3CPLB

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplB00
1RZKH 4TSCH 3H9HA 1R5VA 2JIXB 3BMWA 1A9BA 3O6FA 3KPNA 3MRMA 4UNVA 1RHHB 1JNLL 2GY5A 1IEAA 4LOUC 1A8JH 4UT7H 2LU7A 3FQNA 2IANB 3P30L 5FYKL 1R5VB 1T66D 3QQ9C 5FM5O 1REIA 1TJIH 3ZKMC 3TZVD 1G9MH 2Q8BH 4MD0A 3BAEH 4X6EA 1PBYA 2NZ9D 3P77B 1YYLH 3BZFB 1D5BA 5F71A 5IW1A 2PYEA 5D1QB 3GBNH 3KVQA 1QSZA 1ETZA 5CUSL 4AJ0A 4HV8A 2XZCL 1DUYB 3L3JA 5JQHC 1VGKA 4S1DC 2CKBL 3J7HA 4OLYL 4HKBB 1P84K 4LSTH 5CJQL 3P4NA 3QDJB 5E6IB 5I30L 4Z8FL 4ZYKB 3S3JA 1F90L 4YHKL 2P1YA 3MR9B 1ZLSH 5DC4B 5I76B 3LKQA 3AB0B 4PP1D 5EZJB 4XPHL 4Y16A 2QQQA 4OM1H 1FL6A 2KL6A 4N9GB 4MJ2A 1T3FB 1D5ZA 1CD1B 4ONHB 1I9IL 2A0LD 2Q87A 4HXBH 3VH8B 3QG7L 2CXGA 4M93B 4OIIH 3WLWC 4HEME 4CUCA 4WDIA 1AXIB 3JV5A 1DLHA 4S1DD 4Q6IC 4ZQKA 5FO7A 1BZ7B 5I1AA 1S7TA 2M8XA 1KIQA 1WFNA 3EO0A 1CXHA 4X6CF 1JZ4A 1SYSA 4WTWA 1BOGA 3PL6D 4UNTA 1QLFB 1AO7A 3ARZA 1KJ2B 4F8QA 2FX7H 5J13C 3C09C 4PRBA 2GFBA 5SWSE 3EO0B 4RIRB 5FHAH 4GAGH 3BQUB 4MNGB 1YYMH 1DEEB 5GHWL 1A6AB 4PR5A 1YJDC 4G8IA 4X4XB 5E2UL 3U7YH 1QPXA 4LEXH 4IRJB 4WHCA 4YR6A 3QQNA 4JPVH 2HH0L 4JVUA 1S9XB 4Z7UF 1WCQA 4H25A 1SY6A 2Q20A 3EYVA 3NTCH 1K4DA 2AK4B 4HMCA 5TQ0H 5E03A 1X5YA 2ZSVB 3FFCD 4HUVB 4LSSH 5FHBL 5HDBF 2F8XC 2F54A 3WKNA 1XF4A 2A9NL 2R8SH 2IH1A 2YD4A 2AXFB 5IG7B 3HS0B 3BDXA 3VD7A 2YD7A 2VR9A 1M05B 1KCVL 4KK5D 1FIEA 4O4YL 1OTSD 5CD3B 4QLRA 5ICZB 4G6AD 2R9HD 4M43L 4LLMB 3MGTB 5T3XL 3B8YA 4LVHB 3FQUB 5EOCH 5T3ZE 4ONFH 1UEYA 1I1AC 3DX8B 2E7LA 5C0NC 5B22A 1MWAA 1NAKL 3S37L 3ESVF 4PJGA 2NY4D 4KY1H 2EEDA 2CDEB 4LLMA 5LBSL 4X5LA 1CICA 2PCPA 2QADC 4HPOL 4EXKA 1HEZA 5DRNA 2OK0L 1MRCH 2IBZY 4J3VA 2IALB 3DRTB 3WIHL 4D9QE 1I8KA 5L2JB 1J1XH 3BP4B 3C5ZB 3GHBH 3OKMA 1Q72L 2XN9E 2NQCA 3ARED 3KXFD 3LQZA 1HOCA 4WGWB 1GYAA 3OAYK 1KBGL 4AZ8A 4R3SB 5BO1L 1MFAH 2EKJA 5ITBH 3VCLA 1G7LA 5DQ9B 4NQDD 2HLFC 3VXMA 5DFTA 5F7HA 4WFFD 2OP4L 1JN6A 4L3ED 1L7TH 4F7EB 4Y4FB 3T0BA 4OCSH 2OJEB 3LQMA 4ZO9A 4X99A 4HIJA 5F7WC 5D1ZA 1JI1A 2C1PA 4XBEH 1U0QA 1OWWA 4N90E 1AR1D 1AGDA 1A1MA 1WBXB 4XC3H 4GSDL 4MMXC 5C8JA 1AXTL 4X99B 5H37G 5IJKC 4HBCH 3I6LE 5CEZH 1G7JA 4JFEB 1EFXB 4NRZB 1G7IB 1MRFL 4JFXB 4P2QA 3SEPA 4I0PB 3WIFB 5HGGS 4NC1C 4XPFH 1KEGL 1HSAB 2X40A 3MLVH 1P7QB 4OLWH 2F19H 5C0DA 1Q9KB 3TT3L 5JR1H 4MXQD 1NUGA 1VB9A 2DLTA 3FAWA 3QH3B 4F58L 4HF5H 4ZODA 1Z9MA 3RL2A 4NRYA 5CILL 4RGMC 5IW1B 4EOWH 1LO0H 3F6IA 3QUMA 2CDGA 5ECJE 4D9QD 1JHKH 1NC4D 4OB5L 3N0PB 3FQTA 1P7KA 2ED9A 5H8DA 1FNGB 1F45A 2NX5B 1FGVL 2ESVE 1XR9A 4PJDF 2A6IA 4F33A 4M6OL 3LN4B 2NY6D 3FL7A 5HI3D 5C6TH 3SBWA 2PYEE 1Q9OA 4MJID 2Z0BA 3HPLB 1UQSB 3AXLA 3JUZA 3EYSL 1BVZA 4G8FA 1URLA 2YA1A 3A6CH 4KKCD 1T22A 4ODWB 3IKCB 3KHQA 5DD0L 5FV1L 2YA2A 3S36L 4FQIH 1EPFA 2R29L 3PWUB 1BQSA 3VMNA 5DD5H 1KN2L 1T83A 1UVQA 4G7YH 4JFHD 1QSEA 3V4UL 1QBML 1QFWH 4LF3B 1J8HE 3P11H 5FO9A 3V0VB 3ILQC 4LCUA 1UCBL 3C9NA 2BVQB 3H7BB 4D94A 4UIKL 3KYOA 3TA3D 4XMLL 4HJJL 4YXLH 4X0KA 3O3AA 5CWSB 3NAAH 2BNQD 2NY4B 3HMXA 1MF2L 1ORQA 1QYGL 2GUOA 3RVVC 3O81A 5ESAB 4LCUB 1K5NA 3EJJX 5HY9B 2ZCKH 4YFLF 4NBXB 1ONQA 4B50A 2GI7A 4EN3A 4E42B 1DANT 4KKBD 4YDKL 3TGXA 4NC2B 2VLLA 4OQTA 5T1MA 5L2KA 4WVRA 2QKIA 1ONQB 2C9AA 4YNYA 3L3DA 1HSBB 4PRIE 4P9HH 1II4E 1TMCB 2MNUA 4Y19A 1CQKA 3C2AH 4L4TE 3QUZB 4OV5B 3GIZH 1CFQA 2FJGB 1CU4H 1N26A 3L9RB 4XNXH 4OFPA 4Y2DC 4TVPL 3EYVB 5IHZA 2YWZA 3HR5B 3EOBA 3SQOL 3G6AB 3WFDL 4LSRL 1MIML 4PBXA 4WI3A 4LVOB 5GJTH 3U7WL 4UU9B 3MRKA 1IBGL 4I0KA 3O3BA 4GUPA 3MLTA 2AXFA 1A2YB 1OAKL 1FNEA 3PWVB 5C07A 2VLRA 4F7MB 5DRWB 4Y16D 4UTAH 1ZWIB 2O5XL 2C1OB 4DAGH 2ENYA 3MA7B 3CH1B 4LLVB 4MYWB 4U6VH 3QNZB 3T09A 4XP4H 3M8OL 2UV3A 4PGZA 5MP6H 3FO1A 3K4DA 4ODXA 2XG4A 1S7XB 4ELKB 4TTDD 3BH9A 4LSUL 3WFEL 4ZXBD 1R3HB 2R1XA 5D93C 2J1KA 3DX7B 4UV7H 3UZVB 3AMKA 2M26A 5C0AB 2IBZX 2RB8A 1UA6H 3Q2CA 5ILTH 4WWID 2W0PA 3OKOB 4OCLC 4YHLH 5AZ2H 3O4OB 3H9YA 2X4TA 4YPJA 1CZ8L 2R4RH 5D7SL 4HFUL 1A7NL 3TBTA 2H41A 4WO4A 5FYLD 1LEKB 4IOFC 5ACZB 4NIKB 1IGIL 3D69B 1JPSL 1IAKB 4M6ML 1J0IA 1I3GL 3VXME 3BD5A 4LPCA 1G1YA 5DS8B 1TJHL 1WF5A 2XWJA 5E5RB 1JWUA 2DYPB 5CEYB 3SKNB 3MR9A 5AZEL 5HHMB 3SDXA 5D2LB 1JHLL 4APQC 5DS8A 2A74A 4WUUE 3V4PL 1QOKA 1NCBL 4Y5XC 3MLWH 4G8EA 4NUJA 1ZT1A 3MRHA 5DQDH 2APVA 5BVPL 3V6ZA 1HHGB 4WWKC 4LP4A 3UO1H 5DUPH 4TOYH 5D2LA 3VH8A 4I48A 3D0VA 3B8SA 5TFSL 5CIPB 5D1XD 2FBJH 3N85L 5KVFH 4AIZA 1ZEAH 4PREB 1LO4H 1P2CA 2BMKA 2YK1H 3HMWL 3TYGL 4EI5C 1MCWM 5IMLB 2VLKB 3QDMD 3HZMA 2I9LA 2XXMB 2ERJC 3PHSA 4H20H 1AO7B 3RVWD 2WINA 4NO5A 5D71H 1DL7L 3ZE0F 1N5AB 3W9DA 3VGDA 1VCAA 1IGJA 5GISL 1I7ZB 2HFGH 4KKAD 2H8PB 4LSVH 2YR3A 2R15A 2DQTH 4WEBH 3P4OA 4YZFE 1MCBA 1A6AA 2E8YA 1HINL 3NN8A 2XPGB 1I1RA 1G0YR 5C0JA 5IF0B 4OZIB 1AFVL 4G42A 5EC2B 5EO9B 1A64A 1AGBB 1VACB 3OAUL 4HKJA 1NAMB 4GOSA 4ENEC 3VWKC 3CDGB 1T7ZA 4WU7A 3GKWL 1VGEH 4PP2B 2IG2L 3U36A 1HXMA 5JPNB 3FZUC 1TVBA 3RQ3A 4OZHA 2F53D 2ATKB 4OF7A 1XGUA 4R4ND 2NCMA 4ZO7A 2ADIB 2BSSB 2YD1A 3KPRA 2CUHA 4WU7B 2H32A 5GGQH 4I18A 5JW4Q 1P1ZB 2VIRB 4G6JL 4NKOA 2YZ8A 2BHYA 3OF6D 5IHUH 3S34H 4OZ4A 2P44B 3WJLA 3WSQL 4PLKD 4X0KB 4MXVE 3UDWC 5GRJL 3MFFA 4F7CA 4MA1B 4X6FA 2VIRA 3DETC 4NNXB 4AEHH 4XCEB 4Z7NF 1KCUL 1NH6A 2Q3AA 1LEGB 4UT6L 5JHDA 1DQMH 2AJXH 2P8LA 4OCRL 1MCRA 5CJ8A 2X2YA 1Z2KA 1CICB 1A6WL 2CMRL 2ICWI 4DGYH 1ITBB 1EEZA 1CBVH 1LEIB 2PO6B 1A14L 2H3NA 3RZCD 3Q6FB 3TIDB 1J0ZA 4BH7B 1FLTX 3QEUB 4XP9H 1HSBA 2HP4A 4BSVB 1SM3L 3C5ZA 4Y19B 5EU6E 4PIRF 4QXUL 2YBRB 4PYGA 3JTTB 3L95A 2R0ZL 3HTLX 1AGEB 4R3SA 5FUCC 3T4YA 3MRJB 2JB6B 3PQYD 1YMMB 3DV6B 4JQXC 4X6DF 4N68A 2VDMH 4DW2L 3O3BB 4HS3A 3QDAA 3SE8L 3GSXB 4YDJB 3U0WL 2DN7A 2QSTA 2QQKH 3QCUH 2AVGA 3BN9D 2XKNB 4G9DA 2CIIB 5H35B 3T77A 4KXZI 1RQ5A 1I4FA 4G9FE 1I1AD 1MCFA 3PV6B 4IDJL 4UAOB 3QJFA 3WNLA 4UOW1 2EZ0D 2XKUA 5EIQA 3ULUC 1FL5A 2KQMA 3INUH 2FD6H 4TYUA 1RUQL 2FEEL 1SBSL 3K80A 1LD9B 1U8KB 1MHPH 3H9SA 4FXLA 1KPRB 1B90A 3B9KD 2XY1A 2ID5A 4N0YH 4GKNB 3RTQC 4AG4H 3IF1B 1MFCL 3K8KA 5L2KE 2F74A 1Q9WA 4W4OC 3WJJC 1MPAH 1Q38A 2ESVB 4G8GD 4YHNA 4FQJL 4G6FD 3EYFB 4RDQF 4PJ8D 1GC1C 4RMSA 4NN5B 3RBGA 4KVCL 3B6SA 3U0PB 1YPZA 1QBAA 1JWMA 3TBVB 4K94H 1P9MC 1P5VA 4MDIA 5MEQB 1OARH 2H6PB 2SEBB 4K71B 2APXA 4TN9A 4U2ZA 5E8DH 2R0KH 2Z4QB 2VC2H 4YHYC 5F9AC 3U1SL 4U1KB 1QR1B 4UUJB 3OB0H 1RU9H 2P5WE 1YPZB 4X6EB 4P23B 3BFOA 4NT6A 1NBYB 1X4ZA 4MAYC 3SDAA 5EU7C 5KZCB 1UENA 1JCKA 4KV5E 3DUUA 2P8PA 4M3JA 5I9QB 1YEIL 3VJ6A 2DAVA 4ZUSA 5I1CH 3GBML 1U95A 3NIGE 1FH5H 1NGQH 1U8HA 1IJ9A 3MREA 4G6KH 1YC7A 4PRPA 1DZBA 3QNXA 4GXUM 3D1MC 1EHLL 1QLEL 5ENWA 5JXED 1VFBB 2BC4B 4KROC 4ELME 3DO7A 4R0LB 1CXIA 4URTB 5DVOA 1X9QA 5JW3L 5C0AD 2WBJA 3BKCL 5HI4D 4NZUH 4QRTA 3QHTC 2CLVB 5DT1H 5EG6C 5BS0A 1A0QH 3LKNB 5J9PA 4Y4HD 2FEDD 4JFYB 3T2PA 2I9TA 3LH2L 1IKFH 2GJ6A 3IETB 3AY4C 2W65B 1N5AA 5HY9A 3RZCB 5IMKB 4H88L 1HYSC 4PRPD 5K9QG 3D0LB 2GTWB 4F80A 2OX5A 4G3YL 3X3GL 5BXFA 1UKTA 3MBEB 1ZE3C 5C0IB 3EOTL 3P30H 5KS9F 3MJ8B 3HHRB 4ETQA 5TE4H 4OI8A 5ERWA 4YNYB 1TQCB 4P49A 1U58B 3E8UL 3DGGB 3W0WB 3L1OH 4O02H 1YYLL 2AEQL 5E7BA 1OD9A 1KB5A 2FJFA 5C6WH 2VE6A 5KAQF 2NY5L 3TEUA 5F3BA 2HRLA 4Y1AE 5ALCL 4APQA 1QD0A 4XMKL 3VXPB 1NGYB 1SJEA 2HTKD 3S37X 5I8EA 5B38A 4DQOH 1S7RA 5FUCE 3S35X 2X4SB 1KJ2A 4JM4H 3SDCA 2YKLL 3ARDD 3HAEB 4D9RD 5D7IB 1XEDA 3KPRE 1L0YA 4OKVA 2C1OA 1NAMH 4KI1A 5EUOA 4C56A 2AGJL 2B7DT 2AAVA 4X6DE 3IVKB 4RMTA 5BQ7B 3NZHL 1ZLSL 4PY7B 1O7SA 4KRPD 4LHUD 1T7WA 4J4PC 4XH2B 5IB3B 5CD5D 1NCDH 5CLTA 1JPTH 1N7ML 1ZSDB 3D25B 2AI0L 4QTIH 4KI5D 2P4AB 3PDOB 1R3HA 1ZANH 1FZKA 2WAHA 3FZUD 1MFBL 4EXPX 3EO9L 4PJEB 2R2HA 1JVKA 1FVDA 1QO3A 4L4JA 4LNRA 1H3PL 4NCC1 1RZ8A 3Q1SH 2G5BB 5JOPE 1HEZB 5DRNB 3RRQA 4GBXD 4PRIB 3MA9L 4I3RH 3MRRB 5FGCE 3ROLA 1RHFA 2FHBA 3OX8A 4Y16C 5D6CA 3QDJD 4PBWD 3FQUA 3WEXB 1MHHB 3HAEH 3ISWA 3QCTL 1BBJA 1H15A 4RNRB 5E2TH 1KFAH 2YN5A 4PJGB 2LAGB 5C08D 3QFDA 4GRLA 4N0CD 1J9CT 1RZGA 3VFPB 4ZFFB 4MQXD 1R3KB 2NXZD 3D39A 5E00B 2X4PB 1EHXA 5KAQG 5AD0B 2V2WB 5IWLC 2ZOKB 5GIRB 5TQ0L 4Z5RA 3HZYB 1JF1B 3ZTJG 4TUJA 1EJOL 3HE6C 2CKBA 5DJZB 3V0WL 4OJFH 3LMJL 3ZYOA 1C5BL 2VWEE 4EDWL 5HSFA 2XOTA 2OXHA 1FLRH 2GSGB 2F74B 4P5TB 2W9EL 2MCPH 4UDUA 4ZTPH 5CGYD 1LDPL 5DJZA 5CSZA 1G7IA 3HNTH 2XACC 3DSFH 5T5FL 3UTQA 5I2IB 5EOCL 1MCLA 5K59F 3VE0B 3LHPH 2UZYB 3HI1A 1QFWI 1T1XB 1R3IH 3CVIH 1UM5H 1LO3L 3WFHA 3W9DB 3VFNA 1LE9B 1NBQA 4IRSA 3CSPA 1MRCL 5C0EA 4MD4B 3MCKA 4NT6B 1VFMA 3WIHH 1IEHA 2D7TL 1MCOH 3SDAB 5C8JB 3FT3B 5K33A 1T04A 3S5LB 4KZEH 1BJMA 5F7KC 3PNWA 5CP7B 5IFAL 4J4PD 4NZDA 4PB9H 5TQ2L 3GSNB 1JFQH 5JDSA 4L8SA 3JWOH 4X4MA 2B8OT 4JDTH 1VEMA 1BZ9B 4U31A 1IGFL 1XGRA 3QNXB 4LEOA 3SKOA 5ALBL 1E4KA 5B8CB 4O51B 1I1AA 1N8ZB 5HYSG 4OFDA 3VD9A 1CXLA 1VHPA 2X09A 4P2RE 4R0LA 2VR5A 2F5BH 1UXSA 3TO2A 2ZG3A 3LKOB 3VD3A 4JRYE 1WZ1L 5I6XC 5DHYA 4U1LB 1TTUA 2Q86A 2ESVD 4XPTL 2VDQH 2V2TB 2YMXL 5EUOF 1R3JB 3IJHA 5KOVC 1V3KA 5FEBA 3GNML 1EAPA 3EYOA 2GCYA 1IGTA 4OBSA 5E8PA 4L8BB 4B53A 2FHCA 1FC1A 3EJYD 5BXFB 5LQBL 4I3SH 4ODWA 4KJYA 2Y5TA 2Y6SD 5SWQA 1T89C 4HX1A 5ITFA 4KHTH 2X05A 1LILA 4QYOB 1FJ1A 5JXAL 5IB4A 2VDLL 4YHIA 1YEKH 4X7FC 1I85A 4J1UB 4KTYA 3MOAL 5DO2D 3L3KA 4XMPH 1MLBA 2E7MA 2UYLB 3KJ6H 5HI4C 5JIIA 3IXTB 3MACH 3FOMB 3EFFA 4N90D 1R5IA 3KDMA 2WV3A 1FGVH 1A7RH 1YNTA 4MS8D 5IESL 1K5NB 3FMGH 4FZ8H 4WI5A 4NQXB 2I5YH 1JPGB 1EUUA 1S3KH 1KELL 4KHXL 2XWBB 4YEEA 4DZBB 3MPCA 1A1NA 4J12A 3EYSH 2PN5A 4RA3A 1K6QH 4RGNB 1GGYA 3RDTD 5FYJE 2WSKA 4AM0A 4JFED 2JELH 3GJFA 1KLFA 1RSFA 4XNMA 4EVNB 3DX6B 1U3HC 1J8HB 1NFDE 3IU4L 3JTSB 1QBMH 2H1PL 1I3RB 1NSNH 3L9RA 4O9HL 1IQWL 4UDTA 3KXFE 3UZQA 1RUPL 4QRQB 4RA0C 1FL3B 3QXDA 4XNMB 4A6YL 5D2NB 5IMMB 1F6AA 3MXWH 3VFSB 4F57L 3SE9H 1QHPA 3P0VH 4D2NA 4Z0BH 2VXQL 2X4OA 5EZOL 2WWKO 4P3WA 1ORSB 1N6VA 3GMLA 1KN4H 1DQQB 1CK0L 4JREB 3GSOA 5JORA 4MAUL 2Y7QB 4FQXB 4CMMB 5D6CB 1IE5A 4O5LH 3ARQA 3QEQB 5DEGB 4LSQH 3SGEI 2OZ4L 3TBWB 5JNYB 3SE4C 1EZVX 4PJDE 5CEXB 5K93A 2HKFL 5EIIA 3QIBB 3IFPB 3WNPA 4LQFH 5DJ0B 3NFNA 5EORH 5FUZL 3QDHA 3RPKA 3ULUD 1N64H 1KUMA 5DMIH 3WN5A 4QRRA 2ZJSL 3MOBL 3NFSL 4JFDA 5FUOL 4AIXA 4X6DA 4JANB 4HUUB 1DR9A 4X8JB 4XNYH 3MROB 1G7PA 3F5WA 4K3DL 5SV3A 4UOJA 3PWNB 3TVMA 1F4YH 5EIIB 1PYWA 4BFGA 1Q0XH 3STZB 2CKBB 5E99L 1V8HA 2HJFA 4WTXA 2W0FB 4U0RB 4OCWH 5KSVA 1WC7B 4X9HA 2BNQB 2MMXA 4NFCA 5HYSA 3HNVH 1CYGA 5LGKA 5C0GA 5IVXB 4ONGL 4P2OD 1KTLA 4PV9A 2PYED 1OPGH 1DQTA 2OI9B 1AP2A 3UTQB 2YD5A 5I2IA 3MX0A 4U1NB 1I9JL 4S1SH 5T33L 3FT2B 5EU6D 1ZK9A 5BZWB 5F7UA 3IDXH 5EC1B 3T0EB 5F3HA 1FORL 5DURB 5EBLA 1CWVA 1G9NL 3IJYA 3IDGA 2A83A 4X80H 5IQ7H 3WJLC 2DM2A 5DMKB 3IAGC 4IIQC 2WP3T 43C9B 4V1DE 5AWNH 1QFUH 2C5DC 1RI8A 2YPVL 4Z9KB 3WKMH 1BGXH 2WANA 2VLJB 1CT8A 4CW1B 4JY4B 1MVUB 5KJRL 3MUJA 5ICXA 4AQ1B 1E28A 1R3LA 3TCLA 4LSPH 3VFMA 3OR7B 3LB6D 3JWDC 4K3JH 4GBXB 2OL3B 4YLQT 4G42B 1LO2L 3ULSA 1OW0A 5FDWA 4PREA 3LPWA 5C07E 4BH8A 4TTGA 2F53B 3H42H 4DKEH 1WBYB 1FNFA 1NGYA 3SPVB 1BX2B 1TETH 3BP6B 4KTEH 4P5MA 5C07D 4QRUB 4K9EC 4RCAA 3IS0X 2OQJA 5TGBB 2APWA 1FO0B 3CJJA 2XRAL 4G43A 1MJ7H 1ZS8B 1OT1A 1VFAA 3VXTB 2JCCB 3MUGB 1HHJB 1OAYL 3RKDD 2VL4A 4X7TB 1JIBA 4Z0XB 4JO1L 3CVHA 2C26A 4ISVB 2ARJA 3B9KA 4WUUA 4GRWF 4PJXF 4HKJB 4G80B 1A3LH 4LAJH 1FZKB 4V1DD 1A4JB 2VDOL 2P45B 3BT2H 4HWUA 2CRYA 5DFVC 3C6LB 3ES6A 3LQAL 4QXGL 3DI3B 1OGAD 4HG4J 1QUNA 2EDDA 4OLVL 5IQ9A 4N1HB 4P9HC 1W72H 5KSBE 2AJ3A 5DVKA 2VZTA 2WUCL 5DUBA 4DGIL 1WTLA 4HLZH 2EDHA 2CR6A 4QT5B 4LSVL 3WD5L 4MQTB 5HYIA 2AJSL 2NX5E 1T6VN 2ICCA 3PQYB 3NABL 1OW0C 5EO0A 1GZQA 3BXNA 4M7KH 1C12B 4OT1L 4JAMB 2UWEE 3BKYH 2YPLB 4S1RH 1KLUA 1MAMH 1A1OA 1A6ZB 1CXKA 7FABH 3OAUH 2CXKA 1EMTL 4QXTA 3EDKA 2XTJC 3V5HB 4JM2C 3ARGB 1MCKA 4N0UB 4L8DA 4YFEA 4AM0B 2EDOA 4OZHE 1OAUH 4PFEA 4FXGB 3HUJB 3SDYH 4Y1AD 3OXSA 1OTUC 2XZZA 4UT7L 1JHTB 1H0DA 4IOFD 4TUJB 3CC5A 3RGVA 2Y06H 5DWUH 5FA3B 4MJ6A 4I77L 4L3CB 2P7TA 2NR6D 1T5XB 3S34L 5IHUL 4NHCH 3VFSA 3KYNA 3CPLA 5FYLE 4QHMB 4UI2A 3CXDL 5FOBB 2YD6A 4MHHI 3HB3C 2NPLX 1W2KT 3HZKB 1FBIL 2XKNA 1FCCA 4PJBF 3QDMA 4APQD 1RJYA 4EI5B 4OLYH 1C5DA 5EA0L 3MZGB 4LLUA 1L9MA 4XP1H 4Z7VE 5H2BB 3VI4E 3W81A 3HFML 2WWKT 3MRCB 3MJ7A 4H1LA 3HZKA 1N2RA 3TC9A 1IC5H 4HQQH 4P48A 1JJUA 4HIXH 4X6CE 4OM1L 3UBXA 4ELMB 1SM3H 1GGBH 1ZLUH 2X9XA 3WDHA 4TNVK 5ESQB 4KKLC 3LZFH 3RVWC 1G7HA 2Q8AL 3MNZB 1XF5A 4I4WB 4K23L 4NCDA 4CVWA 4LCWB 2MQCA 3NIDE 4OQTL 3VWKB 4L9DA 4Z7QF 3HI5L 4KGJA 2VDML 1C08B 1U8NA 5EZLA 3VA6A 3SKOB 3TN0A 3LRGA 3AFLA 4JJHA 2C3HA 3C09B 1XF5B 2NY3B 5BRZE 3KPMB 2O61B 4OM0H 4JO2L 2DMKA 4P46D 4RFOH 5I8KH 2H6PA 1UM6L 1G9NC 2VWEC 4IHOB 3SGKC 3HMXL 2IADA 5DD1H 1LDSA 3PWPA 5I1IL 4U1LA 5KVMC 1KENH 1QKZH 4WIQA 4DN3L 1X5AA 1OQOA 3GI9H 3WS6C 4WV1B 5KVGL 4XNZB 5GS0C 2ZNWA 1FFOA 2Q1EA 2E9BA 4ZUSB 3NA4A 3S8WA 1EAPB 4PUBH 2MHAA 3L3IB 4D9LH 4G7VL 3ALXA 1D5IL 5IFJB 3WXVH 4PRPB 2YPKB 4PJCB 2ZP0T 5F44A 1EAJA 1DLHB 3NTCL 1MPAL 2AK1H 3RZCA 4U4BA 3QIBD 4DOHB 1XR8A 1WEJL 3HE6D 4R8WL 5L2KD 1TJIL 2OM5A 4WUKH 5J06A 3OB8A 4KH2A 1XGTA 1F4AA 1N4XH 3S36X 2O5YH 3G08B 4DCQB 1SQ2N 5LAXB 3ULSB 1DQLL 3MSPA 1YEEL 2GFBB 3OR6A 4OZFA 3TO4C 2AEWA 4ERSL 3PIQA 3KLAA 1M7DA 2GJ6B 2XWTA 4MJIB 1ES0B 4NO0A 1E6JH 3BOVA 1JGUL 3VGFA 1FO0A 2HLAB 2OCFD 4DZBA 3IFLH 4YHKH 4MNGA 3VWJD 4OLUL 1T0MB 2PYFB 2XWTB 1KCRL 1S7RB 1FIGL 4OF8A 3GMNB 2ARJB 3B9KB 4WFED 3MJ8A 3DVNA 2ZSVA 3VMOA 1BWMA 4GMSH 3FO0H 3QJHB 2DI8A 3JV6A 3ARBC 3MLXL 5GGSA 2ADGA 5GGRB 5DRZB 4ODHH 4QEGA 1MFAL 2KQNA 4XGZB 1M4KA 5HVGB 2VLJD 2ICWA 2V5MA 4M7ZC 1CFVL 3MV8E 1IM3B 1W72B 1CG9B 3HZVA 3MV7D 3DX9B 5HGBB 1F6FB 1I1FB 5HXMA 1H3XA 5DUBB 5D7IA 2EDFA 4HCRL 1DN0B 2FGWL 5TPWL 2AV7B 4JFFB 5J11B 4HKZB 1MWAB 1QO3B 2P5WA 4MXVF 4RAHA 2DQGL 5EBWA 5JUEH 1XZ0A 3HR6A 3VGAB 1XGYL 3LKRB 1EZVY 1AGCA 3VXNB 3AUVA 4ZAKB 4Y2OA 5EU7E 4WFHD 3EOTH 4WENB 5CEXA 4LEXL 3O41A 4BZYA 2DWEA 3AM8A 3ROOB 3NVQA 3RWEB 3QT2A 2IMNA 1DQJA 2X1WL 2RFXB 3L1OL 4ZUWB 5FYLH 3HUJA 2Q7YA 2AEQH 2QQLH 2WK2A 1WIOA 2DIJA 5L2JA 1ZVSB 3VDCA 2VO5A 4HXAL 2NXZC 2AJZA 4RWYL 4A6YB 4V1DB 2X4PA 4HF5L 1WLHA 2JJSC 2V2WA 3G9VA 3B2VH 3KYNB 4JG0L 3ZYIA 4EOWL 4CBPA 5GGTA 4M43H 2EDWA 3PJSB 5C70A 5CCKL 1PDKA 2AJZB 1A7QH 2VMFA 2R2BA 5IIEA 3RI5F 1BBJB 3MCG1 5IVOA 2AS5M 5C6TL 2WBKA 1NAKH 4IEFB 1ZA6B 2GSIA 4U6HB 2Y07H 4MNHA 5D1ZB 1I7RA 1QSFE 4U6XB 3CFKB 5CUSH 2R69L 3DXAA 5EU3A 5DRXA 3QDME 3V79C 3G5XA 4NJ9H 4XCCL 1W0WA 4F37F 1D9KD 1JF1A 4FQIL 9CGTA 3EAKA 4JRWA 4Z95H 4U6XA 2R2EB 3SDXF 1QFWL 4I4WA 1B4JH 3KPNB 4JKPH 2W0KA 4GAYA 1VADA 5GGTH 5GRVL 3S5LA 3GSUB 1C08A 1GXEA 3UJIL 3P9LA 1IL1B 2OTPA 2CD0A 4S11A 5MEOA 3QCTH 4FFYL 5DZNA 5F1IB 3G6DL 1IAIL 2WNGA 4JFFE 1GOFA 2VDKH 3SO3B 1KIRA 4R26H 2D0HA 1NEUA 1OF2B 4F7PB 5EN2A 1ZTXL 1RFDL 4JG1L 4X6BA 4H26B 4IIQA 3BKMH 1CD8A 2YXMA 4XBEL 1FNGA 5BRZA 2EE3A 2X44D 3GFUA 5KS9B 4RGNE 3RA7L 4BFEA 2CLZB 1S9KC 2UVFA 4FQQA 1XGPB 4IMLA 5E5MB 3S96B 2EC8A 4X7TA 2IAMC 4Z0XA 2GJJA 1AXTH 4NZRH 3EFDL 1UQSA 4HBCL 4PY8I 5I8OL 5LWYH 4DN4L 1P4BH 5KS9A 2DOCA 3LPGA 3R0NA 4LIQH 4JFOB 2IH3A 3F58L 1HZHL 2BVQA 3K4AA 3MRPA 3CFJA 1UYWH 4PJXE 3HB3D 5CS7A 3FB6B 2BOCB 2X1OA 2ZPKH 2J88H 4D8PA 4Z18A 2GUOB 4KXZH 2GK0B 4DCQA 3W5NA 1U93A 5CILH 1QR4A 3KYOB 5T1LB 3ULVH 2ITCB 1BZ7A 4P2OC 5I1AB 1JRHL 5K9JH 3LAFA 2X70B 4GAJL 5KANI 2FR4A 4PJIF 5B4MD 5TE6L 1IAOB 4X9FA 3NCYP 3BWAA 3KPPA 3EYQD 3PQYA 1MFDH 1LP9A 5HVWA 1J7VR 3QHFH 4R4FL 3NIFF 1KPVB 4X9GA 1YEGL 3RJQB 3HNSH 2DMCA 3WFEH 2FIRT 5TQ2H 3RHWF 1OTTD 3QUZA 1T0NA 2LVCA 1JZ2A 5ADPL 1ZAGA 3I3EA 3GMNA 4FXGA 3S37H 4QHUB 3RDTB 3FCTB 5LBSH 3EDJA 4PJFE 3UX9B 4R4NC 5EUKA 5J0BA 5AZ2L 1JTOA 4WW1B 3L3KB 3EO1B 1IZKA 1UCBH 4WEMB 3REVB 1KXQE 2ADJA 3GHEL 3TNMA 1NFIB 4JDVA 4OZFG 1BQLL 4HUVA 1WK0A 5F7EL 3O8XA 2K9UA 1IILE 3GSNL 4UDTB 2DQDL 1FNLA 2BDNH 4DEPB 1T03L 1WUNT 4W4OA 5DFVD 5IROA 4JB9H 1HCFX 3HCVB 5I15H 1D9KB 2XN9D 4MCYA 2WUBL 3TLRA 4Z7UA 5LQBH 2NXYD 5D7IE 1UB5A 3FQRA 4R2GC 1ORSA 4M7JL 5KOMC 4JR9L 1RZJC 4R9HA 4FRWA 4NUGH 5D7JD 4WWKB 1YY9D 2V7HA 2XQBH 5D70H 5GRUH 2GT9B 3GMPB 1E6OH 3C2AL 5DK2B 1NC2A 3OB0K 5CZVL 2KKQA 4KTDH 3B83A 5K9KA 4KRNA 4ZUWA 1WCBA 3P9MA 1FL3A 4HS8L 4OD3L 5CMAB 5C0AA 1KTDA 3LPFA 1I8KB 2HT3D 2YRZA 1D6EA 4NWTH 5F1NB 3IDMB 4FQHA 4YDVA 2X4OB 3ZKMD 2PXYC 4XT1C 3QXUA 5CKAA 3HUJE 4HCRA 4JY5H 1TJGH 2VZOA 2R23A 4D9RE 1DE4A 2GJ6D 2WM0A 4JANA 3BPNB 2O61A 2VDNH 1WITA 3T2NH 1RZ7L 4U1MB 3VXMB 3R8BB 5J1AA 2P24B 5DGRA 2W0FA 3DJ9A 5IIEB 2YSSA 3AREA 4WEBL 2HT2C 2VDPL 1CE6A 4PJ8C 5JNYA 4YO0A 1IAKA 1NC2D 4ZNEA 5D5MF 3ULVE 1JGEA 3FTGB 5D7LE 2RIKA 1C7SA 1OB1A 2YD9A 4KDTA 2VSCA 3BE1H 4R7NB 3VDAA 2V9RA 1WWBX 2ZG2A 3GKWH 2V6HA 2EO1A 3OAYH 3W11D 3QPQD 1X4YA 4F57H 2Q3ZA 3CFDB 3W2DH 1X4XA 4LRNH 1CGYA 4TSBH 1EEYA 3P0VL 5F3HB 1YEHH 4PJ8B 3CSYB 5JTWA 3THML 2VLKA 5GGQL 4NN5C 5B38G 4HFUH 3BIKA 4ZS6D 2R29H 1OTTC 1T66C 3D85B 5C0CD 3C60B 4JN2B 3Q3GA 4FQPA 1IL1A 5D1QD 4ODVH 3H0TA 1WWAX 3QB7C 5JOFA 1I7ZA 5D6DC 1QSVA 2NY0D 1AD0A 4EIZC 3RGHA 3PIQB 4ZAKD 3KLAB 1PG7L 2ZNXA 2FWOA 2IGFH 4HJJH 1TJHH 2DQIL 1OM3H 5JZ7C 1XIWD 1Z3GH 4YHPA 4BH8B 4WV1C 2F53A 1F2QA 1N64L 1RULL 1BQHA 1F42A 4PJ7F 2A6IB 3MLYL 4PP2A 3U36B 4F33B 5CBAB 5I75B 4WCYH 2C4XA 5FGSA 4KMTH 1MWAL 1SY6L 1T0PB 5C0CA 2DMBA 4OCWL 5J6GA 3QJHA 5DUPL 5CZKA 1T22B 3TESA 4C83A 1XGUB 4ZXBC 3BSZH 4JPWL 1FZMB 2FBJL 4EIGB 2VR4A 3N85H 3HG1B 2VLJE 3FB6A 1TCMA 3F7QA 1JZ7A 5E4EC 3BYYA 3DYPA 3CFEB 3JUYA 4YGVA 2B4CC 4C83B 4L9LC 5J8OA 1OWRM 4H20L 4RZCA 2PR4H 1RZKC 1X5KA 1CGSL 4C56D 5C0BD 2V17H 4LLQB 3BWAB 3KPPB 3WFCL 3U6RB 2FX8L 1OP9A 1M6OB 1P69B 3MODH 4DAGL 3PGFH 4OQ1A 2EXWD 1BM3L 3N9GL 3O41B 4M6NH 1RZKL 1DN2A 1UACH 3FJTA 2UY6A 4OCNC 3ULVC 3DRQA 3T0WA 3NCEB 2RFXA 4BJLA 4N0YL 1JZ6A 3Q6FA 4BK5A 1MFCH 2NY6B 4LSUH 2ATPA 4GG6A 2DQFA 3VXSD 4QXTB 5GGVH 1EGJA 5IVZB 2AJ3B 1ND0A 4UV7L 4YHOH 5KS9E 4PPTA 4KTEL 4JFQA 1KT2B 1A47A 2FEEI 3WHXB 5GZOD 4NFDA 1GIGL 3MRQB 2BRQA 5HGAB 3SO5A 1I9EA 4OZGB 1E4XH 3NACH 4X98B 2R0KL 3P3YA 2NY7L 1RZIB 4QY8A 2EIBA 2W0LA 4FMFA 4HC1H 4I2XA 4OCYL 5TDNB 3T65B 2NY6C 1JGLL 3ULUH 4NZTL 2VQTA 1UADC 5D7SH 1FPTH 3D6GA 1TIUA 3TWCH 4S1QL 3KYKL 3QXTA 5DRWA 1KJ3H 2X10A 1D5MA 3ZDYE 3UC0H 5C0FB 1YEIH 1L7IL 1TNMA 4L8DB 3MUZ1 1CDGA 2AV1A 1UKQA 2ICWJ 5KSBB 4M6MH 3QZWB 3RWIA 4YQXH 4JLRA 4LARL 5A16A 1JHTA 2ORBL 1IC4H 5CJOH 1U6AH 4PRNB 4UNUA 2Q76A 2R0ZH 1P6FA 1SJXA 1NLBL 5KSBA 1IQDA 2EEBA 1UZ6E 1BVLA 4UV4H 3BO8B 1JI2A 2CUMA 2B5IC 4MJ4A 4FQHB 3G6JB 4Q6YA 3P9LB 4GBXC 3AS0A 4M8VA 1NMAH 2IBBA 2FATL 1BPVA 4ZO8A 1C16B 5CLWA 2N7BA 1YQ2A 2OJZH 5F9WB 4XCYB 3VJ6B 3TN0B 4AQOA 3BEWB 5DEFB 2LU4A 1YN7A 1CGWA 4UUJA 3D69A 4P23A 2P5WD 3MUY1 5E8NA 5MI0B 1JNNH 1YUHB 2RBLA 4MVBC 2VXSH 4L8SC 4OZGE 4PTUB 3VFWB 4QNPE 2X41A 3O8XD 3HI6L 4L5FH 2WBJD 3C5ZC 4Z76B 4EN3C 1RV6X 3ALWA 4HV8B 5D7LA 2NTFA 2A74B 4I9WE 3DBXB 1HYSD 1J88A 3DSNA 2NY5H 5BV7H 3E6FA 4F3FA 1GC1H 1HH6B 2BC4A 1S7SA 2EDLA 2Z92A 1MH5B 4PGBB 5JPMA 4K7FA 2XG5A 4LFHD 2CRMA 2YPKA 2P5ED 4PJCA 4FQLH 3NGBC 3WHE0 4LCYB 5FYKH 1NAML 4XWOC 1IGYB 3FN3A 3CX2A 1I7UA 4U1IA 4DFHA 3MBEC 4JM2D 1S7SB 4L9LA 1U3ZA 1X5ZA 1FFOB 4KJWC 1NCDL 3KPSB 4XPBL 3VXMD 1QSFB 1XF3A 3BMVA 5IMOA 1S9XA 1TENA 5TH2A 4OQTH 4GW1B 3ARGC 4MJIA 5LGJB 1LE5A 4G9FA 4IBLT 5INDB 3IT8D 3O6FC 4N8VG 4ETQB 2JB5L 3U30B 35C8L 4Z8FH 4HUNB 1UC6A 2BZDA 4OZHB 4DTGL 3DGGA 3W0WA 1DLFH 1MJ8L 1WTGT 2FH6A 3FFDB 4F15C 3SDCB 5I1KL 3EJZD 4BQ6A 3H9SE 4UIMA 2KDGA 4HAGA 1QFWM 4JDVB 3HG1A 5DT1L 4APQB 1U8PB 3AAZB 2H32B 4TVPD 3VH8G 2G75B 4DWHA 4ZNCD 2ADGB 1ACYH 3LH2H 1U36A 4MLSA 3EHBC 1MAKA 2WLYA 1KFAL 1HHKA 3QULB 1AE6H 4OIBA 4YDIH 4OCSL 5DVMA 1VERA 5E8EB 3K3QA 3SDDC 4Y5YA 1WZKA 4R6UA 4D0BA 3NCFB 4ZPTB 2I25N 4LASH 4NNXA 3U7AA 3MNVB 2X4NB 4H8WH 5DI8A 1U8MB 2AK1L 5FYKU 3S3PA 1MCPH 4LRIC 3K1DA 4WWKA 3BH8A 5IV2B 3PDOA 1U8OB 2FYYB 3E2HB 5FO8B 1MFEL 3BRDA 4GAGL 2NW3A 1QLRA 4ZOAA 4E41A 1M7IB 3TJEL 1A9EB 1JBJA 1IM9B 1DP0A 4YJZL 3INUL 2A0LC 4XGZA 1YEJL 3C60D 1DQLH 5E2UH 1CS6A 1TLKA 3BH8B 1S9WA 4GW5A 1MHPL 1U8OA 2EDJA 2FYYA 3GI8H 1CIUA 2C4FT 2HH0H 4YDVB 4PJ7A 5CIPH 1YC8A 5MEPB 5C0CE 1AGEA 3WJJA 4YBLB 2OR7A 3QDJE 4GG6E 4NNPL 1JGUH 2UUDK 1UM5L 1J1PL 1LO0L 4HIJB 4FQJH 2AGJH 1JHKL 2AXGA 4KVCH 4GKSB 4XBGA 2A9NH 4M03A 1KCRH 3VXQB 2Y72A 3RVTD 5GIRA 1EHAA 1H5BC 2I26N 4U3CA 3H9SD 5AAWA 2A6KA 2J8UB 4K8RC 4XVJH 4JLRB 2XZQL 2FJHB 4EQ2A 2E7LC 3HRPA 2XXCB 3C5JB 4RBPH 4TULH 5DDHA 32C2B 3BN9C 3EOAB 1EVTC 3EZJB 3IGAB 1R0AL 3MRMB 3VE0A 1BFVH 4J2XA 1FP5A 3Q3GB 1Q72H 4YXLL 4ZFZB 1MCJA 2VNCA 4JZJA 1VENA 2ITDB 2IQAB 1JUFB 2GJZA 4N0UE 4X7SL 1IAIM 1CL7L 3VI3F 5KBNC 1U41A 1CDUA 2GSIB 4PRDA 4HJGB 3ARWA 1BD2B 4ZFZA 3IFNL 3NOIA 1YY9C 4PY8J 4Z7WE 3K4ZA 5I0ZA 1DBBL 3LRHA 1IEAB 4FNLL 4PRDB 2EZ0C 5D7JC 3E1F1 4N9OB 3QUMB 5E6IA 4DK6A 1EJOH 3QDGD 3BZEB 3MJGX 1I1AB 5GHWH 3MOAH 4TNWF 2CLZA 5AUMB 3BRFA 1FFNA 2NTFB 3O3DA 2E9WA 5EZJA 2VRAA 3O4LD 1SYVB 3H8NA 3BZEA 5GJTL 4ZXBA 4HG4K 4KK8D 1WT5C 2GTZB 3QO1A 5F6IC 3FMGL 4FZ8L 5AYQA 1SYVA 1SJHA 3BN3B 3MQIA 4CN4A 4QNPF 5TDPA 3IAPA 4OLWL 1WAAA 4GG8A 3JSSA 5EOTA 4OSUL 1KCKA 3MNWB 4DQOL 1EEUA 1XGPA 4IMKC 4NJ9L 4XCCH 1KCVH 1IM9D 3RIFK 2BXZA 3GJEA 3O3AB 5CWSA 4L3EE 4J3WA 3BQUA 5F1KC 3LV3B 1PEZA 4O9HH 2C3WA 5I16B 1X5IA 3QQ4A 4NP4L 4XVUD 5LGJA 1LE5B 1QRNB 1LHZA 3QR2A 2BJMH 5GJSH 1UM4H 1TVDA 2AI0H 4QTIL 4Y4KB 4F37K 3SE4A 4Z0BL 3QUXA 4QRRE 2BY1A 4JO4L 2GK0A 1VFUA 5B4MC 4H25B 1MCIA 2FX9L 5DD0H 2VQ1A 3TBYB 4F9LA 4PRBB 3S36H 2DLGA 1FYHB 4I1NB 4MAUH 3EFFB 1IKNC 5A3IC 2FHFA 2C3VB 1YA5A 2BNUB 3VRLF 4NQDE 3J8F7 2HT4C 1AI1L 1NCWH 4WW1A 2FL5B 3S9DB 3O0RL 3MA9H 4I3RL 4JQVA 4G8GE 2AQ2A 2B0SL 3PG2A 4MMZC 3UP1A 1OHQA 4HZAA 5IB2B 2DKMA 4UQ3A 3V7MA 1RPQA 4TVPE 4QOKE 4OF5A 4UU9A 3O8XB 1NANI 4PY7A 4HK0B 2IFFL 1QTYT 3PGDB 4FHBD 2VXUL 2EYTA 2IC2A 4XI5D 4F7TB 3KPRD 5A16B 3IRZA 3V4PH 1HCVA 1KC5H 5EUKB 4QRPD 1KACB 4X83A 4JCMA 2APBA 3UTSA 5JMOC 1A9EA 5BVPH 5IJKA 4QCIA 3IB4A 3KJ6L 4ODXB 4P2RD 5KSAD 5DJXA 25C8L 5D2NA 1FVDB 1W8OA 6FABL 3JWDH 1N5YL 1YPZE 5K9JL 2DQEL 5CEZL 1OAQL 2R1XB 1OPGL 3LEXB 4PG2A 5MERB 3LMJH 1AY1H 1OSZA 3L3OB 5IGXL 1NC4B 2VL5B 4XNXL 3QEQA 5DEGA 3UAJC 3H6JA 3ARFB 1P7HL 3OJMB 1UKSA 3ETBF 5JORB 3M17B 3WFDH 1KELH 3BPOB 4KHXH 4N8CL 1B0GB 3VFGL 2RCSH 1ZXQA 1BIHA 2HMID 1WBZA 5AEAA 2ZCLL 2VZ3A 4CU7A 2B20A 2QSQA 4F7EA 1QFUL 4K7PL 2G2RB 3SDXB 4D0CA 2LAAA 5C0BA 4UTAL 3R8QA 1XF2A 4PLNC 1RJZA 4J3OC 2HJFB 5IJVA 3CFBB 4EJ1C 2G2RA 3AMLA 4KMQA 5I9QC 4KZEL 4XAKE 5F1NA 2V2XB 4A2MA 5IFAH 4R7NA 1JFQL 5IEKA 1AD9B 4MB5A 5IR1A 3MZTA 2BDNL 4JFXA 2BHUA 2ZSWA 1T83C 1IGFH 5DJ2B 3X11B 2XQYK 3WE6B 4MHHG 2VTFA 4HH9A 1KTLB 4PV9B 3A67H 4HFWB 1BFOA 5DD3H 5EBLB 3T04D 4R0LC 4O5LL 4X4YA 2EIDA 1CZ8H 4O2CB 4GRWH 4PJ7E 2QHRL 3RWCA 5E2VL 3C8KA 4OZIA 5H37H 4HFWA 5L0QC 4FZEL 2EIEA 3STLA 4I0CC 1MF2H 5IMOB 2OI9C 2NX5A 2ENSA 2LU3A 5KN5B 1HXMB 1TQBC 1PKOA 2X4QB 4NM8H 2EC9T 1HILA 4OFVA 1FFNB 3HKFA 1TNNA 3O3DB 2OL3A 3NN8B 2H2SD 5DJYB 5I1JL 5JOPD 2D7OA 3MCLL 1JWSA 1L0XA 4WU5A 4P3DA 1NGWB 3MO1B 2RAMA 3A6BH 1AHWB 3FQTB 3KXFA 3WD5H 5DTFB 4OIAA 3GMRB 1I9JH 3U0WH 5DJYA 2QQKL 4WW2A 4QRUA 5E2WH 4P4RA 5HGHB 2IAMA 4LVNC 4ZUTB 5FYJU 4FA8A 3E3QE 3VA2C 4YDLC 1G9EA 3TNNA 1VPOH 3UTTE 2HTKC 5CSGA 2PO6A 2O26U 4P4RB 2XZAH 4C57C 1MCCA 2UWEF 2OMNA 5HDBE 1EX0A 3FRUB 4JO3L 5IQ9B 5DWUL 4FQCH 4BQBA 2JELL 4PJDA 3VWJC 3TNNB 1MLCA 4OGXL 1HINH 1F4XL 4HKXB 1RZJH 4RAUA 3SDAD 1JZ5A 2JB6A 3ZT5A 3QI9A 5KW9L 1JGDB 1H3VA 1MHCA 1OP3K 1G7MA 2BVTA 4OGZA 3WIIL 5I71B 4KAQH 4A6YH 3QEUA 3OKNA 3FOMA 2QL1A 3VWJB 3UPAA 3ARGA 1QFHA 1EBAA 3PV6A 5E6YA 3ZE2E 3QJFB 4HJ0C 2NR6C 3U1SH 3B9DA 3CDYA 3DHMA 4HQQL 3V2AR 2GITA 1KLUB 4LVHC 2BY2A 4ZUVA 2CUIA 1XH3B 3B3IB 4HIXL 3VFRB 5J57B 2EKSA 2PTTA 1MWAH 4S2SB 5M94B 1GGBL 3RX7A 4NNYA 4NQDA 1CL7I 5B21A 3KG5A 1AGFA 3ZLQC 4U1GB 2AXHA 4LHUG 3SY0B 3HI5H 3KAAA 2NY2C 5FAAA 4QHMA 3Q0HA 1U92A 3KS0H 3G5VB 5FDYA 1QLEH 4QCIB 3VXUE 1GGCL 1CBVL 1BJ1J 1FZJA 4K3DH 4F2MB 2F58L 4Q2ZB 1W0YT 5DJCB 3TBVA 3QDMB 3OG6B 5B3JE 4B5EA 4HIIB 4NZUL 5MERA 4JGUA 2VLMD 3T0AA 1V7NH 5C92A 1OSZB 1V3JA 2BVYA 5DQDL 2FIKA 4OTXL 3CDCA 1FZJB 2IAND 1FRGH 4RAVB 4V2CB 4JQIH 4LK4A 4UT9H 2R56L 5HHPA 4EKXA 4ONGH 5I1EL 2NY3D 1ZEAL 3CSBA 5ESQA 3HMWH 3S88H 1JRHI 4YBQC 1LO5A 3SE8H 4PJFA 1D5IH 1XIWC 3RWIB 5JMRA 4XI5C 1U8QA 1RAMA 4PG2C 1CFTB 1CF8H 1NGZA 1WWWX 3IU3A 2BY0A 4P5KB 4OLZL 2HTLD 1G7HB 3MJ9A 4JFDB 5GGSY 3GSWA 5ENWB 3H9ZA 4PJFB 1ZHLB 1IGCL 1S9YA 2G9HA 1WGOA 1A3RH 3BVNB 2R0LL 2AXJA 2DQHL 5GPRA 5DJ6A 1AFVH 2IANA 4PJGE 2IADB 4JN1H 3VFWA 4Q58C 5ISZE 2Z8SA 4ZXBB 4OCYH 1HH9A 4LKXA 3RVTC 5IR1B 2BVUA 1GPOL 4EDXB 3KPMA 2BNQA 2R4SH 3T3PF 5TDOB 2BSRA 5C09A 4Z7UE 5TF0A 2Z91B 2BRRL 3S6CA 1BFOB 1KTRL 3BEWA 5FYKD 1Q94A 3HFMH 4Y4HC 1A6PA 3L7FB 3NZHH 4GRWB 3WLWD 5B3JF 2P46B 3HC4L 4JDZA 4MGXA 4YQXL 4RMWA 1YUHA 4NO5B 5LJYH 3CLEL 3H3PH 5CJOL 3TA3A 5J7CC 3O6ML 4QRPB 4CJ0A 3PL6B 1JE6A 5B39A 3GJEB 2XRAH 3OJDA 1VSCA 4XHQA 1T1ZA 4PGCB 4U2YA 4WHDA 2UWEA 43C9A 2VITB 3HE7A 5IBUB 1LMKA 2EICA 3BUYB 4FXKA 4UV4L 3UTTD 4KROD 2CKBH 2DBLL 4LSTL 5DA0B 1KCSH 5GQBA 4LIQE 3QQ3B 1T1ZB 4PGCA 2VITA 3ZDYF 2VDOH 4NO2A 1NGQL 3BT2L 2H32H 3HE6A 4JO2H 1DJSA 3GMMA 4F9PC 3SO3C 2VAJA 1ES0A 4NO0B 2AJVL 1KJ2L 4POUB 1A6VH 5I1IH 3RTQB 4KK8C 4DN3H 5BQ7A 1UFUA 4PJ5A 1BOGB 5F7MC 3OV6A 3QG7H 2MKWA 4HUKB 2YD2A 4X7EC 5E9DD 3Q5TA 3NIGF 4MB4A 3BX7C 1ZSDA 3D25A 4LHJB 1YMME 4MA3B 4D9LL 4XB8A 2AJSH 3RTQA 2YD3A 3F7PC 3VXPA 4LPVA 1NFDA 5FYJD 1PFCA 4NQVB 1X44A 4PR5B 4X4XA 1BWWA 4YXHH 3QAZC 2PW1A 4P3CH 1JNJA 5BV7L 5EUOB 1YEFH 4R8WH 1O0VA 3UDWA 4G3YH 4NQVA 4ZPTA 4BKLB 1F8TH 1SMAA 4RAUB 1SMOA 1S9VA 4JG0H 3B9KC 2AV7A 2N56A 4XPGH 3MFFB 4XCFH 5IB1A 2AJUH 4XXDA 2C3XA 3LEXA 3MV9A 3PABB 3DSFL 5T5FH 4L4TD 1BECA 4Y5VB 1M05A 4HW6A 2QADB 4JKLA 3V95A 1MCWW 1R24A 4Y4HA 3VGGA 3O6KH 4JE4B 4C54A 5EBWB 5KG9B 1ADQA 3ILPA 1CCZA 3QDGA 1G0XA 5H35A 5HGDB 1F02I 4JHWL 4WO4D 5FV2A 3BW9A 3P9WB 4GMSL 5F7LB 4KUZH 4MZ2A 3RNQA 1DQJB 4UILH 1B4RA 3QUKB 1YN6A 4JKPL 5MENB 3WN5C 4ESKA 4MJ5B 3W5MA 1QRNE 2Q8AH 3RNQB 3FN0L 5IEKB 4K7PX 5FXCH 2E3VA 4MNQE 1A1MB 4GKNA 3SHSA 1Z0MA 4B7IA 4IOSD 1MUJB 4HIIA 2DQGH 4PJXA 5JUEL 4DUXA 1AO7E 1RIUL 2R2BB 3GGWA 2OR9L 4HGWA 4Q6IA 3GMQB 5HHPB 5JW3H 4IRZL 1F3RB 5HDQL 4LLUB 1DUZA 5DJDA 3MYJA 4KUCD 4C55A 1AR2A 3W39A 4IJ3B 5GRXG 1HZHH 3QRGH 3GSQA 3O6FD 1DUZB 3K2MC 5JXAH 3WFHB 2AKRB 2ARWA 2FRGP 1R6VA 3W39B 1NKRA 5E8OB 2DF3A 1TXKA 4LGSB 3ULVF 4J3TA 5DJ6B 3GSUA 8FABB 3DOSA 1N6QL 3QQ9D 1PW3A 2HWZH 3O4LB 2GJZB 3QIWD 2IF7A 4FQQB 2NW2B 3QHFL 4ZFOB 2W9EH 1LDPH 2Z8WC 2BVPB 3I50H 2GCYB 2NYYC 2R69H 4Y7MA 1U8HB 3RWHA 3SJVD 5ADPH 4JDZB 2FO1A 3X12A 2I9TB 2YKLH 5BRZD 1AXSA 1GRWA 5FB8A 4Z95L 2Y6SC 1T3FA 3B9AA 3IFLL 2CJUL 3JVGC 1OAXL 5DMGC 3C5ZD 3QRFM 1R0AH 5D1XC 3WFBH 3WS6A 5F9DC 1AXSB 4HKXA 2UUDH 4PJBA 1JPTL 4DEPC 4H5SB 1SHMA 2HVJA 3U2SA 3FO0L 4W70A 5F7EH 1MFBH 3AS2A 2J8UE 4HUXA 4OZIF 2VLLB 1D9KC 1U93B 1AHWC 1LP9B 1RJLB 5SX4I 2XI9A 5ACMA 1KN4L 2WLZA 3QUZD 1CK0H 5I19H 5ALBH 2XV6B 3IDYC 3KPLA 4Y4FD 1LNUB 1T0NB 1PKQB 1DBBH 3RHWK 3BEVB 3QUZC 5I75C 3DVIA 2W9LA 3WUWG 2FDBP 5C09E 4D0DB 5BMFH 3DX6A 5LWYL 4RRPA 4AEIL 2E8ZA 3KPLB 2APTA 2P47B 3QUYA 1WJ3A 3K2UL 3VFVA 5E24E 1I85C 1S5HB 1QPPA 2DD8L 5E2TL 4XNYL 4LQ1A 4MQXC 3QFJE 3SY0A 2OSLB 5K9QI 5E70A 3WUWA 2X4RB 3QUXB 4KI5E 1KGCD 3CU7A 1CFQB 2FJGA 1XF4B 4U6TA 1CE1L 4HK0A 3NIFE 3CAFA 4FTVA 3VD5A 4F2MA 2Y36L 3TNMB 1JL8A 2V7NA 1NFIA 3GSOB 4GW4A 4Z7WF 1PGRB 1OOAA 1GAFH 5JXEA 2G5BA 3LCYA 1T7XA 4TPRH 4R7DB 4HHAB 1UB5B 5LCVH 4TVPH 4S1SL 3OQ3B 4O58H 4RGOL 2NX5D 3EBAA 3FOLB 1FDLL 1BBDL 5GZOC 3RY6A 4LSRH 2E7BA 4UQ2A 4X6CA 1A7QL 4WI4A 1FGNH 1V7MH 3BISA 3DWTA 4MJIE 4PJEA 1OP3H 3QDGB 4UAOC 2H2PD 3LHPL 5DMJB 3UTTB 5I6XB 4RISL 3T1WA 3MRLA 1OGAA 2J6EL 1G7PB 3WKML 3PWNA 3TVMB 3TT1L 4UQ2B 4LRNL 4TSBL 4FQXA 4ZSOA 3QIUB 1GHFH 3E3QC 3NPSC 4N5ED 5E2JA 3UTSB 2IJ0C 4MXQC 1A7BA 4HIEB 3RWGA 5D2LF 2D7TH 1H9VA 3CLFL 3DO3A 3VCLB 3DNKA 2BSTB 3HRZA 4X5WB 2EDXA 4R2GB 1FFPB 2F54E 4DOHE 1NUNB 1T7YA 1CTNA 1CLCA 3IU4H 2P24A 4YIQB 5SWSD 5ID1A 1RJZB 2X9WA 1AI1H 3SKNA 2OBGA 1FQ9C 3HAEG 2MSPA 4JDTL 3STBA 5GGTL 4I5BB 4XCNB 1TETL 1KIPB 2OJEA 3UJIH 3NPSB 2DQIH 1OM3L 2Z91A 2V2XA 3STZA 4LDLB 4JHBA 3CZFA 2Z31A 3OMZA 1JTPA 4Q74A 5GS0D 5F1SA 4XNUL 2P5EA 4LU5L 5I0DA 1GL4B 1WBXA 3HI1B 3FTGA 1UB6B 1ZA6A 2J6EA 4P23C 5KVDL 1YQVL 4XVSL 1G7JB 3O2DH 3LEVH 4LAQH 1E6OL 2YUXA 4R97B 3OJDB 2WZPD 4BK4A 4MD4A 3VFMB 1JPSH 4NZRL 3HE7C 4L29A 4NWTL 2B5IB 1L6ZA 3I84A 4YK4B 3LRSB 1AD9A 1AY1L 4Q7DA 5JW4N 1TJGL 1CGXA 4I3SL 1W72L 4Y4KC 2LV4A 4NO2B 4KV5F 3BIKB 4KHTL 4LDOB 2QADD 3D85A 3BP6A 4YWGL 4RFNB 1B6DA 1F4YL 3TN0D 3GIVB 3VFGH 4AIZB 1NCBH 1Q0XL 3EDFA 3MV8D 4Q0XL 1LE9A 2E9JA 2ZCLH 1JP5A 5GZNC 2VDPH 2VZVA 4QHLB 3FB7A 5CBAA 3CSGA 1VFAB 1MIEL 3UO1L 3ZE2F 1EUTA 4N0FB 1HHJA 4OT1H 5D1QC 5J3HC 3FO2B 2D0GA 2HJKA 3ULVL 5D72L 4FG6C 5MI0C 7FABL 4HBQA 3MLUH 5DHYB 1IGJB 5KVFL 1NMBH 4L8SB 5DTFA 2NZIA 1UACL 3RWHB 1VESA 3MRIB 2PO6C 3X12B 3SPVA 4R4FH 5E5MA 3CDFA 3ET9F 4RSVA 5T33H 3PL6C 3MJ9H 4G9FD 1JK8B 1DL7H 4O51A 2HN7A 3KNBB 1PQZA 3BDYL 4L8BA 2A9ML 3MV8A 3Q48A 2LE9A 3IDIA 2YPVH 3CVHB 3I9GL 1OQXA 1B3JA 2NXYC 1AHWA 3UROR 1P5UA 5DVLA 1X5JA 3FRUA 2CPCA 2V2TA 3EYUL 4ODTH 1K3ZA 4NZTH 3MV9B 3WXWH 2ZUWA 1A5FL 1PG7H 1YDPB 5BJTA 2IGFL 1UEMA 1LO2H 4BSVA 3VFUA 2X70A 1HNFA 2BFVL 5EZIH 4TUOB 1R5IB 1PD6A 5C0BE 4M4PA 4M9OA 2DQDH 4OF6A 3SE3C 5SWQB 1A02N 2DYPD 4U49A 1IC5L 4M7LT 4W6XB 4GRWE 3H3BC 4XRCA 4PGEA 1X5FA 1C5CH 4HWBL 1K8IA 1EJ6A 4J1UA 3VWJA 3UJJH 5BW7C 4ZNEE 2P8MB 5DYOA 3RGVC 3OKDA 5BOPA 5HHQA 1XH3A 3B3IA 2Q6WA 3VFRA 3IXTA 2XQBL 5D70L 2GYSA 1J8HA 5EORL 4OZGA 3RVXD 5DMIL 4BA8A 3D9AL 3OKEA 5FUOH 4WNQA 1YY8A 3AS1A 4M5ZL 1FNEB 5IVXF 5I8CB 4FTVB 3S98A 1J0KA 1LP9F 2EIZB 3TO4B 5FA4A 4ZFGL 1NFDF 3R4DA 1A1NB 5C0FA 1QFPA 5CGTA 3CC5B 1DBKL 3RGVB 4MWFB 4QXUH 4NO3A 1GJIA 2JCCE 3LD8C 3MRCA 1JPFA 1FV1B 3A0OA 3P73A 4NNYB 4NQDB 3MLSH 2VXSL 2X4UB 4PRNA 4DGVH 3MRGB 2V5YA 5LG1A 1HWHB 5F7NC 5J1SC 4NJAH 4LCWA 2DIBA 1T4KA 2F53E 4CVUA 3NCJL 3IDXL 4HGMA 4TQEH 5GS0H 1H3UA 2Q76B 4QRRB 3WN5B 1HI6A 2PF6A 1INDL 5IFHH 1GVIA 4K55A 1RUKL 1NBYA 5DZOA 3V6BR 4NKQB 3TN0C 3QWRD 1UWEL 2IBGA 1FNSH 2EYRB 4RDQG 4D3CL 1HI6B 1U3HD 4BM7A 2E7CA 3MNZA 3O4LA 3L7EA 1K4CB 2CK0L 3O11B 2FECL 5DJ0A 3OAZH 4XPBH 5DEFA 4JZNA 4WHTB 1QRKA 1I9RL 2YSSB 4H1LH 4KDTC 1BREA 1ETZB 1Q0YL 5ETUA 3SCMA 3OGCB 2HG5A 3DO7B 3QWOB 1NGZB 3IU3B 4AYFA 3V5DA 4P5KA 3KLHC 3DUUB 3DBXA 4KK6C 1FO0L 4IJ3C 5CSBA 4JZNB 4WHTA 3SDCC 1F3DH 1BZQK 1HN1A 1ZHKB 2A83B 4XWOD 4WCYL 5J1TC 2AK4E 1XGTB 4N1EA 3CFCH 1EXUB 2OYPA 4ZS7L 4DK3A 3S35L 1NMAL 1E27A 1D5ZB 2EDNA 1CD1A 4ONHA 1T5WB 3HZMB 4OAWB 4MA7L 1QNZH 4XB7A 4IS6A 5I1EH 3PWPE 5A40E 3QWRA 2QSCH 2D2OA 5ERWB 3VU2A 4ZFOL 2ZKHL 4NWUH 1T0MA 2PYFA 5D1ZC 1FYTB 1U8LA 2XPGA 5IVNA 2DM3A 3MC0A 5IM7A 3FT4B 5IW6B 3DV4A 1F97A 1KB5B 2FJFB 3TA3B 3BKCH 4QRPA 3BHBA 3NGBB 3NPZB 5F7YC 1P4LB 4RIRA 5T5NG 3HI6H 4MX7A 1KENL 1QKZL 3OKLB 5DK0B 1VEOA 2D3VA 2FX8H 5KVGH 5BV7C 5BCAA 4GQ9H 2CH8A 1YEJH 1DBAH 2C7UA 4M3KB 5FDWB 1CVSC 3VXUA 1U8IB 3KNBA 1BM3H 3N9GH 1PQZB 4HXAH 4PG9A 1KYOK 1F4HA 2G75A 5F6IB 4NKOB 5DXWA 3FB8B 4OLXL 1NANH 4YC2B 1B2WH 4NM4H 4HKZA 4PG9B 2LTQB 4EI5D 3SGKA 2CGRH 3KS0J 4OZIE 3ZSTA 3HC4H 1N4XL 2D9CA 5IBTH 5IG7A 3LKRA 3MNVA 4KJPD 3HAEA 2Z8RA 2X4NA 3L5IA 1ZVHA 3RIFF 3H3PL 3VFUB 3E2HC 4ZD3L 1YEEH 2NY7H 3M1BA 4D0BB 1HNGA 2EDQA 3AU1B 1LWRA 1EEZB 3TWCL 4E0RA 2BK8A 1KJ3L 3BKJL 4HDIB 4JFDD 4NFBA 4XVJL 4CVXA 5LXGH 4JM4L 3ECBB 5J12C 1A1OB 1A6ZA 1IARB 4TULL 1L7IH 4XP1L 2VABA 1NJ9B 5INCA 5LGHH 4U7KA 3QIUA 4GAFB 3DRQB 4DTGH 4EZMA 1HHIB 5F96L 5L6YH 3BZ4B 4S0TD 5J4MA 2B1HH 1J5OL 5C86A 5ANMA 4MA1C 3VXRB 4ZPVA 3DUHA 1ED3A 4Y2DB 2CKNA 4Z7VF 5F89A 4PB0H 3BRGC 5C0RH 4K23H 3D39B 5E00A 1CL7H 4JFQB 1IAMA 2A6DA 4FFZH 4QHKI 5CBEA 3DHJA 4J3XA 2VISA 1AKJB 3SJVA 2OL3H 4ZPVB 4OFIA 4HAFA 2GY7B 3QZWG 4GKSA 4XBGB 3CFKA 4OCXL 1NKOA 3RA7H 2A6KB 4OM0L 4WW2F 5FGCB 5IKCB 4H8WC 2GSGA 3FFCA 3OXSB 1CDYA 5DHVH 1ADQL 1MJJA 3BW9B 4GS7C 5DD1L 2H2PC 3LKSB 2E6JA 3V8CA 2D7NA 5I8OH 4G6MH 4KKCC 3QIBC 2D4DA 2A2QT 1I1YA 2ZOKA 5D7JA 3DTXA 4GO6B 1XFPA 2DBJA 4KK9C 1I7RB 1UYWL 2JJUA 1H5BB 3CMGA 4L5FL 3UMTA 2IQAA 4QTHA 3WXVL 1BIIA 1BP3B 1KXVC 4PRPE 1Q1JH 5H2BA 1OF2A 3F7YB 3N1PC 1FVEB 3MLPA 1GC1L 4MD5A 3GSNA 4OJFL 4OSUH 5IOPA 5HVHC 5JDSB 4X8XA 3GMQA 1L6XA 1S5IL 4AIOA 4CVZA 2D7QA 3LIZL 4NRYB 3UBXB 3MGAA 2JTDA 3I6LD 4ELMA 1AH1A 4JHWH 4LEOB 1MREH 2P8PB 3FO2A 1NBVH 1NEZB 1YN7B 2EEAA 4J3UA 1ZT4B 1QFOA 2VZSA 4YHMH 3GSVA 2JIXD 1E4KC 3T08A 1JNHB 2BJML 2XTJE 5HTSA 1E4WL 4HUMB 4QOKA 2XN9A 5BRZB 4DFIA 3QAZB 5E8OA 3G04B 5I76A 1FIGH 1BZ9A 1CFSB 1PY4A 2FX9H 1BLNB 4IHOA 2G60H 2BNRA 1TDQA 3GHEH 2JB5H 1KULA 1ZKAA 4EUPB 1A6TA 2DWDA 4Y5XA 4ZS6C 1RVFL 2VLKD 3MLRH 2W60A 5MHSE 3ZO0A 1NCWL 4JPKH 4ODHL 2W91A 3G08A 4GT7A 5CEZE 4DJMA 2DRUA 3HLAA 3V5KA 5M7QA 3X13A 4M48L 5IMKA 1A6TB 5I1HL 3D0LA 5E4EB 4Q97A 1I75A 1DVFA 4PBVC 5EOTB 1NGPL 3QNYB 3MUHL 5C08B 4L9LB 1RZFH 2HKHH 1KLGA 2I60L 4I3GA 5I16A 4K3EH 3VRJB 5E94B 5IW6A 2DJUA 1QBLH 2FB4L 3PWJA 2JJVA 1K8DA 3HC3L 3RDTA 1RFDH 4JG1H 3BGMB 4KQ4L 5A43C 1LNUA 5T3ZD 3ZSSA 4WGVB 5EU5B 3G6JE 1QRNA 5GGUB 1EGJL 4QYOA 3REVA 3VI4F 4G8IB 2ADJB 3PWJB 1ITCA 1U8IA 1K8DB 4RGND 2BNQE 4BFIB 4S10A 3D3VB 1MFEH 1T1YB 4HUXB 1FNHA 4GH7B 5F7FA 5I8EB 4YE4L 3Q5OA 3VFVB 3O9WB 1S5HA 5FYLL 2DKSA 5KVEL 4DZ8A 5HDOA 3O3EB 2VDNL 5FCUL 5JLZA 1ZLUK 4Y89A 1RZ7H 4CNIA 1RK0A 3I50L 4BZ1L 1YEKL 4RWYH 1WWCA 4LLDA 5EO1A 1RMFL 1UH3A 3L3HA 4K7PH 3FQRB 4XMPL 2O5ZH 1J1PH 5D8JL 3ABZA 4Y5YB 4LLVA 4U1HA 1OAXH 3MGTA 2GT9A 3N1MC 3R0MA 4WI9A 5KSAA 3BESR 2YUWA 1A7RL 5DRZA 2ZZUT 4HDIA 2OZ4A 3DIFA 4ZAKA 4KZDH 1A4KB 3RU8H 5GJSL 1YEGH 1P4IH 4JRXA 5HYQA 1QSFD 4CMMA 4NQCD 1K6QL 5EIVA 3EGSA 3TYFA 1JF5A 4C59B 4YAQA 1DDHB 5A2LH 4HWEL 1FNAA 4P2RA 3UTOA 3FRPA 4ODVL 5D4QA 1KJVA 3HPJA 1WVZA 5SWZB 1QP1A 5L8KB 4FFVD 5EULV 5HYJB 3VXNA 4YUEH 3N06B 5FK9B 1AQKL 3JBG7 4Q9QL 5L0QB 4FMKA 4L8CA 1I1CA 1XCQB 1FN4A 4FZEH 3G9AB 5JIPA 1S78C 2VXQH 4GRLD 4FFYH 5IJVB 4B7LA 1SVZA 2Q7YB 2GEEA 2DLFH 4WI7A 1C7TA 4IRSC 4WEUD 3SCMB 2DJ4A 3D18A 4U1GC 2HG5B 2P48B 2I07B 3LDBC 3ARTA 1E4JA 4RMUA 4KI5F 5TE7H 1H8SA 2NY2B 3BPOC 3W82A 2NY0C 5DSCB 3NH7H 4ZDHB 1D6VL 5EU6B 1K85A 2FJHA 4AEEA 4DKAA 5CINH 1OT2A 5I17A 4WFFE 2DQEH 1INQA 3NBNA 4MXWL 2YN3A 5E56A 5ID1B 1JMZA 2DM7A 4JHZA 4NRZA 5MENE 1MNUH 2DICA 4MAYA 3VMPA 1EBPA 3FQXA 1B9ZA 2CR3A 4QTHB 3G5YA 2VLRE 3U4EB 4L3EB 3P2TA 1PX3A 3B2UD 2RCSL 3VFNB 3LRSA 3OXRB 1NCAH 5ANME 5ICXB 1BAFH 3CFIC 5IOPB 5E99H 1QVOA 1CLOL 5F1IA 1OLZA 4O2CA 3WFCH 5F88B 5KN5A 1KNOA 4Z6AT 3FT3A 4LDEB 3T2NL 5IM7B 3DV4B 5E6ID 4YHYB 4JJ5B 1NMCC 2EDBA 1DSFH 4H26A 1GHFL 1MCHA 2X4QA 3IDGB 3MBXL 4PRHB 5TE6H 4PP1C 2QR0B 2W38A 4YBQD 1T89A 1MFDL 2NY1D 2VXVH 3IDNB 4IMLB 1Z9LA 4GRMB 5C0JB 3P4MA 5EC2A 4JY4A 4JJ5A 3RNKA 4P3DB 5E1AA 4XP6H 4FTVE 1SBBA 1M7XA 1LK2A 2OQJB 2JJTC 4JKMA 5TGBA 4J6RH 3RKDC 1TVBB 5DGQA 2EDEA 3UPCA 1NMCB 1CLZH 4GXVH 1UM4L 4LLAA 1MAJA 4WY7H 4Q9RH 3PDDA 3L6FA 3NZ8A 3UTSE 3CXHK 4ZUTA 1WBYA 1ZLWK 4XNUH 1K3IA 4F15B 4KJWD 1JGLH 3ULUL 3GO1H 3QCVH 2D0FA 1AQDB 4S1QH 3H7BA 5D9SB 5DQJA 5SX5H 3IJSB 3LS4L 3QSKB 3O2DL 4LAQL 4KWUA 1U3JA 4GG8B 3QNYA 3QEQE 3H42L 1ZS8A 4DKEL 3VXTA 4HX1B 4KKAC 5ITFB 4G5ZL 1MCNA 4CVXB 4O00A 2B0SH 2A1WL 2ATPB 4EN3B 1JGDA 5T3ZL 2BOCA 5I73C 3RPIA 2G5RA 2WUBH 3V6OE 3VXOB 4D8PB 1AIFA 1GGIH 4LLQA 3OGOE 1JYWA 4MZ3A 5DJ8A 1IC7L 4ODSL 5IEHB 2H3NB 3QIUC 3RUGF 5HYJD 4K8RD 4U33A 3DUSA 4P2YA 3ARGD 3F7VA 4JZOB 1J18A 4AENA 1UZ8A 2NMSA 2BCKB 3QHZL 2P8MA 5DJ8B 5CHNB 2FATH 1U91A 5ADOH 3TBYA 3JWDL 3ZZ1A 4FABL 1ZHNA 1KV3A 4QT5A 4WHYG 3RWJB 3S5LG 1H0DB 5TJWK 4L4VD 5ISZA 2R0WL 3MLZL 4LLDB 4NQSA 1X6LA 1WFTA 4E5XB 3PWVA 2C4FU 4NYLB 1ZHNB 4PJEF 2XNAB 2YOCA 1YMHA 4KRLB 2DJSA 1K8IB 1D9KA 3EYQC 3BDYH 3V5HA 3AC0A 4MCYB 2A9MH 1KF9B 4NO3B 4FQCL 3DIFB 4P46A 1F4XH 3RUGA 2EYTB 1S7XA 4ELKA 1BVLB 5DA4A 4ELMF 3ZL4L 2HYMA 3RBSA 1P53A 4OUOA 4WNQB 1BQUA 5EFIA 2NXZB 3WIIH 3RY5A 3GMLB 1FAIH 5FKPB 3PV7A 4LCCC 5F93C 2X9YA 4ENED 4JRXE 2BRRH 1YEHL 3PP3K 1N3NA 2EDKA 3S3SA 4ZOEA 1XIWB 3TZVC 3ORJA 4MD5B 4U3XA 1A9BB 3T8XB 4RAVA 1PJ9A 2DLHA 4QXWA 1JWMB 1FV1A 3P73B 3TBTB 4EI5A 4WO4B 2EH7L 2DQCL 3KR3H 3T3PE 3QIBA 4JFZL 1U8NB 5EZLB 3QIWA 1HIMH 3O6MH 3UJJL 2CRZA 3QEHA 4IDLA 3RWDB 4U1KA 1QR1A 3T8XA 2QHRH 1OGTA 2GHWB 4X8JA 3KYKH 3L5XH 2FLBT 2NY3C 2JJSA 4PJIE 1XF2B 2B2XL 3C6SB 1OB1B 4KGLA 5DSCA 2J3SA 3PWPB 3V7AG 5EU6A 2XN9B 2BXYA 3TH3T 2G9HB 2EYSB 2ZUQC 2F58H 5D7KE 3VWKA 1MJ8H 5HYFA 4ZFGH 2AJVH 5E0QA 4MCZB 4PGDA 1SY6H 4PJ8A 1V7NL 3CSYA 4ZYKA 3MRHB 1CE6B 3V6ZB 1BFTA 1HQRA 3GMOB 5HPMA 1I8LA 5I1JH 1FRGL 1LGVA 2E27H 2VXTL 5D7LB 5IFJA 1L9NA 2AQ1A 2I24N 3IDJB 1NDGA 3FB5A 4OGYH 3KPSE 3ZTNH 5E6ZA 1XR8B 4KQ3H 1QVOB 3L7FA 3S7GA 2I9LB 5JHLH 2X89D 4LASL 4ZTOL 2YC1A 4O2EA 3FQWA 4RFOL 5I8KL 3QUMH 4YXHL 5LAXA 5IVXE 4YHPB 5FO7B 3PL6A 5B39B 3L3IA 4JEGB 5GSRA 1OSPL 3OR7A 1VPOL 2XFXA 1QBBA 1NL0H 3JV0A 3I02B 3MODL 1M71B 1SEBB 3KPTA 3ARBA 5ICYA 2ZG1A 3BJ91 4JO3H 4BFIA 4M6NL 1DCLA 4OFKA 4D3CH 5F21B 3QO0B 3D3VA 3L5WB 3UAJD 3DXAE 1GPOH 3AAZA 5DMGD 1IEBA 4ALAL 2ATKA 2FWOB 2DTMH 1X5XA 4WU5B 4IMKA 4M00A 2CDFA 1SJVA 3O6KL 4UINL 2WBWB 5F3BB 3B5TA 1WZLA 2VYRE 3TIEB 4G43B 3RKPA 2JLLA 1MELA 2X4SA 1EVUA 1T20A 3N50A 4XC1H 3ZHKA 2Y23A 3I6GA 1FO0H 1XCTA 2ICWB 1E4XL 3NACL 1IZJA 1P4LA 2O93L 1QACA 3DLQR 5C2UB 4OV6F 3QYCA 4F7CB 1T1WB 1MQKL 4YHZH 1U8JB 4CKVX 3IXAA 1X5HA 3UC0L 1J10A 1WQVT 1KCSL 5D2NE 3GZKA 4ODUB 1NCNA 5C3LD 2XKSA 2WW8A 1MLCB 1UT9A 1U2HA 4LARH 2A77L 3ECBA 3QBTB 4XZUB 1MQ8A 3O4LE 2ORBH 4HZLA 2E9IA 2DQFB 4JZOA 1A6VL 3WDIA 2H2SC 2VH5H 2YBRA 2AXGB 3KLSA 3JTTA 3L95B 5EO0B 1IM9A 3MLXH 1EO8L 1DN0A 2X42A 4BQ8A 4XVUC 3RAJH 5DVNA 4PJ7B 1YECH 3IFNH 4DKFL 2MJWA 4XP5H 2NY1B 3OZ9L 2A6DB 5CBEB 1XMWA 2OJZL 4FNLH 2I07A 1NJ9A 5T1KB 4U05A 5JQ6H 2IFGA 2VDRH 3CZJA 3S88L 2E6PA 3QXWA 5FA3A 3MRFB 5H94A 2EDYA 1LK3H 1G7QB 3RUGB 4OLXH 1JNLH 1B2WL 5HGAA 4U6HA 4XPGL 5T1KA 5I17B 1RIHL 1INQB 1IC1A 1DBMH 5F9JB 4J7RA 1J1OL 3O6FB 2VN4A 2ED8A 5FKPA 4JM2B 3G5XB 5HHMD 3VFTB 3WO4B 3G5YB 5KSAC 1VA9A 3UCRA 3FQNB 5JA8B 4HJGA 1BD2A 1Q9LB 3GI8L 5F9JA 4DUVA 3QWQB 2F15A 1RUAH 5LXGL 3FFCB 5BZDB 1BIIB 3P77A 5GSVB 4MNGE 2N1KA 3B2VL 2GKIA 5I71C 3UTPE 3QIWB 1IT9H 4PJ5E 4IRSB 3SCMC 2RQ8A 3MRDB 4KI5C 3I3BA 1NGXB 1UXWB 2H9GB 4KK5C 4CVZB 2FNBA 3MMEA 1RHHA 5E8NB 1OTSC 4HMEA 4NGHH 1J5OH 3QPXH 4HKBA 4AMKH 3PNWB 4MNQB 2YD8A 3FN0H 3GSWB 4HWBA 2IPTL 4MD0B 5FOJA 1ZHLA 5C3TA 1J11A 1VADB 3LY6A 4RX4D 3LKQB 2BX5A 4NN6B 5IT2L 3ZKNC 4MCZA 4P2OB 1W0VA 4OZGF 1KOAA 1TVHB 2WIIA 4M1CD 4PV8B 3SBWC 5B8CA 1HH9B 4LKXB 2MKLC 3G04A 1TITA 2ZOLA 2IH3B 5E6IC 2K3TA 2Z35A 5HDQH 2D03H 1NCCL 3NCBB 1DVFC 2OLDA 5HHOA 1HKFA 4PTUA 4H0HB 5E95B 4TNVF 4Z7WA 3ZHLA 5KZCD 1QSEB 3GSVB 3M07A 4GRLC 1ACYL 2IWGA 5DC0A 4CDHA 1IAIH 1QLFA 1BF8A 1F4WL 2VERN 1TTGA 3RJDA 2Z35B 4LPUA 4R26L 3U7YL 3GJFH 3KPSA 2QQNL 4DVRH 2GTWA 4Y4KA 5E8PB 5K59E 1MVFA 2HT4D 1IAOA 3BUYA 4FXKB 1BLNA 4WDIB 1P6AB 4GW1A 1RJLA 1FJ1B 4BUHA 2VQ1B 1S7WB 3V7AE 3KYMB 4YX2H 4DN4H 1MCSA 4IOIB 2W60B 2BNUA 3VD4A 3TJEH 4TPRL 2AJYL 2FEDC 5EU5A 2ZWLT 3U9UB 1U91B 1RIVL 3AVEA 3DGCR 3UBXI 2QKIB 2F5AL 3P0YL 3O9WD 5JHDD 1T21A 1FGNL 1V7ML 2DL2A 3T0EE 4HLJA 2J88L 4P4KB 2VLKE 4ONFL 4J3SA 4M93C 5JXEC 4KJQC 3O3EA 2DQJH 2HT3C 4R96A 3CUPA 1JGVH 2J8UF 3RFZC 5KTEH 4UTBH 5CJXA 3C8HA 2EDRA 2PO6D 3IXAB 4LSDA 2G60L 4F7MA 4UB0H 2PW1B 5FFLA 4M6AA 1JZ3A 5B39G 5E9DA 3P4LA 3DMMB 1NLDL 2IH1B 3O9WA 4Z7UB 1M7IA 3BPCB 3TFKD 5ITBL 1TPXB 3MV7A 2IPUG 4F7TA 1J8KA 1U42A 4M5YH 3WV0A 1FG2A 3KPQA 3RZWA 5IB1B 2GQHA 4EBQH 1RZFL 4JFPA 3GBLA 3NCYS 3QUXC 5K9KB 4P57B 3DX8A 3P9MB 4CAGA 3RY6C 4HMDA 4D0CB 5E2VH 1FG2B 3K0WA 3KPQB 1UJ3A 3LS5L 1UWGL 1EEQA 2FO4B 2PCPB 3U4BL 4YXKH 4PRHE 1TPXC 4HIEA 4X7SH 3V4VL 2RGSA 1A7PH 4OKDA 1AJ7H 3M17A 1JV5A 1TZHA 3O2VL 1NC2B 2ZCHL 4YIQA 4NKDB 5C08E 3AREB 1G7QA 1JTTA 1KTDB 5I66B 1EO5A 2BSTA 3HRZB 4P23D 4PJCE 3A6OA 4X5WA 4M1GH 2P42B 5IW3A 3HZYA 5DJ2A 1INEL 4OUUA 2CQVA 3VRLE 5EBGA 4PJAA 5SWZA 1YZZA 5CZVH 5HYJA 3EOAA 2Z31B 4KTDL 5I18H 5LVEA 5I66A 2DI9A 1TZIB 25C8H 1KIPA 6FABH 1N5YH 1IFHL 1FDLH 1MUJA 4JPIB 1GZPA 2ARJQ 5E2WL 3RX8A 1JF6A 1N6QH 1NMBL 1AGDB 2ITDA 1CFNB 1I3VA 1G9MC 5FIEA 3FT2A 1F6LL 2J6EH 1X7QB 3ARUA 4JPIA 4O2EB 1H8NA 3TT1H 4HH9B 4N8CH 1EFXA 3JZ7A 2MPAL 3RZCC 3SDDD 4NRXB 2HRPL 1CFNA 3CGTA 3MMEB 3VWKD 7CGTA 4OGXH 4Z7QE 1RZJL 2AABL 2MTPA 4BZ2H 1MI5E 5CEZD 4NCC2 3Q6GL 1NDMB 4FP8L 2EECA 3BE1L 5D1XA 4E41D 3FQXB 4YUEL 3L5WA 1AQKH 2HA1A 3P4OB 4Q9QH 3ZT6A 4R97C 5MEND 3EJZC 3QFJA 3RWFA 4P2QD 3TV3H 5F9OH 1AGBA 4BELD 5JOFB 2HJLB 3ZDZF 4Z7VB 1XR9B 4PGJA 5T5NF 1M1SA 4ZFOA 4P5MB 1XF1A 3SOBH 1KTKE 3FONB 4PTTB 6CGTA 1OVZA 5AAMA 3KJ4C 3LEYH 4RFEA 5K9OA 2CIKB 4XNQA 4HWBH