4TUJB

Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody against neuroblastoma ass
publication title Structural Basis of GD2 Ganglioside and Mimetic Peptide Recognition by 14G2a Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tujB01
4KJQD 4S1QL 3VXSD 3QIBB 3FQUA 1D3CA 4XRCA 3H0TB 4HFUL 4KTYA 7FABH 1PQZB 1QFOA 2WQRA 3S35L 2BVPB 5CEYB 1JNLL 4LEOA 2JJTA 2P24A 1FLRH 4HIIA 4Y2DC 2ZCKL 4WI9A 4G80A 4K7PH 2A77H 1PFCA 3QHZH 1FNGA 1DQMH 4QEGA 2VL5B 2ZUXA 1ULVA 3S34L 4FQIH 1J88A 3KPLA 4XCEA 2P5WA 2MSPA 2V5RA 3IU3A 2EKSB 3EIFA 2DIBA 5IFHH 3OPZH 3IDYB 3B9VA 3QIBC 3VFVA 5IB1B 1CR9L 4ZNEE 2O61A 4RBPK 4JJ5B 3RP1A 3TZVB 3O2DH 4ALAH 4YHKL 4FP8L 5IK3A 5DZLA 1DQJA 2ADGB 3GKWH 3QIUA 2HTKD 4GKSB 4P59L 3T65B 1MHEB 1FFNA 3GSXA 4U1IB 4M7LL 3WS3B 5J1AB 4NNYA 5CZVL 1NAMA 2YD9A 4XNZB 3VWKD 4C56A 1ZWIB 2FECI 2AP2A 4PRPD 3WJJA 3BDYH 2OR7A 5MHSD 3RZCB 1MFEH 2YA1A 4A6YH 5J0BA 5DJ8A 1KXVC 3QISA 2I24N 4PJ5D 4G6KH 2V5SA 3TZVC 5EU7E 3ROOA 3SO5A 4M61A 1NGPH 3FO0H 4HW6A 2Q6WB 3P3YA 3T2OA 4MMXC 1T7ZA 3QO1A 3BEWB 3DI2B 3G5YA 1ZT1A 2C3GA 4KTEL 1KPVB 2X1WL 4UU9A 4PB9H 4XNZC 1XR8A 4YBQD 3EJZD 4G9DA 4JEGB 4HCRA 1GZPB 3H6JA 4OM1L 1O5DT 3RZCC 4O5LH 5B39G 4X4YB 3ALWA 1IAII 1T22A 5LBSL 2DM4A 2Y06L 4XP1H 4QHUA 1QSFB 3X14B 4JZJB 4RISL 4ODHH 4I18B 1R0AH 1LDSA 1YJDC 2VQ1A 3PWPA 4GRMA 3FN0L 3T8XB 3GZKA 1FC2D 2D9CA 2JJSA 4P5TA 5D8JL 4TVPL 3NFSL 3LH2H 3VE0B 5F89B 4U1MA 1A6WL 4EOWH 4YE4H 1KENL 3GB7B 4Z7VA 3L3GB 5HGGS 5MENE 3CMOH 2ZUYA 4WTZA 5HPOA 4Y5XA 4I18C 3BIAX 4WWKB 3BKYL 1S7XA 3RKPA 1KULA 1F6AB 2F8VA 3BPOB 3FQWB 3GMRA 3KLAB 4KK9C 5F7DA 4MJIE 3LKQB 2ZWLT 2EYTB 3GSWA 3O8XA 3P4MB 1NLBH 4JFOB 3QG6B 1JZ6A 3QUZD 1OGAB 3ULUF 2IBGA 3UMTA 2XA8L 2DS4A 4MNHB 2Q7YA 4WWKC 4RRPG 2ZNXA 3MRPB 1H0DA 2A73B 3FO9A 4EUPB 3BPOC 1M05B 1JF1A 1JWSA 1BZ9A 2JELL 1LGVA 5LXGL 5KOMC 5LGKA 4JPIB 3QQ4A 4Z7WA 3IJYB 2ICES 1WWCA 2HFFB 3DTXB 2PO6A 4M5YH 4LKCB 1CQKA 4QRUB 5KVEH 1FGNL 2G75A 3N85L 1CDIA 2OZ4L 4IEFB 3HCVB 5H2BB 1NC2D 4ZDHA 4YBLB 4MJ4A 2OXHA 5CLWA 1TJIL 3SBWC 1EFQA 3CFBA 5HYQA 1INDL 1ZT7B 1WCBA 1U8PA 1WICA 4LPYA 2J8UF 4R3SB 4PJHE 5FYLH 2X1OA 3X11A 5HGBB 3D3VB 5CGYC 4X4ME 4ODVL 1N64L 2YKLH 2W9DL 3BP5A 3WS6C 2IWGA 3BIKB 3RTQD 4H0GA 5GJSH 1NAKL 1NGWA 3DVGA 4XCCL 1Q0XL 2O5XH 3TBWA 4YBLC 5EB9A 2NTFB 3SCMA 5FOBB 4BFIB 5IF0A 3ARXA 3E1F1 3RU8H 2I5YH 3OKMB 3DMMD 2VDLH 2PF6A 2IPKA 3I3EA 4HUVA 1ZHBA 3BZ4B 3MREA 5E94B 5DJYB 2R4RH 1R24B 1BLNB 4DKAA 4ZFFA 2YPLB 3QXAB 3ZHLA 2W0PA 3U30B 4G6FD 1MCIA 5D5ME 4PJIA 4QXGL 5GGSA 4DUVA 5JHDD 3V6FB 2FR4A 1UXWB 3B8YA 3RWHA 4JO3H 1CGYA 2CDEA 4P9HC 3FOLB 5C0JB 1UWEL 1FZMA 3MJ9H 3OAUH 5CIPB 4P3DB 2X4RA 3VRJB 4LRIC 3L7EB 2AXGA 2B1AL 4HF5L 2EICA 1XGTB 1C5DB 2JTDA 4G8IA 1SJEA 3NCBB 3U30C 4L29A 1G9NL 5IROA 4PRIB 4ODUB 2W65B 1MAJA 1EXUA 1WQVT 2ZSWA 1NGXB 3SE3C 4R4NC 3MRIA 5JUEL 2QR0B 2QSCH 1VCAA 1D5BB 3PV6A 2DD8L 2J6EA 4JG1H 4HDIB 4NT6B 3UJTH 2P5ED 5ID0A 4JFFD 4WI5A 3PXJA 2MQCA 3UDWA 4C54A 2BNQB 5DUPL 2X9XA 4UAOC 2DL2A 2BRRH 3T2NH 1OAYL 5AAWA 2R0WH 3BYTA 2R0LH 5DA0B 5DK0A 3P30L 2A6DA 1OT2A 1TIUA 1J0ZA 4LNRB 3LPGA 4Q9QL 4I5BB 1RUAL 4OD3H 5GRUL 3MOBH 1DBKH 2FJGA 3UX9B 1P4LB 1U2CA 4MCZA 2Z31D 3CZFA 1M6OA 5CBAB 3OHXB 1RURL 1EAJA 1GIGL 2ADFL 4Z0XB 3U0WH 2P8MA 3B9KB 3V2AR 3LRHA 5KVDL 1EERB 2NX5B 5JHLH 4PRHE 3LN9A 5E6YA 5DI8A 2XFXB 4LBEA 1GOFA 1CICA 2KZWA 5T1LA 1A8JH 2E8ZA 1A6PA 3Q48A 1BPVA 3KYMB 4OFVA 2NY6D 2EH8H 2H32A 3THML 5IB3A 1RZGA 4QRSA 4OLUH 4TVPD 5TPWL 3GSNH 5TQ2L 3ILPA 2ZUQC 3BDBA 4JE4B 3DHJA 3L5WA 1UH4A 5HYSB 1QNZH 2HT2D 3CFDA 4BUGA 4GG6A 1DBAH 3B9KC 3GJFA 1G9MH 2R2EA 5GGUB 3KPNB 3LS4L 3OGCA 4R4BA 2RFXB 5TDPA 1Q1JL 4LSTL 3BQUB 3QUYA 3PHOB 4HZAA 5E00B 4HS8H 5C0EB 5IM7A 3HG1B 4Q9RL 5JDJA 1MF2H 2VXSL 3K1KC 2V2WA 4KRMB 3KLSA 3F7QA 5C0CD 4OCWH 1J1OH 1EAPA 4X98B 1JE6A 2VLKA 3QWOB 3OKOA 3FRPA 4HX1B 4OLVL 3O41B 1I1FA 3IJHB 1TDQA 4ZXBC 4HUWB 4IHOB 1LE5A 5DC0A 5FGRA 4J8RA 1RZ7L 4PJCA 2C1OA 3BQUC 2HP4A 4S2SB 1YECL 5HGAB 3QRGL 4P2QE 3QFJB 1F42A 5CSBA 3T09A 4QHLA 3KJ4B 3GNMH 1PJ9A 4L3ED 1A14L 1RIVH 4YUEH 5DEFA 1K85A 3H9SA 3O3EB 4EDXB 4YNYB 2PETA 1FNFA 3UCRA 3RGVB 4EXPX 1IVLA 2DKMA 3HZKA 3QUKB 3ET9F 2HKFL 2ICWA 4ZPTA 4WCYL 1K4CB 1EUUA 2PR4H 3P0VL 1LE9A 4MD4A 2EC8A 2YZ1A 4ZUWA 5DYOB 1P4IL 2FJFA 4Z7UB 4N90D 4M1GL 3KJ4C 1U8QB 4YWGH 2C7UB 5FM5O 1V7NL 2FATL 3PGFH 2QHRH 4YXHH 5IB2B 1FH5H 3RGVC 1GOHA 2AW2A 4G7VL 4NJAL 3EO9H 4FFZH 3D39D 3DIFB 4I0PB 5L2KA 5F7FA 3ZTJH 3EHBC 2D7OA 3RI5K 1T6VN 4F7PA 3RWCA 2G60H 2E27H 1U3JA 5IIEB 4YGAB 3QUXB 1OW0C 2LU3A 3T0EE 1BQHG 5GSVA 5E8EA 2NCMA 1LWRA 5ITFB 3O6FA 5EIVA 3OKDB 1RSFA 4Q9CA 1AXIB 3AVEA 2I07A 4I0PC 3MUY1 4OZGF 3OJMB 3KR3L 4LRNH 1WV7T 4UQ3A 4JFQA 5T3XL 2YUXA 2EDJA 3OX8A 4NGHL 4PJ7E 1LEIB 4ZOBA 3MV9B 1QFWH 4M00A 4XBEL 3IS0X 1G7QB 2YBRB 1U8IA 1FFOB 3ARBD 2G5BA 4R2GB 5T3XE 1YDPA 5IVXB 4OCRL 3QUXC 3P9MA 3UJIH 5I8OL 2NR6D 3IXAA 3UYPA 5C8JA 2APXA 5D71L 3L5HA 4LQFL 4P57A 5EO0A 2KBGA 4LSUH 5FK9B 2V5YA 1MHHA 4BJLA 43CAB 1MCKA 5EOCJ 1QRNB 4S1RL 5MEQB 2YPVH 3RWFB 3GSQB 4S1SH 4RFOH 4MB5A 3AMKA 1R3JB 4YXLL 1CLOH 4PV9B 5E56A 4K9EL 4R2GC 1MQ8A 4JFDB 1Z9MA 4HUUB 3S36L 3WN5A 1DUYB 4OM0L 2P5WE 5JW4R 1S9KC 3VWJB 1CT8B 1UC6A 3OF6A 2FH8A 4NSKB 4MXQD 4TOYL 3QIWA 3TCLB 3B3IA 1A6AB 1ZHLB 1GYAA 4XPAL 1ZOXA 4CJ1A 3M8OH 3RWDB 2NQCA 5C6PB 2H9GB 1F97A 2BSSB 4KKBD 1Z5LA 4L8DB 4Y1AA 3VXRB 4KQ4L 4LK4A 5C1MB 3N1GC 1DBMH 3TVMB 3FZUC 2CIIA 2JF1A 5FYJH 5IWLA 5AYUH 1FZKA 5D7SL 3ZYZA 1P9MC 3VWJC 2HMIC 1IZJA 2H2PD 4BSVB 4NO0A 3GSUB 3MRBB 5JIKA 5JOPD 1S9WA 5I75B 2VABA 5CJQH 1WAAA 2JE8A 4X7CC 4CVZA 1H3PH 5HHMB 1N8ZB 3JBG7 1YC7A 5IESH 1ZT4A 1B9ZA 3QWRA 5SWZB 4OZIA 3QDME 2P8PB 3HAEH 4HCRL 1U8MA 3RUGB 4LLQB 1MCCA 5DEGA 5D4QA 3OKNA 3EOTL 3TVMC 4IS6B 3WIHH 5DJ6B 1MCOH 3ARFD 2AS5M 3NFPB 1C08B 5DSCA 1AP2B 1BBDH 2DQJH 3U9UA 3PWVB 2IQ9L 3U1SH 5I75C 2DQTL 2YD6A 1FN4A 4L4TB 1T2JA 4XXCC 4K8RH 3QDJA 1MVUB 3HHRB 4ONGH 4PJXB 2OK0H 3DSNA 1MLCA 1DVFD 2DJUA 5AD0A 4KK6D 1IC4H 3M17B 4R9HA 3PWPE 3VFOA 3BMVA 1KYOK 4V1DE 2JCCB 2BMKB 3RVUD 2D0HA 5ESAA 5IW6A 2R1XB 1YEHH 2D31A 3MBXH 2AK1H 1HDMB 3HE6D 4MQTB 5T1MB 4KI1A 2OLDA 4MHHG 5C0IB 3ARPA 4I2XA 4K7PY 1KV3A 1IKFL 3TBSB 5DRNA 2UUDH 4H5SB 2X1QA 4Z7VE 4OQTA 5IB4B 5DJCB 2VISB 5DD6B 2HG5B 4AM0A 3CFJB 4HIJA 2DMKA 2EEBA 4M4PA 4U1NB 4XTRD 1CFSB 2ESVB 3EYVA 3G08A 5EULV 3TP4A 4IBLT 4RFNB 4L1HA 4QWWC 5H35B 2CKBH 4JPKH 4B0MM 5LWYL 2EDTA 4TNVF 3SKUD 3LQAL 2X40A 2RGSA 1ZTXH 4FOMA 2NY1D 2ILLA 2BHUA 4HD9A 2PXYB 3BKML 4X80H 5DGQA 5C09B 1XH3A 3STZB 4ZD3H 4CADB 2VLME 3ZKMD 3Q5YA 2J12B 3UO1L 3KPOA 3JWDL 4LCWD 2EXWC 2CO7B 4GMSH 1PZ5B 4TTGA 2XN9D 3C2AL 1LP9B 4G7YL 3MRJB 1U8NB 5BZDA 5TQ0L 4WEMB 3RWGB 4RFNC 3INUH 3U2SA 4ESKA 2IAND 4ZTOL 4UOW0 4X8JB 4IRSA 4FQXA 4XZUB 4LLDB 5GZOD 2OP4H 2PXYC 3GMNB 2A6KB 3O2DA 4L9DA 4OBRA 4QGTA 3ZE1E 3DGGB 3TJEH 3WHE0 3WKNA 3JTTA 4GKZA 4PR5B 2F53E 4N8CL 2F5AL 4WHCA 1MUJA 2DRUA 5CJ5A 3MR9A 3BUYA 2AQ1A 2CD0A 2WBJA 4XT1C 4IMKA 3WLBA 1QBMH 1NBYA 4PJHF 4WY7L 1NFDA 2BFVL 1MFCL 3CK0L 5E2TH 1V8HA 4A6YA 2A1WL 1S9VA 3E6FB 3RVTC 1TFHA 5CD5D 3VFRA 4K94L 1JGDA 3U46B 3DX9A 2FO1A 1CDCA 4M6MH 2VLRA 3JTSA 4HGKC 5DFTA 1JHLL 3VG0L 1T83A 3QXDB 1S7UB 4XVUC 1LO5B 2PTUA 4TQEL 4QXTB 5F9AC 1OP5K 5I1AA 3X3FL 4TRPH 4DGYH 3MLUL 3SDDA 4AENB 2PW2B 4NOBA 4HQQL 1HILA 3MRHB 3QDHA 3RJQB 4KMTL 5KSAA 4O2FA 3ZTNH 4NO2A 1OQOA 3PNWB 4J23A 4PJIE 3Q5TA 4GQ9H 5D5MF 4WNQA 3CCHB 1AGFB 5BS0B 1KN4L 5FO9A 2E9BA 4R0LB 4QOKA 3L5JA 4JDTL 1RK0B 3T2QA 5GRJH 4DZ8A 1P7QB 3V4PH 5J9PB 3OKEB 1BQUA 1XF3A 1Q0YL 3WUWB 4O4YH 1R3LB 3D9AH 3QIUD 3KPMA 2VSCA 5EOTA 3KXFB 4PRAA 4XP6H 4F2MA 5IBTL 1EGJL 3CH1B 2GTWA 1UM4H 2AEQH 4JKPH 5FM4A 4O2CA 4C56D 3DVFA 5CJXA 2J6EL 4YHOH 5C2BH 1KB5L 1W0VA 5JZ7D 4XNQB 3VXTA 1CLYH 3U82B 3MNZB 3S5LA 1IKNC 4OB5H 4R0LC 3MBEB 1RJYA 2HJFB 3IGAB 2A6JA 2MOVA 2R15A 3GMMA 4LARH 3BDXA 5JQ6L 4L8CA 1W72H 4AIZA 4XMPL 1C5BL 2CGRH 4KK5C 5A2JH 1Z2KA 1DBBL 3M07A 5JPMA 3WXWL 3HMWL 1MJ7L 5KN5B 3ULVD 4PTUB 4WUUA 4KRLB 3UP1A 5HHOE 3JWNC 3MRKA 3MBEC 2KQNA 4DWHA 3TBTA 5DHVH 5J6GA 3C6LA 1JFQH 2OS7A 4WFHD 5FHBL 5HHPB 4M9PA 3GIZL 3W11D 4L4VA 2A6IA 3MJ7B 3I6GB 2ZJSL 5I1KH 2QQKH 4F8QA 3CVIL 4M93B 3UJJL 1KXQE 1I9JL 5IFJB 3TPUB 5EPMB 1X4ZA 3B5TA 4KH2A 5K59E 4P5TD 4G3YH 4MNQD 5K9KB 1JGLL 4WW1B 5I1IL 4RFEB 2O5YH 2Z35B 2FL5B 1NCUA 4HJJH 1KACB 3SE9H 5A2LH 3QDGB 3DGCR 4FQCL 5FYKH 2EDHA 3MLZH 1I7TA 4M1CD 5GGTA 5E1AA 1L0QA 3I50H 3HUJB 4LSVH 1YEGH 4M93C 4XXDA 1EEUA 1AQDA 1RUMH 4NUJA 2ICCA 1YEDA 3RBGA 2YMXH 3W0WE 5AAMA 2ED8A 5CZXD 5GS0L 2NZIA 2Z93B 3I85A 4NRZB 4X6DE 4NKDB 4PRNB 5EZLA 1TENA 2CLZB 4KROD 3MRCB 1REIA 5I1LB 5E03A 2I60H 4JREB 3SJVB 1G1CA 1ZAGA 3QUMH 4LMQI 4M7JL 3TIEA 2YRPA 2DWEB 1K6QH 4N0CC 4R7NA 1R3KA 3L1OH 4ZS6C 2GT9A 2PYED 2Q20A 4JY5H 1IM9B 3CXHJ 1G7JB 1PEZA 3WNMA 4G8EA 4JFEE 4LSPH 5D7IA 1XF5A 3K8KA 1OD9A 1QR1A 2OQJB 2YUWA 1MJJA 3NCEB 3X3GL 5DT1H 1VERA 7CGTA 5JIHA 1K4DB 1L4IA 4PY7A 1HH6A 4AJ0A 3DOSA 4QO1A 1IGJA 5GS2D 2X4PA 2HN7A 5IJVB 5E8PA 4LVEA 1YQVH 3KPPA 2XNAA 1KN2L 1I8KB 3MJ9A 2DBLH 3CIQA 3H9SE 1LO2H 4Y8DC 5CUSL 4XAKE 4JDZB 4PJAE 2GK0A 5DRZA 2A2QT 5HGHB 4L9LA 5CS7A 4RAVB 5CCKL 4LSDA 4F33A 4OGYH 4AL8H 2ARJQ 1QBBA 3MCKB 1RK1A 3P0GB 1IGML 4NHUB 3D85A 3VFNA 4P2YA 3TF7C 4NYLA 3QSKB 2CLRA 4N1EA 1S5IL 1OARL 1I1AB 4GW1A 3LEXB 4H1LA 3HPJB 2WWMD 3VGEA 1F4WH 2MKWA 4D9LH 3UPRA 5D72L 3Q6FB 2DDQH 1RY7B 1IAOB 2BOCA 2F54A 4MHHI 3SCMD 3BKJL 1G7HB 2Q76B 1P2CA 3MXVH 3FO2A 3TT3H 4LCYB 4PJ8A 2CUMA 5CEZE 1A7OL 5L2KE 3I6LD 2AGJH 3LZFL 3V0AC 1FVEB 1T21B 4UQ2B 4GAGH 3AREA 4WHTB 2J2ZA 1B2WH 2MNUA 1I1AC 5E8OB 1MIEH 4PP1D 4O58H 3GMQA 1Q9OB 3UYRH 5FCUL 3GDBA 2MJWA 1JZ4A 4QNPE 3GO1H 4HC1A 1U8OA 4I3SH 4U3CA 3CPLA 4M7KL 3TIDA 3LKNA 5K9OA 3EYUL 3TM6A 5TDOA 3EJYD 4X6FA 1EUTA 3HC3H 3DECA 2OR9H 3ALPA 5DRWB 1T1ZB 1N3NB 4ONHB 4W4OC 3BD4A 5T5FH 5M95B 4PJ7F 1GL4B 5DZNA 4EN3A 3SDAB 1N59B 4JHAL 1CZ8L 4CMMB 4EEEA 5T3ZE 3DV6B 1B3JA 2M1KA 5LQBL 5GRVK 3GSNA 4WW2A 4IRJD 1YUHA 3BO8B 5EOCH 3RWEB 3LRGA 2DN7A 1DQQB 2F19H 3BP7B 4JRYD 3MGOB 1VA9A 3KG5A 4MWFA 4OGZA 1MNUL 1HXMB 4HKZA 2BOBB 2X2YA 1T7VA 4HH9A 5ANMA 4OLYH 3ZLQC 1BVKA 2KH2B 3MUJA 3S96A 4R4FL 1UWXH 3REVB 3SDAC 2DJSA 5DVNA 4OUUB 1KCUH 3RDTA 2EIZA 3RY4A 1A3RL 1GZQB 1OOAA 4YPGB 2GKIA 1MI5B 2QLVB 4CKVX 4K7FB 1QLFA 4MZ3A 1HHHA 2JIXA 2SEBA 3KPRA 1QYGL 1BOYA 1A2YB 5KS9E 2V6HA 1DE4A 2FLRT 3SGDH 1N5YH 4Y4KA 4DFIA 2BHZA 4ZSOA 4M5ZH 1BD2B 1X5IA 1UVQA 1VFBA 3ARDB 5E5MA 1RFDL 1UG9A 3GHEL 4M62H 4Y1AE 3CFKA 1NGZA 1ZANH 2N4IA 1EO8H 3OTTA 5F1IA 2J8UB 2GAZB 2KPNA 5CSGA 3ZSTA 1VB9A 4HT1H 3ZDXE 1U8LB 1OB1B 3BGFC 1EBPA 3QXUA 1WAAE 1MCLA 4NQEA 3C5SA 4O2EA 4PRBA 3ECBA 1BZ7A 1GJIA 2NXZB 2V9QA 2Y07L 3MTRA 3VXOB 4OZIE 5FAAA 2VLLB 2XY1A 3QZWA 2L7JA 1I8LA 1QSED 5LAXB 3F7YB 5DWUH 4JFZL 2DQUL 4P2RA 4S10A 1KLGB 1U8KB 3L3KA 3C5ZA 2G2RB 3S35X 3WNOA 1KC5L 1K2DA 2NMSA 5D7LB 3QQ3B 1WFOA 4LPVA 4F7CB 3GI9H 3QDJE 2ARWA 3SDYH 4BKLB 3CSYB 3R8QA 2NXZC 3OKLA 1U92B 2ED7A 3IU4L 5HYEA 3KDMA 4PGJA 1J05A 4OZ4B 3HNSH 1FFPA 1OP9A 2VLKD 4XMLH 5C9KA 3IDIB 4NRXA 3ILQD 2Y7QB 1IC5L 2OSLA 2IAMA 1K5NB 4BH7B 4U1LA 4MAUH 1CF8H 3FT2A 5IV2B 3D0LB 4OQTL 3OMZA 2VKWA 1F11B 5ENWA 1JZ5A 5DD3L 1EZVX 3CVHB 2GUOA 4DCQA 3IDMB 4NKOB 4DN4H 3RVWD 4ETYA 3RY6A 1AXTH 2X9YA 5AZ2H 5HVWA 1NANI 4OTXH 4BK5A 4WGVB 4Z7VF 4QY8B 5C0FB 4F80A 3NGBB 3GSVB 1X4XA 1YN6B 2HT3D 1GGCL 2RHEA 4NHCH 3P4NA 3B6SA 4OLEA 4Z7NE 4JO4L 1FE8H 3IFOB 3ZDZE 2JLLA 2LVCA 2FO4B 2H2SC 1FNEB 3WIIH 2C3VB 2QADB 7FABL 1ZS8A 1JTOA 5IVNA 3UTTA 1B0GB 4NJ9H 1FLRL 4ODSH 2AVGA 3PABB 4JN2B 4K7PL 2A77L 5HI4C 5L8JB 1H15A 3QHZL 1KIPA 1BFTA 2E6PA 1HYSC 3NGBC 3B2UC 5HPMB 4YC2B 1CE6B 2CK0H 5KSBA 5IFHL 3OPZL 4LPXA 1IEAB 3ZYIA 2JB6A 4PGBA 3MV7B 4GXUN 3TV3H 2GI7A 1OTTD 4Z7WF 1YYLL 3AROA 2QADC 4ALAL 5C07D 5F3HA 1GGIH 4WRLA 1A6ZA 4LHUA 3GKWL 4QRPD 3FRUB 4G9FE 4X5XB 4OT1H 1TNMA 1J1PH 4U1GB 2VZVA 4YC2C 4PRPB 3ZE1F 1S78D 1EMTH 3O9WB 1XGQA 3LHPH 1I3UA 3BDYL 3UTPE 3TN0A 1DQDH 1MFEL 3QPXH 3L95A 4HGWA 1J8HE 1JK8A 1RZ8A 2Z8SA 1WBXB 4U33A 3TYGH 2HTKC 1NFDE 4XVSH 2E7MA 2PTTB 4ERSH 4MJ2A 3FO0L 5F3BB 4LCIH 3VGDA 3PV7A 3VXUB 5HBBA 5CFHA 4G42B 4EDWH 2B20A 4U1GC 2VLRE 2LFGA 4RDQF 1KTDA 1TTGA 2N56A 5DQJB 1MIMH 1YY8A 2QHLA 3O9WC 3HAEA 3S4SB 2YD3A 3PJSA 3MRNA 4X7DC 1IM3B 2JJWA 4XI5D 2XWTB 3WIHA 4O5LL 5D9SA 1ODAA 1TCRA 3FQRB 4XP1L 4J3VA 4DKDC 2ORBL 2YC1A 4P4KD 1G7LB 2Y5TA 1BAFH 4ODHL 4Y16A 1AY1H 4HIEB 1R0AL 1T6WA 3HRZB 1GXEA 4YBQC 4Y19B 3EJZC 4LOUD 3AS0A 4PJIF 3RZWA 1IGCH 3OF6D 4P5MB 4EVNA 4QOKE 3OWEA 5FDWA 3WIFA 3DX8B 3O6KH 2BVYA 2DMCA 1D6VH 2GQHA 4GMTH 5T5NG 4EOWL 3UTQB 1HKFA 3O11B 3MJ6A 5CBEB 1XGRB 4W6XB 3DYMA 3HZMA 3Q3GB 3CMOL 3RL1A 1FZJA 4UIMA 4PG2C 3I3BA 5LGHH 1XEDA 4D9QE 5FF6B 4CDGC 2EE3A 1R5IA 1S8DA 1ED3B 1Q9KB 2OR8A 5HGDA 1JHTA 1I8MB 2Q86A 3SGJA 3BH8B 3UTZB 1M7IB 4JKKA 5GGRA 1NLBL 2DM2A 3TBYB 3RVXD 3HZVA 4LHQB 3IKKA 2VR4A 4NDMB 2CKBA 4LSSH 3TWCH 3PWLA 2AJUH 3JV6B 1BHGA 4LL9A 2AV7B 1NCNA 4E5XB 4XWOD 5D1XB 5EWIH 3CX2A 4WUUE 1JI1A 1QR4A 3RKDC 2X4OB 4EI5B 2VZTA 2BRQA 1UQSA 5CHNB 1NJ9A 3EGSB 4FTVB 3DV4B 3B9EA 3BD3A 4NQUA 5CGMA 1DEDA 4YFEA 4PJFA 4NO3B 3HB3D 4M5YL 3BGAA 3W39A 5KVEL 3D2UA 5F1KC 1IEBA 3AAZB 4N9OB 1I1YB 4OZGB 1JGEB 3MJGX 1D5XB 2WIMA 1PG7W 2V7NB 2C4XA 1OSPH 5AWNH 3MRLA 4LDOB 1E27A 3G6JA 2X70A 5D1XC 3CZJA 1F4HA 4QTHB 1PAMA 4DEPB 5K59F 1JJUA 3VGGA 4EI5C 1NGYA 5BJTA 2DIJA 2R2BA 1E0OB 5FYLL 4H0HB 1NUDA 2YKLL 2FHCA 4GXUM 5GJSL 1N2RA 3WFHA 4LEXH 2H8PB 1OQXA 3IDGB 2XKUA 3VCLA 2O5XL 4HS3A 4H8WH 4MQXC 1AE6H 1XR9A 3RU8L 4DEPC 4L8SA 4NRYA 4ZFZA 4YIQB 2IF7A 3V8CA 4X6DF 3S8WA 5D7KD 3IAPA 4X0KB 5DMKA 3EDDA 1UJTA 2R4RL 4NQXB 1CDHA 5A16A 2HLAB 4AEEA 4XCYB 3F65A 4R7DA 4B7LA 1KBGH 4R26H 4KHXH 4EIZC 1I3RB 4OZFG 4D0CA 5D7IE 1NC4A 1KIRA 4JO3L 2AJ3B 2BCKB 4PJBA 3MJ9L 4OZHA 3AC0A 3OAUL 1MCPH 1DDHA 1QSFE 5JO5B 1U95B 4PJCF 5HJ3B 2CRZA 4GW5A 3LRSB 1ZA3B 4IRSD 2EO1A 4I0CC 4TSCH 4AEHH 5ICYA 1FYTA 4MJ5B 1UADC 4RMRA 3QXVA 1NEZB 5CWSA 5D1ZA 2R9HC 4ODTH 3CC5A 5I73B 3MNWA 1S7QB 1AGEA 4FA8A 2BVOA 5I76B 4ZUSA 2QSCL 3TC9A 5EFIA 4JG1L 3OB0H 1Q9LA 3UJTL 5ACZB 1SYVA 2V7HB 5TE4H 1NL0L 5J3HC 1RJZB 4I3GA 2BRRL 1DLFL 3T2NL 1YA5A 2FYYB 3G6DH 5FXCH 4OV5A 4AYFA 2B39A 2F54E 5CEXA 3UAJD 4JFPA 3EDFA 3VXQB 2R0ZH 2R0LL 4PGEB 5D6DA 3BWAB 4FMFA 1PYWB 3MRRA 1W72A 2F58H 5FGBC 5I73C 2WIIB 5LCVH 2I9TA 2APVA 4BELD 4GFTB 4OD3L 4C83A 1QBLL 4ZOCA 5EU7C 3MOBL 2AEPH 1CDBA 1SEBA 4HPYH 3H9YA 3KS0J 1UXSA 3U0TB 3CUPA 1F58H 3QI9B 5DHVA 1BFOB 2XG4A 3MO1B 3P73B 5CP3H 3U0WL 4ZUTB 4XPFL 5DD0H 4GH7B 3MYJB 4QNPF 5EH1A 2FHBA 5JHLL 1AH1A 3N9GH 2YSSA 4NQVA 2V17H 1Q72H 3GK8H 1D7FA 4JRXA 2NY6B 3KPSD 4UZGA 1JV5B 1T5XB 1OM3H 2FWOB 2GK2A 3AM8A 2EH8L 2VXTL 4B53A 1RHFA 5HDBE 4LKXA 5MENB 1Z9SA 3GSNL 1UJ3A 2B8OT 3VD5A 4OFKA 1EO5A 2VZ1A 4OAWB 4TPRH 3F7VB 3O6MH 4KJYA 3QI9C 4QHNA 4UV7L 4XHJC 1QNZL 2EEDA 1DBAL 3K4AA 2VLJB 2NY4D 4N0FA 2AXHA 1G9ML 3MRFB 3S3SA 1MWAH 4HKXB 1A4KA 4HWBH 3SDXB 2NY6C 4JPVH 1TZHA 5KSUB 3AMLA 3VD4A 4YO0A 4X5WB 3LPWA 1CD1B 2WP3T 3WYRA 3QO0B 4X6EB 5MEPB 5IR1B 2MKLC 2YEZB 5D6CB 5SWSD 4HS8L 1CXIA 3MOAH 4WFFD 4XGZB 4ORZC 3TBVB 3BI9X 5C0CB 4ZG1A 1IAIH 1X9QA 4N9GA 3B5HA 1NDMB 5E2JA 1MF2L 2HYMA 1D9KD 4DFHA 3QUMA 5F21B 4Z78A 4PV8A 4OCWL 1J1OL 4HK0A 3T0BA 4GSDH 2NLJA 4M48H 4ZOEA 3NCYS 4Z76B 1OTUD 1E4KC 5E8NB 2YD4A 1BOGB 3C6LD 4NO5A 5K9JH 5KS9F 5EU6A 4L4VD 5BW7C 4RMVA 4PJDB 3MXWL 2X6MA 1RIVL 4YUEL 8CGTA 4LLMA 4ZPVA 3TA3B 4DTGH 4MVBD 5HDOA 4MX7A 1DLHB 5DQDH 2X89A 3N50A 1MH5A 2PCPB 4FFYH 4KZEH 5IMLA 1RZFL 3MZTA 3P11H 4PJHB 3QULB 3UTSD 2PR4L 1DL7H 4NQEE 2QSVA 1UB5A 2I9LA 4DQOH 1LEKB 1WAAF 4OI8A 3BZDA 1KG0B 5H94A 1YEEH 4JJHA 1NEUA 4C57C 3C8KB 1WJ3A 2CK2A 1KYOJ 2FBJH 3BP4B 4PRIE 3I84A 2R23A 5CSZA 5FYLD 4YWGL 4OZIF 3PGFL 2QHRL 3HMXH 4YXHL 3TA3C 1FH5L 1BIIA 5IP4A 1AGCB 3C60D 5ICXA 2DLFL 2Q8BH 4QCIA 3EO9L 1XZ0A 2V2TA 4CL7A 5EOQH 3LKOA 1JWUB 2P7TA 5I18H 2BXYA 4MCYA 1XCTA 1KCRH 1XCQB 2G60L 1LVEA 3S36X 3UBXG 2UYLA 3FQTB 1PX4A 3MPCA 3O6LH 4ZO8A 1INQB 5D5MB 1OSZB 4KK8C 2FEEL 4NWUH 1T89A 2BVTA 3W2DH 1M71B 3GUTB 1F2QA 1B0RA 2BNRA 2UY6A 3IDNA 4X6BB 3O45B 1RV6X 4LRNL 1NBZA 1H5BB 2BDNL 4UTBH 2B2XH 2ZG1A 1IC1A 1A3LL 5GGQH 5ACMA 1QFWL 1AJ7H 1CVSC 4DGVH 1S9YA 2X9WA 2GY5A 1ES0A 3ESUF 3WO4B 3NCFB 4YHNB 2OTUB 3BISA 1FL6A 3UJIL 1A1OB 2NY2D 3TGXA 3MA7B 5A2FA 3DWTA 3WEXA 4Y4HA 3VI4E 3SPVA 4LSUL 4W6WB 1CGUA 4J3TA 1FV1B 3WNLA 4Z7NF 4LAQH 3NIGE 3ZDZF 3WUZA 1H5BC 3JUYA 2YD5A 5B38B 2YPVL 2DQFA 3UTTE 3DI3B 4H88H 4X7TB 5L9DH 4S1SL 4XH2B 1VGKB 4RFOL 4BQ9A 3O4LA 1INEH 2NR6C 1CLOL 3P2TA 3WO4C 3RBSA 3T1FA 1JN6A 5IMMB 4HHAA 3DO7B 2P45B 1EO7A 2XKNA 4ODWB 4J3UA 5C0AD 2JK5A 1NCAH 1G9NC 1XIWD 1A22B 4JAMB 5DK2B 5KSBE 1EA9C 1FNLA 1MFAH 2ADIB 5E6IA 3HG1E 5EZJA 5DTFB 4TSBH 3ARED 3P9LB 5LGJB 3HE7D 4U7MA 2IGFH 1MEXH 3M8OL 3BN9C 2D7PA 3QJFB 2E3VA 5KJRH 1IT9H 3W9EB 4PRHB 1L6ZA 4LCUA 1DBML 2V2XA 4MGXA 5FYJL 2E7LA 5AYUL 1BECA 4MXQC 4JKLA 4ODBD 2X1PA 4GT7A 1FRGH 2BY3A 4BYHA 1CG9B 5FYJE 3V6OA 5EBWA 1H3PL 3DUSB 4U3HA 1ACZA 2PW1B 5IJKA 4EN3D 5IESL 5JLZA 3PG2A 1NFDF 1X7QB 2UVFA 3QNZA 5A3ID 1T0MA 2IADB 1T1YB 4YR6B 4TUJA 3LQZA 2J5LB 4AT6B 3WIHL 1MCOL 1N0LA 5ADOH 4KJWC 1BBDL 2VERN 2DQJL 4NKMB 5IB5A 1BJ1J 3V4VH 2NNAA 2P8LB 3U1SL 3RPIB 2D9QB 2HWZH 2GSGA 4K8RL 2YN3A 2P42B 5EU3B 1NGQH 2RR3A 4ONGL 2BVUA 3BGMA 3CSPA 2OK0L 1TJGH 5F1OB 4PREB 1IC4L 1LD9A 3V5HB 4XNMB 2BXZA 2CR3A 1HOCB 2C3HA 1FL3A 4JFHD 4JQVC 4D8PA 5F7EH 4YHIA 2J5LC 1X6LA 2JIXD 5DUML 5F9DC 2UWEA 3KPRD 3P77A 3TH2T 2CIKB 1A0QH 1YEHL 3MBXL 2VDKL 3SY0A 1JYXA 2AK1L 3BEVB 4P2QB 2Y36H 3IETA 1U8JB 4YGVB 3GMPA 4OF6A 1DEEA 5CMAA 4RGNE 1HHGA 3GSRB 3BP6B 4TULH 1Z3GH 5FHAH 4NOFA 4ZUVB 1AGDB 4PBWD 4LF3A 3L6FB 1NUFA 1AD9A 3HI5H 1WFNA 5BVPH 4PFEA 3D0VA 5C0NC 3MV9E 3WLWD 4ZAKD 3DHMA 3M1BB 5FB8B 2CKBL 5IVXE 2Y4SA 1ZGLM 4FZ8H 3V0WH 3EFFA 3NZ8A 4BH8A 1ZTXL 1BF2A 3OGOE 1GGTA 4IMLA 2ADJB 4X80L 1QQDA 1H8NA 4ZD3L 3WE6B 3NTCH 4IRZH 1NBQA 3TH4T 1MFDH 3FHQA 5C7XH 4GMSL 5TGBB 5I0ZA 5SX4I 2LV4A 4KXZI 4ISVA 3MGTA 2X4TA 4P4RA 1ROWA 1LNUA 1WIUA 3INUL 5BVJB 3SE4A 4LLUA 1L9NA 4JFDE 1T3FB 2OJEB 3T0EB 4U0QB 2FX8H 3ZKMC 5AUMA 2OP4L 3U0PA 2OJZH 3DXAE 5FKPB 1MCWW 4Y2DA 3RFZC 3U6RA 3TJEL 5EU4A 2IAMD 1G7PB 2CRMA 3VFPB 5ESVA 3KYAA 1CLCA 4PJ7B 1EFXA 3OSKA 2YRZA 4PLJC 4DGIH 3MC0A 1RZIB 1W2KT 2Q87A 2O5ZH 5D7JD 1QBML 4JY4B 4NQCA 4FN0A 4HJ0D 4HK3J 1HINH 3T0EC 3H0TA 2EYRB 5E2TL 5CINH 1PQZA 5J11B 3MV8A 2CRIA 1N6VA 4JO2H 3FQUB 4M6ML 5KOVC 1TNNA 4XRCB 5HHME 4BSWA 4LEOB 1UZ8A 2ENYA 1TVBA 2P24B 4TRPL 4DGYL 2EXYC 3BRDA 3I3DA 2Q8AL 1IFHL 4DKEL 4G80B 1RUQH 3T04D 2D7TH 3RUGE 1FNGB 3K80A 1RD6A 5IB1A 1FNSH 4U6YB 1PX3A 4XCEB 3KPLB 3ZTNL 4NN7B 2B1HH 2P5WB 3IU3B 1S7SA 4F57H 5J11C 4CNIA 3WDHA 3TFKC 3VFVB 4GQ9L 1AQKH 2NXYD 3OXRA 4L4TE 5D7IF 4PJBE 3TO4B 1MHEA 3AB0B 3T4AA 1JYVA 1H8SA 5IK3B 1DQJB 2JJTC 5J1AA 5GRJL 3QIUB 4LGRB 1FIGH 3BWUC 4O4YL 1J0JA 3D9AL 1FFNB 3GSXB 1I8IA 3HI1A 3RZCA 4XP6L 1E6JH 4NNYB 3WSQH 1WK0A 2APWA 2AEQL 3QCVH 4NN7C 4WTXA 4JKPL 4WEUD 4UNVA 4K9EC 1I4FA 4P3WA 5C2BL 4KDTA 4Y0GA 4XPBL 2AK4E 4JANA 5DJ8B 1F4XH 3UBXI 1CLYL 1F4AA 3AB0C 5BV7H 5E08H 3ROOB 1K8DA 3C2SA 4A2MA 4M61B 2BC4A 1KPVA 2D4FA 3Q5OA 3QIUC 4RGMB 4LGPB 1ZLVK 2LE9A 2X09A 3LS5H 3QDMB 2IG2H 3QO1B 3LD8B 3OR7A 4LARL 3G5YB 4KZDH 3V7AG 2IH3A 4OCSL 3STBA 1W72L 1ZT1B 2OMBA 3VXSA 4OV6F 2P4AB 4UU9B 1XR8B 4LGSB 4G9DB 5JA9A 2CGRL 1A7PH 3EO0A 4Z5RB 2X4NA 3WJJC 5E2WH 4NZTH 4JZJA 3KS0H 5IBUG 1J18A 3WHXA 1T22B 4K3EH 4N8VA 1JFQL 1M7DA 4QHUB 2N1KA 4RGMC 2D03H 2GCYA 1A64A 1FL5A 2IQAA 3LD8C 3PWPB 1IRAY 1I7ZB 4GRMB 1A4JB 5I1KL 3U4BH 2QQKL 1KF9B 4FQ1H 2A0LD 4M9OA 4ZO6A 1LP9E 2ZPKH 3BFOA 3CD4A 3U4EA 4G3YL 4N5EC 3RA7H 4U1MB 1ZV5A 2HRPH 1KPUA 2O5YL 1F02I 4WWKA 4HJJL 1T0PB 1CXKA 5TF1H 3SE9L 4Z7VB 3ARYA 4RX4D 3MSPA 3W11C 3FQWA 1R3IH 5FYKL 4Y5XB 1I9RH 5HI5D 5EG6C 3MLZL 5HDBF 4XWGH 3I50L 4LSVL 1YEGL 4TN9A 2F8XC 5FYKE 3GMRB 2VR9A 2JJSC 1RUML 4JCLA 4P5TC 3HZYA 3QG6A 1T1WA 2YMXL 4WW2F 2QKIA 4PJ5A 3GSWB 2DAVA 4MNHA 4N0UA 1QO3A 3LKRA 3O8XB 3B83A 1IGFH 3MRPA 2I60L 1Y18A 3B5GA 3LV3A 3QUML 1AO7E 2VL4A 2XZCH 4Y5XC 2Q7YB 1H3VA 4HFWA 1K6QL 4JQXA 1H0DB 2X7LB 3L1OL 4EIGB 3FO9B 3T2PA 4NM4H 4JY5L 2MQ3A 1JWSB 1BZ9B 2AJXH 2BSRA 2VWEE 3DTXA 4MD5A 4LKCA 3SGEI 3QQ4B 4LSPL 4Z7WB 3HCVA 4KROC 1EEZA 5DT1L 3O8XC 2PO6B 3VGHA 2XT1B 3GBNH 5E8DH 1B88A 2G75B 4M1DH 5EU6E 2XZZA 5EORH 4RZCA 2VDRH 1YQVL 2EYSA 4S11A 4ZDHB 4Q6IB 3TYFB 1U41A 2DBLL 3LQAC 1J10A 3CFBB 4XX1E 2F53B 1WCBB 1U8PB 1CI5A 3BIKA 4OGYL 4AL8L 2AJVH 5DMIH 1NAMH 3JWDC 3X11B 2PO6C 1YMME 2EDFA 2NTFA 5FOBA 3BP5B 3KXFE 4NCDA 4ZUUA 5KVMC 5BQ7A 4R6UA 4JG0H 2C3WA 3DVGB 4LLYB 3D6GA 4D0BA 1TMCB 3SCMB 1F4WL 4D9LL 3O3AB 5IF0B 5KZCB 4MQ7A 4ZFGH 2DDQL 3ARUA 1VHPA 5E94A 3TESA 1R24A 4JM2F 2YPLA 3BOVA 3QEUA 4U3XA 5ISZA 3QUZA 2YN5A 5F7KC 1Q8MA 1ZHBB 5I1HH 2AGJL 3ULVH 3MREB 1FPTH 1MCNA 5ALBH 5KVFH 1WT5A 3WFCH 4GAGL 3VH8A 2NZ9C 4NFCA 1B2WL 1UKSA 2EZ0D 4PJIB 5GGSB 4O58L 3WJLA 5FCSH 3UYRL 1JUFA 4UT7H 3SCMC 2FR4B 5TE6H 3GO1L 3RWHB 2CDEB 4I3SL 4U05A 3OR6A 1FZMB 4K94C 1UCBH 2X4RB 3MLSH 2OR9L 3V0VB 2NY0B 1KLUA 3QEQD 5CP3A 4POZD 2AXGB 5BOPA 1RPQA 1J86A 3BESR 3CFIC 3TEUA 1NC2A 2X41A 4NUGH 5T5FL 2FIRT 1SJEB 1QVOB 5C86A 5INCA 1FLTX 4UV4H 3HTLX 1JYNA 1G6RH 1FYTD 2D7QA 4NT6A 1AKJA 2E7BA 2IJ0C 3IDXL 4PJEA 3SKNB 3MRIB 5EOCL 4JR9H 3PV6B 2F19L 1YZZA 4E41A 5EA0H 4HAGA 3VI4F 1YC8A 1KB5B 5ID0B 4APQB 1J11A 3UBXB 4OLYL 1MWAA 3F12B 4FFVC 5DF0A 5EC2B 1L6XA 4HWBA 5I15H 4I5BA 4Z8FH 5F9JA 5IROC 2A6DB 3CSBA 4AMKH 3DMMA 1GOGA 1JPTH 1VACA 2YD2A 2W9EH 3U36A 5FO7A 5EBLA 5AZEH 2AKRA 2LVEA 4N0RA 1F4YH 2P46B 2R0KH 5BRZA 4UIKH 5KSBF 2FJGB 2VZ3A 4MCZB 1FG9C 2MQ0A 2NX5A 1M6OB 3CZFB 3UDWC 5DD1H 2HTLD 2OXGA 5JHDA 1N5YL 1JZ3A 5L7XH 4NBZB 4M5ZL 2P8MB 5GS2H 4M62L 3KYMA 5E70A 1IGYA 1ZANL 4LBEB 1EO8L 1CICB 3AXLA 5T1LB 4I9WD 5HYJD 2VDQH 1U3HD 3WNNA 4HT1L 1JWMB 1RZGB 2XV6B 5HDLA 4QRSB 1VFMA 2J7LA 1NBVH 1PGRB 1WBYA 3V6OE 2QJDA 1M4KA 3ULUH 5JOFA 5C0DA 3GHBH 4XHQA 4GKNB 4JVUA 3T4YA 2Q1EA 2FLBT 3KJ6H 3SEPA 3FCTA 3L5WB 5EBMA 3L3HA 3CFDB 1HCFX 1IEHA 3GM8A 4KRPD 1IQWH 3GJFB 5CEZD 4JKMA 2R2EB 3OGCB 4R4BB 5TDPB 1BFVH 5DWUL 8FABB 4GLRI 2RBLA 1CICC 4X6DB 3F6LA 4TUKH 3QUYB 2AJZA 5DJZA 5GS3A 5IM7B 3K2UH 4K7PX 3GI9L 5IBLD 1WTGT 3O41A 1NCCL 3SDYL 3R1GH 3B2VH 2V2WB 3JVGA 4KJPC 3JWOH 1EAPB 3DURA 3OKOB 3HNSL 1AXSA 3VD9A 1I1FB 3F62A 5HGAA 4F7MA 4XMLL 5KVGH 1LO4H 3FN3A 1LE5B 2HFGH 3DSFH 4J8RB 5FM5M 2UWEE 4PJCB 5ITBH 4D0DA 1SVCP 2DLGA 3QUYC 1G7MB 2Z31A 4KKLD 4MXWH 2WNGA 5IMKB 5GS0C 3A0OA 3CU1A 4OGXL 4QHLB 5T3ZD 1CWVA 1A3QA 1WZKA 4DN4L 4KVNL 5IW3A 1KOAA 3ETBF 3FT4A 1RMFH 5DEFB 3QAZB 3PHQA 1AXTL 3H9SB 2FEDC 5D2LA 5AZ2L 5F44A 2DI7A 2EDDA 4OTXL 3MNVA 1CBVH 4QRQA 4EUPG 5IHBA 4X9IA 3HZKB 4U2ZA 3ILQC 3LN4B 2X89D 2ICWB 2X4UA 2HRLA 3O3DA 4ZPTB 4NHCL 4PGCA 1U8QA 4QRRE 3ZHKA 1LE9B 4MD4B 3TH3T 2FZ3A 2FJFB 1DN2A 3WIIL 4GG8A 5IG7A 4NJ9L 3QAZC 3DIFA 5D2NA 4I0PA 5IVXF 4ODSL 3KYNB 4HLZG 3KHOA 1GC1H 2DYPA 4POUB 4Y5YA 5C08E 1XF1A 1L7IH 4IJ3B 5DC4B 5L2KB 2CK0L 1HKLL 5IIEA 4F7PB 1FO0H 5FUCC 3RWCB 1OY3B 5AYQA 5J06A 4M6AA 5ITFA 1X5LA 1KGCD 3K3QA 4AH2A 5F88A 1YYMH 1GGIL 1WCQA 1V05A 5E8EB 5GSVB 3RHWK 3O6FB 4KKCD 5EZIH 4OT1L 1E6OH 2DIAA 2BNRD 4IJ3C 2I07B 4KGLA 2I25N 1ZLWK 2YZ8A 1FFOA 4HIXH 1EMTL 3VXMD 3LHPL 4UQ3B 3CGTA 4JFQB 1MCJA 3QA3A 4L3EA 5EUOA 1OTTC 3PQYE 3FKUS 1TVDA 1DQDL 1BD2E 3QPXL 2R69H 2G5BB 1IAIM 1YDPB 2H32H 4NQCE 3TYGL 1S7WA 1FNAA 3P9MB 3CXDH 2BY2A 4ERSL 5HVHC 3SDCD 4LCIL 1VENA 1I1CA 2J8UE 3IXAB 3O6FC 5C8JB 1QRNA 3D48R 3FOMA 3RWFA 2P47B 4P57B 5EO0B 4EDWL 3MV8E 5I8EA 2HKHH 3QP3A 12E8H 3DYOA 1MIML 4MQSB 4HUUA 1KIQB 1OP3K 4RMUA 1P9MA 4GBXD 1GHFH 4UBDC 3FFCE 5MP6H 4NSKA 1R5WA 4MA8L 5C6WH 3O4LD 4WWID 1IQDA 1MCEA 1XFPA 3MLRH 1BAFL 1A6AA 1FAIH 5E2VH 1ZHLA 4E42A 1AY1L 2W1NA 4F9LC 4PRDA 1KJVB 3BT2H 4Y88A 3U4AA 5IMOA 3QIWB 1IGCL 5KS9B 4XI5C 3G5XA 4LCCA 3O6KL 1FGVH 3TVMA 4PJBF 1D6VL 4GMTL 4JLRA 2EDNA 4OZHF 3U7AA 4E9LA 3VFSA 4Y1AB 3MRBA 4FRWA 5DMJB 4Z0BH 3C9NA 1Y0LA 3HLAA 3WN5C 3BSZH 4WIQA 4F7TA 4MXVE 4XXCA 1KPRB 4LOUC 1FZKB 1X4YA 1HHIB 1N8ZA 3KLHD 4I4WA 4NO0B 3MLVH 2J4WL 1S9WB 3H2WA 3OKKA 5DFVC 5LGHL 5K9QG 3FMGH 3QIWC 1NCBH 2NW2A 4P99A 4DKFL 4KUCF 4BK4A 4CVZB 1MFNA 4NZUH 3OV6A 1PY9A 4HGMA 3ARBA 3C09B 3FFDB 4HV8A 5TH2A 1ZSDA 1QLRA 1ZT4B 2MCPH 4IS6A 5DJ6A 1YMHA 5ETUA 4OZIB 1AP2A 4OJFH 1CK0L 2WUCH 3IXTA 5DEGB 1XT5A 3JV0A 3OKNB 3VXSE 4DN3H 5F7WC 3EKCA 3TWCL 5DSCB 5IWLC 1AC6A 1J0KA 2AJUL 4LFHG 4XVJH 3U9UB 4PJXA 4OF8A 4X9BA 4YX2H 5EWIL 3M17A 1FN4B 4HS6A 3QDJB 3P40A 5EZOH 2OL3H 3C09C 3BMWA 1TQBB 2Y23A 3FB5A 2JCCA 1QLEH 1MLCB 5AD0B 2BMKA 1V3JA 1A9EA 5LKNA 5HYSG 3O3UN 5D1QD 2EIDA 3VFOB 2J88H 1HDMA 4HUMB 1F6LL 3FB7A 5C0BA 4PPTA 4TTDD 5ESAB 3RNQA 5IW6B 3EYSH 4RWHA 2D31B 1OSPL 5AWNL 4RIRA 3PWNA 2VISA 3FQXA 1LK2A 1LP9F 1HSBA 2CKNA 4QRTA 4LNVA 1J5OL 1KJ3H 1J0IA 3JV4A 1TQBC 4AM0B 2D4DA 2KQMA 3ARGA 1WF5A 4HIJB 5TJWK 5B39A 4PRPE 4WFGD 4OQ1A 5H35A 6CGTA 5ILTH 3EYVB 5MHSE 5I74C 3G08B 5DD5H 2Z0BA 1LHZA 4H8WL 4PJ5E 3DJ9A 4H25B 1C7TA 3BX7C 1AE6L 4G8GD 4ZYKA 2A9MH 3STZA 4JPWH 5BMFH 2YPKB 4HEME 2X4SA 2YK1L 3QHTC 4TVSa 2Z8RA 5DRXA 5SWQA 3ARFA 1I7RB 1XH3B 1CTNA 5C6TH 4DAGH 1CDJA 4FQPA 1ACYH 4YZFE 1BBJA 1U91B 3RWGA 3KPOB 3EW3B 1KBGL 1LILA 4KHXL 4R26L 2ENSA 1VGEL 5FKAA 5BZDB 5F6HI 3QHFH 2PTVA 1CLZH 4LLDA 4ORGA 4MA3A 2C4FU 4P23D 5A2KH 1DVFA 3KYKH 3VFMB 5E9DA 1MCPL 5GHWH 4IRSB 4FQXB 1F13A 4G9FB 5L8KB 1GRWA 2D7MA 4JN1H 4OLZH 4TSCL 4Q2ZA 4AEHL 4L8BA 3JTTB 5I1DA 4GKZB 3HE6A 1J0YA 1NANH 5C0RH 4Y2DD 1N0XH 3LMJH 4GS7B 1MUJB 4GOSA 3WV0A 4ODTL 3MR9B 4RRPA 3BUYB 3NCJH 2WBJB 1EFXD 1J8HB 3TNMA 3LN5A 5DMGC 3WLBB 3MLWH 3BPCA 1NFDB 1X5JA 4QHMB 1M1SA 4IRSC 4A6YB 3QIBD 4FQXC 5TE4L 3W5NA 5CD3A 3VFRB 3CXHK 1JGDB 3DX9B 1V7MH 4J4PA 2VLRB 3JTSB 3AY4A 3G6DL 3MLTA 2C4FT 1TTUA 1WFUA 3QJHA 2R0ZL 1AHWA 4GS7C 1WGOA 4R96A 4YFLI 1FJ1A 3SDDB 2F58L 2WUBH 2WBJC 4IMKC 4I3RH 5LCVL 4QTIH 1HILB 2HJKB 5DFWH 2GJ6A 4HPYL 5KSAB 4O2FB 1RUPH 4NO2B 4AQ1B 1QA9A 4LCWA 1F58L 3UC0H 4FP8H 4IDLA 2XN9A 1F3JA 1HNFA 4WNQB 1T83C 3TO2A 2UY7A 5DD0L 5FO9B 3RWJA 3FO1A 4QOKB 2XWJA 3LOWA 3N9GL 3CH1A 4J3SA 4DZ8B 3ISWA 2V17L 1HHJA 1Q72L 3GK8L 3SDDC 1XF3B 2W92A 1OM3L 2FECL 3KPMB 3WFEH 3DVNA 5ACLA 4PRAB 1X5FA 2Z9TA 4F2MB 2GTWB 3RIAF 2FIKA 5KSAC 1UWGL 3D69A 1PW3A 3L3IB 4TPRL 3RZCD 4JZOA 2GSIA 3DX7A 3O6ML 4K71B 1F3DJ 2HJFA 4O2CB 1WWWX 4Y5VA 4PJEE 1MCBA 3VXTB 3PGCA 4XP9H 3S5LB 4HLJA 2W0KA 4PJGA 1RJYB 1CYGA 1MWAL 4KTEH 4HWBL 2A6JB 4QXWA 4UUJA 5GRXG 3GMMB 2VXVH 2XTJB 3MFFA 4L8CB 5JA8B 4AIZB 3MOAL 1I85A 2COQA 4UNTA 2XG5A 2Y06H 1IAIL 4KMLB 4K71C 2NY4C 1GCFA 5JPNA 5CJXC 2WK2A 5HHPA 3W82A 4L5FH 4WUUB 4GSDL 4M48L 3MRKB 4F8TA 3T3PE 2IMMA 3MLPA 3TBTB 3ROLB 1KNOA 5J6GB 2IMNA 1WVZA 2RB8A 2W60A 2WSKA 3TPUA 2AXFA 2D2OA 4L4VB 5EPMA 5GRZA 2D7NA 2XTJC 4X83A 5JHDE 3VFTA 5K9KA 3OG6B 4KK9D 4XPTH 3SQOH 3OZ9H 5BXFA 2VC2H 1KENH 4U6XA 5IKCA 4Z77A 3S3JA 4LLVB 3DETC 3QDGA 4DTGL 4UDTA 3U7YH 5F7UA 1QD0A 1UEMA 5DQDL 4DK3A 5I6XB 1OTUC 4FFYL 4X9HA 3HUJA 3P11L 4WWKD 5KAQF 1DQLH 3W81A 1DL7L 1I7TB 2H1PH 4DQOL 4KKAD 4XXDB 4PTTA 4UINH 4ZODA 1AQDB 2FBJL 3PDOA 4NUJB 1YEDB 4MVBC 4X7SH 1BJ8A 4Z18A 3HMXL 1BJMA 1OGAD 3D87B 1VPOH 2Q8BL 2P5EE 5EZLB 3VFWA 4JFFE 2XZAH 5I6XC 3BVNA 2HJLA 5EOQL 1MVFA 4LQ1A 2ZUVA 5I18L 1KCRL 1OAXH 4N0YH 4IOIA 1IARB 4R7NB 1PVHA 1H3GA 1R3KB 2GT9B 3NCMA 2Y9RT 4W81A 3O6LL 2CLVA 3WD5H 5K9QI 3VXPB 5EUKA 4G8EB 5D7IB 1WIOA 4NWUL 1N6UA 5CGYD 5IJVA 3OQ3B 4I0KA 1QR1B 3W2DL 4PLNC 1MJJB 4M8VA 3K8LA 5E7BA 4PY7B 1DSFH 1HH6B 1IGJB 2Z8WC 4FXKA 2HN7B 2UWEF 3FONA 1G0DA 4OIAA 5HGHA 4RAVA 3KPPB 1PBYA 4UTBL 2B2XL 1I9EA 2BY1A 3C5JA 2VDNL 5GGQL 4CVWA 3WXVH 5GZNC 1T66C 4LIQH 4DGVL 5DRZB 2DQIH 4MNQA 5CP7A 4L9LB 3AGVA 1JGUH 3D3VD 4F33B 2ATPA 1ERNA 2HFEA 1NUNB 4F15B 2NY3D 1RK1B 1KTLB 3CJJA 4CN6A 1I3GH 4TVPE 3D85B 4WDIA 3VFNB 1G6RA 2G9HB 5IQ7H 2CLRB 4LAQL 4GW1B 1S7VA 1OF2A 4MYWB 4W6YB 3QB7C 4H88L 5D2NE 3UPRB 4NZDA 2VLJE 4DW2H 1RZJH 1O7SA 1IBGH 1IAMA 2BOCB 2F54B 2X4QA 1INEL 2XXMB 4L9LC 5GSRA 2ZKHH 4UQ2A 4CBPA 1TTFA 3FO2B 3GBMH 4PJ8B 4WEBH 5SX5K 3SDXE 4F15C 2YPLD 2VSDA 1NCAL 5ISZD 5HHNA 5F72S 4HIHA 1MFAL 4S0SD 3QPQC 2H26A 2PYEA 4TSBL 5C0CE 4R4ND 1RHHA 3L3DA 2EIBA 5IFAH 2AEIT 1MEXL 1MRDH 1U8OB 5DO2C 2GTZB 3CPLB 3LKNB 5K9OB 1JNHA 1JPST 5KJRL 3RQ3A 4PYHA 1N3NA 5TDOB 4X6FB 4PJ8C 1ZHKB 3D25B 3SDAA 3ARTA 5CILH 4XPGH 1CD0A 4Y4FB 2F5BH 3VJ6A 3DV6A 5T1KB 4L3EE 5EUOE 4ELKA 2W38A 1FRGL 4GO6B 3BRGC 4PJ9A 3KWWA 4PJDE 3RWEA 5JIIA 1B90A 1PKQA 3GSNB 4WW2B 1HXMA 2BOBA 5GGSY 1G0XA 1AKJD 5C9JA 5GGTH 4F7EA 1X5XA 3VFGH 2BNQD 1D5IL 4MWFB 5ADOL 1BQHA 3REVA 4E41D 4N90E 2AABH 4UTAH 4Y4FC 1NCDH 3B4NA 3WUWG 1FQ9C 1Z9OA 1BVKB 1MI5A 3VG9B 3S96B 2HWZL 3SOBH 1VADA 2ICEA 3QCUH 2ITDA 3RDTB 1NGQL 2EIZB 1TJGL 3D39E 4WW2C 1QLFB 2UZXB 3EOBB 4MD0A 2JIXB 1JGVH 5IHUH 4MS8C 4M3JA 4QKXB 5F7EL 3KPRB 3ARDA 1QTYT 2DQDH 5KG9B 5BRZD 1AR1C 1A0QL 1G9MC 1DE4B 1JZ8A 4Y4KB 4KKNA 2NX5D 4ZSOB 2Y36L 3VG9C 1UVQB 1HCVA 4R8WH 4JM4H 5E5MB 3IF1A 3CFKB 1NGZB 4LFHD 3QCTH 3RDTC 1OB1A 4TULL 1Z3GL 4HKJA 5F1IB 3OKYA 4U1KA 5FHAL 3WKMH 4MXVF 4JDVA 3S37H 4D94A 4F37F 1U3ZA 2WMPA 4OGAD 3ZE0E 2OTWA 2VMFA 4NQEB 3C5SB 4O2EB 5DR5H 3BD5A 3HI5L 4UAOB 4ONOA 5BVPL 2YWZA 1JHKH 1BZ7B 1T5WA 4FQHA 5DDHA 5HI3D 2HH0H 4RAHA 4Y4KC 1WZMA 1KLGA 1U8KA 3MRGB 1CQYA 1MAMH 2XRAH 3QZWB 3Q6GH 4FZ8L 3V0WL 4HEPG 4IRJA 3F58H 4JRYA 1K3IA 4JM2B 4P2RB 4XAWH 2R1YB 3C5ZB 25C8H 3L3KB 4H1LH 3NTCL 1K2DB 4IRZL 3ZKNC 1J9CT 3DROA 3U48A 1MFDL 4UT9H 2IH1A 5C7XL 4P46B 1RULH 1CDYA 3IDIA 2ZUSA 2ATKA 3L3OA 1B6DA 2FX9H 1J05B 4LHJB 1FO0A 3L5XH 2YWYA 1I8LC 1FFPB 2FX8L 5ELIA 4NRXB 4JM2C 5EN2A 1B4JH 4NKOA 2OJZL 2OSLB 3C5ZC 3QFJD 2IAMB 4U1LB 3MGAA 3FT2B 5F8QC 4I48A 3GSOA 4HC1H 5ENWB 4DCQB 2ZUQB 4U1HA 4Y7MA 3DRQA 4P46C 3RGVD 5LG1A 2DLHA 4DGIL 1C8PA 4NNXB 2K9UA 3W5MA 2O5ZL 4LSQH 1CFBA 1PKOA 3BJLA 4YHYB 3SQBA 3NVQA 1HINL 5HDQH 4P2OA 5JOPE 3B43A 2C3VA 2VRAA 3P4NB 5CINL 3B6SB 4TNWK 3OL2A 1WWAX 2IAMC 3PP3K 3ES6A 4PUBH 2FATH 4JO2L 4KWUA 4JN2A 5KAQG 4ODXA 2BK8A 1SY6H 3VGBA 2P44B 4BQ6A 4CVXB 1ZS8B 4WHYG 4NJAH 5DVOA 5I8KH 3UTTB 1UA6H 1EEYB 3I2CH 4OCXH 1QSEA 1FBIH 1RUQL 4M7ZC 4I0PD 1CGSH 1KIPB 4YHYC 1OAUH 1FNSL 4ZXBB 2DYPD 4OLWH 1LEGA 2CJUH 3MV7A 4YZFF 2BHYA 2NXYB 4F57L 5KSBB 2JB6B 4MNGA 1AQKL 3FRUA 4PGBB 2VN7A 4FNLH 4KRNA 3RL2A 5F1NA 5F3HB 3E6HA 4UI2A 4J6RH 1A6ZB 4LHUB 5I66B 1F5WA 3QEHB 4JHWH 1FIGL 3Q1SH 3IB4A 3ZDYE 4UNUA 1E6JL 4UDUA 3WSQL 5CJBA 3QCVL 1WBXA 3E8UH 1XGQB 4PD4K 2NXYC 4YH6A 1DFBH 1O7VA 5F3BA 3BW9A 4M43H 4ZTPH 1U58A 3TN0B 4R2GD 4WI2A 5CLTA 1F4XL 3FAXA 4HGWB 1JK8B 2NY5H 5A43C 1EHNA 5DVKA 1OL0A 5E08L 3NH7H 1JP5A 2YXFA 1OTSD 4MLSA 1WTLA 1YEIH 2OI9C 2IG2L 1EVUA 5FA4A 1KCSL 1IM3A 2WWKO 1QRND 5ESQA 1P69B 4FXGA 1KTDB 1A7PL 1YY8B 5ERWA 3HAEB 1ZVSA 2Z4QA 4YK4B 1T04A 2VAJA 3MRNB 5E2WL 4NZTL 3TN0C 4HSQA 5D9SB 3ARVA 4LVNB 1TCRB 4HIEA 4NQDA 3PIQB 3MUGB 4K3EL 1H3UA 4MA7H 4XB8A 3VWJD 4TOYH 2YC1B 2HMID 1ITCA 5I1JH 2D03L 4Y16B 4LCWE 2OL3A 2XN9E 5F1SA 3U4BL 1NSNH 3ZO0A 4FQ1L 3U9PH 4KI5D 3UTQA 2DF3A 3O11A 3E2HB 4KQ4H 1YY9C 4EVNB 1IZKA 4YK4C 4ACPA 3WIFB 1PEWA 1YEJH 5DLMH 5C07A 3Q3GA 2IANE 3VXRD 5A1AA 2HRPL 3QG7H 4LVNC 3TVMD 4FZEH 4QRPA 1IL1A 1F3DH 4RGNB 4FABH 4IDJL 5TF1L 3HZMB 5J6HB 3DUHA 1R3IL 3K1DA 4Y16C 1I9RL 3MLXH 4K8RC 4XWGL 3RL1B 5J8OA 3F6IA 4UIMB 2EO9A 1Q9KA 4OZFH 2ITCA 1QHPA 1I8MA 1J0HA 1UB6B 1SJXA 3BH8A 1M7IA 1N4XH 3E2HC 1R5IB 1S8DB 5SWZD 4PJGE 4PJEF 3TBYA 5HGDB 5HXMA 4GRLA 1JHTB 3PGDA 2Q86B 1AGBA 3JV6A 1IGFL 5GGRB 3IKCA 4YHPA 4RGNC 1I3VA 5JW5A 5D1XA 3HZVB 1TETH 3BXNB 2XZCL 2CKBB 3V5KA 4NC1E 3REWB 3PWLB 3R06A 5CHNA 3G5ZB 1X5HA 4S1DC 4DZBA 1E4JA 1VFAA 3ZKQD 1KB9K 1WIPA 2AJXL 4BQBA 5F97E 3F5WA 2NY7H 1NJ9B 4XCFH 5I1CH 3L9RA 3T3PF 4P4KA 3SGJC 1T4KA 3GBNL 5E8DL 1X5YA 3W39B 2RCSH 4M1DL 3D2UB 1IEBB 4QTHA 4XC3H 5EORL 2VDRL 4MDJB 3DXAB 3OJVC 5C0BD 3MRLB 1L9MA 1E27B 3O2VH 3V79C 4QYOB 1NGYB 5BJTB 4WI8A 4RAUA 2AJVL 2R2BB 1NAML 1UM6H 1Z6JT 5DMIL 2H8PA 4AEIH 3L7FA 5EDXA 3BKCH 2EXWD 2ESVD 3ARGD 1Q94A 4C56E 4JG0L 2R29H 2PYFA 2WM0A 43C9A 4WV1A 5FO8A 4HS3B 4L3CA 4X0KA 4JO1L 2VDPH 1T7YA 1L0YA 1E4XL 1MHPH 5FUOH 1XR9B 4L8SB 3ZL4H 2HLAA 4RSVA 3V6ZA 4ZFZB 4JHBA 5EIQA 5C09D 3WFBH 5DMKB 1FORL 5I1HL 3BZFA 1KJMA 4K23H 2VAAA 3UEZA 3ULVL 3C2AH 1FPTL 5SX4H 5KVFL 5IVZA 3E3QE 4KXZH 3WFCL 1I7UB 4R7DB 3TCXA 4MA1B 3SO3B 1A1MB 2HLFC 4ZNEA 1TZIA 4D0CB 3ULVE 5DJ2A 3V95A 1NC4B 3DLQR 5TE6L 1KIRB 5HJ3A 1KUMA 4WUKL 4PJBB 4WFHE 3LRSA 4L8SC 1NLDL 1U93A 3IJSB 1UCBL 3RVTD 4OZHB 1YNLH 4JKWA 4QF1A 3MLSL 4MB3A 4G5ZL 3MYZA 1F2XK 4MJ5A 4N8CH 2F5AH 5E9DD 3VU2A 4GW5B 3G6AA 2EZ0C 4MA1C 3SO3C 5ICYB 1EV2E 1JPGA 1WEJH 2ARJA 4MNQE 4UV4L 1G6RL 5D1ZB 4U1SB 2AK4B 2V7HA 1E4WH 3MNWB 4RNRA 5BCAA 1AGEB 3NCYP 4HZLB 4XP4H 4ZUSB 4JR9L 1YNTB 4POZC 5F7HA 5EA0L 1MCRA 3VG0H 4HUNB 1RJCA 2DJ4A 4G6AC 3VI3E 1KFAH 2A9NH 3P9WB 4WJ5A 2J3SA 1SJHA 4MDIA 5I15L 4OV5B 3EYFA 1DP0A 4XVTH 4MAYB 4J4PD 5CEXB 4JFPB 2KZ1B 3NACL 4R97B 5D1ZC 1W72B 3MRRB 1JPTL 3CFCH 2W9EL 5AZEL 1HQ4A 3SDXF 4EI6B 3OXSA 4C83B 1JNJA 1F4YL 2BERA 2WZPD 1BFOA 3MO1A 2R0KL 3OJDA 3VA6A 1SEBB 4UIKL 4ZUTA 4HJGA 1ND0A 2DQHH 5KTEH 2PYEE 2GJ6D 5BS0D 5DD1L 5DHVB 4HG4K 3GGWB 3OBAA 2AJYL 2JB5H 1JV5A 4NP4H 5L7XL 1GGBH 1ORSA 3NAAH 4PLKD 3GRWH 4MAYC 1P7QD 4Z7WE 3HR5A 5D6DC 4YEFA 1NMCB 5IBTH 4R97C 4NQVB 5MENA 3S4SG 4JRXB 2GJZB 3KXFD 1GPOH 2VDQL 3WBDA 2NTSP 2DL9A 4EZMA 4LKXB 1NBVL 1UJ3B 3ULUL 5EUOF 1R3HB 4KJYB 4QHNB 4MJIA 2A74A 4PJDF 3KJ6L 1CGXA 1A5FH 2QBWA 1PKQE 3MBED 5FGSA 1X44A 5C0GA 3TNNA 1IQWL 3KNBA 3L3JA 5JQ6H 3TJHC 4HULB 1NMCC 5TDNB 1A4KB 5BW7A 3R0NA 1BGXH 1TZHB 1J12A 4LLWA 4TUKL 3AM8C 5DXWA 3D18A 1AO7B 3HNVH 1UJ3C 1RIUH 4PB0H 3P4OB 5IHZA 4YHMH 1CFTA 3MLYL 3ARWA 3R1GL 4Z78B 3QUMB 4PV8B 5E8NA 3JWOL 4K3DL 1AFVH 3CVIH 1ZLVH 5HY9A 5KVGL 1LO4L 3BAEH 2HFGL 3DSFL 1OCWH 5ITBL 2FSEB 4NWTH 4NO5B 2UZYB 1SBBA 2R1WA 5IBLC 3G5VA 5EU6B 5H37G 2PCPA 4S0TD 3LVEA 1RMFL 1SYSB 1JMXA 4LLMB 4ZPVB 4PJHA 3QULA 3RNKB 5INDA 5IW1A 3SGKA 4MX7B 4Z9KB 4X4MA 1CBVL 4QT5B 3GMOA 2VWEC 3QDGD 1MH5B 3JSSA 3KPSA 1LEKA 5IMLB 5JXEC 2CQVA 4Y89A 2VN4A 5FGCB 2LU7A 3C8KA 1NPUA 2OBGA 4M7LT 4N0CD 5CJOH 3HN3A 2QQLH 1UB5B 5LJYH 1YMMB 2EDXA 2I9LB 3RX7A 1RZKH 3ZE0F 1K8IB 3DNKA 5H94B 3V6BR 1HEZA 1AGCA 4Q74A 3EYQC 1P1ZB 1M7XA 4UT6L 5CSZB 3QQ9C 1D5ZA 2GFBA 4JRYE 1BIIB 4Q0XH 3SJVD 5ICXB 1GC1L 1CL7H 1XCQA 1BVLA 3IDJB 5DZOA 4QCIB 4NPYA 1XZ0B 2V2TB 1L7IL 3F7RA 1ORQB 3LKOB 2P7TB 1QACA 5SWSA 2IPUG 4MCYB 1XCTB 5F71A 3RX8A 1TXKA 2IBBA 1IM9D 1FO0L 3SGEH 1RJLA 1U42A 3S9DB 2UYLB 3X3GH 3SN6N 1D9KA 4G8FA 3I02A 1YYML 2H6PA 3O45A 4X6BA 4F9PA 3NMEA 5F6HJ 1CD8A 3UZVB 3DX6B 1OD7A 1NCWH 1B0RB 5EZIL 1ZGLB 1E6OL 1PSKH 1KIUA 1BEYH 2XWBA 3X17A 4TSAH 3GMLA 1PZUB 3B8SA 1AIFA 2R69L 1S9YB 4YHZH 1FL6B 1Z0MA 4KKCC 2BX5A 1T89C 1OARH 3GJEA 3WEXB 1AR2A 4Y4HB 3CFEA 3UTSA 1I1AD 5CEZH 1A02N 2HKHL 12E8L 4XH2A 4D9RD 3MACH 5J1TC 3MZGB 5F8RC 1A7NH 4GG6E 1ETZA 1QSEE 1RUKH 1GHFL 5DK2A 5MP6L 3C60A 3T1FB 1JN6B 2WQ8A 4HHAB 4H20H 2XKNB 2Y6SC 1NEZG 3MLRL 1FAIL 4Y4HC 4E0RA 1LO3H 3BT2L 5E6IB 1EH9A 5EZJB 3QJFA 3EOAB 1QFUH 3V7MA 4GRWH 1OAQL 4PRHA 4RWYL 1FGVL 1T20B 4OFPA 1KJ2H 4LPUA 2VLKE 1MPAH 4O00A 3SKJH 5T3ZH 4Z0BL 4C4KT 4PG9A 4LCUB 1MJ8H 1S7RA 1JRHH 3CAFA 3BSZL 3PDDA 3H3KA 3LKPA 4PJCE 3ZDYF 2PW1A 3MLVL 1WBZA 2EDOA 3SDAD 3BZEA 5E1HB 4LDLB 5E6IC 3FMGL 1NCBL 1DR9A 2IADA 4NZUL 5EBWB 3MRQA 4PJ9D 1T1YA 5DJXA 3RI5F 2VE6A 1ADQH 1BFSA 2W0LA 1FVCB 5JLZB 3QNZB 1QEWB 1T0MB 2WUCL 5MERB 1JL8A 3H7LA 2ZCHH 2V9TA 2P8LA 5EO9A 3ULUD 4TUJB 5FA3B 3LQZB 1VKXA 5ALCL 4DN3L 4P3CH 4X6CA 2E7LC 5FUCE 4HWEH 4XVJL 5IB5B 3SKOA 2NNAB 3FJTA 4YX2L 2IPTH 3QXWA 4F3FA 2MHAA 3V6OC 2JJVA 4O02H 4UILH 1HOCA 1MI5D 5E5UB 5EZOL 2OL3L 2F15A 3PWJA 5GRVL 1QLEL 5EC1A 5IJKC 3ESVF 4KY1H 1SVZA 1CGVA 3TT1H 1LD9B 5C0AA 3BEVA 4D8PB 1XIWA 4L4JA 1XF2A 1GVIA 3G04A 2UWEB 3P77B 2DI9A 3SY0B 3ARDD 3HE7A 3GSRA 4X4XA 5C07E 3BP6A 1YEFH 1NFIA 4CJ0A 4DVBA 3IETB 4WO4A 1ZVHA 1AGDA 4QRPE 2MCG1 2G5RA 5IVOA 3GMPB 1KJ3L 3CSGA 1DEEB 5CMAB 1URLA 4YAQA 1CVRA 3LSOB 1HHGB 5CZKA 5I71B 2FB4H 1D5MA 2QEJA 1GAFL 4FQLH 3BYYA 5ID1A 4LF3B 4YXKL 4JHZA 2Y07H 3M1BA 3V5DA 4QRRB 5ILTL 4N5UA 5DD5L 1AD9B 2NXZD 1IE5A 3D0VB 1VFUA 2C1PA 4GLRH 4PJGF 1U6AL 2A9ML 1KEGH 3QFDA 4JPWL 5BMFL 2HT4D 5GJTH 2EDRA 2AV1A 4BH8B 3D5OF 5I71C 1A6VH 4IMLB 3DUUA 5TGBA 1QQDB 1SY6A 5D7LD 5K93A 5L0QB 5C6TL 5C08B 4DAGL 2VXUL 5HD8D 1ACYL 3WNKA 5K33A 2HVKA 5BVJA 3UZEA 5KW9H 3WO3B 4IOFC 1KELH 4ISVB 3MGTB 1PG7H 1A7BA 2X4TB 4P4RB 1LNUB 3QHFL 1DQTA 1YNKH 4OI9A 1CLZL 3NIDE 3BHBB 1KCVH 4Z7OE 3KYKL 5TE7H 5B4MD 1EDQA 1CFQA 5GHWL 2W9LA 5J12C 3VDAA 1N5AA 3PUCA 4HXAH 2H2SD 5AUMB 3SKMA 2RQ8A 5L0QC 2E7HA 4LDEB 4JN1L 5TF0A 2DOCA 3BGFB 3U6RB 4OLZL 5EU4B 1OAKH 1BIHA 5C0RL 4BQ8A 5GS1A 5ESVB 1I9IH 1N0XL 3LMJL 5HI4D 3PQYB 3NCJL 2XOTA 1HYSD 4YDLB 3B2UD 4JO4H 3MLWL 2MTPA 2VIRA 1SHMA 4EKXA 4NQCB 2ZCLH 4X7EC 4WU5A 1C1EL 5DS8A 1T03H 2MPAL 1V7ML 4P2OD 3MV8B 1G7IA 2QADD 2VDOH 3CDFA 4ZS7H 5JDSB 3I6KB 1HWGB 1JPFB 3PL6A 1NKRA 4ZAKA 4BSWB 3ORJA 1UZ8B 1TVBB 4U6YA 2FGWH 1HIMH 2WUBL 3A67H 4YDLC 2FGZA 4I3RL 4QTIL 3FFCB 3LAFA 2IPUK 2XZQH 3TO4A 1RUPL 1YYLH 4XMKH 4FQ2L 4G43A 2F74A 3UC0L 1S7SB 3EO1B 3MV7D 4CNIB 1B4RA 1ONQA 3ULVF 3OXRB 4WU7B 3QXTA 3ZE2E 2B4CH 3T4AB 4OF7A 1UFUA 1JYWA 5B38G 1EHAA 4Q58C 2LAGB 3IDYC 3WFEL 4XCNA 3BE1L 1I8IB 3T77A 3HI1B 3O9WD 5C92A 4XP5H 4B5EA 2H45A 3IFPA 3FB8A 5JNYA 1I4FB 1MCFA 2BVEA 5GXBB 5EO1A 4I2XE 2VUOA 2XYCA 3QDMA 4JANB 3ZZ1A 4XP9L 5D7JA 3VXUD 4OZFA 2NW3A 1K8DB 3EBAA 2BC4B 1HQRB 1UKQA 3R4DA 4OF3A 4JZNB 4Z5RA 3OR7B 4UB0H 1ZLWH 2VXVL 2IH3B 2ZSVA 3LIZH 4GW4B 3VXSB 3VI3F 4ETQA 1RU9H 3EO0B 5JR1H 2W91A 1C5CH 2PNDA 2X4NB 2ORBH 4KDTC 4L5FL 4NKIH 5D7KE 4DVRH 3WHXB 4XNXH 1I7ZA 3KPQA 1A4JA 4V1DA 4N8VB 5DHXB 5TFSH 4NQDD 1M7DB 1S7TB 4Y19D 2CH8A 1HZHH 2GCYB 1DQML 1JBJA 3FT3B 1FL5B 2IQAB 4KJQC 4FQIL 4XPTL 3SQOL 5IQ9A 3OZ9L 2VC2L 1OP3H 4OUOA 4WFED 4RMTA 3U4EB 2DKSA 2GITA 3U7YL 4L1DA 4JZJC 1RIHH 3S97C 1BWMA 1KPUB 1WISA 4U6VH 3O2DL 1HI6A 1DQLL 3P0YH 3VWKB 3VRIB 3VMNA 2H1PL 4JY6A 3RKDD 5EU5B 1XGYH 2QQNH 3FN9A 4UINL 4NKQB 1QRKA 3HZYB 4YQXH 3X12B 4MSWA 4X7SL 4OKVA 1T1WB 2X44D 4YDJA 2Z91A 4EBQH 3PWUA 2QKIB 4PJ5B 4A6YL 2DMBA 3H42H 1A7RH 4N0UB 1QO3B 3LKRB 5IOPA 4GUPA 1VPOL 4G6KL 3H9HA 4GRLD 2XZAL 1NGPL 2X7LA 1Y18B 3MOQA 3LV3B 2EH7H 4KQ3H 5IGXH 5GISH 4KKAC 1T7XA 3LKSA 1OAXL 4N0YL 4HFWB 5D1XD 3VWKC 1MREH 3NN8A 4EI5D 1ZK9A 4PB9L 1HK6A 1F8TH 4FTVD 2BSRB 3WD5L 4MD5B 4WI7A 4IIQB 3CDGA 3HPLB 1EEZB 5E99H 3K8MA 4Q6IA 3TYFA 1LDPH 1DSFL 1UKTA 4H8WC 4ZQKA 3RX5A 2F53A 2ZZUT 4MQXD 4RZCB 1A7QH 4TNVK 2EYSB 3KAAA 5GGRY 4JQXC 4KFZC 4ELMA 1K3ZA 3WXVL 4LIQL 1QFHA 2DQIL 3HFMH 5HTSA 3KPSE 2L4OA 3LH2L 3MROA 2NY3B 2A83A 1JGUL 1NUGA 5JORA 4IIQC 3TLRA 1CN4A 3VGFA 4LLYA 4LIQE 2Z92B 4RX4A 4HMEA 3S6CA 4YE4L 1I3GL 4B41A 5I16A 1JIBA 4ZUUB 5IQ7L 3O3AA 5BQ7B 1YJDH 1NMBH 1WWBX 2D0FA 4D0BB 4P0DA 4XBPA 2GEEA 4MQ7B 4DW2L 4X8XA 1RZJL 1IBGL 1PY4A 2CMRH 3ARZA 2ZKHL 2NY3C 3GBML 3C6SA 3QEUB 4WEBL 3QH3B 5GQBA 5ISZB 3T0WA 3QUZB 1DUZA 5SWSE 5DQ9A 4WFFE 2XTJE 4B7IA 5FECB 3VH8B 4AY0A 2R9HD 4Y8AA 3JXAA 1MSPA 2R2CA 1JVKA 5IFAL 1JUFB 1HXYA 3V0VA 1G9EA 1MRDL 1ZE3C 1MHCB 3OR6B 2R4SH 1WC7A 5DJ0B 1G1YA 1XF4A 2W0FA 3N1MC 5J3HD 5EBGA 5F9WB 1FAKT 1QFWM 3ZMRA 1KLUB 1QVOA 3QUZC 5CILL 4L4VE 3GRWA 4XPGL 3VMOA 3AU1B 2F5BL 1W0WA 1NC2B 1WT5C 1EGJA 2UZIH 1P84J 5FFLA 2DM3A 2MMXA 2ZOKB 4PGDA 3SKNA 4PYGA 3MRDA 1UH3A 4CN1A 5INCB 5BZWA 3WJLC 1KB5A 4OF0A 1AKJB 1OT1A 4APQA 4PJEB 1NL0H 3UBXA 5GGTL 3UTSE 3MMEA 1DLFH 2MWCA 3F12A 4LPTA 5EC2A 4E41B 5F9WC 4WGWB 3VFGL 3STLA 2VNCA 3RTQB 4UTAL 2AABL 1NCDL 2FDBP 1MWAB 5L2JA 5FYLE 5BOZG 5HHOA 5JMRA 5JW4N 3SOBL 5F9JB 4GG6F 1QBLH 4Q7DA 3QCUL 4EUPH 2EECA 4BFGA 4PD4J 2B7DT 3DMMB 1VACB 2IBZX 1LO0H 3U36B 1MLBA 3I75A 5FO7B 1LMKA 5EBLB 2I5YL 2AKRB 2VDLL 1JGVL 5IHUL 3H3BC 2FHFA 3QI9D 4XHJD 5BRZB 4XPFH 4B50A 5GPRA 1R5VA 3RTQC 3O0RH 2DQDL 3WL9A 2EDKA 4MJ6A 4J3WA 4G6FB 1IAKA 3FB6A 1F6FB 5JHDB 2X1XR 1T1XA 3FAWA 1MRCH 3UYOD 4R8WL 4JM4L 3IFNH 4U6HA 4HLZH 4BA8A 1IGYB 2VXTH 1JWMA 2Y5EA 4K3JH 3QCTL 1KXTB 3CX5K 2FH6A 3DMMC 2VXQH 3DBXA 3AXLB 3GBLA 3QEQA 4UV7H 4GKNA 3WKML 5I2IB 5MEND 4KV5E 2W07A 4X99B 1EBAA 3S37L 5EIIA 4XNUH 1WBYB 3KYOA 4R90H 4AZ8A 3S7GA 3PE9A 5JOFB 5C0DB 5DR5L 2VLJD 1JHKL 3T4YB 3W0WA 2HH0L 3FCTB 3W9DA 8FABA 5EBMB 3L3HB 3MRMB 4MJID 4X6DA 4XB7A 1FG2B 3VFUA 2E8YA 2KL6A 3KGRA 3O2WH 1MAML 2XRAL 1VDGA 3Q6GL 4YDVA 1CIUA 3ZYJA 3F58L 3R0MA 2MFNA 4P9HH 2A38A 1EJOH 4XAWL 3ZT5A 4X6CE 4XC1H 2DM7A 25C8L 4PBVC 2P5EB 4H26A 2B5IB 4JFFB 2AJZB 4OGAC 5E4IA 5DJZB 3O3BA 5HVGB 3FHAA 4UT9L 1O0VA 5HI3C 4WTZG 4CU8A 4JFEA 4WHDA 4O51B 1T80A 1RULL 1CXLA 2H3NA 4CUCA 1IILE 4U31A 2R0WL 3DURB 2FX9L 1P5UA 1A6UH 5C0AE 1G7MA 1AXSB 3L5XL 4F7MB 5IMKA 1NH6A 1B4JL 3MXWH 4D0DB 5CIPH 2B5IC 1QBAA 5AEAA 5F6IB 2Z31B 1DBKL 4XPHH 2Y72A 2FBOJ 4HC1L 4PJAA 4HBCH