3TBTB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtB00
2YC1A 4KROD 4O2EB 4PY8I 3KJ6L 1IARB 4MQ7A 4YHZL 3B6SA 3BIAX 4J1UB 5I8KH 5DMKB 3NPZB 3BHBB 5EIIB 3NABH 4HDIB 2OMNA 3DGGA 2EDNA 5DJ8B 1JZ8A 1L0YA 4U1MA 3F58H 4G3YH 5B39B 3GSQB 2IGFH 2CKBH 4YEEA 5CS7A 1R3IL 3P4OA 1TVDA 2D4DA 4UB0H 3SDYH 1BLNB 1IQWL 1U6AL 5ICXB 2KL6A 5DUMH 1I85A 1B0RB 3U4AA 1HIMH 4I0CC 5HGAB 3BRGC 1XGRA 3KG5A 4M02A 2HKHL 1H3VA 3NGBC 3W11D 4OZGA 3QR2A 5DHVB 5D1XD 4G6ML 4JDVB 4BH7A 1B0GB 5HYSB 5A2KH 3BE1L 3RGVC 1L7TL 4V2CB 5EO0A 3FT2A 3QIUA 3G08A 3ZT7A 3IGAA 4TVPE 4R97B 5EUKB 4HUMB 2VL5A 4WW2B 2F54E 1X4ZA 3U4EA 4MJ4A 4MS8D 1CVSC 5I1GL 3WUZA 4X6BA 1AO7B 1HYSD 4HHAB 1NUFA 3OJVC 3GEWB 3QNYB 1LEKB 3VJ6B 2W9EH 1JPGA 4CDHA 4LMQE 4L3CA 4YBLC 1B9ZA 4EI5D 4ZFFA 1I7TA 3ARDB 4ELKA 1KC5L 2HJLA 4GRWE 5DJAB 1V7ML 2ZUXA 2R4RH 4PBXA 1FYTA 2EIEA 5DJCA 2CMRL 3UAJC 1C1EL 3NH7H 4MNHB 1CFSB 1KEML 1MJJA 4MAYA 3OR7B 3MLWH 1HHIB 1ULVA 1J11A 4EI6A 1A6WH 5FA3A 4BSWB 1C16A 5HHMB 3K81A 3ROOA 1JZ3A 3ZDZF 3DMMA 3DX8B 4L9LC 3OKKB 5F88B 1EHLL 4YDJB 4NUGL 1IZKA 1M6OB 1KXQE 3B2VH 1ORQA 1W0VA 3NA4A 5I76A 2P1YA 3V0VA 1V3JA 3FT4B 5TDNB 1RZFL 4L8SB 2BCKB 3HZYA 4PRID 4XPAH 3TT3H 3SCMA 4PS4H 5F7DB 5B8CB 3THML 3RZWA 3MLPA 3FQTA 4JRYE 4K94L 3ESUF 2EKJA 4K7PY 4RGND 4L3EB 5EUKA 4WWKB 3WJJC 2HT3C 3Q2CA 4EJ1C 2VDPH 5GGVL 2FJGA 2ILLA 3MBED 3HPLB 4XCCH 1N64H 3L3JB 4N0FB 4POZD 4L3ED 1M71B 3TESA 1RY7B 2ARWA 2FWOB 1XEDA 1RZ7L 2HG5B 2QSCL 2DQTL 4D3CH 4RNRA 1JVKA 1CFTA 1WAAE 3FQUA 4FNLL 1RIUH 1EV2E 4Y1AB 1CICC 4HWNA 5DVKA 4ZFZA 2PETA 3GRWA 5HVHC 4XNZB 4MA7L 5GGSB 5EU7C 1YEDB 1JNLL 3SDAB 4C57C 3ZE2F 5IM7A 2WQRA 4K3JH 3RWHA 4S1QL 3WFHB 4HUKB 4S0TD 1IEHA 4QO1A 5ANME 1RUQH 4XNUH 4NNPH 1K4CA 1FYHB 1OHQA 4F57H 3NFSL 5L0QB 4Z7UA 5C0BA 4AYFA 3BRFA 3VFPA 4EDXA 3U9UA 5F3BA 5ITFB 43CAA 5BRZB 4U1IA 4K8RD 3NCEB 3B9KB 3PNWB 5F6IC 3JUYA 2J3SA 1SEQH 5HYJE 2NW2A 4WUUA 4JCMA 1DQDL 4OCXH 4ZAKA 3NGBB 4LLVB 4OJFL 1T3FA 1FL5B 5B3JF 3T0XA 5MENA 3NN8A 5DD6B 1U8QB 2EIZB 1KCUH 1HHJA 1ZTXL 3JBG7 3QUZD 3QHTC 1K4DB 2AXFA 1T2QL 1Q38A 1IEBA 4OLYL 5I19H 1O0VA 3PDOB 4LVOB 4GS7C 1Z2KA 3LKRB 1ZT4B 2VQUA 2Q76A 4XPBL 4W68A 5GRXG 3SJVB 1FNSH 2NY4D 4WO4D 3IS0X 3GMLA 5GGUA 3W5MA 2VABA 4QNPE 3DBXB 3ALWA 1Q94B 2E9BA 2AGJL 4FTVE 2Z31C 4NQEE 3KYOA 4YHOH 1RK1B 2R56L 3OKEA 4Z7WE 5GPRA 4KRMB 4G42A 1KCSH 2HVKA 4KK9C 3H2WA 1P69B 3U1SH 1HXYB 1ADQA 4DVRH 3IVKA 2FHFA 3BYYA 2DMCA 3O6ML 3BW9B 3VI3F 1NBZA 3CVIL 3FT4A 5TDNA 3TA3D 1IM9B 2NY1C 3SPVA 3H42H 2QKIB 2V7NA 3DX9B 4WTZG 1KG0A 2IQ9L 1U8IA 3A67L 1WZ1L 2VITA 1DDHB 1TETL 1JP5A 1I1FA 4JKWA 3HR6A 3MGOA 4I3SL 7CGTA 2VJXA 3O0RL 1MJUL 1NMBH 3TYGH 3VRIB 5T3ZE 5ISZB 4YIQB 3KNBA 1F90L 1JHTB 1YPZE 1CFTB 3C6LA 2XG4A 3TFKD 4PTTB 2VN4A 2VISA 1ZT1A 3U4BH 4OUUA 1V7MH 1ED3A 2YPLB 4LVOC 2VXSH 5F1IA 5H37H 5F8QC 1HN1A 3ET9F 3ULVD 1A4KB 4JRYA 2IEPA 2P5EA 1JGEA 5D9SA 4EUPH 4PV8A 3D18B 5HVGB 3P4MA 2W59A 3WXWL 1QO3A 3QDJA 3LIZH 1TVHA 3TC9A 1U8PB 4NUJB 2OJEB 4HPOL 3LEXA 4NN7C 2D31B 4N0UE 4WO4C 3W9EA 2B2XH 3SDCD 5JHDB 2HMID 4NQCE 1Z6JT 4JN2A 1K8DA 3GHEH 4CVUA 4PJGA 1I1YA 5EZLA 3LPGA 5E4EB 5GGQL 2P8MB 3GO1L 3QEQE 4MXWH 3UYOD 4OT1H 1EH9A 3D1MC 1OP9A 2JK5A 4YHYB 3SKOB 1FRGL 3WV0A 1OW0A 5IVZA 4DCQB 1PEZA 4L8SC 1I1AB 4XNMB 2I9LA 2JCCB 1KLUA 2XZAL 1M71A 4AEIH 3EGSB 2V2TB 5JPNA 4YDVA 1IMHC 1CG9A 1GOGA 2X4TA 1S9YB 2HH0H 5B38B 2AJYL 2JJUA 2VR5A 3DO7B 1DVFC 4GG6E 1ZT7A 2A6DA 5J9PA 5DMIL 3TJHC 5F71A 4L8CB 2W92A 4L9LB 2WBJB 5CBAB 1M7IA 1YMMD 1U3ZA 2EEAA 4LQ1A 1BOGB 3JXAA 5TFSL 3HI1A 4P3DA 3RNQA 5C08B 3P30L 1T66D 4CADB 4OUOA 3V0WH 3SE8H 4J3TA 2BSTA 2VXSL 2X4OA 5JA9A 1AQKH 5KSVB 4HWZA 4YHZH 4CMHB 1ZLUH 4Y2DB 3QEUA 2X9WA 1G6RL 4H8WH 3SGKC 3DV4B 2C4FU 2QLVB 4XCEB 3BZEB 2YWZA 4XC3L 2FIKB 5C3TA 3C08H 4BH8B 5JZ7D 5D7KD 4U6HB 1F4HA 2IH1A 4LKXA 3Q1SL 5C09E 4PGDB 1NCAH 3LKPB 2FD6L 4Y16D 3WKMH 4U1SA 4WHCA 2NW3A 4PJFA 5IQ9B 1J1XH 1GHFL 1QBBA 4Y5VB 4X7FC 3QXDA 1KT2A 4ALAL 2IADB 2X4NA 1CYGA 5KSBE 3HB3D 1HDMB 2GYSA 3L3DA 4IRJD 3OF6D 1K4DA 4XPAL 4YZFF 4XVSH 1A6UL 8FABA 4HIJB 4LHUG 1NGYB 3OAUL 1AP2B 1UWGL 4KVCH 2Z31A 3MZGB 4GLRI 3H3KA 3O2VL 3D48R 3EYUH 5D7IE 4CJ0A 2NY5H 4PFEA 2BOCB 4AEHL 2BVPB 5L6YH 5SWQB 1IC7L 1OGTB 4PJCA 2DD8L 2ZOKB 4PGBB 3V5KB 1WBXB 4GSDL 5AUMA 4MNQB 1KLFA 3OKNB 5I1IH 1WWWX 3SOBH 5DEFA 1FNSL 3QUML 1D5IH 4HMCA 1CCZA 3MRRB 4BQCA 2C26A 3TIDA 4F15B 1SHMA 2CDFB 1G0DA 4X7SH 4IIQC 4PJ5B 3BJ91 3SGDI 3QFDA 3UDWC 1HK6A 1Z9OA 5JW3L 4M03A 1E4JA 3ZKNC 5GS0D 1MF2H 5EU4A 2X10A 3N1GC 1ZGLP 1QVOB 2HT4C 4WRLA 2AQ2A 4ISVA 4E0RB 3P9MA 2VO5A 1MFEH 4XX1G 4JJ5B 1UGNA 3I2CL 4KJYB 1RUQL 3D39B 4XMLL 2R0LH 1NC4D 2EXWC 4WEBH 4XXCC 4OM0L 2ADIA 1EGJA 1P7QB 2BXZA 3MLYH 1AY1H 4I1NB 4KUCF 1S7SB 2OCFD 1A7BA 1RIHH 4ZPTA 2JB5H 4EUPG 4KZDL 1HI6B 1Z5LB 1UA6L 4R26L 2C3GA 2WUBH 1LP9E 4GAFB 2QJDA 1L0QA 3BPCA 1JWMB 1KCKA 4AMKL 3OAZH 4XVUC 1ADQL 4U3CA 4JFPB 4LRNL 1UM6L 2AXJA 4NQEA 1OQXA 4HUUA 3HMWL 5DC0A 15C8H 4GBXB 4U2YA 3RY4A 3OXRB 4L8SA 5EBMB 4RBPH 3VXOA 2VZVA 4QHUA 3WS6C 3WUWB 1DBAH 3EFDH 2A77H 4TQEH 5D6DA 1VACA 4FQPA 3S4SG 3T8XA 2X4UA 2ID5A 4C56A 3NZHL 4RX4A 5SV3A 3FRUA 3MRMA 4NC1C 1T83A 3TIDB 1UXSB 1MRCH 1CXLA 3GMNA 1INDL 4JFXB 1P84K 3HPLA 4ODBD 1CFVL 2AV1A 3MO1A 2Y7QA 1UJ3B 2G60L 2DMBA 4YX2H 2XPGA 5LAXA 1FIGL 5A16A 4HGWB 3F7VB 3QUYD 3N0PB 2PW1A 3A6BH 1MRDL 4C58B 4ZXBB 1UWEH 4S0SD 2O61A 4IOIB 3ZKMC 4GKZB 1P4IH 5BMFL 2EICA 3G6AB 5CJOL 4OFPA 3VRJB 4WUUD 4R97C 2NXYB 3Q5OA 2R2EB 3ALPA 4NKIL 2APTA 2X4RA 5FA3B 3DYOA 5KJRH 5TQ2L 1Z9SA 3ARFD 4JPVH 5DD0H 1DEDA 2NZ9C 4UILH 4PJFE 1LP9F 2X4OB 1NCBH 1I3GL 1QA9B 4OAWA 1V3MA 4KQ3H 5LBSH 3BSZL 1GCFA 1OB1A 2X1PA 3WNKA 2M8XA 4ZFFB 1BAFL 1GPOH 4B0MM 1A1NB 2GSGB 3TVMB 1IC4L 2VDQH 4Y1AE 4MD4A 4JO4H 3IDJB 1IEAB 3UPRB 1XR9B 3O3BB 4TUKL 2VXUL 3QB7C 4OFVA 3O6KH 3PHOB 4OTXH 4LGRB 4XC3H 1D5MB 4JHAL 1LO4L 4MVBD 4IIQA 1OP3H 1QRNE 4ONFH 4QRTA 3OB0H 4LLUA 5IVXA 4OB5H 4NQDD 1VFAB 3NZ8A 3OKOB 1Z3GH 3RWGA 4U6YA 5EO1A 5IW1B 5K93A 4Z7UF 5CFHA 5FUOL 4LIQL 4JDZA 3EYOA 2F54D 3GO1H 1JGVH 3PABA 3FQRA 1MCHA 4MLIA 4OLUL 4RZCA 1F6LL 5MEQA 2VDOH 3QQ3A 3RL1B 4ZSOE 5FCUH 5INDA 3EOTH 1TJHL 2LFGA 5EU6B 2R4SL 1RUKL 1EPFA 1GGBL 1UYWH 2DI9A 3SKNA 4P0DA 1LDSA 5CZVH 4JY4B 3T3MF 1MWAB 4GOSA 4M93C 2H8PB 2MHAA 4ZUTB 4XWGH 4GAJL 3GK8H 4NRZB 3AS1A 4QRRB 4WI4A 3TBSA 2J1KA 3KLAB 1ZLVH 1BBJA 4I0PD 4F3FB 4YAQB 5C0RL 1MNUH 3A6CL 4AJ0A 1IM9A 2CJUL 1OAXL 4JAMA 5GRUL 4A6YA 1AHWB 1UEMA 1FFPB 4HUXB 3QIWB 3QDJD 3P9MB 1HHHB 3JTTA 1EGJH 3EYSL 4A6YL 1JGDB 5FA4B 1ORSB 1CDIA 1QPPA 1N0LA 2VR4A 1KGCE 3E3QE 5DVMA 4NWTL 5F1NA 2IAND 4JO2L 4HKBA 4JFDA 2NXYC 5DMKA 2GT9A 1S7TB 1U3HD 2VLRE 4MYWB 1PLGH 3L9RA 4P48A 2RQ8A 2KZWA 4LLWA 4W81A 1NCTA 4G8GB 1RHHA 4PRAB 4Z7WF 4WI3A 3VFSA 5IMOB 1V3KA 2EXWD 3K1KC 1GIGL 2D7TH 3ZTNL 2FDBP 1HXYA 2P42B 1JUFB 1A1MB 2LAAA 3CX5K 2Y25A 3TCLB 1BEYL 5FOJA 3P4NB 4OD2B 3PWPD 1KG0B 5TDPA 3WIHL 1HOCB 2PCPB 2CRZA 35C8L 3LS4H 3UPAA 5JDJA 1GGBH 3MPCA 4PD4J 3NCYS 4NQVA 4Y5YC 2O5YL 4LAQH 1D9KC 5B3JE 2L0DA 2Y6SD 2DQCL 4NKOA 1RU9L 3I02B 1RMFL 3QEGH 2WSKA 1U36A 4ELME 5EDXA 5LCVH 2PTTA 1YNLH 1DLHB 5I1IL 3MLRL 5FCSH 3FO0H 4I0PC 5C8JA 5KSUA 5GRYA 4GW5B 3FO9A 2WV3A 2HJKB 1UADC 1HCVA 3B2UC 3OB8A 4NO0B 3EYFA 3UYRL 5BQ7B 3S34H 4WV1A 1A3LL 3DOSA 4UT9H 4QWWD 4IDLA 3VDBA 4O00A 2IAMC 1FDLL 3BH9A 3ISWA 4Y4HD 1MCQA 4P2RB 5HXMA 3K8MA 3VWJA 4J12A 3ALXA 1I8LA 3W81A 5AYUL 1P6FA 2AJSL 4JO3H 4NGHL 1CXIA 3LH2L 1CK0L 3JVGA 2YK1H 5CSBA 1PG7W 4M6AA 4LHUB 4MX7B 3JUZA 3VGGA 4KJPC 1ES0B 5DJ2A 4M48H 3U46B 1MI5B 5E8NA 3LB6D 3OR6A 3RGHA 1UENA 2C3HA 1YZZA 5DRXB 1F11A 4N1EA 4R3SA 5DJDB 5I8OL 2V2TA 1Y18B 1SEQL 4PJAF 4G8FB 1MQKH 3QHZL 1NEUA 4PJ5E 3V2AR 3V5DB 1SEBB 2R9HD 1WEJH 4M6MH 5TQ0L 3LKSB 1IL1B 2EC9U 4IMKA 1TQBB 3QI9A 4CMMB 1T2QH 1A0QH 4V1DE 1WWAX 4FZ8L 4WUKH 4TOYH 1HSAB 3HS0B 4BKLA 2VDPL 5GGVH 5E8EB 2BFVL 2OLDA 1RZKC 1PFCA 5FYKD 2HN7A 1FL3A 3EGSA 3BPNC 3C9NA 5D93B 4U3XA 2DQHL 4MXVE 4OBSA 3BN9C 4DK3A 4C4KT 2VZUA 4P46D 1KJ2A 1KENL 1OAYL 1INDH 4YNYB 4Z95L 4ZFGH 3ESVF 4FP8L 4LVEA 1ZVSB 3CFKA 5I1DB 5H94A 2X89A 4NKQB 4PY7B 4W6WB 5HGDB 4LVNB 4Z7QE 1JCKA 1FVEA 1R24A 3PGDA 4OCWH 4NCC2 2ESVB 3SGDH 1NCWL 4XMKL 4RAVB 3M07A 1U8HB 2GFBB 3KXFB 3EOTL 1XF1A 4KRPB 5ESQB 3NABL 1VKXA 2K3TA 1Q9KB 3S5LA 1MQ8A 5E4EC 4OZFA 5HI5C 4JANA 1N59B 5J3HC 3IRPX 2MJWA 5F7EH 3EO9L 4CVZA 5J11B 2ESVE 2F9BT 4EVNA 4NQED 3PWUB 1LQSR 1PYWA 5EPMB 2IQAB 5DJYA 4KZDH 4LEXL 3QI9D 4JM2F 1BFOA 4WV1B 3UBXI 1I8LC 4FQLH 1JN6B 5SWZD 5J1TC 4Y19A 4HIIB 4YXHH 4S1SL 4QHLB 4X83A 2EDXA 5GJTH 4PS4L 4HMEA 5BS0D 1C16B 1UH4A 4LRNH 2VAAB 1QFWM 1RZJC 3RPIB 4UNUA 1FZKB 4MNGE 1VPOL 4TSAL 5D7JC 5ADOL 1ZHKA 3V6BR 5HBBA 4XBGB 3O3UN 2HN7B 3O8XD 3D3VE 3JWOC 2VAJA 5E94B 1YEIH 2Y9RT 5BQ7A 3QDGA 3E6FB 4PJHE 3TH3T 4N68A 3JV0A 5E8DL 3BXNA 1CI5A 2VIRB 3STZB 5EN2B 2DJUA 3H9HA 4J3SA 2PCPA 4YBQC 1JGVL 1S8DB 1S7WB 2H3NA 4BM7A 1TPXB 3IU3A 2BX5A 3CMOL 5IBLC 4DTGH 4CN6A 1U8QA 3LQAH 4R4BB 3QUXD 4YC2B 3LD8B 1NBYB 1JZ4A 3MV7E 3E2HC 1EX0A 1PW3A 3HAEA 5JUEH 1OP5H 3QPXH 4E42B 4PP1C 1J1PH 2X4SB 3L7EA 1P4IL 5BMFH 4YHKH 1ACYH 2Q76B 4NNYB 1BM3H 4UT6L 5C0CD 4QRPB 4UNTA 4KJYA 1MVFA 4JRXB 1NCAL 5DLMH 3CX2A 4HCRH 1JYWA 1QYGH 3CLFH 1RUAL 3BPNB 4HW6A 3EOYG 5DD6A 5C70A 2J12B 1WFOA 2FJHB 4KQ3L 1NL0L 4N9GA 3WXVL 4NZUL 3DHJA 4GAYA 1I7RA 2AABL 3MRRA 4EN3A 5IM7B 4R9HA 4PGCB 4KZEL 3QO0A 3IU4H 4UQ3A 3ZHLA 3VH8G 3HAEG 1Q9WB 3QFDB 3QDAA 3EJYD 2NY5L 5E94A 4EQ2A 1XCTA 4P23B 5C0CB 2B1HL 3BIKB 2G5BA 3DV6B 4NKDA 4ACPA 3S5LG 2X4PA 1TITA 2VB5A 3OKYA 4DOHE 1Y0LA 1A64A 4B7LA 4HIIA 5EFIA 5CD5D 3HMXL 4FFYH 3RL2A 4FFZL 2PYFA 2H6PB 3CVHB 2FX9H 3RNKA 2OSLB 1NC4A 3D0VB 3MROB 3LQAL 5EO9B 2CLZA 2OS7A 1NDMA 4OD3L 4E42A 4CVZB 4UQ2B 2EYSA 1K6QH 4MAUL 2UVEA 1C7TA 3VXTA 4NCDA 2YEZA 3QXWA 4G80A 5CZVL 4G8IA 3IFLL 4NNXA 4PRHB 4EI5A 1C5CH 5MEQB 3AAZB 3NCJH 1XIWC 4Y19B 1QBLL 4WENB 3G5VB 1WZMA 2QBWA 4HKZB 1MRFL 3VE0B 1ZANH 5F1SA 5HYIA 1IEAA 2A83B 1PKQA 2XN9E 1BZ7B 1KENH 2APXA 1T5WB 4MAYD 4M61B 1X5XA 4BQBA 5IB4B 1R5VB 4Z0XB 4XCNB 2CK2A 5CILL 5BVJB 5CKAA 2I24N 3BP6B 3S8WA 2XRAH 2BNRD 1RUPL 1CR9H 4G9FE 5DURD 1UG9A 5E95B 1TZHB 3TWCL 1U95B 4OAWB 1VKXB 3QT2A 5KSVA 4KJWD 3LCYA 1KTLA 3DV4A 2XPGB 3PJSA 5D70L 2R69L 2X41A 3VU2A 2VXTL 1CG9B 4LEOB 4X80L 4YDVB 4MB3A 2AJUL 3Q48A 2ORBH 3OKDA 2QHRL 5DK0A 1IRAY 2B7DT 4UTBH 4XXDA 2E6PA 3UTPD 5J3HD 4Y16C 1M7IB 3QEHB 3DGCR 2Z8RA 2D03H 1MJ7H 1QLFA 4AM0A 3FQXA 3TV3H 3WNMA 5BV7B 5JW5A 2GHWB 2DQIL 2AEQL 3MA7B 4Q9BA 5I18H 1DQQA 4N0UA 5KZCB 3GB7A 3FT2B 4ALAH 3I84A 3EUUA 4QRPE 4XPGH 3BEWA 4AMKH 2I9LB 1C12A 2VZOA 1C08B 1B0RA 2HJFA 5JPNB 1AR1C 4ZSOB 3EYOB 3T0EE 1D9KD 3CFCL 1BOYA 2WINB 2A6KB 5CJXC 4LPCA 4YDIH 3VXPA 5ACZA 1LEKA 1TVHB 5DJZB 2BNUA 5FGRA 1HQRB 4AEIL 2MTPA 5I71C 4U0QB 4F7CB 3NCJL 2WIIA 1HNFA 2X1OA 4TQEL 4HKXB 4WHYH 2YD4A 5DTFA 5ETUB 5LGHL 5EO0B 1JHLH 1H9VA 1Z0MA 5JLZB 4C59B 3I50L 2M26A 4MNQD 1IGTB 2WW8A 5E70A 4D0BB 2X9YA 1JV5B 2KH2B 3BPLC 3UEZA 3TN0D 1E6JH 2AQ1A 4ENED 5DT1H 2BHZA 1A7QL 1T4KA 4XMKH 1HH9B 4H26A 2ATKA 2CIIB 2P5WD 1FQ9C 1F4XH 3BKJL 5HPMA 4UAOB 3M17A 1GAFH 4M8QA 3KHOA 2VXTH 1CLZH 2NY6C 1PX4A 4KHXL 2FSEA 3FRPA 1F8TH 1KSRA 2NY0B 3DUSB 5TH2B 2H32B 2R2HA 4N8CH 4HGKC 2AVGA 2QEJA 4EUPB 1JZ2A 4HXAH 4U2ZA 2WMPA 3AMLA 1IVLA 4UV4L 2DIAA 2XZQH 5CEXB 1P5UA 1AKJB 1FGVH 3C6SB 3KPOA 4QOKA 1M4KA 2KBGA 4AQ1B 1FPTH 4KRPC 1XGTA 3T0AA 4F58L 4XVSL 2DQDL 1I75A 3ULUE 4FABH 1S7RA 5KSUB 2Q1EA 4QHKJ 4YQXL 5C0IB 4E0RA 1D5BB 1ACZA 4MNQA 4K94H 1A14H 1J1OL 3C8KB 2ZG3A 3MRLB 1J5OL 2O93L 3E6HA 5EUOF 5EU7E 3MRJB 3QO1A 4EZMA 4ERSH 3CNKA 4GMTH 4W6XB 2PTUA 2R0KL 1DBJH 1XIWB 4XPTH 4NKOB 2FBOJ 3RL2B 3VXRE 2QQKL 4PLJD 1DE4B 1IILE 3UXFA 3CZJA 4FQ1L 4IOFD 4G5ZL 5C0RH 2P5WA 3B8SA 4RAUA 1ERNA 4WWID 2JJWA 4PRPD 4JFEB 4QRQA 1A7OH 3C8DA 1DQLH 4H25A 4U33A 4NQUA 4X6CB 4ZPVB 2WLZA 4UDTA 3BEVA 4O4YL 5C0ND 5EORH 4P57B 2J7LA 4DGVH 1CXKA 4F7TB 3TCLA 4XWOC 5CINH 2DIJA 2ERJB 1WZKA 5CEZD 3HLAB 1V5JA 2AKRA 1RUKH 4JQXC 25C8L 4NKMA 3R0NA 4IRJC 1LP9B 3RZCC 4Z5RB 4DQOH 1AGBA 2EDEA 5C0AE 3GI8L 3DVIA 2ZP0T 3MLXL 3MRPA 5FYJE 3UP1A 4DZ8A 5L8JB 1PZUB 1HH6B 5LG1A 4ZODA 2B1AH 5JOPE 3FB5B 4LSVL 5CLTA 1MNUL 1U58B 1E4XL 5IF0B 2Z9TA 3S4SA 1K4CB 3GJEB 2FL5A 3N9GL 1ZE3C 2XFXB 4PJXE 4YFDB 1Z0NA 3LVEA 2A73A 5JA8B 4S1SH 3BH8B 3MJ9H 5E5RB 2E9WA 3MCG1 3RWCB 5AZEL 4X9FA 1S7QA 4WI7A 3CSPA 2EDWA 1BQHG 4RFNC 3CFJA 5E08H 5IW6A 3OHXA 1MAKA 3D3VA 5L8LB 3MA7A 3MOAH 1MFBH 4KJQC 3Q6GH 3UPCA 2XKNA 4G6AC 1A9BB 2CKBA 4L4TB 4X4ZA 5L8KB 4YBQD 4PJXF 3QUKB 1A6VL 3VFMB 3T4AA 4XPFH 2D0FA 3ZTJH 3P4MB 5HGHB 1NAMA 2IPTH 3QUYB 5TGBA 4OV5A 4MJ5A 2J4WL 2BNQB 2C1OA 4APQD 4PUBL 5IT2H 5DJZA 4FNLH 1KJ3H 2DMKA 2PYEE 4G6FB 1TJIH 2XA8L 1RZKL 2A9NH 4ODTH 5CGYC 3UPRA 3ZHKA 4FMKA 4YWGL 5C0JB 2C3VB 3MJ8B 3CU1A 1MHEA 3MV01 4HK0B 3BZFB 3RGVD 5C0FB 1WGOA 4IIQB 4ZNCD 4JB9L 1DBKL 2DWEA 1HINL 2R2BB 4JY6B 1IAOA 3BDXA 2LQRA 4ZD3H 4XGZA 2GCYB 3JWDH 4I18B 1A4JB 3QWQB 5JNYB 1G7PA 1NMCC 3F65A 5HGGS 3OKLA 3TCXA 3WFEH 5I2IB 4KWUA 2ZCKH 3MV8B 4TUOA 2WBKA 1ZA3B 4LSQL 1FVDB 4TSBH 3G6DL 4NZUH 1VESA 5F6HJ 5L9DH 3VG9C 2BVTA 4IOIA 2XKSA 2VWEC 1J18A 4G8GE 3TO4D 3UC0L 2COQA 2FZ3B 5GGTH 3OR7A 1LK3H 3H7LA 4HC1H 3OKEB 5CP3A 3MXVH 3AUVA 2RAMA 1G0YR 3GMPB 1P7KB 4XP9L 5GRWA 5I1LA 1XAUA 1QFUH 4N8VA 2YD7A 3D85B 1SYVA 4X0KA 4ZFOL 1PY9A 3QNZB 5IWLA 1P4BL 2P5ED 4RWYH 3DROA 3VXSE 4QKXB 1FGVL 1HSBB 4KHTL 1HEZB 3AFLA 1O7SA 2VITB 4P4RA 2XWTA 2SEBB 3RVVC 1YJDL 3MRLA 4YHOL 4XVTL 5DJAA 3BD3A 3WFCL 4YK4C 4MDJA 4NQDA 5TQ0H 1P2CB 3OAYH 4TULL 5F96H 1YEFH 2JCCF 1JF6A 2ADJA 3EO0A 2YD3A 4L3AA 3ORJA 1MSPA 5B39A 1RHHB 5DDHB 4M7ZC 3LQZA 3BWUC 3VWKA 3RNKB 4JPKH 4R7NB 3IRZA 4XH2A 4J23A 3NZHH 3TFKC 2DDQL 3I50H 5CUSL 5DK2A 4DVBB 5GS2H 1V7NH 2ZCKL 3LDBC 4BH7B 5C0CA 4PJXA 4HUNB 2YD6A 2HFFA 5HYEA 4LP5A 4POYA 1X9QA 4CVXB 5A40E 2FJHA 2EDTA 1NGWA 4DGVL 5KW9H 2RFXB 5ERWB 1KELH 2BSSA 4F33A 2NY2B 1KFAL 3QUXB 3HC0B 2FECI 4NRZA 25C8H 4DKAA 2LU7A 4R0LB 5HHPB 3QO0B 3MA9L 1JGLH 3O3EA 3LRSB 1YN6B 1AGDB 1IM3B 4XP6L 1MELA 3RZCB 3AROA 2C3WA 1FFNB 1X5IA 3FO9B 3I3EA 2KUTA 3SQOH 3AGVA 3PQYD 3O45A 3SKJL 5DRWA 1OCWH 1XF5A 3KDMB 1MOEA 4JFEE 1BZQK 1ONQA 4DKFH 3CDGA 4PJHB 1FC1A 4XBEH 3ARFA 2DN7A 3O41B 2DBJA 3AM8A 2DYPA 1UZ6F 4PLOB 3VFOA 5FECB 4NN6B 5IMOA 3DUUB 5JHDE 1P7KA 3ES6B 3EW3B 4Y89A 2DF3A 3DTXB 4GMTL 1OT1A 4XVJL 1D6EA 4XNZC 4KXZH 3QNZA 3HC3H 1EHAA 2NY7H 4P5TD 3BKMH 4EKXA 3U6RA 4B7IA 3VRLF 5I75B 1J10A 4HLZG 2YXFA 2C7UA 5ALBL 4ODSL 4L8BA 1FAIH 1E28A 1UQSA 4KKAD 4Y4FA 5IMKB 3GMPA 1FFQA 1J0ZA 1FSKC 4PIRF 1SJEA 1KOAA 4Y5VA 4G7VH 2I9TA 4L3EA 3C8HA 3FT3A 5D6DC 4WFFD 3H3PL 1IAOB 2XG5A 1UKSA 1F4XL 1JK8B 5IMLA 4CW1A 5T5FH 4LHUD 2GCYA 5F7KC 5TE6L 4I2XB 3EJYC 4J3VA 4LGPB 3GSXA 4MDIA 3GRWL 3MLVL 4MA8L 5DLML 1HYRC 2A38A 2MKLC 1F42A 3N1PC 2PW1B 4TUOB 4BFBD 2ICWB 3FN9A 3O9WD 4FG6C 4U1JA 1K3ZA 4HAFA 2ZG2A 5C0GA 4KY1H 3VXSA 2FZ3A 2H9GA 1KTKE 4P5MB 4JKMA 4Y1AA 4KAQH 4NO0D 1KJMB 4Z7NF 2YSSB 1BVLB 4HV8B 3MCLH 1TFHA 2F8VA 1RZGB 4RAVA 1JIBA 5EC1B 1QG3A 1A22B 4R4ND 2MPAH 4BQ9A 3ABZA 5MHSE 1IGTA 3RJQB 1I4FB 4JG0L 3LKOA 1QRNA 1G6RH 1FN4B 3TZVB 3IFLH 1TCRB 1I7ZB 2VZSA 3C5ZC 2FX8L 5ACMA 3CFKB 5I1DA 1KF9B 1QBLH 4DFHA 5DSCA 4WJ5B 5I1JL 4HZLB 4F7CA 1JPFA 5MEND 3ARED 4YC2C 4CUCA 4GRWF 4PP2B 3ZKND 2HYMA 3ZKQD 4X7SL 5IG7A 4GAGH 4PB9L 1BEYH 3WDJA 2ZOLA 5IT2L 1FLRH 4LRIC 1FVCB 3RUGB 1MHCB 1HSAA 3P73A 4LNVA 3MACH 2YPLA 3DSNA 3G5ZA 1UWGH 3DLQR 1WWBX 3MRHB 3GSXB 1MUJA 2AI0L 2W0KA 4FQJH 4NOBA 5H2BB 4JFPA 4G9FD 1QEWB 1MCSA 5L6YL 2ORBL 3HE7B 3KR3H 3QXTA 5IB5B 5F7LB 3U48A 4P2OD 3GIZH 1OM3H 1GL4B 5CEYB 3C6LB 2X4QB 2H9GB 3NFSH 3LEYL 2FHCA 3O0RH 3ME0A 5KANG 3ARWA 2VLLA 4FQLL 2VC2H 4CKVX 3SY0B 1E28B 1UQSB 2ZPKL 4U1HB 2GUOA 1TLKA 4HULB 4M1CD 3VWKC 3D3VD 5IVNA 3UROR 3ZDYF 2AP2A 5IIEB 4WWKC 5FEBA 1S78C 1WEJL 5IBUG 4K9EL 1KIQA 5E99H 4OLXL 4PJAB 1KBGL 1LK3L 4RAUB 4LF3A 4OCMC 4WI6A 5DRZB 1ZGLA 2QKIA 2V7NB 3DX9A 3LZFH 3FFCB 4JZOA 4O2EA 1DDHA 4QEGA 4F7EB 1C5DA 2DYPD 4HS3B 2DS4A 3QO1B 3SDXE 3IDNB 1BVKA 4CU8A 4YIQA 1W0YT 1XGPB 3SHSA 4DGIH 3SGEH 3IAPA 4JFZL 1M1SA 3HKFA 1IBGH 2DYPB 4HF5L 3KLSA 2V2XB 1B6DA 1X5GA 1YY9D 4JFYA 5GGRY 3PWLB 1HHGA 3VI4F 5EZJA 2HTLD 5HHNA 4ZO6A 4MJIB 1FIGH 3TO2B 3L7FA 1IAII 4XZUA 2D2OA 5C9KA 4LSTL 2ZKHH 1KJVA 4IS6B 3E3QC 3W39B 1M7DA 2G75B 3OAYK 1JPTH 4RMUA 1YDPA 2VL4A 4P2QE 3NAAH 4JAMB 2X1QA 3TYFA 4CNIA 5TDPB 1JYNA 1UWXK 3MBEB 4Z76B 4PGDA 1OD9A 1QQDA 5CIPH 4OGYL 4JLRB 3NFNA 1YNKL 2L4OA 4LLWB 5HHOD 2LTQC 4M7JL 2EXYD 4DJMA 5L9DL 1SVCP 3GMRA 1NC2B 3HAEB 3REVB 1G7MB 1A7QH 2DI7A 1A6PA 3ZYJA 3UYPA 4P4KB 2J8UB 4FQXA 4AH2A 3LRHA 4ISVB 3OG6B 3FHAA 1ORSA 4MA1C 5I1EL 3JTTB 2X4TB 3DSFL 2N4IA 3VD5A 3HE7A 2GW5A 5F1NB 3IXAB 3L95B 3V4VL 3HFML 4KKCD 5F7EL 3ZTNH 4UTBL 2UWEA 3AC0A 3MOQA 4PP1D 2AW2A 3SCMB 5IGXL 2JLLA 5T1DL 1BVLA 2YKLL 4JDTL 3AY4C 8FABB 3G5ZB 1CL7L 2CO6B 3QUXC 1R0AL 4J4PD 3TEUA 2DI8A 1RQ5A 5I6XC 1YY9C 3TBSB 3TN0B 4TVPL 3L3GB 3RX5A 4JHBA 3U7WL 4CJ1A 1EFXD 5BXFA 3SDDA 3ZYZA 1QRNB 1WAAA 3VFMA 1A47A 5E1AA 5CHNB 5ACZB 2VWEE 5TDOA 1CU4L 1V05A 4NQDE 3QH3B 4PGEB 2CQVA 1GPOL 1BVZA 1T1XB 4IHOA 1AHWC 4PJBE 5GRVL 4MXQD 1JPFB 1IAIL 3Q0HA 5DQDH 5FM4A 4L3EE 4XP5H 3PGFH 5DK0B 1MJ8L 1BM3L 3KPRD 4UT6H 3OKMA 1BFVH 4XTRC 4QRUA 3L6FA 4GSDH 1D6VL 5IG7B 3FQTB 4S1DC 4NQXB 5JZ7C 1FHGA 2Y06L 4WWKA 5D7IB 1UC6A 1U95A 5BV7C 5CUSH 3RKDC 1A7PH 1WT5A 4PRHD 2DLFH 3K7UA 5EH1A 2YHGA 2PXYC 3MXWH 5HYFA 5GS1B 2YZ1A 3QFJE 3DX7A 1OGAB 5A3ID 1W0VB 1ORQB 1JPSH 4KKLC 1OAQH 2BRRL 4PJAE 2YPVL 3WIIL 5E8PA 1CLOH 4JQVA 3QXAB 1TZIA 1YY8B 2Q7YA 3C5JA 3GBNL 4PYGA 3G5VA 1FL6B 1CK0H 3BMWA 5BO1L 5F7UA 1QFPA 2QHRH 1HQ4A 3WS6A 1CLCA 2C3VA 3KR3L 3MJ8A 3S36X 1JFQL 4PJ7F 4R2GB 3CH1A 2GJJA 4NJ9L 5MEPB 1VADB 5EU5B 2V17L 5DJ0B 4WDIB 3IFPB 6FABL 2ERJC 3SKJH 5E2UL 4I18A 3GJFA 2NPLX 3HS0A 5C08D 5F9DC 4R7DB 5CGTA 4HIEB 3SPVB 5MI0C 4WGWB 3TVMC 1GJIA 2NY4B 2K9UA 4X5WA 4FABL 4OZGF 1EZVY 1WLHA 4LIQE 1RAMA 5IBTL 4OCRL 5J57B 2XZAH 1PLGL 3CSBA 3CDGB 4PJHA 2Q86A 3PHQA 4LQFH 3IJHB 1AJ7H 1DSFH 3ARFB 2VQ1A 4GBXC 4OSUH 2AJ3A 3RQ3A 1U3HA 2Y06H 4PJ8D 5INCA 3E0GA 3MREA 2B8OT 2ICCA 2QR0B 5FKAA 4LHUA 1NCCH 3I3DA 1L4IA 5C71A 4ZOCA 1QSFE 3VW3H 3BRDA 1FE8H 3QEQB 4OZGB 1WTGT 4HS8L 1CFNA 3R0MA 3KPTA 4EDXB 1FFNA 4LU5L 4I5BB 3HZKB 3VGFA 3QZWG 1VDGA 3HI6L 1K9TA 2BSSB 1LO5A 3X3GL 2MNUA 5HDLA 1X6LA 1I8KB 4JGJA 2E7LC 3O6LH 3RWHB 2DQGL 5HYJD 2P7TB 2YS4A 4R0LC 4YDLC 3NFNB 4F2MA 5D7SH 3ELAT 4PTTA 5E2VH 3O6FB 4Y5VC 1UWXH 1DQJB 1AFVH 1UB6B 2DAVA 2EDOA 3V8OA 3GJEA 4MHHG 2Y5TB 4U0RC 2I26N 5EA0L 3QA3B 1RZIB 4K7FA 1OAKL 4X6CA 4I0KA 3LDBB 5BS0B 1N5YL 3MUY1 4OGAD 4WU7B 3U83A 5AG8A 3ECBB 4UUJA 4RMSA 2X7LB 3CFBA 4X8JB 1SJVA 5KS9A 2VABB 4PJIF 4L4VD 3BXNB 4KMTL 5DFTA 3T1WA 1W8OA 1F97A 1N6UA 1TENA 3RIFF 5SWZB 2RFXA 4WFHD 4ONHA 2UV3A 2QSTA 1C5BH 1CL7I 1INQA 4U49A 1FZKA 5DMGC 5CP3H 3GDBA 5EU5A 2Y36H 4X6FB 5E8DH 2FH6A 4LARL 1DQTA 3FB6B 2HT2D 4D8PA 1EEYA 1XGQB 5LGKA 3CFEB 4NO5B 5T1DH 2YBRA 4G7YL 4LCUB 3T0DA 2Z93B 5CJ8A 5EOQL 4XPGL 3ARBD 4RQQA 1DN0B 3UJIL 2ZJSL 3MRKB 3IDJA 5JW3H 3MRJA 2GY7B 3ILPB 4IMLB 4ZQKA 3L3OA 1VADA 3KPLB 3QBTB 4XCFH 3LHPH 3EJZC 3KYMB 3IDIA 3WHE1 4HJJH 3WO4B 4XP5L 1CE1L 5KANI 4LHQB 2NR6C 1MCOH 1T7YA 5FUZL 1Q0YH 3L3DB 2OTUB 4KRNA 1YEKH 4PB0L 1D7FA 4MLSA 2Q6WB 5JNYA 5AD0B 3X14B 2Y4SA 2Z92B 4X99B 2EYTA 4AIOA 3G6JA 1QYGL 4JPVL 4BZ1L 1I3UA 1WC7B 3BAEL 1S9YA 5B38A 5F9JA 3O4LE 1YNKH 4HKBB 1M05A 2Z35B 1I3GH 1XF4A 1E4KC 2BXYA 1RZJL 4J7RA 1P9MA 1OT2A 5DRNB 4Z0BH 3GNML 4U1NA 5L7XL 3K0WA 1H0DA 1T21A 2I5YH 5C0JA 5IMKA 1ZA6B 2H26A 3DRQA 5GJSL 2GTZB 3C09B 3BPLB 3CCHA 5BV7L 3MRDA 3PP4L 1MIEH 4MQXD 5D1ZA 4U31A 2R2BA 1NLBH 3Q6GL 2OZ4H 5T1MA 3LKOB 4OFYA 3U7YH 3QUYA 3QNYA 4JPIB 3SDCC 3H9SE 5IJVA 2HMIC 4DCQA 3TBTA 4MA3B 5EO9A 1UCBL 4L3CB 4Y19E 5JTWA 1J0IA 2VDMH 3BH8A 2NQCA 3V9FA 4UOW1 3RVVD 1CFVH 4WY7H 1BBDL 6CGTA 4HF5H 4JEGB 4LP4A 4OM1H 5HYSG 1RK0A 5C0GB 2P8MA 3I75A 3T0VA 5C0FA 4LOUD 2EDYA 2ZWLT 1G7LA 3O4LB 3AXLA 4NN7B 4WO4B 1I8MB 5JDSB 2DQJH 4GKSB 2J88H 1LO0L 1IAIH 5CAYB 1KN4H 2PYEA 4Y19D 2WBJD 2ZUSA 4M1GL 2OL3L 3Q6FA 4JM2D 4PJBB 1DVFD 1TTUA 5JW4M 3FO2A 3WLBB 1OL0A 1WC7A 3JWDL 1NAMB 2LV4A 5CWSB 1ETZB 2HTKD 1PSKH 4X98B 1DTUA 1I1CA 3RWFB 3L1OH 1FO0A 4NRXB 4I2XE 3HHRB 2GJ6B 3NBNA 3KYAA 4I4WB 1R3LA 4ELKB 4MS8C 4MHHI 1B4JH 1FH5L 2YPKB 1E6OL 4NP4H 5D8JH 3S97C 4ZQKB 1EGJL 3ILPA 2NMSA 2C9AA 4LAJH 1MIML 2DQEL 5ITBH 2IALB 5IHBA 5L2KB 5I8KL 3JSSA 1ZAGA 4MQXC 2Q6WA 2LU3A 2N7BA 1BPVA 1ACYL 4G3YL 2EE2A 1F4AA 4NSKB 1AR2A 3VXTB 1FFOB 3GSUA 3PWJA 5HHME 5IEHA 1XF2A 1IQDB 1OTTD 3FN3A 3B83A 4G80B 4W6YB 3MGOB 5F9JB 4GRLA 5I66B 2UYLB 4DKEL 1CDUA 1GHFH 2WM0A 3VXNB 3X3FH 3SE9H 1QBAA 1JL8A 3RVTD 5ELIA 2G2RB 2K1MA 1FLTX 1N2RB 5FV2A 5KVMC 3QHZH 4GRWB 5MERB 1P53A 2V2XA 1XT5A 1TJIL 2XA8H 4MA7H 4MMZC 4X4YB 3ARFC 4Z7OF 5D71H 1EDQA 2HVKB 3BOVA 1MCPL 2E7BA 5D2NA 2XI9A 2RR3A 4QTIL 4XZUB 3W2DH 3WHE0 3SJVA 2FATL 4U7KA 2AK1L 3SKMA 4JREB 4PRPA 2OTPA 1EXUA 4K94C 1DBKH 1JTTA 1FNFA 1EFXB 1RU9H 1LWRA 3BT2H 1JNNH 4LCUA 5MI0B 1CVRA 5C0IA 5EN2A 3FB8B 4XRCA 4HD9A 1A7PL 5IR1A 3D39A 1GH7A 1W72A 2Z8SA 1OLZA 1D5XA 4KKLD 2DRUA 3ARXA 4ZS7L 4ZAKB 4LLMB 3R8BB 2IBZY 3IFOA 3QISA 4R0LA 4YX2L 3EO1A 4MVBC 4U1MB 3LN5A 4JO2H 3SDXB 3F12A 3IKCB 1OP3K 4LLQA 3HG1E 3GKZA 4NZDA 1XF3B 5SX4H 5JOFB 3WN5B 3MX0A 1T4KB 5FKPA 5HHOA 5IOPB 4A2MA 2NNAA 3EBAA 4ODWB 5MENE 1XF2B 2AQ3A 4Q9CA 1UH3A 43C9A 1JN6A 3WJJA 4PJ9B 3K2UH 1FFRA 3QQ3B 1FO0B 4NJ9H 3RY5A 5F3BB 1N4XL 2B4CH 4QWWC 3LV3B 3U9PH 2WIIB 4UIKH 5ETUA 2JJTC 4QHKI 1S8DA 2PYEB 3QP3A 3HI1B 4HPYL 3A6OA 3RNQB 1U8KB 4KQ4L 1U8MB 2CO7B 4Z0BL 2NYYC 5FYLL 3L3IB 5J1SC 3VFUB 1L0XA 3PL6B 4KMTH 1CFQA 1PY4A 1ZVHA 1ZMYA 5F9WB 1TQCB 3RVTC 3EYUL 5E6YA 1X7QB 3F7YA 3LS5L 1OY3B 1EFQA 4P2OB 3RX7A 1S5IL 4YE4H 3RPKA 1T03H 1H3GA 3GSNH 4ORZC 3BT2L 4AG4L 3C5SB 2VYRE 1N64L 2NX5D 4APQB 4E5XA 2DDQH 3MJ9A 1I3RB 4YGVA 3RUGE 2QQNL 2FJFA 3O11A 5KN5A 3WHXA 3FRPG 4H20H 2H1PL 4QHLA 2V6HA 1KLGB 5M95B 1YEJL 1E0OB 3N85H 1CWVA 1FNGA 2FECL 4WEMB 3UAJD 4G7VL 2HP4A 4B53A 1KB9K 1ZHKB 3TT1L 1GYAA 3IFPA 4KV5E 3VMNA 1OGAA 4NWUH 4DVRL 1FZOB 1FYTE 1G6VK 2XWJA 3QFJD 5FM5O 3UTPE 2QQQA 1XH3B 5F70A 1X4YA 3GK8L 2Q7YB 4F15C 3U6RB 3DI2B 2BHYA 1ZS8B 5K9QI 5DD0L 4O02L 2CLRA 5CP7B 1AFVL 3P9LA 1CE6B 3BWAA 2ICWI 4JKPH 1B2WH 3W9DB 3MRPB 1B0WA 5GHWH 2YUWA 3VWKD 3VWJD 5MEPA 1ZGLM 2OR9H 4OI7A 3K46A 4Z18A 3VD3A 3MJ7B 4DKFL 3WN5C 1T1ZA 2VISB 4WUUE 4D0CA 5F6IB 1CGWA 2VLME 1GGIH 4ETYA 4Y5YA 5D8JL 1MVUA 5GRVK 3LPWA 2CKBB 3CH8A 4L4TA 1OF2B 4OFKA 5DJ6B 1FJ1A 3OKLB 4RFOH 2G5BB 5C6WH 1KGCD 2KDGA 3BIBX 3BESR 2CK0L 3D69B 3P0VL 4HBQA 1EA9C 4S1DD 5D4QA 4PRHA 2EH7L 3VXRB 1LO4H 4AG4H 1F8TL 3EFFA 4QOKE 4HPOH 2FJFB 2OQJA 4JFFE 5EFIB 1BQHB 4F9LC 3JV6A 1Z3GL 5JR1L 5C0NC 1OGAD 3P4OB 3CUPB 4UZGA 3SQOL 4KK5C 5E2TH 4FZEH 1FGNL 3IGAB 3N50A 4NDMA 1LMKA 1MWAH 2VL5B 2VTFA 4WW2A 5FYKE 1RUML 1UACH 2DQUH 3D25B 1SJHA 4NNXB 2YPVH 4ODTL 3D9AH 3GSNB 3TT1H 1X7QA 4PJ9A 4YHMH 4KXZI 3GM0A 4P46B 3DRTA 4HKJB 3UZEA 4AENB 3FONA 2VLJE 4HX1A 4U6XB 2HH0L 4APQA 1SJXA 1T20B 4IDJH 2OK0H 4NUGH 3OHXB 2N1KA 1S7VB 2IFFH 5IW6B 3V5HA 1UM5L 1YQVL 3VFNA 2W65A 4L4VE 3TYGL 3GSRB 3MLZL 4LCWE 5C09A 4M5YL 2XIDA 3HE7D 1ZSDA 3TJHD 5GSRB 4ZS6D 5H8DA 1CR9L 5D1XB 3WN5A 4HZAA 3IJYB 2FEEL 1MCEA 5C9JA 4GW5A 2VE6B 5DWUH 1MH5B 1NGPH 1KJVB 2NNAB 2UUDH 4IS6A 4ODWA 3THMH 4RGOH 4NN6C 3TBVA 4PJ8A 3U30C 1OWWA 4P5KA 4QTHB 5A43C 4P4RB 2YOCA 5AUMB 3V6ZB 3ZKXB 1WCBA 3Q1SH 1LK2B 1QLEL 3SOBL 1R3JA 4PRPE 2B1AL 2YR3A 4D9QE 2R29H 3CGTA 3BP5A 5KSAD 3VW3L 1WIPA 5DJ6A 1HEZA 2P8PA 1T04B 1HSBA 1XGUB 1YECL 4N0CC 3FONB 4EVNB 1X5KA 5EOCL 4HLZH 1A2YA 3C8KA 1F13A 4Z7WA 5E8OB 5LWYH 5IJKA 2ZCHH 2EC9T 4GFTB 3CZFB 2C3XA 4YHKL 4O51A 3INUH 1DSFL 3P9WB 4BFIA 2ZOKA 2BFVH 4PGBA 4YLQT 1T1WB 4WTXA 3HRZA 2BOBB 3FQXB 4RGNB 3MOBL 3D0LB 4ZD3L 3O9WB 1HWGB 1IEBB 2F15A 1U8OB 2OR7A 1ZANL 1OF2A 3BGFB 1CGVA 2CJUH 4AY0A 3BDYL 2F53B 2VZTA 3HC4L 4Y5XA 2VE6A 1A3LH 1CICD 1JJUA 2IPTL 4Z7VE 4NP4L 4GLRH 1Q9KA 3S5LB 4NPYB 2ZNXA 4FTVD 1NGPL 1YPZA 2K7PA 3MLSL 1VGEL 4LCCC 5IQ7L 4GRLD 4ONGL 5BRZA 5BZWA 5ITFA 5J89A 3CLEL 1MI5D 4MNGA 4UBDC 3K74B 4OLYH 4OZFG 5BOZG 1J05A 2YPKA 5B3NA 1I1RA 1VEMA 3H9ZA 3WSQL 3K8LA 4U3HA 3KXFA 2R2CA 4P4KD 5HHVH 3F7RA 3TNMB 5ESQA 5IVOA 4GKSA 3MQIA 5GGSY 1KTDA 2HVJA 3BVNB 4JG1L 5CD3A 3CPLA 2AK4D 3DECA 1KEGH 3HMXH 5CBEA 2OZ4A 3T09A 3DIFB 4OZIA 4F7MA 3FO2B 1JPST 4XVTH 1ZWIB 4GG8A 2CUMA 3RWEA 1WFUA 3VDCA 1SMOA 1VEOA 4MJ2A 1ZVSA 4PR5A 2O61B 1ND0A 2CDEA 3BQUA 5D1XC 1FIEA 5DA0B 15C8L 4IRZH 1EEZB 4N90D 5CBAA 2Z91B 3CXDH 5JHDA 1JGUH 4OCRH 1JPTL 3UJJH 4LVHB 1MCCA 4PRIE 3JV6B 3WNOA 3OXSB 3PWNA 1FVEB 2UZXB 5DI8A 3MFFB 4GQ9L 5FXCH 5E8EA 1F3JB 3G08B 4XPBH 1JE6A 3TBYB 5E03A 2CRYA 3CCHB 2W9LA 3UTZB 4OLWH 2P5EB 4S2SA 1L7IH 2R0WH 3VI4E 3MRFA 3E8UH 3AY4A 1NPUA 3HR5A 3D39E 3BDYH 3DXAE 1XCQA 3HC4H 1XCTB 4KK5D 2XFXA 5HTSA 5FF6A 4RMRA 2DWDB 4KJQD 1G9NH 1QFWH 3IFNL 4HQQH 3SDXF 5BZWB 3ZE2E 1OQOA 5CINL 2ADFL 3VGHA 2GK0B 1FYTB 2HAZA 4XP1L 4DZ8B 4U1JB 2Q20A 3SDCA 4X6EA 5JW4N 3Q3GB 5EIVA 3RY6C 1JWSB 2Q8AL 2BNRE 1CLZL 3O4OB 1VGKA 4JRXE 3LIZL 1JFQH 2ARJQ 4MA8H 2VSDA 1FSKB 1U8OA 3VJ6A 4K9EC 1YC7A 4GMSL 1TETH 4D9RE 1MJ7L 3ZL4H 2IBGA 2CLZB 5DFVC 2IFFL 1KIRB 4YXKL 2V9RA 1TMCB 4J2XA 3BEVB 3N9GH 4OGAC 3SKMB 3T3ME 3ULSB 4EI5B 2JIXD 4OLUH 1B6UA 2RJMA 3QJHB 3EOAB 4MCZA 1OAZH 3QCUH 3MJ9L 1GC1H 1N8ZB 5I74B 4G6MH 5HYSA 1KELL 2IPUG 1PKQB 4TVSa 4Y2DC 1PZ5A 4JN1L 4EIGB 1NEZB 1DCLA 4MD5A 2YXMA 2V9TA 3K3QA 1VFOA 1ZHNA 4OD1L 5F89B 2X42A 4LCCA 5C09D 2NY0D 1C5BL 4K23L 3RJDA 4IEFB 5C7XL 4DOHB 2H6PA 3MBEC 2XICA 2V7HA 1A6TA 5K9KA 4N0RA 2XWBB 3WUWG 1TNMA 1EBPA 1OLLA 2VQTA 1PKQE 3JWOH 4JVUA 4OZHA 2C4FT 4QXUL 3QIWA 1FGNH 4WU7A 2C1PA 2Y23A 1G7HB 3HZMB 5DHVA 4O4YH 4U1SB 4DAGH 2Y72A 1ODAA 1IGCH 1EJ6A 4O51B 3L9RB 1TZGH 1Z9MA 1A7NL 4XP1H 3O6FA 3DETC 4ZUVB 3FOLA 4X6DE 1I7RB 2WZPD 1L7TH 4L8DB 4PG2C 3FMGL 4O2CA 4HIJA 2GUOB 3C6LD 2PR4L 1REIA 5ALCH 5GGVY 1RZIA 2EC8A 4FQXC 2D9CA 5DGQA 1E4XI 1JWMA 1KIRA 5BS0A 5DMIH 2XYCA 3LSOA 1CQYA 1BQLL 4U7MA 2NY7L 3TVMD 3HA0A 5D2LF 1GVIA 1R3HA 4I3SH 2FO4A 4XAWL 1XZ0B 1CFNB 1W72L 2P48B 2DLTA 5T5NG 2MCPL 3BP4A 3DVGB 4U6HA 1YMMB 4QRRE 5ACLA 1YEDA 3SDAA 4C54A 4U1HA 4B5EA 4KVCL 5AZEH 3Q3GA 4MDJB 1MCPH 4OF6A 2AV7A 1VPOH 4TSAH 4WI2A 5EOTA 1FVCA 4LPWA 2AXHA 2BMKA 4M9PA 4AEHH 5KS9E 5HVFB 1BQSA 1PG7L 1QHOA 3HR5B 3L3JA 4LVHC 5LCVL 5DJXA 5BO1H 1ZLWK 1AE6H 1NBVH 2Y36L 5EBLB 2HFTA 4BA8A 1BREA 4BQ8A 1EUUA 2FWOA 2AXGA 5BVPL 4I48B 1FL3B 1AGFA 4JQIL 1ZWIA 1BJ1H 1T22B 4PV9B 5C92A 4RIRB 4DVBA 2WINA 3OKDB 3VXPB 5I16A 1IBGL 2GJZB 5C6TL 4FFYL 4C56E 5EBWB 4Q9RH 5ID1B 3R8QA 3V5KA 2DTSA 4NQCD 1MCWW 1KCSL 3WFCH 2X4NB 4OFDA 3O3AB 2ZKHL 4LU5H 1A7NH 5H37G 3KPPB 4OGXH 1IGFH 1TCMA 4PJEB 1C12B 3T0ED 2ICES 3LH2H 3HUJF 4MB5A 5J6GA 5KVGL 1QA9A 1P7HL 2R0LL 4X6DF 4PTUB 5GSVB 3NFPA 2NY1D 4O9HL 4PRDB 3OPZH 2FGWH 3NCYP 3QWRD 1ZS8A 4TNVK 4WI9A 1W72H 3J8F7 5EPMA 1H0DB 4LL9A 1EAJA 4N5ED 3E8UL 1C7SA 4O5LH 2RHEA 3TA3B 2AEIT 3QZWA 1T2XA 1Y6NR 1T89A 2AJVH 5ICZA 1N5YH 1OWRM 4TRPH 4GKZA 5FOBA 4NWTH 2F74B 4KMLB 2IPKA 3PIQA 4RGNC 3AB0C 3D85D 2EDLA 2X4RB 3WFZA 1XR8A 1TIUA 2A6IB 1GOFA 1P9MC 1FC2D 5ADPH 1MVUB 1GGCH 4CN4A 4I8DA 1QRKA 5LAXB 4XMLH 5TE7L 4TUJB 1AE6L 1NBVL 1O5DT 3WLBA 2W9DH 1BJ8A 3GIZL 1R3IH 2WUCH 4HUUB 1M05B 1KJ2B 4N0CD 3SDAC 3VMOA 1LD9B 1CGSH 4HGMA 3RKDD 1CXFA 2FYYB 1YY8A 4PJDA 2LVEA 2X1WL 2CLRB 5CP7A 5ILTL 2CDGB 1OSZB 1QFOA 3BX7C 4G6JL 3BN3B 4PJGB 4F7PB 1DQML 4HXBH 5LQBH 2ZSVB 4IOSD 4JPWL 5FYLH 2QV2A 3DXAA 3MRMB 1P4LB 5B21A 1WBYA 3TNNB 1GGTA 2HLFD 2XTLA 1AR1D 2P49B 4U1LB 5DVNA 3AREA 3QCVL 4ODUA 5E1AB 5D7LD 3C5ZA 2CD0A 3O3EB 4NQEB 5TDOB 3F6IA 5I1KH 3PDOA 5CJOH 5I9QC 1CFBA 2QSVA 1T03L 2GEEA 2X70A 3L5XL 1D6VH 1RD6A 4JPKL 1F58L 4FQ2L 2GTWA 5ESAB 3WIHA 3MLRH 5KJRL 5L0QC 5ECJE 2YA0A 4R4NC 3FFDB 4JRXA 2VLJD 4NM8L 4U0RB 1Y0LB 3WFEL 2OR9L 4H5SA 2QQLH 3V6ZA 5DJ8A 5HHXH 1BWMA 2AJVL 3MRIB 1PAMA 4Q6IC 5GRJL 1WCBB 4M7JH 3VWJC 5FDWA 3BZDA 5EIQA 5SWSA 4OCYL 1JNJA 5GGTL 3QDGD 1T2JA 3P0YH 3QIBA 4L4JA 4PGCA 5HGAA 1KEMH 1JGEB 4ONGH 5EG6C 5C9JB 4ZTOL 1KUMA 3PGCB 5FDYA 2VLRB 3SO5A 4Q7DA 4NZRL 4D9LL 2EKSA 1KN2H 2DM3A 4AENA 3F58L 4HK3N 1R3KA 1T7ZA 4NKMB 1LP9A 1KPRB 1TJGL 3S9DB 1XFPA 5IR1B 2MQCA 1AD0A 3I6GA 4QRSB 3T1FB 3QRGH 3AB0B 4KK9D 5FUOH 4N0YL 3WKNA 3PHQB 2Q86B 2HKFL 4YXHL 1EO5A 4BJLA 2NY6B 3QCUL 4F2MB 2WANA 1A6UH 3BSZH 4ZYKB 4HUWB 4QY8A 2UZIL 5JMRA 3I6LE 5JOPD 3BW9A 3L5JA 5DVOA 4NRYB 1LDPH 1YEFL 3G9AB 5JOFA 4LLYA 1K2DB 4IRZL 5F3HB 2FO1A 4FFWD 4OD1H 3UBXG 4WHTA 4IRJB 5KZCD 4XCCL 1IT9H 5D5ME 1R5WB 1DBAL 2V5RA 3AVEA 4I13B 3GSNL 4PJEF 1QBML 1OGTA 2NW3B 2XZCL 2YRZA 1LD9A 3VXMA 2G2RA 2GT9B 2O5ZH 3S98A 4JY5H 1UCBH 4G43B 4AZ8A 4Z95H 1V7NL 4PREB 1JTOA 3IDMA 1ZEAH 5DUPL 2FX7H 1BBDH 4OZ4A 3KPRE 1NGYA 4L5FL 5HDQH 1UXWA 4TVPH 2Y07L 3SEPA 1EUTA 3CC5A 2F5AH 4WDIA 1OVZA 3QJFB 1U2HA 3MGAA 3R1GH 1M6OA 2BJML 1AXSB 2IAMD 1GSMA 1KIQB 1A1MA 4NC2B 3VCLA 1KPUB 4DEPB 3A6BL 5EB9A 3KPSD 3VH8B 2Y5TA 1UYWL 2NX5E 1CICA 3KPRB 1CXEA 5IBLD 5ANMA 3MV8A 5TPWL 4GT7A 4OM0H 2YMXH 4Z7VB 4HIXL 1RURH 4J6RL 4JVWA 1PBYA 4UB0L 1EAPA 3D2UA 5DJCB 4Z7UE 2E8YA 5C0BE 5C0DB 4X6EB 2R29L 4X6CF 1YQVH 1PG7X 5IQ9A 5ESVB 4PJFB 1DUYA 2DWEB 2VLRD 3V6OE 4D2NA 4F3FA 4QRRD 1EO8L 3NOIA 4YDKH 1CD9B 5KVFH 1MHCA 1NL0H 1Q0XL 4RFEA 5SWSB 3TJEL 3DMMB 3DX8A 4NM4L 2JE8A 3GZKA 2HLAA 4KZEH 1FAKT 3UTZA 4ZUUA 3MRHA 3RIAK 4GG8B 5IB2B 5HPMB 1J5OH 4JZJC 2VUOA 3UTQA 1DFBH 4NC0B 4QTIH 3W2DL 5DZNA 5TGBB 1WBZA 4L8CA 3ZE1F 4OV5B 5IVXE 5CEYA 1GGCL 4GKNB 3FZUC 3WNLA 2CR3A 1S5HB 3O3DA 2Z91A 3QHFH 5AWNH 5JW5B 4DZBB 5M94B 3QDGE 3GSVB 2VH5L 3OXSA 5JXAH 1T21B 4HUVB 4FQ1H 4GW4A 2WAHA 5F7DA 4Y4KB 3M8OL 1A6VH 5CEZE 4OZHE 1RZ7H 2GJ6D 3FOMB 5D7LE 4M62L 1C08A 1H3PH 4RWYL 4MWFB 5CZKA 5DS8A 1WBYB 1T1ZB 3L3GA 5D1ZB 4ZSOA 5C0CE 2J4WH 3OJDB 3VFWA 3DMMD 1RZ8B 5J1AA 5K9OB 5T1MB 1H8NA 5EORL 3VFVA 4C56D 3BYTA 3QG6B 1U92B 1HXMA 2Y6SC 3X12B 3EYVA 1T0PB 3MZTA 4WWKD 5KVDL 5JUEL 4JO3L 1S9XB 4PJIA 3QSKB 5F93C 4HJJL 4LASL 2O5XL 1SEBA 4BYHA 5IROC 3V5DA 2Z8VC 3KS0J 3KPLA 2DD8H 1OGAE 1DUYB 3BMVA 3MJ7A 4JFOA 4P2RA 2NLJB 3EDEA 5E2JA 2XY1A 3ULUC 2BVOA 3FCTA 1E4XH 1NC2A 2OTUA 5KSAB 5J56B 3SGJC 3X14A 5B8CC 5AD0A 3WO4C 4JFEA 5I1CH 3QULA 3T65A 3UTSD 4Z7OE 2A1WL 3DX7B 2P24A 1M7DB 3MCLL 4RRPG 5L7XH 5DXWA 4K7PH 4RAHA 2VDQL 1KIUA 4M6OL 3VXMB 4UMGA 2EYRB 3MNZA 4NFDA 3WEXA 1DN0A 5IK3B 3VXUE 2AJSH 3BUYA 5CMAB 4DGYH 5F7WC 3CFIC 2EH7H 5FGSA 3W0WB 1EAPB 3WXWH 3BO8A 1YN7B 1FZJA 4YBLB 3NTCH 4X5XB 1N5AB 3NN8B 3OB0K 1E4KA 4JLRA 3ZDZE 4WCYL 1U6AH 4C55A 5BCAA 5IGXH 2ADGA 1LO2H 5EUOE 3KYNA 4WY7L 4JFFA 4LIQH 2D7NA 4BSVA 3CMGA 4P2CG 3X13A 4MXWL 1K3IA 3CU7A 4ZPVA 3AM8C 2RB8A 3MACL 4WHTB 4OCWL 1A2YB 1G7IA 5DHYB 1IJ9A 3BKJH 4PPTA 4GXUN 4YUEH 4KUCD 5D7JB 1BD2D 1FL5A 2FSEB 4E9LA 3O41A 3BP4B 2UWEB 2AJYH 2AXFB 4OIIL 3W11C 5AZ2H 1J8HD 4Z77A 1RFDH 1MPAH 1BX2A 2BVUA 4XCYA 1T5XB 3ES6A 2CGRL 1WTLA 1GZQA 4N5EC 3BKML 3L1OL 3N1MC 3FO1B 4YXLL 1GOHA 3LRSA 5E9DA 3VD4A 3G6JF 4LSQH 4TSBL 5FGBC 4PRBA 1AGDA 1VFBB 4XB8A 3N06B 4HKJA 3DRTB 2HFFB 5EOCJ 2UZYB 4WI8A 5F9OL 3RUGF 3BUYB 3ARGD 3KWWA 2D7PA 4KPHL 3C2AL 5HI3C 5DD3H 2BHUA 3TN0C 1T6WA 4XNYH 4H88H 2IC2A 3ZTJG 4PJ7A 3VGAB 2B5IC 2WLYA 3GSWB 4GXUM 4GG6B 3H7BB 4JM4H 5JDSA 2XTJB 3MV9A 5FUZH 3T4YB 1I8MA 5LGJB 1RURL 4J6RH 1NBQA 4O2CB 3RHWF 1U3HB 4OF8A 3PP3K 2MCG1 5D5MA 5INCB 2JJVA 1FNLA 1KCVH 3QRGL 5GHWL 4N0YH 3FQRB 3LQMA 4WNQA 4UAOC 1KPVB 3TP4A 5KAQG 1SVZA 4K3GA 4QRPA 5B4MC 4KU1A 4KK8C 5I76B 5IB5A 5GJTL 1ND0B 2CDEB 4O58H 1EBAA 5EU6A 2I07A 1I7UB 5INDB 2VIRA 3PQYB 1DN2A 4KTEH 4HZLA 3JV5A 5DHXB 4X5LA 5J4MA 3H9SA 2PXYB 5FYKH 4KH2A 4KDVA 3RTQD 2CUHA 1HZHL 4NQCA 3KAAA 3V4UL 4N8VB 1DBJL 2XZCH 4GQ9H 3OJDA 5JO5A 5DJ0A 1KB5H 4PLKD 1F5WA 3SCMD 3IAGC 3UTTB 4LLUB 5MHSD 3C5ZB 3KYNB 1NDGA 1VFAA 3O2DL 1QKZL 1NFIB 2X5PA 2PNDA 4LFHG 1I7TB 4BH8A 5HDQL 1CDBA 1IQDA 2F53E 1YEHL 4GG6F 2XN9A 5DMGD 1E6OH 1YEGL 4A6YH 4QCIA 5HHQA 3U0PA 4MAYB 2BVQA 4JFOB 1QSEE 2BC4A 1JI2A 3TNMA 2F53D 3F62A 1MAML 3X3GH 4LSDA 5DURB 4HV8A 4MQTB 4BSWA 5C2BL 2FRGP 1JBJA 5AG9A 3TZVC 2BERA 1BIIA 2YUXA 4LSSL 5D7SL 4I2XA 1DBBH 4F80A 5GZNC 2EYSB 4I3RH 4X99A 4WW1A 1ZLVK 3T2QA 4ODHL 1MUJB 5H2BA 3MRCB 1P1ZA 4HXAL 2ZUVA 4GBXD 2OL3A 3QEUB 3EOBB 2PYED 4D0DA 4MXVF 1YEEL 3AAZA 2DLHA 4MJ5B 2XKUA 2MCPH 1OAXH 1G6RB 5GRUH 4PUBH 4P59L 4CRPA 3OXRA 4Q97A 2Q3AA 1FO0L 1L9MA 4KTDL 1FRGH 3VGAC 5KSBF 2OBGA 4M61A 4E5XB 1T5WA 2X4UB 4XNXL 5ITBL 1IM9D 1T66C 2J5LB 4NN5B 3MLUL 1A5FH 4EBQH 5I19L 5JO5B 3MUGA 1BFVL 3MOAL 5CEZH 2DKSA 4RISL 3QHFL 5AWNL 1MCIA 2IANA 4G9DB 2Y7QB 3S35X 4XPTL 3I6LD 3NVQA 4R6UA 1NFDB 3UX9B 3PWVB 1A3RH 3QUKA 3TM6A 3ECBA 4QHNA 4UUJB 3C5SA 1LO2L 2CRMA 1YEJH 4HC1A 3X11B 5D6CB 3IXTB 2Q8BL 1KC5H 5FYKU 5IB1B 4G6AD 1Q9OA 3ILQC 1QFWL 3RTQB 4WFHE 4POUB 1RJYB 2APWA 1VGEH 2VLJA 4HLJA 1S7SA 4WVRA 3V6OC 3H9SB 1HI6A 1Z5LA 4H8WL 5IWLC 5FUCC 4F9PA 2AI0H 5GZOC 2R69H 3C6LC 3TIEA 1ZKAA 2X89D 5HY9A 3BPCB 4ETQB 2CDFA 1A9EA 4MJ6B 3RVWD 5T3XD 4PJ7E 1XMWA 1ES0A 4ZYKA 3VG0L 1MCOL 1D3CA 5CGYD 3ARRA 5DK2B 1EZVX 4M48L 3H3BC 3W39A 4Z7QF 4BUGA 1XF4B 4Z7UB 5C0BB 5HYQA 3TPUA 2PO6A 1DEEA 4QHMA 4P9HH 2CGRH 1QVOA 4DW2H 1U8IB 2VMFA 2J8UA 1QRND 1A21A 4KY1L 1KPRA 1NGZB 3HE6A 1OARH 2VDLL 4O5LL 3MBEA 2X1XR 3EYFB 3MRQB 3OV6A 4P9MH 4LPUA 4OZGE 4MJIE 4KKAC 4NQVB 3AMKA 3K4AA 2VSCA 1XGPA 5HHOE 4HSQA 3UC0H 5EU6E 3MLSH 5HHPA 4M6ML 1GC1C 5DC9B 1DL7H 1LE5B 1CTNA 2V7HB 3LPFA 2WWMC 4ZUWB 3C2AH 2PTTB 2XXMB 2P5WB 3MLUH 1HHGB 1QLRA 4FTVB 1YNTA 3TO2A 4QRQB 4TN9A 4M7LH 3NTCL 2C1PB 4G8EB 4IRJA 3ZDXF 3GGWA 3SKUD 1AO7E 2DQHH 3UMTA 5FYJD 3DVNA 4FQQA 5FGCE 1N8ZA 4GO6B 4RCAA 3NA9H 4LBEB 4PY8J 2NY3D 5F7HA 5MERA 3ARDC 5GIRB 1UACL 1RK1A 2IF7A 3BI9X 1BD2B 1S7WA 3RPIA 5CEXA 1IGMH 2YWYA 3KPNA 3KPOB 4QOKB 3RX8A 3C6SA 2R1XB 1KB9J 4ZTPH 3QDMD 5LJYH 4P3CH 1Y6KR 1YYMH 1YMHB 3FMGH 3KVQA 3MRBA 4Q2ZA 1BECA 5I30H 8CGTA 4Y5XC 5T1KD 5KVGH 5C3LD 1S5IH 4NRXA 3L5XH 3SE3A 3ULUD 2OXHA 2I60H 3FB7B 1HXMB 5DD1H 3RGVB 2ATKB 2CIIA 3D69A 3PWUA 1JZ5A 1NGZA 3E6HB 2ZCLL 2X05A 5GS2D 3M17B 3DO7A 5C07D 4HAGA 2NXYD 2UY6A 4DN3H 5BS0E 5DEGB 1T3FB 5I73C 1JMZA 1QSVA 3O4OC 3VDAA 3SKNB 4JVPA 5SV4A 4G8GA 1UM6H 3KJ6H 1I9JH 4XP4H 5C09B 2XZZA 1GRWA 1SMAA 3HCVB 4LCWD 1NCWH 1WJ3A 5HPOA 3T04D 4QRRA 5F6HI 4NC1E 4H88L 1HH9A 2BSTB 1BBJB 5J6GB 3PABB 3DWTA 5C6PB 3AS3A 1TCRA 3QXUA 2P45B 2MMXA 4XBPA 2AJUH 5EZOH 1JPGB 3U0TB 2W9DL 3DETD 4LARH 1T1XA 2CIKA 4P46C 1EHLH 4DK6A 3B9AA 4DZBA 4PJEE 5D2LE 3QUZB 4JKPL 1UZ8A 1ZEAL 5DUPH 4FA8A 4GW4B 1NUNB 5HJ3B 3KPSA 3CDYA 3WYRA 4OQTA 5TF1H 3L6FB 4J4PC 3ARDD 2PKDA 3R06A 4H0IA 3RHWK 3B9KD 1CU4H 3T0EB 2MFNA 3PV6B 3QAZB 3SKOA 3IDYC 4MZ3A 3ZDXE 3CDFA 1TTFA 2HVJB 3BVNA 4HJ0D 5CD3B 3U1SL 2B0SH 1IAMA 2VDRH 1OB1B 3OKOA 3HN3A 3MYJB 1NFDA 4UI2A 3UZQA 3INUL 4OZIB 5DO2C 1KN4L 3KYKL 3SBWC 4ERSL 4N8PA 4PB0H 3JTSA 4ONOA 3ETBF 1A6AB 1W0WB 3KPQB 5C0EB 1GGUA 1PKOA 1MEXH 5DF0A 4JREC 3VXSB 3HI5H 3LEXB 2BY1A 3WFBL 5DQJA 5FIEA 1MHPL 3GSQA 3A6CH 2J8UE 3F6LA 5IESH 2DQFB 5IVXB 1ED3B 5F7MC 3ROOB 2DLIA 1RUPH 4MAYC 2DM2A 1RULH 3KLDA 5HI3D 4AK1A 1U91A 3FKUS 5DGRA 5F9AC 4WW2C 5L2JB 2DOCA 3S4SB 3I6KB 3PXHA 2YRLA 1JK8A 4RGOL 5IMLB 2IMNA 3IDGB 1ZK9A 5E8PB 3PP3H 3ULUL 4QOKD 4PRDA 2R8SL 4S1QH 2BNRB 2YK1L 5I9QB 2M1KA 1F02I 3IAQA 4MDIB 4WI5A 2HJKA 1N7ML 3FB8A 4L4VA 2HJLB 3OMZA 1AGBB 4IBLT 1B90A 2NY1B 3QUMA 4M62H 4S1RH 4ORGA 3RIFK 1KEGL 4OKDA 1IFHH 3QAZC 1DVFA 4LCIH 4M3JA 3IDIB 4M5YH 4Q2ZB 4L1HA 4ODVL 2HRLA 4TPRH 1A3QA 2UZIH 4MGXA 1QUNA 1U8JB 4NRYA 1CN4A 4UQ2A 1ZHBA 1X6NA 4P5TA 4OD3H 4XNXH 1OW0C 1CDJA 4ELMF 3RWIA 3MRGB 4V1DB 3P77B 5B39G 2OXGA 2WNGA 3W0WD 2YBRB 4NBYB 3HNTH 4IMKC 4OLVH 4LBEA 2F54A 3S88H 3GMMB 3KWWB 3ULVH 1SYSA 1EHNA 4PREA 4NHUB 4ZXBD 3I6GB 4QRSA 4BQ6A 4G5ZH 5JQ6H 2P7TA 1INQB 1IKFH 1PDKA 2FGZA 5I75C 2A2QT 4RA3A 3VFUA 2LE9A 5D96C 5E6IC 4UBDD 3FFCD 3LN4B 4ZO9A 2YD9A 2HA1A 3NCMA 2FX9L 4LF3B 4NO3A 3TWCH 4K9EH 5D1QB 5E99L 5ICYA 5C0AB 3VFGL 4R90H 3D2UD 1HKLL 4JGUA 4GBXA 3U9UB 1FZMB 5JPMA 2MQ0A 5AYUH 3WS3B 2X4PB 5FYJL 2ZCHL 4L29B 2IFGA 1SM3H 3VG0H 4NZTL 5TPWH 3HNSH 2E9IA 2EO1A 4PJXB 3ARGA 2P43B 4O9HH 5FO9A 5GGRB 2QHLA 4P9HL 2Z31D 4ZFZB 5TQ2H 2XZQL 1MREL 1DQJA 4DKEH 2XQBH 4F37K 4RA0C 5GGSA 3M1BA 3OL2A 4P2OC 4EUPA 4F33B 4F9PC 5EZJB 4PLNC 1DP0A 2WBJC 5A1AA 3U0WH 5T3ZH 5BRZE 1AH1A 3O4LD 3LN9A 1EVUA 5LQBL 4ZS6C 1BGXL 1I1AD 1FORH 1DL7L 3MC0A 4PRIB 1A14L 4KROC 2CLVB 4M7KL 1KJ2L 3E6FA 1M7XA 3QDGB 4CU7A 4YJZL 4HWEL 2DL2A 2BCKA 3HZYB 3LZFL 3SDDD 2IMMA 3OKNA 2JJTA 2FEEI 4X8XA 1HHKB 1RJLB 4CVXA 4HKXA 1WVZA 4OCSL 2OZ4L 1F58H 2H3NB 4Y4KA 2DKMA 1ZHNB 5GS0C 1P2CA 4AIXA 5K33A 3CFDB 2FX7L 2DQTH 5MEOB 4UT7L 4D3CL 2AEQH 5IFJB 5KS9F 4N0FA 2BDNH 2ENSA 3A0OA 4KKBD 2IANB 1VEPA 4YPGA 5J6HB 2XNAA 4GXVH 2ICEB 1IGCL 2XWTB 4R90L 1PYWB 3RVXC 2YUVA 3D9AL 4K3EL 2YPLE 4QCIB 1S9VB 3MV7A 2KKQA 3QCVH 3QQ4B 2HTLC 2A9ML 3MR9B 5KSAC 3GKWH 1FL6A 5TH2A 1MI5E 1NANH 3MLXH 3HNSL 4XVUD 4HCRA 4ELMA 1F6FB 5AZ2L 4RDQG 4NBXB 4N0UB 3TO4A 2BVOB 4YHNB 4FRWA 4PJCF 1UCTA 1J86A 4UU9B 1U91B 3BKCH 1R0AH 4Y2OA 3B3IA 3BPOB 1BZ9B 5H35B 4WW1B 1F4YL 5J1AB 1CF8L 1XGYL 3TJEH 5CZXD 4HJGA 3NCBB 2NXZC 5GS0L 2NZIA 4HWUA 1BF8A 1G9NL 1TZIB 4O58L 3V6OA 3EYVB 3KXFD 4HIHA 3ZZ1A 3RI5K 3EZJB 1GXEA 5FUCE 5DQDL 2VDNL 2CK0H 3P0VH 1I1AC 1W2KT 4MWFA 2GAZB 3REWA 1NMAL 3VRJA 5E6IA 1QBMH 3VFWB 3EDJA 5IKCA 3SDYL 2E8ZA 4GRLC 1AO7A 5MEOA 3AS0A 4JQIH 3DXAD 3TBTB 1KCRL 1X5HA 2EDJA 2OSLA 4LSRL 4WCYH 2OYPA 3ZKMD 5EBLA 3G04B 3P40A 4HFWB 1U92A 3DTXA 3F7VA 1JHKH 4TNWK 4B50A 4L5FH 5E24E 4XI5D 4NIKB 3NPSB 2V5SA 2R56H 2DQDH 2ZJSH 2FO4B 4O2FB 3WD5H 1RUMH 2PN5A 1MHHB 3DNKA 5HSFA 3CFJB 1AGEB 4YQXH 2D31A 1RIVL 4IHOB 1MCDA 1EEZA 5D71L 5KG9B 4NKDB 1RVFH 3G9VA 4KK6D 3FL7A 4MB4A 1KCLA 1YYML 4JM2C 4HUVA 4DQOL 2OI9B 3BHBA 3HNTL 1KULA 2AV7B 4BSJA 2IQ9H 1N3NA 3OF6A 1GZQB 4UQ3B 2AERT 3FT3B 1PSKL 4KVNL 4MXQC 3QIBC 4HCRL 3QG7L 4NO3B 3WLWD 1KTDB 4NPYA 3PHSA 3TA3C 2E27H 2A73B 3DYPA 1UB5B 3B4NA 3W9EB 4UOJA 3DV6A 3OG4B 1X5AA 2D3VA 4KUZL 2LTQB 2PW2A 4MD0A 3B6SB 1OTSC 3STLA 3TF7C 2H32H 5ISZA 1Q9LA 3H3PH 1KIPB 1IKNC 3ZT5A 3HRZB 3CIQA 3IFOB 5AYQA 5ADPL 5GGRA 5FO9B 5JXEC 2XACC 3FQWB 3L3HB 3WNNA 4QGTA 1K8IB 1DUZB 4FQCL 4IOFC 1MCBA 2X4SA 1U93A 1AP2A 2MQ3A 3K2UL 2P8LB 1WISA 3L7FB 4OIBA 3CJJA 4G8EA 4IRSC 3C2SA 5IF0A 2DQIH 1EXUB 1UA6H 3H9SD 1IFHL 1YUHB 3ULSA 2BVPA 2HKHH 3MGTA 5IFAL 2EYRA 3MNZB 1A1OB 1T0NB 2X9XA 3WEXB 1N2RA 4JZJA 1JTPA 2B20A 3MNWA 3LKQA 5CIPA 5EU3A 2BRQA 3B9DA 1FORL 1QSFA 1RVFL 3T2OA 4F7PA 1L6ZA 2YD1A 5I1LB 1BVKB 1N5AA 4LMQI 3KPNB 4LKCA 4X5XA 3O6LL 1H5BB 3VFRB 4UTAL 1E27B 1MJ8H 1PG7H 4PRAA 3CK0L 3TLRA 3P11L 4ZAKD 3DROB 5DRZA 1QNZH 4XPHH 1ZGLB 4OLWL 1EHXA 2J8HA 1K2DA 2N7AA 4LRIA 5F3HA 5F44A 2E27L 1HHHA 4NFCA 4Y4HB 4YO0A 2H45A 3S96B 4F7EA 1ZA3A 3I3BA 5E7FA 4BZ2L 4HS3A 4X8JA 2X7LA 4P3WA 2Y5EA 3QJHA 3KLHD 4JKKA 1RIUL 2APFA 5A2JH 1HKLH 4JR9L 2ADFH 1KYOK 2G5RA 2R2HB 2X09A 3QDMB 1CIDA 4RMTA 3G5XA 3NACH 4P3DB 1NKOA 3WFHA 4FQIH 4K55A 2EO9A 4FXGB 3BQUC 3QWOA 2ICWJ 2YD5A 4ODUB 2JTDA 4N8CL 4NKIH 2EKSB 5DK3A 1RIHL 2DKUA 4O02H 1NFKA 1MLCA 4DGIL 4YXKH 2V17H 2ATPA 1AGEA 1CBVL 2X70B 2F58H 5IW3A 5HGDA 2UWEE 3QUYC 5I18L 2SEBA 3MRNB 2PW2B 4IM8A 3JTSB 2QADB 4ODVH 4NJAH 1YJDH 4XHJD 3QYCA 1I3RA 3BZFA 5L88H 2X44D 2X2YA 1LDPL 3CD4A 4LDOB 4KI5E 4XNQA 4NT6A 5D7IA 4XHQA 1HKFA 1KACB 4M4RA 4YE4L 3GB7B 4G9DA 2W60B 4OTXL 3VD9A 3PJSB 1QFUL 4PJBA 4V1DD 4OZHF 1P1ZB 4YFEA 2AXGB 4ZUUB 32C2B 2E7LA 4OB5L 3BAEH 4YNYA 4XXDB 2ARJA 2R0WL 4LCWA 5CILH 3QEHA 4J3XA 2OJEA 3KPRA 3T0WA 4FZEL 2OQJB 2B4CC 1G9MH 2Y07H 2XTJE 1DR9A 1FP5A 1MLBB 4G8FA 1WFNA 3W9DA 1NGXA 2XXCB 4XMPL 2D0HA 3IDYB 5ESVA 4K3HA 3CC5B 2A9MH 3LKSA 3ARBC 5TE6H 3QPQD 5I30L 3I2CH 4JPIA 2HWZH 3WO3B 2IGFL 3KS0H 1T1YB 3MODH 2VLMD 3VH8A 1G6RA 5EULV 1MPAL 2EYTB 4JZNA 2MOVA 1I1FB 5FGBA 3HPJB 3MJ6A 2NTFB 4JG1H 2YKLH 4JDTH 2IPUK 4NM8H 3O6FD 2N56A 1JYXA 2PO6C 3U9PL 1F4YH 3EHBC 4YXLH 5JQHC 1O7VA 3CZFA 1OOAA 2DBLH 1S9WA 1CZ8L 5FOBB 4W4OC 3UDWA 3GMNB 4OCXL 3S37L 5FYJU 3IDMB 3O9WA 3WMSA 4YEFA 3PWPE 3LY6A 4U1GC 3LKRA 3S7GA 1QD0A 1VHPA 4H25B 4P2YA 3C9NB 2FX8H 2GSIB 4QLRA 4NOFA 5AAWA 1G0XA 4YDLB 1YQ2A 1J8HB 1JNHA 2A77L 3MLTB 5IHZB 3DBXA 1RI8A 2CLVA 4LCYA 3B43A 3RI5F 4JY5L 1U41A 3ZYIA 4JZJB 5EZIL 5KTEH 3RWCA 3E1F1 3SJVD 1MFNA 4K71C 5EU3B 5IMMB 3NIDF 3O3AA 4V2BA 1B4JL 1FH5H 1G9ML 1YEHH 1FLRL 4GQPH 4HDIA 4ENEC 4OF3A 1NAML 5T1KB 1AKJA 4BZYA 5IFAH 3V5HB 1ZVYA 2CMRH 4OKVB 1X5FA 3V7AG 4JFXA 4KC3B 1GAFL 2DQJL 5ID0B 1OSPH 2NY0C 3MMEA 1EO7A 3MLWL 3Q5YA 7FABL 1J0JA 3VXME 5GSRA 4A6YB 3C08L 1U3JA 3IJYA 3L7EB 3NAAL 3TGXA 3B8YA 4M3KB 5JPMB 3LOWA 3MODL 1T7VA 5BRZD 4JFDB 2F5BH 4P5KB 5EIIA