3CPLB

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplB00
3RWIB 1IKFH 1QHOA 3I9GH 1VGEL 4UU9B 2GK0A 5KW9L 5JOEA 1WT5C 3EOAA 2VDQH 1MPAL 5ANMB 1EAJA 4HAFA 5DGQA 4BFGA 1M7DB 4NO0B 3QO1A 3A67H 4M6OH 1U6AH 4MAYD 5F9DC 1NAMA 4ZTOH 4RBPH 3TNMA 5CIPB 1HSAB 5FOBA 2DIBA 1JPSH 4FTVE 3MCKA 5IB4B 1M6OB 2DYPA 5IM7B 2P43B 3JZ7A 5ESAA 1MSPA 3D39D 3KPPA 3S36X 5I16B 1NUGA 1QFPA 1WFTA 2AABH 4OF7A 1HINL 3MLRL 2AGJH 5BV7B 1FC2D 1T2QL 4GW4A 1R3HA 1CXFA 3QJHB 4KK9C 5C0AB 1VGKA 1QFUL 4JN1H 1KIUA 3INUL 1XAUA 2YA0A 3GKWL 1UJTA 4OLXL 1T1YB 1T1XA 2A9NL 5EWIL 3VH8B 1T83A 3RIAF 5GZND 5HHXL 1MJJA 4JFDE 1UM4L 5LWYL 4FQIL 1OSZA 3NFSL 4UTBH 4BA8A 1I1AA 3TO4A 5DYOA 4WJ5A 3H9ZA 5E6IB 1TNNA 3HCVA 2ICWI 4I9WE 1FFNB 2Y07H 4F7EB 5LVEA 4PJGF 1HI6B 4FXKB 1TIUA 4XC3H 4YE4L 2DDQH 2GUOB 4BQCA 1HQRB 3HE7C 5SWSD 3P11H 4HDIA 5SWZA 4F58L 3QCTL 3GBNH 1ACYL 3GSQA 5EOTA 3SJVD 2IF7A 3QUKA 2W1NA 4GMTH 3ULUC 1U8LA 4PTUA 4JQXA 3SO3C 4YGVB 1OSPL 1NBYA 4Q9RH 1VENA 3VXMA 1ZHLA 4NUJA 1S7WA 1XEDA 5E03A 2Z31C 1Q8MA 3SOBH 1ZLSH 3SKOA 1N4XL 2NZIA 2PR4L 4HLZG 3TN0B 2VE6A 2AJSH 4ZSOE 3PP3K 1QQDB 4BQ6A 5LGHH 3V4UH 3VFSB 1TLKA 1CDJA 5EO9B 3S37X 4MQXD 4FFVD 4ZD3L 2DWDB 1B0RB 3PGFH 4OKDA 2ZCHL 2O5ZH 4LLDB 1XF1A 1MELA 1P7QD 4JO1H 1JMXA 4N9GA 4U1IB 3RVTC 3ULVF 4GG6F 2G5BA 5DURD 1T7VA 4ZUTB 2VR4A 4CRPA 5A1AA 3OKOA 5F7EH 4Y4KB 5FM8A 1I8KB 1IKNC 3FFCB 5DHVB 2QKIB 4WW2F 1OAYH 1IE5A 4ZOCA 3PL6B 5D96B 5DMIH 5HHQA 3QIWD 1NCAH 2UZIL 4NQVB 5EO1A 5IGXL 1UXWA 3LEYL 3MV8A 1JHKL 4N0RA 3EKCA 3QJFB 4HS6B 3ZLQC 1HKFA 3O0RL 3RWEB 2GJ6D 2NY2D 3U36A 2IPKB 1PLGH 1KB5A 5GS3A 1MWAB 4QXWA 5MERA 4GW1A 3IYLW 1KB9J 4FNLL 5CLTA 1JTTA 2OL3H 1K5NB 1NBZA 2B1HH 3LPGA 1JRHL 1DL7L 1NC2D 4LVEA 5ALBH 5IG7B 4PLJD 2BSSA 5BZWB 5A16B 3DO7A 1A3LL 2DLEA 1I7TA 3D69A 4Y5VC 2EO9A 3MRNA 3SDAB 4ODVH 1QSEE 3EHBC 5E1HB 2DD8H 5JMOC 5CHNB 2Y1VA 1SY6L 4G8GD 3MR9B 1BAFH 3FT4A 3CZFA 2ADFH 5C0BA 4U2YA 2AK4E 2UY6A 1QBML 4JDZB 1RIVH 2XZQL 5AYQA 3NACL 1HE7A 3RP1A 4N1EA 1JNLL 2VDRL 5MEPA 3S9DB 1R5WA 2HLFC 3BYYA 3EOBB 4APQC 3QIUD 2NTFB 3L5XH 3F5WA 5C0DA 1K2DB 1FL5B 3RL1B 3HHRB 2JJVA 1ES0B 1WITA 1RK1A 3EDFA 1OCWL 1UQSB 1CGXA 1H3VA 1N0LA 2BSRA 1ZAGA 1IAKA 2H45A 1N8ZB 4CVUA 3VFTA 3M17A 1J1OL 5T5NF 4WW2C 2HKFL 4LCIL 4X6BB 3P0YL 3UBXG 3ZDXE 4WDIB 1S5IH 2G75B 4LLWA 3RIFF 2HLAB 2FH6A 3OSKA 4IDJH 5EU7E 1YJDL 3VFVB 3QI9B 3MOAH 4ZSOB 3ARFC 3LRSB 3QFJD 1M7IA 3DGCR 1Q0XL 4WFFE 3GSRB 3ZTJG 2YN5A 1EXUB 2WWMD 1EEZB 5ETUB 4H0HB 5J7CC 5KJRH 3WLWC 3OR6B 3HPJA 4QGYA 4LU5L 3WNNA 3UTSA 2D3VA 1B2WH 1F11A 3RVUC 5EOCL 3I84A 2VITB 4HJJL 4JM2B 4FQJL 1FVCB 5L2KE 4PY8I 1INQA 1UWGL 1QKZH 4S10A 1ZXQA 2DRUA 3TBSB 3E2HC 4WWKD 1OAQH 1XZ0B 4YGAB 5L6YL 1XR8A 3GJEA 1HHJB 4MZ2A 1VB9A 2OTWA 3ARQA 4Q97A 1D6EB 3VA6A 1KEGL 2YRPA 2R9HC 4OLYL 3S3SA 4PP1D 1WF5A 1LD9B 1IM9D 4WEBL 2E8YA 1QFWH 2M2DA 3VFNA 3WHXB 4NCC2 3SQBA 5IMLB 3UJTL 1M7XA 4NRYB 3MRMB 2Z4QA 5JO5B 5MI0C 2ED7A 3RY6C 1A7RL 3S96B 2D7TH 1MRCH 3IKCA 2X41A 1A64A 3HUJF 3EOYG 1KG0A 5FHAL 3QDGE 3MGTB 2MQ0A 1C8PA 1MIML 1GGIL 1QSEB 2PO6A 1G7HA 4HEME 2VC2H 4O51B 1JWUA 4YFEA 4NQCE 5CJOH 3S88H 1X3DA 4U0QB 4YHIB 2AK4B 3NTCL 1RVFL 1EX0A 3TJHC 4Y8DC 4J3VA 4K3JH 4M1GL 1CT8A 2ZG1A 2X7LB 5CINL 3VRJA 3LKRB 4KMTH 4X4XA 4HUNB 3VXSA 1PX3A 5F1NB 1PW3A 3K1KC 2HJKB 1T0MA 4YBQC 5HHME 4XBEH 3HN3A 3WE6A 4XNQA 1JNNH 3UAJC 3V6FB 2NX5E 1GGYA 2BOBA 2IWGA 1JYXA 1NLBH 1A0QL 3K3QA 2CO6B 3IDNB 3WL9B 3L3HA 3P40A 4G80B 4P46D 5C08E 4FQXC 4I5BA 4IBLT 4XCFH 3MRPB 4ELMF 3V6OC 1FZOA 3OKKB 2DLHA 4JPWH 1S5HB 4LSTL 1NGXA 3D9AH 4BZ2H 1P4LA 2R56H 1RZGA 1DQJB 1LEGA 4I3GA 3EJJX 4WHTA 1CIUA 1PZUB 4OLZH 1RUML 2Z91B 2JIXB 2CLRB 5JHDE 4WTWA 1C5CL 1NKRA 1I8IB 2B4CH 4BM7A 4JZNA 4U31A 3O2VH 2DL9A 4M8QB 5KANI 3RAJL 1XH3A 4M1CC 4HG4J 3FFDB 1YPZF 4J1UA 5AAWA 3UZQA 2UYLB 1K8DB 4JANA 3WN5B 1LNUA 3LRGA 3ULUH 1RJZB 3WHE1 3QPXL 3TFKD 4BH8A 1LQSR 4QHLA 3JWDL 3EYQD 2NXZD 1FL3B 3QSKB 1FVEB 4NC0B 4R7NA 3LQAC 4DZBA 4AIOA 4RFNC 4CNIA 1SYVA 5T1KB 1IKNA 4U0RC 2MHAA 1EEQA 1FNHA 1AY1L 3GUTB 4Z7NE 5IHUL 1UG9A 3GI8H 4NT6B 3QDGB 3VRIA 2H26B 5F7DB 4JPVH 4LQFL 2C3GA 3EO0B 1YNTB 1FFQA 1A6WH 4OLWH 1U3JA 4TRPL 4PJGA 4NQCB 4ONFL 3HAEB 4NNYB 2IBGA 5I8OH 1MAMH 3H0TA 2HFGH 2FX7L 2F8VA 3PP3H 1SBBA 2XIDA 3AC0A 5IW3A 4F80A 3MXVH 1C7TA 1ZGLB 4ZOAA 2OYPA 4U33A 1Z9LA 2ARWA 3CUPA 4DK6A 3LKPA 2FZ3B 5GGUB 1PKQA 1I9IH 1HHHA 4PGEB 4UINH 5B8CB 4QRPE 3VG0H 1EUUA 1KPRA 3BP5A 2YD3A 1HK6A 5HHMB 1GZQA 2YK1L 4TUKL 4CW1B 5TDNA 4OCLC 5TDPB 5BS0B 3N85H 2NX5B 4X6FA 2MJWA 1SMAA 1YYMH 2EYRA 4QRRD 1IZJA 4K7FB 2UZYB 5JNYB 5EC2B 1PY9A 2QSTA 4DZ8B 4J4PA 1F4YL 2DI7A 4XPTL 2ZOKA 3W9EA 4OF5A 3ARBC 4LLVA 1I8LA 4B0MM 4MCZB 1MRFH 4FMKA 1IZKA 3AUVA 5HJ3A 3MV7E 3CFBA 3S5LA 4PBWD 4EOWH 5C0GA 2X09A 3EOAB 4M4RA 2ZCLH 2H2PC 4WW2A 4PJ7A 3RRQA 2PYEA 1NCBH 4S2SB 2PTTA 1NAMB 3ZO0A 1FZJA 4KK6D 5D70H 1FDLH 4WFED 2CDGA 4Q9CA 4NRZA 3W82A 3ARUA 43CAA 5JPMA 5FOBB 3AAZB 3MCKB 5J57B 5EU5A 5FO9B 1HEZA 3EOTL 5MEQA 2B5IB 1BQHB 5DJZB 3FB6A 1JIBA 1S7UA 4UT9H 1QLEH 4LK4A 3GGWB 4JZJB 1RMFL 2DQHL 3RX5A 1NPUA 1AR2A 1Q38A 3OJ2C 4JFEE 4I0CC 2A9ML 1BBJA 5I2IB 3DPBA 3QUYB 1VGKB 5D93B 1KPUA 5FUOH 5F70A 5IHLB 1MFBH 1NL0H 3OJDA 3R1GL 3LQMA 3PQYA 4XT1C 2VLKE 1WICA 5D7KD 4YZFE 5GGRY 4K3EL 4OTXL 4ODXB 3UTZA 1NGZB 1MJJB 1T3FB 3MRGB 4Y89A 1FH5H 5EPMB 1OSZB 5C6TH 2F53E 1WLHA 4YXLL 3BZEB 2FDBP 3JUZA 3CSYB 4X80L 4WEMB 1G7IA 2YD8A 1J05A 1OD9A 4KC3B 5FGRA 1JF6A 3T04D 1A6PA 3DV4A 1A6AA 5E6YA 5CBEB 3QG6B 1U2HA 4BH7B 1K4DB 3FCTA 5DJ6A 3T3MF 4XPFL 3AREB 2AXFA 5TPWL 5DUPH 5HHOA 4QRPB 2HT2D 4H88H 2ESVD 5BRZD 3VXUD 1JZ6A 1U8NA 4MA1B 1A02N 1RFDH 3L3DB 4Y5YC 2V9QA 5C2BL 3QHTC 2CLVA 1Q9LA 4EDXB 4XHJD 4FMFA 5MEOB 1H3UA 1KXQE 5I74C 1Q9KB 2IBBA 4UOW1 5CSZB 2X4QB 3O2DL 4QRUA 4TTDD 1C1EH 2A77L 3X3GH 2DBLH 3O4LA 5IW6A 3WD5H 2C3HA 2EO1A 4PYHA 3OGCA 4QEGA 2C3WA 5KOMC 1ZT4B 2HFEB 4U1MB 3I02B 1VDGA 2QSVA 4YUEH 4MAYC 3UYOD 1AJ7H 4RISH 4KGJA 1UCBL 4OIAA 4OZFB 5ESVB 3V52H 1A5FH 1DE4A 5TQ2L 1KJVA 4JPIA 2CDFA 4NKOA 3GK8H 1KT2B 3SE3A 3Q3GA 2EDQA 3V6BR 1X5XA 1YEFH 4F7MB 5T3ZL 4N5UA 4FQHA 3UO1L 3BVNB 1SYSA 4U1HA 3PXHA 3VFPA 2XQBL 3FZUD 3EYOA 4ZXBD 5KVDH 4JPKL 5DSCA 5KTEL 4NZTL 5EG6C 1NCCL 4LHUB 1LP9E 4JFEB 5GZNC 1WIPA 1KB5B 4GBXD 3KPOB 1R24A 2KPNA 4HWZB 5T3ZE 4OQTH 3T0VA 5GSRB 3LN5B 3MRQB 3SPVB 4HCRL 4EEEA 3MRKA 4I3SL 5CGMA 2VLKB 2XV6B 3GSNH 3QISA 2WINB 4QHNB 3KLAA 4LCWA 1FCGA 4CDGC 4WFGE 1AGBA 5JOPD 3DO7B 5FA4B 1XGQB 1FYTA 1INDL 5LAXB 2F53B 5EBLA 4S1SL 2NY6B 1HWHB 3GDBA 1YDPB 4UT6H 1ZHBA 4NCDA 4NQDE 3QH3A 5E8NB 3B3IB 1G6VK 3MLPA 1JF1B 1NCWH 1MAKA 5T1LB 3PWLA 3W81A 1BLNA 4ZDHA 3TZVD 3MJ8A 2KQNA 2FL5A 4OF3A 3G5YA 3HC4H 1GHFH 2VLRA 3LS4L 3DVIA 3QDMA 3ZKXC 1IGTA 3P4OB 5D6DA 4HK3J 1AKJB 1HHIB 4QHKJ 1KULA 5SV4A 3LKQA 4YK4B 1P7KA 4JHWH 4K3DL 1A6TA 3LQAH 1OOAA 1X5HA 3L3IA 4MQXC 5HGBB 3VFOA 4FFVC 3GM8A 1NMBH 5CEXA 3QAZC 4KI1A 4RSVA 5TFSH 3X12B 5IMMA 2VDLL 1QBLL 4ELMA 2E7HA 4N8CH 1A7NH 1M7IB 3TYGL 5I17B 3QUXD 5EN2B 4GKSA 4XMLH 2AV7B 1F2XK 2DQGH 4QT5B 4PJIF 1AD9B 3HPJB 4OKVB 4CMMA 1GJIA 5IT2L 4V1DE 5IHZB 1EERB 4PJCF 1QLFA 1R6VA 1ITBB 3BGFB 5C0EA 3H3PH 2C4FU 1CLYH 2XWBB 4YHKH 4N0UA 2VWEE 4Y16C 4JG1L 4W6WB 1YPZA 4UILL 1BFOA 1BIIA 4WUUE 3ZL4H 2PXYB 4N90E 1VADB 4TSAL 2I24N 3EFFB 1I7ZA 2NY2C 2V2TA 4Z18A 3JWOH 4NC2B 1I9RH 2DJ4A 4UAOC 1A1MB 5EU6E 2YXMA 1FO0L 2G60H 4JFHE 5I8EB 3O9WD 4CVWA 3MUZ1 1F42A 1ZWIA 4KKCD 4R0LB 2J4WL 1LP9B 4XCYA 5I1AB 4J12A 5DQJB 3UJIH 1GC1L 1CDCA 4LLAA 4XWOD 4QXGH 1J8HB 2ED8A 3T65B 1MFCL 3MRFB 3RX8A 4IRSA 5JOFB 1T7XA 4K9EL 5DK0A 2WWKO 1KLUB 1N2RB 4XVSH 2R23A 4RGOH 5KBNC 1KG0B 2QADC 2CRMA 2IALA 2LAAA 3UXFA 5CILH 4P23A 5J1TC 4HKJB 4OB5L 4HJ0D 3FOMB 3KYMA 3TIDA 1WZ1L 4QRSA 5TQ0H 4TVPL 2DN7A 4JFZL 3RVXD 2J5LB 4EUPA 4PJ5D 2YA1A 1S7XB 1KOAA 3BPOC 4MVBD 1XR9B 4JY4B 4I18B 2X89A 4NBYB 2X4UB 1A1OB 1ZKAA 2OTUA 2Y06L 5I6XB 5DDHA 5DLMH 4RMTA 4NQUA 1F90H 3W39A 4OZIF 5AUMA 4WUKL 4C83B 1S9VA 2I9TB 1OF2A 1MCRA 4LGSB 4XP5H 5IVXF 3JXAA 4TVPE 3NCJH 3PWUA 4NIKB 4GRWH 5I0DA 1SJXA 1U8KA 1MCKA 4QRQB 2QQNH 1D5ZB 2ZUVA 1N64H 3U0WH 4TNVF 3H9SD 1YEKH 4PV9A 2KUTA 2WWMC 1TVHA 1FAIH 4D0DB 3TBWA 5HDBE 4UOW0 4WTXA 3V8OA 2AJXL 2NY3C 5IBUG 3BMVA 4U2ZA 5BO1L 4HXAL 4MJ5A 5JW5B 4DJMA 3LN9A 3DX7A 4DUXA 1FZOB 4MB5A 2YOCA 4Y4FB 1YY9D 1NGXB 5DJ2A 3ARDA 2W0KA 4HXBL 4V1DB 3B9EA 5K33A 2OXHA 4OCXH 4WWKC 3QQ3A 1XF3A 2VLJE 3STZB 1CLCA 4HBCL 1FBIH 5K9QG 4PP1C 4JZNB 3F6IA 5BVPL 3SEPA 3O3BA 1XH3B 1KTKE 4D0CA 3HMWL 4ZODA 3GMOB 1JMZA 4HEPG 2GTZA 3PWPE 4M6ML 3IJSA 4LP4A 2L7JA 1G9MC 1JFQH 3NA9H 4ODSL 4RGNE 1XGYH 3ZE2F 1R0AH 4X6DF 1AE6L 4KRLB 5EU6B 2YKLH 2PNDA 4U1GC 5T33H 1TCRA 2QHRH 3ARYA 1HYSD 3VI3E 3RDTB 1UVQB 1OW0A 2EYTB 3PDGA 1DBBH 1ZVSB 4R7NB 1T2XA 1Z9MA 3V4PH 2QEJA 5DJYA 4R26L 1DDHA 3VD3A 3FQUA 5IB3A 2QSCL 2ZCKL 1T0NA 3ISWA 2XICA 1SYVB 1KIPA 3VFWA 2EE9A 4UIKL 3DVNB 3MGAA 5KSBE 2E7CA 3D39A 2CD0A 1J9CT 1FO0B 4C54A 4NSKA 5C0CE 4ZUWB 2EKSB 1IEAB 1QTYT 4PJ8C 1SEQH 2ID5A 2O5YH 4O9HL 3KJ4B 5H35A 4HKBA 5IKCA 4JY5L 1J5OH 3MNZA 1WTGT 1FPTH 1KBGL 4OGXH 5FUCE 3L6FA 2OLDA 3H0TB 3LMJL 3AXLA 3PHQB 4NZRH 3UMTA 1ZANH 3TF7C 1G6RH 3A6BH 4M03A 1HXYB 4OV5A 3PGCA 4WENB 2XI9A 4YWGH 5KVFL 2OMNA 1G0YR 1EAPA 2FD6H 5I66A 2X44D 2IPTH 2GK2A 2N56A 4BFEA 4LF3A 2MOVA 5HHPA 4FFZL 3DXAE 3ZKMC 3BDYL 3G5VA 1A1NA 1U8PA 3U9UA 3ILPA 1YEDA 1GYAA 3R8QA 1JYWA 3F58L 3D85B 4KZDL 1UFUA 5FYJE 5L8JB 4OM0L 4F2MA 5SWSA 1VESA 2V5RA 1E27B 2YUVA 4OQ1A 2CKBA 4MJIA 3KNBA 4Z7WA 4G7YL 4X6FB 1ZLUK 4JJ5B 1YMMA 3SJVA 7CGTA 1GOFA 5C70A 5DQDL 2EYRB 2HT4C 1RK0B 1ZT7B 3AY4C 5M94B 4L8SC 5GSVB 5SX4H 1CU4L 2V7HA 3GBLA 5IF0B 1AO7E 4QF1A 1NEUA 1F02I 3CDGA 1HHKA 2ZKHL 4ODUB 3N9GL 1WBYA 2ED9A 2CRIA 2ZOKB 1OARH 1SBSL 3WS6C 3VWKB 4JRYE 3BZFB 1KENL 1CGYA 4YXHH 2APXA 1L7TL 1WVZA 1K6QL 1ORSA 2QSQA 2VLJB 1F5WA 5E8OB 3B9KC 4YR6A 3MJ6A 3PWNB 1TETH 1J11A 2HMID 3TFKC 2P24B 4HK0A 4L1DA 3QQ9D 2NXZC 1CE1H 3PWPB 1FZJB 2CLZB 1I1FA 2A6IA 4OZHF 1KELH 3LEXA 2EDDA 3TCLA 4RGNB 3STLA 4EBQL 2Q86B 1TVBB 8CGTA 3X14A 1MIEL 3BKJL 3RVWC 3MV9E 1UKQA 4OGYH 4PUBH 1S7UB 4PRIE 3P4MA 3CAFA 5DXWA 3CPLB 5DWUL 4D3CL 3HRZA 5I30H 3CDCA 5GHWH 5AG8A 1UM6L 1IGFH 2WP3T 1TZIA 1YEEL 3D3VE 4X7SL 3VD9A 1KPUB 3QIWA 4OFYD 4K23H 4CJ0A 4DQOH 1YEGL 1JGEA 2D03H 2R4SH 5HGGS 4R4FH 5KSBB 1KCUL 1OB1A 1S9WB 4X5XB 5J11C 2XZAL 1P84J 4G8EA 4G6ML 2P48B 2GJ6A 5C0CB 5JUEH 3SGJC 2DQDH 1MHEB 3NPSC 1VFOA 2DS4A 3PABB 2EDWA 3NCCB 2IQAA 4NN5C 4XVTH 3QIBB 2ADIA 4N0CD 2LU3A 3I75A 4NYLB 1Q9WB 3FOLA 2C26A 1NC2A 5K59F 2VMFA 1G7IB 4KKAC 2VH5L 1J05B 2H32B 2OSLB 2CJUL 1EHXA 2MCPH 5KSUA 1G7LA 1YNKH 3BN9C 1IAIL 4W6YB 3VMOA 3FCTB 2F54A 3B6SB 1XGPB 1F4HA 3HC0B 5DJ6B 4G8GA 1A8JH 4A6YL 5E00A 4AIZA 5CS7A 4F57H 3TT3L 5HD8D 3DBXA 4NOBA 3HI5L 2F5BL 1U8NB 3U0TA 3NOIA 3MRJA 4JFPA 1HSBA 4F9PA 1X6LA 3QIUA 5K9JL 1UB6B 3U6RB 2X2YA 4ZUUB 1MJUH 4HUWA 4O58H 4KUZH 4MD4B 4HULB 4P2YA 3KPRD 3DRQA 4Z0BL 2Z35B 4PBVC 1UJ3C 2AKRB 5I1EL 3OGCB 4PJIA 5DA0B 1FE8L 4ONGH 3IAQA 4HWBH 2A83A 1G9NH 4KY1H 4PJCA 5MHSE 4JRYB 3ULSA 3CMOH 1WJ3A 2YUXA 1U8HA 1KCRL 4OZ4A 3QEGH 3T8XB 2F19L 3B2VL 4C56D 2DQCL 2YD6A 2FECI 1VEMA 3MACL 1BVZA 5KOVC 1RZKH 5IP4A 4OD3H 5I1JL 2VIRB 1G7PB 3K2UH 4YDIH 5I8KL 2BNQA 3BPCB 1NFIA 4FQHB 1ZMYA 4WO4B 4U3XA 5FHBH 3ECBB 4Q9BA 4LCYA 5ACZA 4XP9L 5MENA 3MV9B 1J0HA 5B38G 1HDMB 4PRIB 5CEZD 2WUCL 3QUML 4WWKA 4KPHH 4LSQH 1MCOH 2W65B 1HXMA 1FSKB 2B0SL 4XMKH 3NZHL 4AEHH 1IAMA 3D3VB 4OCYH 3IDIA 1IC4L 5D7IE 5JXEA 3DMMA 3G6JF 3VFUB 1PVHA 2IGFH 5GJSL 5HYJE 3VW3L 2Q3AA 2VZUA 2XN9D 1BF8A 3MO1B 3PJSA 3UPAA 4E5XA 4LSPL 5C07E 2J8UF 3CFIC 3C60A 4G6KL 1ONQB 3V0VB 2LVCA 5C0ND 1BEYL 3FO0L 3VWJB 3CH1A 3BGMA 3FN3A 3Q0HA 5BV7H 1ZHBB 1KF9B 3QFDA 2HT2C 3MNVA 4GMSH 4P5TB 2YS4A 5GS0H 1M4KA 5IFHL 5DTFA 2ITDA 1WBZB 4MHHG 1KN4L 1RIHH 5BW7A 5JZ7C 4ZDHB 2ATKA 4OZIA 4NFBA 1G9MH 2OTPA 5IVXA 4IIQB 1S7TA 2N7AA 2YRLA 3KHOA 5ADOL 4TTDC 4OI9A 5GGRB 3W5NA 3PDOB 1JPFA 1LO5A 2XNAB 3MLXH 4Z0XA 1AP2A 3ZTNH 1OAKH 1GAFL 4PJBA 1YJDC 3O6LL 4EKXA 3BZDA 4Y7MA 3SDCB 5FO8A 1D9KA 1OLLA 4L8BA 1WFUA 2ARJQ 5JW4N 2DQIL 4A6YB 3DVFA 2HWZH 4ZAKD 4LFHD 1S7RA 4UDUA 3FONA 4RFEA 3FJTA 5DUBA 3BPNC 3KPSE 2HH0H 1M71B 5HI5D 2VL5B 3E6HA 4KVCL 1ZLVK 3S7GA 3GRWL 3O41A 2PTUA 1ITCA 2ZUQC 4LDOB 5FM5O 1UM5H 3BESR 1IEBA 1WIOA 3EJZD 3MRBB 4P46A 1XF2A 1QLFB 1B4RA 4Y4HD 4JVWA 4JFQB 3MPCA 3VDCA 3QNXB 1D5BB 4N0UB 4NBZB 4ODTH 5SWQA 4ALAL 3FZUC 1CGUA 2HAZA 1UWXK 3FT2B 1BFOB 3MLUH 4XNXH 2JB6A 5IFJA 4WY7H 1S9YB 4X6DA 3GIVB 1Q72L 4GBXC 1QSFD 1N5YH 1FNSL 2GHWB 3LY6A 3ZKQD 4JHZA 4OCSL 4FQCL 3BH8A 2H8PB 1EBPA 1A14L 4LVHB 1LE9A 3TVMC 3RY5A 4NQEE 3BW9A 5DHVH 1FCCA 5DO2D 3KXFE 1QNZH 3FQNA 5D7IB 5C0JA 5HYJB 4L3EE 4R90L 3T09A 3HC3H 4S0SD 4IRSB 1VGEH 5C07B 5KW9H 1FJ1A 3MLWL 1CICC 2Z8VC 4NO0D 3ES6A 3S5LG 3LPWA 3F7QA 2R23B 3FHAA 5GJTL 1S9KC 3QUMB 5DFWH 2OR7A 3FQTB 1ZLUH 4HKXA 4P23B 3TZVC 2GTWA 3FO1A 4Z7QE 3GMQA 4EUPB 1H15A 2VOTA 2WV3A 5F89A 3QG7L 4HZLA 3MOBL 1GOHA 1AIFA 1X5ZA 5JW4Q 3V5DA 2OTUB 5GQBA 4U6HA 1WV7T 1U92B 3BKYH 3GMLA 2AJVL 1FN4A 3VXOA 2OXGA 3LVEA 5F9AC 3ALWA 1EEYA 3MLRH 1HINH 1T2QH 4HQQL 4Y0GA 4C4KT 1QFUH 1CXIA 3UX9B 3INUH 3HI6L 3GKWH 4OLXH 3FRPG 2H1PL 3QUXC 4L5FL 2A9NH 1L9MA 2CIKB 4S1QL 3MNWA 5EWIH 3DUSB 1NEZB 4LGRB 3ZHKA 5HHXH 5E6ID 1UM4H 3QEQE 5LWYH 2HTLD 3S35L 4FQIH 5DRNB 3NFSH 5JORA 2FLRT 2QLVB 1MFNA 3KLDA 3W0WE 4QRRA 1JGDB 3V8CA 3QXVA 4YE4H 5DJ2B 2XACC 5CWSA 2X1PA 3P4NA 5ID0B 1JPGB 3QQ3B 4F58H 5JW4R 4EN3C 3QCTH 1ACYH 1WCBA 32C2A 4J3XA 4L4VA 3LKOA 4M43L 3D18A 4J3WA 4KKNA 3O9WC 4NP4L 4OZHA 1IM3A 4PFEA 4NCC1 1LO3L 1U8IA 4XCCL 5F7WC 1OSPH 1L6ZA 5T5NG 2YPLB 1K85A 3WKNA 2BSED 3BUTA 1JYVA 3TN0D 4XWOC 3DYPA 4LLMB 2JCCF 2FHCA 1N4XH 2VISA 2PR4H 3OKDA 5J13C 3REWB 2AEIT 2P8PB 4YBHA 4NQEB 4ETQA 1RUKL 5DJYB 4RGMB 4UIMB 3FQUB 3ARTA 4ZD3H 4IS6A 4L3EB 2VZ1A 3F12B 2ZCHH 5FO7B 5D2LE 2RAMA 1CFTA 1NFDE 3OF6A 3VXRA 3KYOA 3FFCD 2GITB 3LZFL 1CDBA 1T7WA 5D8JL 5DK2B 1FNFA 1YY8B 4MD5B 4IMLB 3HZVB 3PL6D 1GOGA 2MSPA 4Z5RA 1W0YT 2VQUA 4LVNC 1AI1H 1CI5A 1FL6A 3D2UD 2G9HB 4PJAF 1QFWM 3WCYA 4JRXE 4WW1B 3PGCB 2DF3A 1Q9OA 2P46B 1RZJC 2UZIH 5K9OA 4BSVA 1EAPB 3LEYH 4UB0L 1JHKH 1B88A 3CCHB 5HHPB 4EZMA 1MVFA 3DLQR 2ADJA 3N1MC 5DFTA 3O0RH 2WW8A 1JK8A 1YEDB 2ZUYA 4URTB 3HR5A 4FQLL 4Q6IB 1JE6A 4NRXA 4O5LL 4KXZI 2OR8A 3QEUB 4YAQA 2O93L 4GLRH 1MCNA 4FNLH 4BJLA 2J6EA 4X6EA 4Z7WB 1FQ9C 2P7TA 1FGVL 3I3BA 1JRHH 3SDAD 1DL7H 1YMMB 1OP9A 2NY1B 4HIJA 2IH3A 1U3ZA 1YY9C 2ESVA 3KPLA 1LDPL 1A3LH 4MNGA 3RUGE 3QEQB 2BVOA 3VXTB 3RGHA 4I9WD 1AHWA 1SY6H 2VABA 3DHJA 4MLSA 5HGDA 4PJDB 1QBMH 5TE7L 4PJXB 2NY7L 2XZQH 3NACH 5F21B 3PIQB 2Y4SA 1G7MB 3MLTA 1JNLH 2VDRH 3WFBL 1KJ2B 4ZFFB 3U46A 5I75B 2RIKA 5EO0A 5BMFL 1MFDL 4BKLA 4P2RE 2DQTL 1OCWH 1HYSC 3MJ9A 1LE5A 2X4OA 5F7LB 4NHUB 3ROOB 4DKAA 4ZOEA 2XZCL 4JEGB 4FXGA 3N1PC 3RTQA 2C4FT 3HE6A 3SGEH 1J1OH 1JHTA 3B4NA 3U2SB 2HKFH 4LCIH 4WV1A 3QI9D 3P2TA 3P0YH 4N1HB 4DW2L 3QQ4B 1ZSDA 1CDHA 3AS0A 3VXME 1I3GL 1ZS8B 5ILTL 5C0IB 2P8LA 1MLBA 4EVNB 3G6JA 2OS7A 1Q0XH 5ITBL 1HH9B 3IDGB 4H1LH 3TYFA 2I5YL 2Y7QB 1K8IB 3THML 1CD1B 1Y18A 1XF4A 4LU5H 4ZXBA 4JM2D 5D2LB 2LTQB 4RZCA 1NFDB 2XA8L 1E4XI 3AM8C 3IF1B 4IOIB 5EOCH 4HJJH 3BFOA 4FQJH 1ND0B 4BSWB 4WI7A 2VXTL 3C5ZB 5HYSG 1FVDA 4O02L 5ICZB 1UWGH 4HD9A 1DN0B 3QPQD 1NCTA 4U1SA 3V79C 3FOLB 1R3IH 1RV6X 2FBJL 5L6YH 1CFSB 5E24E 4WHYG 4HH9A 5INCA 4LRIC 1MVUB 1KEGH 3HI1B 4OLYH 4OUOA 5KSUB 1G7LB 1L6XA 1ZLVH 2WBJC 2F54B 4WEBH 1GGCL 2CQVA 1CBVH 4QO1A 1U3YA 4M61A 1FNEA 3F7YA 2MNUA 3UJTH 4XB7A 5IQ9A 5E1AB 3V6ZB 1Q1JL 4RA3A 4YDVA 4MCYA 2C1PB 5TE6L 3GJFB 3VJ6A 3O3UN 3HAEH 4PYGA 2KKQA 1A7RH 5K9KB 4KJWD 1UWXH 1NUDA 2R2EB 2ZNXA 4TSCL 3JWNC 2OR9L 1QSED 4UDTA 3GHBH 3IAGC 4MXQD 4R2GB 5T5FL 3BKML 3RUGB 3U0PB 4F37F 1MIMH 1GGIH 5IBUB 4R4BA 4W4OA 3DX8A 4WI5A 3QRGL 4JREC 4M7LL 5F72S 2A83B 3NTCH 1RVFH 1VACA 5TGBB 4GQ9L 1QYGL 4M1GH 3QQ9C 3BH9B 1CR9L 3VGEA 5GGVY 2AW2A 3EUUA 5CINH 4P99A 5AD0B 3CLEL 4HIIB 4HPYL 4ISVB 3QUXA 2BVTA 3OJVC 2Z8SA 1MCEA 4I4WB 4P2RB 4GW5A 4ZYKB 4WTZG 2O61A 2Y9RT 2UWEE 2ATPA 2EE6A 1W8NA 3PWJB 2IEPA 2X42A 4K7PL 5HGHA 3UCRA 2NLJA 5HY9A 1C12B 1H5BA 4LCYB 3MROA 2DOCA 3DHMA 1YEIL 5MENB 3EJYD 1T20A 4WFFD 1XCTA 1A7BA 3QDJD 1T5WB 4UNUA 5D9SB 3KJ6L 4GKNB 3KWWA 1WGOA 4IRZL 1YECL 5D7LE 3HZMB 4TSBL 3B9AA 1FRGL 3IDIB 2XTJE 1FFRA 5EZJA 3WFHA 1WSST 2Y36L 2JIXD 4LSTH 4NWUL 4PRHA 4N0CC 3OKMA 5E4EC 5D2NE 1RUMH 2RR3A 1L0XA 1C5CH 3UTSE 5E08L 4X9IA 3BP4B 5DJDB 5IW1A 4LHQB 3ZSSA 3MBEB 3RWJB 1CFQB 4EI6A 3RAJH 4KDTA 1TQCC 1PYWB 5CP7A 3PGDB 2R15A 1TQBC 1AGEA 5L9DL 5KANG 1YYLL 1AGFA 4XVJL 5HD8C 3MNVB 3C87A 5JPNB 5GGQL 3O45B 3GMNB 4UBDD 1F58H 4OQTA 3MUJA 1F8TL 3QPXH 2OL3B 3ORJA 3V9FA 5DEFB 3BRFA 2YRZA 3JWDH 8FABB 3RBSA 1V3JA 3GSNA 5KVGL 3MUY1 4NO3B 5IBLC 1UADC 4PJ5A 5F3BA 1QOKA 2CIIA 2R69L 1MEXL 3S34L 5F1SA 4U6XA 3P9MB 3MLSL 3GSWB 4CL7A 4Z0XB 3KDMA 3LDBB 5D1ZA 3ESVF 3QDGD 1J86A 4KJPC 1Z9OA 2WBKA 1BD2D 5IHUH 4PY7B 2F58L 4Y5XB 5GGSY 4F9LA 4X8JB 1D9KB 4L8BB 3WSQL 4MA8L 1T22B 1TFHA 4O00A 5ITFA 2UY7A 4LQFH 4NQCD 2GT9A 5DHYB 1CL7L 2J8HA 4KHXL 4E0RA 2J7LA 4TRPH 1Z6JT 3OAYK 4JVUA 3H9SA 4KJQD 5EU4A 5J6GA 4ONFH 4AG4L 4U3HA 4X8XA 2X4RA 2FX7H 1NMAL 1QHPA 4JFFA 4NFDA 3B2UD 4NKDB 3VU2A 4U3CA 5SV3A 2EC9U 1BFSA 1IT9L 1X5AA 4CVZA 1LEKA 1RZFL 5HHMD 4Z76A 5L2JB 1U3HB 4FXLA 5IMOB 3TPUB 1U91A 2UWEB 5BS0D 1XFPA 4M93C 4I0PB 3RGVB 2GW5A 2YK1H 3VXSE 4TUKH 3K4AA 4LCCB 1S7QB 2X1QA 1EHLL 2JCCA 5FYLL 3NAAL 4XHQA 4DVBA 4L29B 3VE0B 3RKDD 4TNWF 2ZSWA 4Q6YA 4S1DD 5JQ6H 1GC1C 4U1KB 5T1MA 4X6CE 5F6IC 1T21B 3BH8B 1U93A 3IGAB 3F7VB 4OZFH 4PRAB 2Q76A 1F4YH 4M7KL 4XPTH 3ROLB 3QCVL 1D5IL 3BI9X 5D7LB 3VXQB 4G43B 5C0NC 5HI3D 3FQNB 5J9PA 2AXGB 4P2QE 2XTJB 5C0JB 4DGIL 1DBAL 1HNFA 2CMRL 5KSAB 3PHOB 1NC4B 1UZ8B 5EZLA 5D2NB 4XNZC 1T66D 2QL1A 2YSSB 4L9LC 4XXDA 2BMKB 3MJGX 2MKWA 2R0LL 3ULUE 5FYKL 4JDTL 2R8SL 2D31A 2R1XA 4HGWA 4PJAA 5HVHC 4KROC 3GMPA 2DYPD 2HG5A 5IB1B 3OHXB 3TM6A 5AG9A 4QXUL 1AIFB 2E27L 3EOTH 3V5DB 4JE4B 3ARGA 5FYKE 3VXPB 2J2ZA 4N5ED 2BK8A 1RMFH 3FB5A 2LFGA 2DQHH 4ZAKC 3RWDB 2PKDA 4Q9QL 2A9MH 4QCIA 3QXDB 2JJTC 1VHPA 3QO0A 2EYSA 3O6ML 5D7JA 2IAMB 2YPVL 1CGWA 5HI5C 1O7VA 2I60L 4P4RA 4ETYA 1I1AD 2FEEL 3OX8B 4K3EH 4OTXH 2HT3D 4RMSA 3EJZC 3BWAA 1W72L 4S1RL 1QVOA 4Y4HC 1R3KB 4YXLH 3TPKA 3V4VL 3CD4A 4G9FE 3QNZB 4YO0A 5IROC 1I7RB 4X80H 3P73B 4W6XB 3RJDA 3MX0A 1LO0L 3B8SA 1MNUL 1I3RB 1I4FA 5E95B 1Z0NA 3IDMA 4YHOL 3SE8L 2NW3B 3RL2A 5JLZB 4XPFH 32C2B 1WCBB 1V05A 5KS9E 4KRMB 5TPWH 5T1DH 1IC7L 1IGML 4U1JA 1NSNL 1H8SA 2DM7A 4KV5F 1UKTA 5ERWA 4MD0A 1PKQE 1YUHB 3DROA 5C2BH 1C16A 1JI1A 4WFHE 1GGUA 1JZ5A 1VFAB 4G8FB 4EI5C 5CKAA 3KHQA 5DO2C 4XPBL 1I1YB 4KQ4L 4HJGA 2J88L 3O2DH 2KZ1B 3BQUC 1MHCB 4X6CB 3ULVL 5HPMB 4H20L 4W68A 5FGCE 4D9QE 5B38B 4QWWC 4GAYB 4P2QB 4UNVA 3HE7B 2OQJB 3GSOA 1WWBX 3FB7B 4NO2B 3PHSA 3FB8A 2V2XB 3HZKA 5DVKA 1UCBH 4GG6E 1JWSB 4JB9L 5I76B 1FZKB 1VEPA 2VN4A 5TQ2H 4CMHC 4HS3B 5E9DE 3SO3B 1AQDA 2X9YA 4V2CB 3B5TA 3BHBB 2W0FA 3L9RA 3L1OL 1EVTC 3RZCA 5C2UB 4RIRA 5EOCJ 4YHML 5T3ZH 2IQ9L 3WIIL 1GPOL 5ID1A 2HN7A 3MV8D 4JR9L 1SJEB 3UTTE 5F1IB 1GGBL 2XQBH 3L5HA 4LHUD 3RU8H 4NKIL 1CLOL 2R1WB 4JPKH 2FIRT 5KTEH 1LILA 4NZTH 1R3JB 5DVLA 2ADJB 1RI8A 3S4SA 1NCCH 1WBXA 4ZFZA 5GZOD 1DZBA 4J2XA 5CMAB 3HR5B 5D1QC 4NDMB 2F5AL 3O8XB 4YAQB 2VLKD 1MJ8L 2GYSA 2HTLC 4F7CA 1J12A 3KVQA 5D6CA 4I48A 5ACMA 2CGRL 4LKXB 2P7TB 2VDPL 5I1IL 1KJMA 4D8PB 3RPKA 3WNOA 3C6SA 4PRPE 2IH3B 5FYJU 1LK2A 2NY6D 4ZPTA 2ZOLA 2FATL 1INDH 2MMXA 5I1HL 3WJJC 4S1SH 5DD6B 3SQOL 5EOQL 2VABB 4G9FB 3T77A 1PQZA 2ADGB 4RAVA 1UCTA 2BNRB 2C4XA 2KH2B 5HGDB 5DUML 3CK0L 1CTOA 4L4TA 4NHCL 1U8MB 1QPPA 4LARL 5KS9B 3TN0C 1WFNA 1HOCB 1TENA 3C2SA 3LS4H 2VTFA 4KTEL 4HLZH 5C0FA 4OLVL 3SE9L 4YHYC 1LE5B 4K3DH 5C8JB 2A73B 3TO2B 3RTQB 1IQDA 3HE6B 3SKMA 4Y5VB 1F3JA 2C3VA 1KNOA 3RKPA 3VFMB 4BFBD 2EIZB 1BX2A 4X0KA 4UUJB 2DJUA 4CDHA 2R0ZL 5FGCB 4PRDB 1R5IB 2P8LB 2VDLH 1QBLH 3I3DA 2OMBA 3TYGH 3A6OA 2IMMA 25C8H 3R0NA 3O4LE 4M6NL 1Y18B 3SDDC 1J1PL 1XF4B 1A6VH 3CFCL 5KSVB 5IT2H 1QRNE 4APQB 3VGGA 1A9BB 2D7PA 3TBTA 4GG6B 5J1AB 2B20A 2PXYD 1EFXB 4ACPA 4BQ9A 5E9DB 4Y19E 4JG1H 4JO3L 3SGDI 3BIKB 4GQPH 4UILH 1XGUB 2ZJSH 1X4ZA 4Z7UF 4XNMB 2VQ1A 3QBTB 2XN9A 4K55A 4TSAH 5E99L 5INDB 5JTWA 4U1SB 5GRVL 4JM2F 1TITA 4PB9L 5LQBL 4HH9B 2JB5L 3U4EB 3R8BB 3OAYH 5F93C 2RFXB 3UTTB 3ARFB 1TXKA 2CK2A 2X1XR 1FO0H 4WU5A 4OLEA 4YNYB 3SDAC 3S37L 3V6OE 1J8HD 4F7PA 1WC7B 2V5TA 2VAAA 2XPGB 2G5RA 1GC1H 5DA4A 2BP3A 4XVUC 3L3OA 4GG8B 5EC1B 2WP3O 5C3TA 4WFGD 1MFCH 3UYPA 5DRWA 4P9ML 1G7JA 2A1WL 4K9EH 1XGRA 2CXGA 1MOEA 5JDSB 4PRPB 5E7BA 2PO6D 3DYMA 3HUJE 4CADA 3E2HB 2RBLA 4OB5H 3NFPB 4XAKE 1WZ1H 2E6PA 3BIBX 4F33B 4TVPH 4JFZH 4AEIL 2IANE 4P9HC 5E8PA 1RHHB 1W0WA 1E4WL 3BEVB 5IJKC 2DKSA 2Y06H 4P48A 3W11D 5BZDB 5MI0B 3VG9B 3LKSB 4WUKH 4KTYA 4OAWA 3G6AB 5KVMC 3IDJB 3SCMC 5ICXA 5JIIA 1M05A 3LKNB 1N6VA 1QR1B 4DEPB 2NW2A 3ZTJH 2DICA 1F6AA 3HZYA 1U42A 2AJZB 5HY9B 4YC2C 4HWBA 4ODWA 3MROB 2AEWA 3FAWA 2Z0BA 3KYNB 3HS0A 1YC8A 4DK3A 2AJXH 1MHPL 5BO1H 3VMPA 4JKKA 4HXAH 3UTPE 4OSUL 4Y4FD 4MNQE 2VERN 4V1DD 1QSFA 3JBG7 3ZDXF 3O6KL 1G1CA 2XKNA 3SE4A 1CF8H 5EZJB 4R6UA 1DQQB 3AVEA 1QRNB 3C8DA 4HXBH 3QPQC 4DKEL 3O2WL 1ADQL 1P2CA 5DK3A 1JPTH 3RWIA 3D0VB 4HBCH 1CXLA 5HVGB 3N1FC 4UU9A 4Y19B 5BVPH 1S3KL 4LDLB 2FGZA 4ORGB 3TH3T 5ANMA 4EQ2A 1AGEB 1DLFL 3RZWA 1S78D 4Y1AE 1M7DA 3E3QC 4X99A 4ODSH 1OVZA 1KUMA 4X83A 1W8OA 3T1WA 3I6GB 2OCFD 5CIPA 1HSAA 2FJGB 4KJWC 3GSNB 4PGJA 2CIIB 5IM7A 3HNVL 1WQVT 2QSCH 2ZCKH 4NOFA 1FFPB 3S6CA 5I16A 3WNKA 2CUIA 4UIKH 2JF1A 2D7NA 5D1ZB 5DR5L 4K8RD 3QJHA 5C92A 5C0AA 2VLME 4M5ZL 1T1YA 2C7UA 4O9HH 1X4YA 3LAFA 2DBJA 1HN1A 3VH8A 4Z77A 3EDJA 2P1YA 4JY5H 4QOKE 2APBA 5FYJH 1KBGH 2IANB 5CLWA 1VA9A 4JN2B 1AGCA 3LMJH 2DLGA 3OPZL 2AV1B 4GRWE 1OP5K 2PF6A 5E6IA 4ONHB 5KVFH 4H26B 1FFNA 1LEKB 1ODAA 1HI6A 4FXKA 4FFZH 3PP4L 3V0WH 5CJ8A 3BDYH 1HQRA 4RFNB 1FAKT 5CJBA 5DJXA 4U0RB 3EJYC 3MBXH 5IEHB 3F58H 4KZDH 4OM0H 4FP8L 3IKKA 4G7YH 1PFCA 4KH2A 4PGDB 3TBYB 4ZFOL 5DQDH 2NZ9D 1ZHKA 1DUYB 2W9DL 2XY1A 4YGVA 1A3QA 5IOPB 1CU4H 3L7FA 4JQIL 4OFKA 2CSPA 3VWKD 1DANU 1RIUH 3ULVD 2ZKHH 3N9GH 2VDKL 4XNUL 4KDWA 1SBSH 4KAQL 2VLJD 1QQDA 3QB7C 3VFSA 1YEHL 1KENH 3E6FB 2IPUG 2JJUA 3W2DL 1L7TH 2H2SC 1K6QH 5EO9A 2VLLB 3G9VA 1ZA3B 3BAEL 1IFHL 2DWDA 5EA0L 5F44A 4UBDC 5EUKB 3SHSA 3NIDE 1R5VB 3L3JB 3EYUL 4U1IA 1BM3L 4PR5B 2WMPA 5HYSB 2E7LA 2XKSA 4ZUTA 1CXHA 4OZGE 3BT2L 4Y1AB 3M8OL 4Y4KA 1I8KA 3FFCA 3CJJA 5DHVA 2JELL 2QKIA 4EBQH 1OGTB 1BWMA 4LSVH 4N0YL 3RVVD 1MIEH 1LVEA 1QUNA 4J3UA 3BKJH 3GFUA 4X4ME 2EXWC 2Q7YA 3PL6A 3WO4C 4FTVA 5DWUH 4D3CH 5ISZE 1AH1A 3ARBB 15C8L 1UM6H 4NQVA 5I1LB 1X5KA 1YEEH 4X7SH 3WDJA 1JBJA 1QBBA 3QJFA 4HS6A 3RWEA 5C0CD 2JK5B 3SBWA 3IFPB 2IPKA 1OT2A 4HT1H 1KCUH 1MWAA 1YEJL 2XZAH 4HG4K 4G6MH 4NWTL 4BK4A 4KTDL 1L7IL 4LSUL 1K5NA 3B2UC 1MFEL 3QIBD 4FN0A 2DQUH 3QHZL 4G9DA 4NO5B 4MSWB 1P4BL 5B8CC 4XPAL 4M7LT 4QOKB 5IG7A 3MRRB 5BZWA 4Z7NF 5A16A 4YO0B 3R06B 2VH5H 2CJUH 4GRWB 5CHNA 3MR9A 4HMDA 2ZUTA 1IAIH 3BP6A 4JDZA 2CKBL 3T3ME 3Q1SL 4A6YH 1VFBB 3RKDC 3FTGB 2YEZB 5GGSB 3TT3H 1TZHB 4S1DC 3QNYB 3HI5H 2F5BH 1KV3A 4MD0B 3EOBA 4PREB 3V7MA 3DROB 1A6UL 2NTFA 4OI8A 1K2DA 1I1CA 4KU1A 1FL5A 4MS8C 1ES0A 4LPWA 1U8QA 1UQSA 5CZXD 5K9JH 1BVKB 1UGNA 4HJGB 2V2WB 1N8ZA 5A40E 3JUYA 4Z0BH 1KTDB 3GJFK 2AJYL 1T66C 1X5LA 4WDIA 5I1EH 3OKNB 2YN3A 1ED3B 2G75A 4X7EC 3JV6B 1FE8H 1ZEAL 1K3IA 3QI9A 2N4IA 4ZSOA 4FZ8H 3GSOB 5C09B 3LRSA 3MV11 1QA9B 4AQOA 2ZUXA 4MJ6B 3GSRA 4ZFOB 3KLHD 1KCRH 4LLQA 1EXUA 1EEZA 5ETUA 3S3JA 5CGYC 2XQYG 3OR6A 4JLRB 3B2VH 3MODL 2DQCH 1U95B 5E2VH 4Y5YB 5F6HJ 3N50A 3M45A 2WANA 5I1JH 3PG2A 1IKFL 2VITA 4WO4D 4JM2A 4WU7B 4OZGB 4U7MA 4RIRB 5I8KH 1FVCA 4NKMB 1KGCD 1RY7B 4CKVX 1YC7A 4PRID 3TBSA 4XP9H 1T83C 1XZ0A 3EO1B 4OLUL 3PWVB 2VYRE 1HHJA 5LCVH 1U6AL 1PKOA 3D3VD 1D6EA 5GS1A 3H7LA 5CJXA 5ISZB 2WUCH 3QUMH 2BDNL 4ZFZB 3K0WA 1NANH 2B0SH 1I1AC 1LD9A 3TO4C 3NZHH 1A9EB 2XKUA 4MAYB 3WHXA 1IC4H 5IMLA 5GJSH 3BIAX 3VW3H 2C9AA 4NRYA 3MRMA 3QXUA 1KLFA 4MMZC 5JO5A 4LSPH 3SDXE 1KJMB 4YHPB 1FYTD 4G6KH 5TDOB 2OJEA 3QZWG 3QR2A 1G6RB 2FX8L 2PW2B 2M8XA 3OG4B 1BEYH 3WLBB 3FO0H 5EUOE 4TPRL 2BY1A 1D6VL 1ETZA 43C9B 3MGTA 1PQZB 1JZ8A 2EDKA 1B4JH 6FABL 1QSEA 3C9NB 1CD9B 5IFHH 4O51A 1KN4H 5SX5H 4WI4A 5EBGA 4DFIA 1T03H 4YHIA 3CC5B 2AK4A 3G5ZB 3NVQA 1RZ7L 3ZZ1A 1QO3B 3GO1L 2EICA 4XP4L 5F1KC 2Y07L 3BXNB 2X7LA 3DI2B 5ADOH 2ILLA 4M48L 3LKRA 3TP4A 5C0FB 2BVQB 2X70B 3CVHL 3SDCD 4P5MB 2Q8BL 1GAFH 2OJZL 1T6WA 1JP5A 1SY6A 2HJKA 3ZE0E 1OHQA 3O6LH 5F7UA 1U8OA 1I9EA 1F3JB 1BWWA 2L7UA 3RHWK 2BSTB 1BX2B 2DQIH 2DI9A 5DD1L 4M62L 3V6FA 1BP3B 3R0MA 1MAJA 3O3DB 1Z5LB 1ZA6A 4OUUB 2VJXA 3WL9A 4Q9RL 3P0GB 4KVCH 4G80A 1UA6L 2L4OA 3GRWH 4JG0L 4PGCA 2E7MA 4NPYB 1CG9A 4QY8B 3TH2T 1D5XB 4RMRA 3MRPA 3MSPA 4GFTB 3OKKA 4HUVB 5LGHL 1S5HA 2JLLA 3V4UL 4P59L 4DAGL 3NIGE 1DQJA 3QRFM 4M6AA 3BYTA 2E9WA 2Y23A 4NM8L 4ALAH 3QFJE 4M7JH 1I7UB 2Z91A 2JIXA 2CLRA 1H9VA 1I8IA 1SM3L 5IVOA 5AYUL 1RUPL 4IEFB 5F7MC 5GZOC 1Q72H 4A2LA 3QAZB 2QTEA 1P7QB 3FFDA 3FN0L 2K3TA 1FNSH 5DURB 2UYLA 1K8DA 1GZPB 4OCSH 4FQCH 1EA9C 1YZZA 3WN5A 3DSFL 1OP5H 1A14H 2WUBL 2VN7A 1RJZA 2YC1B 4F7PB 4P3WA 5HYJD 4LLUB 2NY6C 1V7ML 4MQSB 4IRSD 3U9PL 5C07D 1OTSC 2FO4B 5ECJE 1NCAL 1FVEA 4NNPL 3EIFA 4AT6B 2BHZA 3HPLA 2BVEA 1G7JB 3CU1A 1LP9F 2GAZB 3SDXB 4Y16B 4RAUB 4AH2B 3MLWH 4P23D 5T1KA 4J7RA 2EZ0D 2CPCA 5GJTH 3VXNB 3GUTA 3MRIB 3CFKB 1BBDL 2NY2B 5EUOB 1INEL 3V2AR 3QDGA 2H26A 1FG9C 2X89D 5F7DA 2F74B 1AGDA 1YNTA 1Q94B 3ZKNC 4ZPVB 4X4ZA 3QG7H 3MOBH 4NQCA 1OAZL 3HAEA 4Z7OE 1FFOB 5JR1H 2GI7A 1BAFL 4KQ3L 2AJVH 1PG7W 4GOSA 2N1KA 4OFDA 1ZGLA 2XOTA 1NAKL 2BZDA 2FZ3A 5GGUA 4HQQH 1H3WM 4NQXB 1UACL 1EO5A 4PGEA 5B8CA 3HI6H 2H1PH 4MQ7B 2FCBA 3LV3B 4L5FH 2QADB 4S1QH 1AXSB 1P6AB 4CW1A 5TDPA 3WEXB 3VI4E 1XMWA 2NX5A 1DN2A 3S35H 2F9BT 4YHZL 1BECA 1A7QL 4POZD 1OTTD 4K7FA 1H3GA 3ARDD 1JI2A 5JNYA 5EC2A 3BZ4A 4HFWB 3IS1X 4DZ8A 1IGJB 4MJ2A 4MXVF 1BIHA 3MOAL 1DBML 1KFAH 5DD5L 3ET9F 5BJTB 4MCZA 4HIEB 1FGNL 4M43H 5GS2D 5MP6L 3K80A 3QFJB 4FA8A 2YPLD 5EIQA 3E1F1 1LO3H 4XCCH 5BXFB 2K7PA 1AC6A 3IVKB 3FT3B 4X99B 2NY3B 1XGTB 3EYFB 2FRGP 4S2SA 3ZE2E 2VXSL 1TJGL 1QFOA 1IGCL 5IMKB 2D9QB 3OAUL 4LCUB 3LN4B 3AAZA 5FO9A 3CDFA 2PO6C 1BQHA 5DJZA 2X05A 1RUKH 1F4XL 3GGWA 4JZJA 3GSVB 2DAVA 4MB3A 2BNUB 5D7SL 2VRAA 1MCFA 3QUYA 4MWFA 5I2IA 1OM3L 5I6XC 3UPRB 1IM9B 3STBA 2SEBB 3LZFH 1RZIB 3DUUB 3K46A 5D8JH 2C7UB 4H0GA 4J8RB 2ZUSA 1J88A 4Z77B 5T3XD 5DC0A 3W11C 4ODXA 1NGZA 4JY6B 5J8OA 2D7TL 3MRGA 1T3FA 3GJFH 1AGCB 5EPMA 2BFVL 4U1GB 2UV3A 3BZEA 5FB8B 3CSYA 5DZOA 4XBGB 2IJ0C 1ZV5A 4UB0H 1N59B 3AU1B 5CBEA 1MUJB 4LRNH 2HVKB 3QG6A 4BH7A 1K4DA 5DJXB 3S4SG 3FMGL 4MJID 4O5LH 5DRXB 4I2XB 3AREA 1YMMD 1ZGLM 4QRPA 1JV5B 5GGTA 4Y4FC 4DN4L 3MJ7B 3KYKH 4KMTL 3O4OC 2P42B 1FGVH 1JJUA 1ZT1B 3QEQD 4PJ8B 5EU3B 4ZUVB 3L3DA 5A2JH 1ZHKB 4KUCD 4DTGL 4EDXA 2RJMA 1LDPH 4O2FB 3PV6B 2MQ3A 5MEOA 1Q9KA 1S8DB 2ZG3A 3L7FB 2X10A 2BY0A 4AEFA 5CSZA 2X4QA 4XTRD 3ILQD 1CQKA 4Z7VE 3UJJL 5GRWA 1KCLA 5HDBF 3G04B 5TE7H 2NY7H 2NXYB 3NA4A 1ZT4A 2HFEA 4U1MA 3WFBH 3I02A 1ULVA 4XCNB 1UENA 5BMFH 1MFDH 1P4IL 5I1KL 2DQTH 3DO3A 2HFFA 4OZFA 5ESVA 5ACLA 4L8SB 5EIVA 1BJMA 1KT2A 2EDJA 2YZ1A 4PJ7F 4F7MA 4DUVA 1X5GA 2BXZA 3BVNA 1WCQA 1I3GH 5ILTH 1CYGA 3TA3A 2Q7YB 3KJ4C 3G08B 4FTVB 3SKJL 5ITBH 5IUSA 2B2XL 1E4JA 1B0WA 2I5YH 4I1NB 3EFDL 4PLKD 3THMH 4LHUA 2FH8A 5FYKU 4JFEA 3VI3F 3B9KB 3C09C 3KGRA 2OX5A 1J0YA 3U1SL 3C5ZD 3KPOA 5DVOA 4HWZA 3KPNB 2XA8H 4XAWL 6CGTA 5GSRA 3LN5A 3MRQA 3DVGB 3SPVA 1IGIL 2VXTH 3E8UL 4XP1L 1MF2H 2VLKA 4G9DB 2ERJC 4O02H 2WINA 4QHNA 1BQLL 5KSBF 5DJ8B 4RWYL 1XT5A 5EBMB 4ENED 5FA4A 5HYQB 4JFDB 2FBJH 1XGQA 5GISL 5LAXA 5J6HB 2F53A 2XTLA 2F54D 4ODBD 4G5ZH 2FYYB 2GSGA 3AROA 1YDPA 2NY5C 2YHGA 5BQ7A 1MI5E 3BP6B 5E8NA 3B3IA 5H37H 3OAZK 2J6EL 1JF1A 1GGCH 3RNQB 4DVRL 1J0KA 5T1LA 4FQQB 3OKLB 5HDQL 2NZ9C 4Y8AA 3DURB 3C08L 2HFGL 4N8VA 4FOMA 4J4PC 4PRNB 1Q1JH 1QRKA 2C3XA 3ZT7A 1OT1A 1NGQL 3K74B 5J11B 2NMSA 2WM0A 1KN2L 1I8LC 4R2GD 3ULVC 1EO8L 3NPSB 2LAGB 4NN6C 4TSCH 1U8QB 2OR9H 3P4OA 1CK0L 1AKJA 1HHIA 3KG5A 4IHOB 3CSPA 1G7QB 4CU6A 4NN5B 1E28B 5T5FH 3BKMH 5HGBA 4Z7VB 5BRZE 3VXUE 3TEUA 4MNGE 3BP7A 3QRGH 4M7LH 4RAHA 1DP0A 3ZHLA 2EH7L 2FEDD 3X12A 2DI8A 3LSOB 4PLOB 5I17A 3JV4B 4GQ9H 1QYGH 2BVYA 4UMGA 1CR9H 3MJ9L 5EN2A 1A4JA 4LLQB 5FKAB 4LFHG 5A3IC 2AV7A 4LEXH 4QT5A 1ZGLP 5I9QC 1AD9A 3CLEH 2NPLX 4OKVA 3DTXB 4HPYH 1T04B 5IHZA 2BNQD 3GEWB 3RVVC 1RAMA 3O2DA 1B6UA 5CSBA 5K93A 2XWBA 4F3FB 3KS0H 2A74B 1I75A 4Q7DA 4K7PH 3NFNB 5MEND 2PXYA 1VADA 3EFFA 1N5AB 3DX6B 1UJ3B 1YEIH 1ZHNB 2OZ4L 4QTIL 2DQJL 3C5JB 5GS1B 1FHGA 1LHZA 5JXED 3DMMD 1A1MA 3KJ6H 2W91A 3QIBC 5I8EA 1YECH 4TSBH 3EDKA 1IRAY 3GSUB 5FUCC 1FRGH 4QLRA 3U4BL 4R0LA 2P4AB 1LP9A 5I1AA 2Y36H 5DQJA 3C60D 5F9JB 4HAGA 3RIFK 1H0DB 2W60B 1J8HA 2OJEB 3T65A 1IEHA 2J8UE 4OM1L 5E08H 3MRFA 2ZUUA 3EBAA 5JOFA 4KKLD 4X5LA 4LHJB 2QR0B 4DN3L 1KLUA 2BRRL 1N2RA 5EFIB 3P77B 1NL0L 4PTTB 5C6WH 1ETZB 3IETB 5L9DH 3BKCH 1YYLH 4XVJH 4KWUA 2CUMA 2IG2H 4P5KB 3WDHA 4HKJA 1R3LB 2DTML 3IFLL 3FOMA 2A6JA 3R4DA 5GGQH 5ENWB 4XX1G 1F8TH 1MI5B 5IVNA 3OXRB 3D0LB 3V5KB 5A2IH 1S7XA 1XR9A 2Y6SD 4JY4A 4P2OB 4I18A 5JOPE 5CZXC 3DARA 1FV1B 5KVGH 2X4UA 1A1OA 5JIKA 1P84K 2ORBL 2R69H 1MEXH 1WEJL 3S34H 3MLSH 1RZ8B 1D9KD 4C83A 2I9TA 3EW3B 1JGLL 2HTKD 1U8OB 2F58H 4QRQA 4HS8H 4ZO6A 5DUPL 3ZE1F 3WSQH 4MA8H 1D5ZA 3WUWB 3CFEB 1CL7H 4O2EB 5GRVK 4D0DA 4KHXH 1OD7A 5BRZB 3VXUB 3SE3C 1ZA6B 4AG4H 4GS7B 2DLIA 5JW5A 1NMAH 4PGCB 4WO4C 4XBPB 3RWCB 1CG9B 4GXVL 1EDQA 1IT9H 4Y4FA 1RZFH 3QP3A 2P8MB 4I0PD 4V1DA 1FSKC 3STZA 4B50A 5I1DB 5L2KB 2IFFL 5IEKB 2FJFB 1L0QA 2VDML 5HHNB 4WUUA 1EHLH 5FYLH 3FKUS 3NAAH 4H1LB 3V52L 1A5FL 3SKNB 5IWLC 3GMOA 4RMUA 1C5DB 3HMXH 1I3VA 3BPNB 3MFGB 4P0DA 3LEVL 5D7LD 2JTDA 2XTJD 1NQBA 4Z8FL 5EU6A 2BHYA 3QCVH 1D5IH 4XXCA 5KSAD 4PIRF 3I2CL 3RDTA 1NC4D 1UVQA 4DGIH 2EYTA 1ZE3C 2GJZB 1DBAH 1ZVSA 2CMRH 3HPLB 4FFYL 2VUOA 3T0XA 4QRTB 2DWEB 1F3RB 2J8UB 5I71C 1DBJL 3DVNA 2R0LH 2YBRB 5D7IF 5FYKH 1XF5B 4JDTH 2R8SH 5B39B 1FO0A 4Z95L 4ZUWA 4NJAL 4GBXB 2EKSA 1I85A 1IEAA 5D6DC 3P9LB 1AGDB 1YMHA 4M5YL 4MX7B 2UZXB 4PG9B 3CXDL 3SDCC 1CS6A 4H5SB 1PJ9A 1HZHL 3O3AA 1V3LA 2R2HB 4J6RL 1NDGB 3PHQA 3TVMB 1YN7B 3T2OA 2A38A 4NM4L 3QXAB 1HXYA 1HYRC 1U8JB 2UUDK 2Y25A 1TTGA 2IAMD 2FHBA 3OJMB 1KCSL 4Q9QH 2BY3A 3O6MH 1CICB 1W0VB 4PJ5E 2YPVH 1RZJL 2I60H 5F7NC 3D85A 2GKIA 5D5ME 1UYWL 1GHFL 2NYYC 3JVGC 1E27A 3TZVB 4D0BB 3TV3H 1TNMA 4PGBA 1YA5A 2EXYC 4JJ5A 4DUWA 1W72H 4S1RH 1RK0A 1FG2B 1ZT7A 5I19L 1DR9A 2BOCB 4GAGL 3V4VH 5GSVA 2I9LA 4X7CC 5IF0A 3BZ4B 5C08B 1LO0H 3OKEA 1MNUH 4GT7A 3CXHJ 4ODUA 4OJFL 1F6FB 1BFVL 2X4PB 4L4VD 2EDOA 3CNKA 4YHOH 1S9XB 3VWKA 5DGRA 3SE8H 3BZFA 2H9GB 4G7VL 5DEZA 2X6MA 1IC7H 1IGMH 1NSNH 2VLJA 4O2CB 2FJHB 5JHDB 5E8OA 3MUGB 1MLCB 3PWNA 2P24A 5GGVL 1RJYB 2V9RA 4XPBH 3IDYB 4IRSC 4U6YB 5C0RH 3PWPA 1CXEA 4KQ4H 2CLZA 1IVLA 2J88H 4AIXA 4JGMA 4AMKL 1AXTL 4H20H 2Q86A 1TVBA 1CD8A 2APWA 3HNTL 4HX1B 4P2QD 3HE7D 1JZ4A 4P23C 3MRDB 2EZ0C 5IB5B 1JPST 2EH8L 3OAZH 3U30C 2B7DT 3CPLA 3OF6D 3VXRD 4EN3B 3ULUD 4POUB 2X4TA 3TH4T 5EBWA 4MWFB 4ZUSB 5E94B 3WIFB 4JB9H 1OY3B 4PD4J 5KSBA 1S9WA 3O11B 4X5XA 4GRLA 3T1FB 1BQSA 5DI8B 3T0WA 5HYIA 1UEYA 5C0CA 3L1OH 1MHEA 2GFBB 4RFOL 5E8DL 2WAHA 4YHMH 3PABA 1WAAE 1RSFA 2IQ9H 2KZWA 2IMNA 1GPOH 4PJFE 5EIIB 3QIBA 4JR9H 2VDOL 4NYLA 4N68A 1Q9WA 4NN7B 4CU7A 5J13B 1GGBH 4NKIH 4Z7QF 2H32A 2OSLA 4TN9A 2BC4B 3CX2A 2RB8A 5KZCD 4OT1L 4OD1L 3O8XD 2X1WL 1MQKL 1KACB 4RA0C 4U1NB 4UV4H 3G5XB 4H0IA 3B6SA 1XGPA 2F5AH 2XY2A 3HC0A 3DV6B 3DXAA 1MJ8H 2H6PB 2XWJB 4OIIL 3SN6N 5DMJB 4POZC 1OTTC 2CGRH 3ARDC 2VDPH 3VGBA 5I1IH 5D5MB 1JZ3A 4E41E 3H8NA 1QSZA 3BJLA 3NH7L 5LBSL 2H3NB 3MRLB 1VERA 2PW1B 3OR7B 2BX5A 1UB6A 2BNRD 2FATH 3U6RA 4ZUUA 5I1HH 3U0WL 2R29L 4MD4A 4Z7WF 2C5DC 3SQOH 5EOQH 5DD0L 2OI9C 2VNCA 2Z35A 3B5HA 3HRPA 1MRDL 2DQFB 1AO7A 2AKRA 5DUMH 3CK0H 5C9KA 5M95B 4NHCH 4R9HA 1KLGB 4KUCF 1RU9L 3WFEL 4JRYA 4LARH 1VPOL 5TJWK 4PJDF 3VCLB 4LMQI 1OW0C 4R97B 3MV7B 4PJXF 5F7KC 5IV2B 3SGKA 3T8XA 2GSIB 4KTEH 1JTPA 3RTQD 4OLVH 2HFFB 3HE6D 4RGMC 3SE9H 3X11B 1KIRB 1P9MA 4XZUB 4OCXL 4YDKL 5K9QI 4ZS7L 1HNGA 2VIRA 1G7PA 1P1ZB 1OAUL 3NCMA 2PYFB 3BPCA 4WO4A 1NJ9B 3KS0J 4JO2L 1N3NA 2R0ZH 3ECBA 1A7PL 3TA3B 4GRMB 3WHE0 1JFQL 2HLFD 3MV9A 3OQ3B 1HDMA 1CDIA 4PRIA 4M6NH 4LSDA 3H9HB 4UV7L 1J1PH 3H6JA 3CFCH 2W65A 4KHTL 4N9OB 4IMKA 1EFXD 3K2MC 1KEML 3D3VA 3FO9B 3VFUA 1FLTX 2ARJB 3MO1A 5KVEH 1TTUA 5IWLA 4JO3H 4MNHB 4CUCA 3VD4A 2ZSVA 1ONQA 2XWTB 3P9WB 3V0VA 5BVJB 5E99H 1NFDF 3UTTD 3ARFD 2Y5EA 4PB9H 5LQBH 4PJFB 1E6JL 4XRCB 3B43A 4QHMB 4FFWD 4KI5D 3FQXB 3LHPL 3VWJA 2JB5H 5E2TL 1DEEB 4LKCB 4R7DB 2GSGB 5E5RB 2ZPKL 4HK3N 5BQ7B 4YEFA 5H8DA 3SKUD 1J5OL 4P5TA 1I8MB 5F7YC 1WBZA 5B3JE 3FQWB 3WXVL 2APFA 3S37H 4N8VB 5ICYB 1ZANL 1SJHA 3NIFF 4K94L 4JKPL 3MXWL 4IIQA 2R0WH 4HF5L 4PRPD 3K1DA 4PG2C 4DKFH 2DLTA 3ILQC 4P9MH 4PJEE 5GGRA 3PDOA 2A1WH 3MLZL 2XNAA 4PJ9A 4E41B 1FNLA 1JGUL 3SDCA 1Y0LB 1GSMA 3L3KB 4A6YA 1I3UA 3BP7B 4ESKA 3W9DB 5IQ7L 4AEIH 1CFNB 2WBJB 1M71A 1KIQA 2VL5A 3SO5A 1LEIA 2PUQT 5I18L 1A4JB 1E4KC 3P3YA 4HUXB 5H94B 1MJ7L 3KPRE 1SEBB 4NQTA 3V5HA 4AL8H 3MRBA 4RRPA 4QXTB 1FLRH 3JVGA 1ZVYA 4UQ2B 1EJOL 4MZ3A 4JFQA 4X7FC 5D71L 3SY0B 3QNXA 1D5BA 3PF2A 4K07A 1QACA 3QIWC 4RMVA 3FT2A 3WFDL 1IC1A 4HV8B 5CCKL 5J3HD 2DL2A 1S9YA 3GIVA 3L3GB 1MHPH 1WTLA 3RQ3A 3TJHD 3GHEL 4C56E 4JREB 12E8L 2P45B 5CEZL 2EIDA 4S0TD 1QZ1A 1QRND 4PRHD 1E4XL 2H8PA 2WBWB 2LABA 5A43C 2UUDH 2XXMB 1Z3GL 4PLJC 3VGAB 3LIZL 4OGYL 4ENEC 4YBQD 1P7HL 4DKEH 5D7IA 3O2WH 1ADQH 1IQWH 2FIKB 3ARWA 5FOJA 4WHYH 2E9BA 5HYJA 3T2NL 5AZEL 4JHBA 5CEZE 3TGXA 5C07A 1VKXB 3BE1L 1S3KH 4H25B 2R4RL 3QUMA 3BJ91 1DLFH 3FQTA 1JNHB 1QFWI 3QA3B 1KTRL 4F9PC 3DX9B 2A6JB 3QIUC 4NQDB 3AMKA 4R2GC 1TDQA 4EXKA 4JZOB 4L4JA 5C86A 3DGGB 4CJ1A 1AQKH 3T3PE 2DLFL 2IC2A 5D1ZD 1WFOA 1U92A 3HNVH 3G6DL 5A2FA 1KCVL 3I50L 3UP1A 5IB2A 2B8OT 3WKML 2CDEB 3GNML 4PJEB 5DR5H 4GXUM 2FWOB 1HWGB 2FEDC 2A6KA 2YUWA 2R0KL 1IAOB 4E42B 1TJHL 1ZTXL 3BRGC 1KYOJ 4M5ZH 3X13B 1TQBB 3DI3B 2J12B 1RJCA 2CIKA 2IAND 4PJBF 2YD9A 3DUSA 1NEZA 1FNGB 4JFFD 3WIHL 4QHKI 2YA2A 2QQLL 4WGWB 5DRNA 1E6OH 1O5DT 3OPZH 2BRQA 1CFVL 4XGZB 1JGDA 5I1GL 1KPVB 3KPRB 4NC1C 1Q0YL 4EDWL 3PP4H 1F97A 5ID0A 1JPGA 1G9NL 4KY1L 3RA7L 2YWYA 5LGJB 2YMXL 1CD0A 5JXEC 3OZ9L 3DMMC 4DKDC 3IAPA 2DMCA 4FP8H 4WUUB 2AQ1A 4YFDB 2LU7A 2P47B 2VZOA 4MA7L 4WNQB 2W9DH 4P3CL 2UWEF 3C60C 4MB4A 2VXUL 4OCNC 2YPLA 2P5EE 4JQIH 1K9TA 3F6LA 4LLMA 3A6CL 1KJ3L 4ZNEE 2VDKH 2EDTA 2B39A 1ORQB 1MCJA 1X44A 4TNVK 4XNUH 2Y72A 3QCUL 4KAQH 3I85A 1FORL 5DD3L 3OV6A 4OD2A 3REWA 2P8PA 3FN9A 1YEHH 4NQEA 4P4KB 3KXFA 1T1WA 3W2DH 2FSEB 4UIMA 5BW7C 4KJYB 3BAEH 3WO3B 5CAYB 4G6FB 2UVFA 3L5WB 1IFHH 2R2CA 4L3EA 5EA0H 3F12A 2AI0L 4M93B 5FO7A 1WUNT 4OCYL 2AAVA 3EYUH 4NQSB 1TZGL 1BM3H 4OFPA 4HMEA 4IOFD 1OWRM 2GITA 2W92A 4RDQF 5HYFA 2Y6SC 3I3EA 5DQ9B 1YN6B 2CO7B 4LEOB 3BT2H 5DK2A 3M8OH 5CEYB 5EORL 3SDYL 1YMHB 2ICES 3LDBC 1YY8A 2J8OA 4MD5A 2JELH 5F6IB 3ARGD 4IMLA 2OP4L 3HZVA 4N0YH 1DBKH 1D9KC 1QLRB 4TTGA 3ARBD 4XX1E 3O3AB 2G9HA 5I8CB 5BV7L 4WW1A 4HC1L 2D7MA 5D7JD 15C8H 2AJ3B 5GS0L 1T0PB 2WIMA 3CCHA 4PS4H 2H2PD 3T0EE 1RIHL 4W70A 1FNAA 4XNZB 1BZ9B 4LBEB 2HYMA 4L9LB 4Q6IA 4LHUG 1YEJH 3Q5YA 3QEUA 4PJHE 4NWTH 4P46C 1L7IH 4LSUH 4UQ3B 4JFXB 5H37G 3QHZH 4JHAL 4JKMA 1OP3H 4I13B 4PGBB 5HVHB 4HGKC 1P4BH 4YJZL 4KROB 4XPAH 4OGZA 4QYOB 3CFJA 5IK3B 1AC0A 1DFBL 2W9EL 3UBXB 3QEQA 3VXTA 2I9LB 2ITCB 4OF6A 5FKPB 1ERNA 2ICWJ 4LCCC 3F7PC 3OKEB 2G2RB 2FR4B 3MMEB 3ZT6A 3W0WA 4PJDA 1QEWB 1NDMB 4L8CB 4PG2A 4PJXA 3T2QA 4ZAKB 2CKBH 3Q1SH 3PIQA 4R3SB 1G7MA 4ZQKB 1EGJA 1C08B 3MREB 4AM0B 1KJ2A 5IESL 4D2NA 1EO7A 4ZFFA 1QG3A 1UM5L 4K3GA 1A6UH 3L7EB 3RI5K 4JGJA 3E0GA 2RCSH 1A3RL 4W81A 3EYQC 2Z8WC 4NHUA 3ROOA 4Y4HB 2C1OB 3U2SA 2P5EB 4OFIA 2AJYH 5F8QC 1E4KA 3QQ4A 5C09D 2AJUL 3B8YA 2CK0H 5M7QA 1ZEAH 3IU3B 1ZS8A 2Y5TB 5I73C 5C0IA 1MH5A 3LD8C 4X6CF 4EVNA 4EXPX 3LQZB 2B1AL 3UC0L 1EMTL 1HH9A 3IDGA 2X4TB 2FX9L 4IRJB 2Y7QA 5EBWB 1K8IA 1CD1A 5KG9B 3MODH 3RZCD 5L8LB 5D2LA 4GRLB 1NFDA 1OQOA 2EIEA 1HKLH 4LPYA 3IF1A 1DVFA 4IOIA 1RUAL 4EI5B 3HG1E 2YUZA 1ND0A 4BSWA 3HC3L 4GUPB 3KPQA 3C5ZA 4JFOB 1WK0A 5ICZA 2IAMC 3BQUB 2X40A 3IXAB 3ULUF 3FO2A 1DN0A 3ARVA 5ISZD 4O4YL 4UT7L 4WHDA 4OLUH 1XIWB 1CFSA 3FFCE 1QBAA 3EYVB 3MA7B 1IBGL 1XCQB 4JRXA 2JJSA 1MVUA 1MWAL 3HI1A 2BDNH 3MRCA 1DCLA 5J06A 4C57C 4J23A 3T0EB 3DXAB 2X9XA 1RUQL 4R96B 5DC9B 2LU4A 5E1AA 5JHLL 3V6ZA 1CE6B 3BKYL 5FA3B 1NGWB 3O6FB 4CMHB 4PJHB 3BSZL 2C1PA 3GJFA 1G84A 2LVEA 2R2BB 4MMXC 2NNAB 5K9KA 4XCEB 3JTSB 2R2EA 1X7QB 2FX8H 4RWHA 2Q20A 3HLAB 1EHAA 4TPRH 4GKZB 1D6VH 4L4TD 3RUGA 3U0PA 3OKYA 4D9RD 6FABH 4OIBA 5HYEA 2R1YB 5E5MB 3X3FL 1AO7B 5KN5B 1UH3A 3RWFB 5C1MB 1MCIA 2D0FA 4TYUA 3CDYA 4IJ3C 3UZVB 4OCMC 1F00I 3ZSTA 3I6LD 4F7TA 2EEAA 1RZ7H 3K4DA 5D1QB 3QWOB 5TGBA 3GO1H 3IFOA 4S11A 3BH9A 4GO6B 4XP4H 4KK6C 3IT8D 5A2KH 2VXVL 3Q6GL 4C58B 4M48H 5AD0A 2ICEB 4P9HL 2B4CC 4HIIA 4ISVA 3Q48A 3CVHH 1BJ1H 2DQEL 4K7PY 1HQ4B 5IR1A 2PCPB 2Q8BH 4AQ1B 2OJZH 1N7ML 1CFBA 4I4WA 4P2RA 5JXAL 4ZYKA 4JFYB 5KS9F 3D25B 3QQNA 4KRPB 3EGSB 1A47A 3PWJA 5GRUL 1MQ8A 2DTSA 1AD0B 5DD1H 1V7NL 4M62H 1C12A 1N3NB 4BK5A 1QPXA 2AVGA 4LPXA 4YPJA 5E0QA 1HIML 4YPGB 4I77L 4ORZC 1T5WA 2WK2A 1UA6H 4JG0H 5D9SA 4GKNA 1EBAA 3GIZL 3HZMA 1BZ7B 1K4CB 3GB7B 3Q5TA 4G42B 4P59H 4DAGH 4YHYB 1JN6B 4NM8H 4PY8J 3N1GC 5FDWB 3HG1B 2ZSVB 4FQ2H 4Z7UE 3IU4H 3O8XC 3BP4A 5DJDA 1SM3H 5AYUH 3MBEA 3RWJA 5IIEB 1RUPH 1CFQA 2IPUK 1PYWA 4N0FA 3VGDA 3PGDA 3FN0H 3WJLA 3M1BB 4YDJB 3MRHB 4K2UL 4X9FA 5JPNA 4JGUA 1B9ZA 1KTLB 3O45A 3GMNA 3DSFH 2WUBH 1AHWC 3QULB 2OL3A 1AI1L 3SDDB 5DEFA 4XHJC 1SJHB 1V7MH 8FABA 1DQDL 3U9PH 5FFLA 4Y16D 2FBOJ 4NNPH 4KI5F 3D2UB 4NO3A 3GMRB 5E56A 4YBLC 3P9MA 2Q7NA 3GSWA 4PJ9B 3NCYP 4BFIB 5F9OL 1H3PL 4MYWB 4PY7A 3IFNL 1BBDH 4Y5XA 1INEH 4X8JA 1T22A 3BD3A 1T5XB 3E3QE 2N7BA 3NCYS 2HVJA 5DHYA 5EZOL 4OFVA 3RTQC 3HE6C 3V0AC 1KIQB 1LEIB 4WV1C 1OAZH 4NKDA 4GAJL 4KQ3H 3V5HB 3L5JA 4L8DB 2IFGA 3D6GA 1MFAL 4YHNB 1NAKH 1KXTB 1T2JA 4RQQB 2QADD 1UACH 4L3AA 4JO4L 5IHBA 5L2JA 1U3HA 5IMOA 2W38A 2KDGA 5D1XA 4ZXBC 3TPUA 2UWEA 2EDFA 2APVA 4I0PA 3RGVA 3DUHA 1B6DA 3RX7A 4LCCA 2HJLB 1S7QA 5F88B 3WYRA 1OAXL 2DM2A 3RNKB 5FV2A 4L29A 3VE0A 4YHZH 5CZVL 4KGLA 3MOQA 5IBTL 1A7QH 3JV0A 4U1KA 1T21A 5CD3B 3IGAA 4GAFB 3F7VA 3Q6FA 4PRAA 1D5MB 2V7NB 3J8F7 4Y2DB 4MA3A 4OF0A 3WFZA 3ROLA 3VXQA 5D7LA 4G43A 1DBMH 2AXGA 4NGHL 3QUZB 2IH1B 1B0GB 5DD5H 4FFWC 4KI5C 1OGAE 3TLRA 4NZDA 3H42L 5KSAA 5BOPA 3SCMB 3QDJE 3NN8B 1FGNH 3PHOA 1NC4A 1J0ZA 1UZ8A 4PPTA 5D2NA 5MP6H 3CX5J 2YSSA 2BMKA 3U7YL 4Z7UB 2NY3D 2P5WE 4YC2B 1MPAH 1JL8A 4M7ZC 4RNRB 2Z93B 2XQYK 2VXSH 1TJGH 4Z78B 1MCQA 1IGCH 1OPGL 4ODHL 4YXKL 5IB1A 3OAUH 3D1MC 3OHXA 2NR6D 4HKZB 1R3IL 1AFVL 1J87A 1X5YA 4JDVB 4W4OC 2EEDA 1JTOA 4HGMA 4BQ8A 2I27N 1F4XH 3VXPA 5HGAB 5C0AD 3O81A 3C6LB 1NUNB 5IB2B 5GS0D 2EE3A 2GCYB 3RWDA 2QQKL 1CTNA 1CBVL 1OL0A 5D7SH 3QXDA 2A6KB 1OM3H 4F15B 2IAMA 1UXSB 1WT5A 3K8MA 3WS3B 3VG9C 3TNNB 1IGYB 4X98B 2HJFB 3OB0K 3NBNA 1TPXC 3OX8A 3KPMB 1K3ZA 2Q8AL 4NFCA 1DUZB 4DEPC 3GHBL 2BFVH 3C5SB 3KPSB 1R3KA 1H5BC 3QNZA 1BD2E 1DSFL 1I7RA 3ZYIA 1OQXA 3P73A 4JKLA 4Q0XL 1I3RA 1CWVA 2AXHA 5J3HC 4D9LL 1NFKA 3FMGH 5TH2B 4LSSL 2NW3A 5JLZA 4HUUB 3AFLA 3O3EB 4PJ8D 3DIFB 2XFXB 4GJTB 3BPLC 4TOYL 4DN4H 1MCDA 3N06B 4P49A 1CDGA 1YUHA 5IFAL 4KKCC 1VFAA 4G8FA 4DTGH 5F96L 1I1YA 2VSCA 4KDTC 5TF0A 3UJJH 4X6CA 1MHCA 5BS0E 1EZVX 2NXYD 5HPMA 1WWAX 3ZKMD 4H8WL 3T2PA 2EDEA 5B38A 5FECB 3EDDA 3OXSB 4EQ3A 4OD2B 2YPKB 4GAYA 2WQ8A 3KXFB 1T1WB 4P2QA 3HE7A 1MCWM 2OQJA 3FB7A 4NO2A 1OGAB 4WI6A 4HJ0C 4HWUA 2EDBA 1WZLA 3QDJB 1OLZA 3BO8B 4HIXL 3HMXA 4ZOBA 2V2XA 3RVXC 1NAML 2HT4D 1P4IH 5I1KH 4Y4KD 1JWSA 5I76A 4MVBC 3S98A 2P5WB 1FZKA 5JQHC 1O0VA 3L95B 3IJHB 5C9JB 3H3BC 4HS3A 3BEWB 1JUFB 4P57B 5C6PB 2YD5A 4XH2B 2WIIB 5D1ZC 4X4YB 1I9JL 3BHBA 1DLHB 5F9WC 4OCWL 4AYFA 3HKFA 4F9LC 1PZ5B 4FTVD 3QEHB 1HHGB 2Z31A 1H3TA 5DEGB 1HILB 1SJEA 2GEEA 3SKJH 2EDHA 1YQ2A 5F1IA 3K81A 1H8OA 2VDNL 2Z92B 2R1WA 2B2XH 3BUYB 5IGXH 3B9KD 3DECA 4MDIB 1T1ZB 1F58L 1R3JA 1J1XL 5F3HB 3EFDH 3X17A 3WXWL 2R39A 5CMAA 5EZIL 3U1SH 4LIQL 1S7SB 2E5EA 4NDMA 1MCLA 3O8XA 4G8IB 5D72L 4XAWH 4JM4L 4QTHB 2E6QA 3IS0X 4DWHA 3T4YB 5DJ0A 1IGIH 3VFRB 1CZ8L 1IC5L 4LKXA 2ZP0T 3E8UH 4XP1H 1NCDL 2LE9A 4JFDD 5HSFA 4D8PA 1T6VN 1V3KA 3CFJB 1BQLH 3ESUF 4RWYH 3RVWD 5ADPL 3RY4A 4YDLC 3L5IA 3MA9L 5GISH 3S8WA 4LIQE 3T4AB 4JQVC 4QNPE 5DD6A 3NCBB 4G9FA 2BVUA 1IJ9A 1BD2B 3VFGL 2ADG