3CPLB

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplB00
4GG6B 1YA5A 3BW9B 2BRQA 3CH1A 1Q94B 1GGUA 4MJ5B 3VH8B 5FHAL 2RCSL 4QY8B 1W72B 4NGHH 4QGTA 1IM9A 5L88L 2QLVB 1BD2E 5HDBF 3MLUH 3GM0A 4PP1D 3UMTA 4PJCE 4WRLA 4KRLB 8FABA 4LRNH 4F7CA 1GGCL 2AJUH 4Q0XL 3CVHL 2O5XL 4RAVA 4DFIA 3ROOB 5F1KC 5J3HC 3VGEA 3MOBL 3DGCR 2GJZB 3FO1B 3KPRD 4JZNB 1II4E 4KUCD 3BKML 1Q0XH 5I1KL 1MWAL 2OTUB 3DMMC 3OKKA 3KYAA 2K7QA 3QCUH 4ZXBB 1LILA 4UOJA 4MWFB 1GYAA 2VXQL 1EJOL 4PJDE 4N8VA 1QFUL 2QEJA 4WUKH 4AQ1B 3WIHA 2PR4H 4OFDA 4XPGL 1T22B 3EYOA 2VLKA 2RHEA 5B4MC 2A6KB 4Z7UE 5ISZB 2NXYB 3QO0A 4MA8L 2G60H 4ODTH 4U0QB 2ADJB 2QSVA 5HHPB 4PRPB 1JHLH 2WUBH 3F8UB 3CDFA 5DJ0A 3RVVD 4F15B 2ZG1A 1T2XA 2JTDA 5JO5A 4JRYE 2Z4QA 4QRTA 3RTQA 2ZZUT 1NCUA 3BSZL 3DETC 4PY7B 4NC2B 1S7XB 4Y2DB 1A1NB 3GI8L 2AKRA 4J8RB 5D7LB 5I1HH 1T7XA 4IRZL 4NO3B 4B7LA 2FATL 2FHCA 3BZFB 1H3GA 4PJGA 1KJ2L 1XGPA 1OAUH 2Y25A 1XZ0A 3ARBA 3L3KA 4I18B 3FQNB 2PETA 4LVHB 2DQFA 4WHTB 2Y5EA 4XNXL 5F96H 1F3JA 2VLRE 2YUWA 1SY6L 2Q8AH 1FBIL 2IFFL 3TT3L 5F72S 3H9YA 3I75B 1H3PH 4N5EC 5ETUA 5GSVA 4PJ5E 2YHGA 1D9KD 1ZVYA 3LH2H 3EYSL 2VAAB 2V17H 1FG2A 1JMXA 3VMPA 5TH2B 1YNKL 5EC1B 1RZIB 4JFYA 4L8SA 4LLDB 4U6VL 4X6BB 3ARUA 3BXNA 4I3GA 3ULVH 1BWMA 2AEQL 3B8SA 4LLWB 4G9FE 1N5AA 1C12A 2CLRB 5JPMB 3MLYH 3HNSH 4KKNA 5TFSH 5I1GH 2HT3D 1KCVH 4BQCA 1IEBB 2A6IA 5FUZH 2CXKA 3OWEA 1LEKA 5HYJB 1JNLH 1OGAB 2RCSH 1F13A 3NABL 3HFML 1X5JA 5FYJD 3KPNB 3P30H 5L88H 2NY1C 4R0LA 4OZIE 2BMKB 2DQHL 3VFOB 4NUGL 3C5ZA 5D6DA 2APWA 4NQCD 2X4PA 1KTLB 4DW2H 2Y06H 1G0DA 3U4EB 1GGCH 4Q0XH 1X9QA 2F54D 4APQD 3DRQB 3O9WB 5T1LD 3MA9L 2WBJA 1A7NH 4QYOB 3MOBH 4HHAB 2V7HB 3OKDB 5EU6A 1MFDL 4JPWH 5TDNB 1YEGL 3BKMH 5JOPE 1S8DB 1MWAH 3LN5A 3RBSA 4QXGL 1TZHA 2YBRB 1KNOB 1QSFA 4I5BA 1UEMA 2R1YB 2BXZA 4PYGA 5TQ2L 4YHLL 1FPTL 1Z6JT 1EJOH 5D1QC 4X98B 1NGXA 4U6TA 1FL6A 4ZO9A 3RWIA 1QFUH 1OAXL 5BZDA 3JUZA 2B39A 4LHJB 4XPGH 3DVNB 4ZSOA 3SE8H 4S0SD 1F4AA 3D5OF 2D9CA 3UBXB 4ORZC 2LFGA 1YEIH 3MROB 2NW3A 3EBAA 2ICES 5HGHA 3OGCB 2FX9L 3BOVA 4X4ME 1S5IL 3QO1A 3BGMA 3MRJA 2VZVA 1NEZG 1R5VB 3VWJD 4KRPD 5IEHB 1G7HB 5I0DA 3BSZH 4RGNE 1FV1A 4OBRA 5EU4B 2EXWC 3V4PL 1OAZH 5CSZB 1GCFA 1BMGA 4JY4A 1G6RL 2FATH 1D5MB 2OR9L 1I8KB 5SWSB 3IRZA 1F6AB 1JZ3A 5ILTL 1G9MH 3GMRA 1J8KA 5CJOL 4XNXH 2UY7A 2YPKA 5ERWB 5KS9F 3IJHA 4R2GB 2RFXA 3DI2B 1FBIH 3TT3H 4NYLB 4UV7L 4KGLA 2J8HA 3TVMB 5KZCB 1Z3GL 1YJDC 1IKNC 3LDBB 3EYSH 5JIIA 5DS8B 1ZHLA 4EDWH 3RY5A 3ZZ1A 2NY7L 3LKRB 3RZCD 1YNKH 1QEWA 1WVZA 2R2BA 1CR9H 4TSAH 5F3BB 5KSAA 1MIEL 3FRPG 1K85A 2LAGB 4G42B 5IB2B 4QT5A 1DEDA 1JV5A 4P4RA 3MRLA 4NBYB 4N90D 3VXTB 2FEDC 3ILQD 1CGYA 1MJUL 4EDXB 3O8XB 1PQZB 3I6LD 1CDJA 1FFPA 4L8BA 1M05A 2ZCHH 2X4TA 4A2MA 4IMLB 4LCYB 2VDLL 4DZ8A 3KYKL 1QRKA 4YNYB 5L6YL 2EZ0D 1U8IA 4JDZB 2W0LA 3LRSA 3L3OA 4NUGH 2UZYB 5ID1B 1WICA 4NZUL 1DLHA 4QRQA 2E8ZA 3RFZC 1NBQA 1NAKL 4Y88A 1QLRB 1SM3L 4HS8H 1MHCA 3LAFA 4JHWH 2R0WL 3MLXL 4JJ5B 4TUJA 1QLEL 4XPBL 2PTTA 1FZOB 3JWDL 1YEGH 1UXSB 4PRIA 5INDB 1BOGB 1AQKL 3MR9B 2BOCB 4QXGH 2Y1VA 4NO0D 2GFBB 1YUHB 3X12A 1T0MB 3MFGB 3V4VL 1FPTH 4U1HA 3CFDB 2XG4A 5C08E 5IFAL 1OAXH 2CLZA 3QIBB 1PFCA 3L3DB 3UC0L 1WZ1L 3GSNL 1KIQB 4TNWF 5JPNB 2OBGA 3ULVD 2K3TA 3RI5K 5EB9A 4NNYA 1ZA6A 2F5AH 4UDUB 4HMCA 1JF1B 1PKQE 4O4YL 1NAMH 2DLTA 2OP4L 1VHPA 2BSSB 1CGXA 1CGSL 2PW2B 1SBSL 3QI9C 2FX9H 3FT2B 1RUML 4JQVC 1PG7X 1S5IH 4LARH 1NMCB 4MQTB 3GIZH 1CXFA 3S4SA 4Y8AA 3SGDH 5F9JA 4Y19A 3HAEB 4RZCB 1SMAA 1GRWA 2V5SA 3IDYB 3KJ4B 3QNXA 1U8LA 2F8OA 1OT1A 3JV0A 4FQQB 5F9WB 3VG0H 4PJXE 3BIBX 3QDGA 3GSRB 1RZ8A 1T21B 3RNQB 3SDXE 5EDXA 3PQYD 2QQNL 2K9UA 2OR9H 3CVHA 3QIWB 3BIKB 4QRPB 3V6ZA 1JYWA 5ILTH 2XNAB 1YY9D 1AP2A 3SGDI 4KJWD 2E8YA 2EECA 3I02B 5D7IE 3HC3L 5IMKA 3RU8L 2VR5A 3QQ3A 3WNOA 5K9KB 4ZS6D 1VADB 2BOBB 3GGWB 3ARDC 3LEYH 4CMMA 4JJHA 5JDJA 4PUBL 1MCFA 4ZOCA 1HQRA 4FXGB 2VLLA 5KBNC 1MIEH 1QBLL 4OFKA 4LU5L 3N1FC 5D72H 4NT6A 3WKML 3PV7A 1MIML 4IOIB 1GPOL 3DTXA 5HDQL 4XNZB 1KENH 4GRLB 5DVLA 4WIQA 1T0NA 5ANME 5ICYA 4P59L 2R39A 4NQTA 4Q2ZA 2ZUSA 3T3PF 3JVGC 1A21A 4D0DA 4LHUB 2ICWI 4PTTB 2C3HA 5HI3D 2VDLH 4QKXB 3KYKH 3KYNA 5IM7B 4ETQB 5B3JF 5AAMA 1RQ5A 3P0YH 4QRUB 5IESL 3HMXA 5IT2L 5FO8A 3G6DL 1NPUA 3IDIB 3MRBA 1DQDL 3O4OC 4LBEB 5HI5D 1SM3H 2HFEA 5E2TH 4CW1B 3ARGA 4PLKC 1QLEH 2GJ6A 4XPBH 1I75A 3QEQD 3JWDH 3ROLB 3STZA 4HWZB 1XF5A 5B39G 1SY6A 5FKPA 5J1TC 1RZJC 4A6YB 1TCRB 2AJZB 4XI5D 3UXFA 5IOPA 3LKOB 1AO7E 2DBJA 3MXVH 4L1HA 1EFXD 5IFAH 1HQ4B 3QDHA 4JFFA 1WZ1H 1CDGA 3Q3GB 1T1WB 5IVZB 4Y8DC 2X5PA 5KN5A 5JUEL 1IGIH 3ARFD 3V5HB 2APVA 2LABA 4KK9D 3TBWA 5I1AA 2X4QA 4W6YB 4XC1L 5JHDB 4KQ4L 3VXOB 2CR6A 3WFBL 3VE0A 1CGSH 2IPKA 1SBSH 2COQA 4XC3L 3T2QA 3V6BR 1KPUB 4M03A 5FYKL 1FZKA 4DKEL 1O7SA 4EVNA 9CGTA 4Z7VE 5A16B 1BX2A 4U1MB 4BH8B 3QUKA 3S5LA 3SDCB 2O5YL 3BJ91 35C8L 2X89A 1KLUB 3ZL4L 5GQBA 4Z5RB 5KS9A 3IGAA 5I76A 3D0VA 4OF6A 4NUJB 3MGTA 2Z31C 2BVYA 2QQNH 3CJJA 3GRWH 4BZ2L 3TA3D 4KKBC 5HD8D 3OHXB 2ZSWA 4MAYB 3C6SA 2P5WB 4NZTL 3DMMA 1TNMA 4X8XA 3Q5TA 2Q87A 1IILE 5EIVA 4XAKE 5GZOD 3U0TB 4IJ3B 1L7TL 3RU8H 4BFIA 3BH8B 1HEZA 2OTWA 4HIIA 3WLBA 2H3NB 2IAND 3CH1B 1HWGB 2QV2A 4RRPA 3TIEA 1DBJL 4MVBD 5F6IB 3W5NA 1IM9B 5DK0A 2IAMD 1GPOH 5HDQH 5ITBL 2XQYK 2YZ1A 2R4RL 3X11A 4GKSA 5C8JA 4F7CB 4P59H 3O2WH 2CK0L 1W0WB 4RAVB 2AJVH 2EKSB 1CFVL 1UZ6F 4OI7A 3LQAH 1Q9WA 1F2XK 2G75A 2NY6D 1JTOA 2OSLA 3OKKB 3TZVC 1VCAA 3MLRH 1FYTD 1YEKL 2MMXA 1A7RH 5IT2H 3CIQA 3F6LA 1ZLUH 4GRWE 4UV4L 5I8KH 3BZDA 4N8VB 1DQDH 5I1DB 5D7KE 1G6RA 3OKOA 2G2RA 3ZE2F 2H2PD 1E28B 4U3HA 5GRJL 5JLZB 4GW4A 4KK5D 5ESVA 1I4FA 3EYOB 2VLKB 15C8L 4MB3A 3A6OA 2ADFL 3TO2B 4F8QA 5F88A 4QRRD 3I6KB 4FQJH 5J12C 4NFBA 4WWKD 1XF1A 4DZBA 3QUMB 3QIUD 1DTUA 4UNVA 4OFVA 3OAYK 4NCC1 5T33H 4Z77B 4XPTL 3SEPA 5DRZA 5D5MF 3MOAL 3MJGX 4ZODA 1TZGH 3C2SA 5JO5B 2Z4QB 3WIIL 4QRTB 3RTQB 5FF6A 3DHJA 1XIWB 2DQDH 4XC1H 4YHKL 4KQ4H 4PB9H 1MCOH 5GS0L 3S36X 2AKRB 2AXGA 1QOKA 3WFBH 2ATKB 5HHME 4PJFA 2V6HA 4PJGB 4XC3H 1XGPB 2ITDA 2DQIH 1XZ0B 3ARBB 1OTTD 5H94B 2HRLA 3L3KB 3LV3B 3MV7E 4TN9A 3AC0A 2DQFB 4DKEH 5CBAB 1CGWA 4PGZA 3DNKA 4PJIE 4WTXA 4JO4L 3BHBA 3L95A 35C8H 3Q2CA 2H2SC 5ETUB 4Y0GA 3ZL4H 1HSBB 2DJUA 3E0GA 1FG2B 3IXAA 4L8SB 1OP3K 4NN7C 3OL2A 4DUXA 1F8TL 3BXNB 4PJHF 4NZTH 3L9RA 4PTUA 1JWMA 4FFYH 1MLCA 1C12B 3HE6C 4UOW0 4ZFFB 3T08A 1N26A 1L7TH 5D1QA 4Z95L 1F5WA 5HI4D 1SVCP 3VRLF 3IFPA 2A6IB 3UTTE 3UTOA 4CAGA 1IZKA 1LEKB 1PLGL 4GXVH 2EYSA 2A9MH 4WVRA 4U05A 3U2SA 2VE6A 1YYLL 2VQ1B 1A14L 5DURD 3N1PC 3C5ZB 4G9DB 4ENEC 2X4PB 2R4RH 1WF5A 2PXYC 1EZVY 3S88H 3T0DA 3GMQA 2CK0H 3KG5A 3WUWB 1CFVH 2A38A 2WBJB 4Z7WE 1ZLWK 5HJ3B 2HLFD 1HNGA 3IDJA 1GOFA 5EH1A 4J4PC 2AP2A 1KULA 1I1AC 4MXVF 1QSFB 5KANI 1WEJL 4I5BB 3BMWA 4UB0L 4UV4H 5F7NC 2W9DL 1NGXB 1FL6B 4KMLB 3QQ9D 5BZDB 2GEEA 5GRJH 1Y6KR 1JFQL 2CDEA 4DGVH 4KTDL 3DYMA 4ZSOB 2A83A 2C3GA 3VXME 2ADFH 4NQVB 4KZDL 4WCYL 2Z8WC 3VRIA 1KBGL 4LQFL 1NGQH 1VACB 2AJSL 1IKNA 3TT1L 4NQDA 4CU7A 5C09D 5HGHB 2HKFL 2DDQH 4MNQE 4XPTH 4D9RE 1XGTA 1SJEA 2PCPB 3FB5A 1UC6A 3MRJB 3DUHA 4FQ2L 3WIIH 1UXWA 5F7MC 4JLRA 4XH2A 2GSGB 5BCAA 1N64L 2VDNH 4ZDHA 2HVJA 4Z6AT 3M8OH 3VXUA 4P99A 5GGSA 5GS0H 4MJIE 1S78C 4L3CB 4FTVD 1A4JB 1F97A 1T2QL 4JY4B 4K07A 3O4LD 4N0FA 4R9HA 2R56H 5IW1B 4F2MB 2C5DC 4MA7L 3S6CA 3MLZL 4TTDD 4ZTOL 2CDFA 3K8LA 1UENA 3C87A 4JM2D 5IVXE 2YPKB 2XYCA 4RBPK 3IJHB 4UT9L 3HLAB 2APTA 5EBGA 3WXVL 2AQ3A 4GSDL 4XHJC 2MKWA 2HWZL 5AZ2L 3SKUD 1OAYH 1ZHLB 3SKNA 1BVLB 1NQBA 2HJLA 1QEWB 2H26B 2QHRH 2R2BB 4FHBD 4M93B 2DWEA 5TE6H 1F8TH 4XCEB 5DVKA 3RY4A 5E9DD 3TO4C 4N0CC 2CPCA 1ROWA 3UP1A 5DGQA 1RU9L 4R4FL 2AXHA 4QT5B 1JV5B 1TMCB 4P4RB 1JYXA 3MRLB 3IDNA 2XKNA 2DWDA 1J8HD 3AAZA 4RCAA 1M05B 2WBWB 1UG9A 3O81A 5DWUH 2X4TB 4Y5VA 3QFJE 4YO0B 4DZ8B 2AV1A 1UM6H 1YYLH 1U8IB 1A14H 2NR6C 4WTZG 5IROC 1DLHB 3QI9A 3WD5H 4XPHL 1MLBA 1U36A 3M45A 4HUMB 1MHCB 5I8OH 4BH7A 3W81A 4LP5A 1NC4B 1CDYA 4H1LA 4OCMC 3DJ9A 5DJDA 3UPRA 4PP2A 4JCMA 3CZJA 1U91B 4PRIB 4ZYKB 1QNZL 1FAIL 1WEJH 3X12B 4UB0H 4AYFA 5INCA 4U1HB 5L0QB 2W9DH 4HUNB 3S3JA 3T0EC 2CLZB 5EC2A 4M1DL 4LVOB 3GEWB 1A7QH 5D5MA 4KJPD 4UT6L 5FDYA 5LGKA 2A73A 4UTBL 4NNYB 4EQ2A 2D7MA 4HLZG 4KZDH 4WCYH 4KK6D 3EZJB 3ARDA 5IHUL 2NCMA 2HMID 3GBMH 3WHXB 4PJAE 3SBWA 3O3EB 3EOBA 3S4SB 5I16B 5F1NA 4FQ2H 1UM4H 5F9JB 3LKPA 1W2KT 4Y19B 1JK8A 1Q9OA 2V2WA 2X40A 5DA0B 5IR1A 4AEFA 3QNXB 1B3JA 1U8LB 2ZUUA 3H2WA 3KPSE 4XVJL 1GSMA 4NBXB 2C3VA 4ORGB 1RZ8B 3OB0K 3VWKC 3UYRL 2DQJH 4XVSL 3VGBA 3CVHB 1HILA 4YE4L 4LCCB 1A22B 1ZT4B 1T80A 4MA7H 3D18A 3MLZH 4ZTOH 1MVFA 1X5YA 2VR4A 4JQIL 3DROA 2WNGA 3WXVH 1PG7L 1VERA 2EDHA 4GSDH 5IMKB 3SPVA 3HZKA 3F58H 2HWZH 1X5FA 1YN7A 3NA4A 4CMMB 3H9SE 3Q6FA 4MLIA 4F7MA 4PJBF 4P2OB 4KY1H 3CSGA 1FNGA 1YDPA 4W4NA 3FCTA 1E4XL 4WHYH 3MJ8A 4KVCL 5D2LA 1S7RA 4QHNA 4NT6B 1RZGA 2YPLE 4R4FH 3U9UA 2J8UE 1URLA 2Y6SC 5I8CB 3DTXB 1RZ7H 3S9DB 1RHHA 5HHNA 2ZJSH 2X1WL 1T0NB 5I6XC 5CD3A 2X2YA 4LKXA 5C9KA 5ICYB 1AXSB 1F3RB 4LSQL 1Y6NR 1OPGH 4RA0C 4M7ZB 4D0DB 3GI9L 3MLSH 1JUFA 3X3GL 4QHUB 5LGHH 2IQ9L 4L3ED 3MRPA 1L0YA 5I74B 1ZK9A 4GOSA 4J23A 3PHSA 1YQ2A 5GS0D 3GMNA 2IPTL 4X7SH 5I18L 2P24A 3MRBB 3B9KD 2HFEB 5I19L 2MQ0A 2Y07H 1KJ2B 1C1EH 1FFNA 1ZE3C 2GJ6B 1Z9OA 3BPOC 5DD3L 2X7LA 4HUKB 4ZG1A 4PS4L 3STZB 5KVFL 1QNZH 3HHRB 5FKPB 3BESR 2UWEE 1FCGA 1FAIH 3MRQA 2Z31A 4EN3D 4OM1L 4CVZB 3HRPA 5IOPB 4HX1B 3IDUA 3TN0D 4JFED 2X4RB 2VLJA 3O3UN 4MD5A 4JFFB 1P5VA 2WZPD 3HI1A 4M1DH 1JPGA 1LE9A 4OCLC 5K9QI 1EEUA 5KN5B 3RWFA 4ONGH 2UZIH 4UTBH 5LAXA 3W0WA 3QDMA 5IEKB 1XF4A 5ITFB 2AW2A 5J89A 3TBWB 5I1AB 4XB7A 4ODUA 4EEEA 2GTZA 3VE0B 3GB7B 2IPKB 2Z9TA 1FL3A 3F7VA 3VD9A 4X6CE 3EO1A 4HK3N 3O2VH 1TJGL 2DQCL 4ZUWA 1FZKB 4BFGA 1ADQL 3CSBA 3X14A 4OCXL 3S3PA 2F9BT 4FQXD 4UI2A 2XICA 3BZ4A 3UX9B 1BX2B 3CFEB 2D0GA 4P2QD 4K2UH 3QUKB 3S5LB 4U4BA 2AQ2A 3DVGB 5ACLA 5C6WH 3W11D 4XVJH 1NKOA 3CMGA 5KS9B 3IGAB 3D0VB 1CE6A 1DE4A 3MGTB 1L4IA 3UYRH 4XBPA 2DYPA 1M7XA 4YE4H 3VXSB 2NY2D 1NBZA 3ARSA 3DMMB 3TZVA 5KJRL 3HA0A 1KCUL 4M62L 3KWWA 1DN2A 4AIZA 1PG7H 1PZ5B 2EIZB 4BFIB 1FVDA 2EIDA 4FG6C 4M02A 1RI8A 4LLMA 1AGEA 1HEZB 4OCSH 3WLBB 3HMWL 4ODXA 3TIEB 4P46C 5I30L 1E4XH 3O41A 2GT9A 2MHAA 4KVCH 5FXCH 3BKCH 5I1EH 1BP3B 1I7TA 1IAKA 4JFDD 4O2FA 5E70A 2JCCA 5DK0B 4UIKL 5F9DC 4JY5L 1IGFL 4G8GD 3H3KA 1OGTB 4NKOA 4GKSB 3OXSA 4HWEL 5C8JB 4LSQH 3NGBC 3GI9H 1F6LL 4P5MA 2VH5L 1E4XI 2EYRB 2CO6B 1FZJB 1TQCC 4WFHD 3IKKA 3PE9A 1M6OA 2V7NA 2IPTH 3VFUB 5BXFA 5L9DL 2A6JB 4S1RL 2VDRL 5T1DL 5C07A 4POUB 4YBQD 2GTWA 3O3AA 1G6RB 2E7LC 1KPVB 4X6FB 4HV8A 3G5VA 1BBDL 4P57A 5ESVB 1I4FB 3MBEC 5DD3H 5I1JL 3TBSA 3FOMA 2M26A 3U7YL 3V2AR 2XRAL 5KSBA 1N8ZA 3CFCL 1A3QA 4WHCA 4DZBB 5DJ8A 5HDOA 2JB5L 4WWKB 2WK2A 1H8NA 1VGKB 3HPJA 4X5XA 3T1FA 4RFEA 5E8PB 5FV2A 3RGVC 3MLTA 1YYMH 1XR8A 2MCPL 3HE6A 4HJJL 3PJSA 5CJXC 4LLUA 2EH8L 3EYQD 4KK8D 3W9EA 4OZGA 5KOVC 1YPZA 2DJ4A 2AXGB 1I3VA 3WS3A 3MCKA 2H1PL 3MUHL 4I4WA 1AGBA 4PJFB 3AGVA 4E41B 4EUPA 4AH2A 5BVJA 4M4PA 1PYWA 1YEDA 4MD0A 1TJGH 2VDQL 5J6HA 4ZFOL 2K7PA 3FOLA 4W6WB 1OARL 1A6PA 1X5HA 2PO6C 3GMLA 1RJZA 3BHBB 3L95B 4NRYA 5D6CA 3LS5H 2A2QT 1HYSC 4AEEA 5DMYA 2AK1H 3QEGL 2XOTA 4NQCE 1U8PA 3HB3D 4IRSC 1SYVA 3S35H 1U8MB 3IXAB 4Q9RH 4W70A 5F6HJ 5BV7L 5ADOL 2F54E 5ADPL 4J4PA 1B4JH 2E9BA 1N2RA 1I1AA 3D69B 4PJBA 3RBGA 1V7NL 3S36L 5ID0A 4PTUB 1KCUH 1JWMB 3NIGF 1MLCB 4M62H 1QRND 4KROD 4OIIH 4WO4D 5TE4L 5GPRA 4Q97A 4MDIA 5TE7L 2KH2B 5D1QB 1NKRA 5EU6D 5C0AA 4XMKH 4U33A 1IE5A 2CUMA 3K1DA 5I30H 3GSNB 3DOSA 2EYSB 4N1CA 3ZYJA 1S7SA 1BFSA 3ZDZE 3TFKD 8CGTA 3CSYB 3AFLA 3DUUA 2GAZA 4MNHA 4UIKH 1I9RL 3MJ7B 4JY5H 1IGFH 5CJQH 1MNUL 4LRIC 3C9NA 3NZ8B 2FLRT 2W0FA 3M1BA 4I2XE 4NO2A 1P2CA 3IFLL 4TNWK 1I85C 4KRNA 2NZIA 2ZCKH 2LU7A 3MTRA 2HTLC 1CIUA 3L3GB 1D3CA 1U95A 3FAWA 1KPRA 4HKBA 1OP5K 3TM6A 5CINH 5F93C 4YXKL 2IALA 3WLWD 5C0CD 3MODL 3DO3A 2AV7A 5L9DH 4S1RH 2VDRH 1C5DA 2OK0L 4P9MH 4V2BA 1NDMA 4X6DE 5AYUL 4S10A 5DHXB 5EO0B 4PRHD 1BBDH 5I1JH 4DOHB 5HYQA 1KT2A 2NY3B 3SKJH 3U7YH 3QULA 2ZOLA 4KDVA 4FFWD 2XRAH 4YDVA 1HN1A 4K7PH 1QLFA 3KVQA 3UTQA 4U3XA 4XCYB 4C56A 5I15L 2V2TB 4R90H 5IBTL 4HIJA 2BP3A 1TVHA 4ELME 3FB5B 3RL2A 3HAEG 3TO4A 4Y16B 1YMMD 2MCPH 4P23C 4HJJH 4LIQE 3OTTA 2EH8H 3ULSA 1OD7A 4R7NB 5EPMA 2HVJB 1MFEL 1KB5H 5EBLA 4H0GA 2UUDK 4YXLL 5GGSB 3KPTA 5KSAD 4HGMA 4KI5C 1PW3A 3C2AL 2H1PH 3I6LE 1OSZA 5EOTA 1ZHKB 2MKLC 4N0FB 3KLHC 4QF1A 3FRUA 3DXAA 2VDQH 3L1OH 3T4YA 3E8UL 4LHQB 1OARH 1RIUL 3CSPA 5BRZD 3FT3A 3QXAB 5FAAA 5IROA 2B5IB 4LSUL 3VU2A 1X7QB 5CHNA 2VZ3A 5CP3H 4ZOEA 3PWJB 5LKNA 1NUNB 1UB6A 4PIRF 3QDJA 2NTFA 4HS6A 3F7YA 4S2SB 3SKNB 1X3DA 4CNIB 3UDWC 4XNYH 2DM7A 1DL7H 3MO1A 4H8WC 5FDWB 4FFVC 4K9EH 3AREB 4GKZA 3T0EA 2DWDB 1Y0LA 3LD8B 3P0VL 2P8MA 3AAZB 2YXMA 3TV3H 2BNRA 5DD1L 3UTPD 3QZWG 1DLFL 4Y5VB 4NN6B 3B9EA 5B22A 5K9OA 2AV1B 2EEAA 1AR1C 3DHMA 3ULVE 1HH6A 5JZ7D 1IQDA 3N06B 4UAOB 2HTKD 4UZGA 2CKNA 1WFNA 2H32A 3QI9B 3Q1SL 1RAMA 1MNUH 4ISVA 3EFDH 1I3GL 1MLBB 3P77A 1CICC 3IFLH 4HBCH 5DEFA 3K0WA 2NYYC 2XN9E 4CN6A 4LMQI 4K23L 1U3HC 2FSEB 1JNNH 2FH8A 5DJDB 1NCBL 1ADQA 5MERB 3T3MF 5HYIA 3RKDD 3GBLA 3OJDA 1IKFL 2JIXD 1QQDA 4HAFA 1S5HA 1BQLL 1RHFA 3VWKA 3HUJB 1NEZA 3MODH 4W6XB 4HT1L 5BVPL 3U0PA 4M5YL 3WEXA 5IVNA 5AYUH 3CDCA 3PQYE 3RWEA 5EC2B 1GZPA 5D1XC 3QDGD 3DV6A 2CJUL 2A73B 1LDPL 1WIOA 2PW1A 1A8JH 3HG1A 4AIOA 3NIDF 4P5TC 2XTJC 1I9EA 3MRDA 1B0WA 4J3VA 1MFCL 2D7QA 4O58L 3LB6D 3A6CL 3QG6B 1N5YH 4XTRC 5IFJA 5IBTH 2D7TL 4TUKL 4MHHI 1WC7A 2BJMH 5E2WL 4MNGA 1ACYH 3EOBB 3ZDXF 3H6JA 5FYLH 1A6UL 3O6KL 4TOYH 4EJ1C 4H88L 1JGEB 3LKPB 4N0UE 1JK8B 1NSNH 1Q9OB 2PKDA 1ZLVK 2ED7A 2Z8VC 1D5IL 2UYLA 4JKMA 4JO1L 4XP1H 3VGAC 1MFEH 1UCBH 1P1ZB 4YXLH 1ND0A 2C3VB 3BKYL 3FRPA 1KC5L 3ZE0E 4ZOAA 4M7JL 4KAQH 1HILB 4BK5A 4FQHA 5EZIL 2OL3L 5IKCA 3E8UH 1RIUH 7CGTA 1ORQB 1TLKA 4LSUH 2P8LA 4BKLA 5E7FA 3SPVB 1I1RA 1YN7B 4HXBL 3D85B 2X09A 3C09C 4B7IA 3Q6FB 4F7MB 2X42A 1FNGB 1YDPB 3LZFH 3MJ8B 3HZMA 5D2LB 1JL8A 1HHJA 1S7RB 1CL7H 4PG2C 4QHNB 1J88A 1RZGB 1UFUA 3QEQE 25C8L 3ARGD 3HNVL 2LV4A 4MQSB 4HC1L 1EZVX 5M95B 1VKXA 3ARTA 5CD3B 1TTFA 4LKXB 4OAWA 1PVHA 4FMKA 2I27N 1YEFH 3LMJH 5DD1H 3AUVA 3X3FL 2E3VA 4EI5A 1JUFB 4HGKC 4NRXA 1D7FA 1VFOA 3MRPB 1CL7I 4OZIF 3HE7C 3K1KC 1WBYA 3BN9C 4KUZL 2APBA 2HG5B 3U0WL 3ARPA 2EE3A 1LDSA 1RULL 4RAUA 4V1DA 2Z35A 1I7ZA 1FFNB 2W65B 4K23H 5DTFA 5GGQL 4HJ0D 1SBBA 2X7LB 1NCBH 3VFRA 4KI5F 5T1KD 4NBZB 1IKFH 3SDYH 1J1OH 1LP9F 1RFDL 4XWGL 4MJ6A 5DK2A 1FNSL 3ZKXB 2CQVA 2Q7NA 5EUOA 4FFZH 3NACL 2B0SL 4X4YA 1I9JH 1RK1B 2DICA 4M5YH 1FH5L 2VLJB 1WTLA 3H42L 5ACZA 3IJYA 1JPGB 4PJEE 1LE9B 1KB9K 1R24A 1A1MB 5FGCE 5C7XH 1R5WA 2XXMB 1LDPH 5LAXB 2MNUA 3W0WB 1XF4B 5CJ5A 1NFDB 5DD0L 4JRXA 2GUOA 5TGBA 3V52L 5DO2C 3MQIA 3MV8A 4O58H 2GTZB 3A6CH 4AEIH 4JRWA 2D7TH 3EO1B 4ZUWB 2IANE 3MFFA 1HZHL 4BELD 2P5ED 3BZ4B 1IVLA 1D5IH 3D0LA 1EBPA 3CLEL 2IPUK 2Z93A 4L4TA 5B4MD 4CDGC 1I1FB 1CE6B 1DE4B 2HT4C 2DM3A 2DYPB 4M7JH 5EZIH 4P3CH 1FGVH 5ISZE 2OL3H 2OXGA 3SCMC 2LE9A 3TZVB 4NHCL 2IBZX 1I9IL 3LKSA 4PRBA 2YPVL 4PRPE 5DUBA 3KWWB 5ELIA 5F7EH 3DETD 1S9VA 2FZ3A 2UVFA 1FVDB 1FYTE 2E7LA 4HXBH 4LLMB 1AGEB 1AIFB 1EEZA 4OGAC 2X4UA 5DZNA 2MOVA 3EAKA 3MBEA 3L3JA 2CXGA 4HW6A 3O41B 2MHAB 1U8OA 4PJ7B 1ZLVH 1BIIA 1IAKB 2XPGB 4O2FB 5IMOB 2JCCB 5TDPA 2BCKA 3TWCL 3UPAA 5J12B 1SEBB 4P2RD 3HNVH 3QRGH 4JKLA 4QRRE 3SGEH 1BD2A 3WUWG 3RGVA 1F58L 2I9TA 5SWZA 1Z2KA 3VI4F 1CYGA 4NQSB 2R69L 5FYLD 2BX5A 5EZOL 5CJXA 3X3FH 4P5MB 3PHOB 3SDDC 1U8KA 4D0CA 5DR5L 2VN4A 1OLLA 5GS1B 3K7UA 1U6AL 4WFEE 2OR8A 1M6OB 2P8PA 2V7NB 4G6FB 4KUZH 4R26H 5HGDA 4I9WD 1DBBH 4DUWA 3IF1A 4GBXA 1FORL 3SGEI 2GTWB 1IM3A 3B3IA 4L4VD 2AS5M 4HV8B 5DEGA 3NPZB 4ZXBC 4PJDA 3ET9F 4IEFB 5GGQH 1ZSDB 2PO6A 2AABL 3TBSB 4OV5B 3B2UC 1CD0A 4U6HA 4XWGH 4JKWA 5KSBB 1N8ZB 2Q7YA 1FNSH 1MCJA 4IIQB 2QQKL 4TNVF 5DJ8B 2NY1D 1NCWL 3L5IA 3PG2A 5FA4A 4IRSA 5DJYA 5FK9A 3RVUC 3H42H 5I9QC 4O02L 3HPJB 3Q5YA 3BEVA 4X5XB 2NXYC 3T1FB 1UJ3B 4NN7B 3MLTB 2V5RA 1NFIB 1PDKA 3MLPA 1YMHA 5DD0H 1ES0A 4OLYL 2YUXA 3W9EB 4OZGB 1YPZB 4NQEA 1BZ9A 3MV9D 1Q1JH 3O6FD 4MZ3A 3P9MB 3WS3B 3SQBA 4DJMA 3QWOA 4FXLA 1TCMA 5EFIA 5JDSA 1AGBB 4HIXL 4EUPB 4AH2B 4CU8A 3U46B 4Y2DC 1YEDB 4MD0B 5EZLA 5J6HB 1BIHA 3FOLB 2EDJA 4GAYA 4Z8FL 1MQKL 2HAZA 2VDPL 3HC0A 1XGRA 1Q9KA 4NNPH 5D6CB 4KI1A 2VLRD 4LRIA 3CLEH 1ZT1A 3FQUA 5EZJB 2Z0BA 2JK5A 3MREA 4R4NC 2H8PA 4LVHC 4ZNEE 1QR1A 5EUKA 4Y4FB 4LEXH 1U8PB 2HH0H 1CFQA 1I85A 4ZTPL 1B2WL 1IC1A 3ZT7A 2BVUA 4PJ5A 4LDOB 2KDGA 1E4WL 2OXHA 2NY0D 5GJTL 2IGFL 3KPMA 1N2RB 4I0PC 2VZ1A 4W4OC 4NHCH 1I9IH 3OKEA 2EXYC 4LVEA 5ID0B 2EIEA 5IUSA 2NY4C 4F9PC 4MMZC 3PABA 4MDIB 4KROB 4QHKI 4F9LC 4G9FA 1LK3H 3B5HA 3OX8A 4NOBA 5HSFA 3FONA 5C0AB 1K2DA 3O6LH 5EO9A 4OUUA 2EXWD 1C08A 4U6YA 5I2IA 5C3LD 1XF2A 3P11L 1MAJA 5DC4B 4UQ3A 3WFHB 2CO7B 1X5LA 1WITA 1S7SB 3FQWB 1P7HL 3P4MA 3GHEL 3TWCH 1FLRL 2GAZB 1INQA 3HZVB 1NMAL 3CFBA 2JLLA 5FOBB 3TH4T 4X7EC 3VJ6A 4JB9L 1AD0A 3C9NB 4OZIA 3S37X 2W0FB 3M1BB 3MYJA 4NO2B 1F58H 1RZJH 1BZ7B 1A6TB 3B2VH 5GRVK 3QUXD 2E9IA 4L8DA 1MCPL 3PV6B 3S3SA 4P23A 5ESAA 4NQDD 3RHWF 1KLGB 1JPTL 1VEOA 2FLBT 2NX5A 5D4QA 5GZND 5DR5H 3VD5A 5HPMB 1HSAA 1KB9J 3ZDYF 2D4DA 1U6AH 3O9WC 3KS0J 2DL9A 2X1OA 3WNLA 4LSVL 5J56B 1LP9A 3VDBA 3I9GL 2BSTA 1C5DB 2J1KA 4FTVE 4NKDA 3VXUD 4OZHF 3S96B 3MA7A 4POZD 3O4LE 3O0RH 4OQTL 2JJUA 4I48A 3ARYA 2N4IA 4Y89A 2AK4A 1KT2B 3SKMB 4DFHA 3I2CL 3QULB 2O93L 2E9WA 2HFFA 4YDVB 1QLFB 2QQKH 3UTQB 3WO4B 4C56B 3RL1B 3PGFL 5CGYC 3UDWA 3OZ9L 1CLOH 1HOCA 1TVHB 2OJEB 3RL2B 3UROR 5JQ6H 3TO4B 4C4KO 5EU5A 4XT1C 1HIML 4MLSA 4X4MA 5K9JL 1WAAE 5K59E 1T6WA 4CDHA 5LWYL 3ULSB 5E9DE 4ZNCD 1AI1H 5EBLB 4AM0B 3B9VA 3QQNA 1JPSL 1S7TB 1JPST 1AXTH 1FC2D 5FKAA 5L8JB 4HC1A 1FNLA 3NTCL 4DAGL 2CDGB 1NBYB 4PBXA 3TP4A 4Y7MA 1JZ5A 5EOTB 1J8HE 4GG6F 3FRUB 2FRGP 4WUUA 4Y5YC 5KTEL 3G6JB 3T4YB 3FB6A 4PRNA 3LVEA 3P3YA 3FT3B 2VDPH 1ETZB 2CIKA 1L9MA 3CLFL 1UKTA 3A0OA 1IEAA 5CHNB 1QSED 1N0XL 5LGJB 4AENA 5C0RL 4FQ1L 1M7IA 2NY5H 3WE6A 4OGXH 1CICA 2BVQB 4HS6B 3F7YB 4GMTL 1U3HA 2EE2A 2AJ3B 3RGHA 3OMZA 1MCSA 4YXHH 1EBAA 2BNUA 3TVMC 3WHE1 4HDIA 5ESQA 3LDBC 5E4IA 5D7JC 1JZ7A 5CD5D 1JHTA 4GKZB 1HYRC 1MY5A 3C08L 1RIVH 3T0EB 1MAKA 1QPPA 1NGYA 1Y0LB 5KSVB 5D1XA 3AMLA 1KCRL 2ARJB 2NW2A 4P9HH 2BNRB 4KTEL 5H35A 1IGMH 2FWOA 4P5TA 3O8XC 4OFPA 2EDEA 2YD6A 3ZE1E 5D8JH 3DSNA 4UDTA 1NCCL 1NMAH 2H32B 2YUVA 4ISVB 4P0DA 4JB9H 1GC1C 2JJTA 2VDMH 3P77B 1UACH 4ETYA 2EEBA 1F02I 2ORBL 1MCPH 1D5BB 4HK3J 3ARDD 3PL6A 1R3KB 3UZEA 4DGYL 2J2ZA 4XPAL 3PWPA 1TVDA 1ZEAH 3QRFM 2R2EA 3OJDB 3JSSA 1QQDB 3K4DA 2DJSA 3FL7A 1S5HB 4R7DA 3EYUL 4HKJA 3KYMB 1KOAA 5GGTA 2W38A 2FGWH 5DMGD 1NEZB 4LSVH 1ZWIA 3IYLW 2AERT 3U0PB 3I9GH 1P7QD 5BZWA 4UNUA 3WEXB 1JI1A 3VMOA 4GRMA 5JOEA 1FIEA 3QXTA 3RWEB 1NC2A 1KCLA 5T3ZD 5C08A 4OQTH 4Z76A 1I3RA 5T5FH 5HPOA 2DN7A 4K94C 5E6ZA 2PW1B 3ZTJH 3WS6A 1E6JL 3HG1B 4MAUH 3I2CH 1T04B 3QIBC 2W1NA 3C60B 1R3HA 2DAVA 4QXTB 4ELKA 2EDOA 3RZWA 1MCCA 3UZVB 3TCLB 3V7MA 2N56A 3H9ZA 4OTXL 3S7GA 5IFJB 1L9NA 2L7JA 2L7UA 4TSCL 1WC7B 1M1SA 4MNGB 5MENB 4UTAL 3IDXL 4PG2A 5K9JH 1HIMH 5I75B 1WGOA 3P0GB 4NZRL 5D7SL 4GG8A 3CPLB 4BSWA 1JGLL 3TNMA 2N1KA 2PYEB 4IDLA 2VQTA 4OZFH 5I6XB 3V5KA 1ND0B 3OF6D 3NTCH 1MCEA 4P3DB 4DAGH 2EDRA 5DRWA 3IDYC 4GRWH 5F9WC 4YIQB 4X80L 4CBPA 5IKCB 1A0QL 1IAIM 4MCYA 3IFNH 3HE7A 1T1YA 3FN9A 3MYZA 4XNQB 2P8LB 1KCSL 3T0XA 4I3SL 4L3EE 4YHZH 4ZPTA 5K93A 2OZ4H 2QR0A 5E00A 2GCYA 3FZUC 4PPTA 1O7VA 1U2HA 3FB7A 3BDYH 5BW7A 2YOCA 2XG5A 5C0JA 1ORSA 2ZUXA 3BPOB 3EGSB 4UILL 2BVPA 3MGOA 4LF3A 1AY1H 3HZMB 3WFCL 2QHLA 4P2CG 4N0RA 3UJJL 3U36A 3ZMRA 4LCUA 2WMPA 1VKXB 1KEML 4DVRH 2FJGA 3G04B 3FTGA 2V9TA 4JFEE 3V8OA 1MFAL 3GO1L 2R2HA 4KTEH 4Y5XC 5FO7A 2Z31D 5DJ2B 2APXA 4EI5B 4KKBD 4NRXB 2ZUYA 4J2XA 5ABDE 4WI3A 4YDJA 2GSIA 1NBVL 2OX5A 1CXHA 1WBYB 1K4DA 3LHPL 4ZUTA 5IHBA 3QDMD 3WDJA 4NWTL 3ULUC 4RAUB 2Z35B 3IS0X 2DB8A 1KN2H 2CGRL 2ORBH 5E6ID 1QZ1A 1JNHA 1NUDA 1P53A 3IXTA 5DTFB 4XPAH 4DGYH 4IMKC 4OZHA 2XZZA 5DMIL 4ZFOB 3W2DL 5E5RB 4NJ9H 3SOBL 2J3SA 3EYUH 3KPQA 5J6GB 4MJ6B 4F58L 4P2QE 4PBWD 5EUOB 3R8BB 4KKAD 4YR6A 2F53A 4X4YB 1FJ1A 1G7IA 1T6VN 5ACZB 3SCMA 1I8LC 3MUZ1 3IJYB 3NAAH 5JORB 1FP5A 1AO7A 5BV7B 1IC5H 1HH9B 3PP4L 1R5WB 3MCLH 1E6JH 3GSOA 2HVKA 3ARVA 2GUOB 5EIIA 4C57C 5J7CC 4OB5L 3MV8B 2IWGA 1HHKA 5MP6L 1FVEA 1KSRA 4OTXH 2EDDA 3DV4A 5SV4A 4TSCH 4WI7A 4LLVB 4UTAH 3IDXH 1FAKT 3JTSA 4ZO6A 4JANA 3MFFB 1QKZL 4GG6A 2CMRH 4R6UA 3D0LB 1JGLH 4JFDE 1QFWM 2Z93B 5C0BD 4MX7A 4Z7VA 3SHSA 2W59A 4Z7NE 1R3JB 4L4TB 5IBLD 4G8GE 4RDQF 1LEGA 3OAUL 4JFHD 5GRXG 1CTOA 1YECL 3REWA 3BJLA 3SDDA 1A0QH 1IGTB 5ALCL 2EICA 3K80A 2F58L 5GRUL 4PRBB 5DUBB 2VUYA 2YN3A 1LO3L 1KCSH 2XKSA 4I3SH 3ARXA 4JZNA 2YA1A 1KGCD 4WFHE 1M71A 1S9VB 1ULVA 4HCRL 3WFZA 1GOHA 4QLRA 5SX5H 4RWYH 2FH6A 3OB8A 5BOPA 1EEZB 2M8XA 2X4UB 1IC4L 5KVGL 3VXRD 4UILH 1MCDA 1U8OB 3G5ZB 4NM4L 3VXNB 3WFCH 5HGBA 1E4JA 1BIIB 1YZZA 5TDPB 2BCKB 3K81A 3UJJH 1KLFA 4PJGE 3N9GH 1E0OB 3MV11 2CD0A 2V5YA 3RWGA 2VNCA 3GHBL 4G8IB 1BD2B 2H2SD 1KFAH 2ADJA 4ONOA 5SWZB 4PJCB 1OTUC 5I1CL 1DEEA 3BEWB 4DCQA 1U8KB 4D0CB 3FO9B 1JF6A 4ZS7L 4HG4K 1GVIA 1PX4A 1X44A 2P8PB 2YN5A 5E99L 3BKJL 3HE6D 1KEGH 3OPZL 1J1PH 5HGDB 2QQLL 1IGYB 2DQGL 4Y2DA 4NWTH 3IF1B 4GBXB 3GJFB 5FCSH 1IM3B 4I13B 4UU9A 4J8RA 3VFPA 5DMJB 1AD9B 4HKZA 4PJDB 4NO3A 2PO6B 5DSCB 4HS3B 3BZFA 4L5FL 3RWDB 3W2DH 1IC7L 5C0FB 3FMGH 4M3JA 3SOBH 2BHYA 4U6HB 2Q7YB 1OY3B 2W60A 5FK9B 4IRSB 4Z7UB 5DJYB 2OYPA 1V3KA 2YZ8A 5HHXL 3I75A 3I3BA 4RSVA 4ENED 4YQXH 3BEVB 4K55A 2Q6WB 4I0PA 4W4OA 2PXYD 1DSFL 3VFMA 3B4NA 5F1SA 3KXFD 3PP4H 3TNNB 2R1XA 5IJVA 4F9PA 1YMHB 1LD9A 4NRZB 4JRYB 1ES0B 1ZANH 2H45A 4LLDA 1IAIL 3IKCB 4OB5H 1LMKA 2ARWA 3D2UD 5FUCC 1QRNE 1BZ9B 1I1AD 1RZFL 4B0MM 3QWOB 5JDSB 5EU6E 1XIWC 1LO4L 3BP4A 1EEYA 3VFNB 3HR5A 1QSFE 4X0KA 1QKZH 3FB8B 3MLVH 3RDTB 1IEBA 4GAYB 3EUUA 5HYJA 1Q9KB 3UO1L 1OGAA 3ARBC 1FO0H 1ZT1B 3FQUB 3IDMA 3MREB 2JK5B 4PJIA 4Q9QH 2H8PB 3LPWA 1BAFL 3KPNA 4C83A 5EUKB 1BEYL 3CXDL 1YY8B 3VFOA 3U7AA 1LO2L 4XP6H 2R4SL 1KTLA 4PJ5B 2DI9A 4M61A 2BY3A 4PB0H 1JCKA 3KPMB 4ODVL 4Y4KB 3O9WA 4CL7A 2RJMA 4QYOA 4FMFA 3ULUF 4HHAA 2V7HA 5D9SB 2XZAL 2ZUTA 2VXVL 3CFIC 1S8DA 4MD4A 2IMMA 1I7UA 4G9FB 3OX8B 3FONB 1K2DB 3L7FB 4LOUC 4OUUB 1C08B 5C0CE 3EHBD 4POYA 5F21B 5I2IB 1SQ2N 1G7MB 2FO1A 1IC4H 5KVGH 5CIPA 2ERJB 1MHPL 3VFWB 1J86A 1Z5LB 3CK0H 4NM4H 4PRHE 4N5UA 3UTTA 5DMKA 4LK4A 4LKCB 3P4MB 4XP5L 1NGPH 4HGWA 2XZQL 1CS6A 1EIBA 1INQB 4XAWL 2HT3C 4PJ9D 4YHIA 3MNWA 4NQXA 4GKOA 1O5DT 4YBLC 1AD0B 1UZ8A 1YNTA 4NWUH 4OZIB 3MROA 5FUOL 3TH2T 4FZEH 5DZOA 1EEQA 3MYJB 4L8DB 4RAHA 3C5ZC 4XNUL 4P23B 4QXUL 1KN4L 5ESAB 5I1CH 2NX5B 3T2PA 1PBYA 1HSAB 1YMME 1JRHL 4Z7WA 5F97E 3T65A 1WISA 2WBJC 5IEHA 3BD5A 5E99H 4QOKD 1LP9B 2QQLH 2BSTB 1K3ZA 1OTSD 4NKDB 4Y5YA 3LOWA 1B88A 5EULV 3MA7B 1YEHL 2OL3B 5HHVH 4GAGL 5HDBE 5SWSA 3S37L 2GI7A 1X5XA 1FNAA 3GNML 5BRZE 5IHZA 4WTWA 4Q9BA 3VXMA 3BUYB 1UJTA 1JZ2A 5HHXH 4NYLA 1QFWL 5DHYA 1U93A 3UZQA 3W9DB 1HOCB 3TVMA 5EU5B 5I66B 5DXWA 3D87B 5KANG 5DS8A 5D7JA 5DJ6A 3QDJD 3C6LB 1S7VA 3SY0B 1WTGT 4BFEA 3H3PL 4UT7L 5IB2A 4RGNB 5DF0A 3H3BC 2B1AH 4MJID 4KRPC 3WIFB 2D4FA 3CD4A 4ZD3H 2CKBA 4EDXA 3O8XA 3KJ6H 1PQZA 4WUUB 1V3JA 2VLME 3FB6B 4PRNB 2AEWA 5GRWA 1NLDL 4IMLA 1IEAB 1BFTA 1BQHB 3WE6B 1BAFH 4LSSL 1CICB 1F90L 1R3LA 1BEYH 3NCYP 5JXAL 3D48R 1LO2H 4OD3L 1V5JA 2R4SH 3WKNA 2BNUB 3GSXB 5FHBL 4ODVH 4HDIB 3E2HC 5F8QC 1PY9A 5ESQB 3AMKA 4K7PY 3MJ9L 4CJ0A 3FN0L 4KUCF 5CEZH 1JHTB 2VXVH 4QEGA 3RIAF 3RZCC 4FABL 4M93C 4HG4J 3PDOA 2DKSA 2PNDA 1BOGA 3MR9A 1NGYB 2R23A 4HH9B 3BP7B 4O5LL 1HCVA 4M9OA 3GMMA 1J0JA 3VWKD 3RWJA 2FWOB 2I07A 4PJ8B 2YXFA 1A6AA 4P5TB 3QDGE 3QIBA 3L3DA 1RIHL 2RBLA 2VWEE 1U42A 2IBBA 1NGWA 3MUJA 4H20L 2J12B 4UDTB 2HN7B 4UDUA 1OW0C 2O61A 3RIFK 1JF1A 4JFXA 2OM5A 4OLXL 5FUOH 4M00A 2ICEB 2EZ0C 2BSSA 2XWBA 1ITCA 1JWSB 4XNUH 3U4BL 3PL6B 4QXUH 3LQZA 3FT2A 2VL5A 4LAJH 1HI6A 4PYHA 3PWPB 1DFBL 5FM8A 2R2EB 4LCWD 2VAJA 1LE5B 3SJVD 3M07A 1H5BB 4R7DB 4HKJB 3IVKB 4ONFH 5FIEA 1U8NA 2Y6SD 1ZWIB 4Y1AA 4FQQA 5BZWB 4GRMB 4EXKA 1NC2B 4YDKL 2QADB 2YD8A 1YEHH 5C08B 4Z76B 2AJYH 1XH3B 4QRPA 2IF7A 4IRJA 2C7UA 2XNAA 1R3HB 1UGNA 3DIFA 4ELKB 2ZNXA 3FQXA 4QTIH 1QFWH 2E6PA 2HRPH 4R96B 1HINH 1JI2A 3VFTB 1WZMA 1EA9C 2VZTA 4YX2L 5IGXL 3HR6A 2BC4B 3TNMB 3MZTA 2X05A 3H3PH 2AI0L 4UT7H 5CILH 4YUEL 1SEQL 3V5KB 2JJVA 3OGOE 4DKDC 1Z9SA 3MLUL 1CT8A 3KPSA 4OLWH 4Y5XA 2HYMA 1QFWI 3BAEL 4NZDA 3A67L 3TIDA 3SDXB 3LRGA 2H9GA 4MCYB 1T1YB 1NLDH 5H37H 4LCCC 3R1GL 4WEBL 4OM0L 1Q0XL 3QZWA 5E00B 2GCYB 4LSSH 1MCKA 4PGBB 1F90H 3FB7B 5HHOD 5JXAH 5D7IB 4JR9L 1KYOJ 1ODAA 3QCUL 3VMNA 4CADA 1F2QA 4HPOH 4KJWC 4IMKA 3H9SD 3IDIA 4Q58C 2BVPB 3MACL 4LBEA 4LF3B 5FHBH 5BMFL 4WUKL 2WP3O 5CZKA 2BDNL 4HKXB 4ZS6C 1XAUA 4ODSL 4P2YA 4V1DD 2IBGA 2DTSA 4LIQL 1UCTA 4LCUB 4P2OC 3TYFA 1FZMB 3ROLA 1K3IA 2YPLA 4HSQA 2F74B 1I8LA 2A77L 2G60L 5IFHH 3DI3B 4O5LH 3QUYA 2WV3A 3D3VA 5ANMB 2R2HB 5FO7B 3LKOA 3FJTA 2CRZA 2R15A 5KS9E 1RIHH 5E08H 1UM5L 4YDJB 4JZOA 5IVZA 4H20H 4TNVK 5IJKC 3AS2A 1PX3A 3CXHK 4OLXH 5HI3C 4PLJC 4JRXD 5I74C 5IQ9A 3VXOA 5I1HL 3U4BH 4YHPB 1JNHB 2CRMA 1UWXH 2OS7A 4LVNB 4YZFF 1DFBH 2ZUWA 1KPUA 3OJVC 2MTPA 3UTSD 2P5EE 4P46D 5DFTA 1KIRA 3KPQB 5HI5C 3PDDA 4G7VL 5F96L 4V2CB 4BH8A 3PP3H 2W91A 3HPLB 2Q8AL 2E7CA 3WDHA 2DD8H 4WHYG 4U6XA 3SCMB 3VD4A 4YDKH 3LH2L 1AO7B 4OJFL 2DQEL 5AWNL 3GSOB 4XI5C 2HVKB 5CEZD 5EIIB 3TBVA 3WMSA 2RR3A 2J8OA 3ULVL 1GGBL 3QJHA 3IFOA 1N6VA 1HHKB 1CN4A 1FVEB 1OQOA 3HNSL 5DFVC 4N1EA 3ARFC 4ZAKD 5BS0A 4RFNB 5KVDH 4KK9C 5TFSL 4J3SA 1H15A 1MCIA 4CKVX 4YX2H 1KTDB 3EYVA 3JTSB 4JANB 5IGXH 5I1GL 2H3NA 1KCVL 3QQ4B 2P47B 2WP3T 2XZCH 3FFCD 5FUZL 4OZ4B 1JNLL 1NFKA 2WM0A 2LTQC 3MBED 3GSVA 4MX7B 4Z7VB 2AI0H 4P2RE 4YUEH 1SEQH 3UYPA 3P30L 5B8CA 1U8QA 5K9QG 1LEGB 4O51A 3U1SL 4KV5F 1AKJD 4ACPA 2F5BH 3N85H 3BAEH 2ZPKH 3REWB 4DW2L 2Y06L 3A67H 3SDDB 2D31A 2WSKA 5JW3L 5FYLE 4NFCA 1W0WA 2DIJA 3RGVD 2YWYA 2EKSA 4YLQT 4XP9L 1A7NL 2WUCL 2ZKHH 2J88L 4JPWL 3R1GH 4WEBH 3TA3C 4LDEB 4OM0H 3T0VA 1M71B 3KPRA 4JR9H 4X4ZA 1H9VA 3R0NA 1XGUA 4B5EA 4I9WE 4YBHA 3RHWK 2V9QA 5GZOC 5IQ7H 4L4VE 4NO5A 3MACH 5I1DA 2W0KA 5BMFH 5HGBB 4MS8C 1E28A 5JLZA 2BDNH 5SWQB 4JVWA 4ODSH 3SE8L 4LIQH 3OJ2C 3N50A 4MB5A 1Z9LA 4U2YA 5DVOA 2NPLX 3RWGB 1U41A 1YEIL 5I9QB 2A77H 3TO2A 5A2FA 3I85A 3I6KA 5EOCJ 3QUMA 4P48A 2BVOA 4Z77A 4Z0BH 3D6GA 4LPUA 1DEEB 5JIHA 2FL5A 4DCQB 5KAQG 1G9NL 2LVCA 1H3WM 5EU7C 1TIUA 1UM5H 2OCFD 4OF0A 3TJEH 5L8LB 1HHHB 5FM5M 3QB7C 3UEZA 1G7JB 1XIWA 1CD8A 3MV9E 4U1JB 2WLZA 1OAZL 2NY6C 4GRWB 4UU9B 3VFPB 3SGJC 4NQED 2ATKA 4HKZB 4URTB 5H94A 3LV3A 4QTHA 3CCHB 5CBAA 1DCLA 1G9ML 4G7VH 3C8DA 4L29B 4Z7OF 4UNTA 2W60B 3OR7A 3T3PE 3CDGA 3KNBA 2RQ8A 1EVTC 3OXRA 1IARB 4I0PB 2EDBA 4KQ3L 1U8JB 1HSBA 1G1YA 3VFMB 4OJFH 1D9KA 2NY4B 4WWKC 4EDWL 2DQEH 2R1XB 4OD2A 5CSBA 3BPNB 5AWNH 3S34H 5B3JE 5IJVB 1RURH 1LD9B 3RP1A 1K8IA 1CR9L 4TSAL 5DDHB 3MJ9A 4AY0A 2HTLD 1GGBH 3P9LA 4ZFFA 5KVEL 4HZAA 3BP4B 1EEYB 5E1AB 3HR5B 2XY2A 3PXJA 5HHMB 4X0KB 2MJWA 2ZCHL 3IU4H 4FQIH 2MSPA 1MCWM 4BA8A 3MV7B 5TDOA 4B53A 1DVFB 1A7PH 2VABA 3T04D 1PD6A 3IDMB 4PJIB 1CFNA 3RQ3A 2VQ1A 3CFKA 1ZGLA 1OTTC 4WEUD 4C83B 1K5NA 3JV5A 3U1SH 1GXEA 4G9DA 4IS6A 4M61B 4NQCA 1WUNT 1S7UA 5JR1L 4RMUA 4R97C 4HS8L 4KMTL 5JW3H 12E8H 4NQDE 4JHWL 4RMRA 2PTUA 4MB4A 4I8DA 3MOQA 3WUWA 4GMSH 3NCCB 4XP9H 4Z0XB 2WUCH 2F54A 5HJ3A 2J88H 5HGGS 5T1LA 5LQBH 5D1ZD 1EJ6A 4MD4B 3VW3H 1I7UB 1SJVA 3QHFL 3JWDC 4X5WB 3ALPA 4X7FC 3EDEA 5F9OL 3JXAA 1EGJH 3CXHJ 4KI5D 5CIPB 3VXUE 1FFRA 2EC9U 4C54A 2CK2A 3JZ7A 3KLHD 5CS7A 3UTTB 5DMKB 5IWLC 4HGWB 4JHAH 1H0DA 4MXQC 4YHIB 2F5AL 3MNWB 4NQVA 4NQXB 1UZ8B 1YNTB 2AK4D 1BJ1J 1VACA 3A6BL 1NAML 5E8NB 4GQPH 2XI9A 3MXWL 3GK8L 4I2XA 2FNBA 2Y7QB 3VCLA 1G9NH 4LARL 3BQUD 3GIZL 2PCPA 2XA8H 2XXCB 4Z7WB 1LO5B 3T65B 5IV2B 4IHOB 2GSGA 2KL6A 5IIEB 4E42A 3VG0L 3T09A 2HLFC 5FM5O 1CFSA 4MMXC 4Y5YB 1UYWL 4L3CA 1A4JA 3LS4L 2X1QA 3TCXA 2WINB 4H5SB 2L0DA 5IW1A 1BJMA 4F2MA 4U0RB 4HLZH 5TF1L 5IHZB 4NIKB 3QQ9C 3SKOA 3VXMB 4PV8A 1QSEE 3HLAA 4S11A 2N7AA 2NY3C 1F6FB 5DHYB 1U93B 1UZ6E 1T1ZA 4OF7A 4ZFGH 1LWRA 1T4KA 2ATPA 2KUTA 4KQ3H 4MNQB 3LEYL 4NJAL 3RPIA 1WCBB 1KIUA 5D7JB 5DJ6B 4EOWL 1BVLA 4X83A 5AZEH 4GUPB 1S7VB 2H26A 1RJCA 5DUPL 1U3HD 3RZCA 4XCEA 4Y16C 4Y4HD 2EDFA 5D72L 4YK4B 5GRZA 4WU7B 5DZLA 1FSKB 5KVEH 1KENL 3LCYA 3ZE2E 4BZYA 2R29L 2CKBB 1G84A 4HH8A 3KPPA 1DANU 1KXTB 3PGCA 3I3DA 1C16A 5D1XD 3AXLA 2HLAA 1OW0A 2YSSB 4YO0A 4KPHL 5IB4A 5IVXB 1FL5B 2XTJD 1PG7W 4WY7L 1R3LB 3P0YL 5D5ME 2RIKA 2NQCA 2R9HC 2VTFA 2B5IC 1W72H 4XTRD 5JR1H 2A1WL 4KMTH 5E2TL 4MA3A 1ZOXA 1NC4A 1S7QB 5J13B 2PUQT 5SV3A 4HF5H 5DHVH 4RMTA 2VO5A 3PDOB 4GJTB 1U91A 2D7OA 3REVA 4ZYKA 2R23B 4YHOL 3QHFH 4XCNB 2FB4L 3O2DA 3D39D 3AREC 1EHXA 5F9OH 2O5ZH 3GMMB 1YN6A 4WI2A 4OCWH 4HUVA 3RWJB 2I07B 3MXVL 5GGRY 4HD9A 1A6AB 4XMPL 5T3ZE 3LD8C 5DI8A 4J12A 1NGWB 1AGCA 3OKYA 3QFJB 3JWOL 4X4XA 1IGIL 1HE7A 4Y5VC 2QJDA 4NN6C 3RVTD 2O61B 3ARWA 4JFXB 3RWHB 1EHAA 3A6BH 1EXUB 1RZKH 4LP4A 4G8FA 1VFBB 1NDGA 4XBGA 3MXWH 4UAOC 3GK8H 2XWBB 3BPLB 1T7YA 3LQZB 4PJHE 2VL5B 3SDAB 3ZSTA 1HI6B 3WHXA 2XN9D 5L2KD 2HFGL 4G6KH 1WBZA 1J0YA 3O3EA 1T1XB 3OAZK 5I16A 4M3KB 4YDIL 3BVNA 4N9GB 5E8OB 2ID5A 4MSWB 1U8NB 3VRLE 4Y1AB 1KTKE 1CDUA 4EBQL 1BBJA 4LNRB 4PJFF 1XFPA 1CVSC 1UYWH 4ORGA 2B2XH 3GRWL 2E27H 2UVEA 3LS4H 3VXPA 1DQMH 4LCCA 4QXWA 4GW1A 1ZT4A 4IRJB 2C7UB 4J6RL 1LNUB 5TF1H 3DIFB 1BVKA 1MI5D 4YC2B 43CAB 2D3VA 3AROA 1XGQA 3FQXB 3EOYG 3HE7D 1MWAA 4KJPC 3IJSA 3BN9D 3OKLB 1B6DA 4OGYH 3P4LA 2GY7B 2I24N 1MRFL 1W8OA 2OI9B 4NJAH 2Z8SA 4PJAB 4EOWH 3NCFB 4MXVE 4EKXA 4P2OA 2HMIC 5DUPH 3SBWC 4U1GC 3F5WB 5HXMA 1MJ7L 2XTLA 3Q6GL 1A3LL 3WFEL 3EO9L 3ZYOA 3N1QC 1I1CA 1FNHA 5BQ7B 5I71B 4P4KD 5I8CA 1RUAL 2P44B 5DJXB 3C5SB 1CT8B 3KPSB 4Y5XB 2R29H 4NHUB 2EO1A 3G6AB 4PGJA 5CMAB 3TIDB 2C9AA 5HVWA 1AXSA 1CLYL 2H9GB 3O2WL 1IZJA 1C5CL 5JA9A 2AJVL 3LQAL 5IJKA 3STBA 5KVMC 3V9FA 4QHUA 4KPHH 1ZVHA 4HFWA 4MHHG 3QZWB 4WY7H 2JELL 3MLRL 1A5FH 3MRGA 4G6ML 4KC3B 3QDME 1A7RL 1FDLH 4CADB 4TULH 5I8KL 1KJVA 5BJTA 4YHML 1FYHB 5C0GA 1L6ZA 2A1WH 2Y23A 2BHUA 3BO8B 3NPSC 1KJ2A 1SJXA 1WV7T 3CGTA 1IJ9A 2YK1H 1L0QA 2P45B 4U1SA 5HGAB 4YWGH 3TYFB 3R0MA 2ESVD 2YPLB 2J8UB 3MV01 4YHOH 4FQJL 2FB4H 4HWBL 3ILPB 3QUYB 4CVZA 3D3VB 5T33L 4HX1A 5F8RC 5C70A 4ODWA 2X4RA 2F53D 1E6OH 4XMPH 5JXED 2J6EH 1EFXA 1TZGL 2DMKA 3NN8A 4JZOB 2WBKA 2X1PA 3JWOH 5JW4M 5CFHA 4AMKH 5IEKA 3S35X 5ITFA 2DQDL 1F4WL 3ARFA 4J7RA 4J3XA 1D5XA 4PB9L 5IQ9B 1MCOL 3RVXC 3GB7A 2JJSC 2BNQD 2VB5A 2HFGH 4M7KL 5GS0C 4K3HA 2DQIL 4OFYD 4RX4D 4QWWD 4YDIH 1KIRB 2HJFB 1JYNA 4X9BA 4ESKA 2YD5A 3CFEA 5C0BE 3VA6A 3BGAA 3DVGA 4HWUA 4EBQH 3DBXB 3VGFA 4ODBD 2R8SL 4U6XB 5DD6B 4Y2OA 2FJHA 3ZKXC 4JFHE 3EJYD 2FBJL 2WWKO 5E5MA 4EN3C 1HKFA 4D3CL 5IF0B 4K71C 3UBXI 3TA3A 4G3YL 3TBVB 3VXSA 4J6RH 3QJHB 3IFOB 1JF5A 3INUH 4FFYL 2X6MA 1J1XL 5E2JA 2KZWA 5B21A 1KGCE 3BD3A 1PZ5A 1XGYH 1MFBH 2EIZA 3BT2H 5JMRA 2XWJA 5BS0B 3GSQA 2AQ1A 1MRFH 1H15B 2QKIA 3EYVB 3WJJC 4X6CB 4YHYC 3VXRE 2NXZB 4KKCD 4ZXBD 1ZAGA 4GXVL 1AC0A 5C07E 4OCRH 3GSVB 4WDIA 2A9ML 1MJ7H 3Q6GH 1A3LH 3WFEH 3EO9H 1QVOA 1DR9A 5B8CB 1U8QB 5A3IC 5E56A 4O51B 1RUAH 1OGTA 1NAMA 4FQXC 1BQUA 1H3TA 4HMEA 4JPKL 4DVBB 4W68A 3RVUD 1QFOA 2D31B 1IAOA 1CLYH 4DQOH 3S88L 5ISZD 4DEPB 1ONQA 1C5CH 2NXYD 4K7PX 3TPKA 1CXLA 1IAMA 1S7WB 4K8RH 1H8SA 4PRPD 5C92A 1C8PA 2Z92B 1WCQA 1UWEH 3E6HA 3KPRB 2EYRA 1FZJA 4X7TA 2JELH 1ZVSA 3SGJA 5FEBA 4G6MH 2WLYA 1XGUB 3VFUA 1FYTA 1T5WA 2A6JA 4IOFC 1YEJL 4YHMH 3TBTA 4NO5B 1KPVA 2WQ8A 4X6FA 4Y2DD 3ZSSA 5C1MB 4DGVL 4TQEL 4FNLH 5D7LD 1P7KA 1CVRA 3HUJF 4TPRL 1NGQL 1MJ8L 1NLBH 4R4ND 3R06B 1EHNA 4HWBH 2FECI 4OD1L 2BVOB 4QRRA 5F44A 4WWKA 2DDQL 2FL5B 3ZT6A 3EKCA 1VGKA 2Q3ZA 2ICWA 1UKQA 1ZA3A 5E8PA 3KXFE 4A6YL 2CUIA 3LIZL 4R4BB 2DOCA 5F3HA 2VDNL 4WFED 2HA1A 1J18A 3M8OL 1F4WH 3ZKMD 5CJ8A 4PJBE 5T5NG 5GS1C 1J12A 4E41A 4M7KH 2R56L 2R0LH 4BQ9A 4QTHB 1I8MA 4AJ0A 1P6AB 3QNZB 4YBQC 1SYSB 2RB8A 2PF6A 4F37K 3OR7B 3CDGB 3K46A 3OJMB 1CF8L 1BM3L 3KNBB 5HYJD 1OGAD 1H3UA 2R8SH 4G5ZH 3OXRB 4IIQC 4Z7QF 3HAEH 4JREC 1OAYL 3MC0A 1D9KB 2FBJH 4OD2B 4BSJA 1U8MA 2R0ZL 4D3CH 5LJYH 3HZYA 2QHRL 1K8IB 2IFGA 4G3YH 1UJ3C 5TE6L 4JO2L 3D69A 1XF3B 3AY4C 1L7IL 3ZKND 3P9LB 5MEQB 1J1XH 3U9PL 5GGVH 3O9WD 5LCVH 5DJAA 5I17A 3BE1H 2IH1A 3BZEB 5IWLA 5KSUA 5D2LF 4JKKA 5DWUL 4TVPD 2DS4A 4EZMA 1BQHG 5TDOB 3GSNA 3RIAK 4YBLB 2VABB 3QFDA 1A6VH 4OSUH 1CFNB 1UM6L 2D2OA 4LSDA 3CFKB 3CSYA 1INEH 1ZGLB 5IB5B 1KJ3H 2PN5A 4NC1C 1K5NB 3BDBA 2DRUA 4M6MH 3MJ7A 2A6DB 3H7LA 5JNYA 4JFOB 4IS6B 4ZNEA 3WD5L 3NZ8A 4JPKH 4OKDA 5DJZA 4NQCB 1MHHA 1S7UB 4OLUL 2VZSA 4Y4FC 5I8OL 1AHWB 2V5TA 3RWCA 1SHMA 3DX8A 3MZGB 3NIFF 4ERSH 3MNVA 1A6WH 2F54B 3WNMA 4APQB 4TRPH 5T1LB 1CK0L 3L3GA 5EOQL 1RUQL 4QOKE 1MHEA 1F11A 3SO3C 4KROC 3MGAA 1YEJH 4UQ2A 3OR6B 4QRSA 3GRWA 2FCBA 1ZS8A 1J05B 2J5LB 5EO0A 1A7QL 4TQEH 1KIPA 1H0DB 5B3NA 5MI0B 3CZFA 4TPRH 3DXAE 5SWSD 1MJ8H 3WIHL 1VFAA 3WNNA 4OD1H 4LPXA 4XCYA 2YRPA 4RQQB 1P4IH 3GBML 3O45B 4I2XB 2V2TA 1IRAY 5C09A 2B4CH 4R2GD 3IS1X 3VCLB 3E3QE 4Y16A 4A6YH 1JP5A 1NFDF 2FGZA 3LIZH 3QDJE 3TVMD 1UM4L 5KZCD 4L1DA 3VWJB 5HHQA 5MEOB 1UADC 4R7NA 4KRPB 4E42B 5DJCB 1CFSB 4L9LA 3OKMB 1DBMH 2BRRH 4PLNC 1CDIA 2DQJL 3J8F7 4X6DB 2FIKA 4FTVA 5F89B 2E5EA 3WLWC 1ZHKA 5FO9A 3T0EE 4RMQA 3DRTB 4K8RD 1JGUL 3O8XD 3DECA 3RUGE 3SKOB 4PV8B 3QXAA 1F4HA 2ED9A 4BZ1L 1LO0L 1FCCA 1X7QA 4O9HH 3O6MH 1CF8H 1BM3H 4U3CA 4FZ8H 4JDTH 5AD0B 3F58L 3MRCB 3PWJA 3OAYH 1RUKL 1T1ZB 2ATPB 1T4KB 3E2HB 4IBLT 4FFWC 3RPIB 3WO4C 4NCC2 4QGYA 1CD1A 3JV6B 4S2SA 4CNIA 4ELMB 1B90A 5BO1H 4KY1L 2R0ZH 3SE3C 3RZCB 4W81A 4G6JL 5J0BA 4JO2H 2EC9T 5EU3A 1L7IH 5FDWA 1CDBA 4HUXA 1KV3A 3AREA 3KGRA 1BFOB 3G5XA 3U9PH 1RZ7L 2APFA 2ZJSL 3CX5K 3KPPB 3PGCB 2A9NL 3TPUA 2P42B 1NANH 3RJDA 4IM8A 3K4ZA 5F70A 1OPGL 4NKIH 4PJ7F 1C16B 3AXLB 1QHOA 2HLAB 3MLSL 1VEMA 2JCCF 1TDQA 1VPOH 3P9WB 5IB4B 5LGHL 2GQHA 3QIBD 1U3ZA 4I1NB 4RMVA 1V7MH 1S9YB 4X7SL 4UMGA 4XZUA 3DSFL 4HIEA 5E0QA 4XMLH 4OLUH 3WBDA 2FX7L 4MA3B 2Y07L 1NANI 1TITA 2GK2A 3MNZA 3T2NH 1C1EL 1OP3H 1ZHNA 2FSEA 4LCWE 2WIIB 5E7BA 3SJVE 4D2NA 5MERA 1CK0H 1JHKL 2MPAH 3REVB 5EOQH 2IMNA 1RUQH 5FB8A 1QFPA 3HUJA 3BRDA 4QNPF 1WBXB 1YN6B 4NO0B 4HUVB 5T1MB 3QNYA 5DI8B 1P69B 1AGCB 4X4XB 4ONGL 2UZIL 5KSBF 3KHQA 3ZLQC 43C9A 3T8XB 3QIWD 4NPYA 4WNQB 4XVUC 4QRPD 3WIHH 4G8FB 1NDGB 2LU4A 4XBGB 3FZUD 3ORJA 4OUOA 3QG6A 5JZ7C 4JY6B 2HTKC 2X4NA 3GBNH 3NIGE 1WBZB 3NMEA 3O2VL 4U1LA 1ZLWH 2FIRT 1N0LA 3BVNB 3NVQA 3WL9A 2MCG1 3EFFA 4JGUA 1MH5B 1INDL 1JGEA 4OZGF 1YPZF 4X8JA 4K2UL 4OFIA 2WWMC 1MJJA 1P1ZA 5E24E 1BBJB 3UYOD 4G80B 1ZHBB 4GQ9L 1X4XA 3QT2A 2D0HA 3VXPB 3PQYB 3LPGA 4LGSB 4GRLD 5EBMB 4J3WA 1MF2H 4GW1B 1JGUH 1BVKB 5FYKU 2EDXA 4D9QD 4U7MA 2VIRB 1XGQB 1ORQA 4BZ1H 4LHUD 1MWAB 1LO0H 2OMBA 3IJSB 4QCIA 5HHOE 3I50H 1RUKH 3C60C 4OCSL 3D85A 1KXVC 3LEXB 4AK1A 3F12A 3LB6C 3I3EA 4HUWB 4HEME 3PF2A 4G6JH 3BKCL 5I1EL 4N0UB 4V1DE 5I75C 4M1CD 2VISB 4BFBD 2HKHL 3QSKB 2NNAA 2QTEA 2A9NH 4R3SA 4WW1A 1AJ7L 1UH2A 1G0YR 4KJQD 1BHGA 3KYOB 1AGDA 2DLEA 2ADGA 3T0BA 5EA0H 4HFWB 4EQ3A 4RBPH 1DUZB 3CC5A 3MRGB 2AXFA 5GJSL 2HG5A 4JQXC 2JJSA 1XCTB 3HC4L 3ZTJG 2YRZA 1KJVB 4JRXE 5BJTB 3DSFH 2I5YH 1NCTA 3MV8E 4XP4H 5C0GB 2FX7H 5JHDD 3CDYA 5JW5A 5ACMA 2W65A 1UH4A 5KAQF 6FABL 4U1SB 3UTSE 1Q38A 2WAHA 5IHLB 1MQ8A 4F7EB 1JHKH 3CNKA 3QEQB 3RVWD 2MFNA 4YGVA 2IADB 4X9FA 1RK1A 3QEUA 4EN3A 2ZSVA 4ODWB 1BVZA 1F3DJ 3GIVB 4RFOH 3SDCD 4JFEA 1RSFA 1EFXB 5LXGH 4YFLF 3NN8B 1YYML 3MCG1 3EYFB 1A1MA 5M7QA 5CEZE 1JYVA 2YMXH 1T89C 4EI5C 1NFDA 4M6NH 3ARFB 4GH7B 4WFFD 2E7HA 4MAYD 1D5XB 4H0HB 5E6YA 3WJJA 2P5WD 2BK8A 4QHLB 2LTQB 2L4OA 3AVEA 3QUZD 1HHGA 4N0YH 3FFCE 1INDH 3OG4B 3FAXA 1TETH 4FQXA 5C0DA 3LS5L 4P2QA 2AK1L 3QXDA 1I1FA 2FJHB 1OWWA 2QQQA 4GQ9H 1IM9D 4IOSD 3G6JF 1AGFA 5T3XH 2AVGA 4I3RH 3Q5OA 3S35L 1DN0A 3AS1A 1OTUD 3CX5J 5E5MB 4Q9RL 4PJEB 1LQSR 3MSPA 3TA3B 1OF2B 1B4JL 2CLVA 5FGCB 5SWZE 4HAGA 5DHVB 5AEAA 5BV7C 2B7DT 3KHOA 5JW4N 1H8OA 4OIIL 4AG4H 3VDCA 3MBXH 3MRHA 2D7PA 2XWJB 4K9EC 3GSQB 4LSTL 4BQBA 4XMKL 3T0AA 3WNPA 2ENSA 2NLJA 2QKIB 3C5JB 5K33A 3T3ME 3U6RA 1AIFA 1DP0A 5EG6C 4WJ5A 3WN5B 4ZO7A 2IANB 3V6OC 4PJ7A 4OLVL 4WDIB 1FQ9C 1FE8L 1QVOB 2XPGA 5IMOA 3SGKC 5KW9L 2HKHH 4ZUUB 1SEBA 4JFDA 3DX6A 3QHZH 2IAMB 5CJQL 1NAMB 2VLKD 3OB0H 4G8GA 3QCTH 4J3UA 2DQTL 1IAOB 5GSRA 3LQMA 5E95B 3O3BB 1ONQB 3NIDE 1AJ7H 4NQSA 3GDBA 1J87A 2GITA 2ZCKL 1BOYA 4E5XA 4NC0B 3PHOA 4P5KA 1TPXB 3E6HB 4ZFZB 5GS1A 4X7TB 4MQ7A 4LASH 3GSUA 2NY6B 2ZUQB 4JVPA 2EDTA 1ZVSB 5CINL 3D9AH 3EJZC 3NCYS 5GJSH 3DYPA 5E4EB 3ZDXE 1F45A 3RTQD 1FYTB 4HK0A 3HC4H 1T5WB 3HN3A 2QSCL 3TBTB 1XIWD 3QG7L 4P9ML 4NQEE 3HMXL 1WWBX 1ZSDA 5HBBA 2Z8RA 6FABH 1S9KC 1P7KB 3K74B 4OV5A 3SKJL 1R0AL 3ARBD 5A2JH 4K7PL 3MUGB 4IIQA 4MZ2A 4QRRB 1N59A 3QIUB 4R90L 1OVZA 3NCEB 4X9GA 2ICWB 3AB0B 1UJ3A 1ZA3B 3U30B 1OQXA 3O2DH 3AY4A 1J11A 1NFIA 4JN1H 2EIBA 4DKAA 5F3HB 1QG3A 1S9XA 2M2DA 3PWLB 3ZHDA 1KB5L 4OIAA 1T5XA 3MRKA 5JOFA 2ARJQ 1C7TA 2SEBB 4HFUH 3MRRA 3P9MA 4HBQA 4LOUD 5F6HI 4Q6YA 4O2EA 1OHQA 4G43A 1U9KA 3U46A 3BRFA 4Q7DA 1GHFH 1NEUA 4GBXC 4F33B 1I8MB 1OP9A 3HRZA 3L1OL 1ZTXH 4F80A 1HXMA 1JBJA 2B8OT 1U3YA 4M43L 4XWOC 1W0VB 3NCMA 5EZJA 1D6VL 4R97B 4Y4FA 5FHAH 1T20A 3RJQB 3MUY1 3QPQD 2E6JA 4XNYL 3C5ZD 3HZYB 4YFDB 3RA7L 5I1LA 3B9DA 1DL7L 4KWUA 1PGRB 3QHTC 4K9EL 5IW6B 5CUSL 2NX5E 3CVHH 5DJAB 2O5XH 2WBJD 1QRNA 2EDWA 4MDJA 4WO4A 5I17B 2E6QA 4LSTH 2IH1B 1J0ZA 1CGTA 4KI5E 4M4RA 5D93B 5KSUB 4FA8A 1QSFD 5I1KH 2JE8A 3TV3L 3O6FC 1LP9E 3WFHA 1VSCA 5FGRA 1ZMYA 3ZYIA 1Q9LB 3QFDB 3BDXA 3FQWA 4OLVH 4CVWA 1FE8H 5EIQA 2VXQH 5KW9H 3RDTC 1B9ZA 3HZVA 5FGBC 5FOBA 5JNYB 4LPVA 1WFUA 2AK4E 5DURB 2AEIT 2VMFA 3CFJA 4UINL 5DJZB 3EFDL 1MHHB 4HQQL 3FQRB 4NKQB 2DQTH 4XGZB 4HBCL 1BZ7A 1A6TA 1D6EA 3RWCB 1WZKA 3DURA 3PV6A 3DX8B 4WW2A 3MNVB 1KLGA 4MA8H 1AE6L 1JNNL 1M7DB 1CD9B 2DLFL 3BGFC 5HPMA 2VC2L 1DBAL 4Y4KC 2BHZA 2NY0C 1J0KA 5LBSL 4JN2A 1MHEB 1F11B 4B50A 4FQPA 4GKNB 2ZOKB 4ZUVA 5C0CA 2QSCH 2ZNWA 3QG7H 4UQ2B 5T3XD 4QRSB 3S96A 1HXYA 1ZS8B 3STLB 5D2NE 3HMXH 1KIPB 2DI7A 4PRHA 2ERJC 4EIZC 3GI8H 2YD7A 3CZFB 5EUOF 3SKMA 4IRZH 4KKLD 4WUUE 5HYSB 1R0AH 1KJ2H 1VFAB 4YPGA 1I7RA 3S98A 1B0RA 1N5YL 1IGJA 3RL1A 1VENA 1P5UA 3SO5A 5C09B 2NZ9D 3SE3A 2BJML 3QCVL 2OJEA 1EMTL 1ACYL 2I9LB 1SY6H 4M9PA 2YRLA 2IFFH 5FYLL 3VI3F 2YD2A 2XY1A 4G8EA 3QUXC 1BECA 1MCBA 1NSNL 5HHQB 5I73B 1YMMA 4XP1L 5A2LH 1UCBL 4AM0A 1S7TA 1M4KA 2CUHA 4L9LB 5GZNC 3UCRA 2ZP0T 4U6VH 4XPFL 3CUPB 2CDGA 1NBYA 5AG8A 5DC9B 2FIKB 3MMEA 4FTVB 2AEQH 1T66D 4KAQL 5FO9B 5M94B 1LEIB 3O4LB 3G6JA 3QAZB 3HTLX 4M43H 1ETZA 4POZC 5BRZA 4JM2B 3VI4E 2XTJE 5LGJA 1D6VH 4LPCA 4M1GL 1FVCA 1YC8A 5C2UB 2BVQA 1KJMB 3NABH 3HFMH 1QUNA 4CMHC 1CD1B 2Z91B 1OM3L 2AJ3A 3DARA 2DQHH 2MQCA 1XR9A 3P4NB 3LZFL 3O3DA 3RA7H 5F7UA 1CL7L 4O2CB 4PR5B 5EU3B 1G7QB 2C1PA 4HUXB 5E9DB 3G5XB 3KAAA 1NC4D 2EE6A 3PWPE 3C6LC 5CUSH 5IMMA 3MA9H 1EAPB 3D39E 3TPUB 5KSVA 1MFDH 1J0IA 4H0IA 4PRID 4RGNC 1YEFL 2ARJA 5ICXA 3LMJL 1J8HB 2VLMD 2QBWA 2HT2C 3V5DA 1RUPL 5TQ2H 4YHLH 3ME0A 1BZQK 2EDLA 1GIGL 3GMOA 4PJCF 4JDVB 4UINH 3RX5A 4XZUB 4HIEB 1KCKA 4HQQH 3MNZB 5L2KE 1D5BA 2DLHA 1R3KA 1ZHNB 1AE6H 2ED8A 2DLFH 2VC2H 4JGMA 3SDYL 1J1OL 1DBAH 3MLWL 3MPCA 4LFHG 1CGVA 3KYMA 1JNJA 2JIXA 5LBSH 2X4OA 5FB8B 5AUMB 4DK3A 4UBDC 4FFZL 3TJHD 3TH3T 4JAMB 5J11B 4Y19D 1I9JL 1VA9A 2P1YA 5CD5C 2YC1B 3QBTB 4PJDF 1PAMA 1OD9A 3QNYB 1YC7A 4QO1A 3VRJA 4HUUA 5C7XL 5EO1B 3V4PH 4PJ8C 43C9B 4XXDB 1BFVL 5L2JA 1T04A 1MI5E 1G6RH 4Z7UF 3C60A 2X44D 2YEZA 4NPYB 4QXTA 3TCLA 5J57B 4AEIL 1SJHA 3JV4A 2X4NB 3NCJL 5CJOH 2JJTC 3QCVH 5F9AC 2IEPA 1EMTH 1X6LA 4U1GB 4G6AC 4U1LB 5MENA 3I84A 5CEYB 1YJDL 3BISA 3WL9B 4UV7H 2XQBL 3EFFB 3PL6C 1Z3GH 3CPLA 4X8JB 1KF9B 1OP5H 1ZLUK 2PYEA 4GFTB 4P2OD 1L0XA 1MJJB 2VQUA 2NY7H 1H5BC 1P6FA 2W9EL 4RMWA 5H2BA 4P3DA 1Z0MA 4XPFH 1EUTA 1OB1A 1DBKL 3DX7A 3M17A 5DMGC 4YIQA 4P3CL 1FGVL 1QP1A 3B6SA 1EK3A 5J9PA 2QADC 4Q74A 1DQQB 2QSQA 1K9TA 4WGVB 1MJUH 3GUTA 4JQXA 4XNQA 4MQXC 3WS6C 5F7EL 1BLNA 4F7PA 4QCIB 4Z78A 3B43A 3K3QA 4M1GH 2IQAA 4NDMB 4PLJD 4PY8I 1EO7A 3NPSB 1VFUA 3F12B 1OM3H 5L6YH 2ZCLL 3EGSA 3ZDYE 2JB6B 4NZUH 4ZUSA 4JEGB 1TJHL 3MRNB 1RMFL 5C0ND 1NAKH 4MGXA 4JPVL 2NNAB 2UUDH 4OZHE 2ESVE 2GJ6D 3QRGL 2R0WH 3MLXH 4R3SB 2JKXA 2ICWJ 4WW1B 3G04A 3ESUF 3Q48A 4PY8J 2F53E 1AQKH 5DJ2A 4UOW1 3L5XL 1AGDB 1T89A 2ADGB 1FC1A 5ALBL 1RUPH 3QEHA 3V4VH 4JFFD 1U58A 3CC5B 4L3EB 1GIGH 1KB5A 1QSVA 2AXFB 4XBEL 3UC0H 4R26L 4D8PA 3GSNH 4ZPVA 1DQLL 5DFVD