2CKBL

Structure of the 2c/kb/dev8 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA, BETA T CELL RECEPTOR
publication title Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Major histocompatibility complex
total genus 12
structure length 99
sequence length 99
chains with identical sequence M
ec nomenclature
pdb deposition date 1998-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ckbL00
5C0CE 5F8QC 1LILA 1O7VA 3MLUL 5F9OH 4ENED 5HI4C 5HYEA 4WWKD 3ZHKA 5ALCH 4HS3A 4N8CL 5ETUB 1YEGH 4MA1B 1YNKH 5DEGA 2BDNL 1NFDA 3TVMB 4MHHI 3CDFA 3NA9L 4V1DD 3U6RB 4MJ4A 1YN6B 2G75A 4PREB 1M05B 4IJ3B 1URLA 3U36B 4C4KO 1PBYA 2OI9C 3TN0A 4OCXL 2WUCL 5DR5L 1FZMA 5D7IE 3FQNA 3FB7B 4U1MB 5IFHL 3CDGA 3BJ91 5K9QI 1Z3GH 3CU1A 1FHGA 4XXDA 1QO3A 4X80L 3DVGB 4YDLC 1DBMH 1EJOH 1S9YA 2AV1B 1SY6L 3Q3GB 3PUCA 3PNWA 3UPRB 3O9WC 2VDQH 4NP4L 2IGFH 3QCVH 2IPUK 4MNQD 3DNKA 4O2CB 5K9OB 5DT1L 3VFSA 4KTDH 4RX4D 1A9EA 3P40A 1G7QA 1RJZB 4RGNB 2IFGA 5B4MD 4M7ZC 2EECA 3FL7A 3D1MC 1I3GL 1GGCH 3INUL 4F57H 2OMNA 5BQ7B 4PRPA 1TZIB 4QTHB 1KTLB 5DSCA 4NZTH 4Y4KD 3VG9C 3REVB 4K7PX 3BZ4B 5DK0A 1CE6B 2BNRD 5ALBH 2WNGA 1QLEL 1NAMB 3UTTA 4KVCH 2NY4B 1BP3B 1KIPA 2F54B 4OUUA 3WD5L 3GMNB 2X09A 1CVRA 4Q7DA 4HUKB 1WEJL 4LCUA 3T08A 1RZJH 4WW2C 1CLOH 3F58H 2Z8SA 1RUKL 4FQCL 3OXSA 5T1DL 2AV7B 1ZT1A 5A2FA 2BXZA 2LE9A 5JNYB 2BMKA 4X0KB 1AO7B 1G7IA 1UM4L 4KMTH 3RY5A 5D1XB 5KSVA 2YMXH 1OTUC 4KH2A 3DYOA 4QOKB 1FIEA 3BE1L 4GKZB 1JHKL 4NNXA 4G8GD 1CFTB 1KIRA 1W72A 2HVJA 4BSJA 2LVCA 4MA3B 4P4RA 3VRIB 2E9BA 3PHQB 3FMGL 5DJZB 2V2WB 1EO8L 1F3JA 4W6WB 2UYLA 4YHKL 4Z6AT 2W65B 3SE3C 4JRYA 2XACC 3ZE0E 4BUHA 4ZO8A 2UWEF 4RA3A 4N0UB 3UBXI 1Z5LB 5EO9B 1SBSH 4KJYA 4XC3L 2OR9L 1MH5A 4XAWL 1MCLA 4KZDH 4MA1C 2MCG1 5DJDB 2XZZA 3RWIA 3HC4H 1MFAL 5C07B 2H8PB 2YKLH 1LWRA 4AEHL 4IJ3C 5IQ9A 3V8OA 3IS1X 2O5XL 2BERA 1IMHC 1CT8A 4HWEL 4XPHL 1XR8A 3S4SA 3PWNA 5CD5C 2P7TB 4D9QE 1AIFA 3IXAB 8FABA 3MTRA 1NLBH 3MBXL 3RNKB 5IB2A 5I30H 2BSSA 1ZEAH 1J1XH 1HYSC 3ULUH 5ETUA 4OI8A 3QDJE 5J89A 5J13B 1MCOL 4S1SL 1ONQB 4GT7A 1UADC 3KLHD 2FLRT 2HG5B 1YN6A 4LLWB 4PREA 1M05A 3H0TB 4MS8C 2ZWLT 2EC9T 5AAMA 1K85A 4Z0XB 5I66B 3SQOH 5DC9B 5SWZB 4BYHA 5K59E 2CGRH 3SDYL 3FB7A 4HPOL 4U1MA 5AD0B 4RGNC 2WAHA 4NQTA 2MHAB 1CTNA 5F7NC 4G6AC 2AV1A 3Q3GA 3IDJB 5F1NB 4FG6D 4PJDF 4EQ2A 2XTLA 1MCDA 1JZ6A 3UPRA 3GSNB 3KPTA 5ACMA 1QSFB 4HKZB 5K9OA 4GQ9L 4O2CA 2E7BA 2N7BA 1N5YL 1WQVT 4Z0BL 2NY4C 2HVKB 1XH3B 4JAMB 1RJZA 5HDBF 1PLGH 4PJEF 3MNWA 1QFWI 4L4TE 3I85A 1A6AB 1KOAA 1N0XH 2EDYA 4NQUA 4ZOCA 5BQ7A 5AEAA 1IC7H 1TZIA 3D39D 4QTHA 1KTLA 4XP4L 4AENB 5F44A 3REVA 3BZ4A 3O6KH 1CE6A 3CFCL 3R1GH 2VDRH 3SJVB 1A5FL 2I9TB 1CGTA 1X4XA 1NAMA 1P7QD 3NFPB 5D1XC 2HKFL 2F54A 1TTFA 1JGEB 3GMNA 1CD0A 3X13A 2XNAB 4E41B 1HKLH 3ULVD 1G9NH 4V1DE 3HMXA 3U7WL 4D94A 3T3MF 3G6DH 4KK5D 4PJIA 2IQAB 2RR3A 5I2IB 2AV7A 4R4FH 2ESVD 3WFBL 5JNYA 4NYLB 4X0KA 1AO7A 1T7VA 2AEWA 1MAKA 2EXWD 5D1XA 3QG6B 4NQCB 3DI2B 1NAKH 2YWYA 3I84A 2HKHL 3GHBL 2XY1A 4QOKA 1N4XL 5DLMH 3KPLB 4GKZA 2GT9B 2BJML 1KN4H 1CFTA 2X2YA 5D1QD 2GUOB 3RY4A 4MA3A 4MNQE 3HG1D 3VRIA 3PHQA 3VXOB 1RURL 3CX5K 1QR1B 5KJRL 1AGBB 1IGCH 3K1KC 3Q5TA 4YUEH 5E2TH 3VD9A 2W65A 3JWOC 4I0PB 4P2RB 5GGRA 3TFKC 1UKSA 2FJFB 4YHOL 1Z5LA 2BCKA 5EO9A 5BOZG 5HGHB 4OFDA 3MLPA 1TJHL 3LN9A 4HIXL 1RUAH 1BBDL 1ZKAA 5DJDA 2KDGA 2BNRE 2C5DC 4S1QL 4YFLF 2ZCKL 5C07A 2H8PA 1G1CA 4LKCB 5CINL 4PIRF 4TUKL 1FNGB 2R2HA 5TE7H 1PEWA 2R69H 5DVKA 5GQBA 4JM4L 2P7TA 1QRNE 4NCC2 3QO1A 4X6DF 3F8UB 3IXAA 4NO2B 1A47A 3RNKA 1OM3L 4KDWA 3I6LD 2HWZL 5H37G 4IMLB 2B20A 1ONQA 4HZLB 1CDUA 4JFDD 4WY7L 2HG5A 4LLWA 2R56L 5L2KD 1D5BA 1F4YL 3H0TA 1TTGA 4Z0XA 4R9HA 5I66A 1DFBH 4RQQB 5SWZA 5I1AB 5AD0A 2Y25A 1IQDB 3VXSB 3GJFH 3BRDA 2XIDA 2KH2B 3ARED 4HF5L 1MRCL 1P6AB 3LSOB 1U95B 4FFYL 4G8GE 1SHMA 4C54A 1LEIB 4KPHH 4XC1L 5FM5M 1E27B 3TV3H 3OJ2C 3NCFB 5C0RH 1CGSL 2DQHL 2MHAA 5A2IH 1UA6H 5IG7A 3V5HB 1BZ9A 5GZOD 5F1NA 1NGQL 3BXNB 5E08L 4Y16B 4RFNC 1QSFA 4HKZA 5ISZB 4M4RA 5LWYH 2BHZA 3BP4B 5LQBH 3BD4A 4MCYB 2HVKA 1XH3A 3DX6A 4JAMA 1N6QL 2D31B 5C6TL 2IALB 1DVFB 1IE5A 1Q0XH 5I76B 1KB5H 5IFJA 3SE8L 4LPCA 3FQWB 3QZWG 4R7DB 1I7RB 3IRPX 3THML 4L3CB 4AENA 5IB5B 5E2UH 1I85C 3T2PA 3SJVA 2I9TA 5TDPB 2M26A 3NFPA 3MLWL 1JGEA 2CPCA 3O2VH 2XNAA 4E41A 3WO4C 2BVTA 4XHJC 2XQYK 4JG0L 2I26N 4PD4K 5TPWL 2V9RA 5L9DH 1PKOA 3TA3D 2IQAA 5I2IA 5IVOA 4S1RH 5J6GA 5FKAB 5HHOD 1C1EL 4OLYL 4X7CC 4NYLA 3EW3B 2NY6B 4DN3L 2ZCHL 3JWNC 4D9LL 1YQVL 3MV11 4I0PC 1DANT 4NQCA 2C4FU 4HPYH 3GHEH 3MRGB 5E03A 4PV9B 3KPLA 4ZFGH 2GT9A 4H0GA 1JTTA 5D7LB 3MRHB 1QBLL 2GUOA 3D3VD 3CU7A 2IPKA 1F4WH 1T1WB 4XCEA 5DGQA 4QGTA 3VXOA 5GSVB 4W68A 3FQUB 1QR1A 3QFDB 4IEFB 1IILE 2Z8RA 1CG9A 1X5FA 3QQ4B 4I0PA 4P2RA 2FJFA 4WCYH 3D39E 4M62H 1GC1H 3MXWH 4G6JL 4YX2L 3PDDA 4MXQD 3MYJB 3GRWA 2W9EL 4RFEB 5GGVY 5EORL 1YY9D 4LVNC 1YYLH 1E6OL 4KI1A 3PP4L 5HVHB 4XNXL 2BSED 4LKCA 4PG2A 1FNGA 2R4SL 5JQ6H 1BHGA 3MACH 5BZWB 4K23H 3IDGB 3VI3F 3P4OB 3QUYB 4KHTL 2RCSH 3ULVE 4BFGA 5HYFA 5EZLB 3UBXB 1YEDA 3M17B 4IMLA 3PGFL 1QOKA 2ESVE 3HUJB 3K81A 4HZLA 1DEEB 1U6AH 1RJYB 3D85D 1ND0B 3ULVH 25C8H 2FGZA 4RQQA 5KW9H 3X3GL 3QWRA 3V4UL 1IQDA 3VXSA 1JNNL 3H3PH 3LSOA 2PR4H 1U95A 1LEIA 2I24N 1RMFH 1E27A 5AG9A 5J1SC 3HG1E 4JN2B 3BDYL 3BUYB 3V5HA 4WVRA 4PJAE 5AZEL 4KJWC 2J8UA 3BXNA 4Y16A 1ORQB 4AM0B 5ISZA 4YFLI 3BP4A 5HHXL 2EE3A 2IH3B 3NZHH 4MCYA 5IQ7H 3MCLH 2EH8L 5TDNB 5JMRA 5MEOB 3H9YA 2D31A 2IALA 4IOFC 1DVFA 1I9JH 5IW1B 3MLRL 4P0DA 3FQWA 3EGSA 4R7DA 1I7RA 4OI9A 5FHAL 1VPOL 3RBSA 5D5MF 1BJMA 2X4TB 4L3CA 5GGUB 5IB5A 2OX5A 3BIKA 1CGVA 2QEJA 1AFVL 4JFFB 1R3HB 4JKLA 1F4AA 1JWUB 2NY6C 5TDPA 4XAKD 2VAJA 3H9SB 2DLHA 3SEPA 1CZ8L 3HNVL 3I6LE 3PQYD 5B3NA 4TSCH 3VWJD 1QLFB 1YMMB 4OLEA 5EU3B 4NM8L 3BMVA 1MJJB 3L5IA 3U7YL 3QHTC 4NC2B 3TNMB 5L2KE 1F4XL 4GJTB 2G5RA 3GBNL 3L7EB 3BD5A 4R26L 1JPSH 2R1YB 2VN4A 2C7UB 3JTTA 5L8LB 3DMMC 3NH7L 3QXWA 1UACH 4GRWF 3MRGA 4PV9A 2R29H 4X4ME 4G43B 5D7LA 1V3KA 3MRHA 5H2BB 2HT2C 3EO0B 3QXAB 3VW3H 2O61B 1F3DJ 1MREL 1T1WA 5F1IB 2AJ3B 1HSAB 5MP6H 4H1LG 1CDHA 1LNUA 5CIPH 5GSVA 2IBZY 3FQUA 5IIEB 3QFDA 3ISWA 3DMMA 5D7SL 3QQ4A 1M71B 4JM2F 3QHFH 1RIHL 3SKJL 1ZHBB 2DQEL 3MYJA 4RFEA 3R0MA 4JFEA 5ADPH 2VH5L 5DS8B 1L9NA 2VDML 3C60B 4MXVE 3GKWH 1KLUB 3G5YB 1TPXB 1QSVA 4PRHB 4XP1L 2PW1B 5BZWA 4I77L 4OI7A 3IDGA 1FYTD 1RZFL 3P4OA 3QUYA 5C86A 4QTIL 5LKNA 3TT3H 4HCRA 3WNMA 4CADB 1UZ8B 5EZLA 1CQYA 3HB3D 3UBXA 1JRHI 3M17A 3N50A 4Q97A 1QKZL 4L1HA 4EOWL 5HHOE 1DEEA 4JPWL 1RJYA 4ZXBD 1ND0A 3DX7B 1C5DB 5GGTL 5DEZA 1FBIH 4XWOC 3WKML 2VUOA 1MCNA 4KXZH 1IGFL 4EI5B 1QPXA 3D3VE 1KBGL 3MJGX 4JN2A 4MB5A 4MJ2A 2OQJB 3BUYA 5EZIH 1CICD 5CEZD 2DB8A 1ORQA 4AM0A 5AAWA 1WICA 3BUTA 2YSSA 1BZ7B 2HRPL 4WNQB 3T2NH 2NY7H 2IH3A 3IJHB 1GGBH 2X70B 3LKSB 2AJSH 4N9OB 35C8L 5TDNA 5MEOA 3JV0A 3LDBB 3JWOL 1OSPL 1I75A 2H41A 5IW1A 5C2BH 3TT1L 3WLWD 1BIIB 1EH9A 4NJAL 2Q1EA 2IBBA 4D0BB 5HDOA 4LSPL 3UTPD 2X4TA 5BVJB 5GGUA 4U2YA 4CDHA 2UWEB 3V9FA 4ODXB 4JFFA 4OGAC 1P4IL 1JWUA 3C2AL 1FL6B 3UYRL 4DGYH 3H9SA 2JJSC 5FYJD 5SWSD 1QLFA 1YMMA 5EU3A 3OF6A 1JN6B 1MJJA 4LVOB 3WEXB 1SMAA 3MQIA 4P49A 3TNMA 3WN5B 4LAJH 5MEQB 5KBNC 1MY5A 3L7EA 3BIAX 2R1YA 5IB1A 1NDMB 1NUFA 3VFMB 2Z92B 3MJ9H 4KI5E 4LVHB 4UI2A 3VGFA 4ZTPL 2W60B 2EE6A 1OLLA 2JJSA 2X4NB 4LLUA 3DETC 2QBWA 1D6VL 1JUFB 4G43A 1J8KA 4G6FD 4NRZB 3EO0A 3RRQA 2O61A 1R0AL 3ZYZA 3ARDB 3C60C 5F1IA 2AJ3A 1AKJD 5D7KD 3E8UH 4YFDB 5IIEA 1GOGA 4MJID 1TPXC 2QSQA 2E7CA 1NDGB 2Y7QB 4Q2ZB 4DW2L 2CDEB 3EO1B 1ZHLB 1ZHBA 1S7WB 4PJDB 1AXTH 4PJGF 3RA7H 3UYPA 5DS8A 5DWUL 3C60A 5CJBA 1KLUA 4XAKE 1E4KC 3G5YA 3AVEA 4HH8A 4PRHA 3PQYE 3I02B 3TO4D 5A2LH 3LEVL 3AXLB 1DQLL 5E9DB 4ETYA 4CADA 1UZ8A 2HP4A 2FIRT 1FLRL 2VLJB 3MLZL 5F7MC 2Y23A 3U9UA 5D7JB 4YHZL 3R0NA 1H3WM 3KXFD 1B4JH 4XPAL 1YEEH 1QBMH 1SJEB 2DQIL 2VZ3A 3QIUD 2X42A 2NXZC 3RY6C 4RBPK 1KT2B 3DX7A 1C5DA 1JI1A 5JOPD 1A9BB 4KK6C 4R6UA 4BK5A 3CLFL 1WWWX 3LDBC 1U9KA 1MFDL 4L8DB 5HD8C 4EI5A 1F3DH 1K6QL 3ARTA 5CJ8A 4F33B 3U4AA 2OQJA 3ZZ1A 5BJTA 2OSLB 3WIHL 1BZ7A 4WNQA 1OT2A 3RY6A 1EA9C 2X70A 3LKSA 2OXGA 3QPXH 3ZE2E 4E0RB 1T1ZB 2ED9A 1VB9A 4M3JA 1YNLL 4I1NB 1AY1H 1OAQH 1BIIA 1RJLB 4D0BA 3RVTC 3I2CL 4AYFA 2J88H 4LCIH 5IGXL 4OD2A 3HFML 5BVJA 3TO2B 1EJ6A 5ECJE 1AH1A 2UWEA 1QNZL 4MNGE 4ODXA 5HHMB 1DJSA 1V7NH 4XX1G 1FYTE 2AK1H 4TUOB 1FL6A 4XT1C 2HFTA 1JZ7A 3F7RA 4QRQB 5CJQL 3ROOB 3EJZC 4XPFH 4LF3B 4O58L 1UCTA 3C2SA 3T4AB 3QIWD 3WEXA 4B7IA 3SKOB 3WN5A 5MEQA 3ARDC 4X6DB 2GYSA 1LD9B 3SE9L 1NDMA 2VE6B 2H2SD 4HIIB 1NLDH 1T7XA 3BYTA 1JGLL 3VFMA 2BSTB 2BZDA 2Z92A 3WXVH 2W60A 3AROA 2J4WH 4LSUL 4GUPB 1WK0A 2X4NA 3FQXB 5L0QB 5L8KB 2GQHA 4EQ3A 5CEZE 2OZ4H 5F72S 1NCCL 1JUFA 2LABA 3DIFB 1A3RL 5EZJB 3Q5YA 3QDMD 4ODVH 4NRZA 5E8DL 3BZEA 4FQLL 3ARDA 3DLQR 4KZEH 3S34L 1HSBB 3VD3A 4IDJL 1NDGA 2Y7QA 1JP5A 3VMPA 4Q2ZA 4WHYH 1T5XB 1CLZH 4GBXD 4M1CD 3OTTA 1IC5L 2CDEA 3C9NB 2ENSA 1ZHLA 3EO1A 1S7WA 4FFWD 4KRPD 4PJDA 1B9ZA 3UTPE 1U3YA 3BFOA 3L3JB 4YDVB 5ADOH 3TCLB 1LO2H 3EOTH 1T20B 4TVSa 2Q8BH 3RPIB 1TMCB 4G42B 3IU3B 4PJEA 2F8VA 2NY2B 1R6VA 2CRZA 4Y5YC 5J1AB 1RSFA 3O2WH 5FYJE 5MERB 3QRGL 4P3WA 3RIAK 5FUCC 3AXLA 1AD9B 5E9DA 1VCAA 4BZ1H 1J18A 4QO1A 1YMHB 2VLJA 2DQDL 5D7JA 4LGRB 1MNUL 1DBJH 2VZUA 2YXFA 2NY5C 4B5EA 1SJEA 1KT2A 5T1KD 3U2SB 1A9BA 1IEAB 4RGMB 2AQ3A 4R4ND 4GS7B 4POUB 2EYSB 4G9FB 5I8EA 5BRZB 4LRIC 4M3KB 5DD1L 4XB7A 5F7WC 4F33A 1VERA 2QJDA 5D7KE 2IPTH 4MJIE 5A43C 2OSLA 1RUQL 4XRCB 2YEZB 1DBBL 4KRMB 2VWEC 3B4NA 4C56D 4E0RA 4X4YB 1RIVH 1T1ZA 3MODH 4L1DA 3IAPA 1NUGA 5CS7A 4LRIA 1ZLSH 4HCRL 1RJLA 5F1OB 2HRLA 1FNHA 2YD5A 4EDWH 4GOSA 4G9DA 3TO2A 4C4KT 1ZA3B 4P2OB 5FO9B 4NKMB 1NEUA 3L5XL 2A6KB 3OXRB 4PB9L 1CIDA 1WTGT 4TUOA 1PDKA 2VDKH 4OLUL 5IHUL 2KKQA 4QRQA 4DKAA 3CD4A 3ROOA 3QUXB 5I1EH 4LF3A 3R06B 1SM3L 1T66D 3T4AA 1UYWH 3TBTB 1QACA 2GY5A 3SKOA 1WZLA 2EZ0C 1R3JB 4X6DA 4TULH 1LD9A 2VE6A 5JOPE 4HIIA 5E4EC 3ZSTA 3SGKC 3WSQL 2BSTA 3SO5A 4UZGA 5IR1B 4K71C 4FQ1H 3VGAB 1RZKH 1B4RA 4HBQA 4GUPA 3FQXA 1FH5H 3BP5A 3D2UB 4U1NB 3HC0B 2BK8A 3DIFA 5EZJA 1L6XA 2GKIA 2Q87A 4LFHD 4XVUD 2OLDA 4X7FC 4NQEB 1XGTB 4F7EB 2YD7A 1HSBA 3SGKA 2HMIC 4X7EC 3CVHB 1JYWA 5EPMB 1T5XA 5F7DB 3ARVA 3C9NA 3RP1A 1X5JA 1PG7H 4Q0XH 3SY0B 2HFEB 3UTQB 5GRUL 3VRJB 2XZQL 5DFVC 3L3JA 4YDVA 1QFWL 4BH8B 5T3ZE 1T20A 1U8MB 3RPIA 2E3VA 3KLAA 3RAJH 4G42A 2ZOKB 3IU3A 4Y1AB 5J1AA 4RGMC 3SCMC 1V7ML 2HJKB 1DCLA 2NLJB 1AD9A 1KJ2B 4J6RL 4NGHH 5D5MB 5KVEL 3CK0L 5T3ZH 4AEEA 4M9PA 2R1WB 2Y72A 1YMHA 1UWGH 2VABB 3RWCB 3VXUD 4HJ0C 4KTYA 3WIFB 1IAII 2KQNA 1NGPL 3MA9L 5E95B 4AMKL 1G7MA 2LU4A 4JY5L 4LOUC 3QO0B 3U2SA 1RV6X 1F8TL 1IEAA 3QUKB 5D2NC 3VXMD 2WANA 4IIQC 2EYSA 4G9FA 5BRZA 3S98A 4NZDA 4RMWA 2WW8A 1MRDL 3QDME 2DTML 4P46B 3T1FA 5I8OH 2ICES 3SDCD 2N7AA 3PDOB 3IU4L 4P2OC 1E4WH 4HS8L 4FFVC 1KPRB 4GRWB 4XXCC 5ESAB 3NVQA 1QYGH 1UWEH 1LO0H 4X4YA 3QUXC 2BX5A 3S5LG 3HRZB 3OKKB 1A6VH 1S7RB 1N6VA 1KTDB 3RBGA 4JDTL 2WZPD 1R3IL 2D7TH 4WI7A 2Z35A 3QWQB 4GMTH 1ZA3A 4P2OA 5FO9A 4NKMA 2A6KA 4KKAD 3OXRA 4LLAA 4JM2B 2NY3C 1PGRB 4XXCA 3GIVB 5EC1B 4MAYC 3VGAC 1I9IL 3QUXA 5ILTH 4S10A 1I1YB 5FV1L 3K4DA 1X5XA 3R06A 3NCJL 3ZKXB 1WWBX 3KYNB 5EO0B 3TBTA 1ADQH 1C5CL 4HWBA 5I8KL 1YPZE 2FBOJ 1JZ8A 5LGHH 1NMBL 1R3JA 4L9DA 4I5BB 3QIBB 3N85H 3LQAC 4ERSH 3LOWA 5FUOH 5IR1A 4MLIA 5I17B 4LBEB 4PYHA 1JPTL 4MAYA 5DK3A 5E94B 4X99B 4NT6B 4TPRH 1MF2H 4PRDB 5E6YA 3D2UA 5TF1H 4FP8L 2DRUA 43C9B 3HC0A 1INEL 2XG5A 1CE1L 4NQEA 3WFEL 1XGTA 5HYSA 4LIQH 4C56E 2X4UB 4TOYH 1JYVA 5K33A 3CVHA 1CFQB 5IBTL 2A1WH 5EPMA 4OZHF 3PE9A 5F7DA 5F9OL 5FYKD 4L8BB 1QFOA 1P84J 1EZVY 4K8RH 4JFOB 3SY0A 3UTQA 1U58B 2HFEA 3VRJA 2CH8A 4Y8AA 5DVOA 4OCSH 4NUGL 4BH8A 4BSWB 2MQCA 3C5ZB 3D87B 1U8MA 4XHQA 2ZOKA 2QSVA 4Y1AA 1XF2B 3BSZH 5DRWB 1Z3GL 4DTGL 4L5FH 1GGIH 2B4CC 5DMJB 3MO1B 4QHUB 2HJKA 1J88A 1MLCB 1KJ2A 5D5MA 2J6EH 4POZC 2IQ9H 1UZ6F 1I3RB 2D03H 1XCQB 2R1WA 4PY7B 1AR1D 3FZUC 5CGYC 1NCTA 1I1AB 4FS0A 3VFGL 2VABA 3RWCA 1XF4B 2VDQL 1MHPL 2AJUL 4YDIL 3TYGL 1BMGA 1TVBB 2XPGB 3DWTA 4P2QD 3DYMA 5EU7C 5GJTH 3SDXF 4OBRA 3QO0A 3QUKA 4XI5C 2EDQA 3ZYOA 3V4PL 1FIGL 4I13B 4QY8B 3E6FB 3MOBL 5A2KH 1T2XA 4P46A 4X6FB 1F90H 3GMRB 3PDOA 4FQ2H 4QYOB 5ANMA 3VXRE 4NZRH 1FC1A 4JM2C 4PJXE 1KPRA 2IAMB 3K8KA 1PSKL 2IBZX 3QXUA 5ESAA 4X83A 3T0ED 3ZDYE 4RZCB 5ELIA 5ID0B 2Z31B 3HRZA 3OKKA 3DX9B 3ZKXC 4NWUH 1S7RA 2CKNA 4Y4HB 1RZJL 1KTDA 4CDGC 2NY1D 2VJXA 4NN5B 5D7IF 2HT4D 3G9AB 3P77B 5IBLD 5I1JH 2XXMB 4JM2A 3W11D 1OAZL 3OKEB 4WHCA 2F8XC 3GIVA 4LLVB 5EC1A 4PJGB 1L7TH 1FGVL 1I1YA 3EFFB 1DDHA 2UY6A 4TQEH 3KYNA 5EO0A 3VXUE 4D3CH 1JHTB 2Y36H 3FTGB 4XGZB 1K9TA 4OCNC 3RKPA 1KB9K 3SPVB 2P45B 4RAHA 3CSPA 1OD9A 4G5ZL 3VD7A 4I5BA 3BEWB 3IB4A 3QIBA 5GGRY 1KFAL 2I07A 4NNPL 2NY5L 3VXME 4QXWA 2VKWA 4M7JH 5I17A 4LBEA 4CU7A 5E94A 4TSBH 3HC3H 3U30B 4X99A 4NT6A 2RB8A 4PRDA 3I9GL 1FV1B 2EXYD 3L3HB 3UCRA 4G7VL 2DYPD 43C9A 3U4BH 3HC4L 4TNWF 4U1LB 4F7MB 4TUJB 4OB5H 4HDIA 3PDGA 5H37H 1J0JA 4XNUL 3N06B 2X4UA 3EDJA 3M45A 2PO6B 3ILQC 1H3PL 1CFQA 3T0VA 5HDLA 3WXWH 2XI9A 4YHIB 4L8BA 3ULUL 3I50H 3VMOA 4RIRB 1RPQA 4BZ2L 4JFOA 3SGDI 1U58A 4IRSB 15C8H 4PLKC 1QBBA 3C5ZA 4BSWA 3HA0A 2A74B 3SKNB 4NKQB 5KAQG 3ARFD 5KSUB 1XF2A 4YHLL 2PF6A 4UUJB 1EHLL 5DRWA 5CLWA 1OPGH 5B3JE 3MO1A 5JUEH 4QHUA 1MLCA 5LG1A 1IKFH 2R0ZH 1I3RA 3PG2A 3Q0HA 4QHLB 1XCQA 4PY7A 5CJOL 1I1AA 5JMOC 4NO5B 3PHSA 1XF4A 1HOCB 5GGVH 5HPOA 1TVBA 2XPGA 5DVNA 1YEKH 3BT2L 5F9WC 1LHZA 2C26A 1PX4A 2Z31C 3BYYA 2EE9A 4TTDC 4P9HH 4QY8A 1N3NB 3E6FA 5E8PB 1FO0B 4Y4HC 1BREA 2YD4A 4X6FA 1IM9B 4WFFD 3GMRA 4NRYB 3DVIA 5E6IB 1B2WH 2JELL 4QYOA 1NMAH 1QLRB 4GAJH 3RWEB 1JPST 3GI9H 1RZ7L 2IAMA 1REIA 3PP3K 5FYKE 3X3FH 1RZ8B 5ID0A 2Z31A 5IWLA 2R4RH 3EOBB 3DX9A 4KKLD 1VESA 3LPGA 4Y4HA 4ONFL 1MCJA 4QLRA 4RBPH 3QQ9C 4J23A 4R4FL 1LK3H 3P77A 4EIGB 1NMCB 2XY2A 1X44A 2WM0A 3OKEA 1HXMB 1RULH 3K4AA 4LLVA 2P5EB 4P2YA 3U30C 2E27H 4PJGA 4AJ0A 3P4MB 3EFFA 1U8NB 3O4LB 3NGBC 4WEUD 1XGUB 1JHTA 4XGZA 3FTGA 3SPVA 4EIZC 3CFEB 1CXFA 4P2QE 4LSSH 3BEWA 1IGCL 1H8OA 3LIZH 5E2TL 1JRHL 4XPBH 5BCAA 2PO6C 5GISH 4XCNB 4DN4L 1PEZA 5JDSB 1S78C 3V4VL 1DQMH 3C6LC 4HXAH 1FV1A 3L3HA 4N1CA 2C3HA 1X5AA 4OFYD 5K9QG 4DGIL 4IRSC 4D0CB 3N1PC 4F7MA 5BS0D 4TUJA 1G9MC 2VXVH 5KVMC 3A6CL 4I3GA 3OKMB 1FGNH 4O4YL 3T0EE 4Q9BA 2VQUA 1QR4A 2PO6A 2Y07L 1VGEH 2PN5A 4LGSB 1A7NH 3W0WD 4YHIA 2BNQD 3RWDB 2R39A 1EHAA 1OAKH 4S1DC 4M7KH 4XPGH 4IRSA 4DK6A 1J0ZA 4HGMA 4W4OA 4HWBL 2EDWA 3HI1B 2MKWA 4N0YL 2NR6D 4D2NA 5F96H 3EYSH 2A74A 4K7PL 3SKNA 4OF5A 5KSUA 4UUJA 2NW3B 1Q8MA 3MRRB 3ZTNH 3BQUD 3QCUH 4QHLA 3FT2B 2XN9D 1FDLL 1BQLH 4NO5A 3RL2B 1HOCA 5BV7B 3L5JA 5LWYL 3R8BB 4YBHA 2VZSA 2P47B 3F5WB 5FXCH 3T2QA 3LPWA 3RX5A 1IBGL 4OIAA 5F3BB 1N3NA 1FO0A 4C55A 2GEEA 3JWDH 4Z18A 4LHUB 1IM9A 4DK3A 4F37K 4NRYA 5E2UL 3UTOA 3EUUA 4GAGH 4KROC 4KUZH 1NMCC 1QLRA 1WCBB 3RWEA 3QUMH 4QRPB 3EZJB 3GEWB 4BZYA 1WSST 1LDPH 1RZ8A 1DLFH 3EOBA 3RVXD 2ZJSH 4EUPB 1EFXD 3P30H 4HAGA 3IJYA 1FNAA 2W38A 4DFIA 1JZ4A 3UBXG 3MRBB 2VSDA 3OZ9H 1UXWA 5F6IB 3FRUB 5C1MB 3OMZA 3WV0A 4S1RL 4DAGH 5D4QA 4U1HB 4B41A 5E99H 3BRFA 3WNNA 4H1LH 1HXMA 2P5EA 1A6TB 4HPYL 1Q72H 2YZ1A 3GHEL 5E5MB 3DO3A 2B4CL 3P4MA 4DKFL 1U8NA 3D69B 3MRPB 3O4LA 1MUJB 4CU8A 1XGUA 1KNOB 1MCQA 3AAZA 5C08E 1IEHA 4P3CH 3CFEA 4PTUB 3UO1L 4U6VL 4CBPA 1V8HA 4XCNA 1HXYB 2ADIB 2P4AB 4LNRB 5JDSA 3EKCA 4NKOB 3I3EA 4O9HH 5F7EH 5I1IL 1MY7A 4WFFE 3MLUH 2X44D 2W0PA 3TH3T 3RVVD 2E8YA 4N8CH 4D0CA 1FNFA 2BDNH 4PR5B 3NA9H 1P4BL 3OKMA 5TFSL 4GG6E 5JQ6L 1CXLA 2DDQL 5GRWA 4IRJD 4OCXH 1QSEA 2WUCH 5DR5H 5DXWA 5IFHH 1TETL 1CDJA 2P1YA 3TGXA 3RWDA 4X80H 4NC1E 5TQ2L 2YN5A 2AK4B 3IDUA 3BKYH 1SY6H 3HI1A 2X7LB 4HW6A 1HNFA 5I15L 5KW9L 4NP4H 2D3VA 5DJCB 4HIEB 1T89C 5DT1H 1Z9OA 4PBXA 4HUXB 2NW3A 4GRLB 1UM6L 1RMFL 5IVXF 3MRRA 1PX3A 3LHPL 4KV5E 5IB4B 4PP1C 3INUH 4JKKA 5JR1L 2B5IB 3FT4B 1RI8A 3FT2A 3LB6C 1MAJA 1YZZA 2GI7A 2EIZB 4YGVA 1ETZB 4LDOB 3RL2A 2C4FT 2WWMD 5F93C 4CU6A 5B39B 4QXTB 1QLEH 1T89A 3PWUB 4O02L 5DUML 1BPVA 1I9JL 3BMWA 2XTJD 5F3BA 5BS0E 3BAEL 4LHUA 2WP3T 1NCNA 1YEFL 3LPFA 3MRQB 2ICEB 4E42B 3GNML 2G2RB 1CIUA 3B2UD 1RUKH 1WCBA 1XGQB 4FQCH 5T1DH 4QRPA 4FMKA 2PETA 1UM4H 4P9MH 2ICWI 3QEQD 4TSCL 1E4JA 4U0QB 2YD2A 3L9RB 4EUPA 5I16B 2PCPA 3FO0L 3BE1H 3MRBA 1JHKH 2VXUL 3EHBD 3OGCB 4NKIL 4YR6B 4OKVA 4LVEA 3FRUA 1YEHL 2NCMA 2V7HB 4W6YB 3QNYA 4OZHB 2VLRA 3FMGH 3ME0A 3PHOB 4JPIA 4U1HA 4X5XB 5JHDB 2VERN 1EO8H 4YHKH 1BQHB 3IETB 5DD3L 1A6TA 2EIEA 4WUKL 1YDPB 1L0QA 4PJAF 5E5MA 4PJBF 5EFIA 1CDBA 4G8FB 3D69A 3MRPA 4XC3H 1MUJA 2OR9H 3ARQA 1KNOA 3VW3L 1MCFA 3V0VB 1CL7I 3B43A 3LD8C 2HTKC 1MFAH 3UMTA 4PTUA 1FL5B 5CZXC 4X9GA 3VG0L 4KTEL 3VJ6B 3VDBA 1ZMYA 2O5XH 5FKPB 4HWEH 4XPHH 1HXYA 2ADIA 2OTWB 4YXHL 4Y5XC 4NKOA 4J4PA 3MBXH 5IESL 2OL3H 1MRFH 3E3QC 4ODWA 4NBXB 1GRWA 3MV8D 4MAUL 4PJHF 1IAKB 1MCOH 4PR5A 4S1SH 3UZQA 2YOCA 4M1DL 1BBJB 2YC1A 5F89B 2CRIA 5E56A 4BFIA 1LO4L 3WNOA 1VHPA 4HPOH 4GRLC 3KPRE 3TT3L 1NGZA 5EU4B 3FCTB 1MCHA 4Z7VE 5C0CB 2ERJB 1IQWH 4Y4FC 2B5IC 2AK4A 3O9WD 3EO9L 3P11H 3WYRA 2CO7B 2X7LA 4PJ9B 1EV2E 2VZOA 5JPMB 2DIAA 3GIZL 3NCMA 4Y19E 4GQ9H 2KL6A 2Y1VA 5E00A 5DJCA 4HIEA 2LAGB 1N5YH 3IT8D 2VR9A 4Z0BH 1CD1B 3CFKB 4OLVL 4GRLA 5D7IB 2VQ1B 1MWAA 4KRNA 4WEMB 5IB3B 2YUVA 4RWHA 5IB4A 2GHWB 4FQXB 2W9DL 3FT4A 4CMMB 2YD1A 2EIZA 1ETZA 4O2EB 4RMSA 4ZS7L 3EJJX 3CFCH 2I27N 3T0WA 1BJ8A 4YZFE 1NANH 1IFHL 3V6OC 5B39A 4QXTA 4QRRB 1A5FH 2V5MA 2ZUYA 5C0GB 3PWUA 2B8OT 4JZJB 2HKFH 2QL1A 3MRJB 5EZOH 2NY0C 4OCMC 4F9PC 5T5FL 1BVZA 5IVZB 3U82B 1G7JB 3UDWC 3MRQA 3U7WH 2ICEA 4E42A 4M6OL 5E1AB 1FCCA 2G2RA 1NPUA 1G9ML 4A2LA 4KQ3L 5FM5O 1TITA 1XGQA 1TIUA 3QAZB 4BM7A 5FO7B 1OTUD 1CDIA 2ZG2A 3WFBH 2NYYD 3MLSL 4JQXC 4LEOB 5DHYB 3L9RA 5ESQB 5I16A 1WVZA 2HKHH 3RTQB 3GHBH 1OTTC 4HXBL 2A0LD 4L9LC 1EZVX 4HLJA 3OGCA 4YR6A 3UDWA 3QISA 2BJMH 3RU8L 4KGLA 2V7HA 5F7YC 3PABB 3FB5B 4OZHA 1RURH 3PHOA 2Q3AA 5KJRH 4JANB 1P5VA 1BQHA 3IETA 3TIDB 3U0TB 2EEDA 3RKDD 1YDPA 4UT7L 4XZUB 4KKBC 4YHOH 4G8FA 1FO0L 1Q9WB 1TJHH 5C3LD 2HA1A 1JI2A 1BBDH 3V0VA 2EDLA 4S1QH 1A3QA 2ZCKH 4IMKC 5CD5D 5EN2A 1FL5A 2DQFB 3VJ6A 5CINH 3WUWB 5FKPA 1RHFA 1T04B 1NCDL 1MFCL 2XTJE 4P4KB 4JM4H 1IAIL 1X4YA 4ZODA 4RAUB 1JHLL 4JY6B 3M07A 1CYGA 3O3EB 5ACZB 4ZYKB 3GFUA 2ERJC 2O93L 4KUCD 4MS8D 2HWZH 4DGVL 2JB6B 3EJYC 4PG9B 43CAB 1IAKA 3SDXA 5BXFB 4IMKA 3MV7D 2VDPL 3SO3B 4WY7H 2R56H 2OMBA 3VFUB 1F4YH 5DVMA 4YC2B 5F3HB 4HT1L 3DURB 3O3AB 4JFZL 5EU4A 3FCTA 5JQHC 3A6BH 4HF5H 1MRCH 3HE6B 2XKUA 3ARGC 4FFYH 4XC1H 5C0CA 4DVBB 1YA5A 2EEAA 1CGSH 2DQHH 5JORB 1UQSB 3L5HA 4YXLH 5HYJB 5JPMA 3VE0B 1NGQH 5E08H 2DI7A 4JQVC 3GMOB 4JVUA 2DWDB 3HE7C 5J0BA 4JZJC 4LQFL 2ZSWB 1CD1A 2EYRB 4ZUTB 3CFKA 1N6QH 5D7IA 1KCUL 1VENA 2VQ1A 5C6TH 2QLVB 5C8JB 5IB3A 1FCGA 2CUMA 2J2ZA 3ARGA 4FQXA 3KPSD 4CMMA 2ZUQB 1JF6A 4JFXB 3OR6B 4O2EA 3THMH 3NIFE 3ARBB 3QAZC 4JQVA 3U46B 4Z7QE 4QRRA 5F7KC 4QOKD 5C0GA 4JZJA 5GSRA 1AY1L 3MRJA 3MLWH 1VADB 5IVZA 3RTQC 5KANI 3MV8E 2X4RB 3RGVC 4JG0H 1G7JA 2BY2A 4L4TB 2EYTB 5TPWH 1LEKB 1VEOA 4PP2B 5E1AA 1AP2B 1U3HD 2AK1L 5FO7A 2MPAL 3QRFM 4Z9KB 1C1EH 4OLYH 3AS0A 4LEOA 1YQVH 5DHYA 4FMFA 5ESQA 4X6EB 4WWKB 4P57B 3RTQA 3BHBB 2CLRB 1NKOA 2DKMA 1NH6A 1QBLH 1KENH 4RA0C 4V1DB 3WJJC 3KR3L 1QFUL 2VL4A 1IM3B 3PABA 1Y6KR 3FB5A 2IF7A 3TFKD 2MFNA 5HGBB 3LMJL 4JANA 3G9VA 3TIDA 3U0TA 4P4KC 2BOBB 3MLVL 1OAUL 4XZUA 3ZT7A 2FD6L 4JB9H 3W82A 2MMXA 1NCWL 3CZJA 2ICWB 5EBLB 1Q9WA 4YX2H 2W9EH 3PP3H 1JWSB 5EORH 3ZE2F 2BHUA 4HMDA 4ZFOB 5JIKA 1E6OH 3PP4H 3SO3C 2DQFA 5SX5K 4MNQB 3W39A 3QJHB 3WUWA 4S2SB 3QT2A 2R4SH 1UT9A 1A8JH 1EERB 2HT3C 4P4KA 3SDDC 1QP1A 4RAUA 4WUUB 3IJSB 4JY6A 4APQB 1KGCE 3O3EA 5ACZA 1A3LL 2X4SB 5EWIL 2X40A 3OB0K 1OGAA 4FOMA 1QSFD 4Y4KB 2FX7L 5ADOL 1J05B 1LO2L 2BHYA 4PG9A 43CAA 3HAEB 5BXFA 2BNRB 3ZYJA 1WAAE 5JZ7C 1NGXB 3VFUA 1RY7B 4Y5VB 5F3HA 4XBEL 1ZLUK 4DCQB 2K1MA 3X3GH 3O3AA 3LKQB 3V4UH 3TBSB 1JNNH 2PW2B 4BZ1L 4CUCA 5IMLB 3HE6A 1EGJA 3E2HB 2G60L 6FABH 5EG6C 4DVBA 3QQNA 1T4KB 2VKXA 5JORA 1UQSA 2F74B 3GJFB 5HYJA 3LEYL 3VE0A 3ARBC 5AZEH 4WEBL 4WIQA 1TLKA 3GMOA 3IVKA 2DWDA 4RAVA 5D96B 1KACB 5CEXB 5HHXH 5FB8A 5FV2A 2ZSWA 2EYRA 4GKNB 4Y2DC 4ZUTA 3PV6B 2EH8H 1DN2A 4BK4A 1BJ1H 5C8JA 3S97C 3MLRH 3OL2A 2A6IB 1RK1A 4G8GB 1GVIA 2VO5A 1TXKA 4UAOB 5FHAH 1VPOH 3EYOB 4JFXA 3OR6A 2MNUA 3BPLB 5JIHA 5HYSG 4CMHB 1KB5B 3ARBA 1ORSA 2J8OA 4Q6IC 1AFVH 1T21B 3JBG7 3U46A 3STZB 5HVFB 4XHJD 4MXWH 5SX4I 1Q0YL 1M1SA 2X1QA 1ZLSL 1CZ8H 3HNVH 1VADA 1IC1A 4NM8H 2F58L 1HINL 2X4RA 4PYGA 5IEHB 4L4TA 3MV7E 1F42A 1WUNT 2ORBL 2EYTA 3HN3A 3U7YH 1LEKA 3T77B 1IC4L 2FBJL 4PP2A 4HKJB 1C5BL 1F4XH 1AP2A 2IJ0C 4YHYB 3GBNH 4R26H 4EXPX 4Q6IA 4CN4A 3DO7B 5DQ9B 4U6TA 3NH7H 4MQXD 1X5ZA 3WFHB 3NAAH 4X6EA 1MWAL 4WWKA 4P57A 2YPVL 3BHBA 1NANI 5J4MA 5E8EB 3F62A 2CLRA 3GK8L 3QUZB 2R0KH 1QVOB 4XMKL 4MA7L 4V1DA 5FIEA 2H9GB 1MREH 3B9VA 2Q20A 1IM3A 1U42A 3IDNB 4OSUL 3NCCB 4ODHL 4Z5RB 4X6BB 1NAMH 3ZO0A 5DUBB 2BOBA 4F8QA 4PJIE 5B4MC 3KPSE 5GRYA 2Y06L 4APQC 2QQNH 1RIHH 3SKJH 2ICWA 5EBLA 4CAGA 5KVFL 1B0GB 2DQEH 4M03A 2P8MB 4Y4KC 3B9AA 1JWSA 4LMQI 2VH5H 4ZFOA 1IVLA 3V0AC 2VDMH 4QOKE 4MNQA 4Y5VC 5IVXB 4OIIL 3QJHA 4S2SA 2E6JA 4RX4A 4JPVL 4XP1H 3Q48A 3TF7C 1MOEA 3V0WL 4I77H 1UXSB 4HC1A 4WUUA 1RZFH 3IJSA 4QTIH 4ODTH 4APQA 1UB5B 1L9MA 3E2HC 1FJ1B 2X4SA 5A3IC 3D39B 5ISZD 4Y4KA 4GFTB 4OQTL 4BSVB 1J05A 4BFEA 3EFDL 4JG1L 1QKZH 3HAEA 5TE6L 2BNRA 4NPYB 4EOWH 2UV3A 3TH4T 4JPWH 2H32H 2D7NA 1NGXA 2Q3ZA 3HLAA 4Y5VA 4PGEB 1HH6B 4DCQA 5C07E 3RNQB 2FYYA 3D0LB 2KZ1B 4QGYA 5GGTH 1VKXB 3LKQA 2DN7A 1N7ML 4LCYB 2PW2A 1BIHA 3LKRB 5IMLA 3H6JA 5HI3D 1IGFH 4W6XB 1T4KA 4AY0A 4XVTL 4Z7WE 4UAOC 1SYSB 2F74A 1QFPA 4P23D 3MNVB 3LEXA 1Z2KA 1BD2D 2ESVB 5AYUL 1EEUA 4IOFD 5F8RC 4YH6A 3ZT5A 2HRPH 2VDNH 2YRPA 1MJ8L 5DJXA 3OKOB 3O3DB 2ADGB 4GKNA 5B21A 4G8EB 35C8H 3B9KC 3JWOH 1V5JA 4TNVK 1OSPH 3K74B 4NJAH 2A6IA 3NBNA 4G8GA 4ODSL 4K2UH 3EYOA 4LSPH 3MRDB 4NQDD 4OZGE 1VGKB 5DO2D 5GIRB 1KB5A 3MRMA 4PJAB 1T21A 3ROLB 3STZA 4PJBB 5E24E 1P4IH 3C2AH 3RGHA 3UYRH 2YXMA 1QSFE 5IW3A 1XT5A 3FQTB 2VXTH 3QUZC 2GTWB 2BRQA 3KPPB 4LNVA 3KLHC 1S5IL 1KCKA 3DMMD 4B0MM 3GKZA 1F58L 2NTFB 1U8JB 3DO7A 3QG7L 1A2YA 5DQ9A 4MYWB 2IMNA 1N59A 4ZTPH 4JFED 3WFHA 4PJHB 3DYPA 1NC2A 1YEIL 4U7KA 4F15C 5J9PB 2AEPH 4P99A 1CU4H 3MOAH 5E8EA 1CD9B 1OTSD 4OZIE 1D6VH 1F3RB 1UKQA 3QUZA 3KHQA 4XCYB 5EUOF 3X17A 2C3VB 3MLYL 4JFDB 4LCWD 2D7MA 1RUML 1VDGA 2H9GA 5L2KB 1R0AH 5LCVL 4OCWH 3IDNA 4ONGH 1LE5B 1P1ZB 5B22A 3U83A 3PGCB 4Z5RA 5EU6B 2V17L 1QSZA 3AGVA 4TPRL 5DUBA 1MF2L 3AREB 4FQPA 4DW2H 4BQ6A 2J7LA 3WLBB 1B0GA 2P8MA 1V3LA 4QNPE 4LIQL 5DWUH 5M95B 4JRXD 5IVXA 4RMUA 2A1WL 4PJCF 3RIFF 4MA8L 1JK8B 1UXSA 5BZDB 1UB5A 3X12B 1FJ1A 1I9EA 1EO7A 3D39A 2CK0H 4JO3L 3WE6B 1FLRH 3MLZH 4YHZH 4JHAL 4NPYA 4XPAH 4XWOD 3TBVA 3D6GA 4PGEA 2DQIH 1HH6A 2CLVB 4L5FL 2FX8H 1GGIL 3RNQA 3HS0B 5I73B 3D0LA 1ERNA 3CLFH 2IQ9L 3MXVL 4RFOL 3LKRA 2P48B 1B0WA 3IFNL 4JJHA 1MFDH 1K6QH 2E9IA 4GMSL 2WBJC 2DIBA 5C09D 3U9PL 3GRWH 1SYSA 5K9KB 4I4WB 1KF9B 3TA3B 5HTSA 3MNVA 3EIFA 3VDAA 3QULB 4EDXB 4ZFZB 2ESVA 5E7BA 5HHOB 4GW1B 2CO6B 3WIHH 1D9KB 1YMMD 4OLWL 1A7BA 3OKOA 3EDDA 3O3DA 2ADGA 1G84A 2ZNXA 4NFDA 2IANB 4G8EA 1YNLH 4EBQL 3D48R 1F90L 3MGAA 3NACL 2WBJA 3I2CH 4FQ2L 4OGAD 5IGXH 1W0WB 2E7HA 3H9ZA 2YR3A 3HFMH 2DTSA 3K8MA 7CGTA 5GIRA 4PJAA 1QNZH 3WIIL 3ROLA 4PJBA 5CCKL 3WDHA 3O81A 5CJQH 2J8UE 4NWUL 4J12A 1YC7A 5ISZE 3TCXA 2F19L 2EC8A 4O58H 1KIUA 3FQTA 3LRGA 1KTRL 2V5RA 3KAAA 3RWGB 2CLZB 3T8XB 2WMPA 2J5LB 1CLYL 2GTWA 3KPPA 2VITB 5B8CB 1WJ3A 1W0YT 1WT5A 2NTFA 4OCRH 1U8JA 3SE9H 2HTLC 2ITCB 4HUUB 1JGLH 1L7TL 3DETD 3LZFL 4KKCC 4PJHA 1DSFL 5HVWA 4LSUH 4UB0L 5J9PA 4Y89A 3MGTB 1P7HL 1MIMH 4XCYA 1A3RH 1YJDC 2C3VA 2H1PL 4JFDA 5E8DH 5EU5B 5L2KA 1LK2A 4FQLH 3D85B 1AQKL 3ZKND 2CR6A 1LE5A 1P1ZA 5I74C 3PGCA 3S34H 5EU6A 1RAMA 1CD8A 2W0KA 1EUUA 4IM8A 3AREA 3QNZB 2OP4H 1LVEA 4I9WD 1IC5H 4HSQA 5JTWA 1SEBB 1BGXL 4PJXF 3WLBA 4WTWA 1INDH 4XP5L 1FYHB 4MNHB 3OHXB 5JHLL 3MJ6A 1QZ1A 3W2DH 4XCFL 4NJ9L 5D7LE 2P8PB 1U92B 3QRGH 1JK8A 2NMSA 3I50L 3FHQA 4GRMB 2Q6WB 5BZDA 5AWNL 3X12A 1A21A 4U7MA 1WFTA 3WE6A 3LRHA 4XVJL 2IEPA 3CFBB 2NXZD 3UC0L 5TH2B 1MNUH 3I6GB 1R3LB 4GKSB 3D18B 2NZ9C 5ICXB 4MWFA 1D9KC 5GS3A 1LQSR 2CLVA 4JFEE 1UB6B 3O6FD 2DBJA 4ZUWA 5HD8D 1W8OA 3HS0A 5CBAB 5LGJB 3VWJB 1MIEL 2XA8L 1I8KA 5DD1H 4LCWE 4N0CC 5T33L 5K9KA 1W8NA 2CRMA 3PWJB 4I4WA 3TA3A 4ZFOL 3QULA 4EDXA 4KFZC 4U1JB 4ZFZA 4BQCA 1RUQH 5HHOA 3UZVB 5J1TC 3TIEB 1D9KA 4I0KA 4ZD3H 1DBBH 3V8CA 3DHJA 1U8QA 2JJVA 4UOW0 3T4YA 4JGMA 2GK0B 4BJLA 2X10A 1YQ2A 2IANA 5ACLA 4HC1L 2EDDA 2Z8WC 3NIDF 1ODAA 4MXQC 3DRQB 4JN1L 1WIPA 5JXAH 1JWMB 4HCRH 3A6OA 4OJFL 2J5LC 2YA0A 4V2BA 3EYUL 1NMAL 1TJIL 4JRXE 1W0WA 4GAJL 4ZS6C 4ZUVB 5B8CC 5CJ5A 2D2OA 1DUYB 2LTQC 4M9OA 3OV6A 4PB9H 4NO0B 3VRLE 1CL7L 4H26B 1NBZB 4OLUH 4RISL 5IHUH 1U8PB 1TQCB 3QPQC 1BEYL 3K46A 2E7LC 3MRKB 5K9JL 2CLZA 3T8XA 3DECA 2LU3A 5B3JF 5B8CA 3U48A 5IJKC 4QHNB 1HIML 1L4IA 3JZ7A 3OG6B 2ITCA 2KBGA 1UFUA 3CH8A 4HUUA 4MNGB 3WSQH 3CPLB 3GSOB 1FYTB 4PRIB 2E7LA 4WHTB 5C09E 3MRCB 1P6FA 1G6RB 3MUGB 3MGTA 3OGOE 3MBEC 4M8QB 5D70L 1I8MA 3MJ9A 3GSRB 1YMME 1EXUA 3D85A 4ZXBB 2RQ8A 1EDQA 2YS4A 4K3EL 3QI9C 1DQML 2VLJD 1UJTA 5HI5D 4M6NL 1SEBA 5JO5B 1RVFL 4LHUG 5JIIA 3H3KA 3MBEA 5GRUH 1CICB 2VLME 2XZQH 4X98B 2DI8A 1BFSA 4QRSA 3OHXA 1QFWH 1ZGLP 1JPFB 4JZOB 1JPGB 1E28B 5BO1L 4PJ7E 1J10A 2UY7A 2YPKB 5DC4B 3UPAA 2P8PA 1U92A 4ZO6A 1FVDB 4ZNCD 1U8KB 5HY9B 4EUPG 4JREB 1V7MH 3P4LA 4GRMA 4J6RH 2Q6WA 3QA3B 5KVEH 4XPGL 4XBPB 5I1GL 3CK0H 3KJ6L 5JXEC 1C16B 3ULSB 2FNBA 3CFBA 5F96L 5TH2A 1KIQB 3I6GA 5D93B 1R3LA 4GKSA 3D18A 3VFRB 1NGPH 1B6DA 3MA9H 5ICXA 5E4IA 5D8JL 5I1KL 1UB6A 2FRGP 4AMKH 1I9RL 3LRSB 4JY5H 5CBAA 4H8WC 1F8TH 5LGJA 4J3VA 5SWSB 1VFMA 1GAFH 3O11B 5SX5H 5F6HI 1MRDH 2DTMH 5JXEA 2W9LA 2GAZA 1BQLL 4R96B 4IBLT 3PWJA 3VWKC 3WHE0 3IU4H 4U1JA 1T83A 3ULUD 3KPMB 3TIEA 3HUJF 2P44B 1C7SA 4EI6A 3OB0H 2GK0A 4PS4L 2ZPKL 5I1DB 2CUHA 3DRQA 2O26U 1JWMA 4B7LA 4YPGB 2B1AL 4JDTH 1ZLUH 4G6FB 1R3IH 3EOAB 4ZUVA 3WJLA 1EPFA 1O5DT 3KWWB 1AKJB 3RDTC 1MJUH 1DUYA 2XKSA 4MJIB 4KK8C 3ESUF 4NO0A 3ZKMC 2OTPA 1NBZA 4H26A 1U8PA 4HJGB 1I9IH 3NPZB 3CC5B 4C58B 4J3OC 3HHRB 3MRKA 3SGJC 2I5YH 5IMKB 2EZ0D 2EDOA 4E5XB 3HB3C 4L3ED 2BXYA 1KJ3L 3GSQB 1C5CH 5FA4B 5I8KH 5D9SB 1JFQL 3N0PB 4JVWA 1NMBH 4URTB 4ZXBC 5E99L 3RDTA 3X14B 4QHNA 4L4VD 4ZO7A 5I9QC 2UVFA 2VZ1A 4MNGA 3CPLA 1U36A 5DDHB 3TWCL 1FYTA 4PRIA 1JPTH 1PVHA 1NEZB 2UWEE 4WW1B 4WHTA 3MRCA 3MRIB 3SGJA 1CVSC 4FP8H 1G6RA 3MUGA 2RAMA 4M8QA 3RIAF 3VGHA 3SOBL 12E8H 1CE1H 3KXFB 3GSRA 5DA4A 4D0DB 4HGKC 3UJIL 3TN0C 4ZXBA 1A7RL 5B39G 1MVUB 3P0YL 3QIUB 1MFEL 3V6FB 5BMFH 5IBTH 5TGBB 2X9WA 4JREC 5DFVD 5JO5A 5I1HL 1AXIB 5SV4A 1CICA 2DQCL 4X98A 5D93C 4NUGH 1JGUL 5CFHA 1JPFA 3SCMD 3OB8A 4G9FD 4DWHA 1JPGA 1E28A 3L5WA 2YPKA 3OJMB 1JNJA 4ZPTB 1FVDA 5TDOB 4DTGH 1U8KA 5HY9A 3AS3A 2E9JA 2Z91B 3QA3A 5IBUB 3UAJC 1KELL 1WTLA 3BKYL 1C16A 3ULSA 3G08B 3OQ3B 4NHUB 4TN9A 5GGSB 3H3BC 3VFGH 4J1UB 4LOUD 4P48A 4GAYB 1KIQA 3DARA 3H9HB 1HNGA 1AE6L 1MHPH 2AJUH 4PGDB 2YN3A 4YDIH 3TYGH 1BQHG 1C7TA 2O5YL 5DJ0B 1HZHH 1B90A 3LRSA 2X05A 3V4PH 5SWSA 1FIGH 4UOJA 4HUVA 1BVLB 4PJEE 3N1QC 3PIQB 2AP2A 3O11A 2ZUSA 4P2OD 3MOBH 3QIWB 4S0SD 5GS1B 2J12B 4FFVD 4R96A 1FE8L 1I8LA 2HN7B 3EBAA 1YJDL 4LPXA 1OGTA 4FQJH 4JFYA 1YUHB 4X9HA 3KPMA 2VLJE 1PSKH 4LSRL 1BQUA 4WI9A 2WSKA 1QRND 5EUOB 3KNBB 5I1DA 4GG6F 1HWGB 3GO1L 1GYAA 1T6WA 3K3QA 4YPGA 2BFVL 3SN6N 3EOAA 2NY3D 2HJFB 1JZ3A 5FUCE 2XA3A 3T3ME 2LAAA 4MAYD 2CMRL 4WWID 4UIKL 4QHKI 4MJIA 1OAZH 4P9ML 3ZTJG 4HJGA 4ZSOE 1FGVH 3CC5A 3UXFA 5LVEA 1FRGL 5MI0B 4NQED 4E5XA 2X9XA 5F7LB 3WDIA 2A9NL 5FGCB 4K9EC 1Q9OB 4WI3A 1T1YA 4PJCB 5D9SA 5FA4A 3UP1A 2ZKHL 1QG3A 3H2WA 4G5ZH 3X14A 2HFGL 1KFAH 3BPOB 2NY5H 4NNPH 4PLJD 4RSVA 2ZUUA 5FUZL 5DDHA 1NSNH 4PBVC 2IADB 2DM2A 1TFHA 4WW1A 5DRZB 3I9GH 3MRIA 4G7VH 2O5ZL 3TVMC 1XEDA 2VWEE 2MTPA 2E6QA 2JCCE 4Y1AD 1M6OB 3ULUE 3KXFA 3O8XD 4D0DA 3TLRA 4XNUH 2F53A 3QIUA 1FFPB 4NC0B 4YLQT 5CEYB 3SKUD 5T1KB 5J06A 2R9HC 1I7ZB 3V6FA 1G1YA 2JIXD 4ZG1A 1H3PH 1NUDA 1LP9E 5TGBA 3A0OA 5EOTB 2PYED 2OL3L 1MRFL 2BVQB 4BZ2H 3TVMA 1J11A 3U6RA 5KZCD 2A6JB 2W0LA 3U36A 3OX8B 4YNYB 5HJ3B 1SEQL 5L7XL 1A6PA 5JOFB 4POZD 4C56B 1MI5D 4YHLH 1JMZA 4ZPTA 1EHLH 5TDOA 5DZLA 4ELMF 1VFUA 4L3EE 1GOHA 2ZOLB 1U3JA 3DVGA 2Z91A 1IQWL 3QIWC 1J1OL 3P11L 4MD5B 4PPTA 2AJVL 4UT6L 5INDB 3G08A 2W92A 5CJOH 4NHUA 4L4VE 5GGSA 3RI5K 4J1UA 2H2SC 4GAYA 3H9HA 1UH3A 2JJTA 4BQ8A 4XI5D 4PGDA 4KK9C 4EZMA 3BT2H 3Q2CA 5DJ0A 5EC2B 1ES0B 1U2HA 4BELD 3PIQA 3DPBA 2H6PB 1HHJB 2H45A 3UROR 3QIWA 2D7QA 3MC0A 1JTPA 4JM2D 3WS6C 4L29B 4K94C 2HN7A 2PXYD 2JELH 4JO2L 1MHHB 3CZFB 3WUWG 1J8HB 1YUHA 1RZ7H 5DJ2B 2CJUL 4L8CB 3O6LL 4FTVD 5EZOL 5I1CH 2R8SL 4M1CC 4X6CE 4L4JA 5EUOA 1CGXA 3KNBA 5MI0C 4JHWL 2QR0B 4ONFH 5FCUL 5I0DA 2AEQH 3NCYS 3QNXB 3WS6A 2HJFA 4G9FE 4Z7VF 4H25B 4LSVL 4R2GD 3S37L 4FN0A 1JGVL 3P9WB 2APFA 4LKXB 4PJXB 5I19L 4X8XA 2EH7L 2XV6B 2QQQA 1CF8L 1EK3A 5JW3L 3OBAA 1UCBL 5D2NE 1Q9OA 4PJCA 1PKQE 2A6DB 1X7QB 5DJZA 5HHVL 2V2WA 2EE2A 5CP3H 4FABL 2VYRE 2B7DT 1JRHH 2ARJQ 1KCLA 3C6SB 4DUVA 4DN4H 4N0UA 4R4NC 1XF1A 4H8WL 2IADA 3V4VH 3BPCB 1J0HA 2WINB 5DRZA 1OD7A 4RGOL 4YZFF 3RWJB 2Q7NA 5J13C 4EN3D 5DFTA 4DGIH 3GBML 1A7OL 1PJ9A 2IH1B 3VXUB 1M6OA 3IDMB 3ILQD 4UBDC 3TH2T 3A6CH 4LPWA 4CNIB 4O4YH 1DR9A 1FFPA 3DUHA 5CEYA 5T1KA 1I7ZA 2IWGA 2Y07H 3BZFB 3VXMB 5DQJB 5EOTA 5E2VL 5B38B 2BVQA 4NM4L 2EDTA 3AB0B 4PLKD 3LQMA 4HWBH 1KEGL 2W0FB 2A6JA 4N0YH 1ZV5A 1IEBB 1WLHA 3OX8A 2BVYA 4YNYA 5HJ3A 1MCKA 4K7PH 1X3DA 4C56A 5IK3B 3A6BL 4NQEE 1IGJB 5AYQA 3IRZA 2ZOLA 1T66C 4Q9RL 4OD3L 1WGOA 1FZJB 3BWUC 4MD5A 4YXLL 1G6RL 1T5WB 3IDJA 5INDA 1INQB 3TBWB 1FDLH 3GSNA 2J6EA 4S11A 4C57C 4TTDD 2EDFA 3TZVD 2RFXB 2ZG3A 3LQAH 4Y4HD 3S3SA 5EC2A 1ES0A 4R8WL 4FXLA 3NA4A 1IBGH 1X5GA 1AI1L 4LCCB 1A6AA 4Y1AE 3NABL 1HHJA 2EEBA 1WBYB 3RUGF 2ARJB 3RZCD 4L29A 3OSKA 3O2DA 4YHNB 2APWA 4P3DB 1OQOA 4WTXA 1DZBA 3DI3B 4PB0L 3CZFA 1J8HA 4X5LA 5DJ2A 4L8CA 2PYEE 1HHGB 1K2DB 2K3TA 3QQ9D 4WI2A 1S8DB 1KJ2H 1BWMA 3DRTB 2QR0A 3LQZB 2B1HL 2W59A 3QNXA 4BH7B 3HAEG 3BRGC 5IMOB 1MSPA 2AI0H 1VFOA 4H25A 3VD4A 1MI5E 5D71L 2FATL 4NHCL 1ZWIB 1II4E 32C2B 4PJXA 3QG6A 1GIGL 3ES6B 3B3IB 3M1BB 5ANME 1S9XB 5DD5L 4DKFH 2B4CH 2CSPA 2VR5A 4RMVA 5EU7E 3CNKA 4HGWB 1KENL 3MNZB 4FXGB 3M8OL 3L3DB 2OK0L 3BX7C 2C1OB 5JPNB 2DQJL 1X7QA 1XGYL 4PG2C 1S78D 1AGBA 4KWUA 3UO1H 3C6LD 4U6VH 4GRWH 3C6SA 2GSGB 1IARB 4D8PB 5HGHA 4JB9L 1KJMB 3NIFF 3BPCA 5IFAL 2WINA 3QWOB 5I1IH 4Z7OE 2AJYL 3AB0C 4MB4A 3RWJA 1ZANL 2IH1A 3VXUA 1SYVB 3IDMA 1P4BH 4CNIA 4FTVE 5TFSH 3VMNA 1KULA 4P2QB 2DDQH 3E6HB 3JXAA 1H15B 4NO2A 4K7FB 3TYFB 4MDJB 2ZUXA 3BZFA 3GJEB 1DBKL 3VXMA 5DQJA 5L88L 1TETH 2D9CA 4RMRA 5B38A 5H94B 4OT1L 4U1GB 1X6NA 3CXDL 5CILH 5KOMC 5TQ2H 2X4OB 4AEFA 1W72L 1C8PA 4LSTL 4Y16C 2W0FA 1UEYA 1IZJA 1SMOA 3UTSD 3IKCB 4BQ9A 1IEBA 5I15H 4A2MA 3UEZA 5I1AA 5F97E 2XWBB 5IK3A 1DL7H 2NW2B 4IOIB 1DVFC 5EB9A 1IGJA 2OJEB 4KI5D 4LCCC 1UM6H 4HWNA 5CKGA 4YWGL 1FZKB 6FABL 1E0OB 3LHPH 5I0ZA 4RDQF 1FZJA 2CK2A 2NY1B 1T5WA 3QH3B 5JR1H 1INQA 3TBWA 4ZFFB 2HLFD 4K9EL 5C9JB 2DMBA 2HLAB 3SBWA 3F7QA 5EIVA 2RFXA 4O02H 1JMXA 5DJAB 5DUMH 5I76A 4LCCA 4W70A 4KROD 1WBYA 2ARJA 4HK3J 3BAEH 1YEFH 2FO1A 4WW2F 4QEGA 2FEEI 4YHNA 5C70A 4P3DA 2P5ED 3GNMH 3SGEI 4MXWL 4GAFB 4PJFF 3O4LD 3FAWA 1HHGA 1K2DA 4PJ5D 1DQQB 1WAAF 2JF1A 3QUMB 1S8DA 2DYPB 4PGCB 5DMIL 3ZKSD 3DRTA 3LS5L 3FO0H 3LQZA 1L0YA 4U1SB 4NKIH 2VXUH 5DZOA 4BH7A 3QCTL 2DF3A 4HAFA 1YEHH 4GXVL 5FKAA 5E8NB 1ZWIA 32C2A 2P5WB 3ES6A 2D0FA 3B3IA 4LL9A 3KYKL 5DD3H 3M1BA 3NAAL 4WUKH 1AGEB 1S9XA 4O5LL 5HXMA 3U1SL 3GMPB 2R0KL 1AR1C 4H1LB 4HGWA 3MNZA 3JV6B 4FXGA 3L3DA 2EDEA 2DBLL 3QYCA 5HVHC 1GPOH 5FGBC 2C1OA 1QSED 3VG0H 4KTEH 4MCZB 3JTSB 3J7HA 1NAML 4U3HA 5CSGA 2Z8VC 2GSGA 3QUYC 4YXHH 4D8PA 2QQNL 1KJMA 5ID1B 4M1GL 5EOCJ 3QWOA 4GXUN 2QHLA 4U1GC 5IESH 1OL0A 1UH4A 3HMXL 4PJGE 4QWWD 1CXIA 2QQLL 4MAUH 1SYVA 5FOBB 5FGBA 4K94L 4M1DH 4Y88A 2D4DA 3RPKA 4KUCF 2ED7A 4YBLB 5DURD 3E6HA 1H15A 3GSWB 4K7FA 3TYFA 1LO4H 2HYMA 4MDJA 3GJEA 4ODTL 4IHOB 2EDKA 3T3PF 5IP4A 5H94A 2NY1C 1A14H 5FO8B 3Q5OA 3HUJA 3EO9H 3LV3B 4OFIA 2DMKA 1GL4B 1EUTA 3IKCA 3W11C 4CL7A 1PZ5B 1X9QA 4F37F 3GIZH 4GG6B 8CGTA 4ALAL 2XWBA 3ARXA 2NW2A 5T3XL 1S7QB 4OLVH 3NIGE 1XGRB 1FZKA 1U0QA 2DQGH 1RFDH 2W9DH 3QH3A 4FZ8L 5KANG 3DX8B 4ZFFA 5HGDB 2EDHA 3HI6H 4ORZC 4ZS7H 2HLAA 2VDNL 1IFHH 2XXCB 1NC4B 2V9QA 1QRKA 5DJAA 4WJ5B 5F7UA 2EXYC 1HCFX 5T5FH 2ZG1A 2C3WA 4K2UL 2VLRD 3HCVB 4LSDA 4N0RA 1WBZB 1X6LA 2CQVA 4M6OH 3G6JE 1EHNA 1G9MH 4KQ3H 1KN2L 1R3HA 4KVNL 5FFLA 1BZQK 3MLSH 3HPJB 4UMGA 1ZVYA 4HD9A 4J3UA 1DQQA 2VXTL 3QUMA 3D0VB 4PGCA 4LSQL 5LXGH 3ET9F 1OP9A 4HXBH 4M6MH 4ZPVB 5E2WH 4U1SA 3UTSE 3G04B 1JF1B 2B39A 1F45A 1IJ9A 1WC7B 3RU8H 3U4EB 4IS6B 4QRUB 3GSNL 2C7UA 5IOPB 3FONB 1A6WL 2P5WA 4ORGB 1KJVB 4Z7WF 3W0WB 3PL6B 2AEPL 1AGEA 2BNQB 4KMQA 4UT7H 1CU4L 4CN1A 3MOAL 2HTKD 3GMPA 5I1LB 1FO0H 4O2FB 4H1LA 5H2BA 4LDEB 1X5YA 3JV6A 3GMMB 3QXAA 3O2DL 4OCWL 1HSAA 4ONGL 4ZAKD 4ELMB 2QHRL 1OT1A 4FXKB 4MCZA 3JTSA 4YQXL 3JV4B 4KC3B 1NCDH 1MFCH 1IAIH 1M71A 2HH0H 4KJQC 4XNQB 5E0QA 2F15A 4OZGF 1JHLH 5ID1A 3BQUB 4HEME 3I6KB 4UU9B 2P5EE 2XN9B 2VLKD 3RQ3A 2WP3O 4DGVH 3KPOB 4IRZL 1CWVA 5FOBA 4E9LA 4PV8B 3CFIC 1OWRM 2MJWA 2VDPH 3O4LE 3V5DB 4JFPB 2PW1A 3TJEL 4N9GB 4PJ5E 2FHFA 1T7YA 3GSWA 4HT1H 1L7IL 1R24B 4JFZH 4Y4FD 4IHOA 4EI5C 4UTAL 3RVUD 2CK0L 1P84K 3KYAA 3E1F1 5FO8A 4JQIL 4NC1C 5C92A 1WISA 1E6JH 3LV3A 3ZE1E 2F5AL 5IHBA 5CZVL 4R7NB 1ZGLB 3DUUB 2FX8L 2IPUG 1PZ5A 4OZIF 5IMMB 3OAUH 2FGWH 1V3MA 4LQFH 1SY6A 4OBSA 1XIWB 1S7QA 1XGRA 4C83B 4JZNB 2IG2L 1KCUH 2APVA 1F6AB 4Z7VB 5JOEA 3T1WA 3GRWL 3SE4A 1QSEE 4BA8A 3QEGL 3DX8A 4UV4L 4QCIB 5HGDA 2R2EB 4U05A 5IVNA 1UJ3B 2NY0D 2DJUA 4U1IB 1NC4A 3IJHA 4M6AA 5EOCH 4NBYB 3C09B 3PWPD 4WJ5A 2FDBP 4QNPF 4XBGB 1LE9B 3VU2A 4LVOC 3MA7B 2FO4B 3HCVA 3WN5C 3OR7B 4ODUB 4LPTA 1ZE3C 1WBZA 4GO6B 5FA3B 3T09A 2GTZB 5T3ZD 5ICZB 5DQDL 2MPAH 4LVHC 4OIBA 1NJ9B 3CAFA 1OTTD 5KSBE 3FAXA 3HPJA 5HHQB 3PL6C 3B6SB 4EKXA 4UTBL 2VUYA 4PTTB 3SDAB 1JN6A 3D0VA 1FNSL 3F12B 4NWTL 4ZPVA 3G04A 1JF1A 1WC7A 3U4EA 3CDCA 4IS6A 4JO4H 4OCRL 4QRUA 5L6YH 2DLFL 3KR3H 1QFUH 4P5KB 5IOPA 3HZMB 4F7PB 3FONA 2YPLD 1OW0C 4IRJB 4PLOB 5A16B 3LMJH 4ORGA 1A6UL 1KJVA 3ZDXF 2AABL 3CXHK 3V79C 1KYOK 3MLVH 3W0WA 4F80A 2XZAL 3PJSB 3PL6A 4KHXL 2BNQA 5C7XL 4LLYB 1OAUH 1H5BB 5IHZB 4CVZB 1RU9L 2FD6H 4YHPB 3BZDA 1D5ZB 1NCWH 1MIML 2XZCL 4O2FA 5KTEL 4LPYA 3GMMA 4Q9QL 1FSKB 4JKPL 1ACYH 1GGUA 5CWSB 4ELMA 3AM8C 4FXKA 3MRLB 1CTOA 3JV4A 1OW0A 4XTRD 2OR8A 4OLXL 2GJ6B 2OP4L 2V5TA 1MPAL 5F7HA 4XNQA 4V2CB 4WU7B 2VLRE 3EJYD 1AQDB 3BQUA 4EUPH 1A3LH 4Y0GA 4ZOEA 4W4NA 3I6KA 5EWIH 1INDL 4UU9A 5D7JC 1CGWA 2XN9A 4WFHD 3VA2C 2FX7H 1MCWW 4JJ5B 3KPOA 4MDIB 4PV8A 4OGYH 2J8UF 4CW1B 4OF6A 3F6LA 5J8OA 4IOSD 3W2DL 4JO1L 2VSCA 3AM8A 3V5DA 1FVEB 3I02A 4XBEH 3P0VH 3K2UL 3ARGD 3RUGB 1GGTA 1XIWC 1R24A 2XTJB 2G60H 1Q9LB 3W5NA 5MEND 3HE7D 3LEYH 5LGKA 3OAYH 5DF0A 3KPNB 4R7NA 1ZGLA 3DUUA 4WEBH 1QHPA 2X41A 2EDRA 5IMMA 1BX2B 3QEQB 5E7FA 3C09C 4BFBD 1BWWA 4X7DC 2CRYA 1XIWA 2R0LL 4C83A 3FOLB 4JZNA 4L8DA 3N9GL 1Q38A 1F6AA 5T5NF 4DOHE 4Z7VA 1A1NB 4QCIA 2R2EA 5IW6B 4MD4B 4ZD3L 4K8RD 3E3QE 4K3GA 4MZ3A 4U1IA 5DD0L 4NFBA 5EIIB 1JF5A 5KSAD 3RGVD 2DM4A 1Q0YH 4MMZC 3SDAC 4XBGA 5JXAL 2IBGA 4Z7UE 2VLKE 3RVVC 3MA7A 3OPZH 2DLTA 1ZS8B 2F58H 1HINH 2FO4A 3OR7A 4ODUA 3S9DB 2ORBH 1FZMB 1IC4H 2FBJH 3FQNB 1C5BH 1F13A 1Y6MR 3AY4C 5FA3A 3MLTB 4TSAL 2WQ8A 2GTZA 1XF3B 4OCLC 1QO3B 5ICZA 3FFCD 2YD8A 1MCPL 1NJ9A 5BOPA 5HHQA 4YO0B 3B6SA 5L0QC 1SJVA 1H5BC 3EZ8A 3SDAA 4XWGH 1MWAH 2YPVH 4CVUA 4Z7NF 4N68A 3ARYA 3HKFA 3F12A 3MV8B 2OI9B 1FSKC 3GK8H 4H5SB 4DKEL 4XMKH 3BKJL 4YGAB 1JYNA 4MA7H 3AY4A 3WKNA 3SGDH 4HULB 4OSUH 3HZMA 4R90L 5GS2D 4F7PA 5CUSL 4IRJA 4ODHH 5A16A 5BW7A 3VXQB 2C9AA 4WO4B 4YDLB 2XKNB 5GRVL 1OGAD 3PJSA 4I3RL 4LLYA 1H5BA 2Y06H 5IHZA 4CVZA 1N8ZB 3V6OE 4NFCA 1D5ZA 5KVFH 3O9WB 2XWTB 3CSBA 4XNYL 1J86A 2ZZUT 4LPUA 2EDXA 1ROWA 4OV6F 3FQRB 1KIPB 1B0RB 5H35B 1B88A 3MGOB 2HT3D 4OUUB 3SDDD 5CWSA 2NY2C 5T1MB 3VXRD 1OSZB 1ZVSB 1WCQA 4M7ZB 2ARWA 3HI5L 4OIIH 3PWPE 4JPVH 1BQSA 3S3JA 3G5XB 4CJ0A 4LCUB 2GJ6A 3AS2A 3V6BR 3V0WH 1KSRA 3FT3B 4WU7A 2RBLA 1DQJB 1EBPA 5IJVB 4F58H 5DGRA 3GDBA 2ZSVB 3VRLF 4LK4A 5JZ7D 2IFFL 1TJGL 4OQTH 1QTYT 1BFVL 4JJ5A 4MDIA 2LU7A 3TCLA 3EFDH 4JG1H 3NTCL 4CW1A 5TE6H 1RZGB 1FVEA 5MERA 1TQBB 3RUGA 2H26B 4GS7C 4JHBA 3I3BA 3QSKB 4WW2B 1N7MH 3QHZH 1NL0L 2F8OA 1UZ6E 1Q9LA 4DZ8B 4GLRI 4R0LB 4XVTH 5DD6B 4CVWA 2BSRB 4PJFB 2YPLE 1S3KL 4AEIL 4PRNB 3F7YB 4Y2DD 3KPNA 1RUPL 3VD5A 1FC2D 5AYUH 5AUMB 3D5OF 3DSFL 1BX2A 1MJ8H 3ARZA 3QEQA 4Q9CA 3SDXE 3D25B 3WS3B 2K9UA 1GAFL 4WU5B 2WWKO 2YD9A 4WFED 1EO5A 3IFPB 4H20L 3FOLA 1PFCA 1TNMA 2H2PC 1HHIB 5EDXA 1A1NA 4ODSH 4NCDA 2FH8A 3QDGB 4XRCA 3S5LB 5IW6A 4MD4A 2YEZA 2BSSB 3S4SG 5KS9F 4QXGL 3Q1SL 5EIIA 5DUPL 2P43B 4NN7B 5CBEB 3T0BA 3ZTJH 1YN7B 5DI8B 4WFHE 4NZUL 2XQYG 1A02N 1ZS8A 4PJ7F 4AT6B 2JK5B 1CN4A 4CKVX 4GSDL 4X7TB 1MJUL 1MCWM 1S5IH 2MCPL 1F58H 3MLTA 1XF3A 1FL3B 3H7LA 1I4FB 3QG7H 4WO4C 4QT5B 4YO0A 1S7VB 3VI4E 2I5YL 4CGTA 3GM0A 4LP5A 3OKLB 1YEIH 9CGTA 5MENE 3BN9D 5IBUG 4QRRE 3A67L 1FN4B 3UX9B 1DN0B 1KLGB 3MV8A 4H5SA 3DXAD 4KRLB 3MLYH 3MV7B 3LKOB 1RUMH 1CCZA 2ICWJ 4WUUD 5LCVH 3MNWB 4PY8I 4APQD 3VXQA 2V17H 4LIQE 4WO4A 2XKNA 3QP3A 1KG0B 2FIKB 1N8ZA 2VB5A 4U1NA 5H8DA 3O9WA 2XWTA 2QSCL 4KJPD 2OYPA 12E8L 1KEML 2OM5A 3FQRA 1B0RA 5DHVB 5H35A 3MGOA 4F7EA 4M5YL 3MPCA 4R97B 2KZWA 3X13B 5T1MA 1CFVL 2LFGA 1OSZA 1ZVSA 1TQBC 4JKMA 5BMFL 4Z77B 3DV6B 1WZKA 3G5XA 5A3ID 4MA8H 2GFBB 2WIIB 3FT3A 3KLSA 1DQJA 5IJVA 4PJIB 3KPSB 2ZSVA 1IL1B 4ZNEE 1GOFA 3DVNB 4R0LC 4HUWB 4N5ED 4JO3H 4UNTA 2BVEA 1DE4B 1FFRA 3FFCE 4JHAH 1WIUA 4OLZL 2C3XA 1RZGA 2NYYC 2ATKB 2H26A 2NXYD 5GGQH 1YECL 1QUNA 1UG9A 4JKWA 2NLJA 1FFOB 4WW2A 3MXVH 2H32B 4P46C 5GGSY 4RFOH 2A0LC 3IFNH 1GHFL 4DZ8A 1NBVL 2CKBB 4GMSH 4LEXL 4R0LA 3TPKA 3WIFA 3U9PH 5DD6A 1U3HB 4PUBL 3L6FB 2BSRA 1ZLWK 4PJFA 3U0WL 1Y18B 3FOMB 2VL5B 4G6ML 4PRNA 5GGRB 3F7YA 2BCKB 3B9KD 5AUMA 5KN5B 1HZHL 1OGAE 1WAAA 3RKDC 4OLWH 4NN7C 1AJ7L 3D25A 3WS3A 2Z9TA 4WU5A 2LVEA 3E0GA 2FJGB 3IFPA 4WV1B 1G7HB 5GS2H 3P2TA 4EBQH 4MQSB 4LDLB 1HHIA 2WQRA 3EDFA 3NACH 1OAYL 2R2HB 3F7VB 3UPCA 1CXKA 1TVHB 2COQA 3QO1B 1UVQB 3SE3A 4Y8DC 4Z7WB 4FQJL 3QDGA 5ENWB 3S5LA 3DSNA 1NC2D 2KQMA 3WIIH 4QF1B 3BKCL 4ETQB 5CCKH 5C6PB 3BKML 4LHJB 3VGGA 5HYJE 3QUZD 2NNAB 1G0YR 5CBEA 2D0GA 2VRAA 1YN7A 5DI8A 4DJMA 2IC2A 1D5BB 2F19H 4HJJL 1EGJH 4AT6A 5M94B 2JK5A 3LS4L 1CLYH 3MV9B 4X7TA 2P49B 2Y5EA 5IM7B 3QIBC 4DZBB 1JGDB 1ZGLM 2ZCLL 4OZGB 1FL3A 5LBSL 3CXHJ 1DUZB 1KYOJ 1I4FA 5D72L 5CAYB 4FNLH 4QT5A 1S7VA 5IG7B 1BZ9B 2HAZA 1XR9B 1AGFB 3C8DA 3LZFH 1F5WA 5GZNC 1DSFH 3OKLA 4UB0H 1FN4A 1DN0A 1KLGA 3OAZK 2WBWB 3MV7A 3DX6B 2H1PH 2A2QT 3LKOA 3BH8B 4R97C 2GY7B 2PUQT 3DOSA 1OP5K 3ZHLA 1AQKH 5IFJB 2XT1B 4WFEE 1E4XI 2A83B 3O4OB 1NSNL 1OOAA 3MYZA 3NFNB 5F88B 1EX0A 1KG0A 2FIKA 2K7PA 3BGFB 2C3GA 1BGXH 2V7NB 4RFNB 5FCSH 4YXKL 2VXQL 3C5ZC 2DLEA 2MQ3A 4XP5H 4OZIB 5DHVA 1BFTA 5JHLH 4B50A 3AS1A 3DBXB 3VFNB 4M48L 4XCFH 4Z77A 4NJ9H 3DV6A 4H88L 3B83A 4A6YB 5KVDL 2GFBA 3WBDA 2WIIA 4HIHB 3W9DB 4XMPL 3KPSA 5AWNH 4PGJA 1RJCA 1IL1A 3BH9B 3BO8B 1I1AC 3DVNA 5J6GB 2NX5D 4HUWA 4LFHG 4M7LL 3V52L 1DE4A 1U3HC 4XVJH 3MOQA 5AG8A 4TNVF 5EBMB 3UC0H 3LY6A 2ATKA 4NZJA 4ZTOH 3WO4B 2FEEL 4K3DL 3EOYG 1KCSH 1RHHB 2WBJD 4DUWA 3K4ZA 1FFOA 2IPKB 4KAQH 4WV1C 3PXHA 2H32A 4XCEB 1MIEH 2XA8H 3DXAE 2RJMA 4DVRL 4X7SL 1IGML 2ZUTA 2CKBA 2V5SA 3ZE0F 5GGTA 5T33H 4WUUE 2XICA 1U3HA 1J7VR 3L6FA 1XFPA 1BLNB 1CG9B 1FLTX 5C08D 1Y18A 3FOMA 1D5IH 2VL5A 2IAMC 2M2DA 2X4PB 5TE4L 5KN5A 4RWYL 4PGZA 2JCCF 5IWLC 3RL1B 3EYQD 3PWLB 3ULUF 3L3KB 4UINL 2FJGA 4HC1H 4WV1A 1G7HA 2UZYB 3W81A 1T1XB 4JN1H 4NN5C 4WTZA 3ZT6A 2GK2A 1S9VB 3MLXL 3F7VA 4OJFH 2DICA 2LV4A 5FECB 1TVHA 1LP9F 3EYUH 1TJIH 1GH7A 3RFZC 1UVQA 4Z7WA 5ENWA 3HAEH 4YBQD 1RK0B 4G6KL 5I1CL 4QF1A 4U7SA 1CL7H 4ETQA 3VXTB 1T03L 4RZCA 1YEDB 4M02A 4NBZB 4RISH 2NNAA 1I1CA 4LVNB 1BEYH 5T1LD 1ITBB 5B38G 5K9JH 4PFEA 4YDJB 3MUJA 2AEQL 3QFJD 5K59F 1FFQA 2HTLD 5EU6D 3MV9A 1Z6JT 2YD6A 3QXTA 5IM7A 5DMGC 4MQ7B 2WLYA 3L3OB 4DZBA 1JGDA 7FABL 1HIMH 4U6HB 2BVOB 4FZEL 4KKCD 2X1OA 4OZGA 1DUZA 3Q6GL 1MHEB 3O4OC 5E1HB 4KY1L 1XR9A 1AGFA 4GH7B 3BGFC 1FAIL 2J8UB 1A7PL 1WFOA 4M5ZL 1UH2A 2YK1L 1IT9H 5D70H 1B3JA 4TYUA 3BH8A 1LO3L 3LKNB 5EA0L 4I0CC 4UILL 4YDKL 2A83A 2Z4QB 1CFSB 3EGSB 4K3EH 3LN5B 3NFNA 5F88A 5J3HD 4M6NH 4XMLL 3BIKB 3S88H 4U1LA 1RVFH 1FPTL 2V7NA 4W4OC 2VZTA 4P23B 4Q58C 4OZIA 4X6CF 2JJWA 1BD2B 2F9BT 4N0FB 3GSUB 3DBXA 4JCMA 5LAXB 3VFNA 5BO1H 1I7UB 4A6YA 1MFNA 1S5HB 1PW3A 2CUIA 4HIHA 3W9DA 4RIRA 2I60L 1WFNA 1I85A 3BH9A 3BO8A 5I1GH 2FL5B 1VACB 2NZ9D 3KJ6H 3JTTB 3CVIH 1D9KD 1G9EA 2Y6SC 4I8DA 4NQDB