2CKBL

Structure of the 2c/kb/dev8 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Major histocompatibility complex
molecule keywords ALPHA, BETA T CELL RECEPTOR
publication title Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 99
sequence length 99
chains with identical sequence M
ec nomenclature
pdb deposition date 1998-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ckbL00
4BH8B 3T09A 3HTLX 4LCCB 2VC2L 3PQYE 4X8XA 3TV3H 3VWKC 1HSBB 1E4WH 2ADGB 2IQ9L 3IYLW 1CL7H 3PWLA 5A43C 2W65B 1GZQA 5E5RB 5GQBA 1HNGA 2JJTC 4R8WH 4RAHA 3O8XA 4QHUA 1A0QH 4JFEE 5FA4B 5GS1B 3WS3A 4ZAKB 5C9JB 2Y25A 4B53A 3UO1L 1AFVL 1RUMH 1TJIH 3HNSH 3DYOA 4P46C 1GGCH 5IMMB 2P8PA 2ICEB 2R9HD 4AYFA 4G43B 4Z7VF 4HSQA 3WEXA 1RUAH 1UQSB 2D7TH 2PTVA 3TPUA 3KS0J 3PP4L 2P44B 8FABB 2NYYD 3CAFA 2H6PB 2AKRA 3KPPA 3ILQD 3TWCL 4RCAA 1LK2B 4ACPA 3AS1A 4PJBE 1E4KC 5L6YL 3PL6D 2A77H 3OAYH 3SKMA 4N0CC 1GRWA 4POZC 2BNQE 2NZIA 3QIBA 5D1ZA 3EYUH 4JM4H 2FLRT 3KDMA 1S9WB 3QCVH 3MNVA 5DJCB 1CTNA 4JPWL 3FO2A 3WYRA 3MV9B 3LQMA 4QCIB 5JXAH 3TBYA 4MQSB 3DSNA 1GC1L 1TLKA 1JPSH 2GI7A 2OR9L 3ULVE 2WW8A 4XB7A 1BAFL 3R8BB 4FZEH 4Y5YA 4PRID 4ZO7A 2OP4H 1ZSDB 5DRXB 4YDKH 3LEYL 5CZXC 2E7MA 4OD2B 5CEYA 4OLVH 3I3EA 5CBEA 3AREA 3UTSE 5HGDA 1KB5L 1P4BL 4P2RD 2VQ1B 5DQDL 5FM5O 1KT2B 3WNPA 3ULSB 1XGRB 2FECI 4LCWE 2QSQA 1NCDH 1A3RL 1T3FA 1FFOA 4JG1H 3Q6GH 4C59B 5CEZE 1WZ1H 5CP7A 3QDJA 1GCFA 4XPHL 1PZ5B 3ALWA 4O02L 5E4EC 4WV1A 1M05B 1SBSL 1XGYH 3Q2CA 3QQ4B 2P5WA 2OTWB 15C8H 3TYFB 2NY1D 3OKYA 3WN5A 3HG1D 4PJHA 4N8CH 2CLVB 3BGFC 2E6PA 4PJEA 4KPHH 5INCA 5J1AB 1JV5B 4PJ8C 4XH2A 1ZA6A 5HGBB 1I85C 4BSWA 5K93A 2EEAA 4OAWA 4M8VA 3OKKA 4JO1L 3CMOH 3T3ME 3ECBA 2EE2A 2D7PA 2EDOA 3NPSB 5HYQB 3C5ZA 3GO1L 2FH6A 2X10A 1E4XI 5DURB 4Y4HD 3MRKA 4KV5E 2Z8VC 2XQBL 3K4AA 5DS8B 3SDXB 1AGBA 1HKLH 2X6MA 3V5KB 4K23L 1T6WA 5DZLA 2ESVE 1AI1H 5CINH 3IFOB 1IC7L 2UWEA 3BP4B 3L5HA 4WGWB 3GK8L 1GZPB 1TXKA 4NT6B 1OVZA 3MFGB 3X3GH 4TSCL 4HT1H 5ANMB 4U3CA 1MRCL 4PG2C 2Y72A 1OPGL 4GRWE 4MA8H 2BNRB 4ZFOA 4HKZB 2PNDA 5IB3A 5IB2A 3H9ZA 3TYGH 3PQYA 1GAFH 1ZLUK 4F7MA 5H35A 4NP4L 3CJJA 4G8GB 1BBJA 5HGGS 1QTYT 2HJFB 5LAXA 4HGMA 3RWJA 2KZWA 2DOCA 2F58L 3MCLH 2V9TA 3PIQB 3QZWA 4PV9B 4GRLB 2XZQH 2Y07L 1OAKH 3VI4F 2GJJA 4JM2F 2WUBH 2DQDH 2X4SB 4MA1C 4UQ3B 4LFHG 3EOBB 2D9QB 1CD1A 4BUGA 4GBXB 3RVTD 4PLOB 2JKXA 1A5FH 3NZHH 3P3YA 1FE8H 1FL6A 1MJJB 2WM0A 5D7LD 4AEIL 1K2DA 3BT2L 5FGBC 1FYHB 4X6FA 4HZLA 4LSQL 3QWQB 1MAML 5EWIL 5E99L 4R4BA 5E70A 3JWOL 4H8WL 4WY7L 5HHOD 4DGYL 5ACZA 2HTKC 3SDCD 1FVDA 4HK0B 3U46B 5EBMA 2LVCA 4KUCD 5IQ7H 2VYRE 3HE7D 5IW1B 3UBXI 3ZHDA 2ED9A 3WIHL 4WNQB 1U93B 3V4PL 1XFPA 4LSVH 2YN5A 2IJ0C 4BK4A 1MI5A 2VLKE 1DCLA 2IGFL 1XF3A 5IUSA 4LARH 4YC2B 3QXAA 2YD4A 1DZBA 2VXUH 4U1NB 2OQJA 1RUKH 4OFYD 1F4XH 5EOQL 1GSMA 3WDIA 1VFMA 2XWBA 1IBGH 1XGUA 4NKOB 1EERB 5IBTL 1NDGA 3QIWD 5ICYB 1KB5B 1G7QB 2PR4L 4JDVB 2FWOA 5EC2A 4ZUTA 2VNCA 3UTSA 5D2NE 2APVA 3VH8A 5DJYB 2DLHA 3S5LG 2G75B 2VITA 4IOFC 4RFNC 4YBQD 2V7NA 1J5OH 3E6FA 2XY1A 4ERSH 5BV7C 4EN3C 4M02A 5H8DA 2JB5L 3Q0HA 3O3EA 3L3JB 4ZFFA 5DVMA 1N5AA 4AH2A 4X5XA 2CRZA 4K7PL 3DX6B 3IDGB 1U8IB 3CU7A 3IS1X 4AMKH 1OD9A 2B1AL 4X6DE 4P5TA 1A21A 2XA8L 3RWGB 4TVPE 1E27A 3N9GH 4ZUUB 5E1AB 1KTKE 2VZ3A 4YQXL 3FO9B 3QEQD 3FQXB 4YHKH 3UYPA 2VDML 1YN6B 1CU4L 3MJ9L 4LSSL 1NMCB 1P7QB 4XPAH 1MREH 1Y6MR 1MCCA 1H15B 4MA7H 2DDQH 4JG0H 5FXCH 5GISH 3WS6A 3EOAA 1FSKB 1FJ1A 1G9MC 3QR2A 5HY9A 3BKYH 4M6MH 5H37G 1KEMH 1A64A 1AR1C 1FFQA 4TSAH 4Q58C 2DQTL 3WD5H 4XP9H 3RL1B 4XNMB 4GW1A 1FYTD 2ESVA 3O11B 4XWGH 3VWJA 1U8QA 4RSVA 5DMJB 5DO2D 4D8PA 3PGFH 4GAJL 1DBBH 1RZIA 2JIXA 5KJRL 3N50A 1IQWL 1FNEA 4FQHA 4QRQA 3VDBA 5C0AA 3GSNA 3MGOB 4HBCH 4S1DD 5TDOB 1A7BA 5FECB 1QRND 4X9GA 4NO2A 1NGXB 3MODL 3KG5A 4K3DH 2MTPA 3MQIA 1U8JB 2X40A 3OB0K 1JGEB 5KVGL 3C09B 4YEFA 4XNQB 3L3OB 1YPZB 1EFQA 2NX5A 5B4MD 1IAOA 1OAXH 2P8LA 4M6OL 3VXTB 2NY4D 3QUYD 1JYWA 1CFQA 2A9NH 5C0JA 1OCWH 1OP9A 4JZNA 2NY6C 3WFHB 3NCJL 1PKQB 2IPTL 1MFBL 3SE4C 4ISVA 3CXDL 3CLFH 1CDYA 3MLXL 2VABB 5EU7C 3JV5A 3R1GL 5FHBL 2LE9A 4TUOB 3UZQA 4PGBA 2AJXH 4LCUB 3RI5K 3U7YH 2UVEA 4KMTL 4MDJA 1QQDA 4UDUA 1Z9OA 1OP5H 4HULB 4S0SD 1CFTB 3RZCC 2GT9A 2X9XA 1EO8H 1BGXL 2XQYG 1UH3A 4PLNC 2P24B 4OFPA 3HE6B 1R3IL 1U3JA 4TULL 5DFTA 1GVIA 3QHZL 1YNTB 5KANG 1IM3A 3BMWA 4JANB 5TH2B 4WCYL 2VOTA 3TC9A 1JPGB 2APFA 3C6SA 4D0BB 2ENSA 1EEYA 1CS6A 1ITCA 4XVTL 5M94B 4HPOL 2QHRL 2A74B 3SOBL 2W9DL 1CR9H 4WEUD 3CDGB 4TUJB 2VLKA 1T20B 1T1ZA 1F3JA 5I19L 2DRUA 5CJ8A 4LLDB 1PLGH 2PO6C 1AY1H 2Z91B 5HDOA 4OZFA 4XXDA 4HUXB 4WI5A 4NSKA 4FQLH 4RNRA 2DYPA 2AABH 1K5NA 2DWDB 4F7PA 1EDQA 5D2NA 1U8HA 2WIIA 1UJ3B 3MBEC 4BFBD 1CXKA 3I3BA 5IG7B 4N0YL 1I1AA 4HH9A 4K55A 3AB0B 3RVWD 4HIJA 1OSPL 1FIGL 2YZ1A 3BRGC 4MAYD 3BEVB 3MUY1 3HA0A 5I6XB 3QQ3B 4GG6E 3C08L 2B8OT 5FIEA 3SDXF 4Z77A 3JTSB 2DWEA 3ARFA 3FKUS 3RPIA 2XRAL 3H42L 1SQ2N 4F7EB 3RA7H 1LEIB 2QQKH 3P9MA 2EDXA 3GSVA 2FB4L 3GI8L 5J1SC 5DGQA 1A7RL 1OAQH 3KNBB 4OFDA 4YDVA 1T6VN 4IRZH 3C60D 1MAJA 2HLFD 3B83A 2EYRA 3HZKA 4OLWL 5BCAA 2NY2C 4XWOC 1I8MA 3DI2B 1MCQA 3U1SH 2NR6C 2HT4D 5DJ2A 1S7XB 1JZ4A 1EAPA 1UGNA 2KQNA 4CAGA 3BXNB 2AJUL 3AFLA 1RMFL 3HAEG 4LSRH 1I9IL 4ZSOB 4MCYA 4XPFH 3U9PH 2B5IB 2FSEB 3VD3A 3K3QA 2O93L 2LU4A 2CDEB 4X6CE 1FFOB 1QSVA 2AS5M 1UWEH 2F54E 2XWTA 1T21A 3UC0L 3P0VH 4LBEA 4OT1H 5CP7B 1YMME 4PG9B 5AUMA 1FO0L 2R1WA 2XXMB 1YEHL 4HPYL 3VXUE 4O5LL 3THML 1DEEA 5L88L 2H1PH 3GSQB 5L2JA 1MCEA 4TQEL 4OD3L 4UT7L 4K94H 3CFCL 2WBJD 3RX8A 3BZEB 4GXVL 1S7VA 3FB5A 1X4XA 2BVOA 5EU5B 5EIQA 1P1ZB 1NC2D 4PJHB 1IEHA 2J7LA 4L9LA 4FG6D 2VZTA 4BFIB 3GJEA 1IRAY 4FFVD 1K8IA 1HIMH 4GLRH 3CZJA 4I3RH 1GGIL 3QQ9C 4APQC 5I75B 5FKAA 4I48B 1AGCA 1KOAA 1OAYH 43CAA 2FEEL 3F7YB 3GIVA 2X4UA 4OZHF 3Q48A 3IFNL 3KPSE 3TNNA 4DVRH 3VGFA 1IGMH 1IE5A 5B39B 1WSST 2RQ8A 3MLWL 1NLDH 3BEWB 5K9OB 1MH5A 5KS9B 1JZ7A 4HGWB 4Y16D 3K46A 1N4XL 1E0OB 1NBZA 1Q94B 3FT4A 3TNMB 4C83A 1ULVA 2KPNA 3QPQD 4AEFA 4R97B 1JWUA 2M26A 5F7UA 5EOTA 4PJXF 5C0IB 3VFWA 3CK0H 1QYGH 4U6YA 4YDIH 3L3HB 1W72H 3L1OH 2HRLA 4ETQA 5DEZA 1JBJA 3V6ZB 3ZDYF 2NW2B 1S9YB 1U8KB 3BVNA 3G5ZA 5F3HA 2EICA 5CIPH 5IB2B 1NCWH 2C1OB 2X4TB 5DRWA 3OKNB 2DM4A 4W6XB 4LCYB 4ZFGH 2PN5A 3BD4A 4FFZH 3DHJA 3M1BB 1N64H 4KKCD 2BHYA 1KTDA 4PB9L 1UM5H 4X83A 1WWAX 5TGBB 4GUPA 5GGTH 4JZJC 4QHLA 4HIEB 1KEGH 3LQAC 4KZEH 3BSZH 1RJYB 1JYNA 4RISL 3D18B 2OJEA 1P2CA 3O6KL 4RAUA 5DD6B 4F9LA 4JAMB 4EIZC 2VQUA 3D25A 1A6AB 1GHFL 5DTFB 4JY6B 4ZUVA 5F1KC 2BOCB 4NNXA 5GS0H 1E6OH 1INEH 2DJ4A 3SO5A 3PDOA 5C0GA 3RIFK 4DW2L 4DGIH 1SM3H 4N5EC 4QYOA 3K2UH 3EGSA 3P4MA 1T2QL 2QKIA 4G5ZL 3ZKNC 1H3PL 3O6FA 4R3SA 2GITB 3LDBB 3MRGB 3MRNB 5SWSE 1C7SA 3LN4A 4MXWH 5DD3L 4GG6A 1C5DA 3FTGB 1NUGA 2G9HA 1D5IH 2GQHA 4RDQF 1KPUB 3HR5A 5ID1B 2VLRA 3NCFB 4HV8A 3KJ4C 4R7DB 5I30L 2Z9TA 3CC5A 1M71A 4O00A 5FO8A 7CGTA 3V4UH 5F7WC 3MV7E 1CI5A 4KH2A 2VLLA 1J1OH 1XF3B 4HIIB 2ZCLL 4LLYA 5IHUL 1EAJA 3F62A 1UZ8A 5C07E 1CF8H 4HW6A 3VD9A 5IBLC 2Y06H 4JQIH 1YYLH 1H5BA 2UY7A 4JDZB 2FECL 1MRFL 5C0CD 1YPZF 1BEYH 1OW0C 1RJLA 3NACL 4ETYA 4MX7A 1CIDA 5D7KE 1CDIA 2VDLH 3QO1A 3I6KA 4QT5B 1VPOH 5DJXB 4B41A 1NMCC 3LKNB 5MERA 2BRRL 2Z92B 4QEGA 4Y2DB 1D6VH 2FJFA 2GTZA 3CFDA 4XBEL 3DO7A 5SV4A 1YYML 3WIIH 1YY8B 4Z78A 1CFVL 1FSKC 1LO5B 2YA2A 4O9HH 1YMMA 5FKPA 5C08B 5EO1B 5T5FH 4MJ2A 4POYA 3DYPA 2XFXA 4OI7A 1D9KC 4GQPH 2J6EA 4UV4H 3VXUA 3S35H 4HS3B 2K7PA 3A6CL 4P2OC 5AYQA 1JGVH 2HG5B 2P5EB 5JORB 5FYLE 1Q9LA 1NAKH 4QHMB 2BSRB 2VSCA 2Y5TA 4EUPG 3BPLB 3MRHB 4WJ5B 2PW2B 3K74B 3PWNB 4RRPA 1BX2A 2YHGA 2UZIH 2R2BB 1G9NH 25C8L 4TPRL 1EV2E 2FHBA 2CIKB 3IRPX 1NSNH 3E8UL 2JJUA 1PKOA 4FMFA 2X89A 2A1WL 4D9QE 4K9EL 1MCDA 4R2GC 4RMRA 3P9LB 3TN0B 5C6WH 1EFXB 5I0DA 4CVZA 2O5ZL 3QIUD 3UTZB 4I0PD 1Z3GH 5F96L 3DTXB 4MD0A 4LASL 4KHTL 5IESL 5BV7H 5DXWA 3KPSA 2F8VA 4OI9A 2ZSWA 1A6TB 3BDYH 3DWTA 4KVNL 1I4FB 1Y6KR 1UKQA 3VE0A 4JE4B 5BS0B 1QBMH 1VERA 5I9QB 3UAJC 4V1DA 3MBXH 3WSQH 1T2JA 1UVQB 4GW1B 1WZLA 1DVFD 5IEHB 3MSPA 5BVJB 2D31B 3BYYA 1F42A 4QTHB 3VFTB 4G80B 1F5WA 1S7TA 3EYSH 5E08H 3DRTA 2QADC 1C12A 1K9TA 4HUUA 5IK3B 4NYLA 1UZ6F 1AE6H 4J3XA 5J06A 1DQJA 1AP2B 3TO4D 3MPCA 4L4TE 1ACYL 1YEDB 4PRPB 3B43A 1WV7T 5FB8A 4Q6IB 4LIQH 2V6HA 4XHJC 1T1XB 1HH6A 3LB6C 4E41D 3MA7A 1YN7B 1ITBB 2JCCA 4GT7A 3HE6C 2NX5B 3RWFA 3HB3C 3ZKQD 1DLFL 3L5XH 5ERWB 5GRJL 4R4NC 1H9VA 5HDBF 3B5GA 3FFCA 2HVJB 2B7DT 1D5BB 1QSEB 3SQOH 3EO1B 3QFJB 1A6UL 1J8HD 1WAAE 1FFNA 4U1IB 3TVMA 5A2JH 4QXTA 3GSWA 4G7VL 4MJIB 5DHXB 3LV3A 5DVOA 5ADPL 2PYFB 4KQ4H 5I74B 5FV1L 3S4SB 3WFCL 2H9GA 3V6OC 1CE6A 3FQUB 3VWKD 3O45A 3O8XC 4JFHD 2I25N 1BQUA 5MEND 4Q0XH 1NGZB 2IPKB 3ULUF 3IFPB 4JY4A 2QEJA 4DZ8A 4Y8DC 5DHVA 1B2WL 3QHFL 2CDGA 3GMOB 5HVGB 4EDXB 4LEOB 1U3YA 4NQED 3MRPA 1Q72H 1KYOK 4GKZA 1IM3B 2R23A 3PWPA 3IJYB 4NCC1 5GZND 5IVXE 5BZDB 5LGJB 4HKBB 4PJ5B 4E5XB 5SWSA 1F11B 1RFDL 4PRBB 5IB5B 1FPTL 4H5SB 1AGFA 3P9WB 1P7KA 2HWZL 4OIIL 5T1LB 4WWKA 3P11H 4XMKL 5JUEL 1XF4B 4XNUH 3MV7A 4MNHA 4O4YL 3VG9C 1K3ZA 3FONA 4PRHD 1BIIA 3VFVA 2GSIB 4XP1H 3C87A 3QIBC 5D1ZC 1P5UA 4XXDB 5I1KH 2EH8H 5D4QA 4HUMB 2EIZA 4P2RE 1VDGA 4P59L 4U1JA 2AXGA 3KJ6L 1U91B 3NIGE 5IB4B 4QTIL 3W0WB 3GJFK 1CFNA 3EDKA 3WLWC 1CFSA 4JHAH 4Y5YC 2N4IA 3NCYS 4KU1A 4NZRL 1AKJD 3AREC 3H9HA 1KYOJ 5JW4Q 2ZUQC 3TBTA 2V17L 4EI5B 1L7IH 3DMMB 1SJXA 4F58H 3HLAB 3LPGA 4UT9L 2ZOLB 3C5JB 4HWNA 1U8MB 3FJTA 1JI2A 1JNHA 2R8SL 3UTTD 3IS0X 3ARGB 3RPIB 5CZVH 1A1OB 3KHQA 3MLYL 3HG1E 3PWUB 1CBVL 1JK8A 1NC4D 3GSVB 7FABH 3F5WB 5T3XL 4FABL 1JTOA 2FBOJ 5E2TL 2JLLA 2HMIC 3ZDZF 1PEWA 1QFUH 5FUOH 2X1OA 4WV1C 4Z7NE 1I7TB 4S2SB 1U8LA 2IANA 4P2QE 2ZSVA 3QUXB 4NQDB 1T0NB 5DJ2B 5KAQF 5E0QA 3VFSA 4Z5RA 4HKXB 3D69B 1SJHB 3WN5C 5DUMH 8CGTA 4TUKH 3L5WB 2X44D 4FNLL 4MVBC 4QRRD 5AZ2L 1P69B 3I50H 4ZPTA 2HVKA 3V5DA 3GGWA 4JREC 4LSUL 1SY6H 3SJVD 3T3PF 3UTOA 5A2IH 1S9VB 3QULB 1XCQB 4K8RL 3VXPB 3KHOA 3LKSB 2C1PB 1GJIA 2GYSA 5IFHL 1Z9MA 3MRIA 4OLUL 1KN4L 1EGJA 3C5ZC 3V7MA 4NUJB 2X4PA 3CVIL 1JHKL 2IAMB 3VGHA 4NQSA 1BLNB 3QRFM 3I75B 1BECA 1UXWB 2B4CC 3FB8A 2P42B 4WFHD 1XF1A 3KXFD 1DVFA 5L7XH 3RNKB 4ODHL 1A8JH 4P23D 1IAMA 3SGDH 3C8HA 4R97C 4NNYB 3R0NA 1X9QA 1R3LB 1VA9A 4NRXB 4KUZH 2L7UA 5DJAA 1CDJA 5DT1H 5SWZD 4NCC2 1MRDL 3SQBA 5D6CA 4PJ9D 1AO7D 4HJJL 5ESAB 5F1SA 1PG7H 3RDTB 4GS7C 4XMPL 2J8OA 4NNPH 43CAB 1BHGA 1S8DB 4UDTB 5GS0D 4DN4H 4JRWA 1IEBB 2FATH 3DIFB 2XWJB 4LHUA 2C26A 5EIIA 1DQMH 1NBYB 1WAAA 3UPCA 1I1YB 2V7HA 5D7LE 3QJFB 4OLYL 3U0PA 4QRUB 1GGBL 4WI4A 1L0YA 1LD9B 1NBZB 4HDIB 3STZB 2ZCHL 3INUH 4ZUWB 4JLRB 5K9KA 3D2UA 5C0FA 5HHOE 3O2DA 1YJDL 4OZIF 4PGCA 1ZANH 1R3JB 4LKXA 3UBXB 3UDWC 1MCNA 4JRYB 4U1MB 3QDMB 5DFVC 4WO4D 4HWBA 3KYOA 5JXEA 5I76B 3A6BH 2XG4A 3PL6A 2NY5C 1YMHB 4KGLA 1OTSC 1IQDA 3L9RB 4XCCL 2FD6L 1DBKL 3CFBB 2DLFH 1OF2A 1CLZH 5F7YC 3EFFA 3QXVA 3MO1A 2QQLL 3LMJL 2VC2H 1XMWA 4HWEH 4PRNA 4OB5L 1NCTA 2IQ9H 1IKFL 1MJ7L 4MZ3A 1IMHC 4NBZB 1YC8A 4AQ1B 4ZMAT 4PRIA 1N3NA 3GSUB 4E9LA 1UEMA 4R96B 1V3KA 2E9WA 2EYSA 3UO1H 1AFVH 3S36H 2HFFA 2W9EL 5DVLA 4YXHL 2D4DA 1EIBA 3BN9D 4P2RA 5D1QB 1IZKA 5HYSG 3FT3B 4WW2B 5FGSA 1AXSB 1NKRA 2XOTA 3HS0B 1TTGA 3U36B 4KC3B 4JFQA 3UROR 3EO0A 3TWCH 3IDMA 2Q6WA 4BKLA 2KDGA 2IFFL 1K4DA 3ESVF 4HS8L 3FMGL 5L6YH 3KPRA 4KHXL 3KVQA 1CGWA 3G6JE 2JB6A 2EYTA 3O3BA 4NHCL 3VXNB 4KJWD 5HXMA 1P53A 3HG1A 2ID5A 2DAVA 1KPRA 1B4RA 4ZNEE 4F57L 3U0TB 3QEQE 1ZGLB 4C56D 5LJYH 5TDNA 4KKLD 4PD4K 1BP3B 1ETZB 3FHAA 4EN3D 1KIUA 4N0UB 1IGCH 1GC1H 3HFML 2OR9H 1HE7A 5C70A 1HOCB 3H3PH 3OKLA 3QSKB 1BAFH 4QWWD 4P5TC 4IJ3B 4XRCA 4F33B 2RIKA 4RX4D 3LEYH 2VLJB 1RJLB 4Y4HA 4YHNA 5EULV 3ZZ1A 1WBZB 5TDPA 1KB5H 2DLIA 3OF6D 1X5JA 3QO1B 3I6KB 5FOBB 1P4BH 1FYTE 4ONHB 5DQDH 3BP6B 4ZOAA 4K7FA 3T65B 1A3RH 1U3ZA 1ED3A 1UWGL 1ZKAA 5HJ3A 3K81A 2W0KA 4KI5F 3W9DB 1JZ6A 2OCFD 2NTFB 4LLUA 3D3VD 1I3RB 1VADB 5I71B 2ZCKL 1QRNE 3V8OA 4O02H 4JRXD 2BY0A 3LN9A 5KANI 1SBSH 3FZUC 4L8SA 4PD4J 2PCPA 5L2KB 1Y0LA 1D6EA 2AV7A 3VWJC 3MJ7A 3BQUB 5GGRB 2DMCA 5HYJD 4MS8D 5E95B 1ZHBB 4PJFE 3U4BH 3V9FA 4YWGL 5J9PB 1U36A 1VACA 3MOAH 2I27N 2PTTA 4WTZA 1CVRA 2IEPA 3NFNA 2DJSA 4LL9A 4NHUA 4M6NH 4GFTB 3Q1SH 5KSBE 4JO1H 1UG9A 2XPGB 1BZ7B 3IDIA 2YPLD 1LEGB 2W1NA 3CXHK 1JZ8A 1T0PB 3GO1H 1A1NA 4MLSA 2HT2D 2EDTA 1IC4L 1CGXA 4DVBA 1HI6B 3FFDB 4M7LT 4P4KB 4H1LG 5D7LA 4IMKA 2XQBH 4Z95L 3DGGA 3OXSA 4PJCA 4QO1A 1G7IA 2KH2B 4K23H 2OK0H 3RJDA 4L3EA 1AD0A 2HJKB 4PTTA 1IC7H 3RTQB 1GGYA 4ORGB 5F9DC 4BH7B 3GK8H 1GGUA 1S5IL 4ONOA 3SDCA 5I74C 2NY6D 3JV4B 5F1OB 3DLQR 2NNAA 3TH4T 3HE7A 4NN5B 4TSCH 3UZEA 1MRCH 5GJTL 3KWWA 4NJ9H 5GGQL 2A6IA 5FDWA 2ADJA 1IGYA 4N8VG 1KLGB 4G6KL 2CO6B 2A6DA 2EE6A 5CJXA 5INDB 1H3GA 3D39B 3MFFB 5D2LF 2DQJL 2F53B 1A14L 4NP4H 5DUPH 4ZAKD 4M93C 1R3KB 2VE6A 2EH7H 5IQ9B 3CXHJ 3SE3A 2R2EB 4GG8B 2YKLL 4ZD3L 2F58H 4OFYA 1KENL 4NRYA 5DVKA 3ES6A 2GJZB 2WIMA 3QIWA 1TJHH 2Y07H 3ARUA 3WUWB 5HSFA 4WUUB 4CJ0A 3P0GB 4CN1A 1XCTB 1A6PA 3GBNL 1SYSA 4DAGL 1UWXK 4I3GA 3D0LA 1BQHG 1AR2A 1JYXA 3EJYD 3SE9L 5C0DA 4AEIH 1I7RA 5SV3A 3BT2H 4PJAB 4XPGL 1YEIL 5IHLB 3MUGB 1MAMH 3ZYOA 2VH5L 5E99H 5EWIH 2C9AA 2FIRT 2R2HA 3RUGF 3JWOH 4WY7H 1ES0A 4MAUL 1LO0L 3MA9L 2EECA 1QSFB 2WBWB 4K2UL 4ODXB 3RFZC 4KK6D 4OLEA 3QXUA 5D2NC 5GS3A 2BNUA 4JHBA 1A4KA 2OXHA 3QNZB 4P4RB 1I1AC 2AJSL 5MI0C 3BISA 2Q3AA 3U7WL 4OGXL 3G6JA 3VFUA 5DEFA 3MV9D 1KIQB 2V5YA 2G5BA 2AEPH 3QDGE 3V4PH 2FX7L 2VDNL 1Y18A 3LKQA 4L3CB 4NQVB 3F12A 2XQYK 3DMMC 1QLRA 5DRZB 3QEQA 2BK8A 3VMOA 2IGFH 1U92A 3BW9B 1ZEAL 4ZYKA 3ARFC 4Q9BA 2H3NA 5IVOA 3RWHB 4WU5A 2CKBL 4HLZH 5TE7H 3EO9H 5EOQH 4YO0B 3CZFB 1EHXA 1NLBL 2PR4H 1J8KA 3VXMD 1AC0A 2OL3L 2WANA 5DI8A 2A2QT 4NQTA 1X5AA 1JUFB 4CW1A 3D87B 1AD9B 2JB5H 5EBWB 3CCHA 5F6IB 2X41A 1MNUL 3MV8A 3KPQA 4EBQL 5B8CA 4FQQA 4XWOD 2F74A 4NFBA 1LVEA 5I66B 2OJZL 4F2MA 4K3JL 1RZFL 5GRZA 3FRUA 1N5YL 1JF5A 1A9EB 4Y88A 4OM0L 1LO4H 1ZHNB 5I0ZA 4K7PH 4DOHE 5JW3L 1VESA 3VFRB 3BPNB 1A6VH 4X6BB 1LWRA 2D0HA 3L6FB 2B1AH 1UYWL 1ZA3B 2XA8H 3LZFL 4G8FA 1TVHB 3WHXA 4EOWL 1HXYB 4PJFA 2W92A 2BZDA 4YQXH 3RI5F 3BN3B 2B20A 2F9BT 3MNWA 2VDMH 1QFHA 3HUJE 3S5LA 5C6TL 5DURD 1CU4H 3MJ9H 2ERJC 4LSSH 1WT5A 2FDBP 3GHEL 3QUZB 2W38A 1U95B 4DKEL 4UNVA 4QXUL 3W9EB 3QP3A 4KJQC 4U1SB 3TBSA 2VL5B 4M03A 4OBSA 3EZ8A 3DX9A 1EXUA 2FO4A 2W60B 1ZT1A 2DQTH 1E28A 3VXQB 1I75A 3UPAA 4Y1AB 1JHTB 1CICA 5DQJA 4ELME 3BUYA 4RMUA 4O51A 5FO7B 1HYRC 3P73B 4GAJH 2BSTA 2BNRD 5KJRH 1IQWH 4H0HB 5J11B 3V0WL 4X80L 4HIHA 3VXSB 1LE5B 4I0KA 5EOCJ 3B9EA 4YEEA 1RHHA 2R0LL 2FYYB 4CL7A 4BYHA 5D96C 5KVGH 2Z35B 2ZOKA 3TJEL 4RFOH 2O61B 1EK3A 1AH1A 1X5ZA 1MLBB 4YJZL 5D6CB 3BJ91 1F3DH 4M6OH 4F7CA 4OV5A 2V2XA 3EYFB 3SO3C 5E6IA 3X17A 4X0KB 4BQ8A 1T1WB 3K2MC 4H0IA 2GEEA 3QISA 3NCJH 2BXYA 1MFBH 2IPTH 2X4NA 1X7QA 4OFVA 3CXDH 1CXHA 3MLXH 4YDJA 1CGSL 1IGTB 5FHBH 2YSSA 1QFWL 2LU7A 4Y0GA 1KG0B 4G8IA 4KMTH 1FZKA 2V5RA 2XTJB 5KVFL 3MLPA 3PP3H 4HUVA 2OLDA 5EPMB 3F7VB 4N0FA 5F72S 3MRBB 5GJSL 5L8LB 1I8KB 4RA0C 3WDHA 3LKOB 4CUCA 4FFYL 4RDQG 3KYOB 2EDEA 3AS3A 3SPVA 5C0BB 1BGXH 2R0KL 5E9DA 5HDBE 1R3IH 1UB5A 3PV7A 4TULH 1WFTA 3GSXA 4OTXH 3ZKMC 4JFPA 3QHZH 2H32B 2X1WL 1W0YT 2GCYB 2EKSB 1A3QA 3NA9H 4Y4FB 4YZFE 4XVTH 1E4JA 3C60A 2QHRH 3FT2A 3O6FC 3UZVB 1L9MA 5DVNA 2GSGA 2MSPA 2W9DH 4AM0A 1LNUB 2CKBB 4N5ED 5HGHA 4IRJA 5I19H 4JFYB 3N1PC 5C0CE 3OQ3B 3AXLA 3V2AR 3X11A 3BAEL 5EO9B 3AU1A 3VGEA 5DJ6B 5IHZB 4P2CG 2OL3B 3BP5A 2EXYC 5E1HB 4L1HA 2H2SC 4YIQB 3MZGB 3LQZB 2B2XL 2NY5H 5KSAA 3LY6A 1HSAA 4DCQB 4N0YH 1S9KC 3RX7A 5FA3A 4OD1L 2H8PA 1RIUH 2G2RB 1N8ZA 1FIGH 5IBLD 2A83B 3J8F7 4DFIA 4NO3A 1DP0A 3BO8B 3MREA 3C08H 2WBJA 3GJFB 5DK2A 4LLQA 3G04A 1F8TL 2XRAH 3H42H 1LK3H 1NFDF 3CH1A 2FB4H 3VMNA 2VO5A 4AIXA 3QWRD 1A7RH 4A2MA 1P7QD 4M4RA 3ULVL 2BRQA 3KLHD 1U3HB 3VRLF 2CLRA 4OLWH 3KYNA 1SMAA 4G9FD 5HHXH 1VEMA 3DPBA 3B3IA 4DGVL 5CEXA 5CSBA 2E9IA 3LRGA 4P2OD 4XCNB 3B9AA 2MKWA 1RMFH 4LU5L 1I9IH 4PGJA 3S3PA 4Y16A 1QO3B 5EU6E 3RGHA 1DFBL 1FVCB 4LPYA 5C0EA 12E8L 4MWFB 1BJMA 2NY0B 3LRSB 4W6WB 1L7TL 3MYJA 4PJDE 5CEZL 3OKMB 3UC0H 2ITCA 5ADOL 2GJ6B 4ELMA 2YD6A 5GS2H 3HN3A 4O5LH 5SX4I 3K7UA 3THMH 3MJ8B 5L88H 1KJ3L 4PY7A 4X6EA 3B9VA 4TQEH 4WI6A 4OD3H 3OJMB 3L95A 1ZMYA 4UT7H 1W0WB 3CFCH 4PJAF 5HHNB 4E41E 1I9RL 4GXVH 2NXYB 4P3WA 4NM4L 3RTQC 3VCLB 3GMQB 1I3GL 1DL7L 4ELKB 1JGDA 4FQPA 3UAJD 5IKCA 1PAMA 3IETA 3FO1A 1IGFL 2XICA 1D5ZA 4NN5C 3T77A 3QUML 5HPMA 1J8HE 1ZGLP 3RIFF 3LKRB 4CVUA 4P9HL 3HCVA 2ARWA 3BJLA 3MLWH 1B6DA 4JFHE 3IDNB 3B8YA 5IOPB 4XNZB 2Z4QB 4OCSL 2NZ9C 1N4XH 4PJ7E 4YX2L 3O41B 5T1MA 1KLUB 3HE6D 5D5MB 4LLWA 4L3EB 5HI3D 2AK4E 4TNVK 3RWEA 3DUHA 1RULL 3MRCB 3TVMC 4R4ND 1HQ4A 3H6JA 2VDOL 4NQEE 4FQXA 1INQA 2AGJL 2AI0L 3OGOE 1HEZB 3ARYA 4GAGL 2VJXA 2NLJA 3VRJA 1DJSA 4XCEA 1NAML 4ONFL 4ODSL 3IU4L 2RBLA 2CXKA 1N7ML 1FN4A 3IXTA 3PWVA 5JMRA 4PRHE 3DUUB 3S88L 5HD8D 3WE6A 3HMXL 3NN8A 4PLJD 4XXCA 1NCAL 1WK0A 3PDDA 4OZIE 1N2RA 4HXAL 3PXJA 5AZEH 4NPYB 3G9VA 3HZMB 1JHLL 4PB9H 4UILL 1S7UA 1QR4A 3MXWH 5E8OA 4ZOBA 4XBGA 5C0CA 3S35X 4WWKC 1EVTC 2A0LD 3FB7B 4RISH 1JRHI 2EZ0D 1ORSA 1YQ2A 3O6KH 5C09A 1ZLUH 1IM9A 5JPMA 4UQ2A 1GHFH 2Y6SC 4G6AD 1ZT7B 1OTTC 4MSWA 2FBJL 2HKFH 4PJBB 3NH7L 3N1MC 4DW2H 5EZOL 2BVQA 3VGGA 1PSKL 2DD8L 3ZKXB 3UTTE 4EXKA 1T2QH 1FGVH 1H3PH 5D1ZD 5DD1L 3T2QA 1XR9A 4LLMB 1MCOH 3Q5TA 2DN7A 1RZGA 5BO1L 3S37X 4M43L 1WIOA 5DD3H 4XVUD 5D93B 4ZOCA 4BUHA 4CNIB 2N1KA 5I30H 3WLWD 1NJ9A 5JHDA 3OWEA 3WXVL 2EIBA 1U92B 5F7LB 1EJOL 1EJ6A 4PGEB 4EI6A 3V95A 1T4KA 2NMSA 3ARED 5IHUH 1NGWB 4ZPVA 1U9KA 1A7NH 3QIUA 4IIQA 2ITDA 4QRRE 4L8BA 5IR1A 4I0PA 2JE8A 4JEGB 5HI4C 5JW5A 3DVNB 2PXYB 4XP6H 1MRFH 3RP1A 3SJVE 3TA3B 3TIDB 4MJ6A 1CYGA 1JWMA 4LCWB 4OGYL 5CSZB 1A6ZA 1Z9LA 3BGMA 1LO2L 4D0DA 3NACH 1OGAE 4PTUA 4XVSL 1CGUA 2VISA 3MOQA 1HK6A 2R1XB 5CBAB 4IS6A 1A2YB 1MWAL 3LEVL 4F15B 2AK1L 2GTWB 3V0VB 3MV8B 1UB6A 4PJDA 4XBEH 1C7TA 2X7LA 1KUMA 2PTUA 2CJUL 1YYMH 2YS4A 3VXOB 1CFVH 3CPLB 4WFHE 3KXFE 3CVHL 5FYKL 2GAZB 3TO4A 1FVEA 3A6CH 5E8NA 4YLQT 2E27L 4MVBD 2YWZA 2FCBA 3GMRB 5KG9B 4XP5L 1QA9B 4MNGE 2H26A 3GKWL 4TVPL 4D0CB 4M7LL 4OF5A 5EZJA 5EBGA 5SWZE 4HIXL 4QF1B 25C8H 1AO7E 4TPRH 3V6FA 5BQ7A 4WFGE 2QTEA 5AYUL 2QR0A 2I07B 1OL0A 3QUMB 4R7NA 4AIZB 3TT3L 3OJDA 1URLA 2W0FA 5F9WC 4K9EH 4GQ9L 3QI9B 3BIKB 1FAKT 1FNLA 2BDNL 2C3VB 4N1HB 4CVXA 4EQ2A 2O5ZH 1J8HA 1XF5A 3MC0A 4UIKL 4B5EA 5F96H 5F7HA 1KULA 4LASH 4KHTH 5IESH 5DJZA 1BFOB 2E6QA 5I2IA 1SBBA 1ZLVH 2JK5B 1WC7B 1KFAL 4Y8AA 5EOCL 3VWKA 1YNLL 1FV1B 1KIRA 1CFBA 1LP9B 4L1DA 2VZOA 3UTQB 6FABH 4URTB 1A6WL 5HGAA 3BD3A 5MENA 1AHWA 4PJ7A 3O3DB 1WITA 4N90D 4R0LB 2JJTA 5CJ5A 5AAWA 5JLZB 5L0QC 4O51B 2L7JA 1HHHA 4NQEA 1ZHKA 2XTJC 1NAMB 1HNFA 1T03L 5I1LB 3MRQA 4RMQA 4Z7WE 1TQBC 5JXEC 2X9WA 4JJ5B 5E8PA 1IAKA 2C4FU 1ZTXL 3PL6C 1F4WL 1IZJA 2CKNA 3ABZA 4MB4A 4J2XA 4CMHC 1DLFH 5F89B 5GRJH 1G7LB 1CTOA 4X5WA 4PRHA 5E6IB 1A7QL 1L6XA 4R6UA 1RK0B 3LKPA 1A6UH 4PR5A 2GK0A 2YSSB 3M8OL 3OB0H 4XCYA 4G7VH 5ADPH 1SYVB 2P48B 4TSBH 3WFCH 1N26A 2QJDA 4Y5XA 3VGBA 3VFNB 4XX1E 4HFWB 4DZBA 2BVUA 3B8SA 4NZTL 5F21B 4GMTL 1B9ZA 4FXKB 4MQ7B 3FAXA 4OFIA 4PJGE 2DM7A 1B2WH 4QNPF 3NIFE 3QHFH 3LSOA 4TTDD 3UTTA 4M1GH 3NVQA 2X5PA 1M7DA 3MR9A 1ZGLM 1XEDA 3H0TB 1MI5D 3KPOB 1NC4A 2P7TA 4PGDB 4UUJB 4Z7VA 3UMTA 4DWHA 4C56E 3PG2A 1RFDH 5MEQB 1FNGB 1FPTH 5ETUA 4DN3H 2RFXB 4RMVA 2D2OA 3GFUA 2DMBA 2ARJQ 2HWZH 4OIIH 2MOVA 4XMKH 1CE1L 3ROOA 1F45A 2CUIA 4O4YH 1Q1JL 4AJ0A 4PJEF 4NQCA 3I6GA 2NY1C 2N56A 4LNRA 3DYMA 5F44A 3W11C 1PJ9A 4L8CB 3G5XA 4QRRA 3UJTL 3SBWA 1G6VK 4EIGB 1EEZA 1HILB 4K3GA 2ZG2A 3MCKB 1MUJB 3MLTB 4OZGE 3SJVA 3T04D 4Y2DD 3OAZH 4YK4B 4P59H 3IRZA 3KJ6H 3NGBC 1W72A 4QTIH 4Y2OA 1MWAB 5T33L 5C08D 5DJDB 5EO0B 1B90A 3D3VE 3GMNB 2P5ED 4NZRH 4KY1L 4J1UB 4Y4HC 1KXQE 3IXAB 5D9SB 5CIPA 5IVZA 1JE6A 3CVHB 5SX5K 3RL2A 3T1FB 5DFWH 2WP3T 2V17H 1KBGL 2UWEF 4UT9H 4DJMA 2EE9A 1QLEL 3C9NB 3KXFA 1DTUA 4OKDA 4X6DB 2R8SH 4G9DA 1Q9KA 4JVPA 4P23A 3MLYH 2AV1B 3CX5K 2FRGP 2DQIL 1CBVH 2L4OA 5T3XH 4FABH 5GGTA 5E2TH 5GZOC 3X14A 3AROA 3TN0D 1TZGL 1XH3A 4XBPB 1X5GA 3LEXB 3T4YA 4PJ9A 4YNYB 5EUOA 3WFBH 3V0AC 4L8SC 4B7LA 4MJ5B 5J6GA 1DUZB 1EBAA 4PBWD 2YPLE 5JNYB 1F58L 5IM7B 2NXYC 5HBBA 3DXAE 3E2HB 4PJIB 5IJVA 4PREA 3RJQB 5BS0D 1FZMA 4FNLH 2XA3A 5AZ2H 1FORL 2UYLA 4EDWL 4N9GA 5K33A 2X1XR 1F2XK 4ZOEA 1OB1A 4HXBL 2ZWLT 1ERNA 4LSUH 3KPNA 4K8RH 4MQTB 5F88B 3EDFA 3L7FA 5IFHH 3KLAB 5C0AD 5EFIA 4OLUH 1WCBA 1KTRL 3C8KA 3MRJA 4WO4A 5IMOA 3CVIH 4YGVB 3G5VB 1YECL 1JHKH 2DIAA 4PRPD 4AT6B 4FQCL 2X4RA 3BDXA 3CX5J 5D7SL 5GRXG 3ALPA 1W8NA 4IMKC 5DUBA 2CDFA 4Q9RL 2G60L 2DQEL 2XY2A 2NX5D 1WCQA 3QYCA 4ODHH 3S36X 4PJBF 1J05B 3SGEI 4GJTB 3SDCC 3R06A 4XPBL 4P5MB 5KVMC 4G8EB 1I1CA 2J88L 3HAEB 4Z7WA 1M6OA 3O2VL 3HE7C 1QSED 1PQZA 3QFJD 3ARZA 4U1LA 3L7EB 4HJJH 1U8PA 3VRIA 2OSLA 4AENA 4MB3A 2GY5A 4ZFZB 4X5LA 4XPTH 5KSUB 5CJXC 2UY6A 4M7KL 3VD4A 2V2WB 1G9EA 4G6ML 3HC3L 3BH8A 3QEUA 4H26A 4RFEA 2BC4B 2IQAB 4YHIB 3C5SB 4OLYH 3SE3C 1GGBH 1DSFL 4NN7B 5T1MB 2ZCHH 3TZVB 4AIOA 4MMZC 3QIWC 5J13B 3EHBD 4HMEA 4OCXH 1W8OA 1YNKL 4PJ5D 4Y4KB 5CJBA 2AJ3B 5E7BA 4Z7UB 3HZVA 1JZ2A 3WO4C 3MV9E 4XP4L 1DBKH 3DVFA 4YHYB 4UTBL 3MXVL 5T1LD 4JO4L 1A9BA 1NEUA 5I1EH 2QQLH 3B9KA 5F1IA 2A6KA 1EMTL 5LCVL 1ZV5A 1H3UA 4EN3A 3NZ8A 1ZS8A 5ILTL 5AG8A 3L3DB 1IKFH 1MJ7H 3WJJA 3W39A 5CFHA 5I17B 5ICZA 3EYVB 3W0WD 3VXME 1OGTB 1HHIB 3O0RL 4BSVB 3VGAC 1TCRA 2Y23A 3T0XA 1JZ3A 4L9DA 3OF6A 1R24B 1Z0NA 1J1PL 2W9EH 3P77B 5C09B 4IRSB 1IM9B 1KACB 4YXHH 5IMLB 1RQ5A 3D0VA 3V4VL 2JF1A 4NDMA 5DSCB 4JFXA 3M17B 4EI5D 3MZTA 3DMMD 1JMZA 1ND0B 2BY3A 1DE4A 2P8MB 2FX8H 4GAYA 2WQRA 4UAOB 3MMEB 4UU9A 3ARGD 2AEQL 1W2KT 5D71L 1MFAL 5LGKA 2IFFH 4I18B 1K4CA 4JRXA 3IJSA 4U7MA 3SKNA 3EJZD 4HS8H 3FMGH 4XI5D 4RIRB 3JTTA 1PX4A 4NHCH 1XZ0A 1KTLB 3LPWA 5B8CC 5HYJA 1DBML 3RKDD 3KYMB 3BMVA 2X4OB 2IH1A 3QUXD 4NQDD 5ENWB 4F57H 5ITFA 1YEGL 1IGJA 5JDSA 4YBHA 2FJGB 4DTGL 3B2VL 4S1DC 4GRWF 5C7XL 5IMKB 5DWUH 3DBXB 4P49A 5CLWA 2VUOA 1G7JA 1IC1A 1P9MA 4RGMC 5LQBL 5J6HA 3GHBH 3HFMH 2CPCA 4G3YL 1MHHA 2CXGA 1EHNA 3JWDL 3Q3GA 3K1DA 4JVUA 2NY4C 3WKNA 3FOLA 2F54B 4CRPA 1NEZA 4PYGA 1M7IB 2AXFA 2IAMD 4OGAD 1WT5C 1NFDE 1IEAA 1BD2E 5E00A 1ODAA 2R56L 5KOVC 4Z7OE 4C58B 1UWGH 2J4WL 4LVNC 4U2YA 4ZO8A 2BNRE 4RWYL 5C8JB 3VRLE 1RURL 4BH8A 1G7HA 4LCCA 4DKAA 1WICA 4OLXL 2DTML 2ZCKH 3WXWL 1F02I 1XGTB 1HSBA 3GMMA 2YC1B 1QBBA 5F3BB 5IROA 2W65A 1CICC 1REIA 3B5HA 3U0WL 3U30C 5HVWA 4UMGA 3RDTD 5FA4A 5GS1A 4ZAKA 5D7IB 5FUZL 5C9JA 2GHWB 3CMGA 5IMMA 1R0AL 2ICEA 4PGZA 4G43A 3IGAB 4HEPG 1UQSA 2UVFA 1NFIB 5AG9A 5ALBL 8FABA 5MP6L 2X4QB 5DQ9B 1M1SA 2H6PA 3WL9B 1IC4H 5TF1L 1GIGL 1LK2A 3ARQA 3QDMD 5E6IC 1T5XB 3FQNA 4Z95H 1Q9WB 4EUPB 4FQ2L 4NRZB 1GH7A 5ABDE 1S9WA 2AQ2A 3GSRB 5DJCA 4H0GA 3MRDB 4YE4L 3MV9A 5GJTH 4G42B 5GGQH 4EVNB 1T22B 4Z0XB 1JN6A 4PY8I 3RWCB 2IWGA 3PWJB 4G6KH 3BPCA 4J4PD 4Y89A 5DRXA 1ZSDA 4NFDA 2DQJH 3O9WB 1U6AL 1SY6A 2IBZY 1JRHL 4NO5B 2YD7A 2YKLH 1NGQL 2MCPH 1RPQA 1LE9B 2VQ1A 3BKML 1KT2A 1N59B 3ZKMD 5I1DB 3IJHB 3LKPB 3ULSA 1XGRA 3C60C 3VFMB 3TIEB 4DEPC 3O3AB 5LBSL 3QXWA 2GK2A 2Z8RA 4K7PX 3TJHD 4XAWL 5GGVY 3GBNH 4U7SA 1K85A 4DAGH 4IRJC 2WWMD 2V9QA 1PZ5A 3S7GA 4IOSD 5D1XB 2AEIT 3P0YL 5HHMD 3SE9H 1M05A 1X5YA 3PDGA 4XPGH 1YEIH 3QQ4A 1T5WB 3CFJB 4HMDA 2VH5H 3IDUA 3MUHL 5K9QG 1L0QA 2OTWA 3ZYZA 5H2BB 3LD8C 2J8UE 5T3XD 2VLRD 1A1MB 4MAUH 1LO0H 4FQ1L 3MA9H 1A7PL 4K2UH 4F8TA 5KOMC 1FFPB 1XR8B 1BFVL 5KSAC 2CLVA 5BOZG 5DC4B 5J1AA 1JV5A 2AJSH 5HGBA 3U7WH 4OGXH 2H32H 4DUWA 3KR3H 4YDLB 3MROB 2FX7H 2VDNH 4LPWA 1SMOA 5C07B 5DJ0B 3P4NB 5AEAA 4YR6B 1CWVA 4XC1H 4G9FE 3ROOB 2WBJC 4KWUA 5HYQA 2I9TB 4PB0H 1CT8B 1ZEAH 2D3VA 5IF0B 2VLJD 4GO6B 4I2XE 5F7MC 4P57B 4ZUSB 3NABL 4JFOB 2CKBH 4ZQKB 5DS8A 3SDXA 4FG6C 5E5MB 3V5KA 4FFVC 4ZTOL 4MZ2A 2FNBA 4KMQA 1NLBH 3IFOA 3K4DA 3BP4A 3FB6B 4K71C 3ZL4L 2HAZA 2J2ZA 2VTFA 2NW3B 2OL3H 1GZPA 4NC1E 4NT6A 4OQTL 2NY3C 4MD4B 1UC6A 3HPJB 5ANMA 2DL9A 4NQXB 1JP5A 5F93C 4S0TD 4FHBD 1MNUH 3CD4A 3RL2B 1SJVA 2YD8A 3N85L 5L2KD 2BNRA 1RIVL 5CGYD 5I1CL 4HKZA 4JZOB 3NFPB 4K3JH 4KRPB 1RZFH 3BQUD 1N5YH 3QPQC 1CDBA 4OM0H 1H0DB 4G8GA 4DFHA 5JW3H 2C4FT 2HJFA 2C3XA 3GJFH 1KCKA 4NN6B 5IHBA 3PGDB 5ISZB 1HDMB 3ZLQC 3KPMB 1UYWH 3LZFH 3C2AL 5C0RH 3PIQA 4EOWH 1BM3L 4PV9A 4RQQB 4GRLA 4RMTA 1QFWM 2X4SA 4UQ3A 4CDHA 2CRYA 4RGNB 4GBXA 4GXUM 5C6TH 2AJZB 1DUYB 3GHEH 4DKEH 2COQA 1MJJA 1X5XA 1T7ZA 1YQVL 4C4KO 3ZDXE 3L3KB 2AXHA 2YXFA 2ICWJ 4OLZH 3RTQD 1ADQL 4KKCC 2D7MA 1IL1B 3PHOB 4BM7A 2BSSB 4HK0A 3U46A 1YEFL 3TH2T 5F9AC 4KQ3L 4WWID 1NCBH 3S6CA 1HN1A 2OR7A 1NCCL 5GRUL 2FJHB 3SHSA 4KDTA 4WNQA 2ZG1A 4FQIL 1U93A 4S11A 5IBUG 4D9RD 4X4MA 3S8WA 3V0WH 2OI9C 1EZVX 4X80H 2EDYA 3D39D 2WV3A 4P9ML 4B50A 4AG4L 2F53D 3SDDA 3V6OE 2E7HA 2W0PA 3QAZB 2R0LH 1RVFL 4GG6F 4LCIL 4FQXC 4U1NA 2NZ9D 4HK3N 3DVIA 3TJEH 4LDOB 2D03L 2EDLA 2ZJSL 4NKOA 5ICYA 2VLMD 1KB5A 1NL0L 1G7QA 1UH4A 4YPGB 5C9KA 4JDVA 4M62L 1HQRA 1NUNB 4WUUD 1QEWB 3CFEB 1VSCA 5DJYA 3ULUD 2G75A 5GGUB 3JUYA 2CR6A 4UI2A 5I73B 5B38G 3T4AB 1QFWH 5BZWB 4KTYA 5I1AB 2IH3B 3C8DA 3L3JA 4DQOH 2WUCL 5KVFH 1KJ2L 3U7AA 1WLHA 1QLFB 1QSFD 4HUWB 5GJSH 3O4OB 1RJZB 3DX6A 3PXHA 4LEXL 3IDGA 4FFYH 5GRVK 5IVXB 4X6CF 4WGVB 1KCRL 1U8IA 2R0KH 4QHKJ 4GKOA 3RWGA 4OF6A 5BJTB 4JM2B 1JJUA 5E1AA 5F9OL 3KLSA 4N9OB 5JW4M 2Y7QB 5JHLL 3RY4A 1AGEB 1G6RB 3FO9A 2ED7A 3VFGL 3P4OB 3FQXA 2F5AL 5BVPL 1E6JL 1YN6A 3QWRA 3F7QA 1QP1A 3EAKA 1P7QA 2A6KB 4OCNC 4LMQI 3WJLA 2FX9H 1H15A 2AXJA 3V8CA 4MB5A 1TMCB 4HF5L 3W39B 3QG7L 3CDFA 2Z93B 4QNPE 3DURB 3RL1A 4XNMA 3OZ9H 3BAEH 3QDJE 3CDCA 3O11A 5BXFB 4NDMB 1NGYB 2P1YA 5KTEL 4ODBD 3QIUC 4IIQC 5T1KB 4I0PC 2B2XH 3QO0B 2HFEA 5HHVL 3MGOA 5TDOA 5FECA 4OD1H 1NGXA 1VGKB 3E3QC 4PJHE 3TO2B 1U8JA 3HPLB 4ZTPH 1JGEA 3BFOA 5DYOB 3SCMB 2HJLB 2A73B 4XNQA 5B3JE 3L3OA 1YPZA 4UOW1 3QCUL 1JZ5A 5A16B 3VXTA 1F8TH 3AAZB 4ZS7L 5CHNB 1C1EL 5JQHC 1XIWA 3QRGL 3WFHA 4P2QB 1PKQA 3DV6B 3TO4C 2R4SL 5DMKB 5IV2B 3QUZD 2VABA 4HC1L 3ULVH 4JGJA 5L8JB 3IAGC 3BI9X 2OZ4L 2Y4SA 2JCCF 1RZJL 4TUOA 5KS9E 5HYSB 4LCUA 4KKAD 3LH2L 2ZG3A 3EYOB 1B4JH 4OM1H 4TNVF 3RBGA 3ZE1E 3G6AB 4DGVH 5C71A 3ARDB 4YHPB 1CZ8H 1CDUA 3MGTB 4LU5H 4Y1AD 1D3CA 2DQCL 1CFTA 4FTVB 4EJ1C 1DFBH 1V05A 2P24A 3NFSL 4IMLB 4N90E 3HE6A 5GRYA 1ZLSL 1L7TH 1YNTA 3WIHA 5TH2A 4JANA 1CL7L 3VXSD 1JPGA 4DK3A 3AMKA 4U6XB 1G7HB 5ADOH 4D0BA 1YY9D 3RIAF 3RVUD 3PGCB 3GMMB 4S10A 1KJ3H 2A74A 1PG7W 2AERT 1BVKB 4U2ZA 1AHWC 3CDGA 4TUJA 4UINL 5EN2B 5A2KH 1I9RH 1T20A 2I5YL 3V6OA 4NM4H 1I3GH 4CU7A 5LKNA 1DL7H 4LLDA 5F6HI 2Z91A 4YXKL 5GZNC 4LHUD 3UP1A 1IGFH 4HUXA 2DM2A 5DD5L 3DETC 3NCCB 2GUOB 3IDYC 3QUMH 2CK2A 2DWDA 1BVLB 1I1FB 3QDHA 1GOHA 4A6YL 3QBTB 4NWTL 2EDQA 1UJ3A 1WWCA 2XTJD 3KYKH 4P9HH 5IG7A 3D2UD 3UJIH 4PP2B 5HHOB 1CGVA 1KJ2B 1MQKL 3BEVA 3FQNB 5JXED 5C0BD 4M9PA 4YX2H 3QQ3A 3L5JA 3JTSA 4H88L 1RULH 3JBG7 5I8KL 1CG9B 4F7EA 1LEIA 3ARRA 1FRGL 2AGJH 2AI0H 4X7FC 5F71A 1MI5E 2D0FA 4GAGH 5IIEB 3KNBA 4LVHB 3H7LA 4Y5XC 4K94C 5DZOA 2OP4L 4JB9L 2IMNA 3MJ9A 1NAMH 1JN6B 4AY0A 4ONFH 3TLRA 4ODSH 4U33A 4CN6A 3IU4H 3BPCB 2VN4A 1N7MH 3H3BC 1S7XA 4YUEL 4M1DL 1CD0A 3M45A 3TH3T 3BXNA 5J56B 1JMXA 5BRZB 3VW3L 2BVYA 5K9JL 4H1LB 1P4LB 3S88H 1UCTA 4ZSOA 3HMXH 1NCAH 4NFCA 5H37H 4HXAH 1G7MB 2FSEA 5EH1A 1WZ1L 1WBYB 2I9LB 1JHLH 4UILH 4Q2ZB 2JTDA 2CDEA 3VFPB 4BZ2H 1DLHB 2HN7B 4ZXBB 3JV0A 2ARJB 4PG9A 5GPRA 3WFEL 4P3DB 4K3EL 3PV6B 1KCUL 2P5EE 1UFUA 3GSQA 3DX7B 5JOFB 4P5KB 4U3HA 3SBWC 1HHKA 1QOKA 3KPRD 2FBJH 1NCNA 3AC0A 3NH7H 4N8VB 5EZOH 2WAHA 1PSKH 2IALB 3BZEA 1NCUA 2DD8H 2EC9U 1N0XL 1WJ3A 5EU5A 2M1KA 1P1ZA 2A6JB 2Q20A 3W11D 5DD1H 2FIKB 4BFIA 5BO1H 4WDIB 4I9WE 1RD6A 1UWXH 1ZVSB 1FC2D 1U3HD 3KPLB 2FEDD 2Z31B 1XAUA 4I48A 3BESR 4GKNB 3F7YA 4MXVE 5DMGC 5CLTA 3I6LE 4JKPH 3BWAB 1EJOH 5B39A 3ZE2E 3QZWG 4P23C 1BQHB 3ETBF 1GOFA 3RWDB 3BEWA 5K9OA 1A4JB 4YAQB 4X8JB 5AAMA 2DJUA 4IEFB 5KS9A 4HGWA 3W81A 2VUYA 3B6SB 4RGOL 2UZXB 1Q94A 4LQ1A 1KB9K 4S1QL 3TNMA 5T3ZD 1FNFA 3TBVB 2VZSA 4PJ9C 1CXLA 3PNWB 4TOYL 2VDQL 1LO2H 4CVWA 1OWRM 1S7SB 5GS0C 1WAAF 5C0AE 5GZOD 2GJ6D 5C0IA 1BQLL 3UX9B 5JOEA 1CXIA 3L3HA 4OKVB 4U6HB 4WI3A 1MWAH 3LEVH 3MX0A 4PRPE 2AK1H 1QRNB 4YXLL 3L3IB 3FQTB 3V6ZA 5IB1B 1ZWIB 1YDPB 4MDIB 2CJUH 2NW2A 1MVUB 1S9YA 2YRZA 1U8KA 1H3WM 2NXYD 2BCKB 3CLEL 2C1OA 2NX5E 3CVHH 3DGCR 2X4TA 5FYKH 3OKNA 5E2VL 2EXWC 4LCYA 2LQRA 2XZQL 3QUYB 1S9XB 4XP5H 1OAKL 4WO4C 3GKWH 3BKCL 2Z0BA 3M1BA 4M7LH 4HIXH 1QSEE 1TQCB 5IVXF 2BP3A 1A5FL 5TGBA 1Z6JT 3UDWA 4HIEA 5KSBB 3DV4B 3HC4L 5AYUH 4LHQB 2J5LB 1RJYA 4GKSB 1KB9J 3D18A 4A6YB 5DD6A 4GQ9H 4JAMA 5F6HJ 1A6AA 5DTFA 4JY6A 2BDNH 4UIMB 1UACH 2BOCA 5K59E 4UIKH 3VH8G 2APBA 4O58H 5JO5B 4L3ED 5TQ2L 4W4OA 5BW7A 3UYOD 5ECJE 1KFAH 5EOCH 4YPJA 3T0EB 1YNLH 3VXRB 4U1GC 5A2LH 1A6WH 2GITA 3MRGA 4PJ5E 4HAGA 2FL5B 3MRNA 3NIGF 3FTGA 3QA3B 3BN9C 3RU8L 1KPUA 4M5ZL 4OZHB 3VD5A 5ID1A 1B0RB 2Q7YB 4R7DA 3U2SB 1Z2KA 2EDHA 2ATPB 1EH9A 3SDDB 3NMEA 1DDHB 4I77L 1IBGL 4HIIA 2XZCH 1KNOB 1DQDL 3BP7B 4JFFB 1T03H 4X4XB 2BVEA 4XGZB 4C57C 3BPOB 1G9NC 5ELIA 3FRPA 4EKXA 3MRLB 4JDZA 1F4WH 1FBIL 1HINL 3HAEH 1J5OL 3SDAB 1HQRB 2QQNL 4KJWC 5D70L 4PJXB 5IFJB 2D7NA 3MLRL 1A7QH 3W0WE 4PRAB 5CSGA 4Z7NF 4AL8L 4LOUC 2VXQH 4KKLC 3B9KC 4QT5A 5DJXA 2R0ZL 3LKNA 2ATKB 1HZHL 1XF2B 2Z92A 4YBLC 2DQFB 3M8OH 4LF3A 4Y2DA 2WINB 4OV6F 2FHCA 1YY8A 3WJJC 3ZSTA 1LO5A 4QWWC 3NIDE 5C08A 5EO1A 3F6IA 1U8NA 4HS3A 1T04B 4Z6AT 1FH5L 1Q0YL 2HG5A 2P5EA 1WBXB 4OJFH 1HWGB 5JORA 2I24N 4NZTH 3IF1B 4NZJA 4GMTH 1EPFA 2BSRA 4QHMA 1MCBA 5CJOL 2YEZB 3WO3B 1AJ7H 4X9IA 4BK5A 3MRHA 4WJ5A 2PW2A 4X7CC 2Q87A 3PWNA 4CADB 2QV2A 5IJKA 1VCAA 2R2BA 3QDGB 5FO9B 3ELAT 3ULVD 2HLAB 2CIKA 4HBQA 4NQDE 3I9GL 5GISL 3C6LB 2BVPB 4H20L 1CGYA 1LO3L 2H2PD 3P9LA 1SEQL 3TN0A 1BF2A 1EFXA 3H8NA 3NCYP 1I9EA 3UTZA 5CD5C 3WBDA 2IG2L 5GRVL 1KJVB 3DTXA 3MGAA 4FXGB 4O2EB 3ULUL 2PXYD 2R0WL 1CE1H 1C5CL 3GMLB 4A2LA 4M00A 1A6TA 1Q1JH 4KROB 9CGTA 1I4FA 3FN9A 1DQQB 3SDYL 4MS8C 1FL3B 4F3FB 5BS0A 3ISWA 3UJTH 3ARPA 3MLSL 1UVQA 3CSYB 4JY5L 5IEHA 4RAVB 5JZ7C 5BVJA 2D31A 3VFTA 4QTHA 4HCRL 4G80A 1P9MC 3FQRB 3MV8D 1FLRL 3AMLA 4XZUB 2ZP0T 5IK3A 4PYHA 3PABB 2HFEB 1JPTL 1AP2A 2HT2C 1YEDA 4PJCF 2P49B 4PRPA 4NUGL 4KY1H 4O2CA 4Q6IA 4DOHB 3ZT6A 4J8RB 1NC2B 1T1XA 2A9NL 1KBGH 1VEOA 1YN7A 1QLEH 2GIYA 2M2DA 5AD0B 4O2FA 5ERWA 4KUCF 2DQIH 1XIWB 5CJQL 4B0MM 1MVFA 1D5XB 4Y5VB 3QI9D 4LCCC 2HVJA 3DX8B 3U7YL 1D5BA 3RBSA 1QSEA 1TZGH 4OIAA 3EO1A 4LVOB 3QFJA 1K6QL 2YUWA 4U1IA 3OKEB 4MJIA 5IROC 4OZFG 2PYFA 4WHYG 1OT2A 4L29B 1BIHA 3LN5B 1FLTX 3S4SA 1F58H 3FQUA 1KF9B 4KK9D 5GS1C 2D7OA 4ZAKC 3QDME 4EDWH 1NGZA 2IPKA 2VZUA 3IFPA 5E2WL 1CICD 4HXBH 3REVB 3GMOA 4EDXA 1MHEB 4LEOA 3DSFL 4XHQA 1QR1B 3E6HB 4I5BB 3OXRB 3IJYA 5BZDA 1WGOA 5K9QI 4IHOB 1OM3H 1B0GB 4HKBA 4PJ5A 5LGJA 4ODWB 4E5XA 1F11A 5DZNA 1YECH 4JFDB 1C08B 4FQCH 4ODVL 4PRBA 1S78D 5IB5A 2YA0A 4H5SA 5D7SH 5C3TA 3EJYC 3WLBB 2K1MA 2ICCA 3SGKA 5A3ID 3MRFB 2AAVA 5ESVB 1ZT4B 3TPKA 1J1XL 4OI8A 2VR4A 5T1LA 4HJGB 4JCLA 3EDDA 2G60H 3ZT7A 4Q9RH 2XKNB 2DQEH 1XF4A 4U0RB 1QVOB 1R5WB 1GL4B 5E6ID 2GSIA 5I8CB 4KK6C 3G6JF 5MEPB 2J88H 4LSPL 4L8DB 4I0CC 3O2VH 1BWWA 2K9UA 3OKOB 5DRNB 1EO5A 5IP4A 3STLB 1AIFB 1U91A 5JQ6L 5IB4A 3W0WA 4FN0A 3O6LL 1L9NA 2PF6A 5FDYA 1FZJB 1D7FA 4M7KH 4G6MH 3HC3H 5DK0B 5HHME 1CK0L 3RA7L 1DSFH 4EI5A 2QQKL 3DMMA 3HLAA 5E9DD 2ZOLA 5DA4A 3C5JA 4XMLL 1U8MA 1U2HA 2DKSA 3O2WL 4DKFL 5J12B 2OXGA 3ARGA 5T3XE 2VLRE 1A1OA 1IILE 5DHYB 4EUPH 3PWUA 2MQ0A 4M6AA 3F5WA 3CFIC 4P3CL 5F7KC 2RGSA 4XP4H 4N0UE 4X4ZA 4XNXL 4UTBH 1I7TA 2APXA 3MXVH 4S2SA 4JO4H 4F8QA 3QUXA 4NQDA 1T0NA 4XPFL 4IRJD 2IC2A 3GM8A 4HKXA 3D69A 1SJHA 3KYAA 4JR9L 1OAUL 1EMTH 5LCVH 2VLJE 3L5WA 5ILTH 2XXCB 4PJFF 5D7JB 5JIHA 3MRMB 1HCVA 3T8XB 4HHAB 1S9VA 3QULA 2QHLA 1XCQA 5GSRB 3VXPA 3DUSB 3LKSA 5KSAD 2C1PA 4M7ZB 3O0RH 3NPSC 5KSBF 2J8HA 4NUJA 1J1PH 4OIBA 1HYSD 2IAMA 5FCSH 3BKJH 3CH8A 4RZCB 3V4VH 1LDPL 5FYKD 1BLNA 1WZKA 1HHKB 3I75A 3ZHKA 1UXWA 4ZO9A 1SEBB 5L2KE 1FG2B 4ZDHB 4X7TB 1JVKA 5KSVB 3ARBB 2AEQH 3RNKA 3HC0B 3BUTA 4RMWA 1MFAH 2MHAB 4NNYA 1R3LA 4NRXA 3ZKSD 1OAYL 4DVRL 3VFOB 4KTDL 4QRSB 5ESAA 1J0KA 3RDTA 3QFDB 1UEYA 1UJTA 1S8DA 1YEGH 4UDTA 1K8DB 2NY3D 1IEBA 3DIFA 2XWJA 3L3GB 3B2VH 5C7XH 4KAQL 5LQBH 1MFCL 3OR7B 1NBYA 1I1YA 4NKQB 3QJFA 4QRUA 4G3YH 4V1DE 4GRMB 1LD9A 1QBLL 1C16B 4QHNB 3STZA 4HDIA 3GNMH 3JWDH 5EU6B 4ZUWA 4JLRA 1TQCC 5E2JA 4GRLC 2FGWL 3L1OL 3UBXA 1FCGA 1R3JA 4JRYA 4U1MA 3QDMA 3TT1L 4GBXC 5I76A 1OY3B 5SX4H 1YMHA 3G6DL 3MLVL 3RGVB 3TFKD 3L9RA 2R56H 3ROLB 3CFBA 2J4WH 5FGCB 5JPNB 1UKSA 1IT9L 1XGPB 1QFOA 2CK0L 4RWYH 4D9RE 5B21A 1RURH 1HHJB 1I7ZB 2JCCE 3D39E 4FFZL 4E41B 1N64L 2F53E 4OLXH 2DTMH 3WXWH 1UM5L 4Z76B 2VXTH 4KZDL 3FFCE 4J6RL 3BSZL 3FCTB 3NPZB 4J4PA 4KDTC 3U0WH 4OSUL 2VLME 3GSUA 4HWZB 4R96A 5FUZH 4WUUE 3QEHB 4YH6A 2E3VA 1GC1C 3SDDC 3REWB 2V5SA 4GH7B 4EQ3A 1SM3L 1R0AH 1WVZA 3SY0B 1WUNT 4YC2C 5CKAA 5I1GL 4L4VA 4K3HA 5D1QA 3K2UL 4IOIB 5ALBH 5E8DH 3FT3A 5MP6H 4WW2A 1AXSA 3HS0A 5A1AA 3TZVD 3U36A 4MXWL 1T7YA 5TF1H 4YHOH 1GIGH 2AK4B 1QSFE 4FQXD 2AJYL 2NXZB 4LRNL 3PWPE 2YK1L 4Y4KD 1W0VB 2EC9T 3CX2A 3QWOB 4NGHL 1NANI 1BBDL 1YC7A 4P46B 3VXNA 3ILPB 5TE4H 3EYQD 2JJSA 4FQ2H 5T5NF 4E42B 3U0TA 4JQIL 1IVLA 2F8OA 1ZGLA 5DDHB 1AGDB 1ETZA 4LQFL 4RRPG 1I8IB 4YE4H 4JKLA 4N0UA 2XT1B 1I9JL 1HOCA 4FA8A 4J3WA 2DI9A 2OMBA 4OZIB 1HXMA 1KN2H 2VAAB 3LPFA 4OF8A 4F33A 5DR5H 1ZVHA 4KJYB 2VLJA 1JRHH 1WBZA 1OLZA 5C09D 1V3JA 3UJJL 4IRSD 1IM9D 5J1TC 5FOBA 1MIEL 5ITBL 3JV6B 4ONHA 3BKMH 3BP6A 3NAAL 4LF3B 3WJLC 3KLHC 1FO0B 3T65A 3HUJF 1AKJB 5LBSH 1J10A 3W9DA 4XAWH 1F4HA 1NAKL 1OWWA 4J3SA 2NTFA 3D85B 1U8NB 1I3RA 1VADA 2VDPL 4HGKC 2CSPA 43C9B 1J88A 3X12B 4LLVB 3BZFB 4MJ4A 4YHML 3CFKB 4QY8B 4PBVC 5L2KA 1FZOA 5BOPA 1VFAB 2DLEA 5LVEA 5DC0A 5F1NB 4IDJL 3BQUA 4FQ1H 5GGRA 1A7PH 2PYEA 1ZHBA 5JHDD 2IANE 4ELMF 1BFVH 5J9PA 4NC1C 5BV7L 1JGUL 2LFGA 1G6RH 2DQUH 4CU6A 3FQWB 3S37H 4FFWC 2XPGA 1BZ7A 3C09C 1LEGA 1R5VB 1LHZA 5ICXB 1HI6A 3FFDA 4P4KA 1IJ9A 3LAFA 4X98B 3NABH 5CWSB 1XIWC 4MNQB 4Y1AE 2F5BL 2VIRB 3BGFB 5DGRA 1OGAB 4ZTOH 4LKCB 3F7RA 4PJ8B 2HJKA 3WCYA 3RTQA 2MFNA 4ORGA 3ZL4H 4BH7A 5FYJL 4KRLB 3LS5L 2WLZA 5ESQB 2Q8BL 3JV4A 2N7AA 1WIPA 4OQTH 1J0JA 3T2NH 3L5IA 2LU3A 4PUBL 4QRTB 4JKWA 2IF7A 4O2CB 1R3HB 2J12B 3JWOC 4H8WC 1NFKA 5B22A 2P4AB 1G9ML 1KLGA 4MNGB 4QOKB 3BDBA 4OUUB 5INDA 3D39A 3MFFA 5HI3C 3OG6B 5SWZB 2F53A 4O2FB 4OBRA 3SE8L 4MLIA 1AO7B 1R3KA 5IQ9A 2R2EA 4GG8A 4MD5B 5I8EA 4M48H 1CVSC 1DANU 3C2AH 2GJZA 3OR6B 1BM3H 1I7UB 3GEWB 3WUWA 2UZYB 4WFED 3EDEA 4WUUA 4YZFF 1ZHLB 1XCTA 1EX0A 3WIFB 3LS4L 2C3HA 4YFDB 2AJVL 5EC1B 2XTJE 4XB8A 5KVDL 4WTXA 4CGTA 1YQVH 4PJAA 1QFWI 5HD8C 4PLJC 1SJEB 3MUGA 5C0BE 5HDQL 1N6VA 3UCRA 1VKXB 1ADQH 3TCLB 5JIIA 5EZLB 4J23A 1QSFA 4ODXA 5DC9B 1YEFH 1T0MB 3QNZA 2WWKO 4HD9A 4P4RA 1UJ3C 2DKMA 2A0LC 2EZ0C 4MA1B 3T0VA 3GB7B 3DETD 1NCCH 1KCLA 2ZUXA 5FK9B 5GRUH 3AB0C 1KIQA 1NMBL 2X2YA 5KBNC 1OOAA 4FQIH 3G5YB 4G6AC 4L3CA 4NQVA 1BOGB 4XP1L 5I6XC 5DRZA 2YD1A 4JHWL 4GOSA 4P9MH 4RBPH 3BW9A 4AG4H 3QEGL 4HS6B 3IKCA 1WWBX 4PRIE 3UYRL 1F6AB 3U6RB 1S5HB 3RWHA 4LSTL 3GRWL 3AUVA 4HEME 4YO0A 3CZFA 2Q86B 4U1KB 4XVUC 2ZJSH 1NL0H 2V2TB 5TE6H 1TVBB 2R1YB 5GGVL 1U0QA 3H7BB 5D1XD 1JUFA 4WUKL 3ULUC 1AD9A 5EBWA 3VU2A 5FM4A 5D2LB 2B5IC 3KPRE 5D7JC 5I66A 3SGJA 4B7IA 3OG4B 2WUCH 5F9JB 3GI9L 3GMPB 5GSVB 5IFAH 1KJ2H 4JGMA 1A9EA 1MJUH 5M7QA 1ZHNA 4BSJA 3VFRA 2K7QA 3I84A 4X6BA 1JYVA 3HRZB 3L6FA 1FFRA 1BZ9B 4PJDF 2KL6A 1ZA3A 2V5MA 1MLCB 4C56B 4RFNB 1TVHA 3VI3E 1HXYA 5F9OH 5C07D 4X99B 3ZYIA 5JHLH 2YBRB 3ET9F 3MRRB 3U82B 3VFGH 4QRPA 1E6JH 3X3FL 4JHZA 4NQCD 4Q6YA 4X7SH 1VEPA 1MFDL 3QUZA 1U95A 3W9EA 2ADIB 4U1SA 5TFSL 3RUGB 3IAQA 2VL5A 2ZKHL 4LHUG 4H1LH 2DI7A 1NDMB 3QT2A 4PIRF 5T3ZE 3RZWA 5I75C 2W60A 3NTCL 3G08B 3OX8A 3VXQA 4NKMB 2F8XC 3O6ML 2XZAL 4Y1AA 1JHTA 3P40A 3D9AL 4PP1D 4GMSL 4HZAA 3D3VB 1DN0B 2Z8SA 1PY9A 2QQQA 1PYWB 4JJHA 2NY7L 1HHGB 5FO7A 2DLTA 3P73A 5DMGD 4JPKL 3VXSA 5HHVH 1LE5A 3IDJB 3ZHLA 4IM8A 4LPUA 1RIHL 3PP3K 4PJ7F 3RNQB 2FYYA 3GBMH 1PG7L 4JPVL 5ISZD 2B0SL 3DOSA 4NNPL 5EBLB 5CMAB 2Z35A 2MNUA 4J3UA 2O61A 4DUVA 2FATL 1MLBA 3I85A 3QCUH 4Z7QF 4JDTL 1F3RB 1D5MB 4ZS7H 3EYFA 1LEKB 4X0KA 1T1WA 3S96B 4RGND 3V5HB 3VA6A 3QRGH 2YPLB 3INUL 2R4SH 1AXTL 5F8QC 4HC1H 1T2XA 3DXAB 4OZ4B 1UXSB 1F3DJ 3QJHB 1IGTA 2OZ4H 4PRDB 1RZJH 1ZANL 5CGTA 2Q3ZA 4PJCE 1KG0A 3LH2H 2AVGA 2D0GA 5D5ME 4L3EE 4JO3L 5EPMA 3F7VA 2EXWD 1GPOL 3FOMB 3MRBA 3OKDB 1I8KA 3X13B 3LKOA 5IW3A 1Z5LA 2DQCH 5C2BL 5C0BA 1BWMA 1CLZL 2NY6B 3NFSH 4CMMB 4Y7MA 1ZLSH 4U31A 4HWEL 1TNNA 4U1HB 1Z9SA 2H32A 4G6JL 1G1YA 1SHMA 4HG4K 2GCYA 4W4OC 5BW7C 2EKSA 3B2UD 4Y4FA 3SGEH 4UT6L 2NXZC 3IU3B 3LDBC 1QD0A 1VFBB 4KMLB 3J7HA 3RZCB 1O5DT 1LNUA 1WISA 4UINH 3S36L 2CKBA 1CN4A 2BMKB 1V7ML 4XTRC 2I5YH 2VZVA 4Y19B 4TTDC 4JFYA 5GIRB 4IBLT 2W07A 5KN5B 4YXKH 4PFEA 4LGSB 5EO9A 4FS0A 4GW4B 5DD5H 5DJ6A 1BVZA 5IHZA 4MCZB 2OL3A 4L4VB 5SWQB 2SEBB 2LV4A 1NGPL 4YIQA 1PFCA 4A6YH 3PP4H 3WV0A 3LQZA 4NWTH 5MEOB 4Z8FL 4DCQA 3LOWA 3FN0L 5I1IL 3IVKB 5E8EB 2DF3A 3H9SB 4I8DA 2G2RA 5HHQB 4HG4J 3ZE0E 1MQKH 2A83A 2PO6B 1G0YR 1ZOXA 3BO8A 3S98A 5CZKA 3GJFA 5C6PB 4JM2D 1MFEL 4H88H 4Y2DC 5I8KH 2YD9A 3LQAL 2VDRL 1IGCL 4LLAA 4R90L 1FRGH 3H3PL 4LOUD 3B9KD 3MBEB 4JPWH 4XNYL 4M1CC 2W91A 1F4YL 1KELL 1U3HA 5H94B 4JB9H 3BPLC 4WTZG 5I16B 4YUEH 4M1DH 1HXMB 4WHTB 1TVDA 5IJKC 1FL5B 2O5XL 3VW3H 4XCNA 3BE1L 3SKJL 5K9JH 3GUTB 1EHLL 1WTLA 3VXMB 2XN9A 1QO3A 5EUOF 1FVCA 1MCJA 4W68A 2IADB 4MWFA 3TN0C 3T0DA 3LRSA 4KRNA 4G7YL 1FDLL 5T1KD 3DNKA 3MV8E 2BOBB 4NC2B 2NPLX 5CILL 3OKMA 2NY2B 2X70B 1JFQL 4HH8A 1MHCB 3WFEH 2GJ6A 4KJPD 4XPHH 4K3EH 3MJ8A 1KCUH 3PJSB 5CD5D 2FR4B 3U4BL 5I9QC 4YFEA 1AQDB 3SCMD 4I3SL 1I1RA 1W0WA 2VN7A 2HH0L 3MOAL 1F6FB 1FZOB 5HHNA 4MHHG 5JIKA 1N0XH 4OCYL 3VCLA 4M6NL 3GMQA 3Q1SL 2PYEB 4BZ1L 4JPIB 4KKBC 1JIBA 4ELKA 3MACL 3OGCB 3ZTJG 4P2QD 3BWUC 5JZ7D 4PV8B 4Q6IC 4OCWL 2VWEE 4WVRA 2ZNXA 3CUPB 4JN2A 4NO0B 3LKRA 4RWHA 3T2PA 2R29L 3N1QC 3ARDD 1OSZB 2OK0L 4Z7WF 1QG3A 1OP3H 3OPZL 3BZ4A 3IDNA 4UB0L 1LP9E 4E0RB 4FTVD 5IOPA 4U4BA 5I15L 5DEGB 2Z4QA 1U58B 4RGOH 4LSDA 3O41A 1KLUA 4S1QH 5D5MA 4M3KB 1NFDB 4KI5C 1BD2B 3MRCA 4PLKD 4TOYH 2VDQH 4W6YB 4LGRB 4APQB 4NJ9L 4TYUA 1ORQB 5IW6B 1HEZA 3DVGB 4LDLB 1BQLH 4DK6A 3A67L 5FHAL 3HMWL 1RZ8B 2Y36L 4YXLH 5DUPL 2C7UB 1OPGH 4HX1B 1ONQB 2EH7L 4D2NA 1MY5A 3CLEH 3T2OA 1T1YB 3SKOB 3EHBC 4KVCL 5E2VH 4WEMB 2R2CA 4PJGF 4JFEA 1TJHL 3DUUA 5LWYL 3NIFF 5I8EB 2VERN 5E56A 1RZ7L 3BKCH 4NPYA 3LHPL 1DQTA 3HZMA 4DKDC 2FZ3B 4H25B 1R5IB 32C2A 3SGKC 3G9AB 3HC4H 3PHQB 3O3UN 4F7TB 3FB7A 3JZ7A 3V52L 1IGIL 2ZPKL 2DICA 1ZT7A 4YHLL 4LSQH 4W4NA 4PJBA 5E9DE 2UUDK 2LABA 3Q6FB 5TQ2H 4H8WH 4EZMA 3RQ3A 4DGYH 3MLUL 3DROB 1TZHB 2AEPL 2D4FA 3ARVA 4M8QB 4IDLA 4JZJB 4LLMA 2BNQA 4OZGF 1EUTA 1S7RB 1U8OA 3WIHH 4HK3J 1VENA 3RU8H 4KTEL 4NCDA 5GGSB 4M5ZH 4CNIA 4KI1A 4EI5C 5TE7L 1JWSB 4NIKB 4LPXA 5CP3H 2X05A 1KPVB 3EO9L 1QPPA 3QUKB 3LRHA 5DJ8B 4PGEA 2VR5A 3IKCB 3ARGC 4I77H 5BRZD 4KK8D 1DQDH 1NGWA 3OAUL 1J0IA 4FXLA 1F13A 3EJZC 1P84K 4OFKA 3DVNA 4XI5C 2PXYA 2WK2A 2VKWA 1FBIH 5IBTH 3GSOB 2E7LA 1KXTB 4L5FL 1HINH 3TA3A 3TIDA 1FNAA 4I1NB 4LCWA 4K9EC 5CSZA 2QQNH 5D70H 5LGHL 3B5TA 3TBWB 3RKDC 4ZXBD 3ZT5A 3KJ4B 2CLZB 3AS0A 3MLRH 5HHPB 3QUXC 2R4RL 4N0RA 3A6OA 3WFDL 1FNSL 1JNNL 4AL8H 3VA2C 3V6BR 4FZ8L 2R1XA 2R0ZH 5CBAA 3U9UB 1A2YA 1HZHH 1HKFA 1N0LA 1IKNA 2GTWA 2V9RA 3V0VA 1JI1A 1LO4L 3QH3B 1X5IA 3LCYA 5FYKE 1HH9B 5IBUB 5CD3B 1A6VL 2DQGL 3VXOA 3CPLA 3BH9B 2FO1A 3QXDB 3TM6A 4XAKD 2GAZA 1ZLVK 3WKML 2J8UB 5J4MA 1FH5H 1Q0YH 2Q8AL 1T83A 3GMRA 5KG9A 1QA9A 5CJOH 3GIZL 1JF1B 4D0CA 2IAMC 1OAZL 4OGAC 4QF1A 2WNGA 4J3OC 4OF7A 2Z31D 4U7KA 1JNLL 5FUCC 4ZNCD 1UT9A 2GFBB 4WU7B 1P84J 2I07A 3QUMA 4QRPB 1DANT 5E03A 4AIZA 5IEKB 3I9GH 4G9FB 3QI9A 4H20H 2CQVA 3BIKA 4PJIE 1LO3H 1SEQH 1AXIB 4NOBA 4XC3L 1D9KB 5E94B 5B38B 2C3VA 4I2XB 1XGQB 4P2OB 2BX5A 4WI8A 2IG2H 3Q5OA 3ULUH 1BFOA 2R0WH 1C5CH 2JK5A 1WC7A 3ORJA 3HI1B 3W2DL 4WI2A 3SDYH 1FV1A 2CR3A 3RDTC 1P7HL 1LP9A 1YUHB 3OX8B 3UTQA 2GY7B 1KJMA 3MLSH 5D8JL 4HKJB 3O3DA 4JY5H 4WI9A 4R0LA 3BHBB 4HCRH 4ODUB 4MXQD 4MGXA 4JFZL 4R2GB 5JLZA 1FLRH 3UPRB 3K80A 3QG6B 2IMMA 2YPKB 4LPVA 4M3JA 4WW1B 2CUHA 2YD2A 5EUKB 1JPTH 4RFOL 1NAMA 4G8GD 5JW4R 2E8YA 3MODH 5AWNL 4NUGH 4LAJH 2YRPA 3DRQB 1KIPB 5I1LA 2DKUA 3VJ6B 1V7NL 3WNNA 1GGTA 2VZ1A 4R4FL 4JJ5A 1DBJL 5DMIL 3MNZB 3HMXA 5HYIA 4GRLD 1DN2A 5F89A 3RWIB 2VXVL 1G7LA 2PW1B 1F90L 3O4LB 2QADB 5FF6A 5CJQH 2DMKA 4GBXD 5EU3B 1CDCA 1RK0A 2HYMA 2Q76B 4OQ1A 1JTPA 4S1RL 1K6QH 3R1GH 3I02B 2B4CL 2QBWA 1SYVA 4U0QB 5E24E 4J4PC 4X4YA 3T0ED 2P45B 3VFNA 1QRKA 3VXRD 1MQ8A 4KXZI 4HFWA 2ZUYA 4OTXL 5ID0B 1Z5LB 5E2WH 4FXKA 2A9ML 3CDYA 1S7WB 4MQ7A 5KZCB 4Z7UE 1B3JA 1G7PA 3U79A 5T5NG 5D1QC 3NA9L 1B0WA 1MOEA 3OAZK 3DSFH 4ZFOL 4WW2C 1KGCD 3H0TA 3PWLB 4WCYH 3TJHC 1FAIL 3KPOA 4PGDA 1GZQB 4UUJA 3SDDD 3KAAA 1TITA 5MEQA 2WWMC 4ODVH 2Q1EA 1FNGA 4JFFD 1RUQL 4HPOH 2QSTA