2WYTA

1.0 a resolution structure of l38v sod1 mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGVTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural Discovery of Small Molecule Binding Sites in Cu-Zn Human Superoxide Dismutase Familial Amyotrophic Lateral Sclerosis Mutants Provides Insights for Lead Optimization.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wytA00
1IBBA 2WKOF 2Z7WA 1OAJA 4A7GA 3CQPA 3GTTA 3H2PA 4FF9A 2VR7A 1TO4A 4B3EA 1JK9B 2C9SA 3HOGA 2E46A 1SXAA 3H2QA 1BZOA 3HFFA 1SXZA 5KBMA 2ZKXA 4A7QA 4A7UA 1DSWA 1XSOA 1EQWA 4OH2A 1COBA 2GBUA 1N19A 2XJKA 3KM1A 2V0AA 3KH4A 2E47A 1PTZA 1IB5A 3CE1A 3ECWA 3L9YA 1QUPA 1E9OA 2K4WA 1P1VA 3S0PA 4N3UA 3KH3A 2AQSA 3QQDB 1PU0A 2AQPA 2WWOA 2ZKYA 1HL5A 2WYZA 4A7VA 3KM2A 1JCVA 1TO5A 1E9PA 2R27A 2ZOWA 3K91A 2AQNA 3T5WA 2WYTA 1XTLA 1SXNA 1ESOA 2VR8A 3PU7A 1E9QA 4BD4A 1DO5A 2WKOA 1Z9PA 3LTVA 3F7LA 3L9EA 2SODB 1EJ8A 2Z7UA 2VR6A 4MCMA 4N3TA 1F1DA 1FUNA 2AEOA 1SXCA 2GBVA 1SXSA 1B4TA 2NNXA 3ECVA 1PZSA 4A7GF 2WZ6A 2AQTA 1E9QB 1SRDA 3GZPA 1IBDA 5CU9A 1RK7A 1YAIA 1Z9NA 2WWNA 1CBJA 2APSA 1JK9A 1SDYA 1L3NA 1OZTG 1S4IA 2ZKWA 5KBKA 2AF2A 2Z7ZA 1F18A 1CB4A 1SDAB 1E9OB 3MNDA 1Q0EA 1YSOA 2JCWA 2WZ0A 3KBEA 1HL4A 3CQQA 2Q2LA 1F1AA 1BA9A 1IBHA 1MFMA 2C9UA 3GQFA 1UXMA 3GZOA 2XJLA 3SODB 2GBTA 3RE0A 1OALA 2Z7YA 1KMGA 3ECUA 1SPDA 1SOSA 1IBFA 1E9PB 1UXLA 2C9VA 4BCZA 2AQQA 1YAZA 2WZ5A 1F1GA 3GZQA 1OEZW 4OJAA 1U3NA 3KBFA 3QQDA 3MKGA 4U4IA 1N18A 1XTMA 1SXBA 2AQRA 1AZVA 1B4LA 4L05A 4A7SA 3HW7A 2LU5A 3F7KA 4MCNA 2JLPA 4A7TA 3GTVA 4BCYA 5KBLA 1OZUA
chains in the Genus database with same CATH superfamily
3T6ZA 1RZQA 3O6FA 2VJXA 4QHLB 1MCHA 4YSCA 5H2BA 2B4CL 3FQXB 2DB8A 2EKSB 3EXLA 1OOWA 1KTBA 3NN8B 5IHHA 2X0UA 3TZVB 3KWTA 3GMMA 3MJ8A 4LHUG 2C9SA 4FDWA 1U3HA 1SDDA 3QC6X 4XZUB 4OZFA 3T6VA 2DJMA 2R8SH 5FOBA 1BQUA 1KB5A 3RU8H 1KCRH 3NQIA 2MNJB 5CKAA 4RNRB 4XP6L 4XNAA 5IJDC 3K71A 1ZIBA 1QWHA 1S7UA 4M1GL 1U4EA 2QADB 1S78D 1LP9F 4S1RL 3WO4B 2EE9A 2AVGA 4PJIE 3SY0A 3VFRB 4LVOC 4LB8A 4X83A 1VGEH 2X6UA 3ULUD 2CNZA 1M9WA 1IFHH 5HDBB 1E6JH 5IFHH 2FWOA 4U6YA 1O6SB 2NXYC 3QUZB 1LEKB 4QY8B 5E2TH 4A55A 1WO2A 4YL9A 3LS5L 5BZXA 1IVLA 3G5VA 4QO1A 4XPGH 1X3DA 4P9HL 4PQXA 3IKKA 2EIEA 2EYTB 2BSTB 2LVCA 1DO5A 3BWAB 3ZGIA 2VT0A 3OKDA 2EDLA 1EXUB 1XEUA 4TN9A 2D8KA 3CVBA 2YFNA 3BAYA 3L2NA 1FZJA 1Z3GL 1DL7H 3VMNA 3QCVH 1Z2KA 2QT6A 5JTWA 2NXZB 2BJML 2DYPA 5HPOA 4S11A 5E2WL 2MH4A 5DJDA 1C5DB 3HMWH 3GKWL 4Q9RH 2GFBA 4L48A 1TKWA 4XWGH 4Y19D 2Y1AA 4XVOA 4NENB 4U3CA 1OHZA 5AVVB 5G4NA 2Z4QA 5ETUA 1HH9A 1QA9A 2OS7A 3MNMA 3N44F 3A47A 3CHRA 3PWJB 4FQ2L 4HS3B 3C60C 4JBSA 4Q7DA 5H4ZA 1A2YB 3NJFA 2P42B 2BP0A 3FH8A 2Y25A 1UH3A 2IDFA 5AOLA 3IDXH 1QQDA 5LO7A 3WAJA 3ARYA 4E5XA 1AGCB 2ZYRA 2PPCA 4GAJL 3VGAB 4O02H 1SVCP 3BP6A 2MCMA 2AW2A 4DESA 4QXWA 3INOA 3QQDA 1MRCH 3VU1A 2J3SA 4KBPA 4KQ3H 2WBWB 4WI8A 2IJ0C 4NZRH 1E5CA 5DCCA 4G7VL 5LDUA 4HBQA 3RWIB 3F3HA 4CL7A 4KOBA 3TYFA 4LVHC 4JN2B 3G6JB 5GZND 2TSBA 3RY4A 1BMZA 2YKKA 3C09C 3DI2B 3F01A 3OJMB 3TJEL 4AI7A 4H8UA 1Z3RA 3GMPB 4K94L 4EI6B 4MWFB 2YZ8A 3UIZA 4G5AA 5JHLH 4J6RL 3HCVB 1QP1A 5CLYA 3VVVA 2R9HD 5LGHL 5I8KH 3BKCH 4ELMB 4ZUWA 2AJZA 5BO1L 2DQTH 1CDIA 5FO7A 4NBXB 1ULVA 4XCEA 5DHVA 3VB9A 4R4BB 4OLWL 2XNAA 4FZEL 4XGZB 1LE5B 4WLCA 5DDHB 4HX1A 1CR9L 4LHQB 3FO0L 2ATKB 4UYPA 4PLOB 1XAKA 2OZ4L 3AAZB 3LNHA 4JQVC 4M8UA 4WVRA 3CVDA 4E9QA 4IJ3C 2JSFA 2KMWA 1T7WA 1UG9A 2NDGA 3HHMA 4ZPVA 3V0JA 4FFVC 1RULH 5EUKB 3KM2A 2ERJC 1H15B 3T5WA 3LVTA 1HCFX 4WAFA 4U1HB 3ZZLA 4XVTH 4O02B 3R7RA 3ZE1E 3NSDA 3UAAA 2ICEC 4DVRH 3EYSL 2CUHA 1ORQA 3POCA 3RVVD 3F7LA 2ZF9A 1JXGA 1JFQH 2KC0A 2H2SD 4WO0A 4YHNA 5DZVA 5GIRA 2E74C 5EOCH 1JWSA 4L3ED 3TBBA 1OF2B 3HMXA 4FMKA 4DPBX 3BKJH 4I5BA 5CN3A 2G2RA 4QRPD 2QPSA 2IWKA 3BKYH 3LRMA 2J20A 3KLDA 4YFDB 3TBWA 1M6OA 2ZOKB 3CDZA 4U1LB 1MVYA 4Z77B 3GIZH 1QSVA 5KSBF 4H1LG 3CFBA 3JTTB 4U0RB 5CKGA 3X14B 4MLSA 5AZEH 4G6KH 1BLNB 3NSYA 4AQ1A 2XQ0A 3QIUA 2ZP8A 4BUQA 3MCKA 3NK3A 5ENWA 2WMPA 5C0AE 4Y5XA 1TQSA 1NBYB 1I82A 3LV3A 2JH2A 2VRAA 1KTJA 3K5RA 4MCZA 5DS1A 3LEYH 2AQQA 1K2DB 1OANA 4ZW7A 3W39A 5BZDA 3DRTA 5A2AA 2MTPA 5T1KA 1A1MA 1NAML 3X12B 4G8GE 5IROC 3AQYA 2C26A 5ITFA 3SHSA 3PDOA 3TVMA 2MQCA 2DQEH 4Z7UE 1MH5A 4RRPG 4QTIL 4GI8A 4J7RA 1A7OL 3WDIA 1E6OL 4ZS7L 3ZHDA 4OGQC 1WZKA 2JKIS 3O6KL 1TTGA 5I0WA 3ZE1F 2FO4B 2R2HA 4W9CC 1ZJAA 1NEUA 3D2UA 1MWAH 5CFHA 4JY6A 1Z9SA 3EYUH 1MJJB 2FNBA 1Q38A 5D2LA 4P3DA 4AVKA 1XCTA 4PR5A 1IGJA 4HIXL 5L6YL 5GGRB 1FFOA 4QGYA 3VXSE 3T0DA 3IMSA 3SE9L 4N20A 5IB2B 2V6HA 3EH2A 4G43A 5FK9A 3UBGA 4OJEH 4KNQA 4HISA 2WXLA 4OLXH 3VE0B 3V4LA 3F58L 2GJ6E 3AU0A 5FHBL 2A9CA 4MZ3A 5IMOA 1V5JA 2DQGL 3FQ2A 1U8LA 3Q2WA 1QUPA 2JB6A 3DOHA 4LHUB 3LQAL 1ZT4B 2YAMA 4DCQB 1BYOA 3P3TA 2V2WA 1UOLA 4D2NA 3HBGA 2X1QA 1PZBA 1RUPL 2NDFA 1TLKA 4HJUA 1U8JA 5CCKH 3I74A 3VXOB 1SVZA 3VXNB 1A6UL 3VCLA 3VFMA 4HJ0C 5GS1B 3GUTA 1IV8A 5T3ZE 2VE6A 3LSOB 3LKQB 2H47C 2ZG1A 4MQSB 3JT0A 1FNGA 5AENA 3DIFA 1J8HE 4Y2DA 1XF5B 3MGOA 2HFFB 1V3MA 3ET9F 1NAKH 1P9MA 5EIIG 3DDGA 5E51A 5E5LA 2VCOA 4NO2A 4ZNCD 1NCCH 4L4VA 2CA4A 4XCCL 3ZKMD 3WXWL 5C0GB 2BNQD 3SDCB 2JCCE 4JCWA 5HHXL 2EIZB 5DVOA 1ANUA 2C7UB 3MUUA 1WFJA 2J2ZA 4GSRA 5HHVL 2WO2B 3D3VD 2E7LC 1IQWH 1CTOA 4QUOA 1A7BA 2AJYL 2V7HA 2EEBA 2AK1H 1FL5A 4KRPB 4N6RB 2DEXX 4G8IB 1MHHB 5ID0B 3TA3D 5FO9B 5KBPA 3OBAA 4NCDA 3CDCA 4GQQA 3ZDXF 3VI4A 4DGVL 1WEJH 5IEHB 4MS8D 3T3PF 4CVZB 1D3CA 1XMEB 4LCIH 5EUOB 5C07D 3VI3E 3CVIH 2ZOTA 3A6CL 4YZFF 2DMBA 3GBML 3S96A 1DR9A 4JLRB 3DXAD 4U3SB 3GSNL 2BHUA 2ZKMX 1NEZG 2ZIDA 1JXFA 3TBYB 1GGTA 4H26B 1I3UA 4RVBA 4Q9CA 1ZGLP 2DN7A 2AJVL 5IW1A 2XT1B 3C5JA 4CMHB 2CR0A 3UZQB 1FNHA 3AW5A 5FO8B 2V5TA 2DWSA 5A2LH 5FB8A 4GP5B 2C9PA 1N0LB 3LZQA 3ME0B 5TDNA 3TM6A 1ACZA 4N1CA 3QNFA 1TDQA 3OZ9L 8CGTA 2VXQL 4P5RA 3S35X 1EAPB 4N2HA 3BQUA 1HQ4B 3JBG7 3B2XA 1TO4A 3LX9A 4NKOA 3L3OB 1U3ZA 4G80B 3TLRA 1MRDL 2L7JA 5KUKA 3EJZD 3HFFA 2NYZA 5E94B 1OGTA 5JO5B 2FX9H 5HGAA 3UPCA 2NX5E 3DROA 4HLJA 4OFYD 2JELL 1A6VL 1IFRA 4U1KB 1RHHB 3UEQA 2FUQA 1M7IB 3WJJC 4H8VA 1W9XA 2NUTA 4FZ8H 4NLHA 3M46A 3QPQD 3MYJA 3QXVA 4G6FD 4TMPA 4NQDE 4O9HL 5KS9F 3TBTA 4J4PC 5H37A 1A4JB 1RZKH 2IH1B 4OV6F 3V0IA 4ZFGL 2Y7LA 1XGPA 5GZOD 3QDJB 4LLMA 1KGXA 3EJJX 2PABA 1XTLA 1QRNA 1ZSHA 3GLDA 1NOAA 4NWUL 4S1SL 5D1ZC 4YUEH 4LP4A 2DQFA 3CFTA 3B2VH 4JX0A 1YPZB 3Q2VA 4GSQA 4JHZA 5DUPL 4WUUA 1IQDA 1YNTB 4EJ1C 1G7HB 2VMCA 3W9EA 1RUAL 4PG2A 5F0MB 4D94A 1SMAA 4D0CA 4WU7B 4K23H 1ZJBA 4LK4A 1G9NH 2VITA 2NUPB 1P5UC 2BS8A 5GRUH 4JRYB 3NZ8B 4NN5B 1ZTXL 1PYWB 4G6JH 1VKXA 1D5RA 1GGYA 4OZGB 4HCRA 2UZYA 5GGSY 2PR4H 3TO4C 3QHZH 4YK4B 4R5TA 2JFCA 3MA9L 4QRRB 5B39A 5T3XE 4OLZL 1WWWX 4U3HA 3GRWL 1WBZB 5E99L 4F3FB 2YPVL 3RGVB 1NCNA 4PJ9C 3L3KA 4Y1AD 3PWUA 4P06A 3P3RA 2RCSL 2GUOA 5DS2A 2QQKL 4GXUN 5C92A 3N6YA 3VDBA 1NC2B 1G6RL 4NFCA 3UTSA 1UWFA 2NXYD 3OKYA 4P3CL 4NQTA 5D7KD 1YAZA 1P4BH 2KT6A 2F54A 3KPSD 3JWDH 4H1LB 1EERB 1NCAH 2QSCL 1I7UA 3AWEA 4LVNC 2HFTA 5DVKA 3PDGA 1XV8A 1DUZA 1N9PA 4FLQA 5CCGE 2K4AA 2FRGP 3NK4A 3OZKA 1JI2A 4ZBJA 5GRJL 5I1LA 3LRGA 4N4YB 1QWNA 5EA0L 2A1WL 4P2OB 4WFEE 2B39A 3A67H 3S36H 4E9LA 2R0KL 3O6LL 4HVBA 4JFQB 5D8JH 3BAJA 4TLUA 3FO1A 4AM0A 1O9ZA 1BCIA 2D3LA 5IW6B 3O9WB 1TSHA 3PHOA 1BBJA 5CSBA 5LUMA 1C5CH 3MRCA 1K4DA 1NGWA 2BIMA 3HLAA 2EH7L 4HAFA 1LVEA 3O4OB 3QNXB 1EQWA 2FQGA 2FSEA 1PG7H 2G9HA 2VMDA 3BIKB 3MOBH 3U0WL 1UATA 2DKUA 3MRLA 3F05A 2DDQH 3C60D 5DUMH 3VXUB 3VXTB 4RISL 4TUUA 3SKMA 3AREC 1AGEA 3GRGA 1SM3H 2IGFL 3O4LB 1SYVA 2YKLL 4LLDB 4BINA 1DQQB 1G5AA 3SE4C 1BQLL 4MSWA 3QQ3A 1SJEA 5C0NC 4PCTA 4LPTA 4YBHA 2WC7A 2O93L 4NP9A 4XMKL 2HT3C 2ZX8A 1YNLH 1B4RA 3QUYA 1AHWA 3BCDA 3EZ8A 4PRAB 5DJCA 3ULSA 2UXVA 3WFDL 4Y4HB 4QNPE 4W9IC 1QRKA 1T1XA 3P0YH 4XCYB 3T3ME 2EVGA 3LMJH 4OVVA 1IEAB 3LIUA 1TNNA 2A6IB 2YGQA 3PJLA 4X7CC 5TE6H 4APQB 1FN4B 2K6WA 5JXED 3SDXB 3R8QA 1MJUL 1GSKA 5D71H 4GKSB 4UZGA 4NERA 3WMPA 4IEFB 4NNPH 3S37X 2IPUK 3QRGL 4NRYB 4HIPA 3B3IA 3Q0HA 1XF1A 1FNSL 2OTWA 2X4RB 3L5HA 1PZAA 3IJHB 4LLVA 4XVJH 2PYEE 5EIIB 3GM8A 3ARBC 4YE0A 3FUFA 1THAA 5DJ2A 4CVXA 3UTQA 2YA2A 4JKLA 1F3DH 4D9QE 4IRJA 5EF2A 3RE0A 4KJYA 1KELL 4ZMYA 4BFIB 3TV3H 2LLGA 5F9AC 1KIQA 4U7KA 3AC0A 4C4KT 5I82A 5ADOH 2R1YB 2HH0L 1NGPL 4P46C 3KYMA 5BOPA 3NABL 3SDYL 3K7UA 4GW5A 1T4KB 2BOCB 2HWZL 3D39B 4FERA 3CN2A 2Z4TA 5CZRA 1BPVA 4GRLB 5ACLA 2V37A 4OCRL 4GRWH 1OGAD 3Q13A 1J48A 2DBJA 5I8OH 3S35H 1H5BB 4ZFFA 5I6MA 1RAMA 5MEOA 1RPKA 5I5RA 4XBGB 3B1TA 3MZGB 4XO8A 1NLBH 4K8RC 2YD1A 1NEZB 4B3EA 5DWUH 3NG5A 3VA2C 3HPLA 3AY2A 3NCFB 4QHNA 4WY7L 4Z7WF 1EO5A 2JI2A 4QAMB 4QJ3B 1HNFA 2W80C 4JG1H 3IGAB 4BUGA 1XF2B 2EIMB 4MMZC 2VC2H 1L5GA 4XAKE 3IGFA 1DDHA 4H5SA 4UV4L 3T77A 4F8OA 3GBNH 5DD6A 4U6VH 5L0QB 1PBYA 3BFQG 4NFDA 4CMMB 2QZQA 3HZYA 4BQ8A 1KN2L 3O2DL 2D7QA 3CC5B 2P5EB 1ZVHA 4QF1B 4GQZA 4TNFA 3V2AR 3N43F 3MV8A 5DRNB 3RZWA 4WFGE 3Q8CA 3B7TA 4L4TE 5IROD 3IDYC 2X5PA 4MD0A 1UYWH 2OMUB 1UT9A 4ETQB 3K91A 1SXNA 2QHRH 2VR8A 3KDMA 4UQIM 5DEJA 3VWJC 5EBWA 1D5MA 4AGNA 4BD4A 3B9EA 4KNUA 2UXTA 3SPGA 2R7EB 4YNYA 2C1OA 3DMMB 1JGDA 5F21B 4K7PH 4C8XA 3OSVA 3E6FA 4I77H 1MXDA 3I6LD 4LF3A 5BV7C 1KIPB 1E4XL 4UT9H 4GRWB 4ACPA 4AENB 1MDAA 1NPUA 1YN6B 3T2NL 5KJ7E 2CJSA 5GS0C 1SY6H 3VMOA 2DKMA 4BWUA 4YC2C 1QSEE 3L3GA 3AACA 1IKFL 3ZTEA 3M7FB 4X6DA 4UMGA 4YOKA 5EO0A 2VDRL 2X42A 1HZHL 1MCDA 3I9PA 1JHTB 1E3FA 1T1ZA 2AK4B 3VXME 4Z9KB 4FQQA 2X6AA 2VZ3A 4NWTH 5FYKE 5B1KA 4AMKH 2A6DB 2VC2B 5AAWA 1TVBB 4UM8A 5IMMA 1GYCA 4GO8A 4U31A 2DQHH 3ARFC 3ARRA 2FE0A 2YD3A 4HGWB 5TPWL 3BPOC 3O3AB 4LAQH 5EDSA 3DLQR 2DH3A 4K3JL 2FQDA 5E08L 5F9WB 1OP5K 3ZL4L 1G7LB 1FP5A 3HAEG 3WLBB 2QMJA 3EYOB 2NY5L 4HJ0D 5EU5A 3BVVA 2F74B 5FYLD 2WXPA 3RY6C 3ZKXC 1MOEA 5AEAA 3R1GL 2ZICA 3HR5A 4DOHB 4FQPA 3U46A 1G7JA 4DEUA 2DH2A 1AZCA 2AI0L 3OKEB 1OZUA 4UV7H 3FU8A 1UA6L 3S5LB 1F4AA 1P7KB 3E3QC 4JJOA 3V52L 3WSQL 2KLRA 1Z5LA 1KENL 1J0KA 2ICWJ 3QFJD 1RIVL 2J88H 1AQ8A 2VQ1B 1MEXH 1T2XA 3F85A 4OI8A 1U33A 1V3JA 3OKOB 4DW2L 3EDDA 1E4XI 1F13A 3BRGC 4HJEA 5HI5D 4BM7A 5EU6A 2WBXA 2RQ8A 3FOLA 3BEVB 1I8MA 2EVFA 4NXSA 3BUYB 4I85A 3EOTH 32C2A 1JPFB 3QJQB 4JPKL 2XUWA 1TETL 2HFEA 4OBRA 4X6EB 4AQAA 2B5IB 4XBMA 3QR2A 2A73A 1GSMA 1JIBA 3D85B 4L8DA 3DO7B 3SKJL 4Q9QL 4HUVB 1LXMA 3CZKA 4X4ZA 3HS0A 3S88H 3PHAA 2BNRA 4UIKL 3QIBA 3BRDA 3HUJA 5L88H 5M7QA 4GMTL 3WN6A 4S0HA 4UDTB 1EH9A 1Q9KB 4G42B 5CP7A 1S6NA 2BRRH 4X0KA 2AXGB 1TZHA 3K2MC 3BYTA 3GO1H 2XQYA 5SWSA 4RGNB 3TL5A 5C7XH 2EUZA 2VQTA 1NDGB 2VDKH 4JCLA 3NA4A 2D7TH 1W0VB 4D9LL 5IOPA 2CBQA 1JMXA 3POHA 2Y7MA 4FFZH 4LRIA 2YGNA 4I3SH 2VH5L 3EJTA 4JQIH 5KAQF 4IBVA 3H9HB 4RBPH 3X1NA 2G5BB 1NFDF 2FEJA 4L4VE 1C16B 2EXWD 4S1DD 4G6ML 1H6EA 3B37A 3S37H 3KVQA 3FULA 4A37A 5GS2H 1PJ9A 5IG7A 3AS1A 5D2LF 1KTKE 1LO4L 1PW3A 1RK7A 3D08A 5F72S 5JDSA 1YDPB 2VLLB 1JK9A 4FNLL 3T6QC 2ZKWA 4G6AC 4OJFL 4RX4D 2EUXA 4XAWL 5HYIA 4ZD3L 1XX9C 5JIKA 1T5WA 2ESVD 4DKFL 1MCLA 1DFBH 2VXSL 3VI4E 4B60A 1KIUB 2ICWI 1BAFH 1C7SA 1JZ3A 4YBQC 5JIQA 1XIWC 2Y2YA 1H6UA 2Z8WC 2XFXB 3HG1E 4KZEL 3NFNA 4W9HC 3INUH 4HOWA 1JHKH 1EMTL 1AC6A 4CBPA 5I75B 1JDAA 1UCTA 3QZBA 1P84J 3KWUA 4J3SA 5SX4I 3FQWB 4JFSA 1A3RH 5IQ9B 1BYPA 4P4RB 3IGLA 2OAAA 3V4PB 3FQUA 5IJVB 2BY2A 3H7LA 4HDIB 2PPFA 4XC3L 3ETBF 5D1QC 5I6LA 3ZIMA 5C0FA 3EO1B 3U7WH 4BCXA 3TO4D 3TZVC 3DGCR 5EF0A 3SQRA 1UCBL 3MNWA 3R4RA 3BVXA 1N8ZB 4E2OA 3O11A 3TV8A 1PX8A 2O72A 3BDBA 4XNMA 5EORH 3L95A 4TVPE 4DAGH 4PJ9D 2K3TA 4XOEA 4HLZG 4ORGB 2ZXCA 3KH4A 1T7XA 5C0BA 5LWYH 2GITA 2P5WA 2BSBA 2G0LA 3ZE2E 1SOQA 3SPIA 4X99B 4Y5YB 2QADC 3BMVA 1PFOA 3SE3C 4MMYA 3U2SB 3WO4C 1Q0XL 5MENB 3QDGA 3ZZ1A 5A3IC 1Q94A 1B6DA 2OX5A 3VWKA 5F44A 2F61A 1T0MA 4HUXA 4MQ7B 1K5NA 1A22B 3BZFB 3QUZC 1L4IA 3FCTA 5D2NB 5IGXH 1BD2D 1UJTA 3JQOB 3BAWA 2WUBH 2QGCA 4FFTA 1QRNE 2XTJB 1RKRA 3SE8L 1DTUA 4J3TA 2WKOA 4NYLB 3ARTA 4NZ8A 1IBGH 5EZLB 3IU4L 3MNVA 1F97A 3M6DA 1LK3L 3HAEH 4RSYA 1ORSB 4EN3B 3PWVA 5HHPA 1QFWM 4X8GA 4WUUE 1U8PB 1R5VA 4QYOA 5JYLA 2XYBA 4M7JH 3QNYB 4BWWA 3PIQB 3IKCB 2HJKB 4IRSB 1B4TA 2WXNA 3TN0B 1EGJA 2XQBH 2KLSA 1MFUA 1HZKA 4GJTB 2GIMA 3B7UX 2OL3A 2K70A 5ACMA 4DNLA 1KCWA 4NQCE 4OF3A 3CFMA 4AGQA 2NXZC 2VR3A 3WEBA 4HK0A 3ZMNA 1DQML 1RHFA 4Z0BL 3SGKC 1KGWA 1JD7A 4MNGE 4JHWH 2PO6A 3O8XB 4TL5A 2N1KA 1TUPA 4RWYL 3ARED 4A04A 3VFUA 2QQQA 3VXPA 4ZFZB 2J6EL 4ZPTA 1KEGH 4TUOB 1Q9OA 5F0PB 5K39A 1KMGA 4MXWL 3P2BA 1KXHA 3S3PA 4LSSL 2IADA 3BZ4A 3UTSE 3RKPA 3P73B 4WKXA 1YY9C 1FPTH 5A7EA 1UD2A 2A0LC 5F7YC 3OHXB 2F54E 1XGTA 3L6FB 4H88L 3DO3A 2F5BL 4J3BA 3VGAC 4YIQA 5I16B 4CJ1A 4G8EA 4Z18A 2UWEF 1CG9A 2FBJH 3TESA 2AJUL 1W72L 3Q8AA 4KRLB 2OMWA 3MODL 1ZAGA 3AUVA 1P7QB 3EGSB 1UT2A 3EIFA 5IKCA 1NGYA 2JKJA 3BP7A 1DLHA 3L1GA 4NQSA 3HAEB 3RWCB 5IQ7H 4ZUSB 4FFYL 4PJFB 1VEMA 4H8QA 4XNUL 5FCUL 1SJHA 3WMQA 1E4WH 1DQDH 1A9BA 1WA1X 3T0EA 2CIKB 3X3FL 2GBUA 3CHOA 4JFFB 3ARBD 1I8IB 3K1DA 3MRJB 4PD4K 3UPAA 4JN1H 3UGXA 1T7VA 1HKLL 1NKOA 4Y9BA 4ZSOA 3VRIB 3BHBB 1TT6A 2YXVA 1EFXB 1IGTB 5F9JB 4M5SA 2NZIA 1RPUA 4N0FB 3LKSB 3ABLB 4M43L 2X4TB 3HZVA 3P9LA 4PRPB 4NUGH 3NCBB 5HYQB 4L9LA 5D6DA 4P46D 1H9VA 5F7UA 4PCYA 2CRIA 3QPXL 4HW6A 4JFED 3CDGA 3S48A 2RIKA 5E0QA 2TRYA 4EI5D 3UTZA 1CLZH 2F53B 1BG9A 3C6LD 3LN4B 1ES0B 2BLFA 1F4XL 2OJZL 5AW6B 5KYXA 6PAZA 3LRSB 3QJXA 1JF1B 2CG9X 2HVJA 2E7DA 3ESUF 2WWMC 2WVTA 3SBQA 5E6YA 1CL7H 1IIKA 4MX7B 2AS5M 1G1KA 4FQXB 4PJAA 1MG2C 3TWCH 5E9NA 1EHLL 1A7NH 5FECB 4TQHA 3FRUA 3QJSB 4DGYL 1T6WA 2JKRM 3IJSB 1XWVA 4FAAB 2J7LA 1OW0A 2H3NA 2WWKO 3MUGA 1QKZL 1L3NA 1N7MH 3OR7A 4NAQA 2WNGA 4J3UA 3MBWA 2J56A 2Y4SA 4NZFA 1D6VH 3B9AA 1YC8A 1RJZA 3LPOA 4AYGA 4ADIA 4M48H 4H8HA 1QR1A 4NP4L 1CF8L 3X1FA 3E38A 4U0RC 1F42A 4UWQB 1INDH 1ZK5A 2GB2A 4Q52A 4K4KA 5J56B 4J1UA 3LNGA 5HYJB 4PGBA 1FRGL 5I1GL 4RLDA 5E6SB 4P2QD 2SEBB 1T89A 5HDWA 2DWDA 1VFAA 1YC7A 3DBXB 1XGUB 4MNQB 7PCYA 3BSGA 3E9UA 4I48B 3VWJD 5EB9A 4ECNA 3QGVA 4Z3HA 2DQJL 1NCWL 3T0AA 4JVUA 3N41F 1L6ZA 5JIHA 1AXTL 4P2RA 2VIRA 2E27L 2ZZUT 4C83A 4ODVH 1M53A 2UUDK 1S7WB 2AAAA 3HI6L 1U8IA 2KQNA 2QFPA 2BHFA 5CUSH 2EDOA 5T1MB 1KGJA 1I7ZB 2VR7A 1HCVA 3B9KD 4UTAH 4BK4A 2DJ4A 3WFEH 3Q9QA 3G04A 3BAXA 1LP9B 1MI5A 4JFHE 1YECH 4PAZA 4XNXL 5JNYA 2P24B 1UZGA 5KTEH 4PJHE 1FO0L 3N2JA 1KY6A 1OD9A 3MCG1 1THCA 2WTOA 4GBXD 5DJAA 5AB0A 1N19A 1UC6A 4YH6A 1NCHA 3NUKA 3HA0A 1M05A 2ADJA 3BAIA 3GHBH 5CEXA 4MAYD 3MN8A 3L9YA 1AY1L 3EG9B 1NBCA 4FHJA 5C09E 3ARFD 5CJOL 4KK5D 4HSQA 1P5VA 3JWOL 3A6BH 1PU0A 5HYEA 5AOZA 3MV8E 4LLWB 5CGTA 3DECA 4OGYL 2VW4A 5CSGA 4S1QL 2X40A 3TCLB 5DT1H 4X4MA 5ICXA 1G1CA 1DBKH 2YPLE 1G9ML 1D9KB 3QAQA 1RZIA 2UX6A 1ZS2A 5F7LB 5EBMB 3X1GA 1VCAA 2VN7A 4LDCA 12E8L 4O2CB 5JA9A 1CE6B 5B21A 1MCQA 3K4DA 4JJ5A 5DD0H 3BWUF 5GS1C 3EDKA 1MHEB 4WTQA 3OXSB 3UPRB 2BFGA 5EHFA 3RWGA 1XCWA 3Q2CA 2CNYA 4GUOA 1EO8L 1YY8B 4N9OB 4C4UA 4TNVF 4G1MB 4UINL 4NUJB 1L0YA 4WI0A 4PLNC 3N44B 3N40F 5DHYB 4M8VA 3II1A 3LDBB 1KCVL 4JG0H 3SDCC 3V5DA 1J5OL 2L8AA 3R06B 2YGVA 3A6OA 2XZQL 4XCNB 3CU1A 3H42H 3MRHB 4JZOB 4HIHB 4X6DE 4AK1A 1M2VB 1OL0A 4BH7B 2EUWA 1LWHA 3SKNA 2F1AA 4KVNL 3PV7A 3WFZA 5CIPB 4HUWB 4M7KH 3N1QC 4KRPC 1NUDA 2VAJA 4LL9A 5BRZB 1KCKA 1F1AA 2Y24A 4JJHA 1SZNA 3SJVA 1TJXA 2W0LA 2AKRA 4JAMB 1N6QL 4HZLB 2ED7A 3QHFL 5GJSL 2B0SH 4AG4L 3KE0A 3ARUA 5AOJA 4BE6A 3BJ91 4W9LC 4PSPA 5AVWB 4H7VA 3QW9A 5ILTL 3TEXA 4N8UA 3P54A 3I9AA 5DHMC 4IDJL 4N5EC 3WN5A 5EC1B 4PS4L 5AQ0A 1ZLWK 3LIZL 4G1EA 1PF3A 1SNRA 2VL5A 1C8QA 4R26L 4U1SB 4CMHC 2VLRA 2X41A 1QBML 3KPRE 3CZSA 5E8PB 3S5ZA 5EEVA 4UBDC 5B1JA 1KYDA 2DYSB 4Q89A 4XMLH 2Y36H 3SDDB 1RUKL 3US9A 3TIDB 1VFBB 2HVBA 3L3OC 4G6AD 1ZA3B 4IIQA 1G6VK 2KS0A 3HPJB 3L3DA 4JZNA 5AAPA 3GPSA 3IS1X 2J8OA 3QXUA 3NFSH 2ZT9C 4WNQA 4WZ9A 3C08L 4K3GA 2ZSWB 5AVSB 2E47A 3IAPA 3APMA 1TXKA 2JTYA 1IB5A 1D5ZA 2KKQA 2FBOJ 2CE6A 1O7SA 4YBQD 4BUHA 4BZ1H 4DP6X 2QGEA 1XIWD 5GGTA 1F6FB 5BVPL 3DUUA 3LZFL 3X13B 5D6CA 5B3JF 3F7RA 2Q8BH 2BNRE 3U1SL 1FIGL 1NCIA 4KX9A 4Z8FH 3GXNA 4F58H 2WIMA 2WXQA 2PPAA 4N2NA 5B4MD 2W95A 1UQSA 3L5IA 1RJLA 5CZVL 3ATFA 1OIOA 5DZNA 5HPMB 5TH2B 2ORBL 2L7QA 1UOVA 3PNWA 4Y2OB 1AGDB 4HHAB 4O4YL 2Z93A 1FUNA 4L37B 1KBPA 3H1ZA 1IC7L 5KSBB 4OF5A 1NBZA 3KMDA 1AGBA 3LZLA 3B5HA 4EQ3A 4BFKA 1QFUL 3TZVD 1ZTXE 1FFPB 2QKIB 5E70A 3MZTA 3V0VA 4IOIA 1MHPH 1Q0YH 2GSGA 4NN5C 5GRWA 1H3UA 2OFQA 1HXYA 3D0LB 5AW0B 5IIEA 2V3FA 4PS3A 3RDTA 4YK4C 4X5RA 4HOZA 1YMHA 1F6AA 1A7PL 1WUZA 1YEFH 5CGMA 4OSUL 3NRFA 1MY7A 4Y4KD 3S9DB 3RGVC 3ZR5A 1BQ5A 1KEMH 3WU1A 3GNMH 5A3ID 3VD4A 3HFMH 3H4HA 3QJRB 4GW4B 5C3TA 2HVKA 4KJWC 2DJUA 4FXKB 5IWLC 1TZOA 1T4WA 3ZE1B 1ZSDA 3QUZD 5CEYA 2NYKA 4D3CH 4JUSA 3FCUB 3RWEB 3C5ZA 3DX9A 5TDOB 3MV9A 1KYUA 3N9GL 4CC4A 4F20A 4R7XA 1X5LA 1BFOA 4XMPL 2FJHB 3JVGC 4I18B 4OR1A 4G5ZH 3ZHNA 2Q9OA 3HUJF 4J3XA 4HIJA 5GXBB 1F8TL 3UH8A 2FEDC 1AIZA 5TGBB 1KLGA 4HK3J 1RZKC 1GGUA 3CSGA 1PDKB 3D48R 3UYPB 3W2DH 2R59A 1F4HA 4WWID 4TL4A 1JXDA 5I1EL 4P2OC 3GPEA 4LFHD 2DLFL 3VM5A 1SVBA 4ODTL 2HG5A 4M61A 3OPZH 4DKAA 1W0YT 1MFAH 1ZDQA 4J12A 1NIAA 2W38A 1YMMD 2NXZD 2R1XA 3L2MA 1NMBH 3O9WC 4NGHH 3G5YA 4X7SL 3QZWG 3MOQA 4DVBA 4ZMNA 4RGOH 4I13B 2A6JA 3ZTNL 3MBEB 4X5WB 2J4WL 2R39A 1L6XA 3MLSL 3BPNB 2ADIA 1ZGLM 3O4OC 4QWWC 2AJXH 3F6IA 2I60H 2ZX7A 1F90H 5K9OA 5C0BE 3WHXB 4CU6A 2P5WE 3RZCD 4TSBL 1UADC 1C12B 3AQXA 3CFEB 4G8GB 4HJJL 5T3ZH 2BP5M 5IUSA 4FNRA 1YY9D 2MMXA 1BZ7B 4LU5L 2JMRA 2WLLA 3QDGE 2WK2A 1OSZA 3JWNG 4B6ZA 3WEMA 4MA1B 3WGUB 3U83A 4DGIL 4PCKA 3BISA 1S3KH 3OLDA 3M88A 3A5VA 3MLYH 4KDVA 3UTTE 2BSSA 4HBCH 3LEVH 1KTLB 2OTUB 1O5DT 5E9DA 1K3ZA 4W4OC 3QYNA 2VDMB 5BW7C 3D9AH 4Y4HC 2CKBL 5F7BA 2X89D 1A6WL 1L9PA 1CGYA 3JV0A 5KVGE 4APQC 2JKNA 5GHWH 5IMKA 4AIOA 1GCYA 3DX3A 4PP1C 3ZDXB 1KFAL 2DM7A 3D50A 2BXYA 2X6MA 2Z9TA 3T3PB 1AHMA 4U1GB 2VXTL 3MFFB 5DO8A 1CXHA 3PG2A 5IFJA 1U3YA 4HEPA 1MHCB 2O61A 2R4RH 2DLGA 2Z7ZA 3BVUA 3GC3A 4W9GC 3MLTA 1I7TA 1UB6A 4Q0XH 5I6NA 1JYVA 5DMGC 2P7TA 2YFOA 2Q2LA 1OE2A 1VJSA 2PR9A 1MLCA 2CU9A 2H6OA 3NCYS 4YHLL 2PLTA 1MJ8L 1FNEB 2VWEE 3EW3B 2BPBA 5LXGH 4YPJA 4AYSA 1WE5A 3CSPA 1RMFL 4ZMZA 2H4EA 5GGSB 5JR1L 2ZP9A 2YA1A 2YOAA 1JWMA 4MJHA 5LQBL 4NC1C 1CD9B 5E8DH 2NY4B 2XY2A 2NY7L 2ZUSA 1B2WL 1RZ8B 4WEEA 1RUQH 5LN8A 1DBBL 3WGVB 1J8HB 1R0AH 3KL0A 4YHIA 1XDTT 2XRAL 4I1PA 2CUMA 2B1HH 5IVXA 1ZLVH 4KKBC 4I2XA 1KJ2B 4IQHA 2D7MA 3DURB 4F2ME 3EYQC 2YO3A 4GRLC 4R5XA 2WKOF 4AKOA 3L45A 2YBGA 3WTUA 4F7MA 1ZLDA 1H5BC 3ZKQD 5DA0B 2V8MA 3N04A 5E6IA 4YDKL 3FN0L 5F93C 3HOGA 5JORA 3OKMB 5I0DA 5E0FA 5D7LE 5ESQA 2M26A 2C4FT 3F2LA 5DJ6B 2A6KA 2X2YA 5DLMH 4M6ML 5KBMA 1GOFA 3OJVC 1DSWA 3ALXA 2A9ML 3WFHB 3T0EE 4EBQH 3FOMB 1BZDA 5AZ2H 2XG5A 3RNQB 1OAUL 5E95B 3ZVVA 4M6NL 3BVDB 4ZSOE 3AU1B 1HIML 4ESKA 5L0QC 2FR4A 1S8DA 2CLRB 3FQTA 3K6SA 1KV3A 1UM4H 3QRFM 4PBXA 1PEWA 1FH5L 1IGML 2IDCA 3GJFH 4PHXA 2IG2L 4MDJA 5H94A 3HZMA 3RTQA 1I7RB 2DYRB 2HXAA 1EX0A 1TJHL 3BEWB 3OB0K 4TUJB 4GKOA 5B22A 1QBLH 4AC4A 4PRBA 1FG2A 5C0JA 4OUUB 1DCLA 4HKBB 1RIHH 5I1JL 1R3KA 3DVNA 3MRGB 4NI6A 3RHWF 2IAMD 3VFVB 1PD1A 2Z91B 3SO5A 3LH2L 3IT8D 4MJIA 1DDTA 1ETJA 1S7VA 1UEYA 4GKNA 1A9EB 5E5MB 1PMYA 2ZKHL 5BS0E 2K8MA 3DMMC 1T1YA 3CVHA 3L1OL 2R0ZL 1CQYA 1KNOA 4S2SB 3N85L 3MGTA 4XXCC 2FX8H 5CR1A 3BSZH 1NOFA 3HZKA 3FFOA 2NX5B 4PWIA 2D31B 3A4DA 3L54A 1IBDA 1KJMA 3TPUB 1GC1L 1MRFH 1JNNL 4W6XB 3IVKA 1CGTA 1BQKA 4GIOA 1JXJA 4GS7B 4QRBA 4FXGA 3IDJB 4OW6A 1GYWA 1WD8A 2J5LB 1XH3B 3C6SB 4XCFH 4PB9L 1CDGA 4JFVA 1TPXB 4V11A 1AKPA 3D69B 5GPRA 4LHUD 5DZLA 1C08A 1IAIM 1WLHA 3MC0A 4G83A 1JZ4A 5D1XE 3CSTA 2VGLM 1HWGB 5J6GA 1RP8A 3BFWA 1MDTA 1M9SA 3FSAA 3FU7B 3K2UH 4IKKA 2WXJA 4QRQA 5DD5L 2I7OA 4I9WD 5F9WC 5AW3B 1NTDA 2IPTL 2FJGA 1OPGL 2APXA 1OARH 2ODIA 2BS9A 1XTMA 3EYFA 3ARGA 3U9PL 3CX5J 2RR3A 1T1WA 5AALA 4OZFH 3EOAA 3RAJH 3EGDB 3VXRE 4P2RE 4XP1L 2CIIB 5AW1B 4ZDHB 1IMHC 1M71A 2FJSA 1S5IL 4QXGL 4AZUA 4I0PA 5LBSA 4JFZH 1I85A 5DS8B 2QQNL 3SDAB 2EYRA 3SBWA 3VG0L 3V6BR 2CRZA 5DI8B 3VD9A 2ZSVB 3SDCD 3ZL2A 3BH8A 4PJAF 4U2ZA 5L2KE 1MI5E 1QBBA 1AP2A 5GGUB 3U36B 4A7UA 1ED3A 2EKJA 4H8PA 5D7SL 2UYLB 4Z7VE 5F9OL 5DD1L 4P59H 3QQ4B 1X5MA 4P9MH 5KAQG 1CFNB 3RWFA 4PJGE 4Y4FB 1CU4H 1JGLL 3V6ZB 4YJZL 3RRQA 1WZ1L 1FJ1A 1X4YA 2B5IC 3M1BB 2R69H 4LCCB 3HC2A 3MU3A 2XWEA 5D7JB 1ZLWH 3SCMA 1DN2A 3OJDB 4ONOA 2HT4C 1NANH 3QZWB 3U30B 1HHJA 3MRIA 3QORB 4Z76B 4GKZB 3SN6N 4GKLA 3U82B 2NNAA 2XWRA 3JTBA 4F8LA 1ZS8A 4N5ED 4GINA 4NC0B 4X4ME 2WXKA 1OP3H 1WUNT 2R56L 3LQZA 4KNSA 3AY4A 3KPQA 5J5EA 2V8LA 3O6FB 2DQDL 1TZGH 4E9TA 1S3RA 5H2BB 3ULVD 1BBDL 5A16A 5IZ7A 4PU2A 4RGNC 1E4KA 2CO6A 1OB1A 3DUSA 3MJ8B 2VR6A 3APCA 3T65A 4HT1L 3ZHFA 5IT2L 2Q8AL 1Y07A 4LLUB 4DQOH 1SDDB 4OD1L 4KXBA 5FOBB 1KB5B 2JJSA 4HU2A 2AQTA 4IBSA 3LPPA 1ASPA 3B9DA 3GLEA 4XXWC 2IWFA 1S7UB 4JO8A 3NJNA 3NBNA 4PJ5E 4CDHA 1UM6H 1N3NA 3MRPA 3SY0B 2I69A 3P9MA 2KZ1B 1GJIA 2W65A 3QWQB 4PWKA 2YRZA 3N1GC 1YNKH 5GSVA 2EEXA 3V6OE 2C9UA 2FWOB 2WXHA 3SJVE 5C6TH 4P57A 3U4AA 2FJFA 1W8EA 4V1DE 4NZTL 4KWUA 1UACH 3TT1L 1UD6A 1ERNA 3G5VB 4QO1B 1U58A 4QMEA 4DSYA 5I24A 4JHAL 3NRQA 3UTPD 1XMWA 1YCSA 4NT6A 1TYJA 1FH2A 3OKDB 3P2DA 3QDJD 2BSED 4FQ1H 3T3MB 4U1JA 3TEUA 2DEWX 2OR7A 3NSFA 3KLAA 4KI5C 4QXTB 1TF4A 3HBZA 5I75C 2PF6A 2ZXAA 3QUML 4N2DA 4YWGH 4Z7WB 3SPHA 2ZWYA 3SBPA 3G5ZB 1NOLA 4Y19A 2IBBA 2VLRE 1UA3A 1CLCA 2DMHA 2O6CA 5IK3A 4EOWH 4X80L 2DYPB 2ZONA 2Y23A 5FUCC 5DHVH 5DJDB 3RFZA 2CALA 2H45A 3MRFA 3L17A 2GFBB 1TKWB 3FU0A 4ORZC 2MNWA 2ARWA 1UZ6F 4NC2B 5KJRL 2Z4QB 1L9MA 5ALCH 1HH9B 3QVAA 3UBXA 2CDGA 1CBVH 1GS8A 4GT7A 2X38A 2HRPH 3MYZA 4QRRD 3ROLA 4WWKA 5ADPH 3RURA 2BP0B 5FDWA 4JPVH 3DKHA 3PREA 2M83A 4B50A 1QQDB 3RGVD 2R1WB 4GLRH 3Q8BA 1QI3A 4C55A 2ZG3A 3LNDA 3B8YA 3DHMA 5F3BA 3BP6B 1FYTE 1NC2D 4Y5YC 4KJWD 2NZ9D 4YGAB 1PKOA 3QQDB 3NACH 5B1AB 5GZNA 3VFNB 3H8NA 5I1HL 1RZJH 2BK8A 4F33A 2X1PA 2MTAA 2XACC 4JE0A 5IV2A 3ROOA 1CFTA 4YPGA 3TBSA 4EZMA 5D2NC 1QNZH 1QFWI 3TYFB 3HMXH 4ABQA 4WW2A 4O5LL 4J3OH 1RD6A 2XTJC 3J27A 2YD9A 4P2OD 4TNVK 3FTXA 2O6FA 3CPLA 5EEUA 3KR3L 2VDQB 1GYAA 1R3LA 4EN3C 2HTKC 2HSIA 5FYKH 2Y1VA 1TTAA 2AJZB 3O9WD 3QEQA 4ZUWB 1VA9A 2Z31D 3AMLA 4IRSC 1YEGH 1P0SE 4LNRA 3TN0C 2QR0A 5FO7B 3GHEL 1JRHL 4XCEB 5SWZE 3ETTA 5DHVB 3OKNB 3WS3A 3FO9A 4F9LA 1A3ZA 1NKGA 3DX6A 2EEDA 3GMLA 3FH7A 4QWWD 4HX1B 1ADQH 4H0GA 2FNWA 4MVBC 2WQUA 3O0LA 1LNUB 4I89A 1KYOJ 4LP5A 3O8XC 2LVEA 4ZPVB 2R51A 4OCLC 1GY2A 4PGZA 5J3HC 1E2VA 3O4LD 1D5BB 2PMZA 4O51B 2PPDA 3C8KA 3IMRA 3OX8B 4JKPH 3D7PA 3MCLH 2FLRT 2J5WA 1HXMA 1ORQB 3MV9E 3V8CA 2WGNB 1ZDSA 3QDHA 3OHXC 3GYRA 3PE9A 3SGDI 4AJWA 4LKXB 4UT6L 3MX0A 1S9YB 4QRPA 3G6AA 5I9QB 5F1NB 2F7RA 4YHNB 1Z0MA 4Y4HD 2CK0H 5GIRB 4FL4B 5E6UB 4A2GA 4FA7B 4GFXA 1ZHBA 3HI5H 3CPUA 1NL0H 4YHPA 3RI5F 1JWSB 1QSED 1EXGA 2WB1A 3LEXA 5FHAL 4AQ8A 4R90L 4APQD 4ZODA 3LKNA 4K07A 2G2RB 1MAKA 3KPPB 1MQKL 3LAFA 3LZNA 4PP1D 4RGMB 1M6OB 5HVHB 4QXUH 5LG1A 7TAAA 3HN3A 3KEDA 3WDHA 3CFBB 2NW3A 4PWHA 2E6QA 2OK0H 4N0YL 3I84A 2N4IA 4AQ1B 2Q76B 3T6XA 5DMGD 3MCKB 1JRHI 1Q9WA 2WMPB 4HXBL 4E9SA 4Y5XB 3UJJL 1IKNC 3LV3B 1T6BX 5C1MB 3ORJA 1BMGA 1SGKA 4J39A 3DRTB 2CO3A 5T1KB 3NZHL 4XMUA 1N6VA 1RZPA 2CO1A 5ITFB 1S7RA 3PDOB 3TVMB 2XWTA 3VAEA 1BM7A 1MH5B 3RUGE 4Z7NF 4HH9B 3HZ3A 4AT6A 1FAIH 3PFUA 3ARXA 4FLOA 5DEFA 4DP2X 2R2HB 5EOQL 1EHKB 4KKBD 4R97B 1NFDB 5C2BL 3F7PC 2FHBA 3D2UB 3D39D 3D4YA 2XICA 4JY6B 1Z9SB 3EYQD 1U8MA 4GRLD 2ZJSL 5D2LB 1DBJL 4P3DB 3SQBB 4FQCL 2XHNA 3L16A 3F5WA 4K9JA 3IU3A 4XP5L 1JN6A 4PR5B 1MNUL 4N2LA 3BE1L 3CZLA 1IGJB 4KX8A 3PV6A 3UMNA 1FFOB 4NPYA 2I85A 2PNDA 4P5SA 1LDPH 2Z65C 3FN9A 5D4QA 4FQXC 4G43B 2X4OB 3BAEH 1OE3A 3TYGH 1HQRA 4AEIL 2IANB 3KYNA 3K5SA 1GIGH 4CSPA 1W15A 1CK0H 2ZYSA 5IMOB 3KXFA 1U8LB 2PXYB 2EIKB 5FXCH 4R6UA 4FN0A 4ZMWA 4ZO7A 4P4KD 4FQIL 4BELD 4TQ8A 3D6GA 1P4IL 4XN1A 2V9UA 3OB0H 2BHYA 4QAWA 1PIFA 2A4ZA 1QAWA 1U8JB 1J8KA 2P5ED 8FABA 2Q2EB 4OCYL 4GEJA 4WCYH 4LGRB 5HDQH 2MOGA 2B4CH 3FAXA 3VCLB 3VFMB 1JCKA 1Z0NA 2BNQA 2VE6B 2YSSA 4XX5A 2JB5L 4Y7MA 3Q6GL 2AEQH 2WOBA 3I9IA 2O5YL 3DIFB 1XHHA 3MGOB 4DQAA 1QO3A 1HU8A 2GJZA 1HOCA 3QJVB 3L7FA 5DQDH 5IVXE 4QRTA 4DP9X 3QEUA 4L4VB 2HJLA 3WY2A 4L8SA 3DMMD 4WTXA 3T8MA 1XB3A 4XP6H 3TA3A 4TVPH 1JDCA 3CHQA 3KNBA 2J2ZB 1JMZA 2IQ9L 3O3UN 3LRKA 1DJIA 2AFNA 1FL5B 5C07A 4ZYKA 3FT0A 3B2MA 3X11B 3FU5A 5FYJL 4UILH 4TOYH 4WQOA 2Q86B 3BYYA 1BVNT 4NHCL 5H37H 1ZV2A 3HR6A 3DXAA 4LCVA 5AD0A 1A1OA 3CFCL 4MMXB 3GMRA 1N64L 4N85A 4L1BA 4B9IA 3HG1D 1E8YA 3QO1A 3VGBA 3MLVL 3EHBB 1MW3A 2X3AA 3LN5B 3S96B 2VZOA 4MA8H 1AIFA 3ZSSA 1RSFA 3N06B 1PZDA 2VXVL 3HI1A 2PW2A 2W0FA 2JKTM 2CGRL 3AGVA 1DQJA 5IW1B 3U25A 2JIXA 3C5JB 3FO2A 5DXWA 3IEAA 3DVGA 4K5LA 5FB8B 1E8XA 3PL6A 3FMGH 3OR6A 4LQFL 1U8KB 2BJMH 1TCMA 3ASOB 5TDNB 1D9KC 4OJYA 5A6LA 2XBTA 4A68A 3GKWH 2JQZA 3BQUB 4XPHL 4MJIE 4QXVA 2V2XA 1NSNH 4NKOB 3U2JA 2UVEA 4PJCA 4KQ4L 2AXHA 2J55A 4OFYA 1IGFH 4KJQC 4P49A 3PJSA 1SN0A 4J8QA 4AEHL 5I15L 3HVNA 4FQ2H 3F6JA 3D51A 1E50A 2G4EA 4QGTA 4UTBL 5HGAB 5ACZA 1K6QH 3DOSA 3DROB 4TSAL 1BWMA 3GWJA 2MQ0A 1T0OA 3GXPA 1J5DA 2BVPB 3LDBC 4KKLC 2EDDA 4GAJH 5GZOA 1WPCA 2BMKA 1JGIA 1OQOA 4FNUA 4OZIE 1R24A 3BN9C 3EH5B 3PY9A 1F11B 3MYJB 3CBRA 2WM0A 1QLEB 3TBTB 2EE3A 4DZBA 1Y18A 3D85D 2GBTA 1KZQA 2HT4D 3U4BL 1XGPB 1AQKL 1HWHB 4LLMB 1ZANL 5ADPL 1DBAL 4G7VH 3SGEI 1QRNB 4OFDA 2TSAA 3GS4A 2N0MA 1V55B 3VFTB 2DQFB 3MV7B 4AJYV 4B53A 3V0DA 2XSKA 4JVWA 4K94H 2NY1B 1QI4A 2XWJB 4J6RH 4WUUB 2K7QA 1IQDB 3FT3B 3QUMA 4RGND 1DQTA 4MJ6B 3W9EB 5IBLC 5LGHH 1FWXA 5G4OA 4D0CB 3DYPA 5BO1H 1DZBA 1UJ3A 2VITB 1GW0A 4D7BA 3HHRB 4Y1AA 4HJTA 4OLWH 4CN1A 4I7ZC 4E0RA 1URZA 2UZYB 4APXA 2ITCA 3WKNA 1CR9H 2WJ5A 5JA8B 5B39B 1MXGA 1SXAA 2OZ4H 2XBZA 2F1BA 1LM8V 3U4EA 4Z6AT 4XZ4A 4N28A 3L3KB 3SDDC 5I1KH 3PWUB 3KPSA 4GI6A 4MASA 1OV8A 1DVXA 1WAPA 2GUOB 4KDTA 3SY6A 3ZDYE 1QG3A 3UTSB 3QUKA 4M7ZB 1A4KA 1KY7A 3L8QA 4WWNA 3V0WL 1KN4H 3EYSH 1A6ZA 3BDXA 1I7UB 4YSAA 3ESMA 3AUWB 5F7EL 1WAAA 3RVUC 2ZOOA 1XB6A 1J05A 2R83A 5BUAA 2LT9A 1SHWA 3RHWK 4HG4K 1N0XL 2DL2A 4KFZC 4H20L 4KI5D 4PJ7F 1BOGA 2P4AB 3WTWA 4X9GA 4OFKA 3KWWA 1IUZA 4B27A 2WO3B 1HNYA 3MLRL 4KXZI 3FO1B 2C3VB 4AM0B 4Z1PA 1MQ8A 2MKLC 3ZDWA 1EXHA 4L4JA 3PHOB 4PHZA 1F1DA 1V7ML 3MRCB 4Z3FA 1K4DB 1NGWB 2J1KA 3KW8A 4F9PC 1VSCA 4OIFA 5GS3A 3HLAB 5LG6A 4HD9A 1G9HA 4JR9L 3L5WA 1AZBA 1BW8A 1E42A 2ZUWA 2FSEB 5AVTB 2G9HB 4HFUH 3MRLB 3NVQA 1AZZC 1PAMA 3QG6A 2QKIC 2AF2A 3PUCA 4K3EH 3SKMB 4ISVB 1K8DA 4POZD 3RIFF 1SYVB 4WTZA 3OXRA 3SPVA 5BJTA 2XJLA 4MSWB 4QTIH 2MPAH 1A7OH 2C3XA 4AWJC 3B83A 4ZS7H 5HHMD 1SOSA 5D1ZI 1I9RH 3JYCA 5JXEA 2LU4A 1DEEA 3OPUA 3NCJL 3QUYB 4EQ2A 5CLTA 2MQGA 5DJCB 3ULSB 1QPKA 2FGZA 4FXKC 1T1XB 3H0TA 1NJ9A 2DWYA 4U33A 3H2WA 4HIXH 2AMUA 5L6YH 2BVEA 1MREL 4PJ8D 4R4FL 2XTJD 2XX0A 4I18C 5D4HA 3SE9H 1X5KA 1AYRA 4R3SA 1JZHA 5SV3A 2PCFA 3ARSA 2D3JA 4Y19E 4KZ0A 4G9FA 5FGSA 2NRDA 4EN3D 1I1FA 2UXFA 4HD5A 4MDIA 3F58H 4Z7OF 2NLJA 3H9SA 4MKTA 1AE6L 4IRSD 3B3IB 3CLFL 3IFOA 3QR0A 1JZGA 4ONFL 2JKWA 1CJYA 4LLVB 2HX8A 1HH6A 4Y5VA 3VRLE 2LHAA 4GAYA 5G55A 3TF4A 4CVXB 5DJ2B 3ULUF 3B4NA 3UTQB 4MXQC 2HLAB 1Q8MA 4MVBD 1CDUA 4PSRA 5TF1L 4BK8A 2N7AA 3IDMB 4KJYB 1JYWA 3MBEC 4PGJA 4PJDE 1Z7JA 5IVZB 3O8XD 3BPNC 3L9RA 2V9RA 2FWLB 1A6UH 1KIQB 1BF2A 3LOWA 5GJTL 4CGTA 1L9OA 1OGAA 4LL1A 2E76C 3KYMB 5J3HD 1RZFH 4OZHF 2OCFD 5INCA 4M6OL 3GSUB 5A2CA 3N42F 3CFKA 4KRNA 3TFBA 3BUPA 4ZTPL 4M5TA 4YLBA 4XCCH 3C75A 4MA1C 1BXAA 2QSTA 3AITA 2IEPA 2FK9A 3KPOA 4A38A 5MEOB 4FYTA 5DC2A 2XA8L 5HHVH 3KCWA 4FXLA 3G08A 1EIBA 1NDMA 5DQ9A 3SQOL 5T5FL 5DJZB 1E90A 4HS6A 5DEZA 2I5YL 3HPLB 2Q5BA 2W92A 4EDXA 3DSFL 1YEIL 3WKML 2NSQA 2Y07H 1GZHC 3FNKA 4DGVH 3GIVB 5E5RB 3BT2L 4PRNA 1L5GB 1XO8A 3W3BA 4H5SB 1DDHB 1YYML 3T77B 5AW8B 2ZXBA 4X7TA 5DD6B 1PKQA 3QDMB 1HSAA 3A6CH 3GINA 5C09D 3FUNA 3HZYB 2NY3B 3GBMH 3KBHE 3L5JA 4U1GC 3EJSA 3VYNA 4PGCA 4F57L 4LSUH 4PRID 2P28B 2OKMA 5AW4B 3MV8B 2AJVH 1J11A 3T08A 4HWEH 5BPPA 4XC1L 1EFXD 1AXSA 3QJFA 5F96L 4MD0B 4N2AA 1R34A 5D7IA 3TONA 3KDMB 1VCBC 1NLDL 1IT9L 5EBWB 1OD7A 1JPTL 3OZ9H 1QZNA 5KVDE 3TASA 4K8RL 3GEFA 3PWPE 4IBWA 3G6JF 2D3NA 2BFVH 3WAKA 4YNYB 2C1OB 2EE6A 2NY4C 1JGDB 2YRBA 4L3EE 1U4FA 5I6XB 2DY2A 4P99A 1MRDH 3E6FB 4LF3B 4QRPE 3FB7B 4UQ2A 25C8L 3F65A 3UMTA 1DJGA 2H6UA 3IK2A 3DV4B 1MZYA 4WW2F 1YHPA 5GGVH 2OTPA 5I66A 5TFSH 2A5UA 3L3GB 4B5EA 2ZWLT 2JELH 1A6VH 4FQXD 2GK0A 4NBYB 4EI0A 3NCCB 1L0XA 3MRRA 4FCHA 5FUOL 4ZOCA 5KVEL 1S5HB 1T1ZB 3RKDD 4N0RA 1IAIL 2O5ZH 5LGKA 3GSQB 4L9DA 3ZDZE 1JNJA 1E5ZA 3UIYA 4A2EA 1IC1A 3VFPA 4UM8B 4J2QA 5IMMB 3QUXA 3TEWA 1YG9A 3E80A 1MIEH 4OV5A 2WO4A 5ECJE 5EEXA 3W0WD 4K73A 3TBVA 4PG9A 3GI8L 4V2CB 4TPRH 3SE6A 2QVTA 5BV7L 3AXLA 4BDVB 1WFUA 2E86A 2K0RA 2ZKYA 1EAOA 4MRBA 5DUPH 5JQ6L 1N5YL 1SBBA 5EU5B 3QFJA 1HXKA 1FHNA 5JOFA 1RUAH 5GS0L 2VXUL 3ALWA 3DPBA 4XH2A 3HR5B 1CD1B 2YPKA 3H54A 3U46B 1G7JB 3ATBA 3GS7A 4EF3A 3ES6A 4PM1A 1X5AA 5C3LD 1AANA 1ZTXH 1RLWA 1JK8A 4UI2A 5I26A 1JV2B 3ZPDA 5DURB 1NMAL 1CURA 1RL1A 1SOXA 3MA9H 2JV6A 15C8H 1QEWB 4OLZH 4WI9A 3WKPA 4HZ1A 3IJ9A 1SXCA 1I9JL 3H9ZA 3V55A 5EU6B 3RYMA 5FO2A 5C9JB 3MFGB 5LB1A 4EDWL 3FOLB 2QQKH 3BAKA 1E2ZA 3EFDL 4LNVA 2APVA 32C2B 2FLBT 1A5FH 3EO0B 3AT8A 2HFEB 4P3CH 1FNFA 5KBKA 3RVWC 3QWNA 4QOKE 5CWSA 1BREA 4OCMC 1RI8A 2QSCH 3EDFA 3CQQA 1IAII 4GS7C 4XTRD 4K9EH 2J5LC 4LARL 3M86A 3QR1A 3W11D 5CEZD 3W81A 1TPXC 3ISYA 5DRWB 5FIEA 3FB5B 3TJHC 3LH8A 3QIBB 2WYHA 3HUJB 4KAQL 2APFA 2DLEA 5EA0H 2A1WH 3NTCH 5ISZB 1MW2A 2GHZA 1QFPA 2R0KH 3O6LH 4HS8L 1M1XA 1TZHB 4FLHA 4X0KB 5CLXA 5SWSB 3DJRA 2WLHA 4LSQL 4FLRA 4NQUA 1UFGA 2BNQE 4OF6A 1HHGA 2MKWA 1D9KD 1IGIL 1KTRL 2W88A 3L3JA 1AKJB 1AS8A 3NCMA 5CZXC 3RI5K 5IMLA 3D3VE 3ILQC 3UAJA 1AFVH 4YVNA 2EH7H 2QEJA 4RX4A 5K9JL 2OJEA 5IG7B 2J6WA 2NCEA 2ESVA 5JDSB 1R47A 3H3BC 1AGFB 3QJOA 5FC9A 4LEXH 3AZUA 4RISH 1LMIA 1JK9B 3SDAC 3T8VA 3ZIYA 5I8EA 3P4NA 2IGFH 1EZVX 3PHQB 5DFTA 2X44D 2EDTA 2YKLH 5C07E 3MRQA 4KKLD 5T33H 1J86A 3I2CL 2VDPH 4FRWA 3J07A 5KYNA 5B1CA 2OW6A 4Z23A 5ALBH 3DXAE 3LXAA 5BRZD 4N8PA 1E8ZA 1UZ8A 4M7LL 3T2OA 2PCPA 4Y4FC 4ZO8A 2FHFA 3NFNB 3JV6A 3AG1B 1F4YL 3APNA 5AYUH 2EXYC 4LCCC 2BSDA 4BFFA 1LK2A 3BN3B 5ABAA 1O0VA 5D7JC 4ELDA 1JYXA 1Q4NX 3U30C 5KVGH 3B1UA 2L0DA 3WFBL 1MJUH 3GSRA 4FFZA 4F37F 3ZTJH 1HHIA 3QORC 4X0NA 1X9QA 3ZXAC 3NPZB 5JIPA 3FQUB 2PETA 3RPIA 4WSGA 2OL3H 3GXIA 3OQ3B 3QRGH 4CN6A 3O6FC 4OJDH 2DLTA 5C0FB 2EAEA 5ICYA 2GABA 4PJ9A 1IJNA 2JQMA 1YUKB 4YFEA 4R2GB 2FD6H 3MBXL 4PJCE 2AJSL 4QHKJ 4RDQF 1SBSL 3JWNC 1PLBA 3VTMA 1U3HC 3MNWB 1CTMA 2DL9A 3C6EA 3O11B 4E36A 1KELH 3L95B 3HNVL 3UZEA 4LPUA 4ZUTA 5F6IB 2NT1A 4NKQB 1ID2A 4F27A 4Q56A 3PXLA 2P5WB 2HH0H 2AJ3A 1CE1H 5CHNA 3NABH 2EO7A 3TO2A 2HFGL 4KKZA 4JANA 4MMYB 3UG5A 5B38A 2EH8L 1DSYA 3MPCA 2VDPB 3QDGB 1Q94B 1WAEA 1XT5A 3NIDE 1XEDA 2OX5B 2WGXA 3ZQXA 5IHZA 1T0MB 2WQ8A 4HUXB 3ECUA 5IF0A 2VUKA 3W9DA 2ZNXA 4K2UL 3FCTB 2WCPA 3G6DH 3RVUD 1MVFA 3APFA 4E9WA 2HG0A 5I73B 1AQDA 4WUKH 2Q7YB 3H4FA 1JGEA 1I3VA 3RGHA 1TTRA 2EIJB 3MNVB 1LQSR 2YD2A 4CAGA 2WPGA 3BKML 1GS7A 5F3FA 3EDJA 4RMUA 5I5MA 1A47A 2AQRA 5CF3A 3PWVB 4WY7H 2NNRA 5JHBA 1R5VB 4QYOB 3IAQA 2APTA 3RL2A 4YQXL 5IB4A 5I6OA 1JTPA 1L9QA 4A7GA 2CBMA 3WJMA 4PJEA 1ZHKB 4PCSA 2YJQA 2OL3B 5C0EA 4YE4H 1URLA 1A7QL 1AC0A 3S2CA 4Y1AE 3WUWA 3EXJA 1MPAL 2ADYA 1IAKA 2FCBA 4HK0B 3FTYA 3F62A 4DUXA 3BGMA 4HZAA 3O2DH 1Y6KR 1Q9LA 4DKTA 3RNKB 2ZAHA 4JFXA 4X9HA 4ZAKB 2PO6B 4YFLI 5D7KE 1BM3L 4OT1L 5JDJA 1OCZB 2O30A 4WHYG 2HRLA 3VFUB 3VXPB 3ZSTA 4GG6A 3KPSE 4ZPTB 2ISDA 3VW3L 5K39B 5H35A 3FF7A 1N67A 1BQSA 2VLJA 1IKOP 3F7VA 2IADB 2JJVA 3BZ4B 3RX5A 2OR9H 4BFGA 3GSOA 3K0YA 2WOYA 3QA3B 4QHKI 4HPYL 1XGTB 4FE9A 5A40E 3ZL1A 4YIQB 3Q2LA 3IYLW 3VD3A 3FHEA 1WAAE 1E4XH 1CG9B 1D7CA 2AV1B 5KZCB 1E9PA 1JZJA 2WBJD 1RK1B 1XZ0A 4RZCB 3OWRA 4JY4A 3H6AA 2HT2C 3RG1C 1CT8A 3DDFA 2OMWB 2HPTA 2OYLA 5IKCB 3HJEA 5EU4A 1NGYB 4FQHA 3WNMA 3BP7B 4N1HB 5IFAH 1DLHB 4NQVA 1REIA 1JGUH 4A2FA 4RFNB 2N3JA 4H8WC 1AD0A 3W5MA 1P1ZA 4LGPB 4PB0L 4PGDA 4W6YB 5EV7A 4EE2A 1SJHB 1B0RA 5HHOE 3BO8B 2R8SL 2H8PA 4TSCL 3NOIA 1LE9A 4JO2L 1A9BB 1XFPA 3S8GB 1KCRL 4EO5A 3MJWA 3T0EB 2NQ3A 3KHOA 1HOEA 3AS0A 4P46A 3T1FA 4XHJD 5BCAA 2J44A 4ZSOB 5F2FA 2NSMA 4JFEA 2VLKD 5E08H 1BG1A 1RUMH 5KSVB 4Y9FA 4I0KA 4EI5A 2NNFA 4LMQI 3C6LA 3HZVB 2NY5H 3P9LB 1XH0A 4PJXE 4TUKH 4L9LB 4ES9A 2IALA 1GYUA 3CFJB 5E2TL 1FC1A 2K6YA 3WTSA 3R1GH 1N59A 3CDGB 2V3EA 3UTZB 1T0NA 5FWRA 3V52H 1ZT7A 5E2UL 1KENH 4KKPA 3UYRH 5E8NA 1RIVH 3QS2A 4H2AA 3KBFA 5KYXB 1UXSA 2HVJB 3S4SA 3IBOA 4JFTA 5BMFL 3BUDA 5EDXA 4N2MA 2JLPA 4PJAB 5GQBA 3V7AG 1DL7L 8PAZA 3QCVL 5I9QC 1RZJC 4ELKA 3ELAT 1QTYT 1A4BA 4FL4C 4YBLB 4FG2A 1RJYA 1TETH 3BVNA 3NJLA 1YEWA 3SGJA 4EKJA 3P4MA 3KHQA 2A38A 4BQ6A 1CXKA 5CXPA 1HKFA 5B7MA 3OR7B 4Q9RL 2YGPA 1WT5A 1R6VA 5JW4N 5CJ8A 1IILE 3MBWB 3IE4A 4XWGL 3SKJH 2VMFA 4RGMC 4DTGH 5HVHC 1RJZB 4NO3A 4N8VG 4A7QA 3SOTA 1QR1B 4UIKH 2XPGA 4MKMA 2Y7SA 3OKKA 4JM0A 4GMTH 1O5PA 4AQ1C 1CFSA 3N0PB 4PGBB 3CZUB 3EH3B 4HJIA 4PRHD 4Y5XC 4O02L 3WEOA 1NBVL 1J5CA 1OGAE 2DWDB 4D9LH 1VFAB 4XB8A 5FLUA 3VJ6A 4KQ3L 5LAXA 1MUJA 4EAEA 1EUUA 1OSPH 3B9KA 3TVMC 2NY4D 1TEYA 4G8FA 1PNDA 4P2RB 3PAVA 5DK3A 2VIRB 4B9PA 4G6MH 4FNQA 4C83B 3HKZA 3PGDA 4L8BA 2F5AL 3QG7H 2NQCA 1U8IB 4YX2L 1LO4H 1PG7W 4KDWA 4JDTL 4R97C 4C4KO 1I3RA 2GT9A 4FNLH 4GBXA 3MTXA 1U93B 2CO2A 3LS4H 2HKHL 3CFIC 1HILB 5JHLL 3ETSA 4LOVA 4WHCA 2FLMA 2IBGA 4ZD3H 3TS8A 4MAYA 3MJ7A 3BKCL 3ARFA 5E24E 1OCRB 1AZRA 2IOIA 2HB0A 1TQWA 2C3HA 2WWNA 3LPWA 1M05B 2ADJB 4XVUC 1WA0X 2FHCA 3NIGE 1I1YA 5CEXB 5BXFB 5J6SA 4F7PA 4FEMA 5I23A 1E7UA 1GTNA 5D5MA 1EMTH 2FQFA 1Z66A 2PXYC 5K1JA 5JXAL 5F1IB 4KC3B 2EABA 3SEPA 3K6OA 4FP8L 1RULL 2V7NB 3CZNA 3BWSA 5ICXB 3L7EA 5LXVA 1KGCD 2PUQT 5F3HA 1K4CA 4WU5A 3I6LE 5EOCJ 2XXMB 3AVEA 1QLFA 4FFWD 4XC3H 5EO9A 2XU9A 1Q90A 3RL1B 2EE2A 1UD8A 3IDIA 4YZWA 4HEPG 3F64A 1JFQL 4X6CF 2BDNL 4F80A 3RP1A 4U1NA 4CW1A 4M3KB 4A7TA 1GGCL 1P9MC 2BOBA 2BHZA 2OXHB 4YHKL 5EOCL 4WI0B 4LASL 3GTTA 1ZE3H 2LE9A 3BKJL 2Y7OA 3BKYL 3NT0A 2DQIH 3P40A 2AV7A 2H26A 2X4SB 3GIZL 3JV4A 2XZAH 3Q43A 1Q0XH 3CH8A 5E4IA 5KOVC 5AB1A 4CADA 3RVWD 5KWYC 5GGTH 1WDAA 1T2QL 4AZ8A 1EV2E 1DE4B 4JRLA 2BY0A 4M3HA 2FT6A 2JJTA 4HAKA 2AKRB 1GPOH 4X8XA 5I5IA 5KN5A 4HSCX 1KBGH 3V9CA 4MMXC 3TJHD 5FYLE 1J0HA 1U36A 3D0VA 1YEJH 4LLAA 3EHBC 1LK3H 2H3XC 4KNTA 4LCWB 2FATH 3MRNA 4AXWA 4AIEA 4H25B 3UBFA 3WN5B 5FEBA 3QFJE 2B59A 4HC1L 5D7IF 4AYID 4G1EB 3BP5A 5D93B 4AW7A 2VL5B 4HWBA 4AQZA 1IGYB 1DEDA 1UM5H 1JZ5A 2VZ1A 1AXIB 1B0IA 1T7YA 3QZNA 4YO0A 5FFGA 5GSRA 3ILQD 5FPIA 2P8PA 1R5IB 1DJYA 1TG8A 3FTGA 3GXFA 1TOXA 5HY9A 4GUQA 4TNGA 2CK2A 4J3WA 4KV5E 3AS2A 3NFPA 5TQ2L 2F8XC 2I25N 2J12B 3BQUC 3VD5A 2ZCHL 4KTEH 3VMPA 3L4TA 1RV6X 2CQVA 3SDAD 2IH9A 3HIZA 5CLZA 4IIQB 1LO2L 2J6EH 4JMNA 4NQQA 4JZNB 1XIWA 3L3DB 4OF0A 3TH4T 2V9TA 5BVJA 1QLRA 4WNQB 3MSPA 3P30H 5T1LB 3S8FB 1Z9NA 2X7LA 1CBJA 4BRJA 4C58B 3OGCA 1KCUL 4F7KA 4RAUB 4HIQA 1D5ZB 1GW6A 4HOMA 3CXHJ 2DM2A 3I9GL 4H88H 5D9SA 1IAMA 2F5BH 4WK0B 2CHDA 4HUCA 5LAPA 5C08D 5LCVL 3WUZA 2C34A 4Y16A 5D6CB 1CYGA 3ZX1A 2AJUH 3ZHLA 2EVIA 1R3HA 2YZ1A 5C0DA 3ZUCA 1TNMA 1EO7A 5CCKL 3MODH 3EH1A 1UKQA 3FQXA 5DHDA 1HDMB 2J71A 3MREA 1UQSB 3QORD 4JPIA 5BRPA 5T1JA 4TVUA 2I07A 5DR5L 1RJLB 3V0AC 4ZFOA 3BESR 2G4GA 2YC1B 3DA0A 3Q1EA 2VOTA 1QZ1A 3PNWB 1NAKL 2NY1C 2YAEA 2Z93B 3O6FD 5DVMA 5HGHA 4BHUI 3ML8A 1NBZB 1IBBA 1AGBB 3CWGA 3X3FH 4UT7H 4PG2C 1BFSA 3Q8FA 3UACA 4Q4EA 5SWZD 3SE3A 1HKLH 4Y4KA 2ESVE 1A14H 4IOIB 2WXIA 2GSGB 3VFRA 1X5XA 3KJ6H 3ELQA 1X4XA 2AK1L 3RDTB 4U1IA 5EF1A 1YMHB 3Q48A 4L5FE 1KPUA 4YSDA 3NZUA 1O6SA 4BZ1A 2J8UF 3QUZA 4QY8A 4MFHA 5TE4L 1WEJL 3UC2A 4B9KC 4U6XA 3TU6A 4NM8L 1QD0A 4UU9B 1UFUA 3EO9L 1P69B 2HVKB 2RFXA 4NIYE 2OJZH 3BWAA 3DHPA 4JPWL 4BZ2A 1ZSDB 4M7ZC 2EC9U 4JHVA 5CEYB 1UB5A 3C5ZB 3DX9B 3I02A 3H7BA 3MV9B 1EXUA 1ZLSH 3RLSA 4N8VB 5L2JB 1YYLH 1BFOB 2EDEA 3THMH 5L4IA 1VGKB 4HOXA 2YQGA 3H3KA 3BC9A 3V6FB 5TDPB 1R3JB 2BWDA 1YMMA 1N12A 4Y1SA 4ERSH 4ZRGA 4X7FC 1IE4A 2MJWA 1QKZH 3BW9A 4ZFQA 5C0AA 4FTVE 4IW4C 1T6VN 2EDQA 4M61B 4B41A 1ODAA 2W5PA 2KLTA 1OAZL 2BVQB 4JPIB 4LPXA 2R1XB 1G7MA 1UUSA 2DYPD 3G5YB 4FQLL 4Q8BA 2KH2B 1GTFA 3RZCA 5DF0A 1CXLA 1PX3A 2FX9L 2PTTA 1EANA 1SFHA 2A6JB 4ODUB 1C1EL 1ZCRA 2Y6SC 4K7PY 4UF7C 4HHGA 1EPFA 4JFDB 4F7CA 2YUWA 5K9OB 5I1GH 4X98A 2WVSA 3N40P 4HV8A 4M5YH 3FFDA 2GTWA 4FZ8L 3NIFE 1BD2E 3S5YA 3MXWH 4U3XA 1JD9A 1IBHA 1SHXA 4PH8A 3D12B 4R7NA 4AYMC 1NCWH 1RZKL 1U95A 1OSZB 2IV8A 2F18A 1ZLUH 5AFAA 1AXTH 1UTDA 1KJ3L 1IM3B 2E27H 2X89A 5F7KC 4IJTA 5I5JA 3VXSA 3GJEA 4W1TA 4XPTH 1P7BA 2P9RA 4ZUUA 1ACYL 4ADGA 3NSCA 4YUEL 5E9DB 4YSUA 5F0LB 2NY6D 2G75A 3GMPA 3QUYC 4WEBH 1H8LA 4MWFA 3BMWA 4OUOA 2GJ6A 4AH2A 1FNLA 4Q74A 2VJ0A 5G2NA 1KT2A 4XNXH 2LGNA 4TLTA 4ELMA 5K9KB 4PEEA 4K23L 4D0BA 3NRPA 2COQA 2AABH 5IMKB 3VNYA 1AO7D 3D07A 1ETZA 5LKNA 4G6JL 1LE5A 2DF3A 1G4MA 3BD4A 2OI9B 3QHZL 1NM4A 4WDIA 4CSSA 1QNIA 1AY1H 3U0TB 2ZD0A 5IFJB 1BMWA 1EHAA 5CJOH 1OQXA 3JWOH 3IJYA 3MLTB 4W9KC 1I7TB 1UB6B 5IHBA 1ILUA 1F56A 2YD0A 2DW5A 3PJNA 3QJZA 1MLCB 1NICA 1COBA 4HJGA 4IKIA 1G0DA 4OGYH 1AACA 5DJYA 4S1QH 4GG6E 5DFVC 3QFDA 2DS4A 1G9MH 2EE0A 5EEWA 1EZUA 3JTSB 4RAHA 3ZTDC 5E5UB 5MERA 1P1VA 1RPQA 2JCCA 3F7YB 3N5AA 2FJUB 4F37K 1G4RA 4IHOB 4W9FC 2FTAA 4YHIB 2A4EA 2FGWH 1CGSL 5IVXB 4BJLA 4I2XB 2R27A 2ZOWA 3CVHH 3BWUC 4UINH 2RQEA 1BFTA 1R17A 2E7MA 4PS7A 1TLMA 1QWUA 4XOBA 1J5OH 1KWGA 5D8JL 2ZCKH 2W59A 1X5YA 3UX9B 2XZQH 4Z77A 3LQMA 5JHMA 2EZ0D 5E6IB 2DQ6A 4UZSA 5DMKA 5EFIA 1M7UA 4X6FA 3FH5A 3VI3A 5JORB 4OLYL 2JJWA 3B7SA 5IBTH 1LLAA 2J1XA 4KK6C 1MCPL 2I9LA 4FCAA 5DGQA 5ESQB 4YXHL 2A6KB 3NDYE 3QCUL 4A7GF 1S7XA 1BLNA 4PJEF 1N6QH 3RBGA 4QRUA 4Y8AA 1FGNL 3SD5A 5C8JA 1EEZB 4J5VA 2OP4L 1WFOA 3MOBL 3QHFH 3ZKXB 4N86A 2D9QB 5DUML 2DDQL 2XG5B 4AG4H 1K2DA 2YGOA 1H8OA 1MVUB 4XNQB 2CLZA 4JFEE 3X12A 1S8DB 5ILTH 3P0VL 3FQTB 3K6SB 4IDLA 3FPYA 1MCWM 2NY3C 1MCOH 4MZ2A 1RCYA 4IDJH 4O2FA 1VADB 4GG6F 1TVDA 2BWIA 4JM2D 4PS4H 2NY2B 2YD8A 1LTXA 2IAMA 4MDJB 5H94B 1E65A 3HZMB 3KYKH 4G7QB 2IDTA 4R26H 3RTQB 4HGMA 2CR3A 3FFCD 4IBQA 3V4UL 1YNLL 2WTRB 4PRBB 1FG2B 3TVMD 4JG9A 4TQPA 1PD6A 1R1CA 1R3KB 4P5TA 5LBSH 3DVNB 4D0DA 3P0YL 1O9WA 4L0YA 3ASNB 4M1CD 5C7ZA 1N18A 3LMJL 5TE6L 3GMNA 2OSYA 4GKNB 4HXAL 1RUKH 1H8NA 4DK6A 5I6XC 2GPZA 1RY7B 1T1YB 2G30A 3CVHB 2EYSB 1KNOB 5FGRA 3MGTB 3P4LA 5D71L 4Z3EA 2YD6A 3KW7A 2EUVA 3LKOA 2OMTA 1NCGA 5AVZB 3VE0A 4GQRA 3UEZA 1KJMB 2BW5A 5ID1A 4OCWL 1KDIA 1NPJA 4F2EA 3OSKA 3IVKB 2RB8A 3P69A 3IETA 4LHUA 5TTRA 4FXGB 4WW1A 5KSAD 5KVEE 2IAND 3VA6A 2VL4A 1EJFA 2QPDB 2PWDA 1KTDB 5I1DA 1AR1B 4P2QE 4YAQA 4XNBA 1KYFA 1KLFA 2PXYD 3C87A 3DO4A 3TV3L 4PV9B 5AAWC 1CICB 4PBWD 3VXOA 4M6AA 1UASA 5J6GB 5ADOL 3EOBB 4MB3A 3LKQA 4QRQB 3O45A 1PEZA 1HN1A 4JK0D 4PMFA 2ORBH 5HJ3A 2G5RA 2AQPA 5T5NF 1XF5A 1E28A 2FJGB 4HC1A 4O4YH 4ZW6A 5LLIC 4HIEA 1IC7H 2DIEA 3EOAB 2CO7A 3SDCA 7FABH 1QFUH 3S35L 1TTUA 1INEH 2C7UA 3ULUH 1M71B 4OLUL 1FZMA 1SMOA 4I0PB 2CO4A 2A9BA 4N6RA 5DWUL 4AL8H 3WL9A 1MHHA 2JE8A 3BH8B 5E23A 1A7PH 1WIPA 2QVKA 1AP2B 5I18H 3GSXB 1ED3B 4JG1L 3SZKC 5IEHA 1DVTA 4LOFA 2VC2L 4ZW8A 3GBNL 3RWFB 1TQUA 2NYYD 3GLAA 4KHXL 1EK3A 1FJ1B 2MCG1 5FW8A 3N9GH 4B9JA 2W9EH 2VDNH 4JDEA 4XMPH 4XB3A 2LQRA 1DVQA 1E8WA 1HHJB 1K85A 5SWQA 5JW4Q 1N6UA 1I8KA 3MRIB 4YHML 4MXVF 5FO8A 2PP9A 4KHTH 3AJ7A 2WCGA 3QIBC 2QHRL 4R5VA 3LQZB 3BPCA 3KPQB 4WNSA 4DUWA 2E7BA 5L9DL 5FOJA 1EAPA 2DLFH 5HGDA 5A16B 1BQRA 3WIIH 4Z7OB 2FT8A 4MZRA 2CO6B 4NDMB 1OB1B 1MAML 3DUSB 3F7QA 1OLLA 3T65B 3DSNA 4NBZB 4BZYA 4UT9L 2IWEA 4ZZFA 4LRIC 1UKSA 4LXFA 3ZTNH 4JNXA 2J4WH 1OAJA 1SY6L 3BQUD 4IRZA 3ESVF 3MLSH 3VFOA 1LO3H 2Y2WA 4OJCA 1IL1A 4IGBB 1V8HA 3X3GL 3NCWA 2A2QT 4U4BA 1M7IA 4G11A 2HLEB 1N3NB 3I6GA 4HJJH 4E42A 5K59E 3O2VH 2EADA 3WTXA 3S3BB 1VFUA 3Q6FA 3S98A 2R69A 1A4JA 4OZHB 4AMKL 3HE7D 3C2AH 1NCDH 2VAAA 2OYPA 4FYQA 5DA4A 4K55A 2BSEA 5CGYC 1RZGB 2V0AA 3E8VA 2FJFB 3N42B 4P57B 2DQHL 2YQ3A 2OBGA 4GUCA 3V7MA 3C8DA 3D30A 2VR4A 1SYSB 2EC9T 1U58B 5D5MF 4G9DA 5D72H 4RCAA 2B15A 5F89A 1IC4L 4NT6B 3II3A 5J1AA 2VDNB 2CKBH 3U7YL 4U1JB 2D7OA 2YAQA 4UDUA 3TT3H 4K9EC 3GF8A 3KLAB 5TQ0H 3OC5A 5INDA 2DIJA 3PP3H 5JZ7C 3MV7D 2GSIA 2PYEA 1MF2L 4N90D 2B1AH 1O6VA 3E8UL 1KFAH 4ZQTA 1PYWA 2FVNA 5IK3B 2HRGA 5FW7A 2WLIB 2YS4A 2J88L 2PN5A 5JW5A 3DX2A 1EJOH 4M9PA 3RFZB 4QRRA 3IDNB 1E27B 1EJ8A 3MRFB 4WO4D 2FYYA 4OQTA 4MNHB 3IXTB 4PJIF 5DD3H 4BK5C 4NB7A 3RGVA 4XN4A 4R2GC 3RJOA 3V4VA 2CDGB 3L1EA 3RJDA 1NC2A 2AZUA 3EBHA 3EOTL 5ELIA 3ROLB 2HLFC 4WWKB 4YS4A 3ZE0E 5FDWB 1RMFH 3ZZSA 5K59F 1UWEL 5DTFA 4MGXA 1XGYL 4LBAA 2E4FA 5F6IC 4TTGA 5KVDH 2NY7H 3WD5L 1DLFL 1B2WH 1NKRA 5F3BB 1YZZA 2PP7A 3NAAL 1MFMA 1WTLA 3RWJA 4ENZA 4YDNA 3F8UB 5IR1B 2PCYA 3JT2A 2XXCB 4XMVA 5L88L 2OR8A 4F33B 2X4QA 35C8H 3MUY1 4N22A 5B7EA 1ET8A 5IV2B 3ROOB 1CFTB 4YPGB 3TBSB 3V4PL 1HJBC 3GO1L 4PJBA 2QSVA 3MRKA 4WW2B 3KS0J 3CJJA 4XB7A 2D7TL 5I73C 1FCGA 2XIBA 3O9WA 4KO6A 2Z31A 4XXDA 4YDKH 3K8LA 1MCRA 2BIOA 5GRZA 3US1A 4RRPA 4I3SL 3CPLB 4JQIL 1AS6A 3RPBA 4AJVA 4WHTB 1TJGH 1R3LB