3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
5BXFB 4QRRD 3I6KA 3MZGB 4KJPC 3DVIA 2R23B 4LLQA 1TZGH 5IQ9B 2VZUA 3DTXA 1J0HA 3MR9B 5I1IL 3KDMA 4RGND 3BWAB 5LAXA 5GGVL 2HFGL 4NHCL 1YNLL 5IW3A 3T2OA 2XICA 1K6QH 1IAMA 3AS0A 4K8RD 2R4SH 2XFXA 5IMKB 3MYJB 3G6DH 2X41A 1WSST 4L4VB 1DQJA 2P1YA 2FLBT 4GO6B 3RNQB 4RZCB 3GJEB 1C1EH 2GY5A 2QKIB 4QRPB 5C0DA 2J6EL 4XNXL 1Q0YH 4MHHI 4EDXA 2DLEA 2NW2A 2XOTA 3SKOA 3ECBB 3KGRA 4UIKL 4TUJB 4GMSL 1AKJA 1A4KB 1MOEA 2EH7L 4WHYG 4YHZH 1NCDH 3O4LE 3K0WA 4CMHC 4LPWA 4Z7OF 4ODVH 5ALCL 2MHAB 2N7AA 3K2UH 3TVMC 1WWAX 2ICWB 5IEKA 1CQKA 5MEOA 2R69H 3QRGL 3WUZA 5DD3H 1U8QB 4MNQD 3SDAB 4RWYH 1J0YA 4YHIB 3LPGA 4X7CC 4HDIB 3AAZB 4ZOEA 4GT7A 2A6JB 1NL0H 3CFCL 5I74C 4I2XB 3RTQD 3HR5B 1LD9B 1TZHB 5KSBA 1MIEL 3GKWL 5C92A 4F8QA 3MGTB 4OJFL 5I17B 4YC2B 4DN3H 3DXAB 3HE6A 2FSEA 3RVUD 3BUYA 3FT3B 4FS0A 4HC1H 5E95B 1UXWA 4JY4B 3GRWA 3F58H 3ARED 5CHNA 5I66B 3VD3A 5L8KB 5H2BB 5ACLA 2ARWA 2QEJA 4P2RB 5LGKA 5HHMB 5HYSG 4BFIB 1N6UA 5C0GA 1X5ZA 2BXZA 2NZIA 2A9MH 4CNIA 4FQHB 1FL3A 2WLYA 1DLHA 2P8MA 4UDTB 4JRYB 3GMNB 3VXRA 1BEYH 3ZTNL 4UINL 5FHAH 5L2KB 4OD3L 1EHAA 3S36X 3KLDA 4TTGA 1NC2B 4H88L 1HXYA 4QRRA 1J7VR 3F5WB 3GZKA 2F8XC 3HN3A 3OKKA 4M1GL 4E9LA 4ZFGH 5HY9B 2H2SD 4X4ZA 5C08D 2RJMA 5TE6L 4OM0L 3HPJB 1SM3H 4JFXA 3BX7C 4Z8FH 2HKFL 4NO5B 1ZLSL 1WBYA 3QNXA 3O11A 1FFQA 2DBJA 4M5YH 1WIUA 2LV4A 2G9HB 3HI6H 1CIDA 4G43A 4NM8H 3X17A 2HA1A 4HXAL 4JFDD 3D0LA 2W0LA 4JO2H 2HJKB 4F7EB 4M9PA 4MQXC 4NNPL 4Y1AA 3ULSA 5HVWA 4QTHA 1CICC 4KV5E 3SKUD 1KPRA 3RVVD 1PG7W 4OZHA 3L5IA 5F3BB 2HN7A 2HRPH 4JPIA 4I3RL 1FCGA 4UUJA 1UB5A 4JKLA 3V6OC 4MZ2A 4FXKA 3CU7A 1JIBA 4LSRH 4PFEA 3NTCH 1A14H 1D6EA 1A64A 4FZ8H 3BH8A 2NQCA 4G9FD 1RURH 3PNWB 4FZEH 5TQ2L 3RTQA 3ISWA 4M5ZH 5D7KD 5ANMA 3L7EB 1S9WB 3BN9C 3FONA 4HWNA 5C0JB 2QQKL 3DRQB 4M6NH 3FFCB 4YIQA 3P4OA 3EOTH 4LQ1A 2AJZA 2OTPA 1G7PA 3V0AC 1S7QB 3C6LB 5D6DC 1T5XA 1YNKH 3MPCA 3BEVA 1W0VB 4HS3B 3PL6B 4N1EA 4JFFB 2OLDA 1K8DA 2MMXA 5J11B 4C4KO 1TQCC 3DWTA 3WO4B 1CR9H 2HMIC 3R4DA 2VRAA 3MRBB 4GKNA 1FNGB 5DYOA 4PJBE 2AV1A 3S9DB 4K3DH 5TGBA 1X3DA 1R24B 3LRSA 1IC1A 4OUUA 3RUGE 3QHTC 3KPTA 3BGMA 3KXFA 3QHFH 5DJ8A 1IC7L 4YZFE 3EZJB 5HYJB 1TENA 4LQFL 4MJIB 1WBXA 1I8MA 2J4WL 1CQYA 5DD6A 3DIFA 4Y5VB 2VXUH 4N8VB 5KZCD 5JMRA 2ARJA 3QCTH 4MD4A 2HFFB 1TCRA 2W9EL 4M8QA 1TIUA 3CFIC 2H45A 1CZ8L 3FFDA 2DQCH 2FATL 1BGXL 1JF1B 3CCHB 1JMZA 3CUPA 4P5TA 3VXOB 1F90L 2VR9A 4QHUB 3BKJL 4GRWE 3P9LB 5GGUB 3ROLA 1SVZA 1GGBL 4U3XA 4X5XB 5JW4Q 2BHUA 4GRLD 1HIML 3MNVA 3FQTB 5EBWB 4Y19B 1PX3A 5B8CC 2LAGB 3DMMC 4NKMA 4Q2ZB 1CLOH 3QUXB 2A77L 3QG7H 1ZLUH 2P7TA 3EYSH 4KU1A 1FFOA 4MAYB 1R3LA 4O58H 1T21B 1FBIH 1GC1L 4FQ1H 1WAAF 4QHMB 3P11H 4KKLD 4Y2OA 1TXKA 1ZHBA 3Q5TA 3BYYA 4BFBD 3BUTA 4U7KA 1CK0L 3QJHA 5SV4A 1V7NL 1Q72H 1DUZA 4XP1L 3TJEH 3GSVA 3IVKB 3EFFA 1CTNA 5IF0B 3IKCB 4MAUH 1QG3A 5KG9B 2XKSA 4PRPB 3ZL4L 4HUWA 2H32H 3KNBA 4ZUVA 4D9LL 1CF8H 4YHPB 4YR6A 5GSRA 4HJJH 3ZHKA 2G75B 3CK0H 3NAAH 2N7BA 4KZDL 4Q6IC 1T6WA 2ORBH 4JY5L 1GOHA 2FBJH 1IFHH 3THML 4HQQH 1FZOB 5C9JA 5AYUL 3JWNC 4NSKA 4Z7WA 3MBED 4W6XB 4Q9QL 1QZ1A 1E6OL 3GHBH 1VPOH 5MEPB 2Z4QB 2FB4L 1GGUA 3QUKA 2YPKB 3PWNB 3VXSA 3EOBB 1Z3GL 3QYCA 3OPZH 3TV3H 4NN5C 4YDJB 1FZMA 3TH4T 4XHQA 3D87B 4N0RA 4X4MA 4EXPX 4A6YA 2XN9B 1EO7A 1I3VA 1D9KA 1Q9OA 3BPCB 1NCAL 3F7YB 1E4JA 4ZTPH 3T77A 4MDJA 4P23A 4H0IA 4OGXL 2OQJA 1Z6JT 2YA1A 5CSBA 4CL7A 1NJ9B 5D1XA 3LKNA 2QSQA 4MD0B 1ODAA 5ISZD 2B0SL 5C0CE 2DQEH 3DUUA 5HTSA 5KS9A 2VDRL 1NGXA 4WO4C 1MCOL 3CC5A 4BFEA 1T2QL 1EFQA 2EDFA 3VWJB 3BZEB 1H3PH 3T3PF 4LPXA 1WLHA 4PRHB 4HFWA 4QF1B 4LPVA 5EU6B 3EDJA 2WW8A 1CE1L 2ICEA 4NC1C 3MLYH 5J12C 5C07D 3D6GA 3PGDA 4QXGH 1T0MA 1P69B 1NLBH 2BVOA 3HTLX 3H3PL 1OSPH 4HT1H 1FSKB 4NO3A 3SGEI 4AM0B 1OAUH 3UEZA 4IOFC 5GJSL 4IRJD 1AQKL 4PJ8D 4P2OD 1KJ3H 1ADQL 1D5MA 1K8IB 4G6AD 4LHJB 2JB6B 5GS2D 4JM2A 4QXUL 5D6CA 5E1AA 4ZUUB 4LLYA 1VERA 4EI5B 1U8MB 3U46A 1IC5L 1LO0L 2WLZA 4PJ7A 1V7MH 4OZGB 1AGBA 5IW6B 3O9WD 2EH8L 4FXLA 1CFNB 5JQHC 4NQTA 3VFTB 5EBMA 2MKWA 3WHE0 1G1CA 2GJZA 1L7IH 4PJXF 4QXWA 5GGTL 2NXZD 2EDDA 1JJUA 3M17A 2IGFL 3CAFA 3U0WH 4TULH 4P9ML 2HG5A 3DBXA 5DJDA 5EC2A 4XNZB 3I75A 3KWWA 5CZXC 4WUUE 1FE8L 4JR9H 2VXQL 5I76A 4K3GA 5I16A 1MWAH 5EPMB 3G04B 3STBA 3VFWB 2ZCLH 4NHUA 3SO5A 1NUNB 3UO1H 3VDAA 4OLZL 2CDFB 1AE6H 3QCUL 4BZ2L 1UYWL 5JW3H 2E27H 3HZKB 3N1FC 1AR2A 3AB0C 2C7UA 2DDQH 4G3YL 4L8DB 4RIRA 5ISZA 1NDGB 3PF2A 2X1WL 5I1KL 1ACYH 4Y4KC 4XMPL 4PJIF 1F4XL 1EFXB 3QFJB 2Y25A 4U4BA 2I9LB 3BE1L 2ENSA 3VXNB 5LQBH 1RVFL 3HUJA 5FYLH 4MA1B 1NDMB 3IDJB 4DUVA 1U0QA 4AIXA 1K2DA 3CFJA 4LEXH 4FFVD 4L4VE 1OT2A 2QSCL 2OL3L 4HLZH 3OKDA 1ZGLM 1B3JA 5EUOF 3WHXA 4GG8B 1KCVH 2H3NB 3UTTD 1HDMA 1MI5D 1NLDH 2YHGA 3QEUB 3GO1H 2EIZA 4FQIH 4OKVA 1EGJL 4K2UH 4ZPVB 1BVKA 2YD5A 2ZUYA 5C0NC 2YD8A 4YBLB 1JV5B 3L7FB 1HYRC 4YDLC 4OSUL 5CSZB 5IM7A 3ZMRA 4JPKL 3VFNA 3L95B 1S9YA 2D0GA 1HWHB 5IMMA 1I9IH 4ZAKA 2O5ZL 1WTLA 1AY1L 3MCKA 3KPLB 3MV8E 3WKML 1PG7H 1U58A 1J86A 1OTTD 3VFUB 2UZYB 5C0BE 5D9SB 1SEQL 4NWUH 2VIRA 4ISVB 4M6OL 1JZ4A 4OI9A 3RDTB 1RULL 5AG8A 4PYHA 3T2NL 3T4YA 1JRHH 3BDYH 4U6TA 4UT6L 2FGWL 3RY4A 3CMGA 4LARL 4D0BA 1ZA6B 1I1FA 2DIBA 3FQRA 4TPRH 4NNXA 4P0DA 2A0LD 2NW3A 3D18A 2F9BT 4ONOA 1RUKH 3TN0D 3VFRA 5FXCH 3AS2A 2VDPH 4HMEA 2P5EE 3EYFA 2UWEA 4LNRB 4JRXB 5CKAA 2H8PB 4L5FL 4V1DB 3GHEL 5DURB 4NQDB 1RK0B 3D1MC 3DSFH 3O6FB 2YBRB 4LSPL 4E0RA 1UA6H 2EIEA 4RFEA 5DQ9B 4D8PA 3QDMA 3U9UB 3VRLF 4YQXH 5GJTH 4RCAA 3WFEH 1AGFA 5CCKH 4U05A 2CO6B 1S8DA 3H9SE 2ESVE 3OKNB 4IRSC 3UDWA 4LLDA 4PB9H 2BZDA 2CRZA 4P59H 5I1EL 5JHLH 5F9WB 3VXQB 1ERNA 4M7ZB 4PTUA 3AY4C 1D5BB 1OP9A 4H0HB 1FC1A 4NQVB 4LPCA 1FLRL 4JHAH 5DI8B 2VR5A 3QXDA 5J6HA 1YQ2A 4J7RA 1FNHA 1EMTH 1BD2E 3CFKA 3JSSA 3U36B 2VLRE 1INDH 4OCSL 1K5NB 5FF6B 3W82A 3KJ4C 3WFDH 4J3TA 4BKLA 5IEHB 3ARDC 1EHLH 1JWUB 1KB5H 1J18A 4RNRA 1MJJB 1ZHKB 4KK9D 2OJEA 3ME0A 1YC8A 3CMOL 3LKOB 4G5ZH 4LHUD 1GZQA 5DUBA 4JPVL 3B9AA 3GMRA 5F8QC 1JZ6A 1NCBL 2MSPA 2X10A 1U3HA 3REVB 1KTDA 3GSNL 4OLVH 1WZ1L 4DW2H 1BP3B 4H5SB 4DVBB 5I18H 5IIEA 2RHEA 4DKEL 3HG1E 5J7CC 2OI9B 3C5SB 1J1OH 4B41A 5JXEA 3NCMA 3QPQC 3A6CL 3VFOB 2Q7YA 1Y6KR 4TOYH 4PLKC 4QHKI 3DUHA 2X4TA 5F96H 3NZHL 2ATKB 3X3FL 1NGWB 2DLFL 2HJLB 4Q7DA 1AD0A 1I85A 5C7XL 3RL1A 2XQYG 5DJYA 2VB5A 1GZPB 4HZLB 4NZTH 5E8NB 2LQRA 5HVGB 1KT2B 3C09C 5D2NB 5DTFA 5DGRA 3BD4A 2NXYB 3TWCH 4G8GD 3RKPA 4KAQH 4ELMB 4KROC 1DBBH 4EN3B 3VXPB 5C0IA 4S2SA 4N8VG 3OV6A 1YMME 4FFYH 4MXQC 1S7UB 5DJCB 5CP7A 4ZQKA 5E08L 1QO3A 3G9VA 5TE4H 3WO3B 1QBLL 1C12B 3IFNL 1A6WL 3VFGH 4ZPTB 3V7AE 4Z95H 3EO1B 1TQBB 4Z76A 1N0XL 5F7FA 4OM1H 5GS3A 4JANA 5K93A 2GK0B 2D03L 2E6JA 1K4DA 2C1OA 4JFYA 3GI9H 3LV3A 2JJSC 1SBBA 3MV11 4YK4C 5MP6H 1YDPB 2ERJC 1IM3B 1T20B 3MOBH 1QLFB 4X6CF 5DJXA 4Q9BA 3UTSB 3N85H 1IAOB 3HAEB 4GUPA 2AJSH 4WU7A 2CR6A 5TFSL 1JPFB 4CRPA 2W65B 4WFGD 5A2FA 2DN7A 5HI4D 1T1YB 3S37H 1TPXC 2ZUVA 3GSWB 2QR0B 1I9JH 3LHPH 5KVEH 1OGAE 2R8SL 4ZXBB 5EZOH 5DDHB 3ET9F 4KMLB 4LHUA 3PE9A 1ZMYA 3KPPB 5L88H 7FABH 3ZTJH 2G5BB 5FFLA 4JCLA 2CPCA 3MXWH 1LVEA 3P77B 5IMOA 2BY3A 2HJFB 4ZS6D 3S36L 4XAKE 1Y0LA 3O0RH 4ZFOA 1GVIA 3BKCH 4OLEA 3EJZC 1T7WA 2VLME 1HHIB 3QDGD 3BPNC 4FNLL 3AFLA 4W68A 5DVNA 4Y2DB 1W2KT 2DQJL 4Z6AT 1G7QA 5JHDD 5ADOH 2IADB 5H37H 2CKBB 4HJGB 4HV8A 5FA4B 4F9PC 5KVDH 1B0RA 1PX4A 3MODH 4FXGA 4WU5A 5IB2A 4NCDA 1KTKE 4YX2H 1FPTL 1S7XB 1BVLA 2HT2C 4KJPD 4PJHF 3U1SL 2B4CH 3GM0A 3MRCB 5ICZA 1EZVX 4JQXC 5E6ZA 2WBJA 3ARXA 5EU4B 4ENEC 1C7SA 2LVCA 5HBBA 5HGBA 4X9FA 5IVXB 5CINH 4R7NA 1S9XA 2BERA 3NFSL 1H0DA 3CFEB 1IQDA 3O41A 1YEHH 4Z0XA 1JFQL 4JREB 2DKSA 4YHLL 3MO1B 4WHTA 2DQFB 4J2XA 2J8UA 3T0DA 4X8JA 1LEIA 1F11B 4OLWH 4FTVD 1PLGH 3L5XL 5FGCE 1AR1C 3IXAB 4X6DE 4BYHA 5D7IE 1LDPH 5D96C 1FH5H 3RZCB 3PQYB 5T3XL 5D8JH 3PP4H 3TO4B 5C09D 4PTTA 5I8OL 1JGDA 1U3HC 1AO7D 1HCVA 4X6BB 1OF2A 3V52L 4LLWA 5I1JL 1YEFL 1QSED 2IH3B 5EC1B 1U41A 4I18A 3TVMD 1JGVL 1NC4B 3VRJB 3LEVL 4GAGL 1MHPL 1MLBA 2FECL 1ORQB 4XWOC 3GRWL 4XPTL 2ZWLT 4U1KA 3P4MB 4AEHH 3O4OC 2R2HA 3HC0A 2OR9H 5DRZA 3MRLB 3DROA 2V5RA 3OQ3B 2HTKC 4LEOB 1A2YA 4RGOH 4W4OC 2EIDA 4YHOL 4BELD 1H8SA 1U8JA 4LP5A 3QJFA 3GMOB 5D7LB 4RA3A 3C8HA 4R9HA 4U33A 5BZDA 5K9KA 5B39A 1G6RB 3RFZC 1P4IL 2KZ1B 4Y5XC 4Z7QF 3PGCA 3TCXA 3BMVA 2VXSH 1RUAH 3FQWA 4KHTL 2XQYK 4DFIA 3IDGB 1P5UA 3RWJB 4ZDHB 2E8ZA 3WFHB 1V3KA 3L3OA 3A67H 3NIGE 3PDDA 3TBTA 3PWUA 4G6FB 4P3CH 5DK3A 3RIAK 4L9LA 4PY8J 3GSRB 3FQUB 3U7WH 2M26A 3QEHB 5I9QB 2A83B 5AAMA 4PGEA 3P9MB 3SOBH 1ZT7A 2XG5A 4KVCL 3GK8H 1PZ5B 3B6SB 4M3KB 4PRID 4Q58C 5C0AE 2XZZA 4OCWL 1KJVA 4NFCA 5ID0A 2VUOA 4NN6C 5F7DA 2NX5A 1TMCB 4XMKH 1I7UA 5KVFH 3EGSA 1BOGB 4HEPG 4LFHG 4MXWL 4S1QL 5J13B 5F1IA 4NT6A 2ZJSL 1ZTXL 2AEQL 3WE6B 5ACZB 2R29L 4LAJH 4RFNC 2FJHB 4Q9CA 2H9GA 1R3JA 2X4OB 5LXGH 1GOFA 3CXDH 4EOWL 2BMKB 4FQQB 5DJ6B 3OKEB 4R97B 1Z5LA 1AO7A 1CICD 4UILL 3OGCA 4JQVC 1T0NA 1AP2A 3GMQA 2DOCA 3DV4B 1CXEA 2P24A 4XAWH 2V5TA 3GMMB 3CDGA 1KJMB 1T22B 3ZKXC 5HHOA 3ZKNC 3GIZL 1T83C 4G42B 4PJEA 5DRWB 1A5FH 4AIOA 4C59B 4D0DB 3UTQB 5MHSD 3CH1A 1NSNH 3MREB 4XZUB 1E4XL 3FOMB 2A74B 1XGTB 1IRAY 4RA0C 3QUMB 4LSTH 2G60L 1PSKH 3VFVA 4HIIB 3B2VL 5CJQH 4JHZA 3T0VA 1EX0A 3UJTL 3FB7B 3BN9D 4GAJH 3W0WE 4MNHB 4BH8A 3IJSB 4NKDA 5IB5B 1R5IA 4RAVA 4JJHA 3C60B 1IGFL 3GIVB 3QWRD 3K3QA 2J8HA 4C56A 1WEJL 1I8LA 1A8JH 1LO3H 1XT5A 5F1NA 5F7EH 3NN8A 1RI8A 3LH2H 3OAUH 1MCBA 1ZA3A 3BT2H 1RV6X 4LF3A 2DBLH 3LVEA 5DMIH 2HMID 3ZE2F 2YPLE 1QRNA 1LP9B 1IGMH 1RJZB 2Z31A 2FECI 1QA9A 2VLJA 5AAWA 3TJHC 3E3QC 3EJYC 1QP1A 2XA8H 2UYLA 5BRZB 5GGQL 4L4TA 2PTTB 3QI9B 3HB3D 4M1CD 5BW7C 1CT8A 3FRPG 3MV9E 2DQUL 3UAJC 3SKNB 2AGJL 1NCWH 3I02A 5SWZB 4WY7L 3TT1H 1CGTA 3MRIB 3TIEA 4LSVL 5F7LB 4HKBA 2PYEE 4XNYH 1MCEA 2EDRA 3IAGC 3MV7B 5I1AA 1NCCH 1MY5A 2HYMA 3V5DA 1CFVH 3KPRE 5KJRL 1G0DA 4LSQL 5FCUH 5I8EA 3MRGA 3QNZA 1MJ8L 2EDEA 1IGTA 4TVPL 3V4UH 2GJ6D 4ZUTB 4K8RH 5E7BA 5T3XD 5TDNB 4UQ3A 4ERSH 4TSAL 1EK3A 1SEBB 2ZG2A 1QVOA 1T7XA 4M4PA 5I71B 4PG2A 1DBJL 1FRGH 5DXWA 5FUCC 5D1ZC 3MLRL 3QULB 2WK2A 1DVFD 1R3IH 4PLOB 4DGIL 3MRKB 3O81A 5IK3B 3ARBB 1F3JB 3DMMD 4TQEL 2RAMA 3BH9B 5SWSB 3QWQB 4HUXB 3MOAL 4JJ5A 1L7TL 2QQNL 3RPIB 4K71B 3RWIB 4NPYB 2PXYA 2AJYH 3B9VA 4LGPB 3QUZA 4Z7UA 1UCBH 4S10A 4YPJA 4FA8A 2ATPB 1BM3L 2B1AH 2E7CA 2BNRE 2M2DA 4YNYA 1KBGH 5FYLE 2A73B 3SDYL 5IFAL 4IMLA 5T3ZH 3VH8A 1A6VH 4Y4HC 5E9DA 2P8LB 2J5LB 3KYNB 4X6FA 5J1SC 2Q86B 3QQ4B 2BCKB 1P7KA 3NACL 5TDOB 1XR9B 1AHWA 1Q94B 4LKCA 5D5MB 1BZ9A 4MJ6A 4XVTL 5F70A 1JTTA 3QXAA 4O5LH 4QRSB 2XYCA 5HYIA 3JTSA 3SDXA 4LVNC 4KI5C 2BC4B 4F80A 3MCLL 4LCIH 2F54E 1LE5A 4LCWE 5F7KC 2G2RA 1QSZA 5AD0A 5I19L 3JUZA 1DE4A 2IH1A 4IMKC 1AXIB 3OR6B 1E4XI 1LHZA 1U8PA 1ZHNA 4LGRB 3WKNA 1WBZA 1KPVA 2XRAL 3V9FA 1KIRB 4PJGE 2EDXA 2QADC 4CU6A 1A4JA 1OTSC 4AK1A 2W0FA 5EU5A 4LIQE 4MAYC 2EDBA 2XKUA 4OCNC 1P7QA 2R0LH 1LEGA 4MCYA 3PHOB 4LLUB 3UBXG 2HLFC 1QQDA 1VGEL 1WFUA 4ELME 3JV5A 2K7PA 1B90A 1YPZF 2Z35A 1NEZB 2A6KA 4UDUA 4CGTA 5MEND 4U1SB 1KXVC 4O9HH 1I3RB 2EXYC 4IHOB 4KQ3H 4P2QD 3MRQB 2D7OA 3OR7A 4WO4D 4O00A 3CPLA 3TFKC 5I75B 1A1MA 4IJ3C 2AEWA 4WI2A 5D70L 1DVFA 2RBLA 4YPGA 3VXMA 1DQLH 3U82B 4N0YL 5DS8B 4GG6E 4DZ8A 1N59B 2H26A 1HHJB 1A0QH 5EWIL 1BBDH 2P4AB 4NQSA 2Z93B 4PREA 4KTDH 3EJJX 1I7RB 3KPNA 3MRJB 3S6CA 5A2KH 5E8EA 5M95B 1QPPA 2V2WA 3AGVA 4OGAC 3SGKA 1ZGLA 3KYKL 4IOFD 1VA9A 2ADGA 4YDVA 4MNQB 5B38A 1CL7I 2AAVA 3SDCC 3PDGA 5DWUL 1HYSD 4BSVB 4OB5L 1KENL 4ODTH 4XXCC 4JFEA 3VG0H 5EBGA 1I8IA 1PKQA 1YEDA 2J88L 1T89C 1W8OA 5MEQB 2QBWA 1XF2A 4JO3H 4S1SH 1RZFH 4P46A 1KF9B 3SGJA 4NQXA 1CDJA 3RY6A 4TUKL 3AU1A 1KJ2A 2GAZB 4PJ5D 3BI9X 3ARGC 4WW2A 4XNUL 1CLCA 2AEPL 3TNNB 5CZXD 4NRZB 1HN1A 4X99A 3QFDA 4HHAB 2EC9U 5DD5L 4E41B 1L6XA 3D3VD 4I0CC 3X14B 2HTLC 4AQ1B 2HT4C 5FHBH 5LGHL 4PJAB 5IWLA 4A6YH 3FMGL 2F58L 2CQVA 5E7FA 5BVPH 5JIHA 2PETA 4OAWA 4TVPD 4JFOA 3RU8L 1I1AB 3WN5C 3Q6FA 4GH7B 3S35H 1ZLVK 4PG9B 1Q0XH 5FDYA 4Y4KD 1X5LA 3SGDI 4J6RH 1VCAA 1NFDF 1I7TA 2N4IA 2RGSA 1P9MC 4U49A 3SCMC 3S96A 4HMCA 3T0EA 1NGPH 3O2VL 5IOPB 5HHVL 2AK4D 1RU9H 4JFDB 1OSZA 4MLIA 5HGHB 35C8H 1P1ZB 1BFVL 1FVCB 1OPGL 3OAYK 3DGGA 5HPOA 3L3KA 5EORL 3QIUC 3S88H 1Z0NA 4I9WE 2B1HH 2PW2B 1MLCB 3VXTA 2Y72A 2DLHA 1T5WB 2DM3A 4P5KB 3H42L 5DEGA 3WLWC 3HCVB 1QHOA 3OKLA 1H9VA 1A3LL 1E4KC 4XNZC 4M1DL 1GRWA 1YZZA 3PHQA 1JF6A 1FORH 2VABB 2R2CA 4UOW1 2OK0H 1C5BL 1RHHA 3NIDE 1QLRA 3QDJE 5IFJA 1YYLH 3BZFB 2PO6C 1MCIA 1RZ8A 1UWXH 4I0PA 1UQSA 2Z91B 1EO8L 3FRUA 1OM3L 3MRNA 2YC1A 3TBVA 4D3CL 4GSDL 4ONGL 1CLZL 1N5AA 1CGVA 4FQJH 4BQBA 3MRPB 4KXZI 4XHJC 4J1UA 2BNUA 4B7IA 1ND0B 3T04D 3L3IA 4N0FA 4R96B 3RIAF 3MNZA 3O4LA 2R1WB 4MDIB 3CVHL 4OD3H 1DZBA 5EU7E 1HHHA 2L7JA 4KI5F 4QYOB 5ESAB 4MA1C 5ABDE 3LKRB 1AJ7L 2FYYA 1KNOB 1IM9A 2UVEA 4NRXA 4YAQA 1RK1B 1CDUA 3D5OF 3HZMB 3LS4H 4LSSL 2P5WE 5BVJB 2APVA 1HI6B 5AZ2L 2C1PA 4EJ1C 4QRQA 3O8XC 4HZAA 4X9HA 1UENA 4NKQB 3TPUA 4PGBA 2XQBL 4MA8L 1G7MB 5J9PA 1U92A 4R8WL 2VDKH 4XRCA 3RHWF 3HZVB 1NMCC 4QXTA 1ES0B 3RVWC 4IRSD 1CTOA 2R4RH 4MSWB 1SYVA 5E2VH 2EEBA 3WFCH 5IJVB 2FR4A 2FD6L 2WSKA 3SGKC 3H9HB 2Y7QB 1KIQA 3MRHB 1NKOA 5IB4B 3MLVH 3ARFC 3TO2A 1TJHH 3HPLB 3H9YA 4GRLB 3RDTC 4O02L 2FIKA 1FDLH 1EERB 1NH6A 2CDEA 3KR3H 3UPAA 2ZNXA 3U48A 4FHBD 5BS0E 2GSIA 1Y18B 1ZWIA 1Z2KA 2Q20A 3BKML 4FMFA 4OLUH 5TE7H 1JNNH 1A7OH 5I1LB 5CIPB 2IG2H 1ZLWK 2R2EA 1YMHB 1CGUA 2VO5A 5DT1H 2WV3A 4JKMA 1FJ1A 1GGIH 1B0GB 5DC4B 2Z8VC 4WJ5B 5GRYA 4TYUA 1OAKH 4OFDA 1I1YB 3MLTB 3ARPA 5GS2H 2E9JA 3NFPB 3QPQD 3GJFA 3RI5K 4PLKD 1HHGA 5CBAB 2FEDC 5EZIH 4IRZL 1J8KA 2DJUA 1BX2A 4C57C 3BHBA 2E7LA 2BHZA 4OZIB 3WXVH 5IKCA 5IMLA 3C9NA 3P30H 1AFVL 2IAMA 2DTMH 5KVGL 2IPTL 2WNGA 4ORZC 1R3KA 4NQED 4CU8A 3RAJH 4KROD 3FO2B 3QRFM 3UPRB 1X4YA 1DQTA 2UUDH 3KLAB 4OQ1A 4MXQD 4PJDB 1HHKA 1A9BA 2J4WH 1OQXA 2VQ1B 5DQJA 1CGSH 4NKIH 1OAYL 1UJ3A 4AG4L 4E5XB 3N1PC 1JUFA 3GMLB 1LE9B 3B5TA 4O2CB 4LKXA 2DS4A 4X80L 3PP3K 5LBSL 3IS1X 1GGCH 3E6FA 5FA3A 2BSTB 2OCFD 3PWVB 4JAMB 2AXJA 5F3HB 5EFIA 4PGZA 4V2BA 4H1LB 1JWMA 3BESR 4N90E 3S5LG 4HUUA 3HZYB 1KYOJ 2WQRA 3WFZA 4HWZA 2CIIA 3PWPD 1A6TA 4DKAA 3QEQD 4KRLB 3QXWA 2X7LA 2ZPKH 4PJBA 3G6JA 2OI9C 1BBJB 1QSFB 5IV2B 4UAOC 1CVSC 4IDJL 1IILE 3RUGA 1CXLA 3ZT7A 2QTEA 1YECL 1T1ZB 1IGJB 2QHRL 2NTFB 4ZUSB 5KANG 3GFUA 5JO5B 3LDBB 3TYGL 1BPVA 2OSLB 1IGIH 5C07B 4PJ9A 3TT3L 3MJ8B 3FTGA 3MMEA 1C5CH 4EN3C 4R26L 2AJXL 4JG1L 5JQ6L 3LPFA 1MNUH 3BIAX 3EDDA 3BW9A 4PJCB 3IF1B 4CVWA 1TETL 4IRJB 4D9LH 3VI4F 4P2OB 4XXDB 4O2EA 1FLTX 1MHCB 3LSOB 2AI0H 3EJZD 1A6ZB 4R4NC 4F7PA 4I4WA 1UZ6F 4KZDH 1FYTB 1BJMA 5K9JH 2JCCA 2YD3A 2VAJA 1OP5H 5E5MB 4PBWD 3SO3B 1A02N 1RZKL 3NIFF 2O26U 3IFOB 4GW1B 2VITB 2QLVB 3SKMB 1RJCA 3VE0A 4OZFA 1FGNH 1MIML 4DUWA 2KDGA 4MD5A 4XP5L 1JYXA 3ULVH 1BQHB 1N2RB 1LEKA 3QIWA 2HT2D 2NXZB 4Z77A 1MFCL 1UM4H 4CW1B 1EJOH 2Z92B 4XPHL 4MQSB 4NP4L 3NA9H 1IEAB 4ENED 2DYPB 1NEZG 4YWGH 4I5BB 1XMWA 5FYJL 5T1KA 3SQBA 4OD2B 4Z0BL 3VXRE 1TVDA 3DHMA 3EYVA 3GMPB 4I77L 1FG2B 4QRTA 1ZK9A 3TH3T 2VWEE 2ADIA 4QRRE 1OCWH 2DRUA 3QPXH 2MCPH 1MAJA 2VE6A 1RJLB 5E99H 1AR1D 4G7YH 1NAMH 2BRRL 1H3GA 4RGNE 5CEZL 2BSSB 2OZ4L 2VC2L 4QT5A 4P2YA 2DQGH 4ONFL 1FVDA 4WENB 3WS3A 1JL8A 5I1CL 4H20L 1U36A 3WCYA 2GT9B 7CGTA 3FN0H 3UJJL 4OV6F 1G9NC 2YXMA 1FNLA 4F7MB 5F44A 1I9RL 2IF7A 2DQIH 2ICWI 2EXWC 4XWOD 3GSXA 1LO4H 3UTTB 3INUH 1QACA 3TNMA 5E8DL 3MBXL 2E9IA 2HTKD 4HMDA 2W60A 3DVGA 4HD9A 4L3ED 4F37K 3OF6D 3PJSA 2V2XA 1IC5H 3L9RA 5K9QG 1E4WL 2YOCA 3I2CL 1IEBA 2Q3AA 4RAUA 2D0FA 1R5WA 3UZEA 1FL5A 3EHBC 4FG6C 5T3ZE 1DBML 1JHTA 3WLBB 3G08B 1T03H 1AGEA 3ESVF 4JREC 1YQVH 4OT1L 3A0OA 1MCDA 4HX1B 5FGRA 2V7NA 5GGTH 5EIVA 2B7DT 1WC7A 2VH5L 4JVPA 2A2QT 3I3BA 4HG4J 4G8EB 1EJ6A 1U8IA 2ZSVA 5IVOA 1J8HA 1JZ3A 2ITCA 3HI1B 3TO4C 5EOCJ 4K9EC 1DN0A 1XGPA 2YZ8A 4K3JL 4KJWC 3B9EA 5T33H 3TN0B 4XBEH 4Q9RH 3FT2B 1HK6A 4KPHH 1QUNA 2Y1VA 3VDBA 5ITBL 4LBEB 3G5VB 1XR8A 2BNQD 4Y4FC 4PRDB 5FM4A 5KN5B 2AV7B 5TQ0L 3KJ6L 3GSOA 2VDOH 5LGJB 3KXFE 3SBWA 4Z7VA 2AXGB 1K85A 5DJ0B 5HHNB 2P43B 4U1IA 1J1XL 1JGLL 4D2NA 4QOKB 1VKXA 5MERA 1OAXH 1NCNA 5C08E 2YEZA 1AIFB 4WFHD 4ODHL 1ZVSA 2YSSB 1JNHA 3LQAC 5BZWB 4GKSB 4FABL 5J89A 5C6TH 5GS1A 3R06A 4WUUA 3BIKA 5HHMD 1IT9L 1WFNA 1MCRA 3ZKND 1OVZA 1UADC 3IU3A 1D5ZB 4JPWL 1HH6B 4JRYD 4KTEH 1E28A 5ALBH 5T1LB 1N6QL 5L2KD 2PCPB 1UACL 3V7AG 5BXFA 4HF5L 5GRJH 1A1NB 4ZO8A 2ADJA 2R23A 2NY0C 5IQ9A 4EUPB 2EO9A 4Q74A 3QHZL 4HWBL 2O5ZH 3DOSA 3B5GA 4JZJB 2VLLB 5TJWK 1AY1H 3MR9A 5I2IB 5DHXB 3BWAA 4NRYB 4JQIH 4AJ0A 1S7VB 4M48L 3VMOA 1GIGL 1FO0H 2AVGA 4POUB 3CSYA 3PV7A 5IMKA 3MYJA 2BSED 4G9FE 2FGWH 4NDMB 4BA8A 2VQUA 4L4VA 2DWDA 3HI5L 4OF3A 3RA7H 4OTXL 5FIEA 4XP6H 5D7KE 2CJUL 2WQ8A 3TJHD 5I1HL 3EJYD 1MEXH 2VSCA 4RZCA 3VXUD 3GJEA 1C16B 2QKIA 4QRPA 2ZUSA 3V7MA 4KRPB 1VENA 5E4IA 1HE7A 5JOFB 3ECBA 1VEPA 4MLSA 1A4KA 1WFTA 3IDNA 3UAJD 1FFNB 2NY5C 5FYJD 2IAND 2EZ0C 2X9YA 4NM4H 4WI9A 1ZANL 1U8QA 4NJAL 4GFTB 4TSBL 4Z7WE 3SDAA 5L7XL 2FHBA 4YHIA 2Z8SA 4HDIA 3AAZA 5D2LB 3QWOB 2A6JA 3OX8B 2X4NB 4RSVA 4I2XA 2C9AA 3HR5A 1LD9A 1TZHA 4UB0H 4UT7H 4K7FB 4IIQB 3MGTA 5A2JH 5I17A 4X4ME 1PGRB 5GS0C 2DB8A 1ZEAL 3DXAA 4L29A 4XB7A 2WP3T 3ARTA 5D1ZD 4NQCB 4JY4A 5I66A 3EZ8A 3MUGA 2IPKB 1TNNA 2GCYB 5I0ZA 5H2BA 1KPUB 4P57B 4P2RA 1KB9K 3MLUL 4OCSH 2OL3B 2GI7A 5D72H 1J10A 4XNMB 4MJ2A 5C2BH 5KS9E 1N64L 4EBQH 3GMNA 4R4BB 6FABL 1A1OB 3NGBB 1NC2A 4ZTOH 1G7LB 3AMLA 4PD4J 3F5WA 4Y4HD 2RFXA 5HYJD 4BH7B 3VWKA 4ZUWB 3QAZB 3RI5F 1QLEL 5HY9A 2H1PH 4ZFFB 3CVIL 3G5XB 3C08L 3TYFB 4FQXB 4CVUA 1EEYB 2AABL 4TRPL 2AW2A 3ILPA 4D0CB 4TUOB 4KV5F 4RBPH 4UZGA 4NO5A 3NZHH 3RX5A 3DX8B 3V2AR 3J7HA 1DBAL 1MJUH 1FO0B 4HKZB 3MV01 4G6KL 3MUZ1 4XPGH 3WIIH 3RWFB 2VKXA 5IVXF 2MQ0A 1UH2A 3QDGB 5KSAA 1T04B 2HH0L 4OIIL 2HJKA 3BEWB 2MCG1 4FQLH 4F7EA 3LS5L 4GXVL 3SPVB 3SBWC 5JHDB 2QADD 3H7LA 4PJ7E 1OTSD 3FQXB 3S34L 4OCLC 2CDGB 3GNMH 2FX9L 4KK6C 2OJZH 5K33A 2ZKHL 4MAYD 1GAFL 4U0RC 1A6WH 1RZJC 4XVUD 4K71C 2XKNA 2VMFA 2HLFD 4KMTH 5BV7H 3FT4B 5FKAA 4H1LG 4PJDE 4HIHB 1FAIH 4Y16C 4JN1L 3QZWB 4PJFF 3F7PC 1FV1B 3PNWA 3MJ9L 3Q2CA 5JXAL 2EXYD 4K07A 1XGUA 2J5LC 1QFUL 3L7EA 1S9WA 5CLTA 5C0JA 4LAQH 1S7SB 3N0PB 1FL6A 3DRQA 4OLXL 1N5YL 3TFKD 2DL2A 3FFCA 1Q38A 4PRPD 2ZUQB 4YZFF 1S7QA 2MOVA 3C6LA 3T65B 3L3DA 4HPOH 1FYHB 1LO5A 3HNSL 5E2WL 5HDOA 4FTVB 1BMGA 3CX5J 4HC1A 1W0VA 3AS3A 3CLFH 4HS3A 3KYAA 3PL6A 5HDLA 1ETZB 4JFFA 1UWEL 3FOLA 3O3DA 5ISZE 3MRBA 1EBPA 1FNGA 3L1OL 1YMMA 1E6JL 4DAGL 4YHML 3JUYA 3PGFH 4GAYA 5E2TH 2XWTA 2W9LA 3KPQB 4JKWA 1R24A 1RIHL 4CMHB 4HS8L 2NY7L 5F9DC 2EO1A 1KC5H 1QSEB 3HNVL 3TVMB 4JM4L 1MCFA 3OZ9L 3SKJH 5DSCA 3SDDA 4MJIA 3SDCD 4DN4H 1CXFA 1PYWB 2LVEA 3GSNB 4U2YA 5D7JC 4Y5VA 1F5WA 4F15C 1DQDH 2FO1A 3IJYB 3BGAA 5D1QC 4XBPB 2BVPB 5C07E 4W4NA 2DMBA 2HFFA 3HS0B 1BREA 3DGCR 1RMFH 3F7VB 1BQLL 3QSKB 1XF5A 4DOHB 1JF1A 3E6HB 3CCHA 3UTPD 2EEAA 4UT9L 1MVFA 2O5XH 3VXOA 3BP6A 4MQ7B 3H7BB 1H15B 4QHUA 2BK8A 3P9LA 5GGUA 1VHPA 1A6UL 3ARGD 1S7RA 1BZ7B 4X5XA 5EBWA 3FQTA 4Y19A 1NFKA 5ERWB 3R8QA 1DFBH 2Y07L 5JIKA 3WNMA 5C6PB 4PRHD 3V79C 4Q2ZA 3QUXA 5C0RH 5F7UA 3IDYC 3ZT5A 4QEGA 5EU6D 1EVUA 4OUOA 1T21A 2HTLD 5DJAB 4IOIB 2HT4D 1U8OB 4LL9A 1JYNA 1MREH 4NBZB 1ITCA 4QHMA 1IAIL 4X7DC 3VD5A 5GHWH 5BO1H 4N0CC 2APBA 4LVHC 3OXSA 4WTZA 4PRIB 3I9GH 4JHWH 4HGWB 4L8SB 3MRDB 3DLQR 1V3JA 5FV2A 3L5XH 5IF0A 2UWEE 3IKCA 1TVHB 5KG9A 4M43L 3D39B 5CUSL 4NC0B 3SCMD 2A1WL 2QQQA 1OY3B 2XTJE 3OHXB 4NIKB 4RQQB 4YHPA 5CGMA 1DTUA 1YY8B 1VEMA 3K4ZA 5DMJB 2G75A 1OHQA 3MGOB 1JGUH 25C8L 4LSUL 3QIUD 2V2TB 5CJXA 1CD1B 1CICB 1FZOA 4XWGL 5CJBA 1TJGH 2EDKA 3ZKMC 2DD8H 3WLWD 2Z4QA 4RFOH 2YPKA 2MTPA 5LG1A 3PWNA 3HE7A 2BOCB 4M6MH 4HWEH 3EOBA 4MXVE 5BQ7B 1B4JH 3GM8A 5HGGS 3DUSB 4YDJA 2X42A 5HYEA 2X4SB 5KSAC 2XN9A 3GGWB 2PO6D 4X5LA 1GL4B 4G80A 1P84K 3UYPA 4K3EL 2F53D 2A6DB 3N06B 4APQC 4UNVA 1MI5E 4X6DA 4K94L 4X4XB 2DQHL 4HBCL 1NJ9A 1LWRA 5JLZB 4Y5YC 1F02I 3DVNB 3VGFA 1MAKA 4XHJD 4MD0A 4PJXB 1O7VA 4PB0H 4LLQB 3OB8A 4XCNB 4KRNA 1EFXD 4AEFA 4DKFL 1TQCB 4PGJA 4LFHD 1QYGL 3VWJA 5E4EB 5LAXB 1J05B 1D7FA 1ACZA 1KJ2H 2AJVH 3T8XB 2F74B 3WSQH 4QF1A 4F7TB 2VDLL 5EU6A 4F9LC 3HMWH 1ZLUK 2R0KH 4OCRL 4U1HB 1L0YA 3O8XD 1FC2D 2F5BH 4RRPA 1YYMH 3ULVE 3QXVA 1B2WH 5C0DB 5EOCH 3C8KB 3SKOB 3RVWD 1CGXA 4AM0A 3I50H 4PJIB 1AKJB 1BHGA 4PV9B 3JWOL 4OFYA 4WWKA 1K8IA 2YA0A 1HOCB 2JB6A 3GBMH 5DUML 4ZUUA 4EI5A 2APXA 5IEKB 5MEOB 4KDVA 4OZGA 3N9GL 2GJ6B 3HMXL 3ARFD 4QGYA 5IW6A 1U8HB 5F7WC 5HHPB 3UYRL 5IBTL 3L5WA 2B2XH 12E8H 5EUOB 2ZUWA 4OCXL 1CFNA 1D5IH 1ZAGA 3RDTD 2BFVH 2EDYA 4JG0L 5KSBB 3RQ3A 5B8CB 2C5DC 1RIUH 2KH2B 3SE9L 4KK5C 1G9NL 2ITDA 1TJIH 4WTWA 4Z7OE 1A7RH 3RGVC 2Y4SA 5CHNB 1EXUB 1KCUH 2E7MA 4UI2A 3GI8H 4P4RA 5EPMA 4NJ9L 4X4YB 3G04A 2VQTA 3VFWA 3E8UL 4JRXD 1HINL 1CBVH 5FYJU 2XZAL 2MNUA 2JELH 1F6FB 2PYFB 4V1DD 4AEIH 1MCSA 2CDFA 4LGSB 2IFGA 5EG6C 3CLEL 1W72L 3RX7A 1UWGL 2FEDD 3HZKA 1AGCB 4L8DA 1NDGA 5E6IC 1BQUA 3CJJA 3U7YH 3LN9A 2FNBA 1KN4H 3OKKB 4K7PY 2IFFL 3ORJA 4HCRA 4BZ1L 3QFJA 2DQTL 4Q6IB 3D9AH 4KVNL 4R90H 1CLYH 2D9QB 2I9LA 2Q87A 3VXNA 1J88A 3WFBL 3JWDH 1NDMA 3IDJA 4R4FH 3QO0A 1WBYB 3MUJA 3ARUA 1ZXQA 4WY7H 4AMKH 1MPAL 4K9EL 5HD8C 3FAXA 3OG4B 4NN5B 3WIHA 2I25N 1BLNB 5DMKB 1LK3L 3W0WA 2YMXH 4WHYH 4ZPVA 5C0FB 1SBSH 3BP4B 4G8GE 4Y1AB 2R56L 3L7FA 4QTHB 5CSZA 1KPRB 4OZHB 4TVPH 3UBXI 3L3GA 3L95A 3WMSA 1CL7H 3T2QA 4RISL 5MENB 3QQ9C 2X89D 3N1MC 4P2QB 1AI1L 1AXTL 5IFHH 1IARB 4WO4B 3VFUA 1FAKT 2Q1EA 3BYTA 4WEBH 1JCKA 4ORGB 1WCBB 4ISVA 4KTYA 1FNSH 3LQAL 3W11C 2HWZL 2EKJA 1WK0A 2W9DH 5GGRY 1YNTA 1VFMA 2DQDL 4Y0GA 4LSDA 4ALAL 2V6HA 1KGCE 1M6OB 1ZA6A 3U4BH 3FONB 2J8UE 1BM3H 4YIQB 1UKTA 2Q8AH 5JIIA 5J12B 1G7PB 3L6FB 1MQKL 1CD9B 5DEZA 1SVCP 5IBUG 1Z9SA 4N9GA 3X12A 2V5SA 4EN3D 5FYKH 3VG9C 2XTLA 3M1BB 5FAAA 4KHXL 3MXVL 1A6PA 4LNRA 3KPRA 5ESVA 2H8PA 5T1DL 5KW9H 1DEEB 3V0WH 1NANI 4JVWA 4HBQA 4DFHA 4NQDA 1RK0A 3O6FA 5CD5C 1NMBH 2YBRA 4R4ND 4PGCA 3U9UA 1CD0A 3GJFH 3OKNA 3LMJH 5T5FH 2FX7H 3CFBB 5DD6B 4UNTA 1F4YH 4NOFA 5GGSB 5JR1L 3VXQA 3LEYL 2ARJB 4GQ9H 4M8QB 4NQVA 3FFDB 5T5NG 4PBXA 4PJ5B 5DI8A 1JWSB 4XP4H 1VACB 1S9KC 5FO8B 5I73C 1KELH 1G1YA 3U36A 3I6LD 3QDGE 1K5NA 1J11A 4J4PC 5FF6A 1NBYB 5EA0L 4G6MH 4B53A 4S1RH 2I5YH 1KN2H 1JWUA 3DX6B 1MJJA 1ZHKA 4KQ4H 3D3VB 1WCQA 3RWDA 3LKOA 4UMGA 5KTEL 4HUKB 1ULVA 2EEDA 3F65A 4NKMB 4X6CB 3ZTJG 3REVA 1D6VL 2P7TB 4XPAL 2VZSA 3BIBX 2F54A 4R0LC 5FKPB 4DVBA 1REIA 3G6AB 1RJYB 4LCWA 2NY3C 1BJ1J 2X89A 5JW5B 2X4RB 4Y4KB 3C5SA 1CYGA 5MI0B 1ZHBB 3VFOA 1DBKH 4OCYH 4KUCF 1QFWM 4F57H 1OAZH 1LO2H 2ATKA 3ZDXE 1NGWA 3QJHB 4PJGA 3WJLA 4I3SH 1KOAA 3PWLB 1EHNA 2AK4B 3ALWA 4KXZH 2CGRL 3EFFB 4HZLA 1KT2A 3EO9L 2EXWD 5D2NA 4M6AA 3FO0H 4ZUVB 5H37G 3KYKH 4FQ2H 4ELMA 2WUCH 5C09E 4XTRC 4EDWL 4M7KH 1AO7E 15C8H 5HYSB 3C5ZC 2X1OA 3IFLL 5DJCA 3BKYH 1AH1A 4YDLB 5C9JB 3TBYB 1QSEE 4ZPTA 3I3DA 1IAKB 3EO1A 4PJEE 5DK2A 3EHBD 2VOTA 4FG6D 2D4DA 2GK0A 3QUKB 3SE3C 3CX2A 4JB9L 5CILL 5FV1L 3VXSB 1I4FB 5E94A 4EI6B 1YDPA 1IM3A 4NUGH 5F72S 3PIQB 1D9KB 3UTSA 1IAOA 3HAEA 3NA4A 3NCYS 4DGVH 3IRZA 3TO4D 1N7ML 1KXTB 1MUJA 1NGQL 1U6AL 5JOPE 4C56E 4F33B 4KJWD 1T2JA 1CDBA 3GSWA 2QR0A 1MRDL 4XCFL 4BQ8A 3O6KL 5IT2L 1XCQB 1QRNE 5FO9B 4JFZL 4Y4FD 1NAKH 4ZXBA 1KB5A 5DDHA 4TSCL 2IALA 3IRPX 3KPPA 1SJXA 2G5BA 5JUEH 1IKNC 4LU5L 4AH2B 4HFWB 4L4TE 3VGHA 4OLYH 2IEPA 4XC1H 4WI5A 2BOBA 6CGTA 4ODUB 4RX4A 5B22A 4YFEA 3ARRA 5CBEA 3P4LA 4IRSB 2XNAB 4KY1H 4WI8A 1HSAB 1UB6B 5ADPH 2K9UA 4YDIH 5KOVC 3NZ8B 1H8NA 4LHQB 2YN5A 1YA5A 3H3BC 4WHCA 1HHIA 2ZUUA 3T3PE 3SE4A 4Y2DA 3R0MA 1PG7X 4KZEL 4UV4H 3QIBC 2IADA 1C08B 4PRNB 2CKBA 4HJGA 5FA4A 3CIQA 4K23H 5D93B 3ARDB 1CD8A 1S7XA 5J6GB 1S3KL 2NY0D 3HA0A 2D2OA 4ZSOE 3MLSL 3MRCA 4KWUA 3UTZB 1JPTH 5D7IF 4LLMB 2FCBA 5EU4A 2GJZB 2LAAA 3L5HA 3RIFF 1HKLL 2PN5A 5F6HI 2GSGB 2PR4H 2X1PA 3KPOB 3RWHB 2VJXA 5DJ2B 3CFEA 1A7QL 5GQBA 2IQ9L 5I16B 2VXTL 3MO1A 1JI1A 2DQFA 2VDQH 4MS8C 5E9DE 4CDGC 5K9OB 2FJFA 3IXAA 4L3AA 3WD5H 4C83B 3RZCA 3PQYA 4UV7H 9CGTA 1JGEB 1O7SA 4P4KC 4PJXE 3C09B 4X6BA 1JHLL 4F58H 3RVXC 2C7UB 4RIRB 4JZNB 2BY2A 5A1AA 5GGRA 1OW0A 4MB5A 1NC4A 1P2CB 4WTXA 3VRJA 2DM4A 2VDML 1ORQA 5C6WH 4KDWA 4ZNEA 5E56A 1N8ZA 3P4MA 2XI9A 3NCJH 1CIUA 4HFUL 5DD0L 1JZ2A 4ELKB 3GB7B 5FECB 1YEJH 1M71B 3MRLA 4LEOA 4G8FB 1G7IB 1GHFH 4NO2B 5GS0D 4HPYH 2FD6H 4YK4B 2HLAB 1MFEL 3C60D 4LDLB 4JLRB 5I8CA 3BRDA 3GMOA 4CKVX 3NVQA 5D7LA 4MNGB 2EIZB 3PWPB 4KMQA 3QEQB 4OF0A 2F5AL 3Q6GL 3C6SA 5I30H 2XWJB 3S3JA 4FFWC 5C0CD 3MNWB 3LZFH 1ZHLB 4QRUB 5TH2B 2X05A 2Q7NA 1TZGL 5IMMB 3B9DA 3IDGA 3RWJA 4ZDHA 5EBLB 5IB1B 3WFHA 3BXNB 1TPXB 5BRZD 4ZOAA 5HHXH 1NUDA 3UMTA 5KANI 3FQUA 1Q1JH 1K6QL 3B4NA 3ZHDA 3JV0A 3QEHA 2R4SL 3DNKA 1A6AA 3G6DL 3P9MA 5IB3B 2EYRB 3MRRA 2Q6WB 1PZ5A 3B6SA 1I1FB 1UG9A 3FQRB 3LRHA 5L8JB 2ZCHH 1IGCH 3QUYC 4U6XB 1VFOA 4JFHE 1C1EL 4WV1C 3VFRB 1M7DB 1GPOH 1Q0YL 1BOGA 2YRLA 5A2LH 5KSVB 1XF3B 4YHZL 4MZ3A 5C0EB 1NCDL 1RUMH 3CH8A 4XCEA 3WE6A 5ACZA 2BX5A 2FJHA 5FM5O 2ED8A 3CVHB 4ODVL 1J0ZA 2X4OA 2H2PC 1OT1A 4GBXA 2VTFA 1OD7A 2BMKA 2R69L 5DJ6A 3OKEA 5DD3L 1PKQE 3FN9A 4RFEB 4RWYL 5HPMB 5SWSD 3T1FA 4NO0D 3DSNA 3DV4A 3GMMA 1NL0L 2GKIA 1KJMA 5IHLB 4G42A 5DRWA 4GRMB 4N0UE 4QHLA 4D0DA 2EDHA 5AWNH 3UTQA 3IETA 5SX5H 4DN3L 2AXHA 3U30B 3MREA 3S37X 4XZUA 3PHSA 2A6IB 2A74A 3FOMA 2AS5M 3GDBA 4X0KB 4Y16D 4HC1L 3QUMA 3F58L 4X7SH 3QXDB 2D7TL 3FO1A 4HUVA 3KYOB 2DKUA 3VRLE 3SE8L 4MNHA 4NCC1 1OD9A 3IJSA 4FQXC 5IB5A 4WCYH 3GIVA 1HEZB 5LCVH 5FHAL 1AXSA 1GZQB 5DUBB 5JORB 3Q1SH 2VNCA 4OGYH 2OTUA 1DDHB 1U3HB 1RJZA 1LP9A 1R3HB 4P2QE 4UOW0 4ZFGL 4M4RA 3TA3C 3QQNA 2JIXD 5JDSA 5IIEB 3JVGA 4JKKA 3KLHC 1SM3L 5DQDH 5DRXA 2PTTA 3B9KC 4Z8FL 3QI9A 3T0EE 2X4TB 5FUZH 3SKNA 3WJJC 3P0VH 5SWZA 5D7JD 3O4OB 4M5YL 3O2DA 4NC1E 4ODXB 5D1QD 3HI6L 3MRIA 3V6FB 4NM8L 1CU4H 4DCQB 1FVEA 5HHQA 4L3EB 2Y23A 4ZD3H 3MV7A 4JO2L 1UKSA 4GW4B 1RD6A 2X4PA 4XGZB 4XMLH 5F7MC 2XXMB 43CAB 5IBLD 5AUMA 3S4SA 5K9QI 2D31B 4XCCH 4AENB 4ZUTA 5FGBA 2HRPL 1QO3B 4Y5XB 3U4EB 4JY6A 3MV8D 5TF1H 2GYSA 2UV3A 2ZUQC 3VFSB 3QULA 3DO7A 2CK0H 5C0BD 4Z76B 1ED3B 2C4FT 3MRKA 1MFCH 5IK3A 3ARBA 1F3JA 4JANB 4LSRL 3BH9A 2EYSA 2L4OA 5ACMA 3LPWA 4HUXA 3NTCL 1A14L 1HZHH 1EUUA 4FOMA 4FZ8L 3LV3B 1RURL 4FZEL 3RWIA 5E5RB 1NCTA 4M5ZL 4ODBD 3DV6B 3U4AA 1YPZB 2DM7A 3HRPA 4YUEH 2ATPA 4M6NL 3H3KA 5EU7C 2A73A 4PJ5E 4N0CD 3EOTL 1HXMB 4GUPB 4WU7B 2NY4B 1YNKL 4AT6B 4AYFA 1QKZH 2P5ED 2BNQB 3J8F7 3BAEH 4EVNB 1JPGA 4NN6B 3KYNA 3VMPA 3D85D 2Q86A 2BCKA 3MLXH 3OXRB 1CR9L 1XR9A 1Q94A 1YEIH 4RAHA 5D5MA 5FM8A 2V9QA 3W5NA 1MFAH 4LCCC 1U93A 4RFNB 4QRSA 5DMGD 5K59E 2B4CC 3H9SD 3QHFL 2BC4A 1FG9C 4TVPE 3WHE1 4AL8H 3BQUC 1LMKA 3ZKMD 1BJ1H 5SWQB 3ZKXB 1IQWH 4OIBA 2VXUL 3BRGC 3QCTL 5E8DH 2AK4E 1H5BA 1BD2D 2DQCL 3NH7H 1XIWC 4FQCH 4E41D 2JLLA 3PHOA 4LLUA 4L8BB 2C26A 1Q9LB 4KKBC 4APQD 4GG6F 4FXGB 3KHOA 3UZQA 5DFWH 2I27N 5FYKE 5D7SH 1NEZA 3O2WH 1NGYB 1I1AD 1BJ8A 1BVLB 1EEZB 2OP4H 5DC9B 3U6RB 4MA7H 3IS0X 4XP9H 3FO9A 1I3RA 4ZFZB 1CLOL 4L8SC 3MRQA 3QG7L 4XB8A 1OOAA 3EYSL 3WUWA 3ZE1E 4O58L 3FB6B 3V0VB 2B8OT 4ZO6A 5EB9A 1FBIL 4FQ1L 3K1KC 4HIEB 1P7HL 3WS6C 3QCVH 1QFWI 5D2LF 1RUPH 3P11L 5JMOC 1S9XB 3DYPA 3CFDA 3BJLA 1RIVH 3PXHA 5DS8A 1IQDB 3O41B 2Y5EA 1HQ4B 3UXFA 1N59A 2VL4A 2CLVA 3VXUB 3E2HB 1NBQA 1MQ8A 1F8TH 3OKOB 2Z93A 5TPWH 3JZ7A 3DURB 2UVFA 3TJEL 2YPVH 5ITBH 5EO1B 3HC4H 4PJHE 5INCB 2JB5H 1JNJA 1I7RA 3FZUC 3MRJA 3ZZ1A 4MAUL 1CI5A 2IANB 1J5OH 1W8NA 3TBWB 1CF8L 3UC0H 5AEAA 4HXBH 4HJJL 4O4YH 1NFDB 1OF2B 4MNQA 3CK0L 3NAAL 4M93C 2R0WH 4KUCD 3WDHA 5DFVC 5A3IC 1S5IH 2ORBL 4BSVA 2FBJL 1IFHL 4HQQL 1WV7T 5F89B 5HGAB 3GHBL 5MEQA 1VPOL 2AQ1A 4UTAH 3IDIA 4XVJH 1XF4B 3TZVC 4XVSL 1RAMA 2NY6C 1CN4A 5D1ZB 4P49A 3MRMA 3OPZL 3TM6A 3TV3L 5IQ7H 3AREA 2MWCA 1A2YB 1JK8A 4JDTH 2GAZA 4KK5D 4ETQB 3MCG1 3RGVD 4QLRA 3TNNA 5E4EC 4GMTH 4ZTPL 3EAKA 3G6JE 4LRIA 2XY1A 4HHAA 3IDMB 4HSQA 4NKOB 4E41A 3FQWB 3GUTB 2WIIB 4Y4HB 4PJAA 4PRAB 1BFSA 1OGAD 5DLMH 3L3OB 1VDGA 2ZUTA 2C4XA 5C08A 3D25A 3X13B 3TBTB 3CDFA 1H3PL 1I1AA 5CEYB 5E6ID 1KEMH 4PG9A 4KDTA 5T5NF 5I6XC 4LVNB 5CWSA 4U1JA 4Z7QE 3MLYL 4N1CA 4OI7A 2D4FA 5E5UB 2GEEA 4WUKH 1U2CA 1CFTA 5EIQA 3TCLB 4QXGL 1NLBL 4OGZA 1XGQB 5IOPA 1BWWA 3BGFC 4JFDA 1OSPL 5F7DB 4LASH 3NIDF 2NX5B 2DJ4A 4HT1L 1P1ZA 5HGHA 1FN4B 1FVCA 3OWEA 4LCUB 5CFHA 1GCFA 1OAUL 3P4NB 2QADB 2JCCE 5HD8D 3ULUH 2E6PA 4CADB 5F7HA 5L8LB 4X6EB 4NT6B 4YHKH 1KJ3L 3ROOB 1JHKH 2PW2A 1MLCA 4DQOH 1T5WA 3BWUC 4P5KA 3GBLA 4OD1H 3RWCA 5L7XH 1FGVH 5CD3B 1Q8MA 3HE6C 1A9EB 3HCVA 2Z0BA 4NQEE 2Y06H 4DEPB 1Z5LB 1QNZL 4M9OA 1T0NB 4M7JL 4RGMC 1SY6A 2VABA 5F9JA 5EO0B 3A6BH 2ZOLA 3BZFA 4G9FA 5IW1A 3QQ9D 1L7IL 3NFNB 2Z91A 3U0WL 3IGAB 4TULL 1KCRL 4IJ3B 3W11D 1WICA 3VW3H 4G7VH 3MRPA 3VFVB 4UTBH 4JR9L 4Z18A 4QCIB 4NUJA 3N1GC 1MWAL 1ND0A 3ARZA 4PS4H 4R96A 4KK8C 3WNOA 3C2AH 1FP5A 2ZCLL 5DEFA 3H0TB 3UO1L 3EYQC 4Z5RB 5ESAA 1AE6L 3LKRA 1KNOA 1HH9A 4LK4A 5JW3L 2E27L 1MY7A 1RK1A 3ARYA 3C08H 3HZMA 2DDQL 4JEGB 5BVJA 2YWZA 1ACYL 2VLJB 4P48A 3W2DH 4RDQF 3SDCB 2VLKB 5CD5D 3PABB 4YXHH 3NABH 3BO8A 4GXUN 1ES0A 1A3QA 5CZVH 1LNUB 4U1NA 4MSWA 4LEXL 5F97E 1IGYB 1WUNT 3I02B 3V95A 3DRTA 2ILLA 5IJVA 4JDZB 1BECA 1KCVL 1F4WH 4HCRH 3H9HA 4UNUA 2Y7QA 3ILQC 2ADFL 3MRHA 1QSFD 5IB4A 3BSZH 2J6EA 1NLDL 3GO1L 4FQIL 4K2UL 3ARGB 4IS6B 2GW5A 1LK2B 3HPLA 5C8JA 3BFOA 4GRLA 2RCSH 4J4PD 3BP5B 1MCHA 2BVQB 3ZDYF 3RTQC 2EICA 4N5EC 5F9OH 1ZGLP 2LFGA 2AJUH 1I9IL 3O6LH 1B88A 4WEUD 1FCCA 3WIHH 4POYA 1PG7L 1JI2A 1Y18A 3BDXA 2IBZY 1J8HE 5I1LA 4NWUL 1YMHA 4U1MB 4D9QE 1TITA 1I9EA 3WN5B 1JRHL 2YKLH 5C0AD 1B0GA 1N3NB 4WJ5A 2UY7A 1I1YA 3T3ME 4TPRL 1BIHA 1UWXK 1DUYA 1I7ZB 4UQ2B 4S0SD 5DA0B 5SX4H 1FYTD 4IMLB 5CBAA 1VESA 3VH8B 3SCMB 1G7HB 3O6MH 5EU3B 2VDPL 4Z7VE 5FDWB 4OZIA 2X6MA 3SJVD 1NUGA 4X6FB 3UROR 2YD4A 3QIUB 1DR9A 4LLAA 3OZ9H 3RNKB 3MBEA 3IDXL 5FCSH 3DSFL 4XTRD 3JTSB 1NMAH 3BDBA 4HJ0C 1UA6L 4P9HH 4PJDA 3KLAA 3C5ZD 1IBGH 1DQQB 4YQXL 5GJTL 2VQ1A 3WFEL 5CCKL 1OLLA 4E5XA 4CVZA 1LE5B 4YXKH 3GMLA 4P5TC 4PB9L 1MSPA 2DYPD 2BJMH 4P59L 5JHLL 1OAQH 1KPVB 1CVRA 3LY6A 2PO6B 3KPSD 5C3TA 3PWVA 2Y36H 4JAMA 3EFDH 1A4JB 3EDEA 1IEHA 2F53B 5F3HA 4JHAL 4NGHH 2W0FB 3RVVC 1WT5A 4PY7B 2I60H 3HZYA 1EMTL 5E2UH 3Q5OA 2R1YB 1INDL 1P7QB 4MB3A 3WFDL 1LEGB 3S35X 1EHLL 1BBJA 1KB5L 2FLRT 4PP2B 5IV2A 2P49B 4KUZL 4WVRA 1KUMA 1IC4H 5MI0C 2Z35B 4G5ZL 4PGDB 1FIGH 4M62H 2YPLD 3MJ7A 1IGJA 2YD6A 2NTFA 4ZUSA 4WFFE 2JJVA 2V5MA 2YZ1A 5EULV 3AM8A 5JO5A 3OR7B 4NZUH 4OLVL 4DW2L 3EDFA 1C5DB 3CPLB 5I18L 3PWJA 3MROB 2ED9A 2OSLA 5C07A 3STLB 1JZ7A 3O8XB 1J1OL 4QRPE 2D7NA 3MJ8A 4HIJB 5IHBA 3MV9D 1MHHA 2J3SA 4PR5A 5EZJB 4TOYL 5KSBF 5F96L 3VU2A 4YXLH 1H8OA 3SQOH 4HUNB 1NMCB 4PJCA 1X5HA 3IF1A 2K3TA 1F3RB 4PREB 5EOTB 4IRJA 2P48B 2PYED 3IU4H 4PJ8A 4P2OA 5DR5H 3KPNB 4XXDA 1MHCA 3LSOA 4GAFB 1A6ZA 3TWCL 2DF3A 4KAQL 5E5MA 1SYSB 2R15A 1DBBL 1KTLA 2QJDA 3ARFB 5EH1A 3FJTA 3QIBD 2ZZUT 3O9WA 4FFYL 4I2XE 3IFOA 1K9TA 4GW1A 4BJLA 2VITA 3CXHJ 3MACL 5TE4L 3SKMA 1FHGA 4JFEB 3VFGL 1D9KC 1MFBH 3DXAE 4D9RD 1KLUB 4Z95L 3H9ZA 1L6ZA 3PDOB 1BQHA 4WFHE 1N2RA 4LIQH 4P23C 1XF2B 4OM1L 4P46B 2X2YA 1JRHI 5D1XC 4CW1A 3MA7B 2Z92A 2ICES 4NQXB 3GI9L 4P2RE 3V4VH 8FABB 5HHME 5MP6L 3AU1B 4I5BA 2BNRD 4WEMB 5F9AC 3MOBL 4OD2A 4JRYE 1OGTB 3N85L 5EDXA 2AJSL 3GMPA 5L2KE 4PV8A 1KLGB 1FG2A 1SQ2N 4X99B 2IQAA 2XZQH 2ZCKH 3BVNB 3M07A 4M7LH 4MS8D 4XC3H 1KXQE 1RJLA 3S37L 1T1WB 4QOKD 2X1QA 2QQLH 5DD1H 1I9JL 3T0WA 3LHPL 3QR2A 4P4KD 4TNVK 2BSSA 1BFTA 5ILTH 5KVEL 5EZOL 3ZYJA 4OZ4A 4OAWB 3HAEH 4N8CH 4OZHF 2CMRH 3RVXD 5L88L 7FABL 1G9MH 5IUSA 2GT9A 3MXWL 4F7MA 3R1GH 1R0AH 4JM2C 1UM6H 3G5ZA 1LILA 5T1LD 5GRZA 4Y8AA 4YGAB 3O0RL 2Q3ZA 1X5IA 5D93C 2B20A 1ZOXA 3UTTA 5I8KH 1OSZB 1MI5A 3BKCL 3DX7B 3P73A 1QRKA 3DGGB 3MLWH 3F6IA 3L3KB 1LGVA 1MF2H 4H25B 1MRCH 5E8PB 3VXTB 5ADOL 1B6UA 3N9GH 4KRMB 1U3JA 2XG4A 5IBTH 5KVDL 2VXVH 3MODL 3OKLB 4UBDC 3WLBA 3P3YA 4FFWD 4YX2L 4UAOB 1OP5K 3OJDB 3S98A 2B4CL 4HX1A 5IHUH 4JKPH 4P2CG 2JJTA 5DC0A 5H94B 3UJIH 2HVJB 1F4AA 1QHPA 3RGHA 1XGYH 3B43A 1OP3H 4G8EA 4I0PB 3FFCE 5CJOH 3BPOC 1BVZA 2CKBH 3FRUB 4KRPD 3ZYOA 3HI1A 4K7PH 1HNGA 1N5AB 3FQNB 3K8LA 5KSUB 2RQ8A 1YEHL 3TN0A 1PKOA 2EDOA 4JFFE 1ZT4B 3FT2A 4N0FB 4BSJA 1UGNA 5IJKA 3O4LB 4OLWL 4CU7A 1PLGL 4PRDA 1CE6A 2AV7A 1MJ7H 3NOIA 4JDVB 4Q6YA 3QXTA 1HHHB 1LDPL 1FH5L 4Q97A 2AKRB 1T7VA 5D8JL 3PP4L 4QWWC 5LGJA 3LKSB 2NTSP 5DJ0A 1PEZA 1JPSH 4YAQB 5HYJE 2WZPD 4MJIE 2F19H 2CLRB 1NBZB 3UZVB 3F62A 3UBXB 5T1MB 4QRQB 2H2PD 5L9DH 2OR7A 1YEKH 4ZS7L 4YHNB 4UOJA 4NQCD 5HYFA 5DHYB 2YSSA 2BSRB 5BZWA 5J9PB 1NAMA 4CVXB 3QEGH 1T80A 2BRQA 3BMWA 1ROWA 32C2B 4XH2B 1QTYT 1XEDA 1PZUB 4L8CB 1KEGL 4JGUA 4YBQC 3FCTB 5GIRB 4Z78B 4Q0XH 3TIDA 4RGOL 1D5ZA 1HH6A 4ZAKC 1HQRA 4NWTH 1DLFH 3CU1A 3SY0B 3RWEA 1MAMH 4Y19E 1A1NA 1X5AA 3HLAB 5IR1A 4EUPA 1ADQA 1BIIA 1CFSB 3HRZB 2VXSL 1RUAL 4JZJA 4FQXD 1S7WB 2FIKB 3W81A 3W9EA 5I2IA 3K74B 3PV6A 4NRYA 5JNYB 1S7VA 2CDEB 1UM5H 1SJEB 1N4XH 3A67L 3MTRA 3GBNH 1VGKB 4P3CL 3RX8A 5A16B 5I1GH 4NDMA 1G6RH 2VISB 3U7WL 4Z7WF 3MA9L 3TA3D 5GGTA 1U95A 2XTJC 3GK8L 1C16A 4PRPE 5INDB 3B9KD 5JOFA 2VDNH 2X4QB 2IBGA 4XMKL 1FFNA 3QO1B 5KVFL 4G8GA 5C1MB 1U8KB 4J23A 3BD5A 4I9WD 2IC2A 4LNVA 2OYPA 3UDWC 4OQTH 1Q9KB 4OFIA 3M8OH 1EA9C 2ZP0T 2LTQC 5AZEH 4BFGA 1K3IA 4N68A 3U30C 5IROA 5LXGL 4MJ4A 3CXDL 1W72B 3OX8A 3V5HA 1DANT 3O3EB 4NC2B 5KS9F 4FFVC 4LLVA 5D71H 4K7FA 4IIQA 5DQJB 3QDJD 1RSFA 4XAWL 3EO0B 2J7LA 4FN0A 2XN9E 2XZCH 3F12B 1A5FL 2IBZX 4NQCA 3I6GB 2FWOB 1NSNL 4WDIA 2BY1A 3E6FB 5FA3B 2GCYA 4P57A 4LSTL 2OL3A 5CJQL 4S0TD 2NY5H 4XNMA 5ID1B 4HWZB 5F1KC 5HDQH 1NFIB 4R4BA 4GAJL 4PJFB 3CSPA 2X7LB 1A1OA 2X1XR 4XPFH 1EGJA 1G7LA 2R0ZH 1G0XA 5JXEC 4Y4FB 4BH7A 3RUGB 4XX1G 4ZUWA 3ULUE 4PRHE 1LO3L 2P5WD 5DMYA 5F7EL 3LH2L 3QUMH 3OAUL 3U2SB 4J3WA 4ZFFA 3G5XA 3BT2L 4JM2F 3TYFA 4BUHA 1V8HA 2DBLL 5EU6E 5DMIL 4HIXH 1JBJA 1NBVH 1I85C 3HR6A 3VH8G 4PJ7F 4ZG1A 1Q9WB 4TUOA 5GS0H 3ULVC 2AJ3B 3DX8A 2XA8L 3LQZB 1J12A 1JN6A 1FO0A 3MMEB 4HKZA 1MFDH 1T66C 2F8OA 3BQUD 3RWFA 3KPMB 5GISH 5CMAB 4YDKH 1FZJB 1NCWL 2Q8BH 1RZ7H 5IHZA 1RFDH 3QDGA 1T04A 3B5HA 1EAPA 2OXHA 5HDBE 3BEWA 3SPVA 2VZ1A 4GRWB 5JHDA 4RMVA 4XNYL 2XA3A 4OZGE 4WFEE 3WXWH 2CDGA 4F7PB 1KCSH 1XIWD 1NCCL 1CFVL 3TH2T 5DUPL 5FCUL 4J3SA 2WWMC 2FX8H 4U6YB 5ICXB 3V4UL 2ZOKA 2NY0B 2YK1H 4K8RL 3OJ2C 4KKBD 5BS0D 4ERSL 3O2DH 2FJGA 4OZFB 2FEEL 4HIHA 3MFFA 1FRGL 4BSWA 4FMKA 1LEKB 1DJSA 2GUOB 2NY4C 4LRNH 1R3IL 3QZWA 3VI4E 4Z77B 1INEL 1FV1A 1PFCA 4RMSA 2WP3O 3L3JB 5ELIA 5B21A 2IPUK 1UZ6E 3KLSA 1NGZB 1S7SA 5J0BA 2AJYL 3HUJF 2CO7B 1J1PH 3D39D 1UCBL 3T65A 3NIFE 4KK9C 5T1KB 2B1AL 4FTVA 1KBGL 1F2QA 4FRWA 1AGDB 3X3GH 1ETZA 5T3ZL 1WAAA 2A9NH 1A6VL 4G9DB 4MQXD 5C09A 4NZRL 4QTIH 2P8PB 1KG0B 1FNEA 4QNPE 4HH9A 1FFRA 2NR6C 3FZUD 3DYMA 1RZJH 3KPQA 3LB6C 3QFJE 4JO4H 4XPBH 3PG2A 1QSEA 1YY9C 1M05A 1WWCA 1QBMH 2J1KA 3TVMA 4O5LL 1FVDB 2FGZA 5DFVD 5FOBA 3MX0A 1PYWA 4P99A 1UH3A 1SMAA 1EV2E 1UC6A 4LCIL 4CN6A 4CJ1A 1SMOA 3LD8C 4XBPA 4JCMA 3HS0A 2UY6A 3F7VA 3TZVD 4RBPK 1XCTB 1CDCA 2NY6D 3HNTH 4ODSH 3AMKA 3E6HA 5GPRA 3TNMB 4N90D 2WWKT 2BVUA 1F58H 3OSKA 2WUBH 4MQ7A 2W60B 3H7BA 1H15A 5LWYH 4HW6A 1RZKC 4Z7NE 3JBG7 4TVSa 3PJSB 5GRUH 5C0CB 4PYGA 2WBJC 2O61B 4U6VH 2R0LL 1BZ7A 1IEBB 3IXTB 4RAUB 1JNLH 4JFPB 1FL5B 3AXLB 5ERWA 1MVUB 4M3JA 1TTFA 3MLZH 2UWEF 3OL2A 1ZSDA 2X70B 3E2HC 5DJAA 4IOIA 1U8LB 1U8OA 2KUTA 4TTDC 4O9HL 3K1DA 4KQ3L 1EEUA 1WC7B 1I8KB 2DIJA 1KSRA 2AK1H 2ZSVB 5EOQH 3P0YH 4PRIA 3LEXB 4HGWA 3WIFB 1AKJD 1DQLL 4TNVF 4WGWB 2I9TB 4M7LT 4ZO7A 5DO2C 1A0QL 1DSFH 5KVMC 5ETUB 1BBDL 1T7ZA 2CLZA 4JRXE 4NZJA 2PTVA 3D39A 5A43C 4I18C 4KTDL 5JIPA 3OHXA 1XR8B 4RQQA 4V1DE 4YO0B 1YY8A 2K7QA 3OJVC 4NQDE 5DZOA 1OARH 3GSOB 3MGOA 5EN2B 1AD9B 3D2UB 2V2TA 2ED7A 3V4PL 3S5LB 2W0PA 1CD1A 1CICA 4HK0B 1KYOK 1MCPH 4ZSOA 2COQA 2FEEI 4NO0B 5MERB 3ES6A 3REWA 4U0RB 2YRPA 3LN5A 4ODTL 3HE6D 5FUOH 4I0KA 2YEZB 4GS7B 1II4E 3V6OA 3VG0L 2MPAH 3KS0H 5GZOC 2BOCA 4G6JH 5BQ7A 1F97A 4QY8B 4JO3L 4S1SL 1RZFL 3DUSA 2XY2A 5GS1B 2VZVA 3R06B 4WUUB 1YEEL 1DQMH 4Y16B 3BP7B 3GGWA 5ICYA 1IVLA 3VJ6B 1YEGH 2NZ9C 1E28B 2A6DA 1KCLA 3Q6GH 4X4XA 2DM2A 5JLZA 3DVNA 5D6DA 2V17H 4PJXA 5FO7B 3U7AA 4L9LC 3QWRA 1DL7H 2ADJB 3WNNA 2LU7A 4KK8D 4XCNA 1RZGA 3ULVF 2DLIA 5FHBL 1F45A 3EYQD 2DAVA 1J05A 4A6YL 2VAAB 3EYUH 3T8XA 2F74A 5BVPL 2JIXB 4F7TA 1DEDA 3CSYB 5CP3H 4JVUA 3S35L 3W9DB 1XGRB 3ZYIA 1Q0XL 5JPNB 4J3OC 2DWDB 4U1HA 2M1KA 4X7TB 3R0NA 4J6RL 4GKOA 5E00B 3ZE0F 5D7JB 5D2NE 4F15B 3C8KA 4AIZB 5D1QB 3V5KB 1NGPL 1IKFH 1P4BH 4DEPC 5I1DB 4Y1AD 4OF6A 4PJIA 1RU9L 1L0XA 3IDNB 4PV9A 35C8L 3WDJA 1HOCA 1JPST 1I3GH 5IG7B 2O5YH 3S88L 3VD9A 3DVFA 3ILQD 2B1HL 4UIMA 2GJ6A 3V6ZB 5T3ZD 1U8HA 4DGYH 5HHPA 5JPMB 3NCEB 3H2WA 3MV8B 5EUOA 3WEXA 4LMQI 4DVRH 4F7CB 5C0BB 1UXSB 4F3FB 5B8CA 3DMMA 1FORL 4N5ED 4L3CB 2OK0L 5DHVB 3IDYB 1V3LA 1Z0MA 1YJDC 4L29B 1YYLL 2WBKA 1KFAH 4MVBC 3UTSE 4X98B 3MUGB 4PUBH 1EXUA 4R3SB 1I8LC 4XNQA 2D7TH 4X4YA 4W81A 4FQJL 5IVZA 4DTGH 2JTDA 4LVHB 3SE8H 2QHLA 2P5EB 3I6LE 1SY6H 2Z31C 4R7DB 2PYFA 1CXIA 3D85B 3LN4B 3KXFD 1F6AA 5E8OB 5F6IC 2RFXB 2Z8RA 1AGCA 4FP8H 4Y7MA 3VWKB 2YUVA 2NNAB 5EUKB 1H3WM 1A3RH 2W59A 3D69B 3H9SB 3LS4L 4Q6IA 3A6OA 2ESVB 5BJTB 5BV7C 4HAFA 3ILPB 1B0WA 4N0UA 5IGXH 5CKGA 1ZS8B 1QFWH 2H6PB 1BQSA 4HJ0D 2VDKL 4FFZH 3QNYB 1X7QA 3HFMH 3QB7C 4U0QB 2R4RL 4P5TD 1XFPA 5E2VL 1BLNA 1BD2B 2VLRB 5DMKA 3WFCL 5KSAB 4HG4K 3FAWA 1ZE3C 2EIBA 2RIKA 3VFPB 5C0FA 4PG2C 5I1IH 4OV5A 3NPSC 4EKXA 3BP4A 3MLVL 5GGVH 2C3VB 5LKNA 2A38A 4APQB 1UZ8B 2HFGH 2J8UF 4MMZC 4NHCH 1YNLH 5D4QA 3ABZA 1TJHL 4Y5YB 3LQMA 1HILB 5DVMA 2XKNB 5MENA 2PXYC 1FDLL 3QUZC 4P2QA 4QHKJ 5FKAB 4WO4A 3KR3L 3HG1B 3Q0HA 3VI3F 5IVXE 4ORGA 1R5VA 1M7IB 1FQ9C 1WCBA 1KACB 4DZBA 2J6EH 4XNXH 4OLUL 5TE7L 3HC3L 1JNNL 1A7OL 4UIKH 2IG2L 1K4CA 1XGUB 1M6OA 2EH7H 3E1F1 4GMSH 4IM8A 5I15L 5DT1L 2CKNA 3AROA 1FL6B 1GGIL 3G5YB 1UH4A 1X5XA 2IMNA 4YFLF 1AHWC 3L6FA 4G8IB 3L3DB 5ALCH 1OAKL 3OJMB 4M61B 1LO5B 3PQYE 4ODWA 3QRGH 4PIRF 5DRNB 5EZLB 1A7PL 3M1BA 2UZIL 3FOLB 3O3DB 5C0ND 5EZIL 2NY2C 1DEEA 3KYMA 3CFCH 4PJFE 5CIPH 1YMMB 3WXVL 2ARJQ 2R9HC 1MIEH 3GKWH 4GAYB 3JV6B 4O51A 1PQZA 2XWTB 1J0IA 3P30L 4OJFH 2DTML 1H3UA 4NYLA 3MLPA 5CS7A 4ZNEE 2VR4A 3VXSD 3BPLC 3RAJL 3SDDB 5DSCB 1PJ9A 3MUY1 4L1HA 3HB3C 2EE2A 4M1CC 4H8WC 2JK5B 5IESL 3CFBA 4AY0A 1CGSL 4NKIL 4P5MB 5GGSA 1D9KD 4GW5A 2KKQA 4RWHA 4P23D 1GGCL 3Q3GB 4JN2B 1VADB 1XF5B 5D7LE 4ZYKB 4PJ5A 1JWSA 4PLJC 3ZTNH 1VACA 5D1XD 4UINH 5FO8A 3RGVB 4H88H 3FB5A 4OZFG 4J8RB 1NBYA 1HNFA 3BP6B 3RWGA 4GXUM 2UZXB 3BZ4B 3DX6A 4M1GH 2VYRE 3ZDZE 1S7RB 3D3VA 3Q48A 3ZDXF 2XPGB 5TE6H 3S8WA 2ZPKL 4OM0H 1DVFC 3S7GA 1OGAB 4X6CA 2HKFH 2V9TA 1ZLSH 3TESA 1UEMA 5L0QC 5FKPA 4MB4A 3G6AA 1RJYA 5E6IB 3RKDC 4H1LH 5JW5A 3DX9A 2X4RA 4Y4KA 2FO4A 5F93C 4I48B 4HXAH 4PY8I 1TTGA 1IGIL 3OXSB 3PWLA 1C5CL 2AK4A 4NNPH 4PJEF 1H3VA 1YN6B 3K81A 1EPFA 1MNUL 4JM2D 4I3RH 4U3CA 3JTTA 3UX9B 3DO3A 4QHNA 3ARDD 1ONQB 2AI0L 3CZFB 4P46C 3MRFB 5HYSA 5J56B 1IL1B 5K9JL 4B5EA 3SGJC 4MX7B 2FZ3B 1PBYA 3E0GA 5GRVK 3O45B 5CEXB 2DTSA 3TBYA 3RY6C 5TQ2H 1IAKA 2QQKH 4XVSH 5B4MC 1FGNL 4WW2C 4UBDD 3B2UC 4PD4K 3HE7B 1ORSB 3ULVL 1BZQK 1I4FA 1E27A 4CMMB 4EI6A 3D48R 3GJFK 4PRBB 1UM4L 1BFOB 2W91A 1FFPB 4X7EC 1EJOL 3UPCA 3IFPB 3NA9L 4G80B 3PIQA 1UKQA 3JV4B 5IWLC 2XV6B 4YWGL 4PJHA 1JVKA 5FGCB 2WINB 3LIZL 4X6DB 3K7UA 5D7IB 2GTZB 4F33A 4L1DA 1RZIB 5CZKA 1G7JB 1IC7H 1QR1B 4LQFH 1OCWL 3VG9B 3QPXL 4J3UA 3C8DA 2MCPL 4ZOBA 1XCQA 1IMHC 1LP9E 5E99L 5FO9A 3OGOE 1EZVY 3G9AB 1DN2A 4G7YL 2V7HB 3QH3B 1NAML 5C9KA 4QWWD 3T0EC 4XBGB 4AH2A 1T6VN 5BRZE 2W9EH 1QR4A 3QBTB 1U91A 2DQGL 2WMPA 3K8KA 1CZ8H 2FATH 1BGXH 4ODUA 5EO9B 2DLGA 3FN0L 4IRSA 5SWZE 1YUHB 4JRWA 1JP5A 3SGEH 2XNAA 1F90H 1HSAA 1UB6A 2GITB 2DQIL 3BKJH 3OAZH 1FZKA 4ONHB 5L6YL 3NCYP 3NZ8A 3RPKA 3MV7E 1GGBH 4WI4A 1LO4L 3AY4A 1HIMH 2RB8A 4YBQD 3INUL 4WWKB 5J1AB 2OM5A 4Z7UF 3CNKA 1C08A 4PRNA 2A77H 5I73B 1HYSC 3V8OA 4ZAKD 4HK3J 4NN7B 2H32B 4RMWA 1GC1H 4I0PC 3ARDA 3CX5K 1QNZH 1X9QA 4KJYB 4M7JH 4U1LB 3L5WB 5J6GA 3GKZA 1HSBB 5SWSE 1WWBX 1UJTA 1T03L 3UTZA 4ZFOL 1CK0H 2YN3A 3VD7A 4LLMA 1YQVL 4EQ3A 1V7NH 2ZSWB 4XP1H 1QEWA 4X5WB 5H35B 2GSGA 5DJZB 3JWDC 4WW1B 2ITDB 1OL0A 3KPOA 4R0LB 3RWHA 3SDXF 1KCRH 1QSVA 1X6NA 5DJ2A 5C0AB 3ZL4H 5JZ7C 2NY3B 5JA9A 4K94C 1I3UA 4P3DB 5C86A 4P4RB 1IJ9A 1VFBB 5HJ3A 3CSBA 3FB8B 5T33L 4XBEL 5K9OA 2LU3A 2XIDA 4Q9RL 1E0OB 4JY5H 2XTJD 3EOAB 4KPHL 4UU9B 3THMH 4C83A 5AYUH 3GSQB 5D5ME 1JGEA 3SJVB 3X11B 4Q9QH 5J4MA 1E6OH 2E9WA 3MZTA 2BP3A 3QDMD 4U1GB 2FB4H 4NQEA 1H3XA 2VDOL 4JZNA 5JA8B 1IE5A 3QDAA 1Z3GH 3N1QC