4TUJB

Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody against neuroblastoma ass
publication title Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB01
4P4KA 3CCHB 4Z0XA 1JMZA 1J8HE 2R1WB 3ZDXF 5LGHH 2Q7YB 3EJZD 4XH2A 3VWKD 1IC4L 2YUZA 1T2QL 4O5LH 1Q8MA 4M5YL 4P2CG 3MV9E 4L4TD 3RL1B 5IR1B 4LHUA 3UTTB 3IKKA 3W81A 4MNGE 4I4WA 5IB2A 1ADQL 2Z92B 4DTGH 4KXZI 5KSVB 2B7DT 5FGRA 5BRZD 3ZT5A 3BPOC 4WCYH 4Y4KB 1KCKA 1XF2B 3GSNH 4ZSOB 1CZ8L 5E2VH 4R7NB 1J1OL 1U41A 1IMHC 1FSKC 4WJ5B 4BQ6A 3OXRB 2Z8RA 2BVOB 4OKVA 2QSVA 4GUPA 3G5YB 3QNYB 1I7UA 4N8CH 4ZD3H 2VQ1B 2VDQH 4PGEB 1TTGA 5T3ZD 3BYTA 2ORBL 2NNAB 5CMAB 2VDLH 1P7KA 1E0OB 3KGRA 3RHWK 1T3FB 3OKDA 1MLCB 1T5WA 1G84A 1CFVH 5I76B 4Z5RB 5IHZB 2FIRT 2DQJL 3MLXH 3UTSD 3BZ4B 3CFDB 3DX9A 2X6MA 4Z7UB 5EA0L 2JCCB 3MRFA 3ROOA 4IOFC 1K3IA 2JJSA 5JPMB 3DSFH 4XPFL 2HN7B 1EHAA 2FB4H 3CH8A 5H35A 3C60B 3W9DB 3H3KA 3L1OH 2AW2A 2D9CA 4XGZA 4PGCA 3FO1B 1CLOH 5GS0D 2X1QA 1HXYB 3V95A 4K23H 4D8PA 5CWSA 4AH2A 3BKML 1E27B 2F19L 5HDQL 5DD5L 1CFNB 4HJGA 4WTZG 2J5LC 3CVHB 4F15B 5ITBL 2P7TA 1WV7T 1QO3A 5FV1L 1ND0A 3B9KB 4Q0XL 5KSAC 1LDPH 3PHOB 4MAYA 2ATPB 2FH6A 3DTXA 4Y5YB 2JIXB 2CD0A 4ZUUB 5BW7C 4P5TB 5C09A 2HFEB 5FOJA 3ARUA 2NY0D 2CMRL 5HYSB 3QDMA 4WW2C 4ERSL 3THML 1X5JA 4MJ6B 1F3JA 1OAZL 3ZDYE 1SJEB 3UBXG 5SWZD 1MNUL 3FB5A 4NC2B 2X1WL 5F7FA 2DF3A 4HV8B 1QSFB 5BQ7B 2AI0L 4HIXH 3S97C 4MA1B 8CGTA 1YEIL 5CEXA 3IGAB 1YEFL 1R3LA 4MQ7B 2GT9A 1BFOB 4NKQB 1YMHB 1A1MA 2EDNA 4XWGL 1I8IA 1R5VB 3MYJB 3WS6C 4YHIA 3T77B 4AMKH 1IEHA 2A77H 3EO1A 4QXTA 4KJPD 1EGJA 2FX7L 4NQCE 2O5YL 2GJ6D 4H25B 4DOHB 5INDB 3ZKNC 4KZDH 1VGKB 4L9DA 5JNYB 4IRJC 1DLFH 1JGEA 3DHMA 3TEUA 4L8BA 4X6BA 5FHBH 3DBXA 2M2DA 3RAJL 5TPWH 2CSPA 5TE4H 4JG1H 3BJ91 1FZKB 5HI3D 5MERA 4P3CH 2VRAA 3O3BA 1OTUC 3V4UH 1YECL 1RUAH 2CO7B 3L3IB 3EDDA 2CRZA 3D9AH 5DRZB 4BSVA 3FTGA 3VXOA 1FN4A 5CGTA 3TLRA 2AJVL 4MHHG 1Q9LA 2VXUH 4GRWB 3U46B 4XWOC 4GRMB 3I6GA 1IM9D 3GO1L 5T1LA 5D5MA 3CAFA 3KPLA 1FNSL 4J4PD 3MLRH 5HTSA 4A6YB 1OTTD 4U1JB 5BV7C 5I1GH 2DDQL 5KG9A 3WSQH 1JNLH 3R1GH 4GAYA 2XKSA 1TLKA 3OKLA 1B2WH 1DQTA 1U8PA 5HPOA 3HLAB 1CE6B 2PCPB 4OCYL 3P73B 4NRYB 4NP4L 4JFQB 1TPXB 1ZS8B 2GK0B 2WBKA 4UTBH 4ZMAT 2EZ0D 3EYOB 2WINA 3TNNB 1BLNB 4JRYB 3BUYB 3JTSA 3GSRB 5D1ZA 4YHLL 4XVJH 2X4OB 1FGNH 2C3XA 4OFVA 2IPKA 3HMWL 3UPRB 3EAKA 4K07A 2XTJE 3KPOB 5IFHH 5D72H 2AKRA 35C8L 3MSPA 5F96L 4UQ2A 1S9VB 3LIZH 3S37H 3MFFA 1KENH 1PAMA 4U3XA 4P57B 1ZOXA 4HKBB 5F89A 1JNHB 4Z9KB 4KGJA 4Y0GA 3UBXI 4HS3A 3PQYB 5BXFA 3NAAH 1P9MA 1ONQB 4E5XA 4EJ1C 2J6EL 5F7LB 3DVGA 4K7PH 4RCAA 5D1QC 1TVHA 2QSCL 1V7NH 3TA3B 3TVMA 2DI9A 2LAGB 2HT2C 3IRZA 3OKOB 2O61B 3R06A 5EUOE 4XCYB 2PYED 4QRTB 1A47A 3HMXL 1RI8A 3VFRB 2IFGA 1PW3A 3U30B 2APFA 1S7TA 15C8H 2NY4D 4PBWD 3VXNA 4GG6B 1EEQA 2VH5L 3HR5A 4L8SC 1QPPA 4OZHE 4XHQA 4LIQL 4QYOB 2AEQH 2P5WD 4XMKH 1DN2A 1CLZL 1N3NB 5KSUA 1DL7L 3ZKMD 4LLMB 4H1LA 1MVUB 1TMCB 4NNXA 4PJAA 2B1HL 3X14A 1GIGH 3ISWA 1NMBH 4J6RH 3SDCD 2D31B 3LY6A 1ZLWK 3GMNB 4P23B 2VIRA 4ZAKA 4NHCH 1NDGA 1VFUA 2CJUH 1NKRA 2E6JA 3O2DA 4KZEL 3NPSB 4HMEA 3HI5L 5FGSA 4QTHB 2W9EH 5HYQB 1FL6A 3MO1A 4MHHI 3RY6C 4WDIA 3LDBB 2OBGA 3PABB 4S0TD 5JDSA 5IVXF 2DBLL 2YPLB 1C16B 1SM3H 2YUXA 2Z35B 1EO8L 5BVPL 4YFLF 3LQAC 2Q8BL 4WI9A 1U95A 3RWIB 3BFOA 3BP6B 1R3IH 2HMID 4MD5B 5D93C 5MENA 3UC0H 3K74B 3SPVA 4XVUC 4Q6IB 2PO6A 4IM8A 1G9NL 5EULV 4ZUWB 2P5EE 2Q8AH 4OB5L 5HHOE 4MMXC 3M8OL 2NXZB 1OSPL 1JFQL 2XFXB 3N1PC 2FLBT 4JRXD 1OQXA 4WHTB 3SKOB 5CBEB 3CX5K 3WO4B 3O3AA 4HLZH 4CN4A 1SMAA 4PJ8D 4PJDF 4G43A 4KI5D 4U6TA 4Y5VA 4O2EB 2B4CH 3ETBF 5C0GB 3MA9H 3SO5A 2NYYD 3IDMB 1CFQA 2FWOB 3DMMB 5D2NC 5T3ZL 1N5AB 3MV7A 4Z7NF 2R1XA 1NBYA 1M7DA 3N06B 4M43H 5FUOH 2ZOLB 5K9KB 5EO1A 4EZMA 4JFZH 3LCYA 4JFEA 3R8QA 2E3VA 2QBWA 5E8OB 5I1EH 3SGDI 3KS0J 4KK8C 2E7LA 2E27H 3GFUA 2BSRA 3RWHB 5BO1L 2E6QA 3WNNA 4QXUL 3BKCH 4AEHL 1EGJH 2UV3A 3HHRB 4ZYKA 1IARB 3QUYB 4NHUB 2DQGL 5JQ6L 1RUPL 2VL5B 4PRDB 2YMXL 3BP4B 5DXWA 4TN9A 4GQPH 5IEHB 4MZ2A 4KROB 2VDMH 3ULUF 1EXUB 3I3EA 4HUXB 4YIQB 3MODL 5D7LE 5GS0L 4I0KA 4NIKB 5IB4B 2UYLA 2NY5C 4F8QA 3F7VB 1OQOA 4U05A 3BGAA 4G8GA 3K8MA 5DT1L 1ZK9A 1QBLL 3DX7A 4I3RL 1SJXA 5LBSL 4ZFGL 4L4VE 2X70A 3JV6B 4OZGB 3IDIB 1KTLB 3AS1A 3HNVL 3QZWA 4YXHH 4MD0B 5DQJB 2RGSA 4F8TA 2XZCL 3RIFF 3MV8D 5CEZL 3ARGD 3L9RB 5T5FL 4S1DC 2ICEA 4G9FE 1TETL 4OZIA 4PR5A 4LHQB 3D69A 2OMBA 3ES6B 1DANU 3SDAD 2WZPD 1NPUA 1BZ9B 4NGHL 5KN5B 2QV2A 3G04B 2MCPH 1MHEA 1FZOA 5DJXB 5HDLA 5TJWK 1FNGB 1NFIB 5C1MB 1I1FB 4IEFB 5I1AA 4NQTA 4FABL 1EHLL 3EJZC 3WLWD 1XF4A 3BXNB 4YBLB 3RWJB 1A1NA 1MRFL 1S8DB 4IHOA 4FG6D 2JJTA 1T89C 2CRMA 1UWGH 3U2SA 1CICD 4NQDB 3BD5A 5CBAB 4D9RE 2D7TL 3O8XC 4JFFE 1CU4H 4F9PC 4YHOL 5FKPB 4BH8A 2BNQA 2AAVA 1MREL 4ISVB 2IANA 3S35L 4WTXA 5HY9A 4HXBH 3SY0A 5JORA 1F3DJ 5GRVL 1HINL 1IC5L 3GKZA 1IQWL 4HKJA 5HYEA 2CH8A 1QFWI 4H0IA 3W0WA 1EIBA 4PJXF 4PRPB 4U1NA 4OF5A 1ZT7B 1XGQB 2WANA 2DMBA 3QCTL 3T0VA 4XPHH 3D3VA 1ZHLB 3KYNB 1U8NA 1QEWA 4PV9A 5IJVB 2BDNH 3NIDE 5GRZA 1XZ0B 4FZ8L 2P4AB 2PW2B 4R4FL 3OBAA 3U7YL 4QHLB 1XGTA 4K8RC 2V2WA 3WD5H 4Z7WE 3DJ9A 5ALCH 2ED9A 3KWWB 5DC0A 1KJMB 1A14H 3X17A 4DN3H 3DO7A 5IFJB 5TDOA 1BQHA 1QFUH 4H1LH 5EBGA 1INDL 3VW3L 5D7KD 1DBJH 2ADJA 3MOAL 1UT9A 1BD2D 3DLQR 2NY7H 3N1MC 5DMIL 5C2BH 1H5BB 5F7YC 1CE1H 3VGHA 3JWOC 3BZEA 3FQNB 1YEKL 4M8VA 4C58B 4NM8L 4YQXL 5DJ8B 4ONFH 5GS1C 1XGPA 2H1PL 5GGSB 3SE3C 4MSWA 3SJVE 4WUUE 2A6JB 3P11H 4TTDD 1X5XA 1CXLA 3DGGB 1U8OB 1F3DH 1Q0XL 4PJ5D 5HGDA 1PSKH 2ZCLH 2BX5A 4FXGB 1MQKL 1T4KB 4CADA 1ZHNB 3N50A 2Z4QA 1ITBB 4Y4HD 3D25A 2XNAB 1MPAL 2OP4L 4LGRB 5TQ2H 4DZ8A 1CVSC 4EDWL 2W1NA 5DA0B 4KVCH 2YPKA 4E0RB 3NZ8A 3VXUD 1FVEA 5IKCB 5CP7A 4XB7A 5F7KC 3E6FB 2YHGA 4KJYB 3QDJB 4OAWA 3QXWA 1FE8H 3WBDA 3AREB 1M7IB 3IJSA 4PJ9D 3U6RA 1J0YA 3LN4B 3QIBA 1LEKB 3T65A 2XN9E 4PJCE 5F1NB 4GKZA 2GIYA 2IEPA 5ID0A 3LD8C 4HD9A 5CJQL 5J6GB 1RUKL 3PJSB 1NBVH 4KJPC 2CIKA 5I6XB 3RL2A 2FZ3B 3QISA 1WBZB 4P2QE 2F54D 3G6JA 5C08E 4JFHE 2BVYA 4YLQT 3OZ9H 2YD7A 5SWSB 4G9DA 2V5SA 5DJ2B 3ELAT 1T0MB 1QBAA 3MRRA 3LMJH 4X4XB 1KEGL 1FG9C 5J8OA 4BKLA 4NKDB 5DQDL 2BC4A 4YAQA 3NCJL 3K1DA 3G9VA 4L3ED 1MFAL 2XZAL 1IGCL 2CLRA 1I3GH 1JZ2A 1QRNA 3Q6GL 3WUWA 4C83A 3VFSA 5C07E 2JJUA 4QT5B 3S5LG 2LVEA 2Q1EA 4HFUH 2NY2B 1SBBA 4KUCF 5HYJE 1WBXA 5ID1B 3H9SA 4YGAB 1N26A 5DZOA 4OZFG 1AKJD 3BN3B 3IDGA 4QRSA 3HE6A 5D70L 4J4PC 5I16A 2H32A 1RJZA 5GRVK 5J13B 2GK2A 3MUZ1 1DN0B 5C6TH 5ALBH 3TN0D 3L5XL 2P24A 5IMKA 3C2SA 2DLFL 3LSOB 3PE9A 3RWCB 3FOLA 5C6WH 4QRRA 4C4KT 4ZFOL 1F4XH 1A7RL 1R0AH 4JHZA 4OV5B 3V6FA 1A7BA 3FO9A 4DWHA 1UB6A 5IHUH 3H8NA 3V6OA 5K9JH 4V2CB 1NEZA 1AHWC 4NQEE 3TBVB 2WWMC 3BAEL 4JQXA 4X6DA 5E1AB 3QUMB 1TXKA 1XAUA 1WZKA 3E2HC 5J56B 4NN5C 4W6XB 5F88A 3ULVD 3BH9A 1N6QL 2V2XB 3H7BB 2A6KB 3OX8B 2FO1A 3VRJB 1IGIH 1W0WA 1MCWW 1UWEL 2F5AL 1NCBL 5GGTL 3DUSB 1XH3A 5E99H 1A6UH 2VE6A 5DC9B 3QIUC 4EN3A 5E8EB 1I9RH 3O4OB 1CN4A 1FNFA 2X4RB 1GVIA 2WAHA 4Y4FA 5D7LB 1MIEL 4Y1AA 4Y2DA 3MA7A 1RK0A 2BSSB 1KJ2H 4WFFE 5IJKC 2OK0L 2FX9L 3RVXC 3RWDB 4KRMB 3WDHA 5DLML 3HE7B 3UTOA 5ESAA 3TFKC 4YGVB 2YPVH 4RSVA 2NY4C 3MROB 3M1BB 2GITB 2D7NA 1HILA 5JA8B 1ZHKA 2OXHA 2X4PB 4FA8A 5DD6B 3TIDA 5L88L 3DECA 4LVEA 1SY6A 4LEOB 4UUJB 5FCSH 5CILL 3C6LD 4HS6A 3GBNL 3ZKMC 5A2LH 3ILPB 3QG7H 2FX8L 4FQCH 1Y18B 2FO4A 5FYKL 3QXTA 4LCIL 4PY7B 2DQIL 1EFXB 1WWAX 4JLRA 3WO3B 5GRUL 1IAMA 4WGWB 2A9ML 4G9FB 4HH9A 3P4MA 2YSSA 3SDCC 5HVHC 5J1AB 5ICYB 5CGYC 4NN6B 5L2JA 3FB8A 1KCVL 4UIMA 4DW2H 4TUJA 3KAAA 2R0KL 3WE6A 5L0QC 1YNKL 2ZOKB 2H41A 3FT3B 3RZCA 1EEZB 2P47B 2AABL 3FJTA 4I48B 1D6EB 4URTB 2E9BA 4GAGH 4D9QD 4L8DA 1FGVL 4YDLC 4OM0H 3CU1A 4NO3B 5FYLH 5JXED 1DQLL 4C59B 5GRJH 3SKJH 4APQD 5DVLA 4ZTPH 2MSPA 2YC1A 5EZLA 5IVXB 4AK1A 1DSFL 4YFDB 3QWRA 1U93B 3NPZB 2VDKL 1BREA 3QHZH 3V7AE 3KPRE 3PWPD 2HMIC 1JRHH 1KC5L 4U7MA 1AR1C 1XR8B 3QP3A 1SHMA 2Y5EA 3WNKA 1NL0H 4LRIA 1KYOK 4WO4B 3OTTA 4P4KC 1MFDL 1P7QB 3JUZA 3V4VL 1TTUA 1WVZA 2EC8A 2W91A 3U36A 3BP5B 3RL1A 5IR1A 3UTTA 3O6FD 1VACB 2F53B 2AJ3B 2XICA 3CIQA 5L6YH 3TV3L 2Z92A 5EOTB 4TOYL 5CINH 5KSVA 4KI5C 4PB9L 1MEXL 1T1YA 4Y4KA 1XF2A 4PJDB 1KB5L 1LO4H 1MFBH 2NYYC 1KG0B 4ZSOA 1QYGH 3MRKA 5CSGA 5I1HH 1BZ7A 5DRWB 4EI5B 2AV7A 4WJ5A 5JLZB 3A67H 3OXRA 2BVOA 5DF0A 4N0YH 3ET9F 3T0BA 3G5YA 2CK2A 1DANT 3QNYA 3AXLA 4G3YH 4XB8A 25C8H 3QO0B 2VQ1A 2UY7A 4OCWL 2Y72A 1J1XL 3V0VB 1V3LA 1T1XB 1FYTD 5ERWB 5CMAA 4DGVL 3IF1B 3OKKA 2Z8VC 3BMWA 1BECA 1T3FA 1SYSB 1MLCA 4Y2OA 4X9FA 4HIJB 2PXYD 4M4RA 4IJ3B 4Z5RA 3W2DH 4BK4A 5IHZA 4K3EL 5C9JB 4C4KO 2A9NL 3BZ4A 4HKXB 5FUZL 3VGBA 1RIHL 4NZTL 4Z7UA 4WHCA 5L7XL 2JCCA 1QFHA 1X9QA 4MA8H 5JPMA 3VXTB 2HN7A 1F8TL 4KQ3L 2NXYB 2JJSC 3W9DA 5IQ9A 3I6LE 4L9LB 3VE0B 1NCCL 1SEBA 3S88H 5GISL 3FO1A 1R5IB 4NC1C 1BIHA 1HXYA 3QEUB 1WJ3A 4WFGD 2XA3A 5I8EB 1CDBA 1LO3H 1E27A 2HFTA 1X5AA 5D1XB 1JYNA 1EEUA 2CXKA 4YHZH 3CVHA 3S8WA 1YYLH 2H32H 3I9GL 1TTFA 2I25N 3D2UD 1T03H 3B9KA 3PHOA 2ATPA 4YWGL 3FFDB 4Y5YA 2JIXA 5BMFL 1HOCA 1S5IL 4V1DE 3Q2CA 2XTLA 4P5TA 1JI2A 4MAYC 1D5IH 2HFEA 5I66B 4B41A 5HYSA 4PBXA 3TO2B 4I5BB 3HB3C 5F93C 4MJ6A 4J3XA 1SJEA 1J18A 6FABH 2J2ZA 3I2CH 1WGOA 1R6VA 5F6IB 2WUCL 5SX4I 1T21B 1UCBL 3N1FC 4IS6B 4N1CA 1H3PH 1QSFA 3D0VB 4P2OD 5BQ7A 1EFQA 1I9EA 5ISZB 4NCC1 4M1CD 1DP0A 4FG6C 2PYFB 3CD4A 2DJSA 1Y0LA 4BFEA 4IOIB 3IKCB 4MQ7A 1BFOA 4TSAL 1UACL 2A0LC 2ZSWB 1U58A 1YMHA 2DLGA 5EIIB 3UYRL 1R5VA 3MYJA 4DKAA 1JPFA 1Q0YH 4H5SA 1KGCE 4LNRB 1WWBX 4RMSA 2VUOA 3QUZD 32C2B 4M7KL 3VWJD 3SKMB 1KTDB 4G6JH 4H25A 2W59A 5INDA 3RJDA 3O9WB 3AM8A 4DCQA 5JNYA 4UT7L 2EDHA 1FFNB 3FQRB 5IQ7H 4ORZC 1R24B 1VGEL 4OGXL 3CDCA 2H6PA 2VISB 5J11B 4PJXB 1NBZB 2X2YA 1TJHL 1FZKA 3H42L 2J7LA 4M6MH 3RJQB 1IEBB 1I9JH 4QTIL 3L3IA 3OGOE 4XNZB 3RX7A 1SY6H 3W39B 3VFVB 2EDQA 2XA8L 1CGWA 1WC7B 2WBJB 5DRZA 2R4RL 3WIIL 2ZUTA 2E5EA 3QJFB 2ICWI 4PJGA 4WW1B 3U46A 4QNPF 3ARDB 3ESVF 4LLYA 5C0JB 4GRMA 3SO3C 4Y16B 4RGMB 4RZCB 2MQ3A 3EFFB 3MGTB 1G7QB 1OARL 1S7VA 3TJEH 4JM4H 1A5FH 2CKBL 4JQIL 4KY1H 3CUPB 2DQDH 4XAWH 4X7FC 3KJ4C 2I9LB 2QADD 4YHMH 4KKAD 1FAIH 1I1AB 2Y7QB 4ZOCA 4V2BA 3HLAA 1NC2D 4KTEL 4Z0BL 1MCFA 3P73A 3OPZH 4X98B 1RJLB 5AAWA 2GK0A 1ZS8A 3EYOA 3TNNA 3CJJA 1BLNA 2EO1A 4FQLH 4JRYA 3GBML 3BUYA 3DROB 3BPOB 3C5JB 3GSRA 3RUGE 3MQIA 5CIPA 4Y4HC 4M1DL 1A6WL 3IDJB 1E4JA 5D1ZC 1TJIL 5HVFB 1F4YL 3HFMH 3BIKB 1FSKB 3FZUD 1S9VA 3O0RH 3O2VH 5LQBH 4NFCA 1G0DA 4HKBA 1IKFH 4JFDD 2E8ZA 1JNHA 3JV0A 2J4WL 3SDYL 3LV3A 1HH9B 5IM7B 1MWAB 4KJWD 3GUTB 3PQYA 3VJ6B 1ONQA 1HNGA 1O0VA 4A2LA 2ZUSA 3TA3A 3BEWB 3WN5C 1NGQH 3OKOA 1GGIL 3KXFA 3MRBB 3TVMC 2DTML 2BVEA 3CK0L 3L3GB 4FOMA 3OAUH 3OB0H 5FCUH 1V3MA 3IVKB 4XP6L 3VFRA 3RTQB 2A74A 3RX5A 4OLYH 2DJ4A 4KI1A 1XIWB 5MHSE 1F3RB 4GG6A 4XPGL 4HIEB 2QQQA 3UTQB 4Y19E 4N5EC 4K2UH 4RGNE 2QHRL 2YD9A 5IESL 4QYOA 3VFPB 4ZO8A 4OCRL 1P1ZB 2Y25A 2IMMA 3CFBB 4YDJA 4KAQH 5LCVL 5JZ7C 2AXFA 4PRHD 3LRSA 5JW4M 2NR6D 1XGUB 1MCNA 5BV7L 2VDPL 5C0BE 4D0DB 4L8CB 4QRPD 3GJFK 3PHQA 4HC1A 4PRAB 1HH6B 3CFCL 3E6HB 3GMNA 1JPSH 1T7VA 1A3RL 2J5LB 5EU6D 5C3TA 3VMPA 3LPFA 3VXRB 5KSAB 4LIQE 5K9QI 5BS0E 4D0BB 4S11A 1V5JA 4OSUH 4YC2C 5HYQA 1I1CA 2N56A 5DJZB 5GJTL 1NSNL 3PIQB 3PABA 1CI5A 4F57H 2OX5A 5IVZA 1S3KL 4I77H 2YPLA 1JHLL 1C16A 1G6RL 2Z35A 4N0RA 3EHBD 4QOKE 4X6EB 5EORL 5GZND 3RWIA 3QDGE 5E08L 4FZEL 3CVHH 4DUVA 4MD5A 4LLUB 1LO5B 4OLEA 1BM3H 5D7SH 3KJ6L 3NA4A 4ZUWA 3ARBD 1G7LB 1OWWA 4QNPE 4RISH 4DVBB 2B0SH 2FGWH 2OZ4L 2XFXA 2O93L 1I8MB 2OLDA 4GBXB 3PWLB 4CJ1A 1PY4A 4WHTA 3SKOA 5CBEA 5KVMC 2XKNB 3FQXB 3OJVC 2H2SC 3MFGB 1YZZA 1I8KB 1HDMB 5DWUL 5DHYB 2MKWA 4POZC 4L4TE 2D9QB 4MCZB 4M48H 1R3JA 4O2EA 4HT1H 5C0GA 2WLZA 4IRJB 5DEFB 4OCXL 5DD1L 3UAJC 5IW6A 1JGVL 1N0XL 2F8VA 2FWOA 4G6FD 4X6CF 4Y5VC 5ANME 2GY5A 3DMMA 1FZMB 1N5AA 3GRWL 4XC1H 1G1CA 2C3VA 2ZKHH 2VZVA 4LASL 4OF3A 1CDUA 2ZOLA 5K9KA 3EDJA 4MNQE 1J1PL 1YPZF 2CK0H 4JGMA 3T0ED 3BSZH 3LRHA 1IGFL 5EU7C 4K71C 1J1OH 1NANI 2FD6L 1U92B 1RULH 4J3TA 4H8WC 3MCLH 1MI5D 8FABB 5EIQA 1CDYA 2NY1D 4MJ5B 1FV1B 4CVUA 2E7LC 4GKSB 5ADPH 2EIEA 1S7SB 3QUYA 4NHUA 1YY8B 5DR5L 2VL5A 4BA8A 4PRDA 3RBGA 1UZ8B 1KCUL 4ELKB 5T3ZE 2G60H 4ZUVA 5IEHA 1B0WA 4JFXB 1Z0NA 4ELME 1LNUB 4YIQA 2X1PA 5KOVC 1WBYB 5F9WB 5DFVC 5J12B 4OD1L 1OCWH 4W6WB 3E8UH 5CD5C 3FFCB 3QEHB 5C0RL 3F7VA 3KR3L 1OAXL 1TCRB 2X4NB 4KVNH 3UTSE 4FNLH 1LEIB 4I2XE 3DIFB 3LQAL 3V2AR 5EA0H 1NAMB 3JV6A 4LCWB 4XPFH 2AK4D 3IJHB 4OZGA 3IDIA 1KTLA 4GRWH 1JWSB 4GXVL 2EDXA 5DQJA 1YC8A 4H88H 3RA7H 2XPGA 3OJDB 5DHXB 2Y06L 2C3GA 1MCSA 4A6YH 1A8JH 3QJHB 5JXEC 5F7WC 2F19H 1LK2A 5HDQH 3INUH 3ES6A 4UI2A 4GO6B 5GRWA 2J3SA 4CJ0A 1F11B 1FZJA 5DK2A 3SKUD 1KB9J 3G04A 3Q6FB 3EJYD 1RZGB 1RIVL 5DJXA 1N59A 1FNGA 1NFIA 1I1FA 1M71B 2AEPL 5D1QB 3UJTH 5CEZE 2BSTA 1FCGA 5DUML 3BXNA 3WXWH 5E2JA 4QXGL 1YEGL 1U3JA 3TYFB 1CGSH 1G7HB 2XQBL 5TQ0L 2IJ0C 4UTAH 1BJMA 3O6FC 4JPVH 1S7UB 5BVJB 1S8DA 2B1AL 4F37K 5SWZE 4G8FB 5FM5M 3LEYH 4YZFF 4OQTH 5HGAB 3C08L 4LLVB 1C1EH 4L8SB 4NFDA 4NQDA 1MY7A 5CBAA 3K80A 2YA0A 2EH7H 3JTTA 3PL6D 3T0WA 4I3SL 5FKPA 1DE4A 5ESVB 1FJ1B 3VXQA 4RA3A 1U3HD 1W72L 1HEZB 3JZ7A 2VZ1A 4XWGH 1ACYH 4DZBB 5FDYA 3O4LD 5KVDL 5I1JH 3CZFA 3RQ3A 3AY4A 3LQZB 2VLRD 3Q48A 1KJ3L 5HSFA 2BVQB 4G7VL 4BSWB 4GLRI 2FX7H 2WUBH 3KYNA 4LU5H 5IJVA 1PZ5B 2WK2A 4XMLL 2PW2A 1FIEA 1FNEB 3RAJH 4QHLA 1YNLL 3CDGB 4JZNB 4XMPH 2PXYC 1NGZA 4OZ4B 5IHBA 2BXYA 3KWWA 1KJMA 1UQSA 2WNGA 4LPTA 1TENA 1YPZE 4WI8A 1J86A 2EIZA 4HC1H 3MBXL 4P9MH 5TDNB 1U8KB 4AEIL 4XZUA 4DK3A 4PJFE 1WFTA 4JEGB 5D93B 2AJVH 1H5BA 3U0WL 5MI0C 3FQNA 3J8F7 4LF3B 5HHPA 2J8UF 2VDNL 3GO1H 4GMTL 2CR3A 2X89D 1AP2B 1HNFA 3AAZB 4ONHB 3OJ2C 4YBQD 2KZ1B 3FMGL 5GGSA 4G6MH 1WIOA 3OSKA 2DDQH 1CF8H 3F12B 5MP6H 2A6JA 3C5ZA 3DGGA 1U8OA 4KI5F 4Y7MA 4FXGA 4NQUA 4MQXC 1U8MB 5FFLA 4WEBL 1T0PB 5TE7H 1CIDA 4WHYH 2XNAA 4FTVE 4IRZL 3VG9C 4OF6A 1Z9LA 3UJJL 5GS3A 2HRPL 4U2ZA 5D2NB 3LS4L 5EUOA 1BFVL 1FG2B 2M26A 4YX2H 3QQ3B 4E0RA 3RRQA 1BBJB 4LRNH 5F3HB 1SVZA 3HMWH 4BQ9A 5IKCA 2BSED 4GMSL 5BZDB 3E6FA 1P84K 4NRZB 2Y36L 2NTSP 2ZNWA 1N64H 2WIIB 2BNRB 5E4EC 2VDRH 4M1CC 4Y19B 1CYGA 3AREA 5IUSA 4XNUH 4LSVL 1M7IA 4LSQL 2DYPB 5GHWL 3NABH 1CIUA 4KJQC 2YWYA 2HWZL 3LN4A 2DM4A 5I71B 1MRCL 4PJBE 4XCEB 1T2XA 3MMEB 1HKLL 1LEKA 3RVTC 4NO0D 1N8ZB 5F1NA 1FBIH 1JPTH 2LTQC 5F44A 5J6GA 1BJ8A 1W72B 2BK8A 4K8RL 4LKXB 2XZQL 1V7MH 5GGRY 2Z93B 2FZ3A 3G6AA 4D94A 5E7FA 2MPAH 5GSRB 4CL7A 4P5KA 2HAZA 2HVKB 4RNRB 5SWSA 3VG0H 5B3JF 5L2KD 3W5MA 5DJ2A 3MLVL 4X4XA 3G5VB 5BS0B 1CG9A 4NKDA 5DD0H 5AUMB 1CD9B 3NFPB 1DBAL 2QQNL 1I1YB 4L3AA 3SE8H 1OPGH 1HYSC 1VA9A 1NH6A 4YDIL 4S1QH 4HKZB 2AV1B 2AJSH 1TDQA 2KL6A 2DWDB 4H26A 4QT5A 1JYXA 3SDDB 4OTXL 4XVSH 4Z8FL 2PTTB 3B2UD 3KPPB 1CBVL 5ID1A 4MXVE 4NCDA 1KELL 3DO3A 4QHUB 5ENWB 3SCMA 1FL5B 1J8HD 1OT2A 5LGHL 4P4RB 4LLDA 1A3LH 1T7XA 1UM4H 4O5LL 1DN0A 3MV9D 1RHHA 3PXHA 3VWKB 2QADC 4KKAC 5DGQA 3S34H 2DBLH 2LU7A 4ZNCD 4EOWL 3HC3H 5ICXB 4OV5A 2Q8BH 3GSNL 4HJ0D 3D85D 5BRZB 5E2VL 4N8PA 3ZYZA 3O6LH 5E1AA 3QUMA 5CAYB 3N9GH 4XC3L 4UV7L 3NFNB 4M7ZB 2UWEE 4MQTB 3T4AB 2BY1A 2VR5A 3ZE1F 1G9NH 2V2XA 4N5UA 2EDBA 2E8YA 2OTPA 2GQHA 2A6KA 3H9ZA 3LHPH 3M8OH 3MUGB 4D0CB 2VWEC 3VRJA 4N8CL 6CGTA 1X44A 1ZLUH 4ZD3L 1AQKH 3FT2B 3QULB 5B8CC 3DUSA 4LVOC 4KJWC 3DX8A 3RWEB 1CT8B 2VDLL 5E8EA 2DIBA 5DTFA 3IFOB 4EN3C 2X4RA 4BFIA 2APWA 4AM0B 4BYHA 2FGZA 5D7LA 3MLWH 1JGDB 3MLXL 1S7XB 2AS5M 4MAUH 3VXSE 1EUTA 2BSSA 4Y4FC 43C9B 3T0XA 3MUJA 1QFWH 1C08B 2F15A 4Y2DC 3UTSB 3DSFL 1MF2L 1ZT1B 4YGVA 4BELD 3MROA 1CDHA 2EE6A 2JB5L 2FB4L 3M1BA 4NBXB 2GITA 4BK5A 1A0QH 1XR9A 2X4PA 3LKRA 1NFDE 5DD6A 2BVUA 4UILH 4TYUA 5HHQA 1NMCC 1J9CT 5BO1H 4LEOA 1CLOL 1SQ2N 4AEHH 4PRID 4JQVA 5SX5K 1QPXA 1Y18A 3EUUA 2CO6B 3CH1B 2NR6C 2D3VA 2VLJB 4PY7A 1EFXA 3LKQB 4G9FA 1P4BH 4S2SB 3S37X 5J1AA 2IBZX 4F7PB 1LDPL 4PTUA 2OTUB 4BSJA 4LVHC 5GGQH 5E94A 3GJEB 1OTSC 2X5PA 1V8HA 4XHJC 2ZOKA 5DT1H 3IRPX 3C5SB 3FT3A 4D2NA 1EEZA 4I48A 1D6EA 2NY0B 1JN6A 2JB6B 5JXAH 3RZCC 3S4SG 1L6ZA 4J8RB 1YQVH 4NO3A 3ZYJA 5IIEB 1U8IB 4P2RE 4Z7VE 5ESQB 4JJ5B 5JIPA 2XACC 1F90L 3MV8E 1MH5B 3EHBC 1K3ZA 2XZCH 5IVXA 4HIXL 3RWGB 3UTPE 4JKMA 5J0BA 4ORGB 1XR8A 2NZ9C 4M1GH 4Z77A 4WO4A 4NPYB 1ZANH 3IXTB 4LRIC 1P7QA 4AMKL 2A77L 5IEKB 3LD8B 3BP5A 5CLTA 1GGUA 4FQXD 4NQCD 2F53A 3P0VL 4JN1H 1TNNA 1X4XA 4TVPH 1DLFL 1UH2A 2GJ6B 5EOTA 4ODBD 5TPWL 3W11D 3FN9A 3WIHA 1ZWIB 1YJDC 1KG0A 5TE4L 4OGAD 4JG1L 3GSWB 1KEMH 4P3CL 4Y4KC 5DRWA 3V4UL 4EI5A 3VXPB 1RUAL 7FABH 4X6CB 3HI1A 5CJBA 5JLZA 5E8PB 4KK5D 4C55A 3D9AL 1Y6MR 3LZFH 1E6JH 3W9EB 1MREH 3S35H 2VB5A 4R96B 1MJ7L 3MLPA 1Q9WA 3QO0A 1EVUA 3V0VA 1T1XA 1IQWH 2AXJA 5ERWA 2VXQH 4GAJH 3T3MF 4JDVB 3MLRL 4L5FL 1IM9B 3ARZA 1AIFB 4OFPA 1QVOB 4POYA 5GPRA 1JNLL 3LB6D 5C9JA 4ZO6A 4HKXA 4LK4A 4WUUA 3VFTB 2I24N 4U31A 1B2WL 1B4JH 1FLRH 1TITA 5EPMB 1JPGB 3VXTA 1Z3GH 3DV4B 5TE6H 3EKCA 4JZOA 2Y6SC 4LDLB 3GM0A 4D3CH 3VE0A 3VDAA 3VFMB 3OXSA 5D96C 3VW3H 2FLRT 4XVJL 3S36X 1FGNL 1R5IA 2ARJB 4I0PD 5D72L 1AHWB 3ULVF 2XTJD 1C12B 5D1XA 1D5ZB 3E2HB 3H9HA 3LIZL 3BOVA 1YEKH 5DS8A 1KENL 5T1KD 3VI3F 3D1MC 3DUHA 3GMMB 4FQHA 3T2QA 3L3HA 3UZVB 1UA6H 1OSZB 3BE1H 3FFDA 4LHUG 3B9KC 3NAAL 2ESVE 1T6WA 4Y5YC 4K7PL 4G42B 3ALPA 4P5TC 3TO2A 3MZTA 2XQYK 3RVUD 4I5BA 4C56D 1OAUH 1CTNA 2NX5D 1MHCB 3NA9L 5GS2H 1S9KC 4R2GD 4KKLC 1O7SA 1AH1A 4M02A 1T21A 2DD8L 3GSUB 3L3JB 2NY3D 2YN3A 3D0VA 3QUMH 2PYEB 5IFAH 15C8L 1KCSH 3HAEA 4WWKD 1T04B 3VXUE 4ODVL 2PYFA 5B38A 2NY4B 4IOIA 5E03A 3IXAB 3QXAA 5D6CB 2AEQL 3OR7A 3TIEB 2ZSWA 3OGCB 5EIIA 3B9VA 4K3DH 4LSTH 4ZXBD 3HUJE 1S5HA 1B4RA 3RDTD 2KKQA 1JUFB 2P5WB 2W65B 5LVEA 4LNRA 3E3QE 3QH3A 4HEME 3GZKA 3SGKC 4NO2B 2QTEA 3SKMA 5B4MD 3TC9A 4DK6A 4CVWA 4N0CD 1KTDA 4J6RL 2B5IC 3ARVA 3MJ6A 4KK6C 4NHCL 5CJQH 3O9WA 3P9WB 1FVDA 3SDCB 1FFNA 4PG2A 1A6TB 5HVHB 4PJHF 1R24A 5ABDE 3AM8C 1NGYB 4NOBA 2VISA 4UAOC 3RKDC 1PEZA 4PJXA 4JRWA 1NBZA 5B39A 4F3FA 1LHZA 5L0QB 2AVGA 3FQWB 1IEBA 1RY7B 1KEGH 4OLWH 4JAMB 3GHBH 4Z95H 3W39A 2F8XC 5J7CC 4RWHA 1WC7A 4IDJH 2WBJA 3ARTA 1CFTB 4L3EE 1SM3L 3VFUB 4YDLB 1CFSB 3QEQB 1IGCH 3QJFA 4EQ3A 1QHOA 1T0NB 3AS2A 4NKIH 1NGXB 2R29H 4WW1A 2RAMA 1R3IL 3ARDA 5C0JA 4Z78B 4J2XA 3D0LB 1VSCA 2N7AA 3UC0L 3MRPB 5EB9A 4MS8D 4NQEA 1DUZA 1B0GB 1G7QA 3MGTA 2Q8AL 3AC0A 1A6ZA 2P5ED 5HHOD 4XP9H 5D7IF 4P4KB 4X7SH 4YBQC 3W82A 2I9LA 2J8UB 4F58L 4HLZG 3O6MH 5DJAA 4JRXB 1I1AA 2Y7QA 4MB4A 1IBGH 2DB8A 2XI9A 4TSBL 4X98A 2B4CL 1RJLA 4PJ8B 3MA9L 4R8WH 5CJ8A 2DLFH 3S9DB 5F9JA 3B6SB 3RX8A 3DROA 3C5JA 1T66D 1CD1B 4M43L 5FUOL 2V6HA 5D7JA 1OP5K 1GRWA 2C5DC 2VLME 4JFZL 4R4BB 1FFOB 4M62H 3BIKA 1CK0H 3BAEH 2W0PA 3MX0A 1LP9F 3P9MB 1DQQB 3ROLB 2R0LH 2BY2A 1IAKA 1HH9A 4RFOH 5A3ID 5K59E 1MWAA 1EGJL 4ZUSA 4HFWB 3T09A 4YNYB 4ZO7A 3VI3E 3VJ6A 3G5XB 3GUTA 5LKNA 1GPOH 4B0MM 1KLGB 1QTYT 2LABA 4WTWA 5GGTH 3BEWA 1QFPA 2VDML 5HVWA 5JW5B 3MRBA 3TA3C 3V8CA 3OR6A 1LVEA 4ZS7H 3WKMH 1Z0MA 3L3GA 3W5NA 3OKDB 3K8LA 3IVKA 1T5WB 3RTQA 1EMTH 3L5IA 4FFWC 1XIWA 5CEYB 3DI3B 3K1KC 3VXMD 4EUPA 3DX9B 4OJFH 4LSSL 5DLMH 2A6DB 1F2XK 1L0QA 2C1PB 3QFJD 3VFPA 5GIRB 4L4VD 1D9KD 4RAUB 1UWXH 5FIEA 2P45B 1DQMH 4NO5B 4YXHL 3CFBA 3QNXA 5L88H 3ARFA 4N8VB 1OP9A 5F7UA 1XGUA 3EDFA 4XGZB 4L8CA 4PRAA 1HH6A 5C0AD 4R26L 3K46A 3BP7A 1EAPB 3ARGB 5FYKH 1Y6KR 2XYCA 3VXRA 5GRUH 5KSAA 3VA2C 4BFGA 3KPRA 4KTYA 4E41D 1I8LA 3ULUH 3MUHL 3EOYG 4GW1B 2JKXA 3ALXA 5TH2A 4D0BA 5DJDB 5JHDE 4MAYB 3F7RA 4DN4H 5HVGB 1RZ7L 2AXHA 5FYLD 1NJ9B 3NPSC 3OHXB 2OJZH 4PJHE 2GYSA 2FEDD 4YPGB 2R0KH 3LDBC 1UEYA 3FRPA 2VZOA 2W92A 4AG4H 3C2AH 4X6EA 1EAJA 2XY2A 4HXAH 1CVRA 1DQLH 2CDFB 4JZJB 5HGGS 3DI2B 2HJLA 1LO5A 2J8HA 1DSFH 2FDBP 4JANB 4D9RD 4JFFD 3F5WA 1CICB 1G7LA 3EDKA 3E0GA 5CEXB 1NMAH 1HZHL 4HXBL 2ICWJ 2NZIA 4GBXA 3PWLA 3WS6A 2GFBB 3PUCA 4ZFFA 1BQUA 1I8IB 2YRLA 5I8OH 2XKNA 2A73B 3BKYH 4ZFZB 3U4EA 1MFDH 4U6XB 3NN8B 5DUBB 3I02A 3V6ZB 1I8KA 1HDMA 3MRIB 5DHYA 3EO1B 3V4VH 4LSRH 4MCZA 3BZDA 1DBBL 4XPHL 2E9WA 4MXQC 4IRJA 5DEFA 2OR7A 4XTRD 1KPVB 5ACMA 3K4ZA 5E7BA 3UYPA 1FZMA 2ADIA 1JGEB 4Q9QL 1CS6A 2KQNA 3DBXB 3DMMC 2GY7B 1MJ8L 3TBYB 4JN2B 1C5BL 2FHCA 4W6YB 3WD5L 4MJID 1CL7I 5CSBA 4DN3L 1A14L 5EIVA 4H1LG 1U92A 1QFUL 2EIBA 3FQUA 3TO4A 8FABA 1O5DT 3MCKB 4XCCL 4MJ5A 4AIXA 1DBJL 1FV1A 4GKSA 1FN4B 1YY8A 1NCAH 3RVWD 1UZ8A 4ELKA 1CE1L 1BD2B 3SO3B 4UDTA 1KLFA 3O2DL 1LNUA 3VRIB 1RZKH 1WBYA 4KROC 1I3RB 2X10A 2X7LB 4DGIH 1KN2L 1KTRL 5KG9B 3P11L 3GM8A 3F6LA 3FFCA 3SJVD 5KVEH 3KJ4B 1VENA 4OD2A 3SE9H 1TCRA 2V5YA 4GAYB 1PSKL 2D7MA 2ZCLL 3BZFA 3I50L 2A9NH 1LEIA 4RAVA 3DIFA 2EXYD 3UO1L 2CDGA 1NAMA 4PJ5B 1MLBB 1HCVA 4LCWA 4GH7B 2R23B 5E5UB 3IJHA 1JWSA 3OAZH 1F8TH 1ZV5A 1PKOA 5TQ2L 3O45B 3B4NA 2YR3A 4X6DF 3BQUA 4Y4HB 1H3TA 1CQYA 3JTSB 4KVCL 4I9WE 4WFGE 5JR1H 3QJHA 4JPWH 5DK0B 2IGFL 3AFLA 1F6FB 2AP2A 3T2OA 4G6AC 1FE8L 4Z7QE 1GGYA 5GQBA 2IH1B 4HULB 2VO5A 4C57C 1F11A 2DI7A 1AFVH 3NIGE 2L7JA 1RZGA 2OSLA 4ZNEE 4JVWA 4KKCD 4PJ9B 5I1IH 4YWGH 4CUCA 2XN9D 4HS3B 4JE4B 4FN0A 2IH3B 3CSYA 4M00A 3WN5B 2K1MA 3GHEL 5FM5O 1VFBB 1NBVL 1TVHB 3QDAA 4LPCA 3RY5A 1YUHB 1DVFD 3GJFB 1S7UA 4LPWA 4G8FA 4YBLC 4UT6H 3RY4A 4P2QD 1F13A 5C08D 3OZ9L 4H8WL 1YDPA 3SDXE 2F54B 3ARRA 4IDLA 3LMJL 4LLVA 4XI5D 5BOZG 1RZJH 5E2WH 2FECL 3VXNB 3FAWA 4G8IB 3HR5B 1UH4A 3JV4B 1MWAH 4PRNA 3WFBH 2CUHA 1A21A 5ESVA 3RIAK 1FJ1A 2DL9A 4YXKH 4TSAH 5LGKA 2AERT 5KSUB 4XXDA 3DVFA 5CKGA 5C07D 4ZODA 4W4NA 3LQZA 4NNXB 5FV2A 3TT3H 3VH8G 4BSWA 3AY4C 3QCVH 5HYJD 1T1ZB 3D39D 4N90E 1PDKA 4D9LH 2YXFA 4UT7H 3MBED 5JPNA 1FNEA 3B5TA 3O11B 2J88H 3VFNB 1AKJB 2MHAA 3CDGA 4JZNA 4OGXH 4YC2B 2Y9RT 3A6BH 4OZ4A 1CGYA 4NQVB 4ETQB 4RRPA 1FL6B 3ARXA 3EYUL 4QTIH 4PYGA 4WUKH 4PPTA 1OHQA 2ZSVB 2W0FB 2XA8H 5EOQL 4XCNB 1OAQL 2UZYB 4X9BA 3WIIH 5TDNA 1R0AL 2DMKA 4F7TA 3ZSSA 5IHUL 3RU8L 1JZ6A 4M93C 1MELA 4RX4A 2X41A 4UV4H 4LF3A 5C7XL 4U6VH 5MENB 3HNTH 1H5BC 3Q5OA 2B2XH 1AP2A 4ONHA 2XTJC 3UJIL 5H94B 3O41B 4HIHA 1VDGA 2GHWB 4KQ4H 3WL9B 3F12A 3MPCA 1IGIL 5IMLB 3B9DA 4PLJC 3VD5A 5A40E 4JHWH 4NN7C 3C5ZC 3GIVB 4NQXA 5E99L 1U8MA 1N5YH 1KULA 4M8QA 1I9RL 3MLYH 3NCYS 4BZYA 3ULSB 2FHBA 3REVB 2BZDA 4FQ1H 5D2NA 4P48A 1FG2A 3QYCA 2G9HB 4CBPA 4WFFD 1M7DB 2DQCL 5BZDA 3SQOH 4K71B 2WIIA 2YPVL 2BNRA 2I5YL 4Y19A 4WWKC 2HTLC 3IDXL 5L8LB 1DBKH 2BVPB 2DYPA 3NFSH 3AREC 3GSXB 1W0VB 3MMEA 2ZCKL 5E2UL 1N8ZA 5A2JH 4P46D 1HKFA 1P4IL 1TQCB 4R9HA 5C0BA 2R8SH 3C6LB 1MY5A 1KF9B 1Q72H 3K2MC 1J05A 3ECBB 1NANH 4LKXA 1TZHA 2F5BH 4TRPL 5F9DC 3CK0H 5IW1B 4CU8A 2EDYA 2HVKA 3CLFH 2VN7A 1BQHG 3HZVA 2JK5A 5BS0A 2V17H 4G8GB 4XPGH 4HHAB 4PJHB 4PV8B 3NFPA 3DX7B 5J3HC 4LCCC 2GJZB 1Z9OA 5I30H 2APXA 3DETC 4GRLD 4OM0L 2X70B 1HQ4B 5JOEA 5FYLL 1L7TH 5DJ0A 3QZWB 2DWDA 2XWTA 3IS0X 4MVBD 5IB5B 3MRJB 4UB0L 4PRHE 2K7QA 5CUSH 5GRJL 3SDDA 3SKJL 4W4OA 5BV7H 2PTTA 4QRPE 2VDPH 3QT2A 4JFOA 3KPPA 4APQB 4M6OH 1G6VK 1UXSA 1PKQE 5C0CE 4QHUA 5EU6E 1LE5B 5ENWA 3C60D 4PR5B 1AD0B 1AQDA 3KPSE 3PWPB 1FL5A 3SCMC 1NAMH 4P4RA 2V5RA 3IAPA 1S7WB 3L3OB 2D4FA 1FZOB 4YDKL 1VEPA 1RZ8B 3VWKA 4NSKB 5D7IB 5ITFB 2DWEB 3JSSA 4L4TA 1A22B 4OI7A 3O6FB 3KLAB 1XF4B 1S3KH 1H3UA 5CINL 3QSKB 2R2EB 1JHLH 5ICXA 4R90H 5JMOC 1T89A 3CVIH 1BF8A 5ANMA 3CPLB 1LO4L 1MFBL 1BF2A 2HFFB 3OKMB 3PNWB 5BRZA 1QYGL 4FZEH 3ZHKA 4ALAH 1T66C 3U2SB 3QQ9D 4KPHH 4PJEF 3WEXB 4PB0L 3A67L 3NFNA 4UNVA 1WTLA 3QRGL 4N0YL 3WFZA 3GSVB 4QWWD 5KZCB 4NZUH 1Z5LA 3MUGA 4D0CA 2BNQB 4EBQL 2BJMH 4X4MA 4FXKA 2OZ4H 2P8MA 5FB8A 3KYKH 2N1KA 5FDWB 3FT2A 3QULA 1PD6A 1LP9B 3K7UA 1SBSH 4HKJB 2W9DL 3RWEA 3X13B 5IW3A 5IB1A 5FHAH 1FYTB 2YRZA 2BHZA 2EYTA 1L9NA 3IFOA 3D3VB 4AM0A 1KIUA 3HI6H 1JGDA 3O4OC 3W2DL 1QEWB 1S7XA 1E6OH 1N0XH 4JO4H 3D18B 3GRWH 1PG7L 2PXYB 43C9A 4P59H 1XGTB 4PJIE 3UTSA 4MA8L 2C7UB 1J1PH 2V2WB 4JY6A 4GLRH 4JJHA 4FQQA 2X40A 4PJGF 5DK3A 4XRCB 2OJEA 1MI5E 3I6LD 3S88L 3G08B 4UIKH 5I2IA 2ADJB 2VKWA 2Z31D 1IAOA 3PP3H 1LO3L 5DR5H 1KIQB 4LQ1A 1MAJA 3CH1A 5FGCB 4YHZL 3LKQA 4JQVC 3QUXD 3QAZC 1HHIB 1YYLL 4S2SA 4CW1B 1S9XA 2EDOA 2DQEL 3P0YH 2JELH 4OUUB 1M1SA 4ZPVA 1PYWB 4OD1H 2YN5A 4NN6C 3GJEA 1D5IL 4V1DD 3IFPB 4RDQG 1KT2B 2EDTA 3P2TA 5HHVH 4N9GA 6FABL 4J8RA 3I2CL 1NEZG 3D25B 1U8IA 4GXVH 5D6DC 5ESQA 1H3PL 5SWZA 1A4JA 2YKLH 2BXZA 1MH5A 5I1LB 2Y06H 3QQNA 1PX4A 2YPKB 1X5KA 3RWGA 4P2OB 1FVEB 3TWCL 3L5HA 3QO1B 1A2YB 1BAFH 4YPJA 4NPYA 1Q0YL 4JFYB 4YO0B 4MDJB 3IXTA 5KS9F 3CMOL 3L5WB 3EFDH 5CZXC 2LTQB 3IETA 4WO4C 3T65B 4K3JH 4G6JL 4OQ1A 4GKZB 1KCRH 2HJFA 2P42B 4MA3B 3QUZB 5AZ2L 5E70A 5ADOH 1X7QA 2V9QA 2GJ6A 1G7JB 4PP1C 5IQ7L 4U1MB 4J3WA 2FEEL 3PGDA 3LKSB 1ZWIA 4XTRC 4U0RC 4HWEH 3GSWA 3DURB 4M6ML 4QHNA 4IBLT 1I9JL 3PHSA 5I0DA 5CHNB 5A2IH 1SY6L 4X6CA 4BKLB 1TCMA 5E8PA 2BC4B 4I3SH 4CU6A 3MJ8A 1AO7E 2Y1VA 3W9EA 1QBBA 1YPZA 5TF1H 1J11A 1CCZA 1W72H 1IE5A 2APTA 3BD4A 2IADB 2XKUA 1YEDB 2AJYH 3TT1H 4GS7B 4JKWA 2VAAB 4G7VH 3TJEL 2NY5H 4JM4L 1IM9A 5FXCH 3RP1A 1AIFA 4KY1L 1QVOA 4J4PA 2DQDL 1OAKL 4XAWL 2PNDA 4QRSB 1K4DB 4OLVH 4XMLH 3GGWB 3VFTA 2VLKE 2R69H 4P23D 2QADB 4M9PA 3ULUC 1JPGA 1ITCA 3DV4A 3OPZL 3PG2A 2DRUA 1NC2B 2NW3B 3K8KA 3U1SH 3VFMA 2E7CA 4FQLL 2P44B 2BMKB 5HD8D 2ARJA 3MBXH 3L6FB 3ZHLA 1MFCH 3GSOA 1Q1JL 1AHWA 5IBUB 2EDRA 4XX1G 2BFVH 1N0LA 3HFML 3FO9B 1UB6B 4ZTOL 1D5ZA 5DHVB 3U0WH 1LILA 1Q9KA 3O0RL 3GMMA 1QLEL 4HAGA 4X6DB 5D1XC 3O2VL 5LQBL 1IKFL 1RAMA 3X11B 2YD1A 4GMTH 3QXDB 3BH9B 1OSZA 3TBSB 4JFDB 1OVZA 3T1FB 1W0WB 3DWTA 5B8CB 2A6IB 4LVOB 1BX2A 3JUYA 5FA3A 4CVZB 2A83B 2IFFH 4XNMB 3CSGA 1OT1A 5DZNA 1MHCA 4WEBH 4EN3B 2NXZD 4GW5B 1EBAA 2BOCB 3OAUL 3GSUA 3L3JA 5FCUL 1E4XH 4Y4FB 5ECJE 5F6IC 2PYEA 4Y1AB 4Y8DC 1FIGH 1T04A 2L7UA 5MHSD 3TZVD 2DBJA 5KJRH 3IT8D 3HPLB 1WT5C 3IXAA 4RGND 5D6CA 3TIEA 3OGCA 4YFEA 2ED7A 1T6VN 4JM2D 1HILB 1KACB 1NMCB 3MRHB 4KAQL 4LSVH 1FO0B 1JUFA 2P5WA 2W65A 4RFNC 3TIDB 5T33H 5HGHB 2HWZH 5FUCE 2FEEI 2HJKB 1KXTB 1MRCH 1AGCB 3HC4H 1HKLH 4NO2A 3EYSL 3F65A 1D5MB 4QEGA 1V05A 3SGJA 1ACZA 3SDCA 5C92A 4LOUC 1A7PL 1A6TA 1ETZB 5EU6B 4HWZA 4OCSH 2M8XA 5F1OB 2YSSB 4KK9D 4PG2C 4LVHB 4NKMB 4OSUL 3FQWA 2QR0B 5J11C 5DSCB 2EEAA 3RWFB 5HHME 3BGMA 2OL3B 3CFJB 3ZDYF 4JAMA 4FQIH 2ZUVA 5ICZB 4I77L 4DEPC 3RZCB 1DBAH 3VFUA 5F1IB 1IGYA 1CFSA 2YD6A 5T3XH 3JWOH 4HPOH 4WV1C 1T0NA 4RGOL 4NKOB 4QOKD 4N0FA 1NGXA 4ACPA 3CVHL 3QDGD 4Z78A 3T3PE 3D0LA 3LOWA 4CDHA 3MRPA 2BVTA 3MREA 3NOIA 5M95B 2IBBA 1B0GA 5D7SL 3EYVB 4G6KL 3RIAF 1CBVH 2B0SL 3NCEB 2FGWL 1HHJA 1YEHH 3EBAA 2UWEA 3ARBB 4O9HL 3QIWD 5HYSG 1XFPA 3B3IB 3V5HB 3U9PH 2J8UA 3U4BL 3WJJA 5MEOB 2DLHA 4JRXA 2C3WA 5CFHA 4XBPA 1I1AC 3U36B 4HJJH 4M48L 4HT1L 4PJ8A 5T5NF 4P49A 3B6SA 5JIHA 1A6VH 4XC1L 3PGFL 4EOWH 1CD1A 2ZKHL 4G7YL 4CKVX 1J7VR 1T1YB 5C09E 4R4BA 2E6PA 1FFOA 2CK0L 4MNQD 3BSZL 2FATL 3SN6N 5D7JC 4M4PA 2X44D 3MRKB 3QDME 1FYHB 2VXTH 1HXMB 1BZ7B 3GMLB 3P9MA 3T0EB 2AV7B 1DQQA 1RULL 3ROLA 3MCLL 1AD9B 4XC3H 1XF1A 3F7QA 4UV7H 1FL3B 1RZJC 4F9LA 5ADPL 2GW5A 4HFWA 4YNYA 1I75A 3AXLB 3G5XA 2QQKH 1DEDA 2NY1B 4OV6F 2YZ1A 1CXHA 1KLGA 3KNBA 2G60L 4NZDA 5JW5A 3TJHD 1G9MC 5JHLL 2XIDA 3OKKB 1I3VA 1OCWL 1Z2KA 3E8UL 1RV6X 2EE9A 5J1SC 2NY6C 5DFWH 4KVNL 5CEYA 2YD8A 3QI9D 2BHYA 4FNLL 3RTQC 2QKIA 4PRPD 1UZ6E 1XIWC 2A6DA 2C1PA 1MF2H 5GIRA 4RAUA 4NJ9H 2JB5H 4NO5A 5D96B 1YNTB 2IAMD 1P6AB 4Y88A 4KC3B 3RA7L 4H88L 5IQ9B 2B8OT 1BGXL 4N8VA 2AK4B 1FHGA 1SEBB 5IVNA 3ARFC 4A6YL 4PRIE 2ERJC 1MCBA 1DTUA 3MV8A 1EAPA 4G80B 3ARGA 5EUKB 3INUL 4LQFL 3DGCR 4NM4H 3HTLX 2HG5B 3WCYA 2EYSB 1GOGA 4GW1A 3NMEA 3SDAA 5DJDA 1I8LC 1WZMA 1NJ9A 3OHXA 1HOCB 1K4CA 4YPGA 3UJTL 5EUOF 5D5ME 3S4SB 4JG0L 4WFED 3WXWL 4DKEL 4MD4B 5CEZD 1JZ3A 1CGSL 1GZPA 4UTAL 3PWNB 4JPVL 4BUHA 3LEYL 5HDOA 1BHGA 4OQTL 1JNJA 5KAQF 4OZHF 2CDFA 1C1EL 1J0IA 4JZJA 1F90H 2IPUK 4JANA 2EH7L 4S1RH 5C0IB 1CICA 3EOAA 2KQMA 1Y0LB 1NBQA 3PL6B 2MWCA 3SGEH 4ZS6D 4KHTH 1U58B 2GFBA 1QLFB 5F7EL 1ACYL 4QWWC 2RR3A 4GBXC 5I1JL 1JPFB 2A73A 3DXAD 4H5SB 3BH8A 4PJEB 4ZFZA 3V6ZA 4U6XA 3NN8A 1U3HB 5DUBA 5F3BA 2D4DA 5DJYB 3MRIA 2B5IB 3O4LB 4TULH 2GAZB 1X5FA 2VLRB 3QDJD 2WUBL 4LU5L 1CXFA 1KPVA 4MA7H 4OD3H 3P0VH 1RQ5A 2AXGA 4DCQB 4KMTL 4TSCL 4LEXL 3V5DB 2ITCB 4FMFA 4UAOB 4FFVC 3TBYA 2RCSH 4JN2A 4XMPL 2H6PB 3WFCL 3QFDB 1ZLSH 2W38A 3CFKB 4YXLH 3MCKA 3K4AA 1B3JA 4HC1L 4P9ML 3TO4C 3STLB 1MJ7H 2N7BA 2FBJH 4PJGB 1BD2A 3BGFC 4LLYB 3LH2L 2DN7A 2ZZUT 4QO1A 3VRIA 1S9WA 3MOBH 1S7VB 1EO7A 1I3RA 2X7LA 4L5FH 1OGTB 3QUXC 4G6ML 3RGVD 3WFEH 5MP6L 1CF8L 3NIFF 5F9WC 3T0AA 4AT6B 5J12C 3PWUB 4PJAE 5FKAA 4M3JA 4OF7A 1SYVA 3OB8A 2NY2D 2FSEB 3P30H 1MLBA 4PJ5A 5GXBB 4WHYG 5C0EB 5TE7L 4CAGA 2FBOJ 2EXWD 2WSKA 2R23A 5KVFH 4FTVD 3O45A 4J1UB 4E9LA 3ZZ1A 4Y4HA 4DVRH 1J88A 4YX2L 3AB0B 2H2PD 3BQUC 5CIPB 4LRNL 4M3KB 3B9AA 5DK0A 5E9DD 3FB7A 3VXUA 1N64L 2VDRL 5FGBA 2ICES 2IH1A 1OW0C 4M7LL 4XNUL 3NABL 4FFZL 2Q76B 3EYQD 2AJUH 4PJ9A 3LV3B 3TBTB 5C8JB 1FBIL 1JPTL 1QKZH 3S3SA 2IH3A 5D9SB 2DM7A 3MC0A 1UEMA 3WN5A 1CR9H 2OM5A 4IIQC 4NO0B 1VFBA 4C56E 4X8XA 1YUHA 5EBLB 2YEZB 2NX5E 3GJFA 3QPQC 5KS9B 1V7ML 3MNZB 5DO2D 3KXFB 3NA9H 4KGLA 3OG6B 2MPAL 4ODSH 3VG0L 1G7MB 2DD8H 4LP5A 4DAGH 2Z91B 4GW4A 5JIIA 4TNWK 2F54A 2A74B 1XCQB 1BZQK 5DD0L 3BN9D 4G8IA 5L2KB 1RIUL 4HK0B 4ODVH 3JV4A 5I75C 4G8EA 5HHXL 1A64A 1W0YT 3SE8L 1D5BA 3DARA 1DUYB 1OPGL 1GOFA 4S1QL 3HZMB 2AJSL 4L3EA 5DEGA 4UDUA 3CZJA 3MV7E 4YDJB 5FF6B 4WU7A 2I60H 4HWBA 1PLGH 2AXFB 4XVSL 3LRSB 5EU7E 5JO5A 2X9YA 3HE7D 3KYMB 3FKUS 3H9YA 3PHQB 5EU4A 1GH7A 2FJHB 3DVNB 1T1ZA 1FFQA 5FEBA 3V4PH 2I9TB 3FCTB 3FOMB 3LS5H 3O11A 2VC2H 3VFNA 2I27N 4U3CA 1AKJA 4QGTA 4U6HB 1A3LL 1U42A 1UM4L 4AJ0A 3SE4A 1J8HB 4NQVA 4YUEH 4ETQA 2ARWA 5A2KH 4JY4B 2ZSVA 2VN4A 4EI6B 1NCUA 3TN0A 2W0FA 3MV9B 4WU5B 5IVZB 3S34L 4XCNA 4Z7OE 3KPNB 3HC3L 1JYVA 3VU2A 2GUOB 1QFWM 4MNGB 3WNLA 2ZUQB 1KB9K 3MYZA 4OFYD 1AXSB 2H45A 3O6LL 3D85B 4JO3L 3N9GL 5E6ID 5DRXA 5H94A 2V9TA 3O41A 1J0HA 2MMXA 3LHPL 3P4NB 5F8RC 3WL9A 1JV5B 5IMLA 3S35X 1YYMH 2HT3C 1AQKL 4CNIB 3GIVA 4F58H 4U33A 2Q3ZA 3NIFE 5EZOH 1B88A 1SJHA 4OZIE 4Z18A 3NIDF 2V7HA 3PGCB 3ULSA 1R3JB 4TSBH 3REVA 4KRPD 1JIBA 5K33A 5AD0A 5IW6B 3MLWL 4RBPK 2HLFC 1U3ZA 3VGAC 4MAUL 4HGMA 4Z7WF 2G9HA 3VXSD 2C3VB 1QFWL 4MB3A 1Q94B 1ZA3B 4QRQA 2Q20A 5IV2B 1N2RB 2EEBA 2BVPA 4H20H 1A0QL 1S9YB 3NZHH 4UILL 3GSXA 4M61B 2C1OB 1W0VA 3OJMB 1IKNA 3T2PA 2XWJB 5I71C 3KLHD 2VABB 1RK1B 2K9UA 3SOBL 3C6LA 1F4WH 2JF1A 1FPTH 2CKNA 4I3GA 3ECBA 4ZUVB 1CL7H 1P4BL 4HBCL 1BFSA 2IANE 4U4BA 3IU3B 5IW1A 3IB4A 2E9IA 1TIUA 5GGQL 1MCPH 1U3YA 3W0WE 5FO7B 3VXME 4HHAA 2WQRA 4PJHA 4PV8A 1II4E 3DYOA 3VFOA 1PX3A 2GJZA 2GJJA 4LSSH 4X99B 3QFJE 1KTKE 5JXAL 1HQ4A 4WFHE 1YQVL 5FYKD 3VMNA 2QQLL 1RZFH 3MRJA 5IB5A 4P2RD 4MX7B 1K2DB 2XPGB 1ZLVK 4J3UA 5JXEA 1F02I 3SDDC 5C0AE 4W4OC 4APQA 4F80A 3KPTA 4R26H 3UTPD 1LE5A 4LPYA 3SQBA 1AD0A 1HHGB 1LK2B 3STBA 2WW8A 4M1GL 3WYRA 3PWPA 4PJCF 4E41E 5DEZA 1FZJB 1ZANL 5DK2B 4LSDA 1S7WA 3L3OA 4QGYA 5FYLE 2KH2B 3B5GA 1RZ7H 5I18L 1YY9D 1N59B 1RZ8A 4NSKA 5D7IA 5ITFA 2DWEA 4JN1L 1TZGH 1NCWL 3O6FA 3VWKC 3KLAA 3TESA 2BSTB 4TVPL 5FYJH 2G2RA 4FQXB 4KTDH 4NQCB 4TQEH 2R2EA 1EJOH 3CPLA 3O2WH 1OGAD 3PNWA 5E4IA 2HFFA 3OKMA 3A6OA 1KEML 5DJCB 3J7HA 3GI8H 7FABL 3WEXA 3MJ9A 2HT4D 3DNKA 3JTTB 3GSVA 4AQOA 3TPKA 3LZFL 1DE4B 1E6JL 3FT4B 4M7ZC 1WIPA 2DOCA 2DM2A 1HZHH 4OGYH 3VXQB 5FDWA 5ISZD 1LP9A 1OL0A 3JVGA 3VD4A 2G5BB 4M5ZL 3CZFB 4PLOB 1H8OA 1QQDA 2VXQL 3GJFH 4GAJL 4OBRA 4YDVA 3X13A 2FJGB 1FYTA 1DBBH 4PYHA 1ORQB 1JPST 3DV6A 4IRSD 3D18A 1ZLUK 4HDIB 5C0ND 4Q9QH 2PXYA 1F4HA 1B4JL 1FLRL 1MJ8H 3I6KA 4AIZB 1C5BH 2C7UA 1NGZB 4MJIE 4MMZC 1Z3GL 1J5OH 2APVA 3QI9C 5TE6L 1YN6B 3V0AC 4XRCA 4D3CL 1UQSB 3BDXA 4HWBH 3G08A 4XCCH 1T22A 4EDXB 2EIZB 5H8DA 1Y6NR 4MLIA 4M93B 4GG8A 4XZUB 1KIQA 4KU1A 2WV3A 2HTKD 4NRXB 1HHIA 2XTJB 4CW1A 5GS0C 5HHPB 4EEEA 4KV5E 3O2DH 1HWHB 3QR2A 4NDMB 4OUUA 1G7IB 5T1KB 1MJJB 4U49A 3UZEA 4Q58C 1UA6L 3BE1L 3D2UA 1KN2H 1PYWA 2I07A 3G6DH 4NN7B 1D6VH 3IFPA 3HG1D 2ESVD 3C5ZB 1YMMD 1KT2A 3I50H 4Y16D 4FHBD 3UO1H 4ENED 2ZJSH 3RHWF 1OAUL 2IPTH 3H9SE 4UU9B 3QUKB 2NY0C 4HUUB 4ZUTA 2NX5B 3ZKSD 2PR4H 5KW9L 3WDIA 3QUML 3ZTNH 5EUOB 1JWMB 5IFAL 5I1LA 1KCSL 2NY3B 1WFUA 3P9LB 1N6UA 4P2OA 3HZYB 1XGYL 3QO1A 1SMOA 4WWKB 4LLQA 3ULVH 2IGFH 1HSAB 1AY1H 5EWIL 1A2YA 5IVOA 5CZVH 3HC0B 3FN0L 4K3DL 4LSTL 1CQKA 4OZHB 4QRRE 1EO5A 4HWNA 3V0WH 3VRLE 4JFYA 4YO0A 4MDJA 3L5WA 4ZXBB 4AEEA 4NYLB 2DQUH 3V6OE 2G75B 1N4XH 3GMQB 4MA3A 3QUZA 3VI4E 3VWJA 1XF5A 4HX1B 3GHEH 3IFNH 1G7JA 1F00I 3U0PB 4U1MA 2NPLX 4XAKE 3LKSA 3G6AB 3ZL4H 2VKXA 3Q5TA 4Z76B 1FORH 3DURA 3SBWA 4P5KB 4H8WH 3UDWA 2IMNA 2P43B 4OLWL 3KG5A 4XPBL 5CHNA 3GHBL 4Z95L 3B2VH 4LCCB 1CG9B 1KCLA 4IDJL 2Z8WC 4Q74A 3MRQB 1RVFH 5HI3C 2UZIH 1C8PA 4DQOH 4JR9L 4NKIL 1GAFH 2R29L 3VH8B 4M7JH 1GSMA 1X4YA 2DMCA 4H26B 4IOFD 3B5HA 3ORJA 2IADA 5JQHC 1YEDA 5I9QC 1S7RB 2VAAA 3ABZA 1DQJB 3L3DA 4XP9L 3D39E 3R8BB 4NZJA 5HXMA 3SCMB 2P5EB 1K4DA 4X7SL 5HHOB 3HRZB 5F7DB 5I0ZA 1OTTC 2FNBA 1U2CA 3GGWA 1EZVY 4PG9A 3O6ML 4NUJA 3JXAA 3A6CH 4LLDB 4OF8A 1C5DA 1KPRB 2EDFA 1IBGL 2W07A 4GAFB 4HG4J 1ZXQA 1NC2A 1RHHB 4R8WL 3EYUH 2NW3A 3BEVB 2YK1H 2BMKA 3QQ4B 4J7RA 5EOQH 1OAQH 4KUCD 3L6FA 3F58L 1OLZA 2EZ0C 5HI5D 2VLMD 4M62L 3RU8H 2ILLA 4O2CB 5DHVA 1KBGL 1CK0L 4EVNB 5C7XH 3BT2H 5EH1A 2Y07H 4NCC2 4HGKC 2VMFA 3X11A 3QXDA 2NMSA 2R0LL 4HGWB 3UJIH 4RFOL 3TBSA 3LEVH 4JFDA 3T1FA 3H7LA 4RIRB 1GPOL 1WZ1L 2EECA 2A6IA 1GC1C 2E7HA 5IMOA 5B8CA 4LPVA 5I8CB 3GBLA 5EZIH 3EYQC 4CVZA 4FQ2H 1UXWA 2A83A 2ARJQ 3DX8B 4XNMA 1EHNA 3C09B 3WIHL 4GW5A 4XX1E 4ZS7L 3WKML 4LBEB 2BOCA 5DTFB 1LO0H 4NBYB 4BFIB 4XXCA 2CLVB 1EMTL 1WFNA 4PY8I 5DO2C 4AIOA 4FQJH 3QEGH 5K9OA 2DQCH 4OJFL 3UTTE 1I7TB 3ARWA 3HPLA 1DFBL 5EN2A 1A4KA 2I5YH 3IDXH 1DQML 3IU4H 4AL8L 3MRHA 5HGHA 3V7MA 1FO0A 1XR9B 1KNOB 3LKRB 4PS4L 5DRNB 4L4VB 1D9KB 2V9RA 2HJKA 4BZ2L 5HHQB 1AGCA 2ZCKH 4ZSOE 1OTUD 5E2UH 4PRHA 1U2HA 4PGJA 4OI9A 1NUGA 3F62A 1P4IH 1D5MA 3QAZB 4QRPA 5F9OL 2ZUWA 1KIPB 1F42A 1CLYL 3VFGH 1ETZA 5D71H 5EU6A 3SGJC 2R1YB 3ULUL 5DI8A 4PTUB 1BQLL 1CFBA 4UINH 4NKMA 4TRPH 3FB6B 4JY5H 4DN4L 5JHDD 2QR0A 2C26A 2OJZL 5DSCA 3RWFA 1VERA 5E94B 2OL3A 3CFJA 5LAXA 4PUBH 5ICZA 1DCLA 1J10A 1CXKA 5F1IA 5TFSL 4AG4L 1QLRA 3C2AL 1JN6B 3CXHJ 2MQ0A 4LPUA 3P4LA 1JZ7A 4NKOA 4TNWF 3VMOA 4Y5XB 1H9VA 1AJ7L 2P1YA 1JBJA 4HXAL 4DFIA 1FFPB 4UB0H 2E7MA 4Z7UE 3OV6A 1RURH 2JCCE 4W70A 1WCQA 3EYVA 5D4QA 1OP3H 1NMAL 2OMNA 4JFFB 1GGTA 3ARBA 4MNHB 3B3IA 1CXIA 4MYWB 3V5HA 4Z77B 3V52L 5MEOA 5I8OL 3BKYL 3PXJA 1X5ZA 2AGJH 3NGBC 4YFLI 3WJJC 4LSRL 4YDKH 4PTTB 4KDTA 3TPUB 4PJ8C 3Q0HA 3U4AA 5E00B 2NCMA 1EZVX 4U0RB 4OLZH 3MV01 3VDCA 1UYWH 3BISA 3JWDC 5D1QD 1I7RA 1MCRA 1HXMA 2HT2D 3GMLA 5CJXA 3AS3A 3IDNA 3T0EA 4PB0H 1AD9A 4MJIB 4Z7WB 1RUQL 3HI1B 3QRGH 1Q9OB 1FL3A 1MFEH 1MI5A 2CIIB 4EBQH 1QSFE 2R56H 3CX2A 4F9LC 1NCAL 2L0DA 3DRQB 1Q9WB 2XRAH 4FFYL 4XNXH 4P9HH 1I7ZA 5L8JB 2W9DH 2DLTA 3KPQB 1RZKL 3DRTA 1A9BA 1PY9A 3ZO0A 5E2TL 3TNMA 3EIFA 4DGIL 4HQQH 4I18B 5KVEL 5EO0A 3SE9L 3CC5A 3ZE2E 3BYYA 4MJ2A 4UNTA 3SJVB 4CRPA 1PG7H 4WUUB 3PWJA 2GSGB 4UT9L 1NUDA 4DOHE 4BM7A 3RUGF 1PZUB 4JDZB 1QOKA 1YNTA 4JZOB 2VLLB 3N1GC 3BDYL 1QD0A 2AK4A 2LE9A 3OXSB 3PDOA 4I9WD 5JR1L 5E6YA 4JPWL 3AGVA 4RA0C 4G80A 5HDBF 5EUKA 1HCFX 1IT9L 1EUUA 3H9HB 2HG5A 3MRLB 4HH8A 5DS8B 2EYSA 3ARGC 3BRDA 2PKDA 4FQHB 1AFVL 2DQEH 5IK3B 1F97A 3L3HB 4C54A 5I1IL 4GRWE 5IWLA 3SDAC 1NDMA 2Q86B 1RD6A 3ZYOA 3S4SA 2XN9B 2ADGB 1A6AB 4PJCB 4MD4A 3DYMA 3PWNA 5FYKU 5I1CL 5FOBA 4UT6L 1PFCA 5DHVH 3WLWC 1KPUB 1RZJL 4P2QB 5C08B 5E2WL 4NWUL 5CP3A 1MCHA 3HAEB 4H0GA 4JM2F 5C0IA 1INEL 1K85A 4JZJC 1D7FA 3T8XB 3X3FL 4FQPA 1MWAL 3TWCH 3WFBL 3MGOB 5B38B 3PL6A 1AE6L 4YXKL 1CICC 3QXAB 4RFNB 1QG3A 3OR7B 1QLFA 3KHQA 1S5HB 1T7YA 1AC0A 3SGKA 3FQTB 4PJEA 1ZE3C 1U3HA 3CMOH 3QH3B 5DJYA 4HMCA 3TT3L 4JPIB 3O4LA 5C07B 5SX5H 2GAZA 5EZJA 2VLRA 3RIFK 3ZMRA 3QCVL 1DR9A 2VR4A 1RZIB 5AZ2H 4O00A 3LKNB 1FVDB 4N90D 2YD3A 3V5DA 1QNZH 4D9LL 2ITCA 4PLNC 5HYJB 5J6HB 1B6UA 4J3VA 4CVXB 1M4KA 1RMFL 2J88L 3PQYE 4NBZB 4JGUA 1J0ZA 2H8PA 3MBEB 3A6BL 4IRSC 5B39B 3QFDA 4F3FB 2G5RA 1U6AH 5EU5B 3DUUB 1FO0H 1H15B 4WUKL 4DKFH 3CFKA 4DEPB 1WAAE 1FNAA 1K5NB 1OAYH 3AROA 3VD3A 2J8OA 4WV1B 2JE8A 5K9QG 5HI4D 5E5MA 1ZT4A 1ORSB 1EH9A 3STLA 5C86A 5F1SA 2VDOL 3H3BC 4UV4L 1T1WB 4U6VL 3HNTL 3ILQD 1XGRB 2JJWA 1WCBB 1DEEB 2B2XL 4FP8L 3BVNB 1GZQB 4NQEB 1DUZB 2EKJA 1NC4D 1OGTA 1EPFA 2HTKC 1H3XA 4XBEH 1A6ZB 4KQ4L 1K8IB 2X89A 5IBTH 3S3JA 3UPAA 2OL3H 4AT6A 3QCUH 3PWUA 1OAKH 4JHWL 4KRLB 2VXVH 1JNNL 2FSEA 3FRPG 5DJAB 5C0EA 1N5YL 4TTDC 3MLYL 4OBSA 3T2NH 3FN3A 2F9BT 5ACZB 3UZQA 4FRWA 4HPYH 1P4LB 2ENSA 4J1UA 3VGFA 4FQ1L 4LKCB 4ENEC 3PDDA 5F9JB 1TVDA 4YEEA 1E28B 3ESUF 1IAII 4AZ8A 1Q1JH 5D7JB 3SQOL 5CGMA 3H3PL 4JREB 4ZTOH 1AXIB 4F7MB 5AYUH 4F7EB 1DBKL 2YPLE 3H2WA 1QLEH 5EU3A 2QJDA 3WHXA 3OAZK 3NFSL 5FGBC 2Q76A 4CN1A 5HDBE 4U1SA 1IAKB 2BY3A 3UX9B 3TBTA 1RJCA 5C8JA 4ZUSB 5GGRA 2UVFA 3BKJH 2D0GA 5D9SA 4ELMF 3O8XD 5ILTL 4PJ9C 3UMTA 2R8SL 4NO0A 4P46B 1Q72L 3E3QC 4XP1H 4O02L 4W81A 5EBLA 1YJDH 2YEZA 3MACL 4A2MA 5KS9A 3MNZA 1CGUA 4HZLB 3OR6B 2F5BL 1EERB 2NY6B 1G7MA 2Z91A 3CLFL 3FO2B 1NLDH 4WI5A 2R9HD 1XCQA 1ZKAA 1BVKB 2V17L 4O58H 2LV4A 5L2KA 4HK0A 1XF3B 4EUPB 1U8LB 5I30L 2J12B 1DUYA 1L9MA 1QSED 5I73B 1NCTA 1U9KA 3HZMA 1L7TL 4PD4J 3QNXB 4K3GA 5FF6A 4GRLB 2IQAB 4K8RD 3ARFB 4OCMC 5CUSL 2ERJB 5TDPB 1DBMH 1GGCL 2XY1A 3KYMA 2V5MA 3EYSH 4M6OL 3O6KH 3PV7A 2FJHA 4U3HA 3DVNA 5GGUA 2EYRB 5C0CD 3BP7B 3KPSD 1A7PH 1BVLB 2BCKB 2I9TA 3FCTA 2HVJB 3FOMA 3KPRB 3U0TB 1NAML 4U6HA 5T3XD 3C6SA 4XBGB 2KPNA 4J23A 5TH2B 1R3KB 3BWAB 1J8HA 2VLJD 3MXVH 3SE4C 4JY4A 4EI6A 1LWRA 5SV3A 3MV9A 4WU5A 2WWKT 1DZBA 3KPNA 4R90L 3CVIL 3TN0C 2GUOA 4GFTB 5HYFA 4MNGA 4RGOH 1K8DA 3N1QC 1AXSA 4ALAL 3FHQA 3BX7C 3KDMB 4KPHL 3D85A 3FO0L 2HJLB 3GDBA 5HI5C 1SEQH 3F5WB 4OZGE 4G6KH 3OF6D 4R0LA 3OAYH 4MXWH 4NZUL 2LQRA 3P4NA 5I1DB 1JV5A 2BJML 1VFMA 2UUDH 3KYKL 4O9HH 2P8PB 3GMRB 3ULVC 1EEYA 4ZFFB 5C2UB 4CNIA 3UEZA 3U4BH 2PTVA 1SBSL 1W8NA 3U4EB 3I02B 5AZEH 1MCQA 2MKLC 3PGCA 1X5YA 5FHAL 3EGSB 4KKBD 3HI6L 3L5JA 5FM4A 3P40A 4NWTH 4JO4L 1E6OL 5CP3H 2ADIB 2P46B 2CXGA 3PGFH 3C87A 4G7YH 4P59L 2XG4A 1Q94A 4WEMB 1ZA3A 4BZ1H 2FATH 5IV2A 3GIZH 1N2RA 3ZDXE 2MNUA 4MWFB 1S9YA 1DLHA 3NH7L 4PJFF 3FQUB 4M61A 3TO4B 2C1OA 1MJUL 3IFLL 4UIKL 2XWJA 4YHYC 2VABA 3BGFB 1IKNC 2VITB 3QRFM 3U7WH 1CTOA 4NQDE 1RK1A 2Z31B 4PRIA 1WK0A 4U1HA 1TQBB 1URLA 2WIMA 1TQCC 3A0OA 1YEJL 4OIIH 5D2LF 3C6LC 4UDTB 3QUXB 5JHLH 3P0YL 2JELL 3IU3A 3GI9L 3NCFB 2R4SL 1IGMH 2VYRE 4RRPG 3MRDB 3OKNB 3VCLB 5CLWA 4OD2B 1LD9B 4HMDA 5FO7A 3L95A 2DI8A 3BZFB 4PRPE 4X4YB 4RAVB 4V1DB 4TVSa 5HHVL 2CDGB 4X99A 3PV6B 1H3VA 1IZKA 4RMTA 4MX7A 3BQUB 1BGXH 1K2DA 5J9PB 2YKLL 4KFZC 1HI6B 4QLRA 1AXTH 1OP5H 4BH7B 3MLZH 2EKSB 1MCCA 1HHGA 4PJBF 4APQC 1BAFL 5M94B 4RWYL 4CMHC 5C0DA 4LQFH 3CU7A 5C6PB 2VR9A 3QHFH 3EFDL 2RIKA 2WWMD 2OSLB 4K3JL 2Y5TB 3LAFA 4IIQB 3U83A 1KCRL 1G0XA 2XT1B 3CSYB 1WF5A 1F5WA 3UBXB 5ADOL 4WFEE 4JG0H 3TH3T 4FQXA 4NQCA 4DKEH 5CIPH 3WKNA 3T0DA 3CMGA 4HWEL 1AGFB 5DJCA 3WXVH 3FONB 4HUWB 1YDPB 4XPAH 1A1OA 4EQ2A 3QIUD 1R5WB 5I75B 4CU7A 1QR4A 4PRNB 3FT4A 3T08A 1AO7D 5TF1L 3OWEA 1T2JA 4MJ4A 4TVPE 3RVXD 5F7EH 4MXVF 5JW4Q 4KHXH 2G5BA 3DXAE 4XXDB 5HHNB 4POUB 2X4QB 3TFKD 3TT1L 2AJYL 3JVGC 3DHJA 2FJGA 5C9KA 3QDJE 2NY5L 2WLYA 4YK4C 3HN3A 1ORQA 4JDTH 5EC1B 2WWKO 4KMTH 4TSCH 1WLHA 4LEXH 4HDIA 4OLVL 4QRUB 5JOFB 2EH8L 3K3QA 5JPNB 2DICA 2VLKD 2MHAB 2R69L 4AIZA 2HFGH 3WFCH 4M6NH 5DJ6B 1LE9B 1YN6A 1IL1A 1IM3B 1CDIA 1JTTA 3O3EA 3U1SL 4LCUB 5CGYD 1JGLH 4EDXA 1HE7A 4L1HA 5SWSE 1MFCL 2YD2A 4R3SA 2BOBB 3CSBA 4F7TB 5EBMB 2BFVL 3RUGB 1RFDH 4MDIB 2UWEF 4I0PA 4Y8AA 3RFZC 2R2HB 1NCDH 2HKHH 2EDDA 1RJYB 4NRXA 4B7IA 1IFHH 3LH2H 2CGRH 2MOVA 3QPXH 2J1KA 4NDMA 4X6FB 3RNQB 1G7IA 5T1KA 1MJJA 3QEQD 2DTSA 1UGNA 4ZDHB 4HIHB 4QCIB 5D2LE 3HCVB 3ME0A 3PP3K 1B90A 3N85H 4JO1L 3DVIA 1AR1D 2IFFL 4NQXB 4M6AA 1J0KA 3CXDH 4M8QB 3TBWB 5BZWA 4C56A 2X1XR 4UU9A 1MAMH 1LO2L 3QUKA 4HUUA 5JW3L 4P4KD 1E4XL 2NX5A 3VGAB 1IC7H 1UVQA 4LGSB 3JBG7 4OCNC 1JWMA 5DYOB 3KYOB 1FIGL 3BHBB 3P9LA 1OM3L 5D8JH 3HZYA 1RU9H 1IILE 1NFDF 5KJRL 4WWKA 5E9DE 4LHUD 1FDLH 4TUKH 1HSAA 4P2OC 5H2BB 3L7FB 3TZVB 3HC0A 1ERNA 5AAMA 4OZHA 4LMQI 4M7LH 4RGNB 5T33L 4FFZH 1GJIA 4ZXBA 4NYLA 4X7CC 1KIRB 3S36H 4JM2B 3RDTA 3HC4L 4HUVB 1JVKA 2G75A 3KPMB 3GMQA 3VFWB 5MEQB 2H3NA 5C0BB 4HX1A 4IOSD 1H0DB 4K7PY 4DJMA 4NZRH 1J05B 3QUZC 4XPTL 3VWJC 3U0PA 1TZHB 4OCSL 5IB3B 4DGYL 1ODAA 4X9HA 1P2CB 4P9HC 3QNZB 3VD9A 4Z76A 1I9IH 3HZVB 3ARYA 5HHMD 2JK5B 4FQIL 3SBWC 4LCCA 3UDWC 1BEYL 1RIUH 4QHKI 5DFTA 2X09A 3MRQA 4Z7VF 1H3GA 2LVCA 3GMOB 5HHXH 5GSVA 5T3XL 3JWOL 4HPOL 2NLJB 2YBRB 3VH8A 5DJ0B 1ZEAH 5LGJA 1ZGLM 2XWTB 2Q6WB 3WDJA 5LXGL 4QOKB 5HI4C 1AC6A 3X3GH 1S7RA 4U6YB 1DQJA 3QDGB 1JZ4A 4JFOB 1L6XA 4U7SA 3NACL 3QBTB 1UXSB