL2B 3LKNB 1QBLL 5IOPB 2H32A 3LS5H 4NCC1 3QCTL 3TO2B 2AABL 4FRWA 2D9CA 5F9OH 1QR1B 1MCWW 4O02L 2B0SL 2R0ZH 1VEMA 1IAOB 1NPUA 1D5XB 3RKDC 4HS6A 1IILE 4DOHB 3T09A 1UJ3C 1KJ2A 4GXUN 1FNEA 4QXWA 2Q20A 4L9LB 1PQZA 4AEHH 3BP6A 4ZSOA 1OQXA 4FP8H 3WDIA 1T66D 4M03A 3GSRA 4MNQA 5C0EB 5JLZB 2NY3C 4P5TC 4PJHA 3LV3A 4DWHA 1OY3B 3DJ9A 1BFTA 1D9KD 2LQRA 1AKJD 4HIIB 4UZGA 5EU6D 3WSQH 5FM5O 1ES0B 2K7QA 3S37X 4P23A 3O0RL 4TNWK 4OGXH 3BWUC 4QHUB 2P1YA 4ZQKA 3V8OA 5C3LD 5F6IB 1QEWA 3WS3B 1B0RB 5H2BB 1F58L 3MRNA 4KDWA 3VWKC 1TQCC 4QHUA 2GK2A 1J5OL 4WNQB 3VXTB 3T77B 1MCPL 5ADPH 5D1QD 1JPGB 1ERNA 5BJTB 3PDGA 3WJLA 4HGMA 4BZ2L 3ZHLA 1PEZA 4N8CH 1FH5H 5DRZB 4Z7UF 1IM3A 2CIKB 2AXHA 3MRDA 2Y06L 5F88B 3GMNA 5D70L 2YD4A 4WEMB 4OFVA 1KENL 4DCQB 1MJ7L 1CR9H 2Z31C 1BECA 4X6FA 1XEDA 1J0ZA 1XGYL 3UEZA 4GKZB 3LY6A 4U2YA 3ZE2E 1I1YB 1QBBA 4Z7UA 2RFXA 3HE7B 3OJDB 4OCRL 1NMCC 5IMLA 3BXNA 1A7QL 2FYYA 4LFHG 5FDWA 4JDTL 4S2SB 5D7IF 1RJYB 2CXKA 1AE6L 1S9VA 5KSAD 2AJYH 3VWKA 1EFXD 3OKDB 3RU8L 3BKJH 4R4BA 1LVEA 1EJOH 4HIHB 2AXGB 3GNML 4WUUD 1QYGH 3VXUD 4FMFA 4GQ9H 3ARDB 5C0ND 2Q8AL 1JF1B 3RVTD 2X09A 1XCTA 3RWDA 3FO2B 5E99L 3QUMH 3TA3B 1D5MB 1EEYA 4AIZA 2ILLA 3C60B 4JKLA 1MRDL 5I73C 3HZKA 5HYJA 1QBMH 1K3ZA 3Q1SH 5GS2D 1CFNB 2DWDB 4M1GH 1UM4L 4HWZB 4PJFF 1FL6B 4XCCL 3LMJL 3P11H 4R3SA 2GYSA 3I75A 1RV6X 3PWPE 4JFEA 2Y6SD 3S4SB 3V5HB 2P24B 4NHUB 4C54A 1T20B 1S7WA 1U8LB 3Q0HA 4S1DC 5E2JA 1LEKA 3CZJA 4OB5H 2VQTA 4XVUC 3QJFA 1B4JH 5EZJA 4LHUG 4U1HA 4CADB 5IB5B 1E4KA 2X2YA 4RMRA 1JPFA 1ZLUK 3G5YB 5KG9A 5CJXC 1JPSL 3W0WE 1LP9E 3L3KA 3BUTA 4GAGL 3HI1A 1N3NB 4JKPH 3GMMA 1TTFA 5HGDB 4HS8H 1IT9H 1GC1C 1JNLH 3T0EB 4D0DB 4NFDA 5CEXB 1YEJL 3BAEH 1JHLH 2HT3C 4U1SA 2OR9H 1T5XA 1G9NL 1YQVL 4KKCC 4PR5B 3T2NL 1EGJH 5GQBA 1XIWA 3IDGA 3KPQA 4PJXE 2A1WL 4HXBH 4P0DA 1YDPB 5I16B 2F58H 4XMKL 3FCTA 2EDDA 4MS8D 1V7ML 3RY4A 3KPRE 3U9UB 1I1AC 5K9JH 4RQQA 5TH2A 2E3VA 3EO9H 5K9KA 2R23A 1L0XA 4ZUTB 1NFIA 1ZVYA 4XPAH 3WUWA 4EQ3A 5E9DA 3BKCL 4IMLA 4IOSD 3RZWA 1KT2B 4TTGA 2H1PL 4LGPB 3FQWA 5DYOB 2YD9A 4P48A 1YY8B 2VDOL 3GMLA 1AP2B 3IU3B 1XGRB 2G60L 1TDQA 5A1AA 5I1HH 3NTCH 4YLQT 4J3VA 3A6CL 5D1XA 3UZQA 5IT2L 3T3PF 1Q0XL 2IAND 4HZLB 4HUWB 1WT5C 3V5DB 5IVXB 4Y4FA 5DQJA 3D1MC 1U0QA 2AJUH 2W9DL 4LVHC 5K9QG 1KCKA 1LO3L 3LKPB 4M3JA 1NCCL 1I9IL 3DARA 3F6LA 5JW3L 1J87A 3LKQA 1ZT4A 2I26N 5SWSD 5IW6A 1FVDA 3WHXB 4OF5A 4HCRL 4I9WD 2EKJA 4JDTH 4CMMA 5HVWA 1ZHKB 4X5XB 2CDGB 3AREA 2P8LB 5CGMA 1A5FL 3OKEA 2IAMA 4R0LB 5B39B 3AMKA 3HC4L 4J3OC 5C0AB 3QIWA 2P8LA 3QAZC 4E5XA 4PGDB 4M6NL 1FL3A 3QUYB 1HHGA 3EOAB 1MFCL 4U1MA 2E9IA 4Z8FL 1FZMA 1MRCL 4LRIC 5KSAB 1UH4A 5LGJB 1R3LA 2SEBB 4M61A 5GIRA 1T04B 3X13B 3MRLB 1DR9A 1N6UA 1KN2L 4EVNA 5H37H 1KYOJ 4NC1E 4EI5D 4PJGE 4KZEL 1C7SA 3UDWC 1SEQH 4LDOB 1YEIH 1TENA 2ITDA 4NN5C 5GS1C 4EKXA 1NANI 2JK5B 5EBMA 2R4SH 3HNSL 4PJCF 2EYRB 1WFOA 3RKPA 5GGTL 3D39A 3MRFA 2HYMA 2IAMC 2ICWA 1I3RB 3RHWF 35C8L 1B4JL 1JHLL 3WL9B 2AABH 1G9MH 2ENSA 5E2WL 3CFDA 1MCIA 4X4XB 1N26A 1N5YH 3BGAA 4HHAA 1XR8A 3GJFB 3RNQB 4PLJD 5DVOA 3WN5C 3B8SA 1OARL 3NN8B 3CMGA 4OD2B 4KI5D 5CGYC 5C2UB 5I18H 3SDCB 5L0QB 4GMTL 2F5BH 5LQBH 4N1HB 4HV8A 3BDBA 1V7MH 3KPMB 3KLSA 3SKMB 5DMIL 1C5DB 4R7NA 3MOAH 1I9EA 5D7JC 3MJ9H 4GQPH 3HE6B 2XQBL 5BXFA 3GJEB 1UKTA 1CT8A 2BDNL 1C12A 4E0RA 3IAGC 1NBVH 5L6YH 2UZIH 1KF9B 3A6BL 4R26L 2PW1B 2V2TA 1IARB 1MNUH 4OV6F 4EVNB 5CIPA 4YHLL 4HS3B 4NBXB 1ZEAH 2PF6A 4QOKE 3KYOA 5EO1A 3C09B 4FXLA 2LABA 4NDMA 4KK6C 4TPRL 3MRJB 1IZJA 2Q87A 2Y72A 4U1HB 3RDTC 1T5WB 2ZKHL 1AXTL 3UAJD 2IANA 5E8DH 5TE6L 4LPWA 4LSQL 1QPPA 3ARBB 4MSWB 3MRHB 3SO5A 1P69B 1F4XL 5EZLA 5IQ7H 1JWUA 5GRVK 1ED3A 3FB7B 3EOYG 4GH7B 3QIBB 1BLNA 3HMXL 3M8OL 4KHTL 4KK6D 5CJOL 1CXLA 4HBQA 2DBJA 3CAFA 5GGVL 4YJZL 1FYTA 1P5VA 1UM5H 2A83A 3VFMB 1JWSA 1BF2A 2VLKA 1F02I 5HHXL 4D9RD 2R69L 3VXMA 3RX8A 3EGSB 3JWDC 4Q2ZA 4U6HA 2YBRA 2BVQA 4GRWE 3FHQA 4ZPVA 1TZHB 5EPMA 2FEDC 3FO2A 4NM4H 4NUGL 4HEPG 4IJ3C 5E5UB 3MLZH 2APTA 3RIFK 4ZNEA 3T0EC 1DQTA 3C9NA 1B88A 1AXSA 3VGBA 2GEEA 2EZ0C 2F53B 1EHAA 1J12A 4XBPB 1KBGL 2XFXA 1KTDA 2VISB 2GKIA 2AQ1A 4Y16D 2RFXB 3KYOB 1RZ7L 4XI5C 4QF1A 4P2RE 3TNNB 4ZUWB 2Y36L 1MRFH 2X5PA 1M71B 1SBSL 5DRXA 4OFKA 5JPMA 2PN5A 4MDIB 2DICA 4YQXL 3ZKXC 1BQHG 3Q5OA 2VLKB 1L6XA 1FORL 1T66C 1K4DB 3C2AL 1GIGL 5ANMB 1HH6B 1MFBL 1W0WB 4NBYB 1MHCA 4XNMB 2IGFH 1KB5A 1ZS8B 3LB6C 4PG9B 5DHVA 1F11A 3FQUA 3GUTA 3AREC 1OSZB 4X8XA 1RI8A 4PV9A 4FNLL 4YEFA 3V4VL 4UIMA 1WIUA 4V2BA 3HC0B 3UTPE 1JF5A 3HZYA 4LLVB 3MNZA 4ORGA 4OLXL 3RIAK 3JV0A 2E6JA 3KJ6H 3L3HB 1KSRA 2IF7A 1XF3A 4CADA 4DZ8A 5DJ2A 3UROR 2CIIB 4U49A 3QFJD 3P30L 3QCVH 3VE0B 1E0OB 5LWYL 2R1YB 1GAFH 5JOFA 5HSFA 4RDQF 1I1RA 4Q0XL 4XBEL 5B21A 4L8CA 1XF3B 4QXGH 4RFOL 5IF0A 1A64A 4KWUA 1MCNA 2VL4A 5HI5C 4X6EA 2P42B 3WO4C 32C2B 2QL1A 5C0GB 3QUXD 3QUXA 4JFFD 2NY4B 4JO1L 4ZPTB 3OKMB 4ZFGL 3O41B 2F53D 1A6ZB 3DLQR 4JKMA 3BW9B 1GGBL 3HI6L 5IJKA 2P47B 3D3VA 4LKXB 2E6QA 3RNQA 5HHXH 3D69B 3FQNB 3C8HA 1KCSL 1S7VB 4HH9A 1JWSB 4DAGL 4B41A 3LEXA 5IIEB 2H32H 2Y9RT 3ARZA 5HI5D 1MCFA 4I0PA 1RIUH 1FE8L 1T4KA 4GG6F 5FYLH 4RIRB 4G5ZL 1TQCB 4NZTH 3ARQA 2FR4A 3ROLB 4BFIA 5ACZA 2XICA 2AEIT 5EOQL 1TQBB 1U8PB 4F33B 2FRGP 3QRGL 4M5ZH 3CC5B 5BCAA 5I1KL 3BJLA 4HPYH 1A47A 4LOUD 1PD6A 2EO1A 1P53A 4PRHD 1WC7A 1F6AA 1C16B 4RAUB 2VWEE 4NM4L 4NUGH 2SEBA 1YEKL 3CLEL 3UTPD 1TXKA 1E4KC 5HHNB 1BM3H 2B5IC 3C8KB 5DVLA 3FO1B 2YD1A 3THMH 3GMNB 4TVPH 1HWHB 1N0XL 1QFOA 4N8VG 4KGJA 2DJSA 2Z9TA 2DN7A 5L2KE 1RZJC 5C0JB 1RJLB 4X7DC 1PEWA 4I3SL 2VUOA 3O2VH 3OAYK 3EYOB 4MZ2A 4ZO6A 3WFCH 3SE8H 4FQXC 3VXNB 1NCBH 4TSAH 1WZKA 1MRCH 1FCGA 5LBSL 1IM9A 4X7SH 3JTSB 1IQWH 3MOBL 4HHAB 5D1XD 2XWBB 3CXHJ 4ZPTA 1ZLSH 3EFDH 2ENYA 2VXTH 5TDPA 4BA8A 1MFAL 4I5BA 2O5XH 1AGDB 5DF0A 3EYSH 2NY7H 4I48A 1G6RL 3BQUB 4NQCE 3HMWH 1FIEA 1YNKL 1KFAH 3MBXH 3PGDB 4NQEA 5IHBA 2W07A 4YX2H 2IJ0C 3O2WH 3UTTD 4X4ZA 3KJ4B 3DV4A 4U6XA 5J13C 5L88L 5INDB 5EU5B 3PWUB 2D0GA 5JORB 1JK8B 1HQRB 1X9QA 3MXWH 3RAJH 5F9WB 2OSLA 4BH7B 1MLCA 1D5XA 3UTZA 1QBAA 1FV1A 1OT2A 2YK1L 1KTKE 1LO0H 2VYRE 4LEXH 1U3HB 4Y4KD 2Z31A 3KPLB 2M1KA 1KLFA 4PJHE 2BNRD 3X14A 4LEOB 4MDJB 4ZUSB 5ALCH 3VFRB 3QJHA 3GBNL 4ZSOE 3O3BA 4MJ6A 1T5XB 2C9AA 3VRLE 3L5XH 4NJ9L 1A1NB 4N90E 1U41A 1JWUB 2VQ1B 3FT2B 5AZ2H 5DD3L 5CP3H 2ICWJ 4IRJC 4K2UL 3WHXA 2FBOJ 4RGMC 2Z4QB 1KPRA 1NFKA 3BZDA 5H94A 5GRYA 5ALBH 1AI1L 3VI4F 2FX8L 3A6BH 4R26H 2XQYK 4FTVB 3WFBL 3S34H 5SWQA 4N5EC 5T5NG 1HYRC 3B5HA 3OAZK 5I18L 4YHLH 2BCKB 4OZFA 1NGYB 3B9DA 4ONGL 4BELD 1TVBB 4WY7H 1CDHA 4KRMB 3OKLA 4ZXBA 3V7MA 1T89A 1KCRH 3TJEL 4P9ML 2CK2A 3VFGH 1WBYB 1OAQH 2CJUH 3CMOH 1ZHBA 4LCCB 5EBGA 2GTZB 1ZA3B 1A21A 1A7OH 3HE7A 3HI5L 1KJ2B 2E7MA 1JBJA 4OJFL 4OLYL 1R5WB 1CI5A 4YDKH 5ITBH 4GKZA 1BEYL 4ELMB 3MFFB 4APQA 4XPBL 1YEHL 1YUHB 5DFWH 1KIRA 2VERN 3BZ4B 3CXHK 4YK4B 4F8QA 2DL2A 3MO1A 3D5OF 2VLMD 4UDUB 1I3RA 1AGCB 3UTTB 4MS8C 3O3AB 5IMOA 1A7RL 4LASL 4Y5VB 1KC5L 2AJYL 3ARFC 5J89A 1QBML 3Q1SL 4LKCB 3RA7H 3BD5A 4H20H 5DURB 5EU4B 5I1JH 5E8NA 4IIQB 5HYQA 2JB6A 1KB9K 3BOVA 2QKIA 3O3DB 4NZRH 5IW1B 1Z9OA 2QSVA 3CCHA 1SQ2N 5DJXA 4G8GD 3SGKC 1JWMB 1KEMH 3MNWB 4JM2F 4DKEH 3GRWL 4PRPE 3A67L 3FTGA 2MKWA 4X6FB 1I3GH 1CD0A 5KSAA 3ULUD 4X99B 2VZVA 2BNRE 3GSQB 1RUAH 3H9ZA 3DMMA 4MAYB 5DRNB 3HAEB 4X4YB 5HDBF 3HNTH 5BOZG 1PX3A 4PJGF 3RUGA 5DGQA 4QTHA 3BO8A 3V4PL 2GY7B 1CK0L 1JMZA 4KZDL 1Q9KA 2IALB 5H37G 3KLHD 3PHQB 4OSUH 3WCYA 1B0WA 1A1OA 1N4XH 5JPNB 1NC2B 1F4WH 3FN0H 1XR9B 1A7PH 4UAOB 2GAZA 3C6LB 4S0TD 5E08L 2IQAA 3G6AA 4LIQL 4JZJB 3MJ6A 4WW2B 4IDJL 4C4KT 1IGCL 1QSVA 2QHRL 3BEWA 1S5IL 3WXVH 4LKCA 4ONHB 4HIXH 1K9TA 1UCBL 3F6IA 5FO7B 4K9EH 1ULVA 1YYLH 3FFCB 3BKMH 5F7EH 2F58L 2ICWB 4XMKH 5J56B 1VFBB 2FGWL 4KQ4H 5IOPA 3L3DB 2ORBH 3RWEB 3V4UL 1IEAB 1X44A 4W6WB 1X4XA 1R24B 4OBRA 3MLPA 1U8IA 2IEPA 1FC2D 5AYQA 3BPLB 3NZHL 3CVIL 2VKXA 1XF2B 1AQKL 1I1YA 3EOTH 1TZIB 2YMXH 1WQVT 2ADGA 3GMPB 3KHQA 3VH8G 3NTCL 3CDCA 3AU1B 3FMGH 2VSDA 3DNKA 4JFZH 5C09A 5JXED 3OL2A 1JYVA 1T2XA 5CJBA 1F42A 3MYJB 4FP8L 5JHDB 3SKJL 4P5KB 1OAYL 4QTIL 5FUCC 5FKPA 3UX9B 5FA4A 1A1MA 4NJAL 4PBXA 2X70A 4HCRH 3BPOC 2DM2A 3T77A 4ZD3H 4OZHF 1IFHL 3IFNH 2YXFA 5TF0A 3SGJA 1I8MA 5C0DA 1HNGA 2WIIB 3OKOA 4NFBA 3AB0B 5DI8B 1EEYB 3U4BL 5DQJB 3UYOD 1IC4H 2W38A 3GMOB 2Z4QA 5ECJE 3PWJA 3MBEB 5L8LB 1I7UA 1F58H 3GSUA 1PG7L 1VPOL 3V0AC 4OZIE 4DUWA 1OL0A 1NCNA 5IMOB 2C1OA 1F2XK 3GIZH 3WLWD 2P5EA 3AM8A 1E4WL 1YPZE 2AV7A 4XHJC 2RIKA 2I25N 2YD3A 1A0QH 1AGBB 3A67H 3S5LG 3THML 1U8LA 5B3JE 5C09E 3PJSB 3T0BA 1U6AL 3LKOA 2GT9A 5I8EB 3NIFE 4N9OB 2X1QA 2DQEL 5DGRA 3S37L 5HDBE 1PQZB 1HXMB 3LMJH 1TZIA 3BPNB 1CFNA 2DWDA 1YN7A 1QSED 3LKRA 2EH7L 1DBAH 4N9GB 3SGEH 1CU4L 4LCCA 3T65B 1K8DB 4M7LT 1AD9A 4TRPL 3T2QA 3KJ4C 3U4EB 5F88A 3D3VD 5DEZA 5BS0E 2DKMA 4NRXA 1AE6H 3DX6A 4P2QB 3SE3C 2VLME 3IRZA 5JR1H 2BVPA 3IXAA 1MIEL 1X5YA 1WV7T 1I7UB 3QHTC 3I2CH 4OT1L 5L2KD 3FO0H 1J9CT 3KPTA 3O2DL 1I8KA 5ICXB 5M94B 4XVJL 5D7LB 3VXQB 3MLXH 3GMMB 4TSAL 5FB8B 4BSWA 4MXQD 4PJ9D 4X4ME 4FFYL 2ZJSL 3BSZH 4KVCL 4K3JL 3W9EB 2HT2C 3IS1X 4UOJA 2WP3O 1T2QH 2BOBA 2JJSA 3BWAB 4O5LL 3PP4H 1DUZA 1GGIH 4NYLB 2JCCB 1TVHB 3SBWC 1AR1D 4M48H 3RDTA 4TYUA 3LDBB 5EZJB 4I2XA 5DTFB 1FBIH 2DI9A 3QPQD 2O5YL 4WTZG 1CFTA 1QLEL 5LGHH 3IU4H 5DTFA 3NCEB 5FHAH 4GO6B 4P2RD 1MREH 4JR9H 8CGTA 3K81A 2VJXA 2XKSA 1QSEE 4NKQB 5T3XH 1S7TA 4H88L 3B5TA 2OL3H 2FX8H 5LCVL 5GRWA 3MV8A 1JUFA 1D7FA 4HKBB 5ALCL 1FNGA 4NC0B 2PXYD 5JUEH 2VR9A 3E3QE 5IR1A 1A1NA 5BVJA 3I3EA 4RFNC 2J4WL 4ONOA 5IWLA 2I60L 3N1PC 3P9WB 3STZB 1Y0LB 4HK0A 1VPOH 4JM4L 4C83A 1PFCA 1KLUB 3Q6FB 4AK1A 4L3ED 1HXYA 5IIEA 3FRUA 2H8PA 1S9VB 1IC7L 3KWWA 1QFWL 2Y5TA 5E8EA 3VWKB 4ZPVB 5FM8A 1Y6KR 5T1DH 4LVOC 1S5HB 2OJZH 5E2VL 4QXUL 3AS3A 3WFDH 4AENB 2A0LD 4HG4J 3RZCC 2XKNA 4XRCA 3IFOA 4BZ1H 5DD0L 1YC8A 5LXGH 5CZVL 3ZKQD 1YMME 4XPGH 3VGHA 3SGDH 5MERA 4NKDA 4NKIH 3QEQD 3PWUA 4PYGA 3GHBH 4XCEB 5ISZB 4G8IB 3S5LA 2YUWA 4M6OH 1GYAA 3BO8B 3RIFF 4ZTPL 3V0WL 4G80B 4MLIA 4HX1B 4JB9L 4TUKL 4G7YH 4L8BA 5C09B 3GSQA 2HT4D 5FGCB 5F7NC 4I2XB 5SWZB 4HF5L 4U05A 5FM4A 3VH8B 1EK3A 1YPZB 4MVBC 1TETL 1UFUA 1UQSA 4HZAA 3LRHA 4RRPA 1DJSA 2V2WA 1R0AL 2OX5A 4KKCD 3L1OH 3ZDXE 3T3ME 5ICZB 4R4FH 2WBKA 1ZHLB 2WWKO 1MCOL 1MHEB 1FL5A 4XVJH 4Y4HC 4JG0H 4PREB 4M3KB 1RZ7H 4N1CA 1S78D 2VOTA 4YEEA 1PX4A 1EAPB 2ZJSH 1UQSB 4KVCH 3GBMH 3QFDB 4FQ2L 2D31A 1MVFA 1H3VA 5FF6B 1ACYH 2Q8BH 3KAAA 4MJIE 1GGIL 1W0WA 2X42A 2BC4A 4OGZA 4ELKB 2B1AH 3MRMB 1BZ9A 3UZEA 2FGZA 5BMFL 3TH4T 5EBLA 3KNBA 2FIKA 4DN3L 2VDRL 2W91A 2EE2A 3OXSB 3WLBA 3VFWB 4LDEB 1MY7A 4BH8A 3IU4L 1DBJH 3KPOA 2ZUYA 1OT1A 4N0YL 2BOCB 3MFGB 2XI9A 1JGEB 3ALXA 5T33H 3HG1A 3MJ9L 2ICEA 2MHAA 4O00A 2I07B 2XFXB 1BD2D 1ZA3A 3MR9A 5EU5A 4XBEH 1QSFD 4PD4K 5FIEA 4IOIA 3OJMB 3CPLA 4QTHB 3QQ3B 1ZVHA 2XPGA 3IKCB 4XP9L 4YPJA 4YHOH 1FZOA 1M7DB 1KTLA 1Q9OA 4UT6H 2VLLB 2NY5H 4M7JH 1JTOA 4JAMA 2I5YH 4JN1H 4XX1G 4Y16A 3V4UH 4AL8H 4L4TA 4D8PA 1FJ1A 1NLDL 5ID0A 2OCFD 2R2BB 3V6ZB 4Q2ZB 5C9KA 1DANU 1BBDL 1I8MB 3OHXB 5HHQA 4OM0H 1R3IL 3SN6N 4M43L 5EOQH 3O9WA 3O6FA 4E41E 1RIVL 3AB0C 5LXGL 1U8OA 3KS0H 4C56A 4Z7WF 5FA3A 2IAMB 2HWZH 4K3HA 3KS0J 1PBYA 4JPIB 1CFQB 2NNAB 3P2TA 5DUBB 3PQYE 4KV5F 5EU6B 2XYCA 3MC0A 1WEJL 2FBJH 2XG4A 5HDQH 5HHVH 4NO5A 1U91A 1FFNB 5HDLA 4P3CH 5EG6C 3NIFF 2WMPA 4Z18A 2NLJB 5ACLA 5DQDH 2HFTA 4L3EB 5INDA 1WBXA 4KI5E 3ULUC 4P9HH 1IGTB 4ZAKB 4TPRH 3C08L 3ARWA 1WISA 5EA0L 5EIVA 1ZLUH 3W81A 1RY7B 4Y2DB 3I9GH 1T1ZA 4KHXH 4K3EL 2FZ3B 1J8HD 3AC0A 1N8ZA 3QDAA 5TE6H 3ULUL 2LV4A 2X9WA 1VFBA 4CMHB 3GRWA 1RZJL 5JO5A 3JWDH 5JTWA 3D0LB 4Z7NF 1E6OH 3O6KL 4GBXB 5JDSA 3VFSB 3QCUH 2R1WA 5D72L 5CJ5A 2GITA 3D3VE 3JTSA 2BHYA 3EYUL 5DRXB 5M95B 1D5BB 2OQJB 3BJ91 1NANH 4LNRA 2GITB 5GGRY 3WXWH 4A2MA 1WZMA 4I0PD 1YEGH 4DK3A 2IG2L 1BZ7B 5EBWA 1Q9LA 1HHHB 5K93A 4LLAA 3BIKB 1MHPL 5I1IH 2Q6WA 1HCFX 1QUNA 2R1YA 1KGCD 1X5LA 3B5GA 3CFKB 3E2HB 1TTUA 5FCSH 4Q9QL 2OL3B 3D2UA 5FO9B 1MQKH 3BN9D 4XZUB 1C5BH 1JHKH 3J8F7 4NPYB 2DQEH 4MA3B 4YFLI 5EC2A 4MB3A 5J0BA 3KYKL 1LILA 1VEOA 5T3ZH 1TLKA 2JLLA 3HUJE 3S36X 5GGSY 4PLJC 4JO2H 5EC2B 2JELL 1NEUA 4NO5B 4EBQL 3HE6C 2PR4L 4OCYH 1UM6H 3DX8B 1JZ6A 1HHIB 1II4E 4L4TD 1CLCA 1I1FB 1LMKA 1DE4B 3ARGB 3FOMB 2IH1B 4V1DA 4PY7B 3GKZA 2VE6A 5IM7A 3LQZA 5F89A 3VRJA 5JXEC 3D39E 4OFDA 5IESL 2MCPL 4PJXF 1CFVH 2O5ZH 3HLAB 4NQCD 5CLTA 2FD6H 1CCZA 2HG5A 4LSRL 3KLDA 5FFLA 3FO0L 3UDWA 4Y5VC 3FOMA 2I5YL 1JP5A 4ZMAT 1EEQA 1ND0A 5D1QB 2ATPB 4LHUA 4Z76B 2B20A 2V5YA 5GJSL 3GJFA 3L6FA 1IGYB 2OJEA 3TJEH 4HC1H 3OAYH 3NCJH 1FG2A 1P2CB 1AIFB 5HHVL 4YAQB 1HEZB 3OR7B 4XP6H 5FOBB 4MA3A 4X7FC 4JANA 1NGPH 2XZCH 4MD4A 4C4KO 4M93B 1GOHA 2FX7L 1RK0B 2AJVL 4OI9A 1UB6A 3IF1B 4X9BA 3CPLB 1INQA 3PQYA 4Z0XA 5E7BA 3NVQA 2UVEA 1JI1A 3UJIL 1FZKB 3S8WA 1C16A 4BSJA 5BW7A 1G0XA 2OK0L 1DVFD 4UIKL 2DKUA 3LAFA 3QXUA 5EU7E 4LMQI 1RK1A 3H0TA 3VMOA 4Z5RB 4L8SB 2CLZB 2R2HB 4HK3J 4G7VH 1KPRB 4KTEL 3CFDB 4OD3L 5JPNA 5C0AE 1F11B 3S9DB 4P9HL 2C4XA 3W0WD 3NH7H 4Q6IB 1I9RH 3NABL 1WF5A 1T4KB 4K3DL 2HRPL 3QFDA 1YEGL 5F70A 3LPWA 1IAMA 3REWA 4PJAA 3KPSA 1N6VA 1G0YR 4LF3A 3MRIB 4I2XE 3BW9A 1ZGLA 3OR6B 3PV6B 4N8VB 4XPTL 3VD3A 2HKFL 1D6EB 5IWLC 4JFFE 4JPKL 1T04A 2E7LC 1OTTD 3CFBB 1U3HC 4L4JA 1VFAA 1DLFH 5KAQG 2CUHA 1KPUA 2UY7A 2X40A 3GSNA 4EIGB 2VDQL 3GMLB 3QJFB 1FZOB 4L8BB 3CFKA 4CN6A 4IMLB 4X7SL 3NCCB 4LGRB 1KJ3H 3S5LB 3BP6B 3C60C 1KIPB 1ACYL 3QFJE 3CSBA 4JO4L 1A7QH 4PJCB 2R23B 5DJ2B 1G6RB 1GSMA 1M4KA 2P8MA 3KPRB 3GK8L 3EYSL 1FNEB 5I8CA 1IC5L 3LH2H 4YPGB 2V17H 3QI9B 3VI4E 4HKJA 4NO3B 4NQDE 3KYKH 1P1ZB 4O58L 5DC4B 4G43B 1RJZB 4KQ4L 3O41A 1LDPL 2L7UA 5FUZL 4ODXA 4EBQH 3DXAB 3RWDB 3RBSA 1NQBA 4IRJB 5F7LB 1CGSL 3SCMB 1IQWL 4K94C 4WUKL 2BC4B 4ELKA 5DD3H 2HTLD 4R90L 2HMID 1CE6A 1YQVH 4ALAL 1UJTA 1CD1A 1QSEB 3W11D 5HHOD 5DJ8A 3G6JF 1NGZB 2YPKA 2CKBB 4Z0BL 1T80A 3B2UC 4JKPL 1ZE3C 4PY8J 2I9TA 3O81A 4XNQB 3CFBA 4WY7L 1KJVB 2BCKA 4K7FB 4M61B 3QUZC 1HHJA 5IB5A 1DDHB 5EOTA 2R0KH 4XBPA 2YZ8A 4Y5YC 1GPOH 3NCBB 2R0LH 2CRZA 3TBTB 3H2WA 1FGVL 1SBBA 3KPPB 4B53A 5KVDL 5C7XL 4M7JL 3U46A 3GJFH 2X4NB 4OZ4B 1CLOH 2BNUB 4MJ6B 5L9DH 4I3RH 4D9QE 2CDGA 3AREB 1OAZL 4Z78B 2MNUA 4HULB 1XF5B 5ANME 5E0QA 3WKML 1MIMH 1IRAY 4PGEA 1KCRL 3JV6B 5GGQL 1A6WL 4GKSA 4MMXC 4FQXB 3SJVD 2VC2L 3VG0H 3OKMA 4HFUH 3AS0A 3I3BA 5DD6A 2R8SL 1G6VK 2ITCA 3FRUB 2A83B 4CGTA 4HXBL 3WL9A 2VIRB 5D1XB 1A7BA 1S78C 2W60B 1Z9MA 4QNPE 4LPYA 3HPLA 3E6HA 4U3CA 2YD8A 1GGCH 5HD8C 2NY1D 2PXYB 5DZLA 1UGNA 3LKSA 3RVWC 3GO1L 1CN4A 4YDIH 1Q72H 2ZP0T 2X4RA 4NHCL 3RGVD 2PYFB 1I9JL 1CLZH 2F53E 3QDHA 3MROA 2WLYA 3BH8A 3RJDA 3PE9A 4RQQB 5TH2B 2CJUL 1JGEA 2PXYC 1FNSH 1M6OA 4O9HH 3GHEH 3DXAD 1QRNE 3W39A 3E1F1 1UJ3B 1UACL 1UT9A 4PJFE 1J1OH 3HG1E 2B2XL 3KR3H 4JLRA 3MA9L 1EHLL 1ZTXL 1ZHNB 2IADB 3DVGB 3JWOH 3QEQB 3CLFL 1JFQL 2X4TB 2J8UB 4GW1B 1BVKA 5IBTH 1FYTB 3TP4A 3EZ8A 5HY9A 3D0LA 1U8JB 3TESA 1ED3B 2XTLA 2UYLB 3BP4B 1I7RA 1F8TL 5CEXA 2IQ9L 3PWJB 3O9WB 2ESVB 4AM0B 1KB5H 5F9OL 2J6EA 5ESAB 3MLYH 4L4VB 1OGAA 4RMWA 1J05B 4FQIL 1SY6A 3MV9B 5IFAL 1BF8A 1GIGH 2ZZUT 3HB3D 5CFHA 5D1XC 3IJYB 5EU3B 2NQCA 2ZUVA 1NSNH 4ZYKB 4U1GC 4FXKB 4KKBC 2VDML 3ZDZF 2W65B 1RPQA 3MLXL 1VHPA 3OXRA 1B2WH 3MUJA 4HEME 4CJ1A 5HDOA 1INQB 4Y19E 3TC9A 5ADOL 1AC0A 4G9FB 4D3CH 3NZ8A 3D9AL 4MNGE 5DJYB 1FGVH 5IESH 3D85D 3CSYA 3I75B 4KZEH 5IROA 5BVPH 2IFFH 3EOTL 1ZSDB 4XGZB 3PV7A 2XWTA 2CR3A 4L9LA 3FZUD 4AQ1B 5KS9F 5KVDH 5DURD 1U42A 2E27L 5FYLD 5FV2A 4YHZH 4TOYH 1GC1L 1S9XB 1QLEH 2NY1B 4N0RA 3MGOB 5ID1B 3QCVL 1R3LB 1BGXH 4KV5E 3EJZC 3DMMC 4XPHH 5GRXG 1WUNT 5DWUL 3MV9E 4YHIB 5E70A 5IBUB 1P1ZA 2IPUG 4X4MA 4LSQH 2R1WB 1REIA 2ZNXA 1U95A 4Z7WE 3SDXE 4DVRH 5MP6H 2QHRH 2ESVE 4S1RL 5C6TH 4EQ2A 1JRHI 2LAGB 4YE4L 43C9B 2C1OB 4N8CL 1R3HA 2IPTH 1YYLL 2AXGA 2HJLA 5EBMB 5HHOE 5C7XH 4CMMB 4JM2B 1WAAA 3BI9X 3BH9A 2DLHA 3UYPA 1IGFL 3H9SB 3CH8A 2ZKHH 4L3AA 5SX5H 1HE7A 2AJ3A 1FFNA 3MCLL 3OAUL 4FQCH 3OTTA 3ILPA 1JYXA 3T0DA 2Z8SA 4GSDH 4JQIL 2F9BT 1NCTA 4JRXA 1AKJA 2CMRH 2YEZB 3V5HA 4X6BB 4QLRA 3FN3A 4PRIA 1DBBH 1C08A 1RZKC 1I9RL 3NABH 1MJUH 5CJ8A 1XF4B 3BT2H 3DURB 3D18A 3O6FC 2EH7H 5ANMA 1JV5B 4OGYH 3ZKMC 5T1LD 3EUUA 3GKWH 1FC1A 4PGBB 5EWIH 3CNKA 3KPRD 4XAWH 3SKNB 4YHKL 3CVHL 4JQVC 5H2BA 1QOKA 5F1SA 3STBA 2WIIA 3CUPA 4ZD3L 2WBJB 1U6AH 4PJEB 2DQIH 5FUOL 3SDCC 1BFOB 5BV7C 5L0QC 2H8PB 3G04B 3L5IA 1U9KA 2X70B 3D2UD 5ILTH 1PDKA 1XIWB 1MIEH 3G5VB 3QPXH 3STZA 2UV3A 3MUY1 2QTEA 1WIOA 2MMXA 3JV4A 2VDLL 2X4SA 5ITFB 2XTJB 1QBLH 4GUPA 2MCG1 1L0YA 3O4LD 3F12A 2FJGA 4H8WL 4JCMA 4YC2C 3H3PH 4TRPH 2FEEI 1RUQL 3P73B 4K3JH 3S3JA 2X1OA 4PLOB 3AROA 2W0FB 3HUJF 4JFOB 4NQCA 4NN5B 2VNCA 25C8H 3IXTB 2H6PA 1KB9J 4JVWA 1EBPA 2RQ8A 1X4YA 4XNXH 2YXMA 3GSWB 4GAYB 4QRPB 2VLRD 5JW4R 4KROD 1ZHBB 4LSUL 2WWMC 1VGEL 5D6CB 4AL8L 2FSEB 3FT3A 5DMKA 3HA0A 3S4SG 2D9QB 4P59L 2RBLA 2ZSWA 1G9NH 3ZYJA 3JBG7 4U6VL 4J3SA 2AS5M 4OCMC 1I1AA 4AIXA 5F89B 3MLVH 1S7UB 4JY6A 4Y4KA 4Y4HA 4HK3N 5I76B 5HYJE 4ZS6D 1TJIH 4M93C 5DUML 1B0RA 1VSCA 2R2BA 1IGIH 4Y4FB 3W2DH 5D7KD 1MLBA 1HZHH 3LS4L 4OCWH 5CEYA 5F8QC 4OTXH 3C87A 1CVSC 3BDXA 5J8OA 3T2NH 1GPOL 4HPOL 4JQVA 4FQCL 5GS1B 4EI6A 1HIMH 3NACL 1ROWA 5C0BD 1LEKB 4UT9L 3VDCA 4EOWL 4F7EB 1FNFA 5EORL 3TFKC 4I0KA 3HRZB 4QY8A 4JFEB 4R7NB 1J8KA 2B4CL 2BFVH 1MUJB 3KLAA 1FV1B 4GW4B 4JE4B 3SGDI 2DAVA 2Z8VC 1UJ3A 3PWPB 1HILB 4JEGB 2F74A 4PY8I 1XMWA 5E8PB 4K3GA 2VDPL 5T1KB 3ZKSD 4NQCB 1AQDB 4G8EA 2DQGL 3N85L 4PJ7F 5DDHA 1W0YT 4U6XB 1U8QA 2VITA 4MJIB 5IB3A 2UWEA 1EH9A 3QCUL 4K71B 5FUOH 3TA3C 3HI5H 1OTSD 1A6VH 1AGCA 1VEPA 4OCXH 4PP2B 1QACA 2VIRA 5EC1A 3CDYA 4XWGH 2P5WB 2O26U 1JMXA 3IDNB 1WWBX 1WAAE 3DECA 2QJDA 3GMQB 2WINA 2VDKL 4JJ5B 2IBZY 5EIQA 5JQ6L 5C0DB 1BOGA 3VXPB 4O4YL 2XTJC 5SWZE 5L2JB 1JGDA 2YD5A 2EYTB 4KPHH 5DFVD 4BK4A 5BRZA 1DQQA 3RDTD 1MUJA 3KLAB 4F15C 5T1LB 1UM4H 3PG2A 4KGLA 5I1JL 3LKOB 5DO2C 3NZ8B 3UPCA 3EJYC 3WXWL 2PO6C 2DB8A 3CDGA 3HAEA 2OBGA 4JFYA 3C8KA 1BMGA 3AS2A 2ZPKL 4YHNA 1FN4B 1JGVH 3SDDC 3KXFA 4OF6A 2PTUA 4U4BA 3ARPA 1EAJA 1RUQH 3TZVD 3WFHA 1JZ7A 2XZQH 2H41A 3CDFA 4HS6B 2D7OA 1NC4D 4GKNB 4I9WE 2DYPA 2DYPD 3P0VL 2DQTL 2NPLX 4U1LB 4JN2B 5F96L 1BFVH 4NCC2 3N1QC 2EYSB 4LEXL 3DV4B 1AJ7H 2H26B 4XNXL 3NMEA 5BZDB 3DI2B 1CK0H 3VI3F 1CZ8L 4HUWA 5I76A 1HINH 2AQ2A 2OXHA 4G8FA 5FGRA 5GGUB 5LQBL 2WIMA 4DKAA 1I7ZA 4XXCA 2QQLL 3O4OC 5A2FA 3L5WA 1YMHB 2DM7A 4UDUA 4NRXB 4LPXA 1YY8A 1ZWIA 2BZDA 2LVEA 4JFQA 3ARDC 4XVSL 1JUFB 3B43A 2DDQH 2B1AL 3NACH 1EFQA 3WNNA 1JCKA 1LP9F 1I8LA 1CG9B 2Z91B 4PLKC 3H3KA 4U6YA 2O5ZL 5HHOA 4PJHF 1SVCP 5IK3B 1QA9A 4E41D 2VR5A 1W8NA 5GGSA 4YHZL 5ACMA 5D7KE 2W1NA 3U9UA 4DN4H 1Y18B 1XF2A 4FZEH 1I3VA 2D7PA 3HUJB 4ISVA 3MRRB 7CGTA 1ZGLP 3SDAB 5CP3A 4HAFA 4NKMA 5MEOA 4GW5B 4K55A 4LP5A 4JFYB 4PS4L 3SJVB 1EVTC 3K74B 3RZCB 5EBLB 3EYVA 4XH2B 3DMMB 4MAYA 5DRNA 1BBDH 3SOBH 1X5HA 3G6JE 1K3IA 2N56A 4CJ0A 5SX4I 4S1QH 2PTTB 3FFCD 5D2NA 3BZFB 3DROA 2ZNWA 4TOYL 2EDFA 4PRAA 4PREA 3HTLX 1LGVA 1X6NA 3OSKA 2BVOA 3CUPB 2H26A 1VADB 3SDXF 4G8GA 1J05A 2E7CA 1OB1A 2UVFA 3OKOB 5CD3A 1Q8MA 3SKNA 3ZZ1A 5E8NB 4JZNA 3KGRA 4HGWA 2R29L 3IDNA 4Y4HB 2F54D 1JGLH 3G5YA 4X80L 1NMAH 4YZFE 1ZS8A 4PG9A 5DHVB 4TN9A 1QFPA 1RJLA 2X4NA 4OZ4A 3IDUA 4ONFL 2NY5C 2BSRA 1EERB 1K85A 4NO0B 3WIIH 2CMRL 1F4AA 3HC3H 4P2OC 2ADFH 4F7TB 2APVA 5T1LA 3SO3B 2YD6A 5HGHB 1J88A 1GZPB 1NGXB 2D0FA 3VW3L 4JFFB 3ULUH 1F13A 1PAMA 4NNXB 3QG6A 2JKXA 2F74B 3TLRA 3QWOA 5KVFH 1NL0H 4JO4H 5JORA 3M07A 4LARH 4Z7WA 3ARRA 3QNXB 5D7LD 2JB6B 2DKSA 2MPAH 4P49A 5AWNH 3S7GA 4H1LB 4MAUH 3VE0A 3H9SE 3I84A 1O5DT 1CXIA 4NSKA 4QRRB 2RCSL 4HQQL 4G6MH 2Q76A 1ZLWH 1DBBL 4WW1A 1U58B 5GGUA 5DEFB 2ZG3A 3U2SB 1IAKB 2FJHB 2DI7A 1CXKA 4YGVB 4IRSD 1E6OL 3O6KH 5F6IC 5F71A 2EYSA 5FDWB 2G2RB 3VXNA 3QDJB 4LSSL 1PG7X 3RWJB 1ZMYA 1IC5H 2Y1VA 5H94B 1AHWB 3LHPL 5JHDE 1OGAD 2Z35B 3G5ZB 3JVGA 1AJ7L 1A1OB 3R8BB 1Z2KA 1E4XH 5D2LB 4F7PA 1JNHB 4OF0A 4QT5A 2BMKB 1NAMA 4RFEA 5MEPB 1CGSH 2YEZA 3BGFB 4ZXBD 4UU9B 2BNQA 1BQHB 2YWZA 3ILQD 1NFDE 4DEPB 1T6VN 2R0KL 3QNYA 3NAAH 1X6LA 1UCTA 5EFIA 1AGEB 1OLZA 2DDQL 3L9RB 3SOBL 4M48L 2AW2A 4Q9BA 1Q38A 1MELA 2X4QB 3PP3H 2OTWA 1RURL 5LGHL 2NX5D 5JUEL 2CDEA 5KBNC 5D2LE 2FHFA 4WI5A 5FHAL 3HKFA 2E7LA 1GAFL 5TDNB 3PIQB 5HVGB 4BQ9A 1ES0A 3QIUD 1NBZB 2ARJA 2BERA 5EOCJ 1MHCB 3AFLA 4Y2DD 1OAYH 4G5ZH 3A0OA 4Q6IA 4HIIA 2XQYG 4XCYB 2GCYB 5JHLH 3GI8H 1JPST 4Y19D 1H9VA 5A16A 3P4NA 4WV1C 3DSFH 3EDFA 2P5WD 5HI4D 1U93B 3MUZ1 2GTWA 4QF1B 5EIIB 1NMBL 3MACL 1Q72L 4NHCH 4LHUD 5B38A 1PY9A 4JDZA 4GW4A 4JFOA 3FB5B 2Z8RA 3F7VA 3MV7B 1QRNB 2F8OA 1DQMH 4WFED 4QYOA 2J2ZA 3ZLQC 1Z6JT 5T1DL 4HUXA 1AKJB 3VMNA 5CJOH 1AGBA 2EE3A 2VXQH 3GSNH 2V6HA 3GSNB 1LDSA 3UTSA 3QI9C 3PP3K 4C59B 5T5FL 2ARWA 2PKDA 2RCSH 3RTQD 4CU6A 1J1PL 2A6IB 4ODHL 2R2EA 1FVCB 4LAQL 4OZGE 4Z7VE 3WFZA 2ZG2A 4LLVA 3UTSE 3SKJH 1ORQA 3M17B 3IFPA 1WBZB 2VDKH 2DYPB 5E6ZA 5JW4N 1KJ3L 4KJQD 2BVEA 3SDAC 4PJBB 5GPRA 4O9HL 3VGDA 5I1LB 3UPAA 4RA3A 4PRBB 5J3HC 3IETA 1G7IB