3CPLB

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplB00
1LO4L 4OZ4A 2AGJL 4S0TD 5C0JB 4IS6A 4EN3D 3G5YB 2D7QA 3EW3B 4JRWA 4CVZB 2BFVH 3KPQB 4PJ9A 3GJFH 4XPAL 1M6OB 1R5VA 3QDME 1INEL 1WIOA 2B4CL 4OTXL 1T4KB 3MZGB 3QCTH 3GUTA 3MRLA 4I18B 4X7SL 5D7LB 1MI5D 1HOCB 2OR7A 5EOTA 4RAUB 1E27A 4RSVA 4DUVA 1GOGA 3LS5H 2AQ1A 4OLZH 5GS0C 5FYJU 5FYLL 3RJQB 5JA9A 3ULUL 5FO7B 4GLRH 2DRUA 4XRCA 2D31B 4FFWD 2DLEA 1X5AA 2WWMC 2FX7H 3BXNA 3DNKA 1PD6A 4BELD 3QJHA 3UTTA 3OHXA 3OXSB 3O2DA 1IEBB 2R8SH 4OD1H 3QUYA 4LNRB 2WBJC 3VWJC 4P3CH 3GIVB 3ESUF 1D9KB 4I0PD 4OB5H 1RZIA 2OS7A 3BPNB 3BSZH 3IJSA 4PV8A 5D96B 4QT5B 2RGSA 1YC8A 3C8HA 4NJAL 2IGFH 1IC4H 4KJQC 1K4DA 4N8VG 2VLRA 3CFIC 2VXVL 4OF6A 4O00A 1X7QA 1RUQL 1Q0YL 3DUUA 5F1IB 3FN0H 1FFPB 5IOPB 5KS9B 4J1UB 4GRWE 4X98B 4FQHA 4Y1AA 4G5ZL 4OQTA 4YC2C 2Q76B 3LCYA 1KJ2B 3MYZA 3Q6GL 3BDYH 3CDCA 4ZPTA 1CDIA 1KN2H 2DLTA 4KUZH 4GSDH 3UTZB 5FF6A 2OI9C 3TN0A 5DZLA 3W0WD 3L3HA 2EDLA 2HN7A 2OJZH 5EFIB 5T1LA 3V52H 1XIWD 2FJGA 1EDQA 2VAAB 2R0LH 4ODSH 4MCYB 2AI0L 3IFNL 3VXNA 3LEYL 3QIWA 2QHLA 1I7TA 3NCJH 5IB3B 5I75B 1NBYA 3STLA 3BWAA 3GSVB 1MQKH 2O5YH 2P24B 4N9GA 3CVHL 3P77A 1IGFL 1EEZB 1KTLB 1S7QB 1WT5A 3LH2H 4M7KL 2YC1B 2Y23A 3IFOB 5D1XC 1G7QB 4U1HB 4D9LH 1G84A 1S3KL 5D5MB 3ZL4L 1X5IA 1IAIM 2LQRA 3BH9A 1MNUL 3RNKA 4XPGL 2ZCLL 2IADB 4Q2ZA 4X6CB 4JZNA 4H8WC 3OB0H 3EO0B 3U4AA 1OL0A 2NY5C 4HAGA 2PTTB 1GVIA 2X4SA 4P2RE 3MV8A 4HS6A 5FYKL 1CDJA 3IVKB 3C60D 1UADC 3MRDB 4XXCA 2Q7NA 2W9DL 4WHYG 3REWA 2BNQB 3MUGB 4P2OB 1DQDH 1E6JH 2DIJA 3HE6D 3CDYA 4XZUA 4O2FB 5DEGA 4ETQA 1F2XK 5E8EB 1A6WL 3TH3T 1CU4H 4OF7A 5I73C 4P5MB 5CHNB 3FN3A 1X5KA 1RVFH 1F13A 3IB4A 2OR9L 3HE7B 1N0XH 3EYQD 6FABL 4HEME 1HOCA 3RVWD 4PJBB 2ED8A 4I13B 5C0NC 2X1PA 2Y9RT 2XOTA 3BPOC 2MMXA 1Y18B 4FQJL 1N59B 4U1LA 3HZYA 4XWGH 4U49A 1X5FA 2X4QA 4XP5L 4OCYH 1ADQA 4JY5L 5AG8A 1HQRA 1HI6A 3C2AH 3BZ4B 1MJUH 3VFMA 5J1AB 3RVVC 1QSEA 3ARPA 4G9FD 4WI4A 1LO3L 5EORL 5FDYA 3DVFA 5HYIA 1TQBB 5E7BA 4QOKE 3OX8B 3KYNB 1IMHC 3R1GL 5D7JC 3GBML 4O02L 3AREA 1WFOA 4MD0B 2Z93B 1JF5A 4LGSB 4PRHA 3CVIL 4GKSA 4L4TD 2WBJD 1FFPA 3VWJD 5IOPA 1YEIL 4S1DC 2EDFA 5E8DL 2Q8BH 4J1UA 4GH7B 4BUGA 3IDXH 1MPAH 5C6TH 3HAEG 2WP3T 5EU7C 1KJ2A 4V2CB 4Q9QH 4G6KH 43C9B 1QNZH 4ZXBA 3W9DB 3QZWG 1TPXB 1A6PA 1WWAX 4YNYA 4LK4A 2AEPH 4HHAA 4DCQB 1R3JB 1NL0H 3F7VA 4JFDD 2EDBA 3HI5H 5ITBL 4UNTA 1AJ7L 3KDMB 3NPZB 5C0AE 3QO0B 1CBVL 4P4KC 1AGFA 1AQDA 2XKNA 4JCLA 4UB0H 4K2UL 3MRMB 1CFVL 5KS9F 5I18H 2DB8A 4JB9L 1S7QA 1AGBA 2YC1A 3C8DA 4LLQB 3S5LG 3EAKA 5EN2B 1V3JA 1FFOA 5T3XH 1QQDB 2UVFA 2ZOLB 2GSGB 1CFSB 4M7JH 3QXDB 1MJ8L 3JV4A 5D7IA 5FO9A 1B4JL 2DN7A 4DFHA 5ESQA 5HI5D 3DGGB 5DRXA 1JPTH 5I16A 3HHRB 3CXDL 5CD5D 3RWEA 4RWYL 4LHUG 3NIGE 4KTDH 4YHLL 3QHTC 1T03H 4WFFD 5IQ7L 4L5FH 1KNOA 3BJ91 5A16A 4O51B 3D3VE 1ZKAA 4HJGB 4HQQH 4BYHA 2YXFA 4WDIA 4P2OA 5ELIA 3SDCC 3MCLL 1CGUA 5MENE 1DBKH 5H37G 5D1ZB 5C09E 3B9KB 1J1XH 1DFBH 1EHAA 5F6HI 3RKPA 1I8MA 5D5MF 3T0ED 3WFEH 4J7RA 5D7IF 4RX4A 1RUPH 5IB1B 2VXSH 5F6HJ 4JLRB 5DMKB 1CFBA 4PJ8D 5IVNA 5I19L 5ETUB 1Q9OB 4PJBA 3TWCH 3IJYA 4FQLH 4ZODA 4P5TC 1JF1B 4XI5D 3SDDC 3TNNA 3VMNA 1ZTXL 1N59A 5TDNA 4YXLH 4O2EA 4JVWA 1KG0B 4HUNB 1IAOB 1JTOA 2C4FU 2HH0L 2V2TA 4P48A 1I1AC 2EDYA 4X0KB 1MFEL 5EU6E 3FHAA 4FS0A 2OR8A 1NGZB 3EBAA 4FFZL 4TUKH 5DLMH 2Y5TB 4PJXE 1H8OA 4Z78A 3MV7A 1RUAH 3B83A 4NBZB 1K8DB 4XVJL 5CLWA 1MSPA 5E2VH 1EO8H 3VXRB 3KYNA 3G6JA 2N7AA 4F3FB 5HI4C 4PJBF 5B38B 3K2UH 5F9OH 1BLNA 4PJIE 5J3HD 2EDEA 5AD0B 4MD0A 4NQDE 2PXYB 1RJZB 3TBSB 4X4MA 3ZYZA 1P7QB 2VAJA 3ARWA 4XMPL 3C09B 3RVVD 1XGYL 4NN5B 1C1EH 2J2ZA 2ARJB 2HYMA 4XHJD 5F9WB 2IAMD 1RK1B 3C6LA 3OJDB 4NQSA 4YDLC 3GSQB 1CXFA 4XVTL 5DVLA 1NLDH 3KPRB 1MHPL 1F2QA 1MWAL 1J10A 3QFJD 43C9A 4CVWA 1NCUA 1FPTH 3SDXE 4FQ2L 1KLUB 2UY6A 3QQ4A 4HWBA 3VI4F 2Y06L 1CN4A 1MIMH 2UVEA 1ND0B 4DCQA 1M7DA 2YD7A 4UT9H 5JO5B 4NRXB 3G6JF 3I02B 4QRUB 3KDMA 2EDDA 3OAUL 5IFHH 3QO0A 4MDJA 1WTLA 3UZVB 5I9QC 2F53E 2Y36H 1JUFA 5HDBF 2CLRB 3HN3A 4N0CC 3LVEA 1IAIL 1D9KC 2FEDC 1F4AA 2NYYC 4KRNA 1UCBH 2FB4H 3BPNC 2APFA 4BQBA 2XQYK 1G7HB 1OF2B 3MJ9A 3QEGH 4KHXL 2DF3A 4RGNB 3U4EB 1DL7L 3TFKD 4NZJA 2NTSP 2A6IB 3GMOA 1FFNA 4JRYE 1ACYL 3CAFA 1CFSA 2ITDA 4R3SB 2G5BB 3HC3H 5J06A 2IBZX 2LVCA 1RIVL 3DARA 3DGGA 3BRDA 3BUTA 4PG2C 4H20L 4ODHL 3W5NA 1CZ8H 5JIKA 1CQYA 2DQTH 2MCPH 1NFIB 3QULA 2CJUH 25C8H 4HPOH 1U0QA 4JO3L 4PY8I 4PJCE 4DEPB 4NQTA 5F1OB 4WI7A 3W5MA 5DC0A 3B9KA 5FAAA 4M1GL 1SJEB 2Y25A 3QIBD 4PY8J 4AL8H 1KIPB 2O61A 4LDLB 5BZDA 5I8KH 5CP7B 3GI8L 5DMKA 4N1HB 1KIUA 5I75C 2NLJA 3OG4B 1UKTA 1P2CB 2R1XA 3SDCD 1FQ9C 4XAKE 4XVSH 3W81A 1JF1A 4HWBH 2FX9L 3ARGB 3Q0HA 5D1QD 4J3SA 3HI1A 4NFBA 2NTFA 3MA9L 4HPYH 1KG0A 3WKMH 1IAOA 3WIFB 4HK0B 3SN6N 2X09A 4X0KA 4ZNCD 2P5EE 3NACH 1DQQB 2VC2H 1VPOL 3QXWA 1CTOA 1QPPA 3FRUB 4HUVB 4Z7WA 2RQ8A 3H2WA 5IBLC 4JM2D 4ISVA 5JW4Q 4PP2B 5H35A 3EDJA 1UWEH 4CRPA 2OL3B 4PGZA 3T4YB 3VXRA 1FHGA 4FZEL 3TVMB 2BSSB 2VLJD 1AXTH 3SDAA 1YEJH 3E2HB 2VQTA 3ZE0F 3ECBA 2BCKB 5AD0A 4Z7UB 1NFDB 4NYLA 1P7QA 3MOBL 3KLAA 4R96A 1MJJB 1G7JA 4NO0B 3O2WL 4TPRL 2ARJA 3VD3A 2HT3C 3AFLA 5F71A 1T89A 4YPJA 4HIEA 1BOGB 1C16B 3HE7C 3MLWL 4BQCA 3HS0B 3LKRB 5IF0B 5GRXG 4F15C 4NCC2 3RPIA 4Z7WF 1KLUA 3FO9B 5BRZE 4F8TA 1FZOA 5AWNH 1S7TA 1S7VA 3SKMA 3CDGB 5I8OL 5ALCL 2V5SA 4M00A 1K3ZA 5F97E 1MREL 3HMXA 4LLAA 3I02A 4ZFZA 4QRUA 5MEQB 3L3KA 4HS3A 2J4WH 3KYAA 2DDQH 2C7UA 4Y19B 3BGFC 2F54B 3WSQH 1I7ZB 1YYMH 1MI5B 3RTQD 2BHZA 2P47B 2CK0H 3HNVL 4E5XA 4LEXL 4QWWC 4U1MB 1G7HA 4XVUC 3MNZB 1J0JA 2A6IA 3DVNA 1HIML 4O4YL 4ZFOB 4R3SA 5JQ6H 1Z0MA 5E95B 2GIYA 4N0CD 4ZUTB 5ICZA 5KVFH 3W39B 2I5YH 4NBYB 1V7NH 2VZSA 1BX2B 3IRZA 1PJ9A 2NYYD 3H7LA 4KPHL 4WFGE 4F8QA 1U6AL 4HV8B 2K3TA 4PJEE 2ZNWA 1IGTB 5C0CE 3BYTA 1U8IB 4KROD 1O7SA 4I0PB 4JZJA 1UYWL 1OD9A 5F3HA 4PTUA 1CLYH 4BJLA 1I9IH 1NFIA 5KSVB 4PJGB 4YBLB 1U2HA 2BZDA 4OI7A 1TPXC 4ZUSB 2IPUG 5GJSH 2JELL 3QWQB 1FORH 3KYOB 3EJYC 5C0IB 1JE6A 4C4KT 1OPGL 3NFNB 1GGIL 3NCYS 2YD1A 4AM0B 3TJEL 2AJUH 1CL7H 1MCDA 1MIEL 1NKRA 3GMRA 5ID1B 1MF2H 1YJDH 2ENYA 3CFCH 4UT6H 4W81A 3OF6D 2MKLC 4G9DA 1J12A 3H0TA 4LSTH 3IETA 4EXKA 1LK2B 4WJ5B 4ZUUB 2H1PH 3QRGL 1FNFA 2EKJA 4MQ7A 5GRWA 4I2XE 2W9EL 3HMXH 3NCCB 4NHUB 4XXDA 5C2BH 1BM3H 1RULH 4L1HA 1YMMD 3O41A 4Y5VA 1JCKA 3MRKA 5SWSD 2ZG3A 5CCKL 1X5JA 4HUVA 2GTZB 2VL5A 4PP2A 5H94B 3T8XA 2BOCB 3SGJA 1FL6B 3D69B 4L9DA 2ZP0T 3BPLB 5FYLD 4PRPD 3RWDA 5IWLA 4DGVH 4Z7UA 1UEYA 4PGJA 3ARTA 1RQ5A 3S36H 1XR8B 3VA6A 1MJJA 4HGWA 3LKPB 3W11D 5IBLD 1GPOH 4HKXA 4YR6B 3WN5A 4M3KB 3OAZH 2IEPA 2QV2A 5E99H 4LARH 3GJEA 2X4PB 1WSST 5DVKA 3ULVC 1NMAH 1DBJH 3RL1B 4LQFL 3T2NH 4YAQA 5B39A 4HDIB 1EFXB 2OX5A 4GAGH 3MACL 3VXSE 1W72B 1FYTE 4ONFL 3H9SD 4KVNH 3G5ZB 4GOSA 4EN3A 3DIFA 5L6YL 3HE6B 1P5VA 3OKEB 1QLRA 4NQCB 1F8TH 5CGYC 5MEQA 1MUJA 4Z7UF 4XPBL 1KLGB 1DEEA 3QYCA 3MA7B 2IANB 2VDML 3IS1X 5GGQH 3DI2B 1RUML 1AHWB 4I3RH 4ZQKB 4JFPA 2MFNA 2DMCA 4ODVH 4U1GC 4X4XB 2WUCL 5DD0H 3MMEB 5J57B 1S7UB 3T3ME 4HZAA 1MCQA 3KJ4C 2VKXA 4QRRE 3UZEA 2PXYC 2R29L 4M6NH 3VG0H 1H15B 1JWSB 1XR9B 4ZUTA 2B20A 3IJHA 1HILB 1Q1JL 2MQCA 4CVXA 3FFCD 1FFRA 1JPFA 1QKZL 1B0RB 3BO8B 5CEYA 4XVUD 5IMMA 4G9FB 2FWOB 2VH5L 1N7MH 3O3DB 5CINL 2XNAB 1DBML 3L7EB 2ADGB 3QCUH 3Q48A 5HHOE 3CFKB 3DGCR 1MAKA 2EDWA 3VCLB 1QLFB 4X9IA 4HKJA 4Q9CA 3ARRA 4R26L 3VFTB 5FGBC 3VFSB 3VWKB 5TGBB 4OCRL 4PJAB 2AV7B 4N0YH 2JCCE 5ID1A 1HHJA 2D9QB 3BKJH 4GRMA 2CGRH 5LJYH 2ZCHL 1CS6A 2C3GA 2LU7A 4R90H 5KAQG 1GZQB 2HWZL 1JGDA 1Z9LA 2IG2L 4RNRA 1OSPL 4RGNC 1ZHNA 4WJ5A 1NCAH 4ZUUA 1X44A 3DVGA 4K8RL 5SX5H 3W0WA 4PJGF 4QHKI 3WYRA 2VLLB 1WCBA 3KPLA 1AIFB 1XIWA 1YDPA 5DWUH 3QUZC 1OTTC 1WZKA 3LZFL 4P46D 4QHKJ 4LPTA 1JNHA 2P8LA 5GGSB 3RHWK 1MAJA 2D03H 2XI9A 4HBCH 2BOCA 5FKAB 2RIKA 3M1BA 5I1HH 4FP8H 4PUBH 5I0DA 3MLUL 4QEGA 2VE6B 3RY6A 5CEXB 1FO0L 4R7NB 3DVIA 4WNQB 1RI8A 3TV3L 2YRLA 2G2RB 1XR8A 3IFPB 4M1CC 4OV5B 4W6YB 3LKPA 4B0MM 4ZTOL 2VZ3A 3JV6A 1VESA 5IJKC 3KPSE 4CN4A 3GSWB 3RL1A 2GCYB 3EYSL 4HZLA 5JOFB 2BJML 3C60A 4O2CB 4YHKL 1V3KA 4OZIE 4LIQH 3ARGC 4ZAKD 5EOQL 4LF3B 5JDSA 2VDLL 3HE6A 4ONHB 3PJSA 2WWKT 2Q8AH 4LP5A 3ZHKA 2GW5A 2E9BA 3ULVD 4X6EB 1YEEL 1OARH 3RUGB 3T0EB 1KLGA 5ADOL 4ELMB 2CRZA 3LN5B 5KW9H 2AQ3A 3V6ZB 3BW9A 5CWSA 3MJ7A 1YN7B 5A3IC 1OM3H 1S9XB 2X5PA 4ZO7A 2X4TA 3LKQA 4LU5L 1W0WB 1I1FA 3O3EB 3UBXB 4HH8A 1U3HD 4X4XA 3TVMC 4WTXA 3E2HC 4F7EB 1S7UA 4PRNB 3EYUL 3PDDA 2UZYB 4GXVL 3EYVA 3FKUS 1H15A 3MV9D 3NCMA 1T6VN 4XPTL 2JB6B 1YNLL 3P30L 1XF3A 2ADIB 2RFXA 5DHVA 4K23L 5GRJH 2ZWLT 1KUMA 4F9LC 4G9FA 3WO4C 3TA3D 1HKLL 4L8BB 3O3DA 3PL6B 2XNAA 2ZOKB 4JE4B 4LVNB 2ADGA 4OGYL 5H2BA 4PRID 3F6LA 2NY7L 5LGKA 3JWDL 4QHLB 4JFYA 2AXHA 4L4TA 2WBJA 1CL7I 3VWJA 3ELAT 2C5DC 2AV7A 2IAMB 4XCNA 5BVPL 2EC8A 4UIMB 5E8PB 4CMMB 2FO4B 1OGTA 1J11A 3QNYB 3GIZH 3RQ3A 2EE9A 3EDFA 1JGEA 1H5BA 1HK6A 1T20A 4HX1B 1GJIA 2CIIB 1NGXB 1T5XB 5EUKA 4JFDA 2VLLA 4WWID 5CS7A 5TQ2L 3T0WA 3FB7B 3UTTE 2R4SH 4Z5RB 4Z7OF 2X9WA 3P11L 5A2KH 2FECL 3HLAB 3H6JA 3VFWA 2RR3A 2FHBA 1QBLL 4NQXB 2HFFB 5EZLA 2MQ3A 4NWUH 1W0YT 3GMLB 4J3XA 1IC5H 5HHMB 5FKAA 4BSVA 1PEWA 4AJ0A 2APTA 2VLRE 3QUZD 3WIHL 5CEXA 4X6FB 1D3CA 1MCIA 1RZFH 4R7NA 2QSCH 3W82A 4UQ2B 1T1ZB 3L3OA 1EEYB 4FXLA 4KJWC 3JXAA 1JIBA 5DHVH 1U8OB 4ZO8A 2EDOA 1YY8B 1C5DB 1TVBA 3VFNA 2ID5A 4NFDA 5KANG 1JTPA 5FGCE 3RVXC 1T0MB 5HPOA 2ITCA 5E9DD 1L7TH 4M1CD 3QO1B 3GHEL 4LF3A 1HQ4A 4FMFA 2R2BB 1JHKL 3PGDB 1MRFL 1BWMA 4FQCH 2MQ0A 1XGQA 4TRPL 3KLHD 1A3RH 2HFGH 4HWZB 3RUGA 3LN5A 1YQVL 3LY6A 3O3UN 2I9LA 5IW6B 5E08H 1EMTL 4PJ8A 3O4LD 4NO2A 1BFSA 4KAQH 2HLFD 1W0WA 1MEXL 3DX9A 1VGEH 4KGJA 4KKLD 1XGPA 2P8MB 3BPLC 5E6YA 3U0WH 5D1QB 5GS1B 1T7XA 4G8EB 3E6FA 5GSVA 2B2XH 2AEWA 4LLDB 5KOVC 4ORZC 1GHFH 3D25B 2HMID 1LVEA 5IV2B 2ADIA 4BH7B 3MV8E 4P2YA 4WRLA 2BOBA 2XZZA 3ZHDA 3RUGF 3RWJA 4ELMF 4L8BA 4JKMA 3VGAC 2IQAA 2YKLH 2VLKD 3NA9H 5C6PB 3X14B 4MA8H 2BY1A 1NGYB 4WCYH 3I3BA 4A6YL 2CKBB 4D9QE 2DQGL 4JFHE 3ZTJG 1HSAA 1ZA6B 1R3HB 3WNLA 7CGTA 3DYMA 4JQVA 4JO4H 5C08D 4X5XB 3MRCA 2IAMA 2XZCH 2IBZY 5HHVH 3VE0A 5HYJB 3KR3L 1AHWC 3JWOL 4YBQD 4TSBH 3QFJA 3SPVB 1SVCP 1MFNA 2FO4A 1H3PH 4HULB 1MAMH 5T3XE 5I1GH 2UZIL 3E3QC 2X9XA 1M71B 4H8WH 1NGXA 1T5XA 3AS1A 5EWIH 2QQLH 1EZVX 2NY5H 2X44D 2NY1B 2AXFB 3S3SA 3O0RL 4AQOA 4Z5RA 1A7PH 5I1KL 4G6AC 4U1KA 4RGOL 5DJXB 1QSEE 4NHCL 5MHSE 4MB3A 1A6TB 2W38A 2YPVH 3WD5H 3RTQB 4MNHA 4QF1B 5T33H 2JJUA 4WO4C 1FVCB 5LCVH 5T5NG 3WFBL 5CEZH 1HHKB 3VFPB 2ESVD 3OB0K 4PRHE 1T2XA 2YPLD 1KXQE 2FR4B 5AZEH 3NZHL 4P59H 4BFEA 2BNUB 1JPSL 3CMOL 2GY5A 4KU1A 1I9RH 3VRJB 1T1ZA 5A2JH 3O4OB 4OI8A 5D8JH 1FLTX 3VWKC 5DZOA 2Y7QB 1SY6L 3QNZB 1YY8A 3FB8B 4HT1L 3MXVH 5I2IA 1T66C 3BMWA 5DMJB 4KROB 3MYJB 1RIUH 4MQTB 1BAFH 1UH3A 3STZB 3B5TA 5BMFH 3MGAA 4PLJC 2BVPA 2A9MH 5F21B 5JHDD 5GRUL 2GT9B 3GRWA 1LEGA 2AJ3A 2R2BA 3DX6B 4FFYH 3WS6C 3QIBA 4HWZA 4JRXB 1TENA 3OKNA 3WXVL 2WV3A 5E6ID 5IW6A 2WMPA 2A74B 3BP6A 4V1DB 2VWEE 3SDCA 4YEFA 4HFUH 1N6VA 2V9TA 3TYGL 4LASL 3W2DL 1I8IB 2F5AL 5D1QA 5GGVH 5GS1A 4YHMH 5D7IE 1O5DT 5IMKB 3QUMH 5HHXH 4LPVA 4OCSL 1R6VA 1FAKT 4UDUB 3R8BB 4G8EA 3B9DA 2PR4H 2HG5B 2P5WB 1N0LA 3DTXB 4PGEB 3QCVH 4H1LA 5DFVC 4HH9B 4OJFH 3UDWA 5IV2A 4BH7A 5SWSB 3UC0H 3S4SB 3U79A 3OB8A 4HG4J 3K7UA 5CJXA 3OKLB 4BZ1L 4JM2A 2XPGB 4IRSC 1A3LH 3WNPA 1JZ2A 3MRJB 3S3JA 1T3FA 2D7PA 5E2WL 4PJHB 4XCFH 4POZC 1DQMH 1HYSC 2VLJA 4GW4A 1CLZL 5F44A 2VOTA 5CMAA 4LCWD 3INUH 3R06A 2F5BL 1QFUH 1T1XB 1F3DH 1R3HA 2SEBA 4CJ0A 3FQTB 4Y7MA 4X5XA 5D72L 1P6AB 4G7VH 1MCKA 4N8VB 1TLKA 5JTWA 5I1IL 4EKXA 4PJBE 3HB3C 4OM1H 2E7MA 5FUZH 2Q7YB 1RZKL 2NMSA 2AV1B 2J5LB 3HFMH 4GG6B 4JJ5A 3P4NB 3WHXB 4AT6B 1C5CL 1YNKH 4JM2F 3GRWH 4I0CC 4MXWL 3U6RA 1Z5LB 5DTFB 4C56D 4P5KA 4KRPB 1AKJD 3VFOA 1KJMA 1XEDA 3BKCL 5D2NB 2A1WH 2A0LD 3WNMA 5B4MC 4RQQB 3MV7E 3VI4E 4YDJA 2WINA 3RTQA 3QSKB 5DMGC 2WSKA 4HF5H 4QXGL 1NMCB 3PL6C 3G6JE 3SO3B 4LVNC 1BZQK 4U6TA 2UYLA 4KK8D 5GHWH 2BY3A 3TC9A 3ZYJA 3ZKND 4PJDA 4EQ2A 5I66B 4X7DC 4LLMA 4X4ME 3P0VH 5HDBE 1IGIH 4G6AD 3WFCL 1A7QL 4R0LC 4X7TB 3WFDH 1DANT 1IQWH 2P45B 2B1HL 1TTGA 4HIHB 1PZ5B 4MVBD 5DSCB 4NNPL 3RVTD 2X4NA 4H1LH 4XB8A 3O6LL 5C07D 4LLYB 2L7UA 4WO4D 3U7WH 5I17B 3PV6B 5L7XH 2OM5A 4BSWA 1N6QL 3LDBC 3HNSL 2V7HA 4R6UA 4UINL 3TBTB 3L5WA 2DQIH 3BVNB 4JDZB 5TH2B 1G9EA 1KFAL 1MHHA 3CVHB 2XFXB 3GMMA 1S9WB 3MGOB 3QFDB 4JFFB 3SY0A 4DTGL 2PYFB 4RAVB 2GT9A 5ID0B 4LCIL 2B0SL 4L3ED 2YD9A 5C0RH 4MNQA 5SWQA 3BN9D 1WWWX 1KCKA 1AD0B 1FNSL 1ZMYA 4PJDF 3AY4C 4HEPG 4XPHH 4X9FA 2GSIB 1YEGH 1BBJA 5FYJH 1AO7D 1ZT4B 5CGTA 3OF6A 5C1MB 2BFVL 2VO5A 4UUJA 3GHBH 4IDJH 5C0DB 1BIIA 5IVXA 5HGAA 4FTVD 1CGSH 1TZHB 5IMKA 5FOBA 4Q9BA 1T0NB 4UDUA 4AIXA 3MJGX 2OJEA 1IGCH 4NT6B 1YMMA 5JW3H 4MD5A 4PGEA 3FZUC 3CXHJ 4P46B 2I27N 4OLZL 2NW2A 1NEUA 2F74B 3OKLA 1WCQA 4MJ4A 5FYKU 2P7TB 4MAYD 4OLUL 4XCYB 4GKZB 2FX7L 4PRPA 1VFMA 2EECA 2FEEI 4JFQB 2R8SL 3RU8H 4OD1L 1NDGB 3QI9C 3H3BC 4UQ3A 4P3CL 1BD2B 1T5WB 4OB5L 5K9QI 2NX5D 1CFTB 3SDYH 4N8VA 4Y4KD 3BSZL 3SKOB 2D0HA 5FA3B 4L9LB 3ZE0E 2Q7YA 5HGBB 2AXGA 2IGFL 1IC4L 2G75A 4PR5A 2XTJD 4PRBA 4JANB 5D7SH 3H9SA 3FN0L 5JPNB 1LWRA 4GO6B 2FGZA 1UZ6F 2C1PA 4PJHF 1C12B 1I85A 1WC7A 3QZWB 3VXPA 4XNQA 1MFCH 4JAMA 3BDYL 4Z7WE 1VACB 3UO1H 3IDIB 2K1MA 5DDHA 1QHPA 1KN2L 4KUZL 2DMKA 3EO1A 4GSDL 3FL7A 5EDXA 1BVLA 2NNAA 3MRIA 5F7DB 5JNYB 4F7TB 3VXRE 1X4XA 1IILE 2OJZL 3MRRB 2XG4A 3V52L 1ES0A 1WGOA 2HVJB 2R0LL 2N7BA 4ODSL 3L6FA 4CNIB 1NBVH 4K8RD 5HPMB 4HGMA 3MV9B 3NCJL 4HIHA 3S5LB 5T1KA 3B9EA 1BREA 1MQKL 2O5YL 3FFCA 4Y5YC 3DXAD 1JZ7A 3GSUB 3LRSA 3LH2L 4HUMB 4EVNB 4ZNEA 3DRTB 3ZDYF 3TBTA 2PETA 3TA3B 4D9LL 1IL1B 1DLFH 5TH2A 1QR1A 4OM0H 4J4PC 2M2DA 1A6UH 2PYFA 1TETH 4LHUB 5E1AB 4EI5C 5L2JB 4LCCC 3EDDA 4CN6A 2YUWA 4POYA 4YK4C 4LDEB 2D2OA 1BPVA 2NY1C 1KXVC 5FDWB 1DVFB 4DZBA 1NC2D 3DV4B 5EBLB 2BXZA 3LEVH 3RL2B 3GSRB 3VD9A 4OFIA 3UXFA 2ICEA 3HRZA 2BNRB 3CLFH 1DQDL 1E6JL 5LXGL 4DVBA 2OLDA 3V79C 3B43A 1S5HA 5BVJB 1ZLVK 1TZHA 3ARYA 4NKOB 1UB6B 1T0NA 1CU4L 4Q74A 4D0CB 1T2JA 3D1MC 4WEBH 4WUUD 1RVFL 1P9MA 4AG4H 3O3BB 1N0XL 1LO2H 4P46A 5HI3C 1NUGA 3FQUA 1NGWB 5HYQB 2KQNA 2X4OA 1KJ3H 1TQCB 3HR6A 2I07B 4MWFA 1H3WM 1ZWIA 2J3SA 1FJ1A 5FCSH 3IAGC 4GKZA 2DLGA 2NY6C 1EO5A 3TBYA 4OCYL 3C2AL 1D5XB 3DETC 5A40E 1MJUL 4KI5E 1F3DJ 2VB5A 1T5WA 2X05A 3TBVB 4GAYA 1H3TA 1PFCA 5FA3A 4L9LA 1I3RA 3JTTB 4YXHH 3BT2H 1HYRC 5E9DB 2QL1A 4MJID 3TBVA 4ZAKA 2JK5A 4WU7A 2UZXB 3HAEA 2Q8BL 4P49A 1C12A 3KPOA 1SBBA 3IDXL 5DQDH 1MPAL 3T04D 3H42H 5C6TL 4RFEB 4Q9QL 4G6KL 4U2YA 4PS4H 1QNZL 4PP1C 1XGTA 1Z9SA 1CCZA 3AU1A 4C4KO 2UUDK 3HC0B 1SYVA 3O4LB 2VN7A 2YBRB 4NCC1 5DXWA 2AEPL 4HBQA 4XBEH 4F7TA 1MWAB 1NL0L 3GK8H 4B7LA 1U3HA 2HT2D 2ICWA 4Z7UE 4U05A 4YLQT 2HVJA 4UB0L 5IROA 3DRQA 1KJVA 4OZHB 3ULUC 4X83A 4HWNA 3MV9A 3S5LA 2BSTA 2X89D 2DOCA 5I18L 4U3XA 1YEDB 1PGRB 4FABH 3GSUA 3QEQB 1KB5A 3UROR 1A02N 1JPGA 2MCG1 3X13A 3PGFH 3QHZH 4IOFD 2BERA 2HRPH 3V4VH 5T3XL 3TA3A 1IL1A 3GSOB 5HHPB 1UACH 2J5LC 4M7JL 4QNPF 3QG6A 1RMFH 3RDTD 2VLKB 1Q38A 5IBTH 3MCG1 3QXAA 4PRIA 4OGXH 4ZD3H 4KRPC 3RWHA 1JPTL 3ARDD 2VZUA 5FDWA 4KTDL 3WDIA 1T03L 3RL2A 5EU5B 5JQHC 1P53A 1QZ1A 4L5FL 2VQUA 3TT3H 1MI5E 2DS4A 4PPTA 4JKWA 3UTQA 4HQQL 4YE4H 4EI5D 1X9QA 4BFIB 2C1OB 3KJ6H 4QCIA 1DBKL 3VXMB 4OCXH 4DW2H 1J1XL 1DFBL 1MFAL 2VDPH 1KF9B 3C08H 4W6XB 3HAEH 4NKOA 3OAYH 1UB6A 1RUPL 4D0CA 1FNEA 4RMWA 1YA5A 2VXSL 3ULVH 4WTWA 3MJ8B 4KWUA 3LOWA 3IF1B 4OCWH 1UWGH 3TWCL 4FQLL 5TFSH 5DC9B 1LQSR 1DN2A 1NGWA 4W4NA 3RIAF 4NBXB 3HC4H 4G8IB 4YXLL 5C92A 1H3XA 4U1SB 3U7AA 3QH3A 1CT8A 5DJ2B 3KHOA 3BP4A 3QUZA 1F4YL 3UTSB 3OAZK 1D5XA 3L5IA 4QHUB 4TUKL 1QEWA 2HJFA 4JN2A 1KCLA 4XX1G 4Y5XB 5DLML 4CU7A 3A67H 1RUAL 3CSGA 1EPFA 3IDGB 5D71H 3RFZC 2MHAB 1KB5H 1EO8L 5E2VL 4HKZA 4TUOB 2NY6D 3LQAC 3LKSA 3K2UL 4KVCH 5F9OL 4Z0BH 3RAJH 3C5ZD 2XWJB 5E9DA 1Q72H 3W0WE 3H7BA 1C1EL 1QLEH 1WBYB 1GGBH 1NPUA 2EDQA 1S9YB 2DQUH 4JFED 3RI5F 3CLEH 1NLDL 2DI8A 2ARWA 1FPTL 1CG9B 4PJ5D 5H37H 3BI9X 4GRLD 2PW2A 2H26A 3ARBB 4P9HH 3O4LA 4P57B 5INCA 1MIML 3JTSA 4FG6C 4MB4A 4UT9L 4PY7A 2Q3ZA 4YUEH 5IFHL 1DDHB 4YX2H 2Q86A 4GMTH 4LPUA 4QRSA 2Y36L 3IDMB 4EIZC 5JXED 4K7FB 4YFEA 2W60A 4MA1B 4KY1H 1YEDA 4OZGA 4PJ7A 1UCBL 2FB4L 3O3AB 5JW5A 3QEGL 2VN4A 3CZJA 3GGWB 3OSKA 3DI3B 1ZT7B 1T04A 2AKRA 4PRDB 3QWRD 3BOVA 1JV5B 1ZANH 2FBJH 5BW7C 1L4IA 2VLKA 3HC3L 43CAB 2X7LB 2CD0A 1ERNA 1K3IA 1V3MA 1IQDA 5E4EC 4RAHA 4BFGA 1CVRA 3L3DB 5CUSH 1XZ0A 3OR6A 1SJHA 3MO1A 3OKDB 3BP5A 1CZ8L 3MLYL 5GGTA 4OZHF 3VH8G 4JFZH 1GGTA 5C08A 2DQTL 2MCPL 2ICCA 4P9MH 1RAMA 3ZDZF 3PGCB 3KYKH 2CJUL 2XZQL 25C8L 4HK3J 3WNOA 4HPOL 3ZSTA 4PJ7F 3KWWA 1VFBB 3TH2T 5J13C 2X1OA 1K5NA 1SMOA 2H6PA 4AL8L 1ZGLA 1AGCB 1UJ3B 2OP4H 4R8WL 5I8KL 5K59E 2QQNH 4UU9A 3VFGH 1YECH 1HH6A 4MYWB 2C4XA 4PREB 1PQZA 3MJ8A 4XCEB 1U8HB 1E28B 1GC1C 3ZE2F 2WWKO 4XVSL 5FO8A 1JVKA 5E8OB 1H3GA 4G9FE 4HWBL 4G6FB 4TTGA 3EHBC 4HPYL 4OAWB 1F58H 3WKML 1BQSA 3G5XB 4W70A 1UVQB 5C0BD 2AJXH 3MLXH 4PBWD 4NJ9H 5J6HA 2ESVA 1WWBX 3NACL 2BMKB 2VC2L 4QRQB 1ZV5A 2YPLA 2NW3A 3PWUA 4Y5XA 3ZE1F 3DX8B 1AR1D 1DVFC 4FXGB 4IRZH 4POUB 4P2RB 4WHDA 1UWEL 1FNGB 2MHAA 3LKNB 4LMQI 4HCRH 3BE1H 1AXTL 3UJTH 3F7PC 2FZ3A 2YS4A 4W4OA 3F12B 1DBBH 3TIEB 3ETBF 1OWWA 1MLCB 5HJ3A 5JHDA 3OXRA 3PE9A 2QBWA 4JFDE 4JFXB 3QQNA 3B6SA 5CBEB 2EDNA 1WBYA 1S9YA 3SKUD 5CSZB 4NO5A 2YZ8A 1OGAD 2EDRA 5F9DC 1BQHA 4WI2A 1WZMA 3T09A 4RZCB 5E6IA 2XZAH 1OW0C 5CGMA 4WI5A 5AWNL 3QG7H 2VJXA 3LEXB 3QIUD 3HRPA 3FO1B 5GGRB 5I6XB 4ODXA 1NKOA 1B0GB 2B1AH 4FTVB 2J4WL 2DDQL 1QBMH 4NNXA 1HKFA 3DMMB 4MZ3A 5IFAH 3LKOA 3IDMA 3WSQL 1C5BH 1YYML 3VRIB 4RA0C 3WJLA 4K7FA 1GGCH 2CK0L 1U91B 3BDXA 3GGWA 4QOKB 4Y2OA 4WFFE 4NKIH 3UPRA 1UM6H 4I5BA 4TOYH 3K3QA 4MAYB 3QAZB 5JQ6L 1SEBA 5KVFL 3FOMB 2HVKB 2I5YL 2X7LA 1V7NL 4U0RB 3J7HA 4LCWA 4R2GC 3WFHB 5F89B 1LE9A 5JOPD 1WTGT 4OF0A 3TNMB 4JZOB 4ZMAT 3RUGE 3SE4C 3T0EE 2EYTB 1FZMA 1QRND 2DWEA 2NX5B 1CLYL 1I9IL 3PGCA 4M5ZH 3BKML 4Y4KB 3WKNA 3S35X 4Q6IC 5GJSL 3MLPA 4EXPX 1FORL 4I0KA 3KGRA 5TPWH 2H9GB 5FA4A 5IB4B 2X4RB 2EYSA 1DQTA 1IEAB 3MNWB 3GMQB 3UTOA 3PF2A 3HPJA 2AJUL 1CL7L 1AGCA 4C56A 2ZUWA 1S9VA 1UJ3A 3NOIA 1AKJA 4WWKC 3QUKB 4JFOB 4HMCA 1MF2L 1YJDL 3UAJD 3CFCL 4UT6L 3ZT5A 3NPSC 2B5IB 1OAZH 4LSTL 2HKHL 4MSWB 2H1PL 2Z35A 1JZ3A 3HMXL 4OAWA 4EBQH 1A2YB 2NY3D 5C2BL 5IMLA 1BM3L 1RULL 4FXKA 4UDTA 2FCBA 1UVQA 2ICWI 3JZ7A 4PBXA 5BS0D 2WIIA 4MD4B 5ISZD 2ICWJ 4OZFB 5KZCD 3IAPA 4JREC 3TESA 1T22B 4FXGA 2BSRA 5C07A 4WO4A 3DXAB 4CL7A 5KSBA 2AK4D 5F72S 3UYRH 3QFJE 4KTEH 2JF1A 3D3VB 2R2EB 4GT7A 4JY4B 3EFDH 4AH2B 3F12A 5IR1A 2HJKB 3S36L 1WEJL 5MENB 5D2LA 4FA8A 1J7VR 2KL6A 1GPOL 4HXAH 5C09B 3F65A 2CUMA 4L3EA 2ZJSH 3OMZA 3PWNA 4U1IA 4XNMB 1FO0B 5E99L 2AQ2A 4LARL 5CSZA 1NMAL 2DTMH 5L9DH 1DBJL 3EIFA 4IMKC 3T2NL 1HHGB 2HT4C 1KTDA 3DURA 5J56B 4GAGL 4FQ1H 3RP1A 1NBZA 4KKAC 1TJIH 1AO7A 1ORSA 4KVNL 1EBPA 3T0DA 1YY9C 5I74C 3TBWB 4JJHA 2Q6WB 3FO2A 2GJ6D 1F8TL 4IIQC 3TJHC 1IKNC 3MFGB 4FTVA 3MOAL 5JOEA 2VL4A 1NCBL 4JO2H 3OQ3B 4MDIA 2KZ1B 4WUUB 1MCSA 1KCUH 3B3IA 3P0YH 5EU6B 3OL2A 5GGQL 3EOTH 5IFJA 4XWOC 4I3RL 2ZUXA 5GPRA 4ODVL 2ZUVA 3RKDC 1A6VH 5DD0L 1MCCA 3OKYA 3TO4B 4XBGB 1JK8A 3GKWH 4MAYA 1DCLA 4M6NL 3T1FB 1WITA 4NQDB 3FOMA 5FK9B 3WV0A 5F89A 1CD0A 5HTSA 1ZEAH 3TNMA 4JZOA 4Y4FD 2COQA 2E3VA 3RWGB 5KJRH 4MS8D 2NXZD 2OMBA 1N7ML 4IRSA 2NX5A 5LWYH 2R0KH 3SHSA 3U30C 4WV1B 2BY2A 3QCUL 1UH2A 2X70B 4Y4KA 5DQ9A 3SDXB 1LE5B 1U8LB 3ARBC 1P4LB 1FGVH 1U93B 3WNNA 1HHIA 4F9PA 2H9GA 1A64A 2O5ZH 3IFLH 2Z92B 3BZFA 4U6YB 3WDJA 3GMQA 3BHBA 5CZXC 4AMKH 5BOZG 4Y4HB 1P6FA 4P23D 2DQDH 1MY7A 4N0YL 2F53B 2V17H 2Z4QA 2QR0B 3BKJL 4QRPD 2CGRL 3V5HA 2CO6B 3LV3A 4G43B 1M4KA 1S78C 4MA1C 3P9MB 3FT4B 4R90L 1J8HD 3L3GA 3RWIA 4MSWA 3ISWA 1G1CA 4M4PA 5DQJB 3JV0A 1RZJH 3ZT6A 1NCAL 2K7QA 1I7UB 2FDBP 4J3VA 3U4BH 4OFYD 1RFDH 2VLJE 3IU4H 1P4BL 5DWUL 5JW4R 5B39G 3IDNA 4YJZL 3MNVB 4AEHH 4GAFB 1A4JA 5E24E 2OQJB 4X9BA 4Y1AD 4HSQA 4CU6A 4MA3B 1MCWW 2QADC 4DOHE 2D03L 2WBKA 4HBCL 2RJMA 3DXAA 5HHQB 5KAQF 3QUXD 1MCWM 4FP8L 4PUBL 2PW1A 4M8VA 4EI6B 2R2EA 4ESKA 5KSAD 3NZ8A 1T80A 1MJ7H 2DWDB 2EE6A 3G6DH 5FHAH 4R0LA 2HJKA 3BGAA 2ARJQ 1HEZB 4HLZH 1K9TA 1U2CA 4XNMA 4PLNC 3DUSA 2YUXA 4Y88A 3CFJB 1BWWA 2BVOB 2CDEB 3RGVC 1NC2A 3CU7A 1RIHH 3CX5J 1U36A 1IAKB 5JHLH 4YEEA 4JO1H 2JIXB 1WWCA 2OZ4H 2FYYB 1IBGH 5EBMB 3TO2B 3OWEA 2Q8AL 5DJ8B 4PJDE 4BZYA 4JGJA 3U83A 2DQCH 3I3DA 5MEPA 2EH8H 3AY4A 1OARL 1UC6A 4V2BA 1J5OH 5KW9L 5IBUG 5DC4B 5DO2C 5I1CH 3MBEB 4WUUA 1JN6B 3IU3A 3QQ9D 4KKAD 3ET9F 1OM3L 5C0FA 5DURD 1NCTA 3MCKB 5ALBH 1F5WA 3MRPB 4LRNL 2PO6D 3NIFF 5TE6H 1JP5A 3SBWC 4LSQH 2CUIA 4WFED 4WEUD 4Z6AT 4XBGA 4DN4H 1QSZA 3T1FA 4NUGH 4KK6D 4MQXC 5M95B 3G6AB 4YFLI 5FK9A 3CD4A 1FV1B 1LEIA 3O6FB 4U7SA 5D6CB 2ZUQC 5GRJL 1DE4A 1EVUA 4NC1E 5I30H 3CFBB 2E7HA 1W8OA 3P73B 3G9VA 4XNXH 1Q0XL 2PCPB 3JVGA 3D39D 4WU5B 4PJFA 2P4AB 4GAJH 1U8LA 4R7DB 4V1DE 2GAZB 1SYSB 3KPPA 3PNWA 1F3RB 3VJ6A 5IVXE 1U8JB 4NO3B 1NSNH 1XCQB 3C5ZB 2Z92A 4YDVB 2NXYD 4MJIA 3MREA 1I1YB 4LNVA 3K46A 4CW1B 1YMME 4A6YB 4EDXB 3BQUC 4HIJB 1DANU 4X7FC 3VDBA 2IH3A 1JI2A 4G6JH 4HIIA 3RWFA 5SWSE 3HR5A 5DHYB 5BCAA 1ZHKB 4PJ5B 4Y89A 3ZTNH 3GIZL 4GRLB 1N8ZB 4OLYH 5DQJA 4XH2B 1XGUA 1UZ6E 2IMNA 1F02I 1FZJB 4W68A 4MLSA 3C9NA 5D7KD 5FYLE 4PRPE 3SDXF 3QAZC 1CIDA 3TPUB 3E8UH 2R4SL 4ZS6D 3FB6B 4LGPB 1NCCH 2YA0A 1WFNA 3MNVA 4FQXC 2XWBA 1XF4B 2X89A 4MA3A 4NWUL 1T83A 4IM8A 1OB1A 1IC5L 2R4RH 5HHQA 3HZVB 2OTUB 2VUYA 5EIIB 2B8OT 3EYOB 3T65B 4GS7C 1FIGL 2AAVA 1CICB 5CP3A 5GRVL 3AGVA 1RZFL 4JKLA 2F8OA 2ILLA 2QSCL 3GSNA 3H9SE 1B90A 5CSGA 3RDTA 4HKBB 3EFFA 2CR6A 3AM8A 3WIHA 3I84A 1AC0A 1A9EB 4Y5YA 3WIIH 5EO0B 3ARDA 1KCVL 5D2NE 3T4AB 3NGBB 2BVOA 5FKPA 2CDEA 2W91A 3KLDA 1IAKA 1CGVA 5F7NC 2B5IC 4U6HA 4AIZA 5EBGA 1L7TL 2KDGA 4IJ3B 4EI5A 2VQ1B 4NM4H 3TO2A 4GJTB 4LCCA 3K8KA 5JDJA 5DJ8A 2GTWA 1ZHLB 4FQCL 1CR9H 4TSCH 1AXSB 3NFSH 2BHUA 4I77H 1A3RL 2HFGL 1IGMH 2E6PA 5E08L 4LEOB 4WHTA 5EPMB 3FFCE 1B6DA 4KAQL 3MCKA 4ODWB 2EDTA 4R4FH 4TNVF 1VGEL 1HH9B 4R4BA 4NSKB 3G04B 2HKFH 3U0WL 1MLBB 2WM0A 2I60H 1PW3A 1ZAGA 5EZIH 1YN6A 2BDNH 4MCZA 3ARXA 4HUUA 3MLTA 5CKAA 2IALA 2B2XL 4JG1H 4XBPA 3G6AA 1FV1A 3L5HA 1GHFL 2XQBH 2E7LA 3QA3B 1WIPA 1OTSD 1IC1A 1GXEA 3BIKA 1MRCL 4M7ZB 4X8XA 2IC2A 5DRZA 3P73A 1BBDL 2YKLL 1KTRL 3NA9L 4MA8L 4WCYL 3TF7C 5DJZB 1CE6B 1SYSA 1FYTB 1U8JA 5ABDE 1NBQA 3UYPA 3C5ZA 3SO5A 1FSKC 1JL8A 2A6JB 4W6WB 2D7MA 1FVEA 1G7IA 1MVUA 4JO4L 2FJFB 3CPLA 2CR3A 4EDXA 2XZCL 5ICYB 3PWPD 5HHVL 4JFEA 2VKWA 3I6GB 3O6MH 3PHQB 3RA7H 4MLIA 4TSBL 4PGCA 4PJ5A 4YHNB 1H3PL 4NRZA 5I1GL 4XH2A 4MX7A 2P43B 5E5RB 4H8WL 4Q6YA 3TO4C 2QQLL 5K9QG 3TPUA 2NY5L 4M03A 3MROB 3S8WA 1I8LC 5DUBA 4QRRB 2LVEA 1D5ZA 1OQXA 1A7PL 3QXTA 3FB6A 4OI9A 3H3PH 1A1NB 3KPMB 1RURH 3WD5L 3P4MB 5IHZB 4RA3A 3OR7A 5JXEA 4K94C 5T33L 5E8NA 4N0RA 1Q9WB 2JJTC 2OTUA 5LCVL 4Y16B 4Z9KB 4WV1C 5CEZL 4YDKH 3FTGB 4NC2B 4NIKB 1NEZA 3QWRA 4OD2B 4FQXD 5AZEL 4P59L 1KULA 4HKBA 4HWEH 2VXQH 1I9RL 2R2CA 4Y4HC 5CIPB 5D8JL 1S7RA 4NKDA 1A6AA 3MXVL 4Z95H 1I8KA 1NLBH 2GFBB 1RIUL 3A6BH 4ZO9A 4QNPE 5BMFL 5T5NF 3V8OA 4WGVB 2A9ML 1K2DA 3I50H 3U36A 4LLWB 5C0AD 3FOLA 3K8LA 4FFYL 1KELH 2ZCKH 4K71B 4KGLA 1UQSA 3ZYIA 4K3JL 1AGEB 2FNBA 4DKEH 3EOYG 3MV9E 2AJSH 4LEOA 1AP2B 1CXIA 3OGCB 3PWJB 1GZPB 5IG7B 4UIKH 4H26A 5LAXB 1UKQA 5DK3A 3EUUA 5AYQA 4HFUL 1HH9A 2IFGA 2YSSB 4NSKA 4WI8A 5CD3B 4NZUH 4F2MB 2AGJH 5GGVL 4YHML 1PYWB 3QUML 5HHXL 3TZVC 1MCHA 5GQBA 3O9WD 2NY3B 1PG7W 5DRNB 4P4RB 1LGVA 1P69B 2PR4L 1U8QA 3GJFB 4PRIE 5C0BA 4DQOH 3FCTA 4KJPD 5BS0B 1Z9MA 3KNBA 3QCVL 3QEHB 4OJFL 4OTXH 5ISZB 1C7TA 4OGAC 1P7KB 3L3JB 3UC0L 3NN8A 1MQ8A 3U0PA 4GXUM 2YPKA 4CADB 4U4BA 1AY1H 1A3LL 2E8YA 2HTKC 1MCFA 3K4DA 2W0FA 4YHOH 3W9EB 1ZLWH 3LPWA 5E2TH 5AUMA 2BNRE 1L9NA 1QOKA 4XCFL 1DQML 1SVZA 5HVFB 1CE6A 1F3JB 2W65B 2XTLA 2E9IA 3INUL 2D7TL 2VABB 1QFUL 1WJ3A 3WJJC 3O8XC 1JF6A 1RU9H 5IEHA 4LP4A 2X42A 5DR5H 4ALAL 3ILPB 3L5JA 2FJFA 1JWMB 2YZ1A 4G7VL 3OJ2C 1MCLA 4Y2DB 3MBEC 3CGTA 3WL9B 5FUZL 1ZK9A 3CZFB 1KCSH 3I6GA 3PHQA 1OGAA 4GBXC 4APQC 5D6DC 5DD5H 5F9AC 3HFML 2CKNA 4D0BB 4X5WA 4WW2A 2DM2A 1A7BA 5GS3A 4C83B 4RRPG 1YNKL 3GRWL 2GK0A 4NCDA 3QIUA 3MBXH 4HUWB 3DBXA 1RUQH 2A1WL 3T2PA 2YD8A 3O6FC 2FH6A 2EDKA 1FBIH 3TP4A 1CVSC 2CDGB 1FVDB 1FYHB 4HF5L 3FQRA 1L7IL 3OBAA 3LN4A 1Q9WA 1SM3H 5GHWL 4LLUB 1F00I 3FTGA 4E9LA 1PY4A 1B9ZA 1IGIL 4WW2F 3SCMD 5E9DE 4KKCD 3WFDL 4PJ9B 1LDSA 1IQWL 3MRBB 3VDCA 1CFQA 2ATKA 4X8JA 1R5WA 3U7WL 5K9KB 5L7XL 1NQBA 1J87A 3MQIA 4LQ1A 3GUTB 5F8QC 5HVGB 3GFUA 3MRLB 3O11A 3MV11 1HDMA 1BQLH 2DQIL 3V2AR 2NXZB 5EOTB 4KK5D 1FL5A 2NY0D 5E5UB 1QRNA 1E27B 2N56A 4FFVD 3O4LE 3CVHH 3MGTA 1HWHB 3G9AB 2L7JA 3BEWA 1UWXK 2GKIA 1N6UA 4OFVA 3JWOC 1SEQH 5CZVH 1KYOJ 3OAYK 5C0RL 4MNGA 1PVHA 2R23A 3A6CH 4PB0H 4Y8AA 3ARFC 1N3NB 3BXNB 3BPCA 4XPHL 3CSBA 2ZCLH 2LE9A 3UTTB 3OHXB 3PQYD 3ZDZE 4LKCA 1YEGL 1RHHA 5FYJL 3QUYB 5C8JA 2IFFL 3PWJA 4HLJA 4OZGE 3LQAH 4PJ7E 4BQ6A 3FT2A 4L8DA 5HGDB 5FYKH 3GHBL 1RZIB 1QG3A 1PX3A 2Y6SC 4IDJL 5EA0H 4CGTA 4PV8B 5JZ7C 2L4OA 5CD3A 4P2QD 3E6HA 5F7YC 1EHXA 1PYWA 2EXWD 2VLKE 2IH1A 1K4DB 5GZOC 1IGCL 2VLRB 1QP1A 1K6QL 3GJFA 1X7QB 2OXHA 1OTUD 1II4E 1EFQA 5JW3L 5BS0A 1X5HA 3ZE2E 4PV9A 4NKMB 5ISZA 2GEEA 3AC0A 3L3JA 4FQHB 4G8FA 4Y1AB 5C0EA 2A9NH 3TM6A 5C08E 1DUYA 4CADA 2EEBA 3TZVD 1R3LA 4LRIA 4ZPTB 2AK4A 2A77H 5FF6B 4Z7QF 4KKBC 1F3JA 3RZCD 1OP9A 2PYED 2HN7B 3RU8L 3ZE1E 5T1LB 3RIAK 4ACPA 2BVTA 2FJGB 4ZYKA 4DZ8A 2MOVA 1JWMA 3ILQC 4E41D 3SDYL 3VXNB 5CILH 3WL9A 3QIWB 4U6XA 1YQ2A 1JFQH 4XAKD 3N85H 3STLB 5IK3A 1BOYA 1TITA 4N9GB 2C9AA 5D7SL 4Z76B 3GBMH 1T0PB 3AMLA 3ARUA 3BUYA 2GJ6A 2ESVE 4HUWA 1MFCL 4M02A 4Q2ZB 3K81A 4JZNB 4GBXD 2NR6D 4I8DA 4JR9H 3UO1L 3MRGB 2X4SB 3MV8B 4HS6B 4X9GA 4MJ6A 2Q1EA 5DD1H 4MAUH 1GCFA 1G6RA 2NY4B 4M5YH 4L4VD 3IDYB 4LLUA 3B2VH 3RI5K 4XTRD 3REWB 3VGHA 1TCMA 1NBVL 2DTSA 4XZUB 5JHDE 1JZ6A 3V6OA 2ADFH 3S96A 3MRBA 1C8PA 5DEGB 2V2WA 2BVQA 2H2SD 4ETQB 3Q5OA 3QPQC 1GC1H 1AD9A 2A2QT 1CBVH 1XF2B 2HLAA 4LL9A 5K9KA 4K2UH 1A5FH 4Y4FA 4TVPH 4TNWF 2DLFH 2YN3A 4KMQA 4Z0XB 4JDTH 1DLFL 5EH1A 4OM0L 1NAMH 1A6UL 5GGUA 3VD7A 2DYPD 1TETL 1I1RA 4U1LB 3HZYB 4O58H 3L3IA 4N9OB 4G6MH 2X4QB 1N3NA 2NXYB 4E42A 3B2UC 3PUCA 3LEVL 1HQRB 4P23A 1HI6B 4X4ZA 1IZKA 3D85D 2Q3AA 1BFOA 1D5MA 3VFMB 4QRPA 5F7UA 1A1OA 1QSEB 4KUCD 4CMHC 5HBBA 3CLFL 5DD3L 2APBA 3O6KH 5HGDA 4ODTH 1J8HA 4IOIA 1BMGA 5IQ7H 3DWTA 3PXHA 3JUYA 1I3UA 3EO9H 3AREB 2CDFA 4RFOL 4OFYA 2XN9D 3LPFA 2AEIT 5I76A 4WEBL 2R0ZH 2EZ0C 4PRHB 3AVEA 4AG4L 1L0YA 4GKSB 4LCWE 4G3YH 1QFHA 3H9ZA 2OK0H 4NKMA 2I24N 2Y6SD 5KSUA 1KJ3L 3G5VA 1G6RH 4ZXBB 1FCCA 1BQUA 3QUXA 2Z31C 5HY9A 4YNYB 5KSAA 4HHAB 1VKXA 4CBPA 3F7VB 3CX5K 3RGHA 3F5WB 5DS8A 4C56E 5GRZA 1AGFB 1AQDB 2XKNB 5GGRY 1VFAA 1G9MC 2HJLB 2IQ9H 5L2KD 4KHTH 3CNKA 2XKSA 4ZUVB 4YXHL 5BJTA 3BGMA 2VR4A 4ZTPH 1AGBB 3LB6D 3QJFA 4Z76A 1FFOB 4QHMA 5FV1L 5EBWB 5D7IB 4ZFFB 3JV4B 5DQDL 5FO9B 5MI0B 3H42L 3QQ3A 4PS4L 5ESQB 4XCCH 5DRXB 4XHQA 3V7AE 3MRGA 2EO1A 4WI9A 5I16B 3RWEB 5IESH 5F9JB 3UTPD 5C07E 5EU3A 1HXMA 4QRTA 4C55A 4XBEL 1CFNA 3RY4A 3GK8L 1A7RH 2PO6A 1KNOB 5A16B 5F3BA 2MPAH 2OXGA 5I1EH 1E0OB 4WDIB 3GKZA 5D2LE 4L3EE 1R0AH 5B8CA 2DM7A 4KDVA 1I8MB 2OTWA 4MB5A 1XF2A 2GUOA 4FABL 1X5ZA 4Y2DC 4JKKA 2Z0BA 3U9PH 1ZGLM 5C3TA 4F7MB 3PGFL 3QHZL 5DI8B 2HRPL 5FV2A 3V4VL 3IJYB 1UACL 2BC4B 2QLVB 5DJYB 4Z0XA 1AO7E 3D9AH 1RMFL 3D39A 4L8SC 2WW8A 5IBTL 3TNNB 2XV6B 5TDNB 4YGAB 4OGXL 4ZD3L 3VH8B 3MFFA 4N0FA 4O2EB 2V5RA 4FTVE 3NAAH 3AAZA 3P3YA 2V2TB 2HTLC 4XMKH 1ZLUK 3QBTB 1HN1A 4CN1A 3PWPB 1GSMA 2VZTA 3HUJB 4FOMA 1T21A 4X80H 4Z78B 5GS0D 3R4DA 1F4XH 3MV7B 4YE4L 2X9YA 3GSXB 2QSTA 3KJ6L 4MXQC 4OCXL 4RWHA 5M7QA 3MLZH 4DW2L 1W8NA 3G6JB 4F33A 2NY2B 1OSZB 2VDPL 2WWMD 3C08L 2AJVH 1BLNB 3PDOB 3WLBA 4PJ9C 1UG9A 3ULVL 5DK0A 2A83A 4OCWL 3J8F7 1UWGL 2XRAH 4I48B 5IW3A 2V9QA 3FQWA 4J3OC 4X9HA 2NPLX 5TFSL 3C6LB 4BM7A 4FMKA 4NQSB 3HC4L 4ODUB 1TCRA 2NX5E 2FD6H 3PHOA 4DWHA 1B3JA 4NQUA 2R2HB 3ZKMC 3VFVA 1VADA 2QSQA 4KJQD 3CFDA 5HHOD 1CDBA 3QQ4B 2EZ0D 4AIOA 5MERA 2CLZB 2XTJE 1LDPH 2YD6A 2YOCA 1M7DB 3Q3GB 3I2CH 1NC4D 2CIKA 2CXGA 1RJLA 3A67L 3F5WA 1A4KB 3VXOA 2IPUK 2PTUA 4MDJB 2BRQA 5D71L 5IKCA 1X4ZA 1RZ7H 5IIEA 1JUFB 2AJZA 1KB5L 2HJLA 1YEFH 2YRZA 1G7LA 2Z31D 4KVCL 4F37F 2DQEH 3S6CA 5F93C 4Z0BL 3RAJL 3FHQA 4ZUVA 4MXVE 2JJSA 3RJDA 4NP4H 1MY5A 1Q72L 1Z3GH 4NZTH 4OKDA 3GMOB 1FFNB 5EBWA 1QLEL 3SEPA 2ITDB 1GGBL 2J12B 4ZFFA 3QHFH 2DQUL 4R97B 2AXJA 4MGXA 4EEEA 5KOMC 5B38G 5JUEH 1I3GH 1RHFA 4LSDA 1DLHB 5F9JA 4P9HL 3H9HA 5D1XD 3DXAE 4G8GD 3G08B 2Z8RA 5GJTH 1YMHB 1UKSA 3QULB 4YX2L 3TN0C 3D0VB 4GMTL 5TF0A 5IB2A 3O9WB 3PWLA 4IRJC 2ED9A 5E94B 3RVUC 3TCLA 1A0QH 1K4CA 1YPZA 3NIFE 4E0RB 2O61B 5BZDB 1QYGH 3N1QC 1JMXA 2BP3A 3QIWC 4F7MA 2F8XC 3SBWA 5DI8A 3T2QA 2NLJB 1FN4A 2R1XB 2BC4A 5DJYA 1ZANL 1WT5C 4XAWL 3U48A 1YZZA 1KCRH 3V4PH 5CEZD 3HI1B 1ORQB 1OCWH 3T2OA 4ZPVA 3VH8A 1ZA3A 2NTFB 1XGRA 5F7LB 1E4WH 1FIEA 4O4YH 5CUSL 3MRNA 5FB8A 1AH1A 5F7FA 4GRWH 5FCUH 3D2UD 4WUUE 1IARB 5C0ND 4P9ML 4YZFF 4YHIA 3KYKL 2VIRB 3PWPA 3HUJA 2EKSA 4K3GA 4HAFA 4Z7WB 1YPZF 3GSXA 4ISVB 4NOBA 4LOUC 5J0BA 5H35B 2NY4C 4PLKC 2Y07H 1JGVH 3IDYC 1LP9B 1OSZA 2HTLD 3SDAB 1NCDH 4DUXA 3AXLA 1Q9KB 1CE1H 1IRAY 3ECBB 3PDOA 4JHAH 1I3VA 4MHHI 2OP4L 2EXYC 4LVHB 4NYLB 3VFGL 1YECL 3KLAB 4R96B 1G7JB 4I48A 2WLYA 2WUBH 1P5UA 4FQIL 4YHYB 4B50A 4HIEB 1S7WB 4I18C 4ODUA 5D7JD 3A0OA 1P4IH 2EO9A 3DROA 2R2HA 1F58L 4PJFE 5F6IB 3HUJF 5KG9A 3RPIB 1BJ8A 4L8CB 1FZOB 4XMLH 2AJXL 1S7TB 1S7VB 3MLXL 3SKMB 1X4YA 4NJ9L 4K9EC 3UJIH 2CLZA 3Q3GA 1MELA 3CSPA 3QDJD 4S1DD 2W9EH 4MJIE 4JY6A 4FQXA 4ZFZB 1A4KA 5CSBA 3L3KB 2Z8VC 3ARZA 4HS3B 2MTPA 2C7UB 4ERSH 3S35L 1JNLH 1X3DA 4HCRL 3BE1L 3UJTL 3VW3L 3GNMH 4S0SD 4LSSH 4E5XB 1DBBL 4HXBH 4LAQH 3LHPH 5D96C 2OBGA 4IHOA 4LPXA 5JXAL 3BH8A 3AREC 3DVNB 4DKFH 4P4KD 4CDGC 5C0AA 5A43C 1TIUA 2QKIB 5ICZB 2DQFB 4IEFB 5GGTL 1T7WA 4NGHH 1WFUA 4KRLB 1RZ8A 2R1WB 2XZAL 4D3CH 1DLHA 5C7XL 3QG7L 1DUZA 3GI9H 4F7PA 3G08A 4JZJB 1H3VA 4ZXBC 5F3HB 4PTUB 1YMHA 4H0GA 1MCPH 2IBBA 2LV4A 4DJMA 3D0VA 4KDTA 5T5FL 3SQOL 1QBML 5IFAL 1QBAA 3R8QA 2VITA 3O9WA 5F7WC 1NUFA 4KFZC 4WUKL 3ZYOA 2XA8H 5D93B 1C5BL 3CSYA 5E94A 4FZ8H 1GGCL 1U3ZA 4E0RA 2VZVA 2CRIA 1KB9K 1HSBA 4NNYB 3GMRB 3FONA 3F7QA 4NQED 3I85A 1UM6L 4G9DB 3H0TB 4TOYL 4MJ5A 1HE7A 4LPWA 2VWEC 3IETB 4IRJD 1ZVHA 1ORQA 3RZCB 4MQ7B 1M7IA 2PYEB 4XXDB 3NCYP 3WLWC 1OP5K 4JG0H 2YUZA 3O41B 4Y5VB 5MI0C 5HGHB 1AGDA 2Q87A 1PX4A 3OV6A 4R4NC 3MRKB 4M5ZL 4P5TD 3GDBA 2VIRA 3SDDD 4OCNC 5A1AA 4GKOA 1CWVA 2VL5B 3CFEA 1HNFA 4K3DH 5TPWL 4P3WA 1KSRA 3T8XB 5AZ2H 4LCYA 5EOCH 1I1AD 1LP9A 3RWDB 3O45B 1I9JH 4EJ1C 1Q9KA 2D4FA 4P2OC 4WFHD 1JYXA 3C5JA 1NAKH 4C58B 3ZHLA 2F15A 4HGWB 4HKXB 4PJXA 3WN5B 3H3KA 1OAZL 3VFRB 1S7WA 3GJEB 5FYJD 3Q6FA 5HI4D 3VD4A 4KXZH 5C9JA 4YGVA 4YAQB 5B39B 4EBQL 1JNJA 4L8CA 5BV7H 4P0DA 3THMH 3DIFB 3VGGA 1BQHG 4EN3B 3SCMA 4OZFH 5F70A 1QLRB 1LP9F 2GJZB 2UWEA 3MRHA 5D7LD 1MUJB 1RSFA 1DEEB 4JFEE 1RZGA 1KBGL 2H32A 3MZTA 4PD4K 3UYRL 4KTEL 1XMWA 1ZOXA 1J18A 1VERA 4KMTH 4PJ5E 1BVZA 3EFDL 4JFPB 1TQBC 3DYOA 4KZDH 2EIEA 1DZBA 4UV4H 5LBSH 2DYPB 2NY2C 4HXAL 4PB9H 2ZJSL 1H0DA 4WI3A 1CLOH 2DTML 2QKIA 5HDOA 5L9DL 3IJHB 2DQFA 4CVXB 1B6UA 2FEDD 1D9KD 1XF5A 2HAZA 3PQYA 1JPFB 4FQ1L 2R1WA 1EEUA 3C6LC 1TJIL 5CEYB 3C5SB 2E6QA 5IMMB 3R0NA 1S7XA 5EZOH 5GS2H 4TUJB 1EA9C 1SHMA 5IBUB 4OIAA 2ZKHH 1MCEA 4P2QA 3RRQA 4LFHG 4YFDB 2P46B 4F58H 3NTCH 4MNQD 3AB0B 5C71A 4OIIH 1KCUL 5AEAA 3P0YL 1YEHH 3EOTL 4HKJB 3QDHA 1FL3A 1N26A 3IDJA 4NNYA 1A6VL 3EGSA 4PFEA 1HHJB 4M3JA 2X10A 4GRMB 1T7VA 5DA4A 3TZVA 1T1WA 1D5IL 3GKWL 3TPKA 1JGDB 5MEOA 4RNRB 2AK1H 4OBRA 1ZHNB 4Z7NF 4HUXB 2ZG2A 3RZCA 2PYEA 3DV6A 3DVGB 4N90D 3W0WB 4TNVK 4CDHA 3WUZA 1ZEAL 3BN3B 1WCBB 4ZUWA 4GXVH 3KPLB 5TJWK 1XIWB 1BFVH 1YDPB 2FIKA 5HGHA 5KJRL 1VEPA 4K94H 3U7YH 3V5KA 5LWYL 1JNHB 4E41A 4X6BB 2R0KL 2H32H 2P8LB 1WFTA 1FGVL 1UZ8B 3EOAA 4KI5F 4X7CC 1CIUA 2JJVA 4RBPH 3WLWD 3M1BB 2O5ZL 3IFLL 3V7AG 3T1WA 3ZKSD 3AS3A 4ZDHA 4AMKL 3O45A 3ROOA 3JV5A 1ZXQA 1J88A 3S34L 4XNUH 4UV7L 1ULVA 2DQDL 2VDKH 1LEKB 5C0BE 1P84K 2V17L 2A6KA 5D1ZC 2QQKH 2DQJH 2ZNXA 3B9KC 1RK0B 4N5EC 2ADJA 3UMTA 4YIQB 4GBXA 2H3NB 4MQSB 3JV6B 1EJ6A 3VFRA 1RZJL 1Q8MA 3IS0X 3U4BL 5JR1H 1L6ZA 2BNQD 4HZLB 1HNGA 1RFDL 3C60B 1KIQA 3I6KA 4B53A 12E8H 3IU4L 4L4VA 2BX5A 5JDSB 4BFBD 5ACLA 4Q97A 3PJSB 4AEHL 2HT3D 5J1TC 4WW1A 2GJZA 5I71B 1CXKA 1FLRH 5TQ2H 1IGJA 3HE7D 1QR4A 1S7SA 1OP3H 2AEQL 1LNUA 3BW9B 5CWSB 3MJ7B 1OAXH 1OGAE 3BD3A 1A1MA 4L29A 4XNZB 2X4TB 1EAPA 4EUPA 3LKQB 2LU4A 1I1FB 1MJ7L 5DUPH 2D7NA 1A21A 3G6DL 5FHAL 3U46A 2DYPA 3SDAC 3SKNA 1JHLH 4ZS7L 2R56H 4QYOA 2E9WA 3ABZA 1E4XH 1VHPA 3EYVB 3B5GA 5JIPA 4KK9C 1MHCA 3C09C 5T1KD 3VGDA 1RIHL 1ED3A 4NN5C 1JZ5A 4YHYC 3K1DA 1XF3B 5JHLL 5F9WC 1TMCB 1T89C 2RFXB 5DHVB 1QVOB 3D85A 1WV7T 4JO1L 1S5IH 4QWWD 4WENB 3C5SA 2OZ4L 3X3GH 2LFGA 4JQIH 1IBGL 4HLZG 4TUJA 1KN4H 2DQCL 1OAKH 1EGJA 5FM5M 2EH8L 1KENH 2G60L 5H2BB 4M7LT 1J5OL 2NQCA 1OWRM 3WHE1 1FE8H 1EXUA 2XN9A 5I1CL 2AJYH 3L9RA 5IHBA 3V0WH 3RX7A 3R0MA 4JFYB 5EO1A 3S36X 4H88H 4L4TB 2WBJB 1TXKA 4NOFA 5JOPE 3VWJB 5ALBL 2A6DA 4O9HH 3TLRA 5HVWA 5C0CA 2IMMA 1Y6NR 5TE6L 4XCNB 2D0FA 1JYNA 1S8DB 1PKQA 4AEEA 4LSQL 3X11A 1QRNE 4RMQA 4DN3H 2YMXH 3BP7A 4OLWL 4DN4L 1ETZA 3EJYD 1OGTB 4NUGL 1JGEB 5F1NA 3GB7B 4MNGE 4OCLC 1H5BB 4HUXA 1T20B 2BXYA 5CJ8A 2YRPA 1V05A 2DJSA 5EUKB 4JFDB 5I30L 1TTUA 4AEIH 4CJ1A 1W0VA 4XNXL 4X6BA 1KEGH 3VFWB 5L2KA 4Z7QE 1JNNL 4GAJL 4OFDA 5EZLB 1UZ8A 4U0QB 4EUPH 4OV6F 4JZJC 2VSCA 4B7IA 3V0VB 4NC0B 1NSNL 5ANMB 1Q9LA 3SGKC 4BSVB 1TJGH 4I2XA 1EHLL 5TE7H 3LRGA 1N4XH 5EOCJ 4JN1H 4DEPC 5DJAA 1LEKA 1U92A 4ZOBA 5BS0E 4U6VH 2MSPA 4G6JL 4PG9B 1RK0A 2FIRT 4B41A 5ISZE 4HJJH 5DK2B 4YIQA 2X1WL 3L3OB 3WUWA 2H2PC 2H3NA 3BDBA 1ZVSA 4BQ8A 3ZTNL 1TVBB 3VFNB 5DJ6A 4KXZI 4U1NB 4G8GB 2AK4E 1EGJH 5D1ZD 2ITCB 5EZJA 4KMLB 5TDPA 1D5BA 4N5ED 4LKXA 2ORBH 3UJJH 1HQ4B 2DKSA 1NCCL 1TJHH 3ES6A 5IVZA 1Y6MR 1H9VA 3F58H 1XGQB 2VYRE 4Y5VC 4UOJA 3O0RH 2CLVB 1IFHH 5I1KH 1CQKA 2I9LB 1LK3H 5D4QA 5D70H 4PJ8B 4NO2B 4KC3B 4PGBA 3DX9B 5DMIH 1EX0A 3SGJC 1XGPB 1HZHH 2VDNH 3GEWB 5CGYD 5INDA 3M07A 4TSAH 2GJ6E 3WIIL 4OF5A 5I73B 5IB5A 3E6FB 5GSVB 1G9NC 1U8PA 1QA9A 2X40A 3M17A 3P4LA 1L9MA 4HGKC 2DBLH 4JHWH 4YXKL 3SJVD 3BPOB 1QVOA 2BOBB 1WVZA 4HT1H 3EOBA 4NM4L 3RWJB 3L7FA 1K8IB 2IQAB 1ZLSH 5L88H 2PXYD 3DO3A 1CR9L 4TSCL 3NFSL 2BY0A 4I77L 5EUOA 4KK9D 1IGML 2PUQT 4EN3C 3V6OE 5DEFB 4GQ9H 3X3FH 1HSAB 3LS4H 2FATH 4AENA 5BQ7A 5FUOH 3KPRD 2J8HA 4R4FL 1WZ1H 3MRCB 1JHTA 5K9JH 1S8DA 5K59F 5ESAA 3VE0B 2HKFL 4RGMB 4OLEA 1YNTA 2I60L 4XP4H 3QFJB 5EZIL 3F7YB 5HHOA 4QTIL 3BD4A 2EIBA 4JG1L 3NMEA 3GB7A 1TZIA 2XQBL 3QUMB 3IKCB 1NC4A 3WO3B 3FQNB 1KIRA 5EUOF 3FFDA 1PSKH 5ESVA 1GOHA 3RBGA 4RDQG 3TIDA 4D8PA 4U1KB 5ENWA 1A3QA 1JGUH 4RGND 1F45A 3HNTH 5ADPH 2Z31A 2R1YA 3LQZB 4MNHB 1J8HE 3L1OH 4I0PC 3V0VA 4MMXC 3GSNL 5C0GB 5ANMA 5TE4H 3TYFA 3WMSA 4YBLC 4H0HB 2NZIA 2IJ0C 3X12A 1OTTD 1ZS8A 1E4KC 3MUZ1 3AB0C 2F5BH 3WDHA 4PG9A 4UOW1 3O6ML 3RA7L 5DK2A 3QNXB 2HFEA 4Y1AE 4LSRH 1L0QA 5GS0H 1TDQA 4D94A 5I2IB 5I1IH 4U1NA 5D1XA 4G8GA 3RIFF 4WVRA 1EK3A 2J8OA 5H8DA 3GJFK 5AAWA 1VEMA 2BVPB 2VXTH 1LEGB 2AJ3B 4MXWH 2EH7H 5BOPA 2HA1A 1U8MA 2J1KA 7FABH 5TDOA 3H3PL 4IMLB 2YN5A 1RURL 4NPYA 1XIWC 2FX8H 3QIBB 2CLVA 4N0UB 3BESR 3Q2CA 1ZSDA 3K4ZA 2FECI 3OKNB 4LVOB 1AE6H 4MA7H 4JPVL 2QHRH 4YDKL 2BRRH 1ACZA 3ARGD 1DQLH 3BP6B 4RMRA 1EUTA 1A14L 4Z77A 3SDCB 1EH9A 3FMGH 4YH6A 1N64H 4HWEL 2VXQL 4N68A 3DSFL 3RY6C 3RNQA 4UILH 1E4XI 1DN0A 3BRGC 4Z95L 1QACA 4WI6A 4EDWH 5A3ID 1NLBL 3D2UA 4H1LB 3A6BL 2JB5H 3N1GC 1G7MA 4KH2A 5ITFA 1J1PL 3TVMD 3BX7C 4PRAB 4JM2B 1UXSA 1K8IA 4LLVB 5ACMA 3C60C 1T3FB 5J9PA 2ZCKL 1U95A 1I1AB 1QFWH 2VLJB 5E03A 4WFEE 4TNWK 3VD5A 1BECA 4DKEL 4NO0D 4GW4B 5CMAB 4UNUA 5DEFA 3HE6C 4HS8H 1D6EA 4XPFH 3R06B 2AJSL 1G9MH 2O26U 4MJ2A 4PLOB 2SEBB 5E6ZA 4UIKL 5JORA 4DOHB 1DBAH 1TNMA 2EE3A 4NZUL 4XNZC 3EYQC 5D7JA 3RVWC 4PTTA 1P1ZA 3D39E 3QXUA 3F7YA 1I7RB 4JJ5B 2F58H 3S3PA 1MH5B 1GIGH 3HG1D 4DQOL 4RFNB 1CD9B 3U6RB 3U0TA 5JW4M 3QUMA 1FP5A 3IKCA 3L5XH 3QDJA 4P5KB 4Y19D 1G7PA 3FQNA 1KJMB 3VFOB 2F54D 4M8QA 4YDLB 1FGNH 4OBSA 1AY1L 1NMBH 3MXWL 3PIQA 4M61B 5T3ZD 1J0HA 4YHOL 5E2TL 1F11A 4YDJB 4EOWL 1DP0A 2WINB 4S10A 3LQZA 4O5LL 4FN0A 4S1SH 4NM8H 5C0GA 2Y4SA 2UYLB 3HCVA 1RU9L 1TZGH 4OLUH 5DJDB 3S4SG 4PJDB 5DR5L 3FT3A 5D7KE 4LLMB 5I9QB 4RMUA 5GIRA 4P4KA 1FNHA 2M8XA 1T7YA 4YHPA 1Z6JT 4RRPA 1KCSL 1NEZG 2X4NB 5DD5L 3DOSA 3QNXA 1I4FA 1WBZA 5CJQH 3FO0H 4BSWB 1XT5A 2X4UA 2V7HB 4FQQA 5B21A 3L5WB 1C08A 2V6HA 4XX1E 3VGEA 1MHHB 3GMMB 3SY0B 1N5AB 3MBXL 2G5RA 4JPWH 2VDOH 4OUUA 1H5BC 5F1KC 3LIZH 4YBHA 4MNQB 5SWQB 1FBIL 1W2KT 4KJWD 3WE6B 4IMLA 3FB5B 4N0UA 1RY7B 2EC9T 5LQBH 5I1AB 3F7RA 2GK2A 3P9LA 1SM3L 3RVXD 4N1CA 4OUOA 1BBJB 1QSVA 4JGMA 3I6LD 4NQEA 3PP4H 4UUJB 2WQ8A 2APWA 1BIIB 1X6NA 5IVXB 4J6RH 4IRJA 5HGAB 1J0ZA 1KPRB 4KV5F 5FOBB 3BAEL 1MCOL 4QO1A 2OJEB 3BIAX 3IKKA 3S37H 1YMMB 1H3UA 4S2SA 1BVKA 3JBG7 1BQLL 4MD5B 5HI5C 4DUWA 5M94B 3MLVH 4P5TA 1AXIB 2XY2A 5CD5C 2NW2B 2ATPA 3SDDA 1INQA 4M62H 4PRAA 2P8PA 1SEQL 5CZVL 3RPKA 4BKLB 5JMOC 4LLVA 5DD6A 3A6CL 3CIQA 4PB0L 1LILA 4X99A 1GRWA 1I1AA 4PRPB 1QBBA 1O7VA 5DVMA 2LAAA 5GSRB 3B5HA 4YZFE 3MR9A 2RAMA 3O2DH 3E1F1 4F57H 4UQ3B 1YPZE 2AS5M 1A6ZA 1F4WH 3LQAL 3KYMB 4LFHD 4XC1H 3T0EC 4QHNA 1J9CT 4JGUA 2VDRH 1EFXD 4I3SH 1MOEA 2R69L 5EA0L 4RMTA 1Z2KA 5IQ9B 4K07A 4PJ8C 1U3JA 1R3IH 5C0JA 1CF8H 2DJUA 4WY7H 3G5YA 2AXGB 5LXGH 2G75B 4CVZA 4PR5B 1I7RA 3KPQA 4PRBB 1MH5A 4XI5C 5DVOA 4NQCD 1M6OA 2XA3A 3H9SB 4KKNA 3OPZH 1CGXA 3MUJA 3V9FA 2C1PB 2DLIA 2FLRT 1T4KA 2J7LA 1WC7B 2IAND 2A9NL 3KVQA 4I18A 4OQTH 4XNQB 5D7LA 3VXPB 1QRKA 4JAMB 3ESVF 4M61A 3VXUD 3PWPE 1QFOA 3HUJE 5IGXH 1OQOA 4RAUA 4F15B 5DDHB 2A77L 1WBXB 3EO1B 1BVLB 2NNAB 4YWGH 3MRIB 1AI1H 5FO7A 2HP4A 5DT1H 5DJDA 2D31A 4DGYH 1ES0B 3LD8B 2Q20A 2BVEA 3CC5B 5J3HC 3L6FB 3OXSA 3BGFB 4XP9H 5BXFB 1IEBA 5CILL 3WNKA 5TF1H 1JFQL 3S37X 3N85L 4LNRA 5T1KB 2DIAA 3GIVA 1D9KA 1FRGH 1IT9H 3FAXA 3FFCB 4JQVC 4XHJC 2PKDA 1OLZA 2IAMC 3LRSB 4QT5A 4K7PH 4RGMC 2X1QA 5I15H 5HXMA 1QR1B 4Z18A 1BJ1H 1OOAA 1N5AA 1DQJB 4LHJB 1K85A 5F1IA 4F37K 4Z8FH 5KS9A 4JR9L 3VWKD 4PG2A 3WE6A 35C8H 1D6VH 2BVYA 3FB5A 4X98A 1T66D 2Q76A 5CKGA 4CU8A 4DZBB 5DD1L 5I1AA 4MAUL 4XP1H 3TEUA 1FNLA 5I1DB 4HMEA 4M5YL 1LMKA 4K3EH 2ICEB 3B2VL 4PLJD 3HRZB 3UTZA 1VDGA 3NH7H 3FQXB 2P44B 4P99A 2ADFL 4DVBB 5I1JH 5EFIA 1B2WH 1KPRA 1S5HB 3TFKC 1GC1L 2VAAA 4HMDA 5F7KC 3ZLQC 5C3LD 3QCTL 1A5FL 4MCYA 4TVPL 3WBDA 3HTLX 5IB3A 4MMZC 3SGDH 2DLFL 3BISA 3GSVA 4JDTL 1GL4B 2P24A 3FQUB 2W0KA 3LS5L 1NAML 2NZ9C 1EEZA 1KTLA 2X4OB 2ERJB 3K80A 3IFOA 1G7QA 4K9EH 4U1HA 3M8OH 4O58L 4BKLA 4MWFB 5KTEH 1ZWIB 3BMVA 1FJ1B 5D5MA 4G6ML 1QFWI 3TBYB 2IADA 1ADQH 1OY3B 4X6CA 1NCWH 5GSRA 5DFVD 5L0QB 3EO0A 5IVXF 3HMWH 4K55A 1EBAA 2PTTA 3QIBC 3D0LB 3KYMA 2KQMA 1YUHB 3O6KL 4IRSD 1EAJA 2EICA 4ODTL 4LVOC 3IVKA 2FGWH 4GAYB 3MRDA 5IQ9A 1WAAA 3VRLF 2PN5A 3GM8A 4POZD 1I3RB 3EO9L 1HYSD 1ITBB 4K7PX 2BNQA 3MUGA 2AERT 2R0ZL 4O2FA 2XXCB 4LHQB 3NABH 1MFAH 3D87B 5D1QC 4G3YL 2JK5B 4WU7B 5E8EA 4ZAKB 5GS1C 3HAEB 2OK0L 2E6JA 2HFTA 1OD7A 3KPOB 4P5MA 4QXUH 5CHNA 3MTRA 1RD6A 3HB3D 4X6CF 3HE7A 1TFHA 1KJ2H 1G6RL 3LPGA 3MUHL 1XGTB 3UDWC 2XG5A 2CXKA 3AU1B 4MHHG 4U7MA 1SYVB 1WBXA 1RUKH 3TCXA 1Y18A 5CJXC 4JM2C 1C7SA 4GLRI 1U3HB 1WAAF 1LP9E 5IJVB 4NZDA 1JZ8A 4OF3A 2ICWB 3WS3B 3QT2A 2VXUH 3CC5A 3DRQB 1F4YH 1KJVB 5B4MD 3BZ4A 2IQ9L 5BXFA 2QQQA 2GY7B 1DSFH 2BSTB 4KHTL 5J1AA 4GFTB 5DMGD 4ODBD 3PL6D 4U2ZA 3SJVB 2W92A 5HYSG 1KB5B 4U1GB 3OX8A 4ZTPL 1JPGB 3X13B 4I9WD 4WIQA 3KJ4B 4KQ4H 5DRWB 3QG6B 2Z93A 4HIXH 1DQJA 4RFNC 3QXAB 4PRIB 1KGCD 4XCCL 2UWEE 4KJYB 3RWHB 5IESL 4N8CH 4G80B 3KXFD 4RCAA 5HDQH 5EC1B 1A7RL 1AC6A 3W9DA 2WK2A 5I1DA 4LPCA 2MPAL 5DFWH 1RPQA 1PEZA 3UTQB 5I1EL 3RTQC 3FQXA 3BIBX 4QCIB 1R3JA 4XB7A 1PG7H 4U3HA 1R0AL 3O81A 4RMVA 2V5MA 4ZSOB 2ZUSA 1FNEB 5F8RC 3AUVA 3MRMA 2FHFA 3U9PL 2OCFD 4P2CG 4BH8B 4YQXH 3PQYE 1J8KA 3O4OC 3LAFA 3IXTB 5HHMD 3D9AL 3S9DB 2XICA 4D9RD 4LLQA 4KROC 4Z7NE 5EN2A 1QQDA 4XWGL 4P2QE 1KOAA 2ZOLA 2GSGA 4NWTH 3NAAL 3QXDA 3QH3B 2E8ZA 1CT8B 2F19H 5ECJE 3IYLW 1YEKH 4XMKL 3BP4B 5F96H 5E4IA 3QUZB 3FZUD 1INDH 1QEWB 2HJFB 1CXHA 4JN2B 1G1YA 2NZ9D 4X80L 2DKMA 1F4XL 3D0LA 4JCMA 1YUHA 3MLYH 4NC1C 3MLZL 1UENA 4HKZB 4O51A 5AYUH 4M43H 2XZQH 3LKSB 4HJGA 3UCRA 2AJVL 3MOQA 2VRAA 5D1ZA 3QI9D 2PYEE 2XRAL 3H7BB 2IWGA 3CH8A 5IB1A 4R8WH 3D6GA 4JLRA 2XY1A 2FD6L 2B4CC 5ETUA 1Q9OA 4E41E 1T2QH 2L0DA 3VGBA 1F6LL</