3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
3Q6FA 5IKCA 1T20A 5E94A 5FAAA 4M6NH 5JHLH 1R5VA 2AJUL 4R4BA 3OQ3B 3WSQH 3KPRD 4JKWA 1AH1A 4NN5C 1OWWA 4M4RA 3T3MF 5ACMA 2A6DB 1JPSL 5AG8A 1U3JA 3MUGB 3GKWH 4DN4H 4UU9B 5E03A 3VGAC 2RFXA 1OTSC 1QNZL 1YNKH 4WO4D 3G6JA 2J8OA 2ATPB 3DROA 2IANB 1TVHB 4H1LA 5DHYA 4CU8A 2CIIB 1UT9A 1JGEB 1FJ1B 4F58H 4GW5A 1UQSA 1FFPB 5FA4A 4JFEB 1I8KA 3W0WA 2XQYG 3K80A 1CFTB 3MV8E 1I7ZA 5KAQG 1NGQH 4OQTA 5HHXH 5C08D 4TN9A 1PG7L 1FLRL 5HHMD 3TN0B 4KJYA 2JCCA 5B8CB 1ZTXH 4JO1L 2ITCB 4IRJC 3PHOA 3FFDA 2J8UE 3CSGA 3PQYD 1UFUA 3U36B 1W0WA 5I16A 2Z4QB 1ZWIA 3HMXA 5A2KH 3LKQB 4Z7VA 4QRRE 2MPAH 3DUSB 1VENA 3H7BA 2XKUA 4U4BA 1DBAH 3IDYC 4M8VA 1MCOL 1CBVL 1QBLL 5JR1H 1BFOA 3IJYA 1IAMA 3U46A 2MCPH 5INCB 3V5DA 4YDIH 2YRLA 3QPXL 5E5MB 5HY9A 2NY3C 4LLUB 4P4KC 5T1KB 4N8CL 4YHLL 1CLOL 2XYCA 1L7TL 3UTOA 5E8EB 4YHNB 4GRWF 4LLMA 2HRLA 1CR9H 3RWIB 4PLOB 1R6VA 3VFPB 5IR1A 4UV7H 4KJQC 5DQJA 4HS8H 3DNKA 5I76B 3I84A 4NJAH 1A4JA 1M7IA 1KBGL 4Z7OF 3HNVH 2UWEF 3V0WH 2B1HL 2FH6A 1NMAL 4CDGC 4OSUH 4U6XB 1DQMH 4YE4L 3FRUB 1J88A 5T3XL 1MFDL 5MERA 3QPQD 1SJHB 4XXDA 3TT3H 4OCSH 2PXYC 2F5BH 4ELME 1KCRL 4KKNA 1CICC 1T0PB 5EC2B 1RJYB 2EECA 3MV9A 5DRZA 5EORH 3ARXA 5AYQA 4DOHB 3AREA 1IC4H 1C5BL 1F4XL 2DBJA 2DI8A 1UXSA 1WBXA 2YPVH 3PGFH 1NDGA 3REVA 4OAWA 1ZLVK 2XZAL 3T0DA 3EGSA 2WUCL 4ONOA 5IVNA 4RGMC 2XA3A 4KGLA 4P5TB 1EA9C 1JZ7A 2X4QA 1HZHH 1OAKH 4P2QE 1U6AL 5GS0C 4RSVA 4P2OD 5IVZB 3C9NB 4D9LH 5EU4A 1T5WA 1LWRA 3VXRB 3WNPA 4JRXA 1IEBA 2XN9B 4X6EB 5IMOA 3W39A 3UTQA 4EI6B 1GIGL 4R0LA 4MJID 2IQ9H 2E7LA 1A6WH 2YUXA 3O6LL 4XNUL 4GXVH 4I3RH 1EGJH 2DWDA 1U0QA 3SKJL 4QXUH 2RB8A 5DRXA 3TBVA 3JTSB 4HJ0D 5DWUH 4MXWL 3E6FA 5LWYH 1X5HA 3OTTA 5I8KL 3DSFL 3C6SA 4HUUB 2NX5E 4UILL 5IHUH 3SPVB 3DHJA 4M6ML 4E0RA 5T1LB 4S10A 5DURB 3ET9F 4OCRH 5C92A 4WUUA 3T77B 2DWEB 1A9EB 5D7IE 1IT9H 4KDVA 2CLVB 1G6RB 3GFUA 5HGBA 5EWIL 3D25A 4JQIH 4HD9A 2CIIA 2CR6A 3ULVF 1AO7E 4M3JA 1KC5H 2IPTH 2CRMA 4YC2C 2GJ6E 1RJLA 3WE6A 2B2XH 3BIAX 3C8DA 5GS0L 1T2XA 1D6VH 1S7WB 3OB0K 3S37H 4Z7QE 5EU7C 4YQXL 1ZT1B 3NFNB 3C5ZD 4EN3A 1I9RL 2IBBA 3OAZH 1FBIL 3I75B 4K07A 2B5IC 2AXGA 15C8H 1I1AD 1QFWL 3U30C 2EDDA 5F72S 5C09D 2NW3A 3DRQB 2HFTA 5GZOD 4JCMA 5EUOB 4LSTH 4P9HH 4P9ML 4MA7H 4PJFF 2IMNA 2QHRL 3JVGC 4AEFA 2WNGA 3X12B 3KXFE 4PUBL 3MLYL 2UV3A 5LXGL 2Z4QA 4OGZA 1IGJB 3LKQA 3DUSA 4QRQB 2R2HA 4ONHB 3IETA 2W92A 1XGQA 3WD5H 3QUXD 4NQDB 2AVGA 2W38A 5ALCH 2XY1A 4O2FB 3HLAA 5JA9A 4G6FB 4YZFE 1XF2B 1EUUA 4OFPA 4ZUWA 4UB0L 3OZ9H 1N3NB 2VXVH 3L3DB 2BDNH 5L2JA 4K55A 5FECA 4EI5A 1MRCL 2VLKD 4NN7C 5ANME 2YK1H 2E27L 1NFIB 3MYZA 4F7EB 5SWZB 4YHNA 5GSVA 3MUJA 4P99A 4QTIL 3X14A 1G6RH 1YC7A 3JWDC 1A22B 3NTCH 3K7UA 1Q9OA 5C07D 1KPUB 1S7UB 4OM1H 2YEZB 1NGWA 3F62A 4WI8A 4XP4L 1AE6H 3JSSA 4DVBA 1CD8A 3NIDE 2YOCA 5IB2B 3KPPA 4RAVA 4ZDHA 8FABA 1QP1A 4UOJA 4U1JA 3UO1H 2HN7A 3OAUL 5GS1B 4OF8A 1V3KA 4EDXA 3LKPA 5HGAB 5F96H 2W07A 2JJTC 3VW3H 2W9DL 4G8FA 3WO4C 3LY6A 4IDJH 4X7SL 5ICXA 5MEOB 1YEIH 2UVEA 1IEHA 1RJZB 3QPQC 5JZ7D 3RWCB 1YPZE 1CE1L 4G6JL 4JFDD 4O9HL 1LE9B 3X3GH 4EVNA 2DQIH 4P2RD 3DARA 1VPOL 3RWGA 5MI0C 4D9QE 4YXHH 4J3VA 1PDKA 3B5GA 3MFFB 4OZHB 1FZMA 1IE5A 1BGXH 3P0YL 1MY5A 5CSZA 3QIWB 5MENB 1NCCL 4F3FB 4KHTL 1MREL 4MJ6B 3C87A 3CSYB 4M5ZL 3C09B 5SX4I 1OSZB 2D03L 4JFYA 2PYFB 2OMNA 4FZ8H 3DV4B 3C9NA 3NPSC 1GPOL 3KLHD 3IXTB 3MJ9A 2EO9A 5EZJB 1SYSA 2J6EA 3SDAA 1DANU 1W8NA 5D96C 1S7TB 3D3VB 2J3SA 4ZFZB 1FFNB 4ONFL 2X5PA 1N0XH 3L5XH 2OYPA 4KTDH 2O61A 4KI1A 5EO9B 4FTVB 2FYYA 4NWTH 2LU4A 2HLFD 1P2CA 4FFZL 1DQLL 4OCYL 1YNLL 4PJCB 4EUPG 5GRXG 3ARTA 2B1AH 1RPQA 2VDKH 4G8IA 1QLEH 3SBWA 4HUUA 2FHFA 2NY4B 4HJ0C 2Y5TA 5C86A 5D72L 5TFSH 3UTSE 5KVEL 5C0CB 4NFCA 1U8NB 4QXGH 1F8TL 3R8BB 4OD1L 1V7NH 3DMMA 4LBEB 2YWZA 1CU4H 4NO0D 3ULUF 3GSQA 2LABA 3HS0B 4G8GE 3KYOA 4X83A 1H8SA 1T22B 5L9DH 3VDAA 1YEGL 2VDML 5C0AB 2CJUL 4LHJB 4GG6B 1TQCB 2DM4A 4EUPB 1KTDB 4KXZI 4ZSOB 4BZ2L 1KB5B 5E00B 5TDNB 4KRLB 3EBAA 5J06A 1ZT1A 2ZCHH 3NFNA 1KT2B 1G7PB 3A6BL 4L3ED 1LEKB 1Z9SA 2BVYA 3AAZA 1U95A 3OKOA 2N56A 3PWUA 2YPLE 4ZTPH 3DRQA 3LEXA 3C5ZC 5KW9L 4GG8B 5AWNH 1I1AC 1RHHB 4LPTA 1MPAL 3FB7B 4LCWE 4ZTOH 3S4SG 1UZ8B 4FMKA 3V4VL 1OSPL 4RWHA 3DX6B 1KLUB 3BZFA 4C56E 5GZOC 2D0GA 3B43A 4PJ5B 5C9KA 3CXHK 2OTUB 2ZJSH 3M45A 1IC5H 2I5YH 3MBEB 3MSPA 3WL9B 1AGBB 5F9OL 3O45A 2FJHA 3SKOA 4ZS7L 4N0UE 5KSUA 3C2SA 4TQEL 2Z31A 4WHYG 1L0YA 5E8OB 1JK8B 1PY4A 1KYOJ 2V2XB 3QUXC 4O02L 1F4HA 3MBXL 3MLXH 1YUHA 1KXVC 5EBWB 3MCG1 5CLWA 4MNQA 3TVMD 1NFIA 3WXWL 4F7EA 4OJFL 5D6CB 4UTBL 3HE7B 1SJEB 4MJ5B 1JGDA 5IBTH 4OD3L 5E8NB 4X6CF 4JY4A 1B4JL 2ZUYA 3EYSH 3P40A 1S7UA 4GXUM 1HHIB 4XX1E 3F58L 3FO2B 1KB5H 1MCIA 3ARGD 5IB2A 1J0HA 3IXAB 1A7OH 1MNUL 2SEBA 2VZTA 1S7QA 3QCTL 5HGAA 3BYTA 1FE8L 2FBJH 1BEYH 3ZE1F 3BKMH 3HRZA 4AEHL 4A6YL 4W6WB 3H0TB 3TA3A 4LMQE 3WV0A 1MF2H 1JPFB 5MEOA 5LGHH 1N6UA 1LE9A 1JHTA 4AEIH 3FO0L 1EEUA 2XPGB 2ZSWA 2E9BA 4POYA 4Z78A 2A77H 5JZ7C 3KPOA 4RGNE 4WV1B 4PS4L 2NW2B 2OQJB 1OW0C 2AXFB 2BRRH 4Y5YB 5HYIA 4MDJA 3QCUH 5IVXF 3BD4A 1TZGL 1S5IH 4F3FA 2ADFH 4PJ9D 3CSYA 2IFGA 4U1SB 1NPUA 4G42A 4QHKJ 4HUNB 3S36H 1XGYH 2PYFA 4XNQA 3D39A 4J6RH 3RGVD 2OBGA 3IXTA 5CGMA 1VHPA 3EDEA 5GGRB 1XR9B 4PRIA 5D71L 1FL3B 4Y4HD 4WW2C 5JXAH 1GGBH 1S7TA 1CLCA 3PJSA 5HXMA 1CWVA 3MJ6A 1J5OH 1FFNA 1GSMA 3ALPA 3KLHC 1HHHA 4UTAL 3VI4E 4WI6A 3NA9H 4YUEL 4NT6A 2BY2A 2W65B 4U7KA 2VZOA 4OV5B 2F53A 2XZQH 1H3PL 3QIBA 4X0KA 4NC1C 3OHXB 5IUSA 5TQ0L 2AK1L 3CH1A 4ZAKA 2NTSP 4UOW0 4HZLA 1G9NH 3TBSB 2EXWD 1A3RH 2X6MA 3FN0L 1XF4B 5C0CA 4QXTA 2H1PH 2DD8L 4KUCF 3W5MA 3MLWL 3BMWA 4YR6B 1OAZH 1TETH 2BHUA 4UIKL 5C0DB 3BXNA 4N8VG 1SY6L 2ILLA 3UBXA 4NKOB 4GG6A 4YDJA 2YD6A 3W0WE 1IAKA 3TCLB 3O41A 4ZSOA 4DGIH 2KDGA 1AI1L 1TZHA 4YHZL 5JPNB 3O6FB 5J1AB 2QEJA 3BRDA 3UZVB 2X4RB 2I9TA 2P46B 4XBEL 1RV6X 2VDQH 1LEKA 2CLRB 4KK9D 3I9GL 1UA6H 5J11B 1SVZA 1ZHLB 4NZDA 3IF1A 3ARBD 1DVFB 2ZOLB 4LPVA 5EU6A 3EOTH 5HGDB 3RU8L 2NNAA 1U42A 3EO9L 1B2WL 4IRZH 4D9RD 4ZUSB 2DTML 2AABH 3EZ8A 5DQDL 4PJ5A 4Z7VE 2HRPL 2OTUA 2L0DA 3H9YA 4HWBH 2HJLA 3IDJB 4M3KB 1FYTB 4OZGB 3SCMB 1AGBA 1KIPA 3IU3B 1QOKA 1WBZA 3JV0A 3S97C 5KS9E 4R96B 1RFDH 4PD4J 1MHHB 1HHGB 3CNKA 4W4NA 1RUML 1CXHA 4WJ5A 1ZVHA 3SJVD 4YBLB 5AZ2H 3U48A 1U36A 3PL6A 3OWEA 3SDDA 2Y36H 2AEPL 1NUNB 4I4WA 3WYRA 1BLNB 4WFED 2IFFL 3WUZA 3M07A 2DLFL 1XF5A 2FEDD 1U8PB 3P73A 2FHCA 3RAJL 5DMGC 3HE7A 5F6HI 5ITFB 4OCXH 1K8IB 5HPOA 4R8WH 1N7ML 3TVMC 2VR5A 1NC2B 4KY1H 3N9GH 1A8JH 4NUGL 4X99A 3Q5OA 5HHOB 1RULH 4IHOB 4RFOH 3VFGL 1HHIA 1KG0B 2X7LB 4WNQA 1FL6B 4PJXE 2H2SD 2ESVA 3MRNB 2ZUUA 4L8CB 1Y0LB 4E41D 5M95B 4K3EH 5A40E 5F9DC 4EDWH 5HHPA 3IXAA 4UIMA 3HMWL 5EZIH 2W9LA 3DXAE 3MJ7B 4D8PB 1AC0A 3ECBB 3ARGC 1TDQA 4OGYL 2EDFA 3NABH 4Y4FB 4TNVK 4KU1A 4LVNC 2A6KB 4EKXA 1UC6A 2VLJD 5IESH 1A7QH 1C1EH 2FIKA 4NO3B 3HI5H 2GJZB 4XCCH 3L3IB 1YQ2A 2LU3A 4P5KB 3OMZA 4X6BB 1A7PH 4ZUTB 1LMKA 3GMLA 4MZ2A 2YZ1A 3L1OL 2ITDB 4RA3A 1BHGA 1N8ZB 4PJIB 1MOEA 2OJEA 5DD0L 4JFFA 3H9ZA 4PJDF 2R4SH 5LAXA 3QG6A 1D7FA 1T7ZA 3G9VA 4NBZB 3B3IB 4R26H 4PPTA 5LJYH 4Z77B 5CP3H 4EJ1C 4OLVH 4CRPA 3I3BA 1H8OA 5D7LA 3QT2A 1Y6NR 2JB6A 2GCYA 2W59A 4GAFB 5CMAB 4JQVA 3LZFH 2BZDA 4Y19A 2R0KL 4ZUVB 3WDIA 5HYQB 2R56L 5C9JB 5J4MA 3L3JB 4UAOB 3QXAA 2P5ED 4ZMAT 1I1YB 4WWKB 3RGVC 1AGCA 3TFKD 2QR0A 4XVUD 3C60B 1PEZA 1FSKB 2CIKB 2EIDA 4NZTH 1A4KB 5D1XD 2WSKA 4PYGA 3ZKQD 4R90L 4Y4HC 2PTVA 1QR1B 2DL2A 1HINH 3BE1H 5IQ7L 1EO8L 3SKUD 1IGMH 4QRUB 3FCTA 4RCAA 5HVHC 1OQOA 2QADB 3GSNL 1ODAA 4OLYH 4UT9H 2VITB 1KCVH 3H42H 3LS4H 3GBMH 2QSCL 4P57B 1M05B 1A1NB 3KNBB 1OT1A 2VQ1B 5CD3B 1MFAL 5F3HB 4WFGD 5FV2A 5GGTL 2EXWC 2VLLB 4OGXL 3RIFF 5F1NB 1CLYL 3MRJB 5J9PB 3LH2L 2ZNXA 2HJKB 3QDMD 2OCFD 4JFEE 3BSZL 4BZYA 2IC2A 2DM7A 3UXFA 4P0DA 3F8UB 4GW4B 1G6VK 2BY0A 5JPNA 3OKMB 5J1AA 3L7FB 3WIHA 1FAIH 3VGAB 1OGAB 2FL5B 5DJ0A 4CJ1A 4NRYA 1WEJH 1YMMD 1U91A 5DRNA 4POZD 4JFQB 2AJUH 2PW2B 2ZOLA 2EYRB 3VXTB 2W1NA 3QUYA 5L6YL 4FOMA 2KQMA 3ARBC 1QNZH 1ONQB 5F9JB 5I1JL 3BZEA 4QNPE 5GGUB 4LCCC 4ZS6D 5EC1A 3V4PL 4L8DB 5DJ6B 2NLJA 3LS5L 3QWOA 3V6OE 1YZZA 5ESAA 5CP3A 4PP2A 4IRJB 3RDTD 5MEQA 4FABL 4HIIB 4KZDL 2X4SA 4FQCL 3K2UL 5CUSL 4AG4L 3SKMB 3LPGA 1PG7H 5MHSE 3IU4H 1FLRH 3ZYJA 4HUMB 1E4JA 3IDYB 5IQ9B 1V05A 4JO1H 2AEIT 5D70H 1DQDL 1FC2D 1U2HA 5TQ2L 5J89A 1NC2A 2GY7B 2YD7A 2FEDC 5CJQL 3OBAA 5A3ID 1I3RB 4IHOA 1HN1A 4JM2F 2WAHA 2NY3B 4P4KB 1RZIA 5B22A 1B0GA 1FL6A 5DR5L 1MCOH 3QA3B 1CBVH 2ZCKL 1QBLH 3NIFE 1S9VB 2DQFA 5KSBF 1CIUA 2YZ8A 3EDDA 2H2SC 3V8OA 4Z8FH 5CEZD 3NAAL 4ZFOL 4OZIF 2EDRA 2CR3A 3OJDA 4KROD 4WY7H 3HZKB 2A6KA 4N8CH 5JHDB 4YHLH 1CLOH 4ZPTB 1L7TH 1T4KB 4L4VA 1JPTH 4XRCA 4DOHE 4YK4B 4OKVB 5B21A 3L3IA 4J4PD 3KPQB 4JN1L 3UJJL 5SV4A 1DEDA 5E5RB 3PIQA 1DBJL 3U0TA 4PGDB 3LV3B 1U8JB 4PJIA 4PJHB 1XZ0B 3DRTB 2PXYB 4J3TA 1PLGH 3KYMA 1KBGH 4K9EC 3GMQB 4NRXA 5IIEB 2FO1A 1CICB 2B1HH 1OLLA 4PV9A 1IM3A 1PY9A 3HC4L 3VXRE 5E9DB 1BREA 4YE4H 5T3XH 2XN9E 4DKAA 3ULVD 1MFDH 5C9JA 3ALXA 3K8LA 2CXGA 3S3PA 4PGJA 1CXLA 2EDBA 5FKPB 3PHQB 1CT8A 4NHUB 2I07B 1YNTB 1PX3A 4RGMB 1KCRH 1LO4L 4LPWA 2GQHA 4BSVB 5EOCJ 2LQRA 2RGSA 1J8HA 2FO4B 3OR7A 3VFWB 1EHAA 3HKFA 2DQCL 4S1SL 3BKJH 3TFKC 3EAKA 1T3FA 3E3QE 4XVUC 4QRUA 2DBLL 4L3AA 1C5BH 1F4XH 1Q0YL 1ZT7B 2GTWB 5D1XC 1ES0B 5IW1A 1BZ7A 1V3JA 1NJ9B 3RZCD 5CJ5A 3NZ8A 3CZFA 4XNMA 5ISZB 4NM8L 2VZ1A 4WENB 3B6SA 4J3WA 3CCHA 1U6AH 4G43B 4JO4L 1OY3B 4ORGB 4LLVB 2HAZA 2AP2A 1ZLUH 3F7PC 4Z7WF 1XAUA 2VUYA 1WUNT 5GRJH 2HJKA 5DD6B 4K9EL 5J13B 2CPCA 5T5FL 1SYVB 4LHUD 1M71A 1KB9K 1GIGH 4RQQA 5DI8A 5E1AB 3QQNA 3O6LH 4PJEF 2VL5B 2X4TB 4GW4A 4XNUH 2H9GB 1ROWA 4LAQL 5TE6L 3SKJH 4TTDD 4ZOCA 1OGAA 2VB5A 4CVXA 3KPRB 4MXWH 1TTFA 4XPFL 1FORH 3IDNB 3C6LD 1IAOB 5FGRA 5CIPB 5I8KH 2YBRB 3DSFH 4JFQA 5HVGB 3LN5A 4YC2B 3STZB 3TGXA 5DUPH 4MX7B 4M6MH 3CH8A 3DHMA 3RHWF 3MZTA 1KN4H 3E6HB 4POZC 2BSRB 1FQ9C 3VU2A 4NKIL 1ONQA 1MLCB 2B5IB 3CSBA 3VI3E 1EJ6A 3U30B 5EWIH 5DJ6A 3HUJB 1GZPA 4HLZH 5C0RL 1AC6A 1QLRA 3OJMB 1IGTB 5C08B 1WBYA 1QO3B 5FYLD 1G84A 5GS0H 4IRJA 1M6OA 4FQHA 4ZS6C 5JIPA 5HHMB 4YQXH 1K2DB 4OF6A 3MRQA 1I9RH 1E4KC 4OQ1A 3CLFL 5IB5B 1FBIH 5IJKC 3VFUB 3H7LA 1NCBL 4MNQE 4KZEH 4WDIB 5SWZE 3RDTC 5KAQF 2Q6WB 2CMRH 3PQYB 3L3HB 1DQQB 5DS8B 1AR1D 3VRIB 2D7MA 5DVKA 5K9JH 1S7SA 3WLBB 4RBPK 4Z7UA 4OB5L 3MROB 3SDXA 1GRWA 5IBUB 4P9MH 5F8RC 2QHRH 3D48R 4PJGF 5I66A 1KELL 1F4WH 3BMVA 4PUBH 3MLYH 5LXGH 4WU7B 3AXLA 4Y4KD 1NCNA 3G5XB 4FQQB 4QRPA 3VFNB 1A64A 2BJML 4G7VL 4NN7B 3SHSA 4BFGA 1LEIA 5FM5M 1A02N 3O6KL 1R3HA 2IEPA 3BP5A 3LHPL 5A3IC 3MUY1 1NCDH 4XH2B 5I9QC 5JIIA 2KUTA 4FQ1L 2C1OA 3UCRA 3VH8B 1PZ5B 5D5MB 5GJTL 1R24B 1PSKL 4UB0H 3VFVA 4GRMB 4NQEA 1NGYB 4X5WB 5CIPH 3MRGB 1F42A 4DUWA 3HG1D 5J7CC 1OVZA 3HZKA 1MRCH 4LK4A 4TVPD 5FOBA 2E27H 4ZPTA 1T4KA 3HE6A 3F5WA 4KROC 1KLGB 4O51A 4HULB 4QTIH 4OZHE 1MSPA 2WQ8A 5D7JA 1ZVSA 3LV3A 1UWGL 2IPKA 1P4LB 5J6HB 4QKXB 4J4PC 2PXYA 3WO4B 5MENE 4HFWA 1ADQA 4XP4H 4DUVA 1GGUA 1CICA 1RJCA 1HNGA 3EOAA 4PG2C 4MA3B 2FRGP 3EYOA 1I9IL 1DSFL 4YGVA 5MI0B 3OAUH 5D6DA 1TCRB 1QSED 4U0RC 2WUBH 3D3VE 5DC4B 1LO2L 3VXPA 2W9DH 2I07A 4X7SH 5EOCL 2PKDA 1D5ZA 1KPRB 2P4AB 4FTVE 1PKQB 3ULVC 3EUUA 5F7EL 4DVRL 4PJCE 1CE1H 4G6JH 3MRHB 4O9HH 1QSFD 1U58B 5GGSB 2AEQL 2AV1B 5FCSH 1VPOH 1INDH 3NPSB 1WGOA 2X10A 4PGEA 1NMBL 5DO2D 1N0LA 2OR9H 4P2OB 3MNVB 5CEZL 4FZEL 5D96B 5C0CE 2P24B 3P0YH 4F7PA 4WI2A 1T5XA 5ISZA 3W82A 2NY0D 5IEHB 1UM4L 1NCCH 1WAAE 1MREH 4MSWA 3RZCC 1QVOB 4NCC1 1KCLA 3JWDH 4K3DL 4M5ZH 4L8SA 2D03H 2H6PA 4MJIB 1CXEA 4I9WE 4JZOB 4PTUB 4C54A 4DK6A 2D7NA 1GPOH 2HWZL 4IOIA 5C0AE 4GG6E 4DN3L 1V3MA 4LVHC 1CFQB 5IMMA 2Z93B 2VDPL 3N1FC 3KPMA 1J0KA 1SYVA 4ZSOE 3DO7B 2F19L 2IQAA 1E6OL 3S96B 1EAPA 2H9GA 3K3QA 8CGTA 4F57L 1JV5B 1QYGH 4PJBF 1EJOL 3MO1A 5AEAA 4FFZH 1DQLH 3HPLA 4OCYH 1YNLH 1JHLH 2H32B 1RIHH 1HQRB 3NFPB 4TUJA 2DYPD 5DVOA 4HJGB 4TTDC 3KHQA 3MRLB 4OLZH 4IRSA 4R7DB 5EU6E 3ULVL 3U7YL 4I2XB 2O5YL 4MX7A 1U8MA 5C0JB 5C8JA 3T0EA 5D72H 2YR3A 5DXWA 3C6LC 1HDMA 1Z0MA 4YDKL 3EDKA 3T4YA 4PJ5E 5KVEH 2XG4A 2BSRA 1F8TH 4M1DL 4OD1H 4XMPL 4MCYB 1MLCA 3BT2L 5TE4L 1RUQH 5E70A 3NMEA 4Z7NE 3T65A 2NR6D 3GI9L 4K94C 5FK9B 3V7AG 4HG4K 3HUJA 1YEGH 3C5ZB 3VRJA 2VDMH 2R8SL 2CJUH 1R3KA 4NQCD 3RA7L 3BP6A 4NP4L 5C08A 1I1AB 1T89C 3IRZA 4BZ2H 3W9EA 2ADJA 1EFXD 5C09B 1JUFB 2W91A 3QP3A 5D7SL 5IB5A 3A6BH 3K8KA 2DTSA 3UYRH 2BERA 3T0VA 3BPOC 3D18A 3IKCB 3MGTA 3LQZA 4JHWL 3PQYA 4YHIB 3NH7L 3RHWK 4A6YB 3FT4B 5KW9H 2ICWA 2X41A 1O7VA 3WLBA 4JJ5B 3DOSA 4P3CL 5LGKA 2AJZB 3MROA 4L4TA 4AM0B 4R9HA 3OV6A 5IB3B 5HYJD 3A6OA 3V4VH 5L7XL 1AR1C 5I8EB 1OSPH 5D2LF 3RWHB 1IGYB 3QUXB 5K9OB 2EDTA 3VFNA 4RZCA 1DUYA 4OV6F 1EEZB 4W70A 5F7MC 1X5XA 5F9OH 5E7FA 4ZS7H 2CDGB 3EJJX 2CRZA 4XH2A 5GGQL 4TQEH 4Y4KC 5D1QA 1A6PA 2VLKB 1PZ5A 2H32H 5I19L 1CLZL 4K94L 4GBXA 4O02H 4GT7A 3MRGA 2QSQA 3MBXH 4N8PA 4NFBA 1TNMA 4X9IA 4PB9L 5F7UA 2HFFB 3T3PE 1NBYB 3NVQA 4UTBH 1CD0A 5C07B 1UWXK 1G1CA 3RI5K 2WV3A 1XMWA 4JFFE 5DVMA 3TNMA 4PRBA 2V2WB 1F6AB 1F45A 1JWMA 2KZWA 4MA1C 1B4JH 5HPMB 3VWJA 5J6HA 3RQ3A 2J88L 3OXSB 4Y2DA 1AFVL 3QEQD 1QFPA 1D5BB 3TT1L 3T8XA 2C7UB 3W11D 4KUCD 4X8JA 3RWDA 3CC5B 5I30L 5FA3A 1HQ4B 4GMSL 3QCTH 1TCRA 3FZUD 4X4XB 5J1SC 4JM4L 4JFDB 1FE8H 4RAUB 2OJZL 4AEHH 4A6YH 2IPUK 3I6KA 3B9EA 4P2RB 4PYHA 1T1YA 1G9ML 4PJ7B 4P59L 4P3WA 4KMLB 2WIMA 3L3GA 1U58A 3FO0H 1P53A 3HTLX 2FATL 4H26B 4JFZL 1KULA 3DVNB 3CZJA 2CLZB 4Y5VC 4PS4H 1BJ1J 3CMOL 4X7CC 1WIUA 1X9QA 4IMLB 3B9KA 4WW2B 1WIOA 1C08B 2W0FB 3GBNH 4UZGA 5AAWA 1TZGH 4I0PD 3O2VL 5DO2C 3TJEH 4TVPL 4OIIL 1QVOA 5C0FB 1SJVA 5BJTB 4H25A 5HGHB 2XTLA 2G2RB 4JRWA 4PTUA 5LCVL 1EV2E 5IJVB 2NY0C 5FOJA 4MNHB 5D71H 1LP9B 3MLZL 5I8CB 1DN0A 5TE7L 5GGVL 3FO1B 7FABL 5FUCE 1T2QH 3SQBA 1MWAL 1HE7A 2K1MA 4UTAH 5HYSB 4YUEH 5DK3A 3IFOB 2K3TA 4DZ8A 1NGXB 2QTEA 1H3PH 3HI6L 2ZKHH 4HHAA 2YN3A 2YUZA 4M00A 3ZTNL 4M5YL 5TQ0H 5JO5A 4BKLB 1BM3H 2AK1H 1HQRA 1T66D 2EDXA 1UB6B 5H35B 5CZXD 4XZUB 3MTRA 4XMKL 1BZQK 4AH2B 1TVBA 1A6UL 2ATKA 5TDPB 2PW1B 4NO0B 5C0JA 1NGZA 3FQRA 3OAYH 1N26A 1ZSDA 3RUGF 4CNIB 3VA6A 3LD8C 3VJ6A 2Q7NA 3MLWH 4MCYA 4OZGE 2VISA 2DLGA 2XWJA 4UIKH 1KGCD 2WQRA 2R69L 5DK0A 3TBWA 1UKTA 2A9NL 1SY6H 2W9EL 2R0ZL 2BNRD 4L3EB 1X5FA 5HI5D 3V6BR 5IV2A 1QFUL 3QO1A 2NR6C 4HK0B 3MV11 4FXGB 3UC0H 4MXQD 5C09A 3C2AL 4OBRA 1AI1H 2Q20A 3S3JA 1K9TA 3DVIA 3UTPD 3FOLB 4XAWL 4XBEH 4KTYA 2CD0A 5ACZA 2PO6D 3IKCA 4ELKB 2P45B 3I9GH 3FT3A 4A6YA 3ROOA 3UBXG 4GLRH 4GS7C 2AJZA 4HLJA 2GK0B 1A0QL 2DKSA 3RU8H 3EO9H 1B2WH 3ARZA 3E0GA 5HHOE 2DTMH 5HBBA 1NEZB 4HIHB 2YA1A 1IGYA 2HRPH 2G9HA 4UQ2A 3UMTA 1PG7X 5L8KB 1UACL 3SGKC 1Q9WB 1ND0B 4ZUUB 1J0IA 4DJMA 1LD9B 1JPST 2VLKA 5AAMA 2OZ4A 3KPLA 3TVMB 3IJHB 1K8DB 4RMUA 1IGFL 1RUMH 5ESQA 2CO7B 4NCDA 1WWWX 2AEPH 2F74A 4P5MB 2ICES 2IFFH 2V2TB 2H3NA 3MXWL 2DLFH 1DBML 5L2KA 3RAJH 5DGQA 5C07A 2WBJA 5LBSH 1MLBB 4PJIE 3QH3B 2V2WA 1BOYA 4NUGH 1GGCL 2ZOKB 4O4YL 3ARGB 5E6YA 2AAVA 2DICA 5IM7A 3VFGH 4L5FL 5CBAB 2OS7A 4LVNB 1V7ML 1KIQA 3GSNB 3GHEL 2IADB 1O5DT 4YWGL 1OAQL 1G0XA 3RX5A 4YLQT 4NOFA 1DR9A 1HSBA 2FSEB 3MRPB 3W11C 4Z6AT 2ZPKH 3P4MB 3A6CL 1CFVL 5IB4A 4CU7A 1KCUL 4OGYH 4RAUA 5AD0A 3VWKD 1QPXA 1X5ZA 4HKXA 1SY6A 4RFEA 3GSOB 1QFWM 5FXCH 2ICEA 1WQVT 5IK3A 3G5YA 1UM5L 1BECA 1AD9A 3FZUC 4A2MA 4GQ9H 4D2NA 1E4XL 2VABB 3QIUD 4TUKL 3I6GB 4M61B 5CKGA 4RDQG 1P69B 3QDGD 3GK8L 1RZJL 3L1OH 2KZ1B 2YD3A 4PJ9B 5DD0H 5FFLA 5H2BB 5F44A 1PEWA 1R5WA 3H9SA 2G75B 4JHAL 1NC4D 2G5BA 3RGVB 3GUTA 3PWPA 1CN4A 2RAMA 1AHWA 4Y4HB 4OI8A 3FONA 2X1WL 1KB9J 3ARRA 4YZFF 1IJ9A 4I0PC 5HDLA 5EN2B 2R0KH 5HVHB 2P42B 2R56H 4LL9A 3LQAC 4LQ1A 4MNHA 2F8XC 1H5BC 2XKNB 3FO1A 1A3LL 4F37F 3HZVB 5HYSA 1K4CB 3LIZL 1OGAE 4NQXB 3IFOA 4HUVA 4NUJA 4DKFL 1CD1B 3GSVA 3EIFA 4R90H 3GJEB 2AGJL 3EO1B 4YFDB 3VG0L 2YPKA 1EO8H 2LVCA 1YY9D 2E7MA 1NCWL 4XZUA 3RY6A 1Z2KA 3GSNH 1G7QA 5EH1A 1I8IB 4HKBB 5EU3A 4UUJB 1ZT4A 5GIRA 4KTEL 2O5XL 2VH5H 1T66C 1LGVA 2QSCH 3NIDF 3FQWB 4Y1AD 2ZUXA 32C2B 3B9VA 3BKYL 5CZXC 3L9RB 1JYVA 5JOPE 4JM2D 1HK6A 2ZSVB 5GGTH 3FQNB 4OGXH 4O2CB 2YRPA 1M7DB 1CLYH 3ZHDA 1LILA 1MJJA 4G9FA 5IEKB 5TDOB 2JELL 3BSZH 4LEXL 4L3EA 1JGVH 2P1YA 2QSTA 3UBXI 1FPTL 3VXUA 3UROR 2PTTB 5JUEL 4Y5XC 2D9CA 2BSED 4E5XB 5T3XE 5HHQB 4NC2B 1VGKB 1RK1A 3ARBB 3MLVH 5H8DA 5CZKA 1CFSA 3FOLA 5HI5C 3LQAL 4CAGA 2AK4D 1C16A 1VFUA 4IIQC 4URTB 4MXQC 4LIQL 4LCCB 4ZFOB 2XZCL 4DGVH 2NY2D 2O26U 5I1KL 3N85L 1CFBA 3C08H 2PO6C 1R3JA 1MFBH 3X3FH 5L6YH 1O7SA 4HIHA 4QRPE 5I1JH 2I60L 4OLWL 1M4KA 4GAGL 1JFQL 3V4PH 1W0VB 1JRHL 3LS5H 2J4WL 3SJVB 3KWWB 1ND0A 1JZ4A 3JWOC 1OP3H 3IJHA 1RZGA 4I3GA 4KZDH 4FQCH 3QJHB 3K2UH 3HC0B 1GOFA 1CE6B 5CUSH 4AG4H 4XCNB 2JTDA 1VB9A 2X42A 2O5ZL 1MVUB 1MFNA 1U93A 2V2TA 3BHBB 3FFCD 1KEMH 3V2AR 3CK0L 4WCYH 3L5WB 5DMKA 4BSWA 1U8LA 4WHDA 5E6ZA 1DQDH 4MWFA 4WGVB 3U0PA 5DTFB 1UKSA 5TQ2H 3WUWA 5CJQH 4E41B 1QHPA 3V5KB 1YDPB 5DR5H 2F54D 3QQ3A 5CJ8A 3UZQA 5D9SB 3E2HC 1EXUA 2ADGB 1IQDB 2HLAB 5DJZA 5E9DE 5EO0A 5C0EA 3JV6B 5BOPA 2OP4H 2ZCKH 5ERWB 4FP8L 3MRPA 2VLJB 5GGTA 3WKNA 2EIZA 1ITCA 1TPXC 5KTEL 2YA0A 1VADB 3FB5B 3JWOL 4Z5RB 5C0BB 1ZLVH 2DKUA 1FNSL 1BOGB 4U0QB 3VWKC 3I6GA 3UDWC 2XY2A 4JN1H 4L9DA 3UJJH 1DFBL 2C3HA 1OCWL 3GSWA 2DM3A 4BFIA 4GRLC 5JDSA 1CL7L 5INDA 3QIUC 3GMMB 4LRIA 2D0FA 3CAFA 3ZKXC 1JWUB 5ISZE 5BCAA 1A6AB 3BUYA 4JFHE 5F7DB 2MMXA 5CEXA 3EDFA 1H3GA 3BP4A 4X98A 3FRPA 2Z9TA 1INEL 1A1MB 2DB8A 4HCRL 4KRNA 1YC8A 2P5EB 2X70A 3HC4H 4OD2A 3O8XD 5DJCA 3GSXB 5FM5O 2XRAL 5MP6L 3BRFA 5D1XB 1RIUL 5F3BA 1I9EA 4LVEA 4W68A 4BH7B 4FQIL 5ESVA 1CVSC 1FCGA 5BW7C 3FB6B 2X4OB 2BVOB 1EFQA 2DQCH 3O11B 3KS0J 4J3SA 4S1SH 1LK2A 2IG2L 3RX7A 3T0XA 3EOBB 2DBLH 5KVFH 1Q0YH 3CLEL 2IH3A 5EIIB 3IDMB 1OP9A 1I8IA 4HKBA 4X5LA 4WRLA 2P7TB 5EU7E 1YY9C 4KGJA 1XGRA 32C2A 4R2GD 3QDMB 4NM8H 1S9XA 4JO4H 5CLTA 3FQNA 4V1DD 3HUJE 1I3GL 3B2UD 2ZG3A 2BNUB 5E4IA 1EEQA 1KNOA 4K9EH 4F37K 4JM2C 5C08E 1JGUL 4PJ8A 2VYRE 3BWUC 5HHME 4M7LL 4JDVB 4IS6B 3PDOB 1YMMB 4KH2A 4E5XA 4YHML 4LAQH 5HHQA 4OCWL 4K23L 5TE6H 2M2DA 4QRSB 4GRWB 5DQ9B 1B6DA 3O4LA 3QWRA 4XPFH 4C58B 5J0BA 3PQYE 5EBLB 3CFDA 4LCCA 3JTTB 4XCEA 5F7YC 1RURL 4QHMB 2WWKO 2ZWLT 5DHVA 2EYTB 4X7TB 2NY2C 4PRPA 3HAEA 1JF1B 2VDLL 4NKIH 3CVHB 4LSPL 5I75C 5IHLB 5EG6C 1HILB 4LLWA 3RDTB 4NHCL 3IDXL 4WTXA 5C0RH 3VXNA 1Z0NA 5D5ME 2P47B 4U49A 4HXAL 5C6TL 2CUMA 4K3JL 1Z9LA 5J1TC 4LPYA 5FM8A 3TIDA 3DURB 3CLFH 1CE6A 3CD4A 4RNRB 1XCQA 1S3KL 3VFSB 1JTOA 4DAGL 2WMPA 1HI6B 1MVUA 4BQCA 4U2ZA 3KLDA 2J12B 5F7NC 3S35L 4HXBL 5I9QB 5FCUL 1G7IB 4X4MA 1ZS8A 5GS2D 1KELH 3RPKA 4QRTB 1XIWD 3CFKB 5ICZA 1AGEA 4M6AA 2BJMH 4G7VH 3IJSA 1A9BB 1FZOA 3AM8A 3O6KH 2HLAA 3LHPH 3JV6A 3CDGB 4JAMB 3FMGL 4MQ7A 4KROB 1KSRA 5EFIB 4GRWH 2NY6D 3RPIB 4G6AD 2EEDA 4ZFGL 1BF2A 2VLJA 1RIVL 5GSRB 5KVGL 5GJTH 1FC1A 1PSKH 2JCCF 3CFEA 3T1FB 1FVDB 1T7YA 4Y7MA 4KDTC 2W60A 3PABA 5C0BA 1BOGA 2BOBA 4M6OL 2Z8WC 4ZO8A 5TF1L 4BK5A 4Z7VF 3DVGA 4U0RB 3SGEH 3LKSB 5I2IB 3BISA 4DFIA 2FGZA 4JFOB 1WWBX 1UWEL 2KH2B 2IWGA 4AENA 1EMTL 5D2NC 5KS9F 1V3LA 2P8PB 1X7QB 4MD5B 4MJIE 3DTXB 1ZTXL 4UQ3B 3RWJB 2R15A 1NANH 3T0WA 1DSFH 1KCKA 1LDPL 3WFHB 1A2YB 2B7DT 4NNXB 1XT5A 5D7KD 1LO2H 3KPSD 1BPVA 4BFEA 3IDGB 1BIIB 3O8XC 1TZIB 5EOCH 3JBG7 4X9FA 1F02I 2VL4A 2BVOA 1WFTA 5F7EH 1W0YT 3N0PB 3RZCB 5T1MB 2HT4D 4PJFB 5HVFB 1WVZA 4P4RA 4Q6IA 4XP1L 4LVHB 1EUTA 4YDIL 5FB8B 1NMBH 4B41A 1MAKA 5CEZH 4FZEH 3G08A 3O9WA 5I1DA 4Y88A 3L5HA 5K93A 1UM4H 3CFJB 5L8JB 5B39B 4LHUB 4K3DH 2BSSA 1Q38A 3OSKA 4Z95H 1F3JB 2HWZH 4R2GC 2C3VA 4JZJC 4DN3H 1DE4A 3RTQD 1NCAL 3BQUD 2VDPH 1RU9L 4H0IA 4FFVC 3GSRA 4YIQA 3TO4D 2VAAA 1E6OH 5C09E 3B2UC 3PDOA 4I18C 4NJAL 3C6LB 2AERT 5ETUB 3V0WL 5B38A 1N5YL 1BVKB 4Q2ZB 1EJOH 4F9LA 3P9MA 2A83A 3TBYB 1R3LA 5B4MD 1HOCA 1S78D 2C1PB 3ULVH 4JREC 2HT2D 3CX5K 2O5YH 5C6WH 1WT5A 1HHKB 4YDKH 4MNGB 4X7TA 5IHZB 1E4KA 4M1DH 4MYWB 3BT2H 5TE4H 5I0DA 1IC4L 3GI9H 1HILA 3BPOB 2HVJB 3MYJB 4U31A 2ARWA 2R8SH 2IBZX 2PYED 1KFAL 5CBEB 2VLKE 3MV8D 3RA7H 3S34L 3T1WA 3PWNA 3FQTA 2H8PB 1MH5B 1H0DB 1UENA 4KFZC 1XFPA 4NJ9L 1NH6A 3D2UD 4XNZC 4PBWD 5D7SH 1GOHA 3DURA 4HIEB 4N0FA 1AXSA 2X4PB 4RNRA 3MMEA 4HPYH 5DD5L 4L8BB 3MXVL 1TJIL 2FJGB 4JHWH 5C07E 5F7HA 3NH7H 3MRIB 2BCKA 3SE4A 6FABL 5ID0B 4Y4KB 4LNRA 4N1EA 1Q9LA 4U33A 1NFDA 1G7IA 2LFGA 4QXUL 2X4UA 3KGRA 4ZD3L 3NCEB 5C2BL 3DGGA 2CDFB 3GMPB 3VE0B 1CGVA 2DRUA 3SGJA 5GJSL 2FX7H 1V8HA 4JAMA 2BVPB 1XIWC 2ZUWA 5GGQH 2D7PA 3HG1B 3UAJD 5E5UB 5I19H 4JPVL 5JW4M 1CLZH 4K94H 4P2RE 4MA1B 4KMQA 4PJ7E 1NBZA 2ZUSA 2NY6C 2IH1B 5HJ3B 1E0OB 2M1KA 1NAML 2APBA 4PG2A 2X1PA 1LO5B 1I7RB 1MCQA 3B9DA 2MTPA 1MWAB 3SDCA 2EC9U 3D5OF 4PRNA 1F6LL 5ECJE 5IHBA 2OX5A 4U6TA 2I24N 2BXZA 2VLMD 5I2IA 4JG0L 1T83C 1CG9A 3BP7A 4M8QA 1CDIA 2J88H 15C8L 3SQOL 1AFVH 5CZVL 3QDJD 1YEEL 2VDNL 3EO0B 4HX1A 3TT1H 4NC1E 1QSEB 4FQLL 4MD5A 2GSIA 1JF5A 3DTXA 4NKQB 3RWJA 4LSDA 5I30H 4DKDC 4Z18A 4MA7L 4DCQB 5ICYA 2COQA 3IS1X 3WFHA 1LP9E 1X5KA 4Y5VB 1QSFB 2OJZH 4K7PL 5DK2A 3BPNC 4RMVA 4YO0B 1WICA 3BD5A 1IM9A 1FRGH 4P59H 1HH6A 1S9WB 3RZCA 2L7UA 4NYLB 3BW9B 4JFZH 1CQKA 2NY0B 4C55A 3CMOH 1KPVB 1AGDB 3DV6A 3OZ9L 4MGXA 2AI0L 4NKMB 2B4CC 2HT4C 2VLRD 2R29L 4ZYKB 5CD5D 4P2QD 1INQB 1QFWI 1DDHA 1PYWA 5DJXB 4X6DB 5KSAD 2XNAA 4Y8AA 3NIFF 3CFJA 4TVPH 5FYJU 4OIIH 4RGOL 3O3AA 3WHE0 5FF6B 2DMCA 1ZXQA 4LKCB 1DL7H 4G9FE 1ORSB 5LCVH 3OKKB 1KJMB 3NTCL 4L3EE 1UXWB 1RZ8B 1YECH 2J8UA 3BIKB 4OM1L 5TE7H 4CVZB 5GGVH 1I8LA 7FABH 3C6LA 4XNXL 2K9UA 2XFXA 1MWAH 1WLHA 1AE6L 3HR5A 4PLNC 2DYPB 3RTQC 1VACA 4QRRA 1BX2A 3LD8B 3HI6H 3TO4C 3ZTNH 4EXKA 4M5YH 3UO1L 4H5SA 4X6CB 4Q6YA 4XMKH 4G80B 1FZKB 3U9UB 3WNOA 1FVCB 1A14L 3VW3L 1X5JA 3KPTA 4IDJL 5B4MC 1S78C 4MNGA 4KK5D 4Y16A 2E3VA 2HT2C 3C8KA 4NQCB 3X3GL 2DQIL 2PTUA 5AYUH 5IB1A 2R69H 3DX9B 2GJ6D 2HVJA 1EFXB 2A9NH 2BK8A 1YMHB 2W9EH 2R0ZH 4K8RD 3EYQD 4Y89A 3V6ZA 1U8OB 2H8PA 4GS7B 3FOMB 1QFUH 4NFDA 1U3ZA 4JQXA 1T03L 3C2AH 4I0KA 3QISA 4QWWD 3U83A 5FYKU 4YHPB 2NXZD 2P5WD 4XAWH 4L8BA 2XWBB 5HYJB 5D8JL 2QKIB 2VIRB 5FUZL 4TUOA 3CDYA 5DEFB 3KXFD 4PBXA 3V7MA 5IVXB 1C12B 3U4BH 1A0QH 2ICWI 4ELMA 4LLDB 2DLHA 2YC1B 4Z76B 4JGJA 1J12A 3ZLQC 1S7RA 2BOCA 5GRUL 2Q86B 3STBA 4MAYD 2XACC 1BQLL 5KN5B 1A6ZA 1A5FL 1UACH 3BJ91 2BVPA 5CJXC 43CAB 4PREA 4NRZB 3ELAT 3ZSTA 1I3VA 5BQ7B 3ISWA 1IGFH 2D4FA 3O2DA 3PP3K 5DMIL 4YEEA 1U8QB 4C4KT 2F58L 2VUOA 4ZO7A 1N5AB 3UAJC 2IH1A 1X5YA 4R3SA 5C2UB 4ODBD 3S88L 1DBMH 1U92B 2D4DA 2DM2A 2KKQA 3UZEA 3QEQB 1ZMYA 3W2DH 4HUWB 3U9PL 2ZCHL 2HVKB 4O4YH 1MRFH 3VI3F 4NDMA 3MA9H 3DI2B 4QHUB 5GS3A 4L5FH 4MA8L 4C83A 4AT6A 3AY4C 4EBQL 1AR2A 4LSRL 1B0RB 1NEUA 3G6DL 3GHEH 1CDBA 3NBNA 4YWGH 3PHSA 1OAQH 1RZ7L 5EPMA 5AWNL 5HD8D 2NX5A 4MB5A 3I6LD 3ILQD 3A6CH 1CFVH 4YHOH 1KCUH 1F6FB 3IFPA 5HYEA 5IG7A 3I50L 1XH3B 4YPJA 5D7IA 1JNHB 4U1KB 1FO0A 5EBMB 1UM5H 1IARB 5E1HB 4XT1C 1E4XH 1FFOB 4TUKH 1OL0A 2VZ3A 1AO7A 4XBPA 5AZEH 3GIVB 3ZE2E 4ZXBD 3MV7D 3GK8H 3ULSB 4I0PB 2X05A 1BJ1H 4YDLC 3QJFB 3IVKB 3EYFB 1DEEB 3X13A 2V5SA 4XBGA 1H5BB 3CFCL 4JHAH 5F7FA 1C7SA 4Z0XB 1TITA 3QFDB 4DFHA 5EOQL 2A9ML 2EE2A 1W8OA 3Q5TA 2YWYA 4ZPVA 5CD5C 3NN8B 4JZNB 1L4IA 3QQ9D 4LGPB 1JNJA 5KSAC 3KPNA 1F13A 4JEGB 4FQXD 1FN4B 3T4AA 2LTQC 4WHTB 3FB8B 4LHQB 1A3LH 4QEGA 5EDXA 4RMRA 1AQDB 3LIZH 2ENYA 3MR9B 3IAPA 1P1ZB 5I1EL 3VD7A 4WGWB 2AGJH 4D9RE 3PF2A 3VG0H 2ARJA 3HHRB 5KVMC 2VZVA 3S5LB 1NCWH 1YEHL 4RIRB 1FZJA 2B0SL 1FZKA 1TFHA 3QUZA 3U9UA 2FBJL 1I3UA 4PRHD 1ZHKA 3BKML 1T1WA 1HYRC 4W4OC 2YN5A 2O5XH 4KTEH 2DJSA 4Y5XB 2Y6SD 3QI9A 5GZND 5BS0D 5FDWB 4NQCA 2BNRB 3JV4A 1YN7B 2GJJA 2X2YA 5C70A 3P4OA 3SJVE 1XGTB 2H26A 4HS3B 4NNYA 3RL1A 4KK5C 4FFYL 3RWEA 4LEXH 4WFEE 2HKHL 3OAZK 2PO6B 4PJCF 5JUEH 2ADFL 4K8RC 3EYQC 1D5MB 1WCBB 1KJVB 3LQAH 1UZ6E 3QZWB 3PGCA 2XZCH 4QWWC 1MHCA 1UB5B 4PJDB 3N85H 5I1KH 3O3EB 2NXZC 4Y5YC 4JKPL 4LQFL 4RX4A 2PN5A 3ABZA 5EO1A 4QYOA 1ED3B 1QRND 5IBLD 2DMBA 1SM3L 1URLA 4RRPA 5HDBE 4MS8D 3U7WH 4GG6F 1YPZA 2I60H 4OLWH 3I3EA 4GAGH 1JFQH 1SEBA 5DUBB 4NCC2 5ACLA 5HDQL 1JRHH 1OOAA 2EIEA 2JK5A 4MAYC 3D85D 2BVQA 2VLJE 4PY7B 4PGBA 3QEUA 4NRZA 2AV7B 1RUPL 2YHGA 4LLYA 4WWID 5ABDE 1B0WA 2CDEB 1N5AA 5B3JF 5C0BE 2R0LL 5F9WC 3MCLL 4S2SB 3RNKA 4ODHL 1VKXB 3BPLC 2O5ZH 3WHXA 1NUFA 1BJ8A 1OAXL 2J5LC 4DEPC 1U92A 3T2OA 3E2HB 5FO9A 3CK0H 3T3ME 5CKAA 4WW1A 5IMLB 3W81A 3P4NA 5HTSA 3GDBA 3Q6GL 4HQQH 5I1CH 3GSUA 4DGIL 4LCYB 1ZLWH 4BQ6A 4Z7NF 1TPXB 2ED7A 4L3CB 1BD2B 4JLRB 43C9A 3ES6A 5IOPB 3GZKA 3SGDI 3U4EA 2P5EE 4G7YL 5E24E 2NXYD 5DYOB 3VWKB 1PG7W 3BEVA 4J3OC 2Q3AA 4JGUA 4FP8H 3EOTL 2R2BB 4HEPG 5J3HD 5F1OB 2YSSB 4IRZL 2A38A 2V7NB 3OB8A 4LDLB 3QQ4A 3WUWG 3UTSA 3OKDA 3QIUB 1T0MB 2A1WL 3E1F1 5KTEH 5JLZA 1JNHA 3JWOH 3QDGB 3ILQC 1JYNA 5ID1A 4LP5A 1FNSH 4TNWF 3RJDA 1LE5A 5DC9B 1VFMA 4RGND 5JIKA 1NC4B 1DFBH 1AKJA 4JRYD 1RI8A 1OCWH 3ILPB 4I0PA 1KENH 3EYFA 1CL7H 4UBDD 5H94B 4K7FB 5AZ2L 3BJLA 1F58L 4JY5H 4ODUB 4YHKH 5I17A 4ZXBC 1DLHA 5C0GB 2Y25A 1INEH 1OF2A 1CFNA 4NBXB 2YPLA 4HCRH 3B5TA 1H3VA 5A16B 5BOZG 2HTLD 3NN8A 3TNNB 3FTGA 5MP6H 4KY1L 3K4DA 3N9GL 4I8DA 1RIUH 3P9LA 4LCWA 3RVVD 1JWSB 1YMME 2IALB 5K59E 2YS4A 3QQ9C 4LEOB 2BVUA 4GRWE 3RNQB 4FQXC 2Y06L 3MRFB 4EDWL 3MA7B 2OTWB 5JORA 3D69A 3FRPG 3CX5J 1TENA 4N0UA 2IG2H 4LF3A 1IAIL 4Y1AB 1IKNC 4OM0L 5DD3L 3CLEH 3WS3B 1MFCL 5L88L 4ETQB 4JM2B 1HNFA 3UJIL 3NABL 4BK4A 4KJWD 2A6IA 3VD9A 4M93C 4ODSL 4ODWB 3VMNA 4Y5XA 1FL5B 1FCCA 1C1EL 1CCZA 4P46D 3MRDA 3V5HA 5KSBB 4WTWA 2V9QA 1I3GH 1J05B 3BVNB 1KJ2B 4IIQA 1XGTA 2Y6SC 5GZNC 3W0WD 3MRCB 1RSFA 3OXRB 3BH8B 2FX9L 5ITBL 4OZIB 1JGUH 1QACA 5CHNA 1MAML 4M7LH 1A6VL 1JN6B 2AK4B 3WKML 4LLQB 3BPCA 4OLVL 4YHMH 5IWLA 2NY2B 5BZDA 4OCWH 4K23H 3MNWB 1KJVA 3AROA 2JJSC 3AU1B 5I75B 4XB8A 4Q9CA 1M7XA 4NKDA 5F1IB 2P8MA 1GGIH 1RURH 2GT9B 4XP5L 2AQ1A 2CKNA 3FN3A 5DMJB 1MJ7L 4YPGB 1Z5LA 2X44D 3TH3T 4DW2L 4NQSB 2VDLH 3BE1L 1LDSA 1D6EB 2FNBA 5T5NF 4U6HA 3ZDXF 5CEZE 4U3XA 5DUBA 5CSGA 3RVTD 4NHCH 5IBLC 2HFGH 5DJ8A 4OLYL 5J8OA 3IDXH 4MS8C 1F11A 3P2TA 3D0LA 4HC1A 3GBML 4HXAH 1C7TA 2AJ3B 2AV7A 4K3JH 5C6TH 3BZ4A 3FFCB 3TO2A 2XZZA 1HH9A 2CDEA 1ZHNB 3IGAB 3SY0A 2R1XA 4E9LA 1MJUL 3HAEG 4OUUB 4S2SA 3ARDA 1EO5A 3RX8A 4DAGH 5JPMA 1JJUA 1CXFA 1YEJL 2EYSB 3OGCB 4U1NB 5IMLA 4LCUA 1F00I 2UYLB 3S35H 4HXBH 3L7EA 4KI5D 5F70A 4HKJA 2F54B 5FCUH 2D31B 3FQUA 1KJ2H 3BOVA 1FAIL 2C3WA 1YJDL 3H3KA 1BD2A 3ULVE 1IL1B 4LPUA 3TC9A 2X9YA 1MHPL 3C8HA 4Q7DA 2ICCA 1NDMB 3FMGH 4LKXA 2GAZB 4PJEB 4OIAA 1U3HD 1G7HB 4S1QL 4ZFGH 1RIVH 5SWSA 4GRLA 4HUKB 3TCXA 4APQA 5KVGH 2NXYC 3QIUA 2J8HA 1BQHB 5HHNB 5J3HC 5BVJB 3MV9D 2OM5A 3QDGA 1T1ZB 3ARED 1HXMB 2UVFA 3QUML 5D2NB 5I1LB 1C5DB 1CIDA 4F9PA 3ZT5A 1DQJA 5E6IA 4M6OH 5KG9A 2XOTA 4KWUA 5TF1H 4M7ZC 2VXQL 3HNSL 4FXKA 5F93C 5H94A 3TZVA 4LVOC 2DQDH 1EZVY 1QA9B 4RGNC 1WISA 4XP9H 5BW7A 3O8XB 4X5XA 3IU4L 1UWEH 3GI8H 3DX8A 1EMTH 3QULB 4UBDC 1G7JB 3KLAA 2DL9A 4JRXD 4F7MA 4MB4A 5D70L 5A16A 1WZMA 5F88A 4PV8A 1IGCL 1LDPH 1XR8B 3L95B 2RBLA 1EBAA 2CK0L 4KAQH 3EYVA 4BELD 2IALA 5DJAA 3W5NA 4Q0XL 3LKOA 5I0ZA 4TNWK 4OKDA 2FZ3A 4NSKA 3RY4A 4LEOA 1RHFA 1TJHL 4M9OA 1JZ8A 1MHEB 1DLFL 3KS0H 1H3UA 3MRFA 3RVVC 4OZFA 4PJIF 3STLB 1I1FA 2OTWA 3UJTH 4P23A 4M62L 1K6QL 4U6YB 5JOFB 5KS9A 4R2GB 3QEHB 4JZJB 4PJGB 3WS3A 4XP1H 3LKNB 4ETQA 4Z8FL 2EDQA 2IPUG 2Q7YA 4KPHL 1I4FB 3Q0HA 4WUUD 3VGGA 4V1DB 4MNGE 4I18B 4WY7L 3DPBA 3WFEL 1Q9KA 1T6VN 3HZYB 1JPTL 2QQNL 4KJWC 3QG7L 4JN2A 4C4KO 4GKNB 2EZ0D 1NSNL 1ZA3A 1HXYB 2YD9A 3RL2B 3C5JB 1NCAH 4P46C 4JREB 5FGBA 1RU9H 4XXCC 4EN3D 2EDKA 4NBYB 1PLGL 1JN6A 1OGTB 3DX7A 1FDLL 3QSKB 1QFHA 1CXKA 1N5YH 4PJXA 4YK4C 1MCNA 4NO5A 5EUKB 1EK3A 4DGYL 3EDJA 1JHKL 3AU1A 1QR4A 1PW3A 5CGYD 3DXAA 3GMOA 9CGTA 5HSFA 4PRAB 1H3WM 4N0CD 2V7HB 4JFPA 3N1GC 1NAMB 4B50A 4XNZB 4YPGA 4NPYB 1S9YB 1ETZB 3BKJL 5B38G 1FGNL 4F7TB 3GO1L 3PWLB 2R1YB 4KQ3H 2ZNWA 3IYLW 3WEXA 5T3ZD 1KFAH 3S34H 4JFXA 3F6LA 4TVPE 1HHJA 4NJ9H 1D9KA 3RVTC 4GOSA 4EI5D 5I1HL 5FKAA 4UI2A 4ISVA 3REWB 1UWXH 3DVFA 5CCKH 3MRBA 5DD5H 1FNGA 2HJFB 4UDUA 4HPOL 3MXVH 5GRJL 1OB1B 1TJIH 3NIGF 5IFJB 3F7YA 4DTGL 1J0JA 2EYSA 2Z91A 3INUH 3GGWB 4WFFD 2QL1A 4MLIA 5LGJB 1XIWB 3VXQB 6FABH 5CP7B 3TWCL 2E7HA 1NAKH 1VFAA 2D31A 4MD0A 4D0DA 1E27A 4ZD3H 5C2BH 3GMRB 1O0VA 3WS6A 4KI5C 4ZG1A 1FORL 1WZLA 2NY6B 1QSEE 4AZ8A 5GJSH 1MRDL 5J13C 3TF7C 3AGVA 5DUPL 4EEEA 4X80L 2A6DA 2G60L 4S1DD 1QSFE 3MUGA 4JPVH 1KN4L 3HMXL 2E8ZA 5DJDB 1I8MB 2EDWA 4UU9A 3VFTB 2EXYD 1BQHA 3ARFD 3QHZL 1DQTA 2ATPA 2K7PA 1U3HC 2IANA 4I1NB 4Z7UF 1TVHA 3SDXF 3ZYZA 4FMFA 1NAMH 5D2NA 1C5DA 1JGEA 1FJ1A 4KKBD 4OUOA 5C3TA 3QFJD 1FFPA 4WO4C 5GRZA 4FA8A 4JFEA 3WIFB 3ETBF 2F8OA 1M1SA 1CFTA 3AREC 1EZVX 2I25N 4JG0H 4J12A 4X6DE 3SQOH 4KZEL 5CZVH 2XXMB 1YEEH 2Z92B 2KL6A 2VDNH 3BPNB 3BYYA 2CMRL 3TN0A 4FQLH 5B8CA 5K9JL 1XF1A 3KPSB 3SDAD 2Y9RT 3BKCH 2ITCA 4ZNEE 2VE6B 3EJYD 5E8PB 1FNEB 5BZWB 3U36A 1F4WL 1ACYL 4Q58C 5GS2H 3OKNB 4K7PH 1OT2A 4R0LC 2E7LC 4LSQL 3STLA 5I73C 1NCDL 4PR5B 2FX8L 3V6OA 2VN4A 1EHNA 1JTTA 4XWGL 1MCJA 5INCA 5F7LB 3LKNA 5D2LB 2BC4B 1I4FA 3MGOB 1A6TB 1AP2B 2HT3D 5E5MA 2AI0H 4LLUA 3DMMD 2R29H 4I5BB 5T1KA 4I18A 4WU5B 5E2WL 3QNYB 4JG1L 4NQCE 3RTQB 3BQUB 5E8EA 5F89B 4RGOH 3TO4B 2GKIA 1EGJA 2DJUA 3RWIA 3VFPA 1XF3B 1HXYA 5E4EC 3MOAH 2R1WB 3C5JA 3TIEB 5SX4H 5I76A 1G0DA 4XNXH 1CTNA 2EZ0C 4KC3B 3V4UL 1K85A 4FXLA 4EN3C 4KVCL 5HYJE 4LSSL 4U6XA 3FRUA 1JNLL 1ZGLB 1BZ9B 1EH9A 1SJHA 2WUBL 3UPAA 4L1HA 2APWA 3MREB 5FV1L 2XIDA 5IVXE 5AG9A 1MIEL 1A14H 4B53A 3G5VB 1UJTA 4WTZA 1ZK9A 5CGYC 5EC2A 3OKLB 1RJYA 1ETZA 2PYEB 3TYFB 4N0CC 4B5EA 2D2OA 3MV8B 1EAJA 3DIFB 1INDL 4ZQKB 2Z31D 2B4CH 1K4DB 3D2UB 4OCMC 3KG5A 1CGSH 3ROLB 4CDHA 2OR9L 4LCIL 4QXWA 3V52H 4P5TA 4PP1D 4RFNC 1S7XB 1T03H 3O3BB 4MNQD 4TOYH 2AJVH 5DLML 3JWDL 5IFHH 4KXZH 5IVZA 3U79A 3UPRB 4CUCA 3BWAB 4HMCA 4EI5C 1OB1A 5D8JH 3VXRA 3S6CA 2XN9A 4X6EA 5FUZH 4HKZB 4P2OC 3QEQE 3RFZC 4EI6A 4GUPB 4X7FC 4M1CD 1OAYL 3V95A 4BA8A 3FL7A 1QYGL 3O6ML 3HUJF 1ACZA 1IC7L 2OR8A 3JTSA 4HF5L 5GRUH 3RVXD 3SE9L 2BNQD 1PQZB 1JHLL 5FO8B 4JANB 1BQLH 1RIHL 4RMWA 4OFVA 1A5FH 2KBGA 4OLZL 2X89D 4ALAL 3SPVA 3CFBB 5T1LA 4XPGL 3LN4B 4FHBD 3TA3D 3EFFB 5BMFL 3S3SA 3T77A 1AD0B 2DWEA 1A9EA 5DMIH 4CVUA 1T83A 2CLVA 2F58H 1G6RA 2BX5A 1RUQL 1KLFA 4S1DC 3S88H 2EXYC 2E6JA 1W72B 4NZUL 3ARFC 1L0XA 5T3ZL 3LSOB 2DQGL 2W0LA 3QDJB 1S7WA 3RUGB 3U9PH 4KKBC 4W6YB 4LIQE 3MLTB 3VMPA 1SEQL 4ODVH 3I75A 1QSZA 3UYRL 2VSCA 3S7GA 2DIBA 3L3OB 1F5WA 4MA8H 1X44A 3D39D 2Z92A 4EBQH 3D9AL 3UTZB 4LSRH 2Y7QB 5IMKB 3G6DH 3NZHL 4JCLA 1DUZB 1RZ7H 3KPSA 4PRID 1PBYA 4KJPD 2CO6B 5EUOA 2WZPD 3C5SB 1XCTB 1FNEA 3FQXB 3X12A 4YDLB 3ZHKA 3AS1A 2F53D 3I50H 3QDAA 3SDAC 3QIBD 1IGJA 2BMKB 4X6FB 3N06B 1UEMA 3EJYC 4GMTL 3OGOE 1GXEA 1OM3L 1J1OL 4QRQA 4ZAKD 4ONHA 4BSJA 2QQQA 3PUCA 4UNTA 4NQDA 4YHYC 3U2SB 3EFDH 1KEGL 2VLRB 4OZ4B 1WC7B 4P2QB 4O2FA 3T0AA 3RWFB 5KSAB 1XF2A 5DFVD 3SBWC 3MGOA 4IBLT 4R7NB 2LTQB 3AS3A 4JKMA 1N3NA 1IGIL 3L3DA 3CFCH 3S4SB 4WU5A 2EEAA 3E8UL 5D4QA 2BNRE 5EOQH 5SWZA 2A9MH 5EA0L 4I9WD 4TNVF 3QXVA 2HT3C 5F89A 1MCPL 3DMMC 3TO4A 4NQVB 1X6LA 3PNWB 4CMHB 1KTLB 5A2JH 2JJVA 1A1OB 1KPUA 4NQTA 4XGZB 2YEZA 2R23B 4V2CB 4EUPH 1U8HB 1KIRB 3AB0C 4HGWB 3GMNB 4PGCB 5I1EH 5TGBB 2FJFB 4G3YL 3MJ9L 4F2MB 1UVQB 2J6EL 5EU6D 1J18A 4PJDE 5GS1A 5DJ2B 4CVWA 1YEHH 1U41A 2B0SH 4TULL 5HYFA 5GRVL 5ILTL 4LP4A 2R2EB 4JDZB 3G5VA 2GJ6B 2MOVA 2RR3A 1RJZA 2NYYD 4HZAA 3RWCA 3P77B 4JGMA 4ENED 3Q3GB 4XB7A 1IRAY 1VESA 2UUDH 3ZMRA 1PJ9A 4M43L 3MFFA 4FFYH 4OZHA 4PG9B 2XWTB 3ESVF 4I77L 1NBVH 2NXZB 5DT1L 3MOQA 2HKHH 2P5WB 2X40A 3PL6D 3SDDD 2Z31C 3GBNL 1G1YA 3TBTB 3V0VB 3QIWA 5MENA 4MJ6A 3TJEL 1H15B 1HCVA 2A6JB 1OSZA 1CGUA 3UTTD 5IGXL 3KXFB 3DV4A 2GUOB 3MX0A 4PP1C 3GEWB 4G6KL 2EDYA 5EZJA 1LEGB 4HKZA 4M7LT 3A0OA 1S5HB 2X9WA 1I9JL 4MAYB 4PLKD 4JKPH 5JXEA 3D3VA 4LQFH 1RZKC 4ZFZA 1T2QL 3B8YA 1PGRB 5EO9A 1N59B 1SM3H 2ESVD 4XVTL 1BD2E 4FTVA 4DUXA 3P30H 2ZKHL 4PJCA 1BM3L 5F9WB 4M1CC 4WHYH 3BPLB 5E2UL 2JE8A 5HDQH 5IW6B 2J5LB 1RY7B 4D0CB 4DEPB 2HLFC 3RVXC 5C0ND 5J56B 3VMOA 4MMZC 1ZHBB 2GTZB 3LN4A 5SWSE 2MFNA 4U1MB 5DVLA 1OP5K 2FWOB 5J12C 3IFLL 2Y4SA 3S35X 1IMHC 5EOTB 1AD0A 1RUPH 3U6RB 3PWVB 1U8NA 4PJAB 1S7VB 3QNZB 1XGPB 1FG2B 4LBEA 2AW2A 3VXOB 2NMSA 3QDGE 1WAAA 3ZT6A 4DWHA 4RRPG 5JQ6L 3TA3C 2R0LH 3HFML 3MCLH 5KSVB 1IZKA 4ODHH 3HS0A 5DHXB 4ACPA 1T22A 4D3CL 1OAXH 4XPBL 5C0AA 3R06B 4EUPA 2VOTA 4JFFD 3VFRB 1KTDA 1TVDA 2BVTA 4K8RH 3X11B 5I1AB 3Q6GH 1KB5A 3LCYA 5E00A 3UC0L 2P44B 5TDNA 1KT2A 4OCLC 4X9BA 3EJZD 4JE4B 5SWQB 1IKFL 1G7PA 3K0WA 4D0BB 5D7LD 4R6UA 4ZOBA 5F1SA 4U05A 1UGNA 4LAJH 1RZKL 2WIIB 4Y19D 4G7YH 2WINB 4GG8A 4HW6A 1J1XL 4OF7A 2QV2A 4N8VB 1RHHA 3O4OC 2GITB 3FB7A 3M17B 1F90L 1HSAB 1UZ8A 3OR6B 3SO3C 1ZE3C 3DX6A 1KLUA 2EKSB 5I74C 3VXMD 4KJPC 2A1WH 1B4RA 3MBEA 3WL9A 4ZXBB 3MV7B 3MODL 2GHWB 1YA5A 2Q8AL 2X09A 3QIBC 4Y1AE 1WC7A 1KJ3L 4W81A 3HN3A 4DKEH 2FHBA 3O0RL 3JUYA 5E8OA 1JK8A 4ZAKC 2V2XA 4R7NA 1F58H 1G7LB 5EBWA 1SMAA 1RVFL 3QEGL 2D3VA 5DFVC 5J6GB 1AGFB 4OCNC 4FQXB 5D6CA 2EH7L 2AQ2A 5DRWB 5LBSL 1RUKL 1CGWA 1SJEA 3D0VB 4MJ5A 4PGZA 5EU5B 3T04D 5E8NA 3BUTA 4R97C 1A1OA 2V5RA 3GM8A 2V6HA 4M93B 5TF0A 1ORQB 4H0HB 4ODXB 1XGUB 4HV8B 3FO2A 2Y06H 3I85A 2P8LB 4PRHB 2C4XA 3T2NL 1UVQA 2OMBA 4XC3L 4WW2F 1ZLSL 1IAIH 1NLBL 4QHNB 2ZPKL 3QUYD 4OM0H 5DD3H 1MFCH 3BEWB 5L88H 5BS0B 3WFBL 3UJIH 2R2EA 3H0TA 4ODSH 1JPFA 4G8EB 4XNYL 1VA9A 4GQ9L 1BVLB 3MRRB 4PLJD 4FG6D 1U3YA 1EVTC 3LRSB 4BYHA 4KDWA 1LP9F 2XPGA 5DGRA 2A0LD 4WEUD 3DGCR 2NYYC 4WV1A 3S9DB 5FO7B 2NW2A 5ITBH 2FX9H 2OQJA 4Y5YA 2AXFA 1P84K 2ZG2A 3ZE0E 1MAMH 2GFBB 1A6VH 2VMFA 3FFCE 3QXDB 3TBTA 3WKMH 3QHFL 3AFLA 2A6JA 4U1SA 1Y18B 3OKEB 1J86A 5DD1L 3PL6C 3SDDC 2GUOA 3D1MC 4P3DB 4XCYB 5CGTA 4IMKA 3VFOB 1QRNB 4L4JA 1IQWL 4PJ9C 4HWBA 5GGRA 1XR9A 2HFEB 3FHQA 4O2EB 1FL3A 4XP5H 1FNFA 4N5UA 3QUMB 5TJWK 4P48A 1MJ7H 1N59A 2W65A 4G9DB 4OV5A 4DW2H 3HR6A 3OHXA 4PLKC 3IFNL 1CZ8L 3D85B 4XX1G 2WP3O 1EO7A 3P4LA 5GHWH 3OX8B 1N6VA 4D0CA 4F33B 1G9NC 1BFTA 4BH8B 3TP4A 3TBSA 1GZQB 1KV3A 2VH5L 4U1MA 1HEZB 1XF4A 3OF6A 5EOTA 3U6RA 3PWVA 4PJAA 1S7VA 3QNZA 3OG4B 5C0NC 3G5ZB 4L4VD 1DN2A 2IANE 4RA0C 4YR6A 3TM6A 1MJUH 5C0DA 1VDGA 1GL4B 5D2NE 3R4DA 1J10A 4OTXL 4WEBL 4NKOA 3TYGL 1N64H 1YEJH 3BH9B 3KAAA 3P11H 3VFRA 1JGVL 3TCLA 1K5NB 4QHLB 1NUGA 4O5LL 1QKZL 3IS0X 4NM4H 1J0YA 4UOW1 3O6FA 5SWQA 2NXYB 3MLVL 4YXLL 1YJDH 2X4RA 3DLQR 4TVSa 3WN5B 2CLRA 3A67H 1MHPH 1CDUA 4DGVL 1ZHLA 3K4ZA 3EJZC 2WINA 3GBLA 5T1DL 1DVFA 4HS6B 4N8VA 3C08L 3IDUA 1D5XB 1MFBL 4JQVC 5HGDA 4NZJA 4S1QH 4KK9C 3X3FL 4I48B 4ZUSA 4M7ZB 3VG9C 2IGFL 1J8HD 3S37X 4LVOB 1QBML 4RGNB 4NQUA 2NTFB 4CL7A 2DOCA 4JRYB 3IDJA 3Q1SL 1FYTA 1IZJA 4OZGA 3SCMA 4X4YB 3IU3A 4HAFA 3QUMH 4CMMB 4HWZB 3ZTJG 4HK3J 4PJGE 3RVWD 4R96A 2NPLX 3H9HB 2VR4A 5K9KB 5GRWA 1MHHA 2VXQH 1HHGA 3HNSH 1VEOA 2YUVA 4V1DE 3TLRA 2LV4A 3UP1A 3QBTB 2Q8BH 4ODTL 1BLNA 5F1KC 4POUB 1U8PA 5CFHA 1KEML 1P7QD 4H1LG 4WCYL 5CWSB 2A73B 3ZKSD 3D0VA 5ITFA 1CDCA 2DIJA 1K8IA 5DFTA 4LGRB 4F8QA 1IGCH 3Q6FB 5IKCB 3MLSL 4U6VL 1T20B 5E94B 4PB0L 1ZGLM 2CK0H 1NCUA 5HHOA 2R4RL 2VC2H 3TESA 4R4BB 4Q0XH 1KG0A 2X7LA 1TJHH 3OL2A 3MRNA 4HV8A 4L8CA 1DLFH 1Y0LA 3ZSSA 4HEME 2RFXB 2OP4L 4M62H 1B90A 1K6QH 3G6JB 4QHNA 3DROB 3MJ7A 4D8PA 5A1AA 1IBGH 3OAYK 4HWNA 3ECBA 1Y6KR 2Y23A 4KPHH 4P46B 3VGEA 4GW5B 4Y4FA 5C7XL 1UQSB 5FA4B 3WFEH 3QUYC 1I8KB 3W0WB 4UINL 2XXCB 3LEVH 1I7ZB 4NO3A 5ADOL 2HKFL 1IVLA 2GJZA 2QQNH 3LRSA 4P5KA 3QG7H 4ZUTA 4X6BA 4OZFG 2YUWA 5BRZD 2ITDA 1NSNH 4NZRL 1N8ZA 3ARPA 4PLJC 4KJYB 2JCCB 4FG6C 3VDCA 4EOWL 2EH8H 5E95B 3B3IA 4Z77A 4OIBA 1FDLH 3PHOB 3FFDB 4N9GB 1Y18A 1W0WB 5I16B 5CMAA 4DGYH 3PWJB 3O81A 4P3DA 1JHKH 1ZWIB 1UJ3C 4Z7VB 2E9WA 4ZUVA 5HYQA 3LPFA 3GHBL 4WI7A 3L3JA 2YD4A 4O2EA 1TJGL 1ZAGA 1I1YA 4WWKA 5F9AC 3QUMA 1QEWB 3IJYB 4QRPD 3C60A 3U46B 2CIKA 1A4KA 3V5DB 1QR1A 4LMQI 3ZTJH 1QBBA 1FGNH 3GO1H 2W0KA 5KVFL 1HWHB 1KYOK 4F33A 3KDMB 2VITA 3MOBL 1GZQA 3BX7C 4NQED 4LLMB 4P57A 4KKCD 1M05A 2XTJD 1A1NA 3KNBA 2VQ1A 5CD3A 5I1HH 5IR1B 3G5ZA 5F3HA 2VLLA 3HE6D 5DQJB 5F1NA 3MACL 3MRJA 4HPOH 1A4JB 4WUKL 1M7IB 5GISL 2WW8A 5J9PA 5D7JD 4DTGH 3OJ2C 5AUMB 3ZHLA 1K5NA 3TWCH 4MJ2A 1OTTD 3LEYL 1Q1JH 3OKMA 5MERB 3L7FA 2LAAA 5E08L 1J9CT 2FL5A 4XXDB 3GIZL 1N6QL 3L5IA 1U3HB 4BM7A 1MCBA 5D7KE 1MRDH 3KPSE 5EUOE 3WJJC 2PW2A 2EYRA 4HS6A 3AMKA 3VXTA 3CXHJ 4Y2OA 1D5XA 4WO4B 3MV9B 5DRZB 1BAFH 4X80H 3AREB 2G60H 1TLKA 3HMXH 4AYFA 1UXSB 1WBXB 2XICA 1NDGB 3REVB 1UZ6F 4OAWB 5IFAL 5F9JA 2Y5EA 3EGSB 3QHZH 2NTFA 4S1RL 5GGUA 4JRYA 4X4YA 1B9ZA 2BRQA 2J2ZA 2NY1D 4L8DA 1BFVL 4NQDE 4CMMA 2X4QB 4P2YA 1LO3H 3H9HA 5D2LE 5HDBF 5EU4B 1T5WB 4HIIA 2V5MA 4JFHD 4JRXB 3BFOA 2XI9A 1QHOA 1CD9B 5IMOB 1E4WL 3W39B 3RVWC 3SKMA 3UTQB 4R0LB 3QB7C 2DWDB 5CWSA 5GGRY 3TBVB 5IQ9A 5I73B 3E6FB 2QQLL 2EDLA 3RI5F 2XG5A 3C6SB 1I3RA 1ACYH 1RUAL 4LASL 4P4KA 4CN6A 4E0RB 1AJ7L 3BO8B 1YN6B 4WUUB 1MI5D 4LSQH 3QA3A 4IRSD 1JPGB 1S9VA 2FX8H 3IRPX 1P5UA 3T0ED 4XWGH 5HGBB 3D25B 1X5LA 5E4EB 1CYGA 2LVEA 4P46A 1T0NB 3WMSA 2Z8VC 4XXCA 1CDGA 1J11A 1RJLB 3WE6B 5E2WH 4JG1H 2PYEE 4A2LA 5JHDA 1BFSA 4OKVA 4EN3B 3KPQA 3VGDA 2AXGB 3CVHL 4NGHL 4PGDA 2FD6L 1U8JA 2NW3B 4PJHA 1XZ0A 1VEMA 3DRTA 1KOAA 3MZGB 5A2LH 1R0AL 1F3DJ 3GMQA 5IIEA 1PFCA 3V4UH 2F5AL 4N9GA 4IJ3C 4KVCH 2ZUTA 4LSSH 3PWJA 3ZYOA 3ULUD 1FNAA 5E9DA 4L4TD 3WLWD 2DQUL 1JNLH 3GM0A 1JIBA 1X5GA 1MY7A 2R2HB 5FKPA 3IETB 3PHQA 3VRLF 1MIEH 1XGQB 1IEAB 4Q9QH 4GAJL 4NHUA 1YNTA 4U3HA 1PD6A 1QEWA 4BSVA 3RRQA 3HLAB 3BGMB 2FO4A 4RFNB 3VFWA 4ZUWB 3VXSD 4Y8DC 2MQ0A 5L2JB 5D1QD 5FECB 3S36X 4EI5B 1ZT7A 2GTWA 3ARYA 4PD4K 4OFYA 1ES0A 3PP3H 1OP3K 3KDMA 5K59F 5GPRA 5DUML 1NJ9A 4LCIH 4GBXD 3CFIC 3FAXA 5GSVB 3X14B 1Z9MA 4HWUA 1Q9OB 4G43A 4WTZG 5DLMH 2HA1A 4ORGA 4LLVA 4XMLL 4KKCC 4Z95L 1JBJA 2VLME 1NGWB 2XTJC 5BVPL 3K2MC 1IAIM 2FB4L 5DD6A 3H3BC 4OLUL 4DVBB 3QDJE 3HE6C 3RUGE 5AUMA 4KV5E 5SX5H 5FDYA 3VWJD 3KPPB 4RAVB 5B3NA 4ZDHB 5E1AA 8FABB 4Y2DD 5EZOL 4U1JB 2VL5A 2X4TA 2HN7B 5D7JC 1OAYH 1NQBA 4EDXB 3O6MH 3LKPB 1IC7H 4HF5H 3SE9H 3KPRA 3IDNA 4G8FB 1IAOA 1U3HA 1OTTC 5ICXB 2ICWJ 5CIPA 3LKRB 2YBRA 4YX2L 3STZA 5K9QG 4ALAH 2LU7A 3ARFB 1UADC 4WO4A 4EVNB 4XPGH 4Q97A 1QTYT 3RWGB 4M1GL 5BMFH 5D6DC 3E6HA 2D9QB 3QFJB 1FZMB 4FN0A 4XVSH 5CSZB 2VLRE 1NFDF 5KOMC 4NZUH 5T3ZH 1IGTA 3B9KD 3NCFB 1QO3A 2DQGH 4JFYB 3JVGA 1K2DA 2NY1C 1JP5A 3LOWA 4MQXD 4B7IA 3MRMB 1SEQH 1SYSB 3SDAB 2YD5A 3VFUA 2H2PD 3PDDA 4QOKD 4HPYL 4WDIA 2J7LA 3D9AH 2Q6WA 1TTGA 2O61B 3L3HA 1DQQA 5DS8A 4ZO6A 3NZHH 3VRIA 2DF3A 3F12B 2FYYB 4YHYB 1P2CB 3LRGA 4L8SC 4G8IB 1ADQL 2JB5L 4WU7A 2Y5TB 3MLRL 3G5XA 4FQQA 4NOBA 4GMTH 3BO8A 1OM3H 1YN6A 2EDJA 2FX7L 1J1OH 4TYUA 4AK1A 1QBAA 1JPGA 1KEGH 3DMMB 5TPWL 4XP6H 3OJVC 2D7TL 3VH8A 3GSQB 1GGYA 2I26N 5D5MA 3KYOB 1R24A 3JV5A 1T0NA 4GRMA 4IRSC 1NGYA 4X5WA 1IGIH 3T0EC 3E8UH 1QQDB 2EE9A 2XV6B 3AB0B 5EA0H 3ZDYE 1MCPH 1KLGA 4H8WC 1P84J 1OLZA 3EHBD 3OKOB 1U95B 3AAZB 3CGTA 1JZ2A 5FYLL 3Q2CA 3PWUB 3L6FB 2P5WE 3K8MA 2L4OA 1P4LA 3LEXB 2JJTA 2FDBP 1UH4A 2EDNA 4MA3A 3NFSL 4TRPH 2WWKT 3BZFB 4G3YH 3CX2A 3VA2C 1EVUA 3MJ9H 2J6EH 4ZODA 3PP4L 1MCSA 4ZO9A 1A7NL 4TULH 3O45B 1WZ1L 3N1QC 5ILTH 2FJHB 5CINL 3SKOB 5KSUB 3ULUC 1IEAA 3HC3L 2I27N 3WLWC 2Z31B 1KPRA 1PKQA 3BGMA 1FRGL 1MJ8L 4M7JL 2VRAA 3MRHA 5GGSA 3FN9A 1PX4A 2J8UF 3H3PH 4JPKL 2AV1A 2EE6A 4YFEA 1YUHB 3LPWA 4IOSD 4HBQA 3KYAA 2C4FT 1QD0A 4MNQB 4M43H 4I77H 4P2OA 3MNVA 5C71A 5DT1H 3WFCL 5D1QC 2P24A 1JGDB 4PJAE 4H8WL 5IEHA 1ZEAH 1GJIA 4JY4B 3VGBA 4GBXC 5L2KD 5IGXH 4W6XB 2WBJD 1DL7L 4MJIA 4JZOA 4G6KH 4YFLI 1CFQA 2Z93A 1Z3GL 1YECL 3DO7A 2I9LB 1I9JH 2BNQB 5K9QI 3S96A 4ONGL 3DETD 2SEBB 5J12B 4UMGA 1S7QB 1JV5A 4KQ4L 4HK3N 3S8WA 4XVTH 2PETA 1RMFH 1P7HL 4XVJL 2XQBL 4FFWD 3VWJC 4OFDA 1E6JH 3HRZB 3I6LE 4LARH 2H32A 5JMOC 5F71A 3TA3B 4Y2DC 3NFPA 4N90D 3ULUL 5E2UH 3LKRA 1WFOA 4HJGA 3MRLA 2DQEL 3MJ8B 4R7DA 4I2XA 2N4IA 3ARFA 1JHTB 4J3XA 4CN4A 1ULVA 2ZSWB 3IFLH 4Z78B 3KPOB 3QFJA 1TIUA 3MV7E 1FYTE 5JQ6H 5AYUL 3HFMH 4MDJB 1CXIA 5FK9A 4AIOA 4D3CH 4ELMF 4XPBH 3C5ZA 3CDFA 1NL0L 3H6JA 4Q9RL 1WCQA 1I85C 1I1AA 4G42B 3O4OB 1DTUA 3H9SD 4XNQB 3D39B 4XAKD 1KUMA 3PWPD 3W9DB 2O93L 1JUFA 3SO3B 1A3QA 3DO3A 3MRMA 5I8OH 1IKFH 4UV4L 5I74B 4PRIB 2AS5M 5KJRH 3B9KC 3PJSB 3NCJH 4MQXC 1HHHB 4YHIA 1RZKH 4NT6B 3FT4A 5FHBL 5CSBA 2F53B 3F12A 1QZ1A 4WI5A 1FIEA 1J1XH 3QIBB 4JJ5A 4X0KB 2H2PC 4JO2L 4GH7B 4AM0A 3U4BL 5IB3A 1QLFB 1F90H 3CH1B 1ZGLP 3GJFB 4ZAKB 5I8EA 3RWHA 4JDTH 2UZYB 3QUXA 4OGAD 4HZLB 5K9OA 4PRHE 1EEZA 3MODH 4QXTB 3Q48A 2Q8AH 2CDGA 1BBDH 1KJ3H 2MNUA 3O0RH 5JIHA 5BS0E 3IAGC 3BXNB 2R9HD 4X9HA 5JW4Q 3UBXB 4R97B 4H0GA 4YDJB 1CF8L 1IAKB 3B2VL 3O41B 4M7KH