4TUJB

Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody against neuroblastoma ass
total genus 56
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB01
1LO5B 3VRLF 3KLSA 3VGDA 5I75B 1BZ9A 1J1OL 1F6FB 3EOYG 2H3NA 2OTWB 2VZTA 3G5YB 1QA9B 2PW2B 1PX4A 1CFSA 1YNTA 3CSBA 3HR5A 1UFUA 4ZMAT 3N06B 5LQBH 2H6PA 4HIJA 3TVMC 1HK6A 3D0VA 1I8LA 4HBCL 1W0WA 4OCLC 2O5ZL 3E2HC 4L5FH 2GY7B 3N1MC 1ZSDA 4UV4L 4FG6C 3QA3B 3OXSB 4HIXH 3U30B 1A5FH 2OQJA 4QRRD 4X5XA 2NY1B 1MF2H 4DW2L 1T1YB 4LLVB 5C6TH 4CADA 5KBNC 3L5XL 3CFBA 1YYML 5DFVC 4JFFA 5I16A 4GKOA 2LE9A 1WBXB 2CUMA 4N0CD 4EZMA 4YGVB 1RFDH 4KV5E 1NMBH 1QZ1A 3LAFA 1CXIA 3P73B 4UUJB 3DVFA 1I3VA 5EC1B 5HD8D 4ERSL 4JZOA 3LMJL 1E27B 4R7NB 1N5AB 4NWTL 1A2YB 2XTLA 4RMUA 1KENH 2YMXH 5C0EB 2KQMA 5TFSH 2DMBA 3RWJB 1PYWA 4HWNA 5DC0A 5IK3B 9CGTA 2CJUH 2P1YA 3EYFB 5H35A 4HT1H 4P5TA 4PJXA 1J18A 3UTOA 4M3KB 3FOMA 1V8HA 2YWZA 4LEOB 2QJDA 1BFSA 3DMMC 3QAZC 1S9XA 4XAWH 4G43B 3ARBC 4N0UE 3O4LD 5KVEH 3DMMA 2G5BB 1HDMB 2JB6A 4JQVA 3WKML 1WUNT 4L3EA 3NIGF 3PHOB 4KDVA 1SBSH 2LQRA 1I8MA 4JFEA 2CK0H 3MA7A 3QWRA 3ZYJA 2VDKH 3PWPE 3NCEB 4I48A 3ARDD 5I30H 3WLBA 3FO9B 4LSRL 1DQLL 2BC4B 2FZ3B 2VLKD 5EPMB 5JW5A 1D9KD 1T66C 1MCWM 5DMKA 4BSWA 1YNLH 2Z35A 2YKLH 5DJ2A 1ZV5A 5ADPL 2Z35B 2XRAH 4CVUA 1OB1B 3GSWB 2PW1A 1RZIB 3T3PE 1TPXC 5A1AA 1F4XH 5ID0B 4HUVB 3R0MA 4N8VB 4B7LA 5BS0D 3OF6D 4WU5A 2VDML 1K6QH 1O7SA 2FJFB 3L7EB 3RAJH 1G84A 1I8IB 4ZDHA 3X11A 1FAIL 4NQCA 4QXUH 1ZLUK 3SKJH 4V1DD 3PNWA 4U1NB 5F3HA 5C6WH 4LRIA 3GUTA 3KS0H 1DN0A 3LQMA 3AY4A 4XI5D 4LKCA 4PD4K 1NMCC 5IJVB 2WUCL 1QTYT 2CRIA 3NZ8B 4X5LA 1DUYB 4K8RC 4PP2B 3TPUB 4ZUUA 4G7YL 3VFRA 3MBEC 1NGWB 1QFOA 5J6HA 1BFOA 5IK3A 4XC3L 3H9ZA 1AXTH 3LEYL 5DSCA 4YHLH 4KRPB 1S7SA 2YN5A 4Y1AB 5IBTL 3IFPB 1P4BL 3WNKA 5B39B 3CVHL 4M4PA 5I19H 4XBPA 2BK8A 4WFED 3MRCA 3CDGA 4YPGA 3QO1B 4KY1L 3R1GH 1SMAA 1BFVH 1DFBL 5CD5C 5HI4D 1G9NH 1WBXA 1DJSA 3OPZH 1KN2L 3EDKA 4QRRA 1CGYA 1VEOA 2CIIA 4K3GA 2ARJA 2VB5A 1Z3GL 5JOFB 2MCPH 4IEFB 2E6PA 4HLZG 4G9FD 2WUBL 3CCHA 1IC5L 1RUMH 4R0LA 4KJQD 2JE8A 1T4KB 3B9EA 3CLFH 1EFXB 5BS0B 3UPRA 5DUPH 1IKNA 1MJ7H 1VERA 4GRLD 3QNXA 2VQUA 3UC0H 3C6LC 1KB9K 5MERB 3GIZL 3NCFB 4X99B 2FL5A 4ELMF 4TTDC 3LB6C 4Y5YC 4W6YB 5B21A 1DTUA 1OP5H 5CILH 5GHWL 1WV7T 1FPTH 1J88A 1XCTB 1UKTA 4MNGB 1EA9C 4M00A 2VYRE 1MY5A 3MCKB 1PKQA 4PJHA 1MWAL 1CWVA 3CH8A 4YO0A 5HJ3B 5JW4N 1IGFL 2K1MA 4HH9B 3GGWA 4IMLB 1IFHH 3MV7B 2A9ML 3CCHB 3H6JA 1IMHC 3TH3T 5EU3B 1PJ9A 2BXZA 3LHPL 5FCUL 1XR8B 2EO1A 3DYOA 5IM7A 3MLSL 4JAMB 4HXAH 3MCLH 4HXBH 4BK4A 1NLDH 5IOPA 1BVKA 1LO5A 1J10A 1NL0H 3Q3GB 4XXDA 2P45B 3ESVF 2BNUB 1UVQB 4LLQA 4WJ5B 3MRCB 1HOCB 4YPGB 1CL7L 5EUKA 2CR3A 1GOHA 2CLRA 4MNQB 1JMXA 4BYHA 2I26N 4YBLB 4RQQB 4ZFZB 1OAKH 2G60L 4JG1L 3QXAA 1T1ZA 1EEZB 1V7ML 4P46A 1VA9A 3LKRA 4YK4B 5LG1A 3SO5A 5C0NC 4KKBC 5TE6H 4POUB 1WICA 3IF1B 2VITA 1YUHB 2VC2H 4APQA 4AEEA 2UZYB 4PJDF 4RFNC 5DQJA 1WWWX 4XVUC 3Q5TA 5E2TH 8FABA 2VE6B 3QWOA 1LVEA 4Q0XH 3W82A 4HWEH 5F7UA 4P9HL 4X6CA 4FQPA 1MUJA 3RVXD 3W11C 2WM0A 3NIFE 1W8OA 1JTOA 1FAIH 3MOBL 5CBEA 1TVBB 4Y2DD 2YPLE 1F6LL 2P5ED 3G5ZB 4V1DE 4FFYH 2P49B 5E08H 2XZCL 4LSUL 5E8EA 5AYUH 5FM5M 5FK9A 3QUMB 4TULH 5KS9A 2BNQD 3QYCA 4NYLA 4XAKD 4OLYH 5CJQL 3W2DL 1UG9A 4KHXL 4ODBD 4ZPVA 4E41D 4I5BA 4YH6A 1LO2L 4RX4D 2XNAA 3FO0L 3KPQB 3PDDA 4FQ2H 3LEYH 4WUKH 1SEBA 2I9LB 3V4PL 5KW9L 4Z7NE 3L7FB 1J8HD 2B0SH 1YEKL 2AI0H 3V6OA 5DUMH 1FO0H 3VXSB 4EJ1C 4GW4A 2MPAL 2BOCA 2RIKA 2W91A 1YPZE 3LN4A 2NZIA 5EOTA 4PJXB 1M05A 1V05A 4IOIA 3VXUA 4M8QA 4E41B 3QUYB 3I02B 3BEVA 2VKWA 5C0BD 2FJHA 1FBIH 1CE1H 1LO0H 1RURH 2DWDB 2YUXA 3FHAA 4KKAC 4U0RB 2V17L 3CFCL 3WIHH 3QRFM 3EJZD 1BQUA 3RVTC 5M94B 1DBKL 1NAKH 1RJYA 4GW4B 4DGVL 4J23A 3HKFA 5L2KE 3MOQA 3BP5A 4JFQA 4IRZH 1G9MH 1KEMH 5F6HJ 5IFAH 4KK8C 2V2TA 4JLRB 1TTFA 2HFFA 4LOUC 1DE4B 4RGNE 3MNZA 4AIZA 1U8IB 3LPGA 2YRPA 4Q7DA 4YR6B 3VXOA 2R0LH 4P4KD 1EXUB 3TA3D 5SWQA 4CMMB 3P9MB 1TNMA 1UM5L 5F1SA 3TIEA 1FVDB 4IRJA 5F7EH 1I7TB 5D6DC 2UY6A 5DUPL 2I5YL 1AR2A 3BVNA 4LGPB 2FL5B 4WTWA 5EZJA 4NN7C 4R2GD 3ORJA 2XA8L 4Z7WF 2FD6L 4Z7WA 3WL9B 2IC2A 3HTLX 2PYFA 3U9PL 2JLLA 4KK6D 3S3SA 5AYQA 4AEIH 1D5ZA 1FFRA 1MJ8L 3FT4B 3BGMA 3PV6B 4OZGE 3ARSA 3IFOB 3NFSH 4JPIA 2PCPB 4NRXA 3D3VE 4HS3B 5L2KA 4CVXA 4O2FA 2H32H 4NZRL 4WIQA 4PBVC 3EGSA 3RL2A 5HHNA 3BRFA 1MFAL 1UB6B 1UM4H 4KQ3H 5I1CH 3TO4D 1NCBL 5B8CC 1EUUA 1BHGA 1U8JA 5DRZB 4R8WH 4HXAL 1UZ6E 5EUOE 3OAZK 4OCWH 1VGKA 1IBGL 1KTRL 2IH3A 4PPTA 5E00B 3H3PH 5E9DA 5FM5O 3VMNA 3A67H 4LSSH 2ENYA 5DZOA 4MJIE 3P4OB 4LMQI 1KLFA 4R26L 5I1GL 5HHPB 1SYVA 3GJFA 4V1DB 4UDTB 5CSZB 4M3JA 5E95B 4KKCC 3DX7A 2WQRA 4G6KH 5BVJB 1QFWI 2AEPH 1I1YB 4J1UB 2WIIB 1K8DA 4I4WA 1OP3H 5LGJA 1I8IA 5E08L 4MX7A 3BW9A 2APFA 3OJVC 3TFKC 2VLJA 1Z0NA 4N8CL 4PRIB 1CN4A 4LF3B 4Z5RB 4BKLB 5BRZE 5FUZL 2FO1A 4P9HH 3QCTH 1W72L 4JO3H 4NNYB 1JGDB 3P4MB 3IDMA 4LPYA 4LARH 1TZHB 2AEQL 1U3ZA 3GBNH 1MCPL 5I1LB 1YMHA 4QRUA 4LFHD 4K7FA 1D5IL 4FQ1H 3S37L 1CGXA 1GGBL 1KBGL 4UU9A 5EO0A 3GMRA 3MBXH 5IWLA 4KHXH 4FQJH 2Z8RA 4P4KB 5EZLA 1FG9C 1NSNH 5GRXG 2E7LA 3ARED 1K85A 5ITBH 3FRPA 1RJLB 3H9HB 4NWUH 5I9QC 2X4TB 4KVCH 3E6FA 5ITFB 4HJGB 4XP6L 4IRSA 4XCFL 4IRSB 4M1CD 3TO4A 2V9RA 3WFEH 6FABL 1ADQH 3GZKA 4YWGH 3FMGH 1AGCB 4KRPC 4QTIH 1QFWH 2Y7QA 2HJFA 2HTLC 5DJ8A 3O8XA 1FCGA 1J0JA 2ERJB 3GSXA 3T0ED 4C55A 3IGAA 4MA8L 4I0PA 1JIBA 4QHKJ 4YE4L 4KK9D 3BKMH 3O0RL 4LL9A 2LVCA 2Z31D 4ISVB 1XF1A 3M45A 3FO2A 5F9WB 5FM4A 3T2PA 4LAJH 4ZDHB 2J5LC 1G7PB 5D1QB 3RZCB 3BEWA 1XF4A 2QSCH 1MI5D 3LZFL 4ZQKB 4Q74A 4NSKB 3UO1H 2R1WB 3ARGD 4MDJA 4Q97A 5E5MA 2B20A 1OAYH 3O3BB 4GAYB 4U3CA 3V8CA 3GSQB 3LRSA 3ULSB 4WI3A 4XNUL 3HZVA 4KV5F 4QT5A 4EUPG 4PJEE 4LLUB 2A0LC 4N90D 2BVEA 5EPMA 3BISA 3PWVB 3AVEA 4D3CH 2X7LB 2MJWA 3L3OB 3TA3A 3RNKA 2B4CC 5CEYA 3CFDB 2DL9A 4PRPA 5GSRA 5DDHA 5IVNA 1HWGB 2BVOA 4FQIL 4JQIH 5FGSA 5C0CE 3GRWH 1JNJA 4XVSL 3TBYB 2IGFH 3U0PB 4K9EC 3QRGL 4X7SL 3RTQD 1CDCA 3NTCL 5HHMD 1Q9KB 5FFLA 2YPVL 5AWNH 1WCQA 2MTPA 1CD8A 1ED3B 1LK3L 5M7QA 4XVJH 5LKNA 2NXZC 2IH1B 4H0IA 5GJTH 2CH8A 2VDPL 5CCKL 2B4CL 4XMLL 4S1SL 2NW2A 4GRMA 5I1JL 5KVGH 4M9OA 2DTMH 4QRQB 1INEL 4GAGH 4FTVD 3DURA 4XNQA 5KVMC 3DV4B 2VLME 5BZWB 4U2ZA 4PRHE 4YPJA 3D2UA 1IAKB 1KB9J 3V0WL 4XXDB 2IBZX 4XPFL 4APQD 1GOFA 2IAMC 3KWWA 3B5HA 4MD5B 5E1AA 4HJJH 4OZHA 4ONGH 2R1YA 1H5BA 4MA3B 4EXPX 4NC1E 1U41A 2W65A 1JPGA 2ZUXA 4OUUB 3SO3B 1YY9D 1JF1A 8CGTA 3SY0B 4ELKB 4JPIB 5IB2A 4HKBA 1EHLL 1FRGH 3WJLA 2YD7A 4K7FB 3SDDD 5F7NC 1N7ML 1SYSA 3T09A 4DGYH 4RBPK 4O51B 4X98A 5DYOB 2FB4L 5C08D 5CZVH 4KQ4L 4MS8D 4P4RB 4RMVA 3NBNA 3S37X 1RK0A 4U1HB 3RJQB 4NJAL 4K23L 5EBWA 4JFEE 5IMOA 3GFUA 4ZFOL 2NX5A 4XCCH 4JO1H 5E4EB 4NO5B 2V7NA 1FFNA 2J8OA 2JB5L 2A73B 2ZJSL 4GRLB 1JF5A 5D71H 4GRWE 4TVPD 1IM9A 2ZKHH 2A6KA 3FONB 5JR1L 3LMJH 3RFZC 1JHTB 1GZQB 4D8PB 2C9AA 2FYYA 4OCMC 3DUHA 4YEFA 4ZFFB 1P53A 3EFFA 4LGSB 3FMGL 5T5FH 5L9DL 4NO3A 3F7RA 2DBLH 2VLLB 3JV6A 3C2AH 5IFAL 4Z7OE 1C5BL 5HY9B 2X1WL 3VXTB 4FXKB 1DVFC 3BKML 4KKBD 2OJEA 3INUL 3VWJB 5HGHA 3LKPB 2CDEB 1MJJA 4WWKA 4FXLA 5DEFA 3WUZA 1ZGLM 5IV2B 5J6HB 3GSVB 1BQHA 3S96A 1VCAA 2CUIA 1INQA 1AD0B 1RU9L 1GIGL 4JJ5B 3O6FB 1NGXB 5DO2D 4X7TA 4NZUH 5KSAA 4NM4H 2GT9B 1KIRA 5JOPD 1KLUA 1CLYH 3PXJA 4MA7L 1XF5A 2CGRL 4KZEL 4NPYA 3X3GL 2VLLA 3JV6B 4MJIB 5DVNA 3FO1B 4N9OB 5MEQB 1S5IH 2G75B 1YJDC 4OGZA 3LQAL 7FABL 4QKXB 2R29H 4J3WA 1BAFH 2WBJA 1KXVC 4HS3A 5D72H 3LEVL 1K4CB 4U7KA 2I27N 3B5TA 4NKOB 4LRNH 2H9GB 4WW1A 1RUPH 4QT5B 4P5KB 4K8RH 3IU4L 4TNWF 1HI6B 2NCMA 4OFVA 1HINL 4S1SH 5I1JH 5I17A 3QUZA 2EDYA 5I1CL 4FHBD 3HB3D 3R06B 4P9HC 3BZFA 3C5JA 1L6ZA 1O5DT 4GAGL 3C60D 4YDJB 3VWJD 4ELMB 4F2MA 1T5XA 2VXVH 3KJ6H 4LEXH 1P69B 4XC1H 1ACYH 3OJMB 1G6RL 4JLRA 4N0UB 3MLRH 4XTRD 1YQ2A 1I7RA 2X9XA 3C8KB 3GB7A 4CJ0A 3REWA 2IANE 3EJZC 5I19L 3GSXB 2NTSP 4XVJL 2AK4D 5DQ9A 3MGTB 2VDPH 1Q9OA 5KVGL 5DEFB 1OCWL 2WWKO 3MUJA 3SDAC 4RAVB 4XP4L 1DQML 1KYOK 1JE6A 4NQEA 4X5WA 3DTXA 1P9MC 3QUYA 3OKMB 3PQYA 3FQWA 3TYGL 2XTJB 3Q0HA 4KAQL 3AUVA 4XPHL 4CRPA 1QSFB 5BOPA 3MRBA 5GGSY 2DQGH 4WFFD 2Z8WC 1ZVSB 2D7PA 4NO0B 2X40A 1ZVSA 1QPXA 3BJ91 4NO0A 2RGSA 5EC1A 2J88L 3GHEL 4UIKH 1N3NB 2QKIB 4GG6B 4G6AD 5GGSB 5KS9E 1FYTA 1JZ7A 2NY7L 1XT5A 3EYSH 4PJ5D 3BIAX 1TJHH 4HW6A 2BDNH 3NFPA 3KLAA 3L6FB 4YX2H 3QQ9D 1MWAA 3DX9A 2QV2A 1JHKL 3N9GL 1XGPA 4CJ1A 3WJLC 2P4AB 3MXWL 1L7IL 2FH8A 2ZG3A 4QCIB 1C16A 1U8PB 4LVEA 3BKYL 1D9KA 3RWIA 4L4TB 5D7IB 2DQIL 3OKEA 1R3JB 1CR9H 5EU6A 3D3VB 4FRWA 4XGZB 5E6ID 5BXFA 3BZFB 2G75A 4JRYB 4WW2B 1RQ5A 3G6DH 2XKNB 2QSVA 4QXWA 2YD1A 5GZOC 3EOBB 5I0ZA 3KPSA 2EYTA 3LV3A 3RL1A 3U4BH 4YHPA 4LPTA 5C9JB 3L3OA 4XCFH 3TA3B 1OAZH 1KPRB 3NAAH 3KG5A 1ZOXA 5JOFA 3MLVL 1NGXA 2VQTA 4JJ5A 3C60A 4NCC1 5E5RB 3WBDA 4K9EL 5DJYA 2QSQA 2UYLB 5C0AE 5CJ8A 3MLZH 3QCVH 3REVA 1WCBA 1MNUH 3D9AH 1QUNA 4PJAB 4X7EC 5FA3B 5INCB 3SOBL 3V7MA 2Q76B 3CMOH 3QIUC 1FNHA 1Q38A 5KG9A 5B3JF 2EDNA 4Y5XC 1KELH 2A1WH 1ZLVK 5I1EH 3MODL 2EDRA 2QADC 1G6RB 2KZWA 3BXNB 3MRQA 3O3DB 1KCRH 4ZNEA 1DUYA 1I9RH 4JCMA 4PP2A 3SKNB 2VLMD 2OTUA 1CD9B 3HE6A 5J4MA 4OQTH 3BKCL 2NW3B 2R23A 4KI5C 4D2NA 1FL5B 1OAUH 5DD0H 5CKAA 3WIFA 4ZXBA 2BVPA 4S2SB 1VADA 4WDIA 3MJ9H 3VFVA 4OBSA 1N8ZA 5CBAB 1MCLA 4PJ5A 4OCSL 3RIAF 1TTUA 1PFCA 1J11A 1MCJA 2YPVH 5AWNL 4QXTA 1LEGB 3T0EA 4QXUL 5JIIA 4FQXD 4HWBL 4XC1L 3P4NB 1YEJL 1KIQB 3KR3H 4GAYA 1XFPA 1ZHKB 5TH2B 3TBWA 3KYKH 3TBVA 3FO9A 3Q1SL 4PJ8B 5D1ZA 2QEJA 4UDUB 3V6ZB 3CVHA 3U6RA 2DMCA 1RK0B 1F4AA 3QG7H 5I8OL 1OGTA 5HI5C 4L8BA 3W81A 1F13A 4YZFF 4LNVA 4QRPB 2EEDA 1T0NA 4RMRA 4C83B 3T1WA 5J6GA 4MXQD 4FNLL 1CTOA 4DK3A 3ARFC 1KFAL 1AHWA 4JFOB 1CLOL 2GUOA 2FLRT 2NPLX 1PG7L 4X8JA 5JO5A 5IT2H 1RIVH 1OP9A 1X5AA 5ISZD 4WENB 1DDHA 3MRKA 3NZHL 1T22B 4KGJA 4JDVA 2NY7H 4O4YH 3PHQB 1FZKB 5FYJE 3RY6A 3QDGD 4IOFD 3HE6B 1Z9OA 1KF9B 2W38A 4PJGE 1NGWA 3MGAA 1L0XA 2ZSWB 3BD4A 3P0GB 5I73C 1MRDL 1I1AA 4R3SA 5BQ7A 3A0OA 5I1IH 3MO1B 1IAKA 1IFHL 5E2VL 3MRMA 3LY6A 2DQGL 3L3DB 3VH8G 4JO4L 2C3VA 5DI8B 4Z7NF 1AQKL 1UM5H 3QFJD 1LK2A 3C5SA 3SO3C 1X5FA 4L8SB 4NRZA 1CK0H 5JNYA 1BFOB 3HC0B 4DUWA 3L3KB 3LEXB 4X80L 2F5AH 3BYTA 1QFPA 1NL0L 4PJIE 5LAXB 4CGTA 1H0DA 3EDEA 3MNWA 1P4IL 2DQFB 4LQFL 1G1CA 4NZDA 3BDBA 3IXAB 4HX1B 5I8KL 4X4YB 5DS8B 4M02A 1JNLL 4NUGL 1R5IB 5E8DL 1UGNA 1D9KC 5MEOB 1YEFL 3LN5B 1B4RA 3BW9B 4D0DB 2AGJL 3L3KA 1J5OH 5F1KC 3QDJE 1AGDB 3FAWA 4FQXA 3GJEB 4RA0C 4WW2A 3RVUC 4Y4HA 1N0XL 5HHVL 5EN2A 5DI8A 4X6EA 4UDTA 2APWA 1EGJH 3QO0B 2PTVA 4R4FL 1P5UA 1OW0C 4YHKL 2V6HA 1UXSB 3PXHA 4PTTB 1AD0A 3NCYP 5C0BE 1F4YH 1OF2A 1S7QB 2EXWC 2GAZA 4PGBA 4ZSOE 5T3XL 3U2SB 1RU9H 4YR6A 3UBXA 2BOBB 3BP7B 3CXHJ 2AK4E 1TXKA 3MOBH 1RY7B 1MCOL 1QSEB 4IRJD 4P9ML 1OAUL 5DD0L 5KVFH 1T0PB 2YC1A 3VXPB 2HH0H 2X4OB 4PR5A 4G43A 3VFPA 2Y25A 4LSUH 2CGRH 4KZEH 1WFNA 2CKBA 4TULL 4M9PA 1M7DA 3FRUB 3TN0A 3FB8A 2X9WA 4V2CB 1S5IL 5JDSB 4D8PA 3UEZA 1FZKA 3SDCB 4GRLC 4LSVH 4UU9B 3UYPA 3LEVH 3ABZA 4EVNB 3U7WL 5IHBA 5D8JH 3OG4B 3PV6A 1ZA3B 2PO6B 1JZ2A 1BFTA 4BUGA 2ITDA 1T03L 4IDLA 3R06A 3MYJB 1HHGA 4UQ2B 3LS4L 5IMOB 1C7SA 1IJ9A 4OFPA 3D48R 2G2RA 3DIFA 1LD9B 4NQXA 5C0AA 1H3VA 5C0AB 1XF2A 3V52L 4GXUM 4Z7VF 5J1SC 1X4YA 4IRSC 4Y4KD 3HRZB 3C6LD 4L9DA 1X5HA 1PZ5B 3IB4A 3MNVA 4BFGA 2XQYG 3LB6D 3AS3A 1M7IB 3N1PC 4ENED 5IEKB 3DRQA 3VH8B 4R0LB 1A3RH 3KXFE 5CEZL 4Q9QH 3GMLB 3MROB 4EVNA 4Q2ZA 4FQLL 1IGIL 3O6FC 4F8TA 3BDYL 5D7LA 4NQDD 4GW5A 4QTHB 4GO6B 1MCBA 3NGBC 1DBMH 1RHHB 3O6FA 3U0TB 4EN3B 4JRYE 4O00A 4HMDA 2VLJB 1MCWW 1RURL 4X6CB 3QNZA 4PG2C 2DIBA 4MD5A 4RGND 3T77A 1UENA 2IH3B 4J1UA 3AMKA 1VGKB 1P1ZA 3TT1L 5SWZD 4OLXL 1KB5B 1JN6A 3IDGB 4HBCH 3ZDYE 1G9ML 1KEML 2X10A 3BEVB 1RIUH 4MA8H 5GJSL 3RWFA 1VFUA 2EC9U 4O02L 4YX2L 1ZGLA 3JWNC 4HGMA 1AI1L 2R2HA 4K7PL 3B9VA 2C3HA 4H0GA 3S98A 2D4DA 1IAIL 3O2DA 1JPTH 3ARBA 5DTFA 5IHZB 2NY0D 1SJEA 3WIIH 5ALCH 4U6VL 1RUKH 1TQCB 1I85C 3BQUD 5D96B 2I9LA 1A4JB 4ETQB 2AK1L 3H8NA 3SGKC 1A1NA 5I1IL 3O4LB 4LLQB 4S11A 4X7DC 3RX5A 1CQKA 3EOBA 2CQVA 3QEUB 5KSBA 3VXMA 4D0BA 3TO2A 5DHYB 1ZLUH 3DUUA 4QRSA 2D0HA 5HVHB 5KZCB 3GRWL 3LDBB 2GFBB 1QEWA 4YXKL 5CJOL 2GITA 4FABL 3JV5A 2EICA 2P8LA 2YD9A 4HKZB 1MLBA 3CSYA 3CK0H 4RGOL 4UZGA 5JMOC 2DLFL 3DRQB 1KTLB 1NCCL 3VH8A 2AV1A 1KCUL 5SWQB 3L3HB 2BVQB 1G0YR 3ZHDA 2OJZH 1QG3A 5MI0C 1MOEA 4OM0H 3GMNA 1VPOL 4UB0L 1XCTA 3H9SE 5E56A 2FRGP 2CUHA 4FS0A 4KQ3L 1U9KA 3BUYA 3BVNB 4FA8A 4OJFL 3OAYK 2CK0L 1INEH 1PBYA 4EUPA 1T20B 3HUJB 4ORGA 3QIWD 1AE6H 4Y4HC 1FG2B 4OI9A 4Y7MA 3VWKD 3BP5B 4JFQB 1U3JA 4G9FE 1EXUA 2EYSB 4Z7UA 1Y18A 2WMPA 5CGTA 3MC0A 3LRGA 4E42A 2NY5L 2Q20A 1EVUA 1AJ7H 2EYRB 4FTVE 4NDMB 1L7TL 5IIEA 2IEPA 4J8RB 4U1JB 1I7ZB 1E6OH 2Y06L 4JPWL 1HOCA 4XWOD 4Q9CA 1T04B 2VDMH 3V4VH 3OAUH 5H94A 1ZLVH 2ADGB 2VR9A 5TDNA 2X4UB 1XR9B 5T3XD 3TNMA 3TNMB 4J3XA 3U4AA 3T2QA 5IG7A 2CXKA 1NBZA 1K4DB 3RVTD 2XG5A 4JM2C 3UPCA 2YZ8A 4U1JA 4RMSA 4NZTH 2JTDA 1XH3A 3FRPG 5C0JB 3HNSL 5IFHL 4JEGB 5DJCA 5F9OL 3RNQA 5I17B 4OZFA 1BLNA 3P30H 1JVKA 2HWZL 4Z8FL 5CJBA 1M1SA 3FFDA 4A6YA 1P7QB 1MSPA 1E4KA 5ADOH 4PJCB 4JGMA 5GZOD 2LTQC 4QO1A 5CZKA 3EYVB 1P9MA 1JGVH 1T5XB 3QISA 6FABH 1BM3H 1T5WB 2YD8A 2NY1D 5J12B 1HNFA 1U8MB 3O4OC 4B7IA 1QHPA 4TN9A 5JHDD 3VWKB 4Z18A 1QD0A 4Y0GA 3TZVA 1BOGB 2AQ1A 3B43A 3PQYE 3UPRB 1BOGA 4WGVB 3V52H 1WAAA 3WLWD 1K3ZA 2WUBH 1OQXA 2CSPA 3E8UL 5DD1L 3BJLA 1MLBB 3CSYB 2ICWA 4M6ML 3HA0A 2PW1B 2DJ4A 1MEXL 1NBQA 3MV8B 4V1DA 3SE8L 4LIQH 4HPYH 1U2CA 3C6LB 2UZIL 1A7QH 3FQRA 2IPKB 1MCDA 1MCSA 3QIUD 3ILQD 5IB1B 2RFXB 3T08A 15C8L 4L8DB 4WY7H 2ZG1A 4JRYD 5D9SB 3NA9L 1VESA 1TFHA 5DFTA 3FKUS 1I9IL 2ICEA 2D7NA 2C5DC 4ZUSB 4PV8B 3RWEB 5EU4B 4MVBD 5I8CA 2X4SB 1IILE 5EIVA 3OKKB 1U2HA 1G7IA 4IIQB 1U0QA 1T2JA 3WNNA 4O2FB 2HTKC 4XPTH 3EHBD 4I77H 1K5NA 5DVOA 5EU3A 1AXIB 4KHTL 1LNUB 2VOTA 2B8OT 4KMQA 1WTLA 3A6BH 3U6RB 3BGMB 3K80A 3UTPE 2AP2A 3CPLB 5GGRA 2F5BH 5F1OB 1KIUA 5JLZB 4LRNL 1LDPH 3QDGE 3VI3E 3IU4H 4ZUWB 4XNXL 2YUWA 2X09A 4XC3H 3GSNA 2XFXA 4LCCC 1MFEL 1FVDA 4IRJB 4G8GD 4R4FH 1D5BB 4BSWB 5I0DA 2VZVA 3F5WB 1P4BH 5T33L 3VFTB 5HJ3A 3BHBA 4I3SH 1HHGB 1F4YL 2AS5M 3VXRB 3G04B 2GCYB 4F9LA 1P7HL 3QIBC 5C07B 5FAAA 1G6RH 3CK0L 2QQNH 1B9ZA 4AH2B 5E2TL 1A6UH 2ID5A 3L95A 4OKVA 1XF2B 4NT6B 4DN3L 3U7AA 3I6LE 1Q0YL 4KMTH 4KJPD 1P7KA 1OHQA 3P9WB 3U30C 1OCWH 1GAFH 1IAIM 1VSCA 1OM3L 1N4XH 2E9JA 3GMOA 3O4LE 1HQRA 3NH7L 3L5HA 4WCYH 4JFXA 5I76B 1FN4A 4XPHH 3ZE1E 4EQ3A 3T0EC 4G6JL 4EUPH 2M2DA 3DTXB 3KYAA 2OR7A 4U1KA 2EE2A 2FJHB 4ZOBA 3DX8A 3ZTNH 2HRLA 5HD8C 1LEIB 4TQEL 3RUGE 4G42B 1U8JB 5DRZA 4OFYD 5LCVL 1L7TH 5J9PA 5GHWH 1QBMH 2CDGA 2E6QA 1XGRA 1CVRA 2UYLA 2VL5B 4KKLD 3JTTA 3LQZB 4G8EA 2ZKHL 3UCRA 1OTSD 4BH8B 1P5VA 5INCA 3BUYB 5CZVL 4ZO9A 2JJWA 5D5MA 4G9FA 4XCEB 3BWAB 2XWTA 3VI4F 1FLRH 4YNYA 1XF3B 4X5XB 5T5FL 2OL3H 4K23H 4KWUA 4QRQA 2AV1B 4BFIB 4NZTL 4ZUUB 3STZB 4N8VA 5DRWA 1R5IA 3C6LA 3QDHA 2CKBL 1NANI 4BFBD 32C2B 2ZG2A 3QFJE 5GS0L 4E9LA 4FQLH 1FL3B 4ONFL 5HYEA 5TQ2H 3RY6C 4PB9L 2DQFA 1R3LB 5ID1B 3OB0H 1GC1L 3ZL4H 25C8L 1NFIB 3SDDA 3LKQA 2NXZD 2PETA 1IT9H 2VDOH 3LIZH 4YGAB 4TSCL 4KUZH 3LN9A 2R8SH 3OGCA 5C2UB 3EYQD 2YPKA 1XF4B 4O9HL 4XBEL 1KULA 2W0LA 5BRZA 3QXWA 1RIHH 2HAZA 5E8PA 1FNGA 5I1HH 5L2KD 2ZCLH 1RIUL 4YXLL 1TJGL 3MV01 4LP4A 4LLAA 5T1KA 4ZXBC 4NO2B 1CDIA 4EI5C 3P9MA 4OI7A 1AXSA 3HUJF 1XR9A 1BQLL 4HGWA 3D1MC 4GOSA 3L5JA 4JJHA 3JSSA 1EIBA 2XI9A 2BY1A 2A1WL 3QUXA 4NN7B 5F6IC 2ZOLB 1KCRL 2Y23A 1IL1B 2CXGA 4WJ5A 1FYTB 1FAKT 4JM4H 4WY7L 1A2YA 2WBJC 4IOIB 3VXUB 3FOMB 3ZYZA 3QDGB 3BZEB 2XZCH 4XNZC 1SHMA 5FB8A 2FWOB 4BK5A 4P23B 5K9JL 5HVHC 3MZTA 4APQC 2IAMD 3KPRB 4PGJA 1DDHB 3MRKB 2ZOLA 1KIPB 4GJTB 4Y2OA 4YC2C 3O3AA 3VI4E 3JWOH 5HI4C 1UM4L 4KKNA 4AH2A 3IJHB 2J12B 1LP9F 4JFXB 1BOYA 4I5BB 5JMRA 1PGRB 3HI5H 1N5AA 4XMPH 3VXQA 4FTVB 1ZS8A 4OQTA 5EOCL 3MTRA 1OARL 4JN1L 3U9UB 1KCVH 3DRTB 4MQXD 3K8LA 3NCJH 3U4EB 3UTPD 4OGAC 3UTSE 4G5ZH 4U1HA 4O5LL 2NY6B 1C7TA 3MJ9A 4EUPB 2O5XL 1CT8B 2F8VA 1RZGB 2VXQL 1QA9A 2DQHH 2XZZA 4P2RE 1SM3L 1EDQA 43CAA 5GGVY 1NKOA 2X5PA 5IGXH 3FO1A 4XNMB 1FL6B 4MA1B 4DFIA 3GHEH 2JIXD 4S1RH 1AQDB 4PJBB 4UT7L 1KN4H 5ID1A 1RULL 2GT9A 4HX1A 1V7NL 3HG1B 1G7JB 1TVHB 5B4MD 2IMMA 3GI8L 2BDNL 1FSKB 1G0XA 3X12A 1NFKA 2QTEA 1FVEB 1Q0YH 1H3XA 5A16B 1F45A 1HYSD 5K33A 3PG2A 1QQDB 2DLTA 2ICES 1N4XL 5GRYA 2O93L 3FT2A 3VG0H 4LARL 4N8VG 1JGLL 1QFUL 1XIWD 1FCCA 3EOAB 5F7EL 3HFMH 1RK1A 1R6VA 5BV7C 4MJ4A 4ZFGH 2OR9L 5A3ID 2K7QA 5H2BB 3HLAA 4YFLI 4RGNB 5HHOE 4LIQE 4LKCB 5IJVA 3EYOB 1NCWL 4CDHA 1BZ7B 1Y0LA 4YDKL 4NNPH 1WIPA 1Q9LB 1D6EA 2N1KA 1Q0XH 3IDGA 4P99A 3WE6B 1OGAA 1KPVA 4ONOA 1XCQA 3ISWA 1P4IH 5I1AB 1F3DH 5C0FB 4ODXA 1PKQB 4PJHB 1R24A 3UBXI 1EJ6A 2Y07H 5L2JA 5C07D 3ULVC 2R0KH 2FX8L 3OXRA 5L7XL 1IAOA 1LDSA 5KTEL 3UTTB 4MQ7A 4WI6A 5ESQB 2AJ3A 1XR8A 2F8XC 4D9RE 1EH9A 1NBYA 3L95B 4DKFL 4P4RA 1QBLL 1TDQA 3DRTA 4FFVC 4DEPB 4FMKA 3TP4A 2WIMA 4PJFB 4A2LA 1OSZA 3G04A 4ACPA 1C5DB 3QUKA 3MUZ1 4XTRC 1I8MB 4Y2DA 1T5WA 3VWKC 3ZL4L 5DHXB 1KJMB 3VFGH 2OS7A 2CK2A 1II4E 3OKEB 3CUPA 1NGZA 2FSEA 3HPJA 3BH8A 1HCVA 1S3KH 4I0KA 4KUZL 4QXTB 4P23A 5HPMA 3PGFL 3EOTH 2CMRL 2G9HA 4Y19E 5GS3A 2R4SL 3S97C 2IAND 4P5TB 4P46D 2YPLA 4O51A 1S7WA 2P7TA 3ZKQD 4FZ8L 1OGAD 4JFPB 2YKLL 1FNLA 4QYOB 1LP9E 3C6SB 1ZT1B 4LPXA 3C6SA 1WBZA 3RBSA 3BKCH 4PJCE 2GUOB 3MV11 2A9NL 5HVGB 2AKRA 4P2YA 2FJGA 3T8XB 5DMYA 2P46B 4GS7B 4K94L 3S5LB 3TCXA 5AZ2L 5GJTL 4ZUSA 4QHUA 1A7OH 3BH8B 4YHZL 4KDWA 2Q76A 1MFCL 2IFFH 1MVFA 1CI5A 1GGBH 4UT6L 2X05A 1Q9OB 4P2RA 4KK8D 2XA3A 3EO9L 3GO1L 3P9LA 2JF1A 4RGMC 1OAXH 5F7YC 1AGBB 3IDJB 1CDBA 5ETUA 3UTSB 3SDDB 4LOUD 5IGXL 1HI6A 2OX5A 2VH5H 1CDGA 4S1RL 1F02I 1ZXQA 1S7VA 2IH1A 1VB9A 5HYSA 3MGOA 4HSQA 4AL8H 3TGXA 4LF3A 4U7MA 2D9CA 5FYKE 1RZ8A 2EZ0C 2IBZY 2NY2C 3GI9L 4PJGF 3BDYH 5BW7C 3UTSD 3E1F1 1NGPL 1OGAB 1VGEH 5CHNB 5DC9B 3UTTE 3T0VA 4YDVB 5JUEL 5MENB 4HAGA 4YHIB 5GS1B 4RWHA 3CFDA 1FFOA 2I60H 1TQCC 4Q9BA 4R90L 3GMQB 4AQ1B 4CMHB 1V3MA 1F2XK 2UVFA 1H8OA 5F70A 3CLFL 4UILL 1MUJB 2HKHL 3CIQA 3VXMB 3T4YA 4QHMA 1GH7A 1JZ4A 5FECB 3GIZH 4MJ5A 1XCQB 4ZFZA 4ZQKA 2P5EB 5DMGC 2R4RH 4H8WC 3LKPA 4H88L 1H3PL 2V5TA 1TJIH 5GZND 1WZ1L 2O5ZH 3TYFB 2HTKD 3E2HB 5EUKB 3EYUH 4TYUA 1KC5H 4J7RA 2F54D 1A5FL 2IMNA 3MREA 3TT3H 2EDTA 3KXFA 1UB6A 5L6YL 1HWHB 3K0WA 3HAEH 3QXAB 4P4KA 2JJTA 1R5WB 3O3EA 4JFED 1S78D 3HC3H 3QIBB 2YA1A 3TNNA 1OGTB 3W9DB 1NFDF 2FIRT 1A0QH 1C1EH 3GGWB 4IMLA 4NKDA 1WZKA 5C09B 4LQFH 1EVTC 3P0YH 2HT4C 4XAWL 1LK3H 1J05B 2VN7A 1T7VA 3C2AL 4MZ2A 4YXKH 1Z6JT 3C09C 1NCWH 5FYKU 4PJ8A 1EMTL 3EAKA 3WXVH 3IRPX 1OW0A 1SBSL 3S5LG 1J5OL 4K3EL 2LAGB 1YDPB 3H9YA 1RIHL 1KTDB 3BKJH 3THML 4L4TE 4YXLH 4UI2A 1BBDL 2DS4A 2ZUYA 5FGRA 1IARB 1LO3H 5AZEH 2ITDB 3DO7B 4FQCH 3QEHB 1PZ5A 1IKFH 1AO7E 1RJCA 1IQDB 3W0WE 4N9GA 5KSAD 1U3HB 3LPWA 3MR9A 3EFDH 4YEEA 2KH2B 3ROOA 2OTUB 5F8RC 4K71B 4GG8B 5HVWA 1FVCA 3LS4H 1R24B 3BIBX 1JGEB 5FUOL 4BZ1L 4H5SA 4GSDL 4MMZC 5C92A 5C9KA 1I1FB 3RBGA 3QQ4A 5BRZD 2EH7H 5EOCJ 2GSGA 3X3FH 1R3HA 2NW3A 4NNXA 2IQ9H 4HV8B 4XWGL 1SJEB 3REVB 4MB5A 4QOKE 2AJSL 3RAJL 3NIDE 1S7QA 2E5EA 2IAMA 1MRCH 3QDJD 4YQXL 5EOCH 3D25A 4PJIB 4M1CC 3PV7A 1T03H 3CGTA 5CEZH 1MJJB 1AC6A 2NXYD 3NPSB 1IGIH 4OT1L 4BJLA 5C71A 4GW1A 3KPTA 3QEGH 1UM6L 5C9JA 5F3BB 5GRWA 5DGQA 2VXQH 4Z8FH 2H8PA 1KLGA 4KK9C 5E9DD 4HGWB 4XX1E 3N0PB 3AS1A 1CICA 3T1FA 2GJ6E 3MRJB 4R6UA 2RAMA 5JPMA 1NEUA 5JDJA 1DQMH 2R2BA 4MWFB 5T1KB 3F58H 1BWWA 3B2VL 4KMLB 2DQCL 2QR0A 1EFQA 1UB5B 5DC4B 3RVUD 1U3HD 2NZ9C 2Y36L 1JL8A 1I8KA 4X4XA 4KC3B 1DBKH 3GJEA 1A4KB 1I4FB 1ZT4B 4LVHC 2Z0BA 4HCRA 3SKOA 2P8PB 3FQNA 3W0WB 3NIGE 4JFEB 1L4IA 2GTWB 4O2EA 4PJFF 4R4BA 4GW1B 4JFYB 4LGRB 3Q48A 2QADB 2FR4B 1RUQL 3VG0L 4S1DC 5JXAH 5DJAB 5C0DA 4B5EA 1X7QB 4KXZI 3MNWB 1SY6A 3I3BA 5I18H 3CFKA 4NJ9L 4KJQC 4LMQE 4I18C 3NA9H 2HKFL 1OPGH 4C58B 3PWJA 2MSPA 4UQ2A 2AK4B 1AGBA 5HSFA 3K46A 1MCQA 5EO9A 1U92A 3VXOB 3UDWC 2GSGB 3FQWB 5GRZA 1G7PA 3U46B 4G3YL 4TNVK 1JI1A 1U36A 1X5YA 4YDKH 2F74A 3O6KL 3C08H 1RUKL 1SEQL 3VCLA 2N56A 3QXUA 1NCCH 1S7TB 3GMOB 2EDLA 1W0VB 1E4XL 5F88A 5IB4A 3DWTA 1NANH 2HRPH 4PREA 3V4UL 5EORH 2Y6SC 3OKMA 3PQYB 5KSUA 3LHPH 3DX8B 5FV2A 4K9EH 5TE6L 2J8UF 2GJ6B 4YFEA 4BQCA 2N7BA 1QRNB 2D0GA 2BSSA 4NQDB 4XPBL 2DKUA 4K7PX 4R7NA 3QA3A 3DO3A 3T0BA 1UA6H 3W0WD 4JVPA 1BQSA 3T4YB 4C59B 4PGDA 4YHYB 1NMAL 5E70A 4N0UA 3VD4A 1WIUA 4L29B 4C57C 3CMOL 3D85B 1XZ0B 2DDQH 4ENEC 4W6WB 3PQYD 3ELAT 5LGHH 3T0EB 2P24B 4HEPG 1V5JA 5E8PB 4FN0A 5EZIL 3VA2C 4XB8A 3ZTJH 1M7XA 1MQ8A 5ICYB 1I9RL 5EFIA 4TNWK 4WFHE 5IBUG 5HGDA 3VU2A 3H3PL 4NYLB 1HIMH 4FP8L 4KPHL 3GJFK 2YRLA 3JVGA 2PO6D 4X7CC 1T7XA 4JN2A 1BF2A 3OX8A 1Q9LA 3BIKA 5DDHB 4M7LL 1VDGA 2H6PB 4HIJB 4RGNC 5HYSB 4ODHH 1D5MB 1LEGA 1QBAA 3QNYA 1GC1C 3TVMB 1T1XA 4MYWB 3ALWA 1IKFL 2AXFA 3EYSL 3HNSH 2MFNA 1DBAH 2ZPKH 2FIKA 2VXUH 3O3BA 3O3DA 2VLKB 5FHAL 3PDOA 3T4AA 1E4WH 1XGYL 3RWEA 5D7JD 1KLGB 1KPVB 3AM8C 5DD5L 5I1AA 4LLYB 3VDAA 4G9FB 1PDKA 3MXWH 4FFYL 4GRWH 5DJDB 3HG1D 1ORSA 2JIXA 3IFLL 4DKDC 1HSAA 3PDGA 4RFEB 1ETZB 2VLKA 1ETZA 1E28A 4MJ2A 2EDBA 3ZDZF 4MNGE 3V6FB 5DJXA 2HJFB 2FATL 4PV8A 3X3FL 1RHHA 4Z7UE 1Z5LB 3O11A 2GHWB 4FQ1L 5IW1A 5HHXH 1CG9B 1U95A 2R69L 4OV5A 2EYTB 3LV3B 3RL1B 3ARFB 3BDXA 1HQRB 4PJ7F 3LVEA 3B83A 3RJDA 1FFNB 1QO3A 2P48B 2NY2B 3ULUH 3DV6B 4WI5A 2CDFB 1XGUB 3GKZA 1QRNE 4L3ED 4U6XA 2BVOB 2CO7B 5C0CB 3VJ6B 1KEGL 3HC4L 4OF5A 1D6VH 2ZCKH 4LCYA 3BSZL 5DEGB 3HZVB 2G2RB 5LBSL 2F58L 1VEMA 6CGTA 5JXAL 4XBEH 1MREL 4JN2B 2DYPA 3SDCD 3KYMB 3RNQB 2V7NB 4D9RD 4MAYD 4Y4HD 2EDXA 3LOWA 1A7QL 1DUZA 5FF6A 5FO7B 4U1SB 5EU7C 1KTDA 3PJSA 1ND0B 4LEOA 1QR4A 1G7MB 4MD4A 5ACZA 3C60C 4OZFB 2VDNL 4JREB 1GL4B 2ZP0T 3WSQH 2YA2A 2X4NB 3O8XB 2VAJA 4Y16C 3QH3A 1J1XH 3H2WA 3QIWC 4U1IA 5IVXA 5ISZB 4Q9RH 3OV6A 2V5SA 5D70L 1BZ7A 3RA7H 1U93A 2W92A 4K07A 1NAML 4XPTL 4I1NB 3CC5A 4OD3L 4HG4K 5IR1B 3KLHC 3QDGA 3O41B 4IJ3B 4Y5XA 2QSTA 2X4SA 3OKDB 5CGYD 1S7TA 3RRQA 4RISL 1SJHA 5HHOB 3UZEA 1NGQL 3C87A 2FLBT 4MAYA 4X5WB 1CE6A 4XNQB 4R26H 3DURB 5I1GH 5EZIH 1WZMA 1IZKA 1P84J 2F53E 3QBTB 1AGDA 2RFXA 2GAZB 4PGBB 1VFBB 3UROR 4PJFA 3CFEB 4Z78B 1FP5A 4FQCL 4NO2A 4F9PC 1FQ9C 3ES6A 2PYED 4U6HB 3HUJA 4ORGB 3S34H 1JTPA 4NKOA 2DJSA 3QO0A 4UV4H 4XPBH 3F8UB 4RA3A 3O9WC 3VFNB 4NKMA 5BRZB 32C2A 5MENA 4ZTPL 3L5XH 3RP1A 4DN3H 4LQ1A 1X9QA 4PLNC 1X5KA 4POZC 1FL6A 1DBAL 2ZPKL 2W60A 1KTLA 2A6DA 4KROD 3DX7B 4AJ0A 4P5KA 1EZVX 5DS8A 4MSWA 2AEQH 4WI9A 1UB5A 2X7LA 3FO2B 3WNPA 4NQCE 1I7TA 3FFDB 4DGYL 4EOWH 3KPPA 3D25B 4I0PB 5FYJU 1ZANH 1ONQB 1M6OB 1MVUA 2BY3A 5F7KC 2OM5A 1PLGL 4LHQB 5LCVH 4CU6A 3MA7B 5D4QA 1BMGA 4MVBC 3BE1L 4BA8A 4ODSH 5HHOD 4U7SA 4PS4H 3NPSC 4N90E 1FFPB 4KRMB 3O2WH 3QDME 3WFHB 5KSUB 2ZZUT 3S6CA 2VL4A 4HJ0C 3ZT5A 4FFWD 4LHUG 4DZBA 2D31A 1MCPH 1SVCP 2XZQH 4RDQG 4K7PY 4TSCH 4YFLF 4ZFFA 3OKOB 5IM7B 1R3HB 3MRFB 4U6YB 3I2CL 2AXGA 2XWBA 3BP4B 5L7XH 1KG0A 5D93B 3BPNB 5F89B 4FXKA 4N0CC 1TJGH 2LU4A 3GIVB 1S7RB 1WITA 4PJXE 1RJLA 4YK4C 5GGTL 2L0DA 4DQOL 2DLIA 4X9GA 4K71C 3TBWB 3JV0A 1WLHA 2MHAB 1JGDA 4PRDA 4HFUL 2VDOL 2OSLB 3LIZL 1TLKA 4LLMB 3RY5A 3OAYH 2R8SL 1A22B 4O02H 2SEBB 5J06A 1LWRA 5MP6H 2VDKL 1CFVL 4KRPD 5E8OB 4XMKL 2CO6B 5DJ6A 5KSAC 3K8KA 3WIIL 5ALCL 1CFTA 4Y5VA 2WIIA 5DMIH 2DYPB 1CFTB 4MLIA 4P3DB 4Y5VB 4UTBL 3DOSA 3IT8D 3D0VB 4P3CL 1DE4A 2MOVA 2MMXA 2CR6A 3K4ZA 3HE7A 4LASL 4TRPL 1BF8A 1NC2B 2QSCL 4JPKH 1AXTL 4PY7B 3ARGA 1N59A 2WP3T 1IC4L 2GQHA 4PJ8C 4OD2A 5JHLL 3TCLB 4P2RD 5FYLL 5IB5A 3STZA 3ARGC 2B1AL 3MREB 4WI4A 2ITCB 2AERT 1MCFA 4PJHF 5LGJB 2Y4SA 1EFXA 5HI5D 1L0YA 4UINL 5HGAA 3C5ZD 1VADB 2E3VA 5EORL 5A2KH 4P5TD 5I71C 1S8DB 3WEXA 4IMKA 3QUXB 3B2UD 1A9EB 3LS5L 5D9SA 4KXZH 4L8DA 4AEFA 4JFZL 5MI0B 5DTFB 1M05B 4X7SH 4Q9RL 4U6YA 5TDPA 4NGHH 2VIRB 4H25B 3LKOB 1K2DA 3KPNA 3VFPB 4P5MA 3PWUA 4JRXE 3TN0D 1OAXL 2VAAA 3IJSA 1FNGB 4JDTL 5EN2B 1X3DA 1CDYA 4KKLC 1I1FA 2VH5L 3KDMA 3UYRL 4ZNCD 5I76A 5GRVK 1A7PH 2NY5H 3JWDC 1YMMB 4EXKA 5I2IB 2PYFB 3AB0C 1IEBA 4Z7QF 2J2ZA 1FE8H 4ZS6C 3U0TA 4Z0BL 2PTTA 3GBLA 3QNYB 1JHTA 3TVMA 1OD7A 2HFGH 4KGLA 4WWKD 3U83A 1MWAH 3EYQC 1NC2D 3ULUD 3QEQB 1X44A 4Z7QE 3JWDH 4P3DA 4ZUVB 3CD4A 3UC0L 2A73A 3B8SA 1D5ZB 1QLFB 2LVEA 4OB5L 4OF8A 2Q7NA 5DR5L 2C1OA 1G7HA 4QNPE 5SWSB 5EG6C 3PF2A 3KLAB 3BHBB 2D2OA 3L6FA 3MLSH 2OI9B 3MRNB 5BO1L 3ARZA 2B39A 1YY9C 4DUVA 3EYVA 3VRJB 1D9KB 1Q0XL 2KDGA 2WW8A 5D71L 1U8PA 4GKNB 3O2WL 4N0YH 1BEYL 3W5MA 2BC4A 2W07A 1UWXH 1MQKL 4Z76B 3AU1A 4XZUA 3PE9A 5IR1A 1WBYB 5KTEH 1MWAB 1QRNA 2G60H 1KJ2B 3LKNA 1BM3L 4ZXBD 4I3RH 4ZAKB 3S36H 4PJEB 1I3GL 2X1OA 3S5LA 3PWNA 2A83B 3BE1H 4U6TA 3PHSA 3SHSA 3G6DL 3NCMA 1X5GA 1S9KC 3INUH 2ZJSH 5ICZB 4LBEB 1JWUB 2VR5A 5F6HI 4HIEA 1ZHLA 3DX6B 5HPMB 4GFTB 4DZBB 3FN9A 3I6KB 5HYSG 3PHQA 1HH6A 4L8BB 2GEEA 2WV3A 1XAUA 4HWBA 4XBPB 4ONHA 4RSVA 1MCCA 3UTQB 3DI3B 4JRXB 5GSVB 1FC2D 3FB5A 1J12A 4HC1A 5EDXA 5C0GA 3QQ3B 1AHWB 4JFOA 5IBUB 4NM4L 2KUTA 2DBLL 3SKUD 1CFVH 3C2SA 1C5BH 5J57B 2BRQA 2ICWJ 3PJSB 2PO6C 5HDQH 2PW2A 3KPQA 4YHIA 3CVHB 4JRXD 5IVZA 3RPIA 3QNXB 4GQ9H 3UZQA 3I9GH 4NHCH 4RMWA 3QUMA 5KS9B 3QHZL 3U0PA 3KJ4C 1QKZH 4LDLB 4K94H 1RZ8B 4PD4J 3RUGF 5B8CA 1QSZA 1OP5K 1NBYB 5IHUL 1NDGA 1RZFH 5JORB 3VRIA 3KPOB 5HYIA 5FYLD 1NFDB 2NY3B 3V8OA 1MY7A 5FA4B 5HYJE 1YEIL 3I75A 4K3DL 3LDBC 3OKKA 3OXRB 4OLYL 1XIWC 4TRPH 3KHOA 4TSAH 3FAXA 4HKJA 4JKPL 5B4MC 2DLHA 3BWUC 4J12A 3KDMB 3HMXH 3ZKND 1RUPL 3MZGB 2CKNA 3BN3B 3E6HA 1FO0L 5AZ2H 4R97C 2BVTA 1I7UA 4U1MB 3QIWB 4D94A 2PXYA 4MNHB 3RTQB 1FGVL 1A64A 3WS6A 1FZJA 1A8JH 4PJIA 4KU1A 2VL5A 3ZO0A 3VD9A 2D7TH 3MV9A 1KSRA 3V0VB 2AXFB 3UAJD 3V0VA 1RZJH 1FGNH 3SJVE 3VGAB 4KJWD 1WBZB 4PFEA 3CFJB 2VKXA 4JFFD 5A3IC 3IFOA 5DFWH 3HHRB 5JO5B 3VXTA 2WBKA 5IIEB 3V6BR 1A1MA 4J4PD 2W9EH 2Z31A 1HEZA 3P4LA 1FORH 4IRZL 4CVZA 2E9IA 3O2DH 3FN0H 1HXMB 3OKLA 4AMKH 4X0KA 3RL2B 4G80B 4OB5H 2AAVA 4PBXA 4FFVD 5KOMC 43CAB 1QP1A 4KK5D 5GXBB 5ENWA 5DRXB 4NOBA 5C0RH 2F54E 5D7LB 3UJIH 2EECA 1NGPH 5DJ2B 3EYUL 4WFGE 4A6YB 5GIRA 1T1XB 3U4EA 5FO7A 2H45A 5D2NC 4H1LA 5B3JE 3T0DA 4R90H 2K3TA 4Y8DC 5FKPB 4LSPL 2HYMA 1DBJL 3WL9A 3WDHA 3U36A 2J6EH 3IDMB 4BUHA 1X5LA 3RGHA 4BZ2L 3JWDL 2XQBL 5M95B 2P24A 5IVZB 2GITB 1NCBH 4F7MB 1AQKH 3VJ6A 4HCRH 1RPQA 1B2WH 2W1NA 4LCUB 4H88H 1T21A 5F88B 5IB4B 3ZE2E 1Z0MA 3O6MH 4G80A 2ESVE 5GS0H 1IEAB 4X80H 1S5HA 5SWSD 5C09D 4LCWB 3M8OH 4I0PC 3WE6A 4HHAB 2IALB 3VGHA 2GJ6A 1A1NB 3BD3A 2BVPB 1PYWB 3QJFA 5F89A 3T2NH 3HMWH 3SY0A 4ELKA 1E4JA 5IB2B 4NZRH 1HHJA 3QWQB 1KJ2A 4OF3A 4PRPE 4P46C 4WW2C 5IESH 4RIRA 2VDRH 5CD3B 1YYLH 2XACC 3SKNA 5IW6A 1Q72H 1UXSA 1MHCA 3MLPA 2IPUK 1J0ZA 2F53D 3L7FA 5F9JA 3RU8H 3ROLB 1ORQB 3T04D 2C7UA 1ITCA 5HDQL 5TGBA 1DL7L 3QZWG 4MDIB 3T77B 4Y16A 3T4AB 3MLTB 1F58L 4M5ZL 4GQ9L 2AJYL 1C5CH 3CVIH 5DMIL 3QHZH 2O5YH 4CUCA 1R3LA 2OZ4A 3L1OH 1LO3L 2OMBA 2RQ8A 4UOW0 5AZEL 2P8LB 2I07A 4UAOB 3CH1A 2R0ZH 1OSPH 1WVZA 4O2EB 4LCCA 1D5IH 5DHVH 4AENB 1IC4H 4L1DA 2FZ3A 1FO0B 2JCCF 3ZYOA 3B9KC 3RPIB 1I8KB 4X4XB 3OKYA 2Q8AL 5IQ9A 1YEJH 3KR3L 4NUJB 4UINH 1YPZF 5EZJB 2VR4A 5B22A 3CU1A 3CH1B 1X6NA 4NHCL 2PR4L 5C7XH 4GSDH 4ISVA 3DBXA 2VZUA 1YQVL 2BY0A 5GGVL 5DURD 4YHOH 4MAUL 3V5HB 5TDPB 3HZKB 3U9UA 2JK5A 3LEXA 2Y9RT 5E8NA 2EE9A 2ESVD 3QG7L 5I8OH 2Y7QB 3DX9B 4B0MM 4YNYB 4HEME 5D7SH 1MAML 2CKBH 1KB5A 1VFOA 1FN4B 2VZ3A 5I1DB 3U1SH 3KYKL 4YHLL 4GMSL 4JHWL 4PRAA 1I1AB 4R3SB 5BQ7B 4FXGA 1WF5A 3JV4A 4LBEA 3EO0B 3AGVA 1GC1H 3FN3A 5F71A 2AKRB 1ZTXH 3FT3B 3G6AA 2HLAB 4CAGA 2CDEA 1YECL 4Y4FA 3IETB 4ZAKA 3H3BC 4JKLA 4HMEA 1G9NL 4NBZB 4OF7A 4NNXB 4LCWA 3HRPA 2APBA 1NGYA 2ZCLL 1BP3B 1IGTB 5TQ0H 3HC4H 5EOQL 1JK8A 4LU5H 1DR9A 1QSEE 3TBTB 4GQPH 5LBSH 1KIQA 4DK6A 4GRWB 3PP4H 43C9A 2DKMA 4I18A 2YBRB 5ESAB 1CK0L 1EEUA 5I75C 3DHJA 5FIEA 4GAJL 1GHFH 4JFFB 5GJSH 2EXYD 3VXNB 2F8OA 2GJJA 4Y1AD 1UWGH 4XP5L 1I85A 2FDBP 3RHWF 3CXDH 1MRDH 4W81A 3MLYL 1CQYA 3D18B 1DEEB 1RZKH 5T5NF 5CCKH 1JNLH 4EIZC 4YXHH 4XPAH 3K3QA 2YXMA 4D0CA 3W9EB 2DQTH 1UEYA 1LQSR 2W0FB 2W65B 4OUUA 1HNGA 5DLML 1CGTA 4N1EA 3V2AR 1IGFH 4WI8A 5MERA 2F5AL 3B2UC 2A9MH 2VDRL 3OHXA 1R3KA 4F7EB 1U91B 3GEWB 1SEQH 1NAMH 4JFDB 1WZLA 1AIFA 1Q72L 1M71A 1UH2A 5KSVA 4BQ8A 3O8XD 1NLDL 3DECA 4GRWF 1GGTA 1HH9A 2P5EA 5EBGA 3BT2H 3PWUB 1Z5LA 4QRRB 3G08A 4OAWA 1G7IB 1ONQA 2DQHL 1LE9B 5F8QC 3TJEH 3V7AG 1IM3B 1BVLA 5ALBH 5IV2A 1UJ3A 1YN7A 4Z7UF 2NMSA 3HZYB 4H26B 2P5WD 5I8EB 3EOAA 4RQQA 3S4SB 4DKAA 1FIGH 3OJDB 4NP4L 1HH9B 2ATPA 3DSFH 2RCSH 2FHCA 1MPAL 4H5SB 1LE5A 5E4IA 3SQOL 3Q3GA 3WUWB 4HDIA 5TF0A 2HMIC 3MSPA 5J6GB 1WAAF 5KZCD 5CEXB 1PEZA 5CEYB 4IMKC 4IS6B 2GYSA 3V5HA 1B3JA 4WWID 3SE9L 3MXVL 4ZPTB 3WUWG 3KPLB 3ZT7A 5DJZB 1PEWA 3G6JE 1P6AB 3JWOC 3OAUL 3IKCB 5E5MB 4S1DD 4L8SC 3ZE0F 2Q7YB 5IF0A 4MQTB 3HFML 5C0IB 2A6DB 5FGCB 3DHMA 4L8SA 5C0JA 4PP1D 4PG9B 3S4SG 1FO0A 1D5BA 3RNKB 5I66B 3WFBL 5HHXL 3DMMB 4KZDL 1S7VB 2C4FT 4NFDA 5KJRH 4JDZA 1P7QA 1R3IH 2W59A 4LVNC 4KY1H 3ET9F 4QLRA 4JY5L 3Q5YA 1J0YA 2DQEH 1TTGA 2E8ZA 1T4KA 5HHMB 1L0QA 1Q8MA 3BEWB 3QT2A 5F7DB 2Y07L 1KCLA 3KPRD 1ZTXL 3IDYB 3HR6A 3MNZB 4AIZB 4JO2L 1JGVL 1I8LC 1FNFA 4EI5B 1A6ZA 1FJ1A 4Y4KC 2IQAB 5DVLA 4DTGH 1CS6A 2W9EL 3EKCA 2YPLB 3GDBA 1HHIB 2J8UE 5HHOA 1JZ5A 3CDYA 1S7XB 4D9QD 1RUAH 1TZGL 3R8QA 2YUZA 4J6RH 1DLFH 2ORBL 2EIZB 4Y5VC 5JQ6H 3O41A 1U58A 2GK0B 4R9HA 2DJUA 5CILL 3QEQD 5KAQF 1DBML 3LKNB 1A6ZB 2R0WL 1MLCB 3D69B 3IDIB 2BVQA 4OGYH 3B4NA 4JFDD 4IOSD 3TT1H 2DAVA 1P2CA 1EO8H 1FV1B 1G7QB 2OYPA 4I0CC 1U8OB 4YDJA 4Z7VA 1YEGL 5CJXA 4RBPH 3MLUL 4ZPVB 3FTGA 1AGEA 4OD3H 4WHYH 3AXLA 4OGAD 4HIHB 2EIEA 4HUXB 1A6WL 1Z9SA 1PVHA 3SBWA 3UXFA 3NN8A 4PJFE 3VFVB 1GVIA 1W0WB 3F62A 3WSQL 5FYLH 2NLJA 2FD6H 3HMWL 4DAGL 5HHQA 1FNAA 4P48A 5IB3B 4YXHL 5CAYB 2IFFL 4R96A 3QIUA 3MV9E 4KH2A 4XP4H 2ZUUA 1T1ZB 5C2BL 3WO4B 4KTEH 4P2RB 3S34L 2VXVL 2IF7A 2IBBA 4L3EB 1QBBA 1KIRB 3L5WA 1JUFA 3OTTA 4N0RA 3EYOA 4RZCA 5C3LD 4UIKL 1A6AB 3MLXL 4KJWC 4PJDE 2MKLC 3SGDH 1O7VA 1FVEA 2E7CA 4HWEL 1BD2E 4P46B 3G08B 5E5UB 2HA1A 3RWFB 3ARUA 5HDBF 1IBGH 1Y6NR 2VWEE 1I1CA 4NKIL 3EJJX 5FDYA 1ERNA 3ALXA 4S1QL 4PJ7B 3FT2B 3GBMH 2R2EB 3NIDF 3NFNB 1JN6B 4RZCB 2P8MB 3MUGB 4NDMA 2FEDD 4P3WA 2X4NA 5IOPB 1S9YA 4HIIA 4JRYA 1YC8A 4PG2A 4XH2A 4QHKI 4UBDC 1CFNA 1T1WB 4LCUA 1GRWA 3DYMA 3LD8B 3K4DA 4E0RB 5DURB 4XAKE 1CGUA 5E0QA 5L0QB 5DR5H 2WWMC 2BNQE 1HKLH 2FIKB 4F57L 2X4QA 4KTDH 3DIFB 1AY1H 4PLKC 1AKJA 2E6JA 3X12B 3GSRB 3VRIB 4WEMB 3ZHLA 1H3PH 2UUDK 5CUSH 3RDTC 5B3NA 4M7LT 1AQDA 3IYLW 3S36X 3ME0A 4DN4H 1W72H 4JO3L 1DSFH 1JZ3A 5GISL 2X70A 5DJ0A 3VG9B 1PLGH 1CFSB 1YNTB 4LPVA 2YS4A 2NYYD 4G8FB 5F9OH 1N2RA 3D9AL 5MEQA 1MEXH 4L9LC 1LILA 4OCYL 4ZD3H 5A40E 2DQCH 5ACLA 5FOBB 1HHHA 4M1GH 1OWWA 4KZDH 3FL7A 5CBAA 3H42L 3QO1A 2V5RA 1NKRA 4C54A 1J0HA 1MAJA 1LNUA 4I3GA 1SQ2N 1BJ1H 4KVNH 2WANA 3O11B 3MRGB 5FB8B 4L8CB 2VO5A 25C8H 5HHPA 5I9QB 2R39A 3ILPB 1BJ1J 4IIQA 4YIQA 4XP6H 1IT9L 3MV7E 4UNVA 1NCDH 3QDMD 5JA9A 3WHXB 1ZHNA 4M6MH 4TPRL 2DQUH 3SOBH 4PRNA 5FYKD 2YC1B 3IKKA 3VXPA 1FFPA 4M5YL 2AJUL 2DWDA 5BZWA 1EO8L 4JPKL 1DLFL 2ORBH 1MCIA 5HI3C 1YEGH 5C0BA 4UIMA 4TNVF 5F9WC 4NRYA 5MP6L 3QUYD 4HWBH 1PQZA 3RKDD 5D1QC 3RZCC 1JWMA 1U8QA 1XEDA 1C08B 1L9NA 1AXSB 4JY4B 3GRWA 4WUUB 4OGYL 5FUOH 3NFSL 2DQTL 3OSKA 3ULVH 5BMFL 3N1QC 4QY8A 3QUZC 4FQHB 3MRNA 1J8HE 3V4UH 4XCNB 2QADD 5TF1H 1EHXA 2WLYA 4Z7WB 5JW3L 1H3WM 2UV3A 2Q8BH 4XXCC 2YHGA 4OZ4B 1R3JA 4KI5D 1XGQB 3T3PF 1DQTA 3F7VA 4MB3A 3OJ2C 1F42A 3JWOL 3SE3C 3MRHB 3ES6B 4U6HA 3HI5L 4HLJA 1DQDH 4KROC 4NQTA 4Q6IA 3O4OB 2BCKB 4RDQF 4NRZB 4Q6IC 4Y19D 1J1OH 3FB5B 4N1CA 4PJAE 3MYZA 1ZA3A 4QOKB 4ALAH 2DTML 4HKBB 4LFHG 3RWHB 1AP2A 2G5BA 2HJLA 1XF3A 3NABH 5C2BH 1HH6B 2ZUQB 5IROA 4OLUL 2AEPL 5HGBA 1GSMA 3G5VA 5JOPE 1T0NB 5L8KB 3HCVB 1ES0B 1A7PL 4WEBH 1EGJA 3IXTA 1LP9A 4AZ8A 2IAMB 4FFWC 1QFWM 4X8XA 5F1NB 4AMKL 4HH9A 3SE9H 4OZIA 4Y89A 4NO5A 1IEAA 3QFDB 4ZS7H 5I18L 3JBG7 4MD4B 3C8KA 4MXWH 1ZHBA 1N6QH 5E8DH 3E3QE 4J3SA 3CSPA 4LKXB 1NPUA 1LHZA 4YGVA 3B3IA 4DFHA 4F58L 1LGVA 4ELMA 4HFWB 1QRKA 3P0VL 4ZUWA 4Y2DB 4N9GB 4GMTL 3TJHD 4OKVB 2OXGA 3U36B 5J0BA 3QDMB 4D0DA 5BS0A 1TZHA 3JTSB 1T2XA 3HI1A 2YSSA 3C9NB 1L6XA 3IRZA 2CRZA 1U8LB 4IJ3C 4QRTA 1K4CA 1KENL 2YMXL 4NQDE 1FLRL 2AJ3B 2ZWLT 3F6LA 3M8OL 4IHOB 4Y4KB 3DUUB 3DXAD 1QFWL 3NACL 1DP0A 5IKCB 4XRCB 4XBGA 4MX7B 1I3GH 1DQQA 3VFSA 5GGRB 4L4VE 1NCDL 4NSKA 2ZSVA 5JQ6L 3T3ME 5T1DH 2VXSL 3TN0C 2DDQL 5EBLA 1VEPA 3WD5L 2ARJQ 1A3QA 3CFIC 1HKFA 3P4OA 1BREA 3RGVD 2E27L 2V7HA 5I8CB 4EEEA 3ZE2F 1EEZA 2D0FA 5KANI 2NX5E 2N4IA 5AD0A 3KYOB 5A2FA 2W9LA 3RIFK 2HMID 3JXAA 3QQ4B 4W6XB 1F58H 1I75A 1NCUA 3SPVB 1A6AA 3N85L 1VACB 3KPSD 3ZDYF 3KYNB 3FT4A 1B4JH 3X11B 2FBJL 4WFEE 3N50A 5GGTA 4NN5C 2R4SH 1HHKA 4X9IA 3QUXD 2RR3A 2HJKA 2C3WA 4XMPL 5FM8A 5F72S 3BN9C 3TC9A 3I84A 3GMLA 1FNEA 1BLNB 1FGVH 3MRRB 1BAFL 5D72L 2QHRH 5IQ9B 3QZWA 3ULVL 5BZDB 1ZWIA 2EXWD 4G7VH 5A43C 2PNDA 4UNUA 3I50H 4N5ED 4ALAL 1YNKL 2HFFB 3ZKMC 3QB7C 1WWCA 4YHYC 4XPFH 4OLVL 1JFQL 1H9VA 5JIHA 3I3EA 5JLZA 1P2CB 2D9QB 4XVTH 4LDEB 1KXQE 5LXGL 1SYSB 1RVFL 5IVOA 3IDJA 4WEBL 3VXME 3TO4B 5DZNA 1Z3GH 1JPGB 5GSVA 4JM2A 3QFJB 3WHE0 4JZNB 3ROLA 5FYJD 1ZHLB 4LP5A 1EX0A 4OM1L 1RAMA 1N6UA 2M1KA 1VHPA 3B3IB 3QEQE 4PJBF 4B50A 1EBPA 5TJWK 3QPXL 2WBWB 4UOW1 2J5LB 4PTUB 1P4LA 1RULH 3I85A 3A6CH 4PR5B 2OR9H 2I60L 3I02A 1ZLSH 4J3OC 5DD3H 4HUNB 4JM2B 4CW1A 3C5ZB 1VENA 3V5KB 3ULVF 3STBA 3FOLB 2HP4A 1GHFL 1TJHL 4NNYA 5K59F 3ARTA 4UV7H 4OTXH 1CL7H 2EYSA 4Z7UB 1JHKH 3N9GH 4I9WD 5F96H 2AJXH 1FH5H 1SEBB 2AJVH 3BMVA 1FFOB 1RZKL 1TETH 2LTQB 1KXTB 3PNWB 4JDZB 2IBGA 2PN5A 4ODWA 3ARVA 5D70H 5F1IB 1T7ZA 3FQNB 4AG4L 1QSVA 4LPUA 4DKFH 5SX5H 1WGOA 2VNCA 3ZMRA 2GJZB 2YRZA 5KS9F 5EU6B 4PJ9A 1QLFA 3HE7C 3BQUC 1JPFB 4X6DE 2P5WA 3Q2CA 5GIRB 4M62H 4RISH 4ZPTA 2VXSH 3VFOA 1TENA 4MLSA 3VG9C 2DICA 3T2NL 2XN9A 4JG0L 2BHUA 5JPMB 5JHDB 4M1DH 4AK1A 1N26A 1NJ9A 3ULUE 1E6OL 1IE5A 1UYWL 3WXVL 1YN6B 1XF5B 1Q9WA 3DV6A 3F7YA 2XPGB 4NHUB 2UWEF 2XY2A 3NACH 3EOTL 3V5DB 3AB0B 5DQDH 2JB6B 5IMMB 4G8GE 1LE5B 4NM8H 2R15A 5KSAB 1K4DA 3THMH 5D1XB 3V7AE 2IG2L 4DZ8B 1CG9A 1U95B 3M1BA 1BBDH 3EDDA 4F7PA 2FECL 3IF1A 1KV3A 3VD3A 3SBWC 3AS2A 1K8IB 4W4OC 3RWCA 3ETBF 5E4EC 2J4WH 2VISA 2JKXA 1CL7I 3FO0H 2AABL 1KELL 2PCPA 2BFVL 2MWCA 2XWJA 1ZGLB 1Q1JH 2CLZA 3SDAA 2A77L 5FDWB 1LEKB 1S7WB 2P7TB 4MAUH 2NX5D 1D5XA 4YJZL 1L9MA 1OSPL 5D7KD 1MI5B 3DETC 4GG8A 4MGXA 3VFSB 3D39D 2I9TB 1P7KB 4A6YL 1R3KB 3OHXB 5E1HB 4LPCA 4MCYA 4DVRH 1FYTD 5CJQH 3W2DH 5D5MF 4ODSL 3L5IA 3ZKXC 3VWJC 2X70B 3I50L 2VUOA 2Q86A 1T1YA 4GS7C 4LLVA 3V4PH 2ZUVA 4CMMA 4KROB 3BAEH 2B0SL 3G9AB 3P11L 1DQJB 1YY8B 4YQXH 4G6FB 4R4NC 1F5WA 1KPUA 4LCIH 5GGVH 5SWZB 2EE6A 2PYEB 3D87B 5SX4I 5T1MB 1U8IA 2XZQL 3QI9A 5B38G 2YD6A 5FOBA 4LLWB 3IDXL 4Z7VB 3NABL 2HT3D 4HS8L 4NQVB 2ZUQC 1MAMH 3SQBA 5GS2H 4V2BA 4PB0H 5C6PB 1MI5A 3SDXF 4L29A 3MCG1 1JPSH 3D85D 4ODXB 2NY6D 3CPLA 2FX9H 3B2VH 2X1XR 3V5KA 3SKMB 3VFUB 2M8XA 4PJ7A 2HG5B 2LABA 1F2QA 1TZGH 1KFAH 1INDL 5BVPL 1CLOH 2NY1C 3UTZB 4XP5H 3VE0A 4L4VD 1CGSL 5CJXC 1X5XA 2D7MA 4X6CF 3RQ3A 2FWOA 1VGEL 1G7LA 3RTQA 2R0LL 4JFHE 3WFZA 1N6QL 3B8YA 4CN6A 2DOCA 4JR9L 1QLRA 3BO8B 3VXRD 2HVKA 3L5WB 1MCKA 3OKNA 2NY0B 5D1QD 3RZCD 1CR9L 1UACL 4PJ7E 1S9WB 5CEZD 4QF1B 5E2UL 3MFFB 3QULA 2XA8H 4GUPA 4YBHA 1JI2A 3AREA 3P0YL 3WO4C 2B1AH 3U4BL 2BP3A 1T80A 2FYYB 5JHDA 2CIKA 4I3SL 4Q6IB 3AAZB 1FZOA 4WO4C 3C08L 4YDVA 1GGCL 3L3GA 1B0RA 3TT3L 1R0AH 3BP6B 1LDPL 3QAZB 1JYNA 3QWOB 4DAGH 4NUJA 3TBYA 5BZDA 3MNVB 5F1IA 1DZBA 3RX8A 4HWZA 4U05A 1V3LA 1J9CT 1SY6H 4E41E 4X4YA 3SGEH 4OLEA 2HLFD 5ANMA 4PJ5E 3GMPB 2Q6WB 3WFCL 3RI5K 5F44A 5CJ5A 4LNRA 4R8WL 2NTFA 5DMKB 4WU7B 4HUUB 5GS2D 3P77A 3MODH 1XGPB 4OCWL 3AS0A 4L1HA 2BERA 2A38A 2BSSB 1A6UL 4K3EH 4BFIA 2ZCHH 1MHEA 4C56A 3A67L 4LSSL 1CDHA 4MDIA 3MRPA 4U1KB 5ALBL 4Y4FD 4HG4J 1UYWH 3EHBC 5F6IB 1BBJB 2FX7L 2ZUWA 4YHNA 3DSFL 3OKDA 1MCOH 2ADIB 3MRMB 5E24E 3FRUA 3MJGX 3H9SB 4P9MH 5E1AB 1A21A 3KWWB 2GW5A 4PJGB 5IHUH 2BNRB 2IG2H 5J56B 4JHZA 4XNZB 2X4OA 4M7LH 2F74B 2R1XA 4KJPC 1WSST 1S7UA 3NIFF 4GXVL 5ERWA 2J4WL 5I1LA 5DQ9B 4X6DB 1U58B 3VXRA 4ORZC 1ACZA 2QHRL 3HMXL 5C07E 1Q1JL 5TH2A 5ESVB 1UM6H 3EDFA 3UJJH 4JFDA 4TVPL 4G8GA 1YJDH 3BRGC 3G5XA 3U7YL 2ITCA 2VSDA 2EH7L 2VMFA 1JPST 4NFBA 3B6SA 5I6XB 2IQ9L 4XWGH 2AQ3A 3F58L 2D3VA 1BIIA 2F53B 1F8TL 1YMHB 4QRUB 2EKSB 1NLBH 5I74C 1UZ8A 1C5DA 2R9HC 4PGCA 5KJRL 4PGZA 1FGNL 2Q7YA 5IF0B 4AIOA 2C4FU 4N68A 4HUVA 5TQ2L 3ARBD 3LKSA 4OCYH 2YD3A 4RMQA 3WIFB 5DK0B 3F5WA 2ZUSA 4F7TA 3GJFB 3B5GA 5J7CC 2NR6C 4O4YL 2MQCA 3MV8D 4EDXB 4R7DA 3QI9C 4MQ7B 2QHLA 5K9QG 5E94B 3UMTA 1PG7X 5E7FA 1CGSH 1YMMA 2A6JB 4NPYB 2YEZB 5IMLA 4KJYB 3GSUB 4XNUH 3A6CL 4HF5L 4RFOL 5D1QA 3RZCA 4PJ8D 2OP4H 2VJXA 2Q3ZA 2HVJA 2YUVA 5HDBE 1OL0A 2HN7B 3IJYB 5DD3L 2NZ9D 5J11C 5K9JH 3MLUH 1YUHA 2H41A 3IETA 2BSRA 3D39E 4OBRA 3TLRA 5D6CB 1CF8L 3I6GB 5CEZE 4P5TC 3EGSB 4AIXA 3LZFH 5CEXA 2DF3A 3I9GL 5IFJA 3M07A 4G42A 3DUSA 3TIDA 4FXGB 2VLRA 5DJDA 3DI2B 3K1KC 4XI5C 4JN1H 5F3HB 3GUTB 2ICWB 3D5OF 2DM7A 2JIXB 4X6FA 2HN7A 4X6FB 1UVQA 2HRPL 1JMZA 2HKFH 1OWRM 4K8RD 4HKXB 3L7EA 2QQQA 3H0TA 4L4VB 1IGYB 1WCBB 3K2UL 1F3RB 1U8MA 2AK1H 4ZODA 5E8NB 1CLZH 5IB1A 3EZJB 5T1LA 4QRRE 3RI5F 3HE7B 1DLHA 2BY2A 4NRXB 1Z9MA 1UA6L 4HH8A 5FGBA 4OZGA 2PXYD 3MV7A 5IBTH 2Z9TA 2AXHA 2GSIB 4JKWA 4DWHA 3L9RB 3CVHH 4F9LC 1T7WA 2EDEA 3FCTB 4PRBB 4RX4A 3HE6C 3GI8H 4MNGA 1DBBL 1SBBA 3VXNA 3S35L 5T1KD 4QGYA 2OR8A 3TH4T 4YFDB 3H7LA 4F7EA 1KN2H 5DQDL 3T65A 3QR2A 4LRIC 2MCPL 5KN5A 5GGSA 5FO9B 4HFWA 2HH0L 5FHBL 5JXEA 1G0DA 1A6TB 1M4KA 4Z7VE 4JY4A 1XZ0A 5HHME 4W68A 3V0WH 1FORL 1DANT 3UP1A 5D7IF 3SDXB 4H1LG 5C0BB 4TTDD 3RVVC 1PSKL 5F93C 1MLCA 2AV7B 4UQ3A 3WN5C 4HK3N 4UTAL 5DD5H 4JY6B 1B0WA 4QHNA 4JO1L 2HT2D 4WHYG 3VGGA 1UJTA 2NNAB 3MRBB 2VQ1B 2Y06H 1NC4A 5HPOA 2BNQA 3VFMA 4ZAKC 5JR1H 5TE4H 1ZE3C 1RZKC 4ZOCA 1MFDH 3GMMA 2R0KL 2VLJE 1F90L 3ARQA 4ZFGL 1MCHA 3BQUB 3CDFA 1RV6X 3CX5K 4X9FA 4HAFA 3WHE1 1WWBX 5IVXF 4H20H 4IRSD 4F58H 3REWB 2Q1EA 4YHML 2ICWI 2HFEB 3MCLL 4HXBL 3T0EE 5KVEL 2FEEL 4U0RC 2XICA 2AK4A 4O2CA 4PY8J 3LCYA 3BZ4A 4RFNB 5ACMA 4EDWL 1HN1A 2BXYA 2ADJA 4HZLB 4F2MB 2B7DT 4NQVA 4PJ9D 4MSWB 2Z93B 3HNTH 4KVNL 5ANMB 2FSEB 2WK2A 1UKSA 4OIAA 4FQXB 4IBLT 4ZUTB 1OAKL 2XKNA 1JPSL 5E8EB 2XRAL 5A2LH 4JKKA 4ZD3L 5FKPA 4MZ3A 2CMRH 5I15L 4M61A 3VFNA 2AJUH 4ZUVA 3QDJA 1TVBA 4LLUA 4LNRB 4MNQD 1BZQK 4P2QD 4OUOA 4XT1C 3T1FB 3PP4L 2IADA 1BD2B 2PTTB 2R56H 3NGBB 5CMAA 2R2BB 4MWFA 4XH2B 4BQ6A 2DMKA 3IVKA 2FEEI 1MHHA 4X0KB 3PHOA 5EU5B 1D6VL 1VFAB 1KLUB 2AJYH 2CLRB 4MJID 3QSKB 2GJ6D 2NY0C 3RPKA 1OQOA 3HUJE 4K8RL 3PGFH 1QVOB 3MO1A 5EC2A 5IG7B 3MRDA 3CLEL 3WCYA 1HINH 4ZO7A 3QNZB 1QLEH 1F6AA 3ZKNC 4MJ6B 3AREB 1IM3A 3F7QA 3X3GH 2BHYA 2AXJA 3DVNA 1TCMA 1EZVY 3OG6B 5D6CA 2EEAA 3GSVA 3VE0B 4LEXL 3KPSE 2XN9E 2Q8AH 1PG7W 2KBGA 3DVGB 4M93B 3VD7A 4TOYH 4HHAA 1G6VK 1NEZA 3MLRL 4PJXF 1DQDL 2P5WE 5DVKA 2OBGA 3VRLE 1QLRB 1E27A 4KHTH 2X1QA 4JZOB 3EFFB 1ZHNB 4YHOL 4Y16D 5J3HC 3I6LD 1EHNA 4PRHB 4NBYB 3GMRB 4OZIF 1SY6L 4J4PC 2F5BL 5JTWA 2FEDC 3G6JB 3DGGB 1NFDA 4L8CA 1IM9B 5E2WL 4UBDD 4YO0B 3QUKB 4G7VL 1U3YA 1NCNA 2OQJB 4CN1A 1HZHL 4BH7B 3TBVB 3PABA 5IWLC 1QPPA 3L3JB 5CIPB 1NGQH 1CZ8L 2RCSL 1GPOL 1YA5A 4HPOL 2Y5TB 4XNYH 5GGQL 3CNKA 4JDTH 2OZ4L 5C0CA 2V9TA 3NOIA 4TUKL 2CIIB 4PRIA 1YPZA 3KPMB 2MNUA 4Z5RA 3FB8B 1F4WL 4LAQL 3SGDI 3T65B 2R4RL 3BZ4B 5HVFB 2J8HA 4BM7A 4PJ5B 3VFWA 1TJIL 3TZVD 4P2QB 4JZJB 3V6OE 1J05A 5JXEC 1L7IH 3NCCB 5E2JA 2BSED 3TF7C 4X7FC 4Z0BH 1YY8A 5CFHA 3SGEI 1JF6A 4GAFB 1NCAL 1F3JA 5L6YH 3O9WD 2HKHH 3P0VH 3G6JF 2X9YA 4GXVH 1KIPA 3U2SA 4WCYL 5D7LE 2I5YH 3CDCA 1OLZA 2BJML 4I0PD 2APXA 4POZD 1YMME 2DRUA 5HBBA 3KXFB 1TVDA 1BQHB 3S96B 4ZOEA 4OF0A 2LAAA 1UWGL 3HCVA 4ZYKB 4UTAH 4FZEH 2O26U 1NAMB 1DN0B 1RSFA 3ARXA 4EDWH 5HGHB 4DZ8A 1I3UA 1A1MB 1IL1A 1V7MH 1QQDA 4JY5H 4EOWL 1F8TH 1OTUD 4C56B 3VGEA 3TPUA 3BKJL 2FGZA 4GMTH 1X4XA 4PRPB 1ZLWH 1KPRA 1A0QL 3GMQA 2UY7A 1MH5A 1EAPB 4MNHA 1NQBA 2ERJC 5KOVC 2IJ0C 5IP4A 3VXSD 3TV3H 4DGIL 1A6VL 4HFUH 1AR1D 2DQJL 3BGFB 3PWLA 3W39A 1U42A 3MV8E 3VWKA 5J12C 1MHPH 4L3AA 5DMJB 1YEHL 2VXTL 4Y19A 3SDYL 1G9MC 4W4OA 4XPGL 2E7MA 3UDWA 5DJZA 1FV1A 3FQUB 5KSBF 3MJ9L 5IB3A 3B9KD 3O45A 3AAZA 2FBJH 5FO8A 4WUUA 3PWPA 5DJCB 1LO2H 4FQQA 3TFKD 5LAXA 4I2XB 2BMKB 4ZSOA 4Z78A 1T3FA 1CICB 2PYEE 5I1EL 3VDBA 1KUMA 3WNOA 3P9LB 4Z77B 2EKSA 1HE7A 3D69A 2VDLH 2C7UB 3EW3B 3ZSSA 2MPAH 4XMKH 1A1OB 4QWWC 3EIFA 2BZDA 5TDOA 2V2TB 3MJ8B 1IC1A 4BH8A 5IBLC 1A9BB 4OCXL 2CKBB 5EZLB 3NVQA 2W0PA 1NC4B 1B4JL 2VWEC 2A77H 3EYFA 3P3YA 3RDTB 1MFBL 1BPVA 2GI7A 1OGAE 5CD3A 3GNMH 4POYA 4RAVA 1YNKH 4OZFH 3GK8H 4CADB 4E41A 2YOCA 2UUDH 5D1ZB 1YEIH 3DPBA 1CFBA 1ZT1A 1JJUA 2F54B 3RX7A 1OF2B 5FCSH 3BOVA 3KAAA 4TSAL