2WYTA

1.0 a resolution structure of l38v sod1 mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGVTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Discovery of Small Molecule Binding Sites in Cu-Zn Human Superoxide Dismutase Familial Amyotrophic Lateral Sclerosis Mutants Provides Insights for Lead Optimization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 36
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wytA00
2WYZA 3HOGA 3T5WA 2AQNA 4BD4A 4A7GA 1N19A 1YAIA 1FUNA 2JLPA 2LU5A 2NNXA 2VR8A 3F7KA 4N3TA 1YSOA 2ZOWA 3GTVA 1EQWA 1Q0EA 2AEOA 1E9QB 1BZOA 3GZPA 1KMGA 1OALA 3SODB 2WKOF 2Z7UA 3CE1A 1E9PB 1SOSA 1SDAB 2GBTA 1HL5A 1QUPA 3MKGA 1B4LA 1SDYA 2WKOA 2Z7YA 2K4WA 4OJAA 2WWNA 2C9SA 1N18A 1SXAA 4U4IA 2WZ6A 3F7LA 3ECVA 2V0AA 1JK9B 3H2QA 2Z7ZA 1MFMA 1U3NA 3GTTA 1SXSA 1F1AA 2AQTA 3GQFA 2WZ5A 3GZQA 4L05A 5KBLA 3ECUA 1XTMA 1XSOA 1CB4A 4FF9A 1B4TA 4BCYA 1Z9PA 1L3NA 3RE0A 1P1VA 1OAJA 1DO5A 1F1GA 2E46A 3KH4A 2C9UA 3L9EA 4A7SA 1COBA 1SXZA 3QQDA 1XTLA 3ECWA 1AZVA 1PU0A 1Z9NA 2VR7A 3K91A 4MCMA 1HL4A 3LTVA 1F18A 1IBBA 1CBJA 1SXCA 1SXNA 2WYTA 5CU9A 1IBFA 2AQRA 1RK7A 1TO5A 5KBMA 4A7TA 2SODB 1E9OA 4N3UA 4A7VA 1EJ8A 2AF2A 1E9QA 3KBEA 2WWOA 4OH2A 1JCVA 2ZKYA 4A7GF 4A7UA 1UXLA 3MNDA 3HW7A 3PU7A 4MCNA 1BA9A 2AQSA 1IBDA 2E47A 2ZKXA 3CQQA 3H2PA 1JK9A 1UXMA 2WZ0A 1TO4A 1E9PA 2JCWA 2VR6A 1S4IA 3HFFA 3KH3A 2Z7WA 1IBHA 2C9VA 1OZTG 4A7QA 5KBKA 1PTZA 2XJLA 3CQPA 4BCZA 1E9OB 4B3EA 1SPDA 1SXBA 1OZUA 1YAZA 3KM2A 2R27A 1DSWA 2GBUA 1IB5A 1ESOA 2ZKWA 2GBVA 3KBFA 2AQPA 3S0PA 2Q2LA 3QQDB 3KM1A 2XJKA 3L9YA 1OEZW 2AQQA 3GZOA 2APSA 1PZSA 1SRDA 1F1DA
chains in the Genus database with same CATH superfamily
1KUMA 4U6YA 2X3BA 2HX8A 4M4PA 3W57A 3WN5C 3LRHA 1KIPA 4GNKB 1F4WH 4PJAB 1MI5E 1MRCL 3U36A 3DVIA 1JHTB 2DYRB 1TOXA 1NDMB 4Z7UE 1U8OB 5K59F 3CFUA 3X1NA 1ZLWK 1YEGH 2PXYC 5D4HA 5EEXA 2FEEL 5IVXE 2KC0A 1VEOA 2H6UA 3L95A 5AVUB 4AVIA 1TITA 2ED6A 4CC0A 4EN3D 3SGKC 3FMGH 2F7QA 4OJAA 4ZAKA 3UTPD 3QH3A 4KVNL 1BAGA 1UCBL 4JY5L 2CGZA 1V10A 1OWWA 1WYJA 3A67H 2VL5A 3AS1A 4IRSA 2QKIA 1TZIB 3INUL 5GZNA 2WCSA 4X2UA 2RFXA 3DO7A 5CWSB 3T65A 4LVHB 4TRPL 3IETB 3T08A 4AQ1A 4LSQL 4ENZA 2JB6A 3DOSA 1T7XA 3PCYA 1HHHB 3EO9H 4B9YA 3UJJL 4I48A 2CGRL 4FF9A 4TVPE 3VGFA 2B5IB 4GB9A 2CE6A 1TFHA 1U8OA 1ZT4A 5C8JB 3GEWB 2V9RA 4A2FA 3LRSA 5DMIL 4TUOB 5SWSA 1OSEA 5BS0E 2XN1A 3FT2A 2X2UA 4NERA 4JDEB 3TEWA 3NA4A 3KDMA 3MUJA 1X5GA 2EDLA 4R4BA 3P40A 2K7QA 2X0WA 1YEJH 3SCMB 2DWDB 4BBWA 5E08L 3UBFA 5LHDA 1XB6A 5ICYB 4HH9A 2JJSC 1YEHH 3JWNC 3BN9D 4MAYD 2GSGB 3H9SE 4OBSA 5AW3B 5ESQA 4N2IA 1AQDB 3CFDA 4K3EH 4KNSA 4BV1A 2GPZA 1IBDA 3KPQA 2ZG1A 4JHBA 4NKMA 4X50A 4QLRA 2P46B 1RMFH 3IU3A 4GXUM 3WN6A 2ODIA 1Q0YL 2HLFC 4OZHA 4LSRH 1B4JL 1D9KB 1LHZA 1S4IA 5I15H 3ZKMC 2HFEB 1QLFB 5L2JA 1CPUA 4U4BA 3FUFA 2O6PA 32C2B 1IGYA 4P3WA 5F9OH 2XIIA 3P73B 4XP5H 4WU5B 3S37H 1I7RB 3QDMD 3WCYA 3FAWA 2WLIB 5C0AE 3GMPB 1HHJB 1XF3A 2XWTA 4JFYB 4XPTH 4Z7WB 5MENA 4MMZA 4ZUSB 2WAHA 4GBXD 3DOHA 4CW1B 1U8JA 3QQDB 3E7JA 3IVKA 1CC3A 3DVFA 2HN7A 4JS7A 5CNHA 3B9KB 3MNWB 3BUDA 1H3PH 3NN8B 1XSJA 2EIMB 2GTWA 2P44B 4P0DA 1NGXA 1XCWA 1JPEA 1JV5A 5GRZA 3S6CA 2UWEB 2OZ4H 5DD6A 2WBJB 5D1ZA 3W0WB 4N3TA 1A21A 4PP1D 2DWEA 2YR3A 4JGMA 5HDBB 3O4OB 5E6ZA 5TH2A 2CDEA 3OWRA 2YRPA 4R4NC 3KEHA 2BIHA 3HAEA 3S3CB 3Q5TA 2GUYA 3DX9B 5I75B 1N8OE 2HFGH 4I3SL 3UG4A 5I15L 3C87A 5DXWA 2F53E 1AHWC 2GFBA 3CN3A 1A6UL 5DEGB 4LCVA 4ZSOE 1G6RB 3D48R 1E30A 3MJWA 3QJUB 1HN1A 1XCQA 3CWGA 2ICES 2NXYB 1OO2A 5LNEA 4R7NA 4WFFE 3BSHA 2W9DL 4P3CH 3VD5A 1FFRA 2ICWB 4LPXA 2ZUWA 4MXVE 3WMPA 1KENL 2R29A 3SYAA 1FAIH 4KXDA 2MCPL 4ZOEA 3WE1A 5JYMA 2C9UA 2V2WA 5H37A 4I3GA 4U6XB 3VYOA 1Z9OA 4UYQA 1F11B 4IMKA 4XP4H 3QWRA 4Z77B 4HZLB 1PY0A 4DN4H 1I31A 2FATH 1PD6A 4GAGH 3SKMB 2GY5A 3GHBL 1U95A 4P2RB 4XPHH 3VGDA 5KVEE 1A47A 1N6VA 3FAXA 1IVTA 4O2FB 4Y4HB 1QRND 4IYKA 1G9NC 2F7RA 2YPLA 1JV5B 4HCGA 2Z8RA 2BWDA 4W70A 4ORGA 4Z7QF 4L3EB 5IVZB 4ZAKC 1N3NB 3C6LB 3CXDL 1XVSA 2X4TA 2J5LB 4Q56A 3SE9L 2FBRA 4P3DA 5LAXB 1OD7A 3NJFA 1KGXA 3LS5H 1ZIBA 1MJ7H 5I1EL 2P5ED 3FU9A 1MF2L 2KERA 4KK9D 4A6YB 1TSHA 1YY8A 4UM9A 1HEHC 2FRGP 4Z18A 3BSZL 3T8MA 3GXFA 3QDJE 1BZEA 3PIQA 2HLAA 4N0RA 2OTWB 3AROA 2ESVE 2E6PA 4ABQA 3MUZ1 4N8UA 4TLUA 4KUCD 2DBJA 4UQIM 3T2NL 4QDGA 5FUCE 5ICZA 4OCWL 1XGTA 2QR0A 1G5GA 2R59A 3HN8A 3N1QC 2R23B 3RIFF 5MERA 3VG9B 4H40A 3QUKB 4XNUL 5C09B 4JKPH 2CCVA 5D1XB 1R5IB 1W0VB 1U3ZA 4WI4A 4YO0A 1KPRA 5IBLD 3C60D 1LO4L 4FADA 4LAQH 3RPIB 4AM0A 3Q5OA 1IKNC 2OYMA 2Z31B 3PP4H 3U4KA 3IJ9A 4K5PA 3MXVH 1F6FB 1KBVA 2GVYA 3V5KB 3BT2H 1MNUH 2EADA 4R4BB 2GG1A 3ZUCA 3CZEA 5FM8A 1YNTA 3NBNA 2IAMC 4M5ZH 4Z7OB 1CI3M 4HMEA 1AGDB 3WIIH 2UY7B 3JVGC 4GP8B 1ETZA 2PPFA 3IMUA 4UV7L 5EU4B 2EAEA 4ZMAT 5BQ7A 4KZEL 3ESPA 1Y6KR 3HMWH 4KOCA 5BS0A 3PGDB 2VXQH 3QORD 3O6LH 3RUGE 4QLWA 1H3TA 5CR8A 5GXBB 1JZIA 1TVBA 3OKDA 3RL2B 3MLYL 1A6VL 3T1FB 4MFHA 2DYPD 1L9SA 1BXAA 4MA8H 3VGEA 1KTJA 2V7HA 4DK3A 4B0MM 5T3ZL 5SWZB 3DHUA 3LEVH 2RJMA 2BOBB 1XBDA 1MXDA 3DVNB 2EIKB 3MYJB 3OGOE 5INCA 1DSYA 5I1CL 4PJDB 4NNYB 2FECI 1X3DA 2VB5A 4PW4A 2OYKA 1RZFH 5HHPA 3OKLA 4UV7H 3VDBA 4WDIB 1U8IB 4GOSA 3ILPA 5I66B 4NQED 3M46A 3QHTC 4TF4A 5EWIH 1YMME 5I5MA 2QQNH 4UMGA 4G9DA 5DWUL 1I7UA 3SGDH 3U36B 3ZYJA 3EF7A 3D4CA 2O30A 5AL0A 2XWXA 1O7DE 3PPSA 5DYOA 1FFPA 1WFNA 2DDQL 3NIDF 1BECA 1S7RB 2CK0H 1ETJA 2YXFA 2W8CA 2HWZL 3SN6N 5F3BA 1ZXQA 3H8NA 1LEKB 3NSCA 1AR1D 1VFMA 1NGWA 4J3VA 2NW3A 1WTLA 1R33A 1DQJB 3V8OA 3DVNA 3MYJA 2W5PA 4Y4FA 2BVPB 1KG0A 1INDL 2ZXBA 5AOIA 2O6FA 5LGYA 3QP3A 5E5MB 3SPVB 2OR9L 4JG0L 4ZFFB 1PZ5A 5INDA 2H3XC 3RGVB 1T7YA 4APXA 4MS6A 1Q90A 1GL4B 2OJEB 2JJVA 4PVBA 3RWEB 4WI9A 2GK0A 3I9GL 4OJFL 5TQ2L 3HR6A 2YGNA 4W4OC 3EAKA 1DHKA 4WUUA 3KBFA 1CLYL 4S0HA 2IGFH 3HC2A 5I1KH 3PP3K 4YHIA 3QDME 4G6AC 3GD1C 4NP4L 4W9DC 3WJMB 2AJUL 2Z4QA 1J9RA 1MJ7L 3FYEB 4I3RH 1UZ6F 3Q2NA 2IH3A 3FRPB 1QKZL 3QCTH 1NJ9B 3WBDA 3ZZSA 2BSSA 1RIVH 1GYCA 2WMPA 2R83A 5CD3B 4M9OA 4OD2B 2R4SH 1XGRA 3KGRA 4WW2F 4EVNB 4Z7AA 5JIPA 2APVA 2XWRA 3CIQA 2EYTA 3H7BA 2JI2A 3JTTB 3TF4A 3KL0A 3GIZH 2P48B 3L48A 2N0MA 4OFIA 2AQ3A 4U1GB 4JKKA 2HTLD 1IC0A 4DF9A 4R7DA 5TF0A 1HXMB 4XWOC 4PW9A 4BQCA 1UKQA 3ZSSA 4FQ2L 3NEEA 3X3FH 3GRWA 5HSFA 2MHAA 4AIZA 1BZ7A 5EBLA 1TTFA 1F3JB 2FQGA 1BYPA 5GGRA 4O9HL 5DVPA 1DN2A 2MFNA 2IPKA 2Z7ZA 4QHKI 4XVJL 3SKNB 2HJFB 1IGTB 5F21B 1UG9A 3IAPA 4V33A 5EZLB 2WSPA 4L05A 5KTEH 1K4DB 3WJMA 2FUQA 4CL7A 4NQQA 1KLFA 3LCYA 3LN9A 1QPXA 4F7TB 2VC2H 2CDGB 1CDUA 2VERA 15C8L 3ARBB 3B3BA 4GFTB 4WFFD 1MEXH 2WAQA 2GK0B 2VZ3A 3QI9D 5DURB 4XBPB 1E90A 3L6FB 1HHKB 2K3TA 1J0JA 3EYOA 3QO1A 2FR4B 4G3YH 3L2NA 4YBLC 3WYRA 2W59A 2NY6D 1LNUA 3GJEA 1RUKH 4Y1AB 5FKPB 4JK0D 4DAGL 3FQ2A 2DQHL 3QIWC 5BMFL 4W9IC 2IALA 2YSSB 4QRRB 2ICCA 5JNYA 4FNSA 1QSZA 3CUPB 5E1IA 3X2QB 3BXNA 2A74B 3PXJA 4L8SB 1MCEA 3FSOA 3V8CA 2WQ8A 2VLRB 5AL8A 4KRPD 3V5KA 1XCTB 5HVFB 4JHWH 5KW9H 2WJ7A 1UXWA 1VPOH 5GS1C 3HRZA 4BE6A 5FO7A 4OF3A 4H7VA 4LOFA 5CZVH 2GJZB 1N0LB 2XTJE 4N2GA 2Q76B 5JHLH 4ONGH 3R06B 1JDCA 3UPRA 1XCQB 3K2IA 3TCLB 5KS9F 3FUMA 4L48A 3KM2A 4ZPTA 3EJYC 2L04A 3K6SB 5HHOE 4AYFA 1NGQH 3TA3A 5I8CB 1QPKA 3ULUD 4Y19B 3NFPA 5DS8B 2C4FU 2WUCL 1QSFD 5F7HA 3MRBA 1RZKC 4L4VE 4XNZB 4H1LA 4XR8C 1BJMA 4GRLC 4LARL 1XAUA 4RGOH 1MJJB 2X44D 4QXUL 5FYKL 3M8OH 4AIZB 2DQFA 3BKCL 3G6JE 1V8HA 4OZFH 1CDBA 4YZWA 5GS0L 2AV7A 3MUGB 1W6LA 2VR8A 4AH2A 4DN4L 1V27A 4A39A 3R7RA 4LU5L 4EZJA 2NX5D 1EQWA 1LILA 2YN3A 4L8BB 5FW6A 4LLUA 1EV2E 4GFXA 3S35L 4OLWH 2PW2B 4AGOA 1T66D 4G6JL 5IFHL 3MRMA 2FDBP 3O9WD 4L5FH 1FL3B 5ALBH 1RZIB 1WFJA 3K8KA 4K8RD 1HILB 6PCYA 5HYQB 2N0KA 4JRXA 2PYEE 4BK5A 4M6MH 1R47A 1XB8A 4BXSV 3N41B 3UJJH 4XX1E 4BSWB 2A0LD 2E4FA 1GRWA 3FO2A 3OD3A 1T04A 3V9EA 3VYPA 3CDCA 1NGPH 1Z3GL 1TJGL 4MCZA 3VRIB 1S7VA 3KYMB 1LK3L 4O02A 1DJWA 1H5BB 1MY5A 3FTZA 5HJBA 4BCYA 3ZE2F 1U58B 3LSOB 1EK3A 4XMKL 2E27H 3NJJA 1EEZB 3QNFA 4UUJA 1AKJD 1SXZA 4GRWF 1ZA6B 5EO1B 1LO0L 3CXHK 5AEAA 1QZ1A 1DZBA 1NCAH 4QY8A 5DHEA 5JPMA 4Y7OC 5ETUB 4PJ7F 2J55A 5HHNB 3EO1A 1WDAA 1F3DJ 1KG0B 4NHUA 5CGYC 5I6OA 4F2ME 1FJ1A 2F9BT 3P4LA 4PB9H 4OM1H 3SZ6A 3LHAA 2VDPL 1A3QA 3K2MC 5DJAA 1IAKB 1CTNA 1UGNA 1U8HA 3KVPA 4DTGH 2DEYX 3U7AA 5JPNA 3O4LD 5AD0B 1KGIA 4KJQD 5IREA 1CS6A 1CD9B 4Z5RA 4IMKC 5AQ0A 3VXUB 2WBJA 3BVTA 1OT2A 3VFRA 3TV3H 1QKZH 3CHQA 3QCTL 1FLRL 3IDGB 4XI5C 4YHPA 1FV1B 4UT7H 5I6NA 2XWJB 1E3XA 3C2SA 5A3ID 1K6QL 4HWZA 3AWFA 4CSPA 2E6JA 4WEMB 5LGHH 4PJ8C 1KYOK 4YFLF 4J7RA 4I2XE 4Q97A 1S5HB 1ERNA 1ADQH 3NJKA 4B3VA 4QRAA 4G9FA 1UWXK 1TMCB 4PBWD 2IH1B 4OZGF 3VCLA 4HKBA 1K5NB 4UILL 4HIXH 2BCKA 4AC2A 1ZHBB 4EIBA 1U4EA 1OQOA 3ZW3A 1OANA 4WO4C 1G7JB 1FUNA 1URLA 1ROCA 1YSOA 3MCLL 5AD0A 3OKEB 4OW6A 5DD3L 4AMKL 1HQ4A 2F53B 5DVNA 3S4SB 5J13B 4Z7NB 1P9MC 5EZIL 4WFEE 5L4JA 2ZCHH 3DOIA 3IXTB 4DQAA 4J28A 5TDOB 3VFNB 1N64L 2YGVA 4ZX6A 2AC0A 2D7PA 1L0YA 4N28A 5C0IA 4G1MA 1PZ2A 2ZIDA 1CICD 1DL7L 3VFOA 3WIFB 3WXVL 1PX8A 5EF3A 3F5WB 4FXLA 5ETUA 4JG9A 5B3SB 4D2NA 3DJSA 1JE6A 1PY9A 4I89A 1J5HA 2A6JB 3FFOA 1GZPA 3MNMA 2C7UA 3IMSA 2BVOA 2NW2B 3QRFM 3TA3C 1JIBA 2LLNA 2PPCA 3GZKA 3QDGA 4CBZA 3WD5L 2NY5C 3HMXH 2HG5B 5IFJB 4HC1L 3PHOA 3OKNA 4W9ZA 4Z7WA 1VZGA 2AJXL 3D08A 3JVGA 4JPKL 4LHJB 4OZFB 2BSEA 4R4FL 3MLRH 4XVUC 5GJSL 3V0VA 4U2YA 3RWDA 1H6UA 4FI8A 1WHOA 4FXKC 1QR1B 4NQDD 5C2UB 2NPLX 3P73A 1UC6A 4HDIB 3P9LB 3FW6A 4RMBA 4OZGA 1WC7B 2NT0A 2OMVB 2FT7A 4JFOB 2VDQL 2GIMA 4R26H 1WAEA 1CIDA 3QCVH 2QT6A 2VLKB 4LP4A 5C07B 4BFFA 5E4EC 2QADB 2ZKYA 1OSZB 4RZKA 4HS6A 3KPSD 5IMKA 1BFOB 4KI5D 4XPGL 2F58H 1AG6A 2CR6A 4HGKC 3OR6A 4UDTB 2C9PA 1S7SA 3KWUA 2CALA 1SDDA 5DJZB 5KSUB 1OGAE 2H0PA 4YXLH 2VM4A 4BK5C 1DQIA 3QZMA 4UNUA 3MRNB 5D1XE 4KK6C 2BLFA 2VJ0A 3SKMA 2A9CA 2OI9C 4V2CB 2P5PA 4QTIL 2PWGA 3FOLA 1EEYA 1YA5A 1MCWW 2B9BA 2DQDL 3HMXL 3PABA 4XCNA 4OLWL 4Z78B 3NGBC 3X1BA 4FA7B 5T8IA 5M94B 2OLDA 2V37A 1D3CA 4ZTPL 1CGYA 2CK2A 3AWGA 3AFLA 3OAZH 1OVZA 1JNLH 4A55A 2WQRA 3TPKA 3BVVA 1NMCB 2VO5A 2LAAA 3DOSB 1FZMA 4FLSA 1BFOA 1ASOA 3OSKA 5AB2A 1I1AC 1ZT1A 3KXFE 5C07A 3ZYIA 1VFUA 2L7QA 4I9WE 1QRNE 4M8RA 3MYZA 5F7UA 4JN1H 2P8PA 5KG9B 3QORA 1A5FH 3P4NB 4O02L 4F3FA 1J7VR 4IJTA 2P5EB 5D7JA 3KLSA 1F45A 5F7FA 4TSBH 4WV1B 5FYJD 3BUYB 3GJEB 1FVDA 4UDTA 4P9ML 4LCIH 1VA9A 1Q38A 1XH0A 2H47C 2Q86A 4XPFH 5H37G 1NCOA 4GUOA 1VACA 2WLMA 2F68X 2H45A 5I0XA 5DUPH 5FK9B 3RVTC 3CZFB 1T0NA 3QULA 5E6UB 4K0OA 1I3VA 1YPZB 3EJJX 4Y2LA 4CW1A 4NM8H 1MVYA 4ZS7H 4LNVA 4MA7H 5D7IB 4O51B 3MJ9H 2ZWKA 4MKMA 5JW3L 5D1QA 1E4WH 4RAUA 3K2KA 4JZJB 4GO6B 3IDJB 3KH4A 1CFSB 1KFGA 3KLLA 5AW7B 3S4SA 2DEXX 2V8MA 3UAAA 3ARFD 4A2EA 4I2XB 1TG8A 2R1WB 3WEOA 2F0CA 3MO1A 1L9PA 2H1LM 3BZFB 3HI1A 4WJKB 1ETB1 5FYJH 3X13B 3N1MC 2WC7A 2RMNA 4WFGD 1C7TA 2Z65C 3R1GH 4IRZL 4L2LA 4OTXL 3MRHA 1D5IL 2LAGB 3NK3A 3FHQA 2CO7A 5DF0A 1JZDC 3FCGA 4GKNB 1LO2H 4ACPA 5DR5L 5IHWA 4AQAB 2AABL 4JRYB 1A6WH 3RKDC 3P4OA 1S5HA 2AEQL 1CLZH 4H44C 4W9JC 3FQWA 2H9GA 4HXAH 1NAMB 1UOLA 3BP6B 3VFWA 4OLUL 3WNJA 4EE2A 1QR4A 3SDAB 1UB5B 4E42A 1G7IB 5KBNC 1Z3RA 5F88A 3QPKA 2DQUH 3SIKA 3B4NA 1Z5HA 3HE6C 4GQQA 4OUOA 1UM5L 4D0BB 3GMLB 4XOAA 1TR7A 1PLBA 3GSQA 2WLJA 3APCA 3LDBB 4MBOA 3GEFA 1X5HA 2IOOA 1KJMB 1P5UA 3PHSA 2N3JA 2BRQA 1M7UA 4R7LA 5HHPB 3AZUA 5IIEB 2A73B 3FQNB 3GMQB 5ERWA 2NXYC 3E38A 4P46B 2X3CA 1OAQL 3V5DA 3V6ZB 4J6RL 1FJ1B 1HE8A 1DQTA 3QJHA 4YQXH 4KROD 1B9ZA 4OM0L 3H56A 2GEEA 2K0RA 3BP7A 3IDXL 4G8GB 3ZIMA 3D09A 2ITDA 5IEKB 1FV1A 3SOBL 1DBJH 4P4KD 3W9DA 4M5YH 5DYOB 2X53A 2PPAA 4KKBC 2GBAA 2EICA 3EJUA 4HHWA 4O2EA 1V7NL 3LKRB 1BFVL 4HIQA 4JKWA 2QHLA 5GSRB 1NCTA 4HCRH 1QHQA 3DKHA 1Q9KA 2ZXQA 3EJZC 2F61A 3NIFB 3POHA 4XCFH 4ZT1A 3U48A 3VXRA 3NJNA 1RY7B 1K2DB 4GG6E 4BZ2L 1SXSA 1GZHC 5J6HA 3ETSA 5G5DA 3TPUA 3DK0A 5LBSL 1B3JA 5IESL 4JUSA 4TS6A 5DD5H 3ZT6A 5DTFB 4XPGH 3MRMB 2IH3B 1AXSA 1KYDA 3IDNA 3OZKA 1UASA 3AG3B 4IU3A 4L4VB 4Z9KB 4A7SA 1L7TH 3LKOB 2Z4QB 3VH8A 5EDSA 3BZEA 3AQYA 4FX5A 4G59C 3HE7D 4YSRA 5MERB 1EIBA 1BBDH 1FPTL 1KGJA 1S2EA 4Q2ZA 4NAMA 2XZQH 3P9MA 4TXVB 4XODA 2WO2B 5L2KB 1K4DA 4H2CA 4MLSA 4QRRE 2V2TB 4PVMA 3RU8H 1NA8A 4X6DB 1QA9B 2XWBB 3CDZB 3P30L 4ZXBB 5LDUA 3BVNB 2ROXA 3ULVF 4PJCF 1KV3A 3ZKSD 4CSSA 1BZ7B 1QATA 1QASA 4JO3L 3CZGA 5DHYA 5AW4B 1IM9D 4AYEC 3K46A 4CVXB 5FYJU 1Y7VA 1TETL 5J6HB 4PTTB 4WSKA 1A7RL 1IFHL 3O8XB 4HK3J 4KJPD 4N0FB 4EKXA 1E2ZA 4KZEH 1ILUA 2HJKB 1D5ZA 4RBPH 4MHHG 5F2FA 4L8BA 1A7OL 1NZRA 1FRGL 4UU9B 1KN4L 2FLBT 1GZQA 3HI5H 4N8PA 1Z0MA 4DKFH 3WTUA 4BSVA 4NGHH 5DURD 3E2HB 1N8ZB 4LOVA 4Z3TA 5FM5O 3OJDA 5KANI 4ES9A 2W0PA 4D9RD 2C1PB 4MAUH 5DLLA 2BXZA 2NYZA 2VLRA 1CFNA 5FWQA 3GDCA 3FUIA 4ZXBC 5LXGL 2NXYD 4X6DA 1JYXA 2FWSA 3RUGF 3FYIB 4PM1A 1J5IA 2GQHA 1K4CA 3AY2A 3DK2A 4NN7B 5KUMA 4PGCA 1OP5H 3LZPA 4WHYH 3QARA 3QO0B 2NYKA 2V2WB 3LV3A 1I1AA 2BH0A 2Y0SA 1LNUB 2AAVA 3L45A 1IKFH 5E99H 1N3NA 3C6LA 4OUUB 4U1NB 1BZOA 4XPAL 4N2LA 3KGTA 3U9UB 3MJ9L 1W91A 5JW3H 5D7SL 2LTQB 2RTTA 4BKSC 3L13A 4G7YH 1EO7A 1BWWA 1CD8A 3O6FA 4JM2A 1G6RH 4XC1H 2F5AL 2G3ZA 5JW4Q 3ZK0A 3T71A 4ICXA 3OPZH 4GG6B 5FCUH 5GIRB 43C9B 1EX0A 2O4EA 1M4KA 4LCIL 3FQTA 4Y19D 3WHXB 3A21A 2XBTA 3EG9B 1INQA 1BF2A 4K71C 3BZ4B 3D4GA 3MJ8B 4LCUA 4XVUD 2NY5L 3LPOA 4RRPG 1OSPH 2BZ7A 2Z31C 1C5CL 4AM0B 1IC5L 1U93A 4MDJB 5T1KD 3RFRA 1QFHA 5D1ZB 4XMZA 4WWOA 2TSAA 3IFPA 5E6YA 1B2WL 3C09C 5I76A 3I2CL 2K3HA 4TQPA 2QQLH 1YMHB 5D1QC 1YJDH 2ED7A 3BJ91 4DUVA 3Q3GB 4ICWA 4HETA 4PRPE 2MSPA 1J8RA 4PB9L 4NQCB 3RUGA 2A9MH 1JOIA 2DI8A 3IDYB 4WW2A 1OGAD 5TPWL 2CK0L 3QFDA 4X4MA 2DQIH 4JFDE 3FB7A 5GGQL 3L3HB 5AW2B 3VXNB 1KJMA 5D1XD 2DMGA 4OFPA 1KC5L 1U91A 2CMRL 4FQXC 3TJEL 1LEGA 3X11B 4QRPA 1BM7A 1R3HA 3NABH 2E9GA 4TQ8A 3GXIA 4UM8A 3BGFB 3EYVB 4KTEH 3QYCA 4S1RH 2QPEB 4TQEL 3FO1A 4ZX3A 4FL4B 2BVEA 3D51A 2WWKT 4DW2H 3LZQA 1CJYA 1KJVB 2O5NA 4JN1L 3IDNB 3FB5B 4UZSA 1QI3A 2J8OA 3C6SB 1F4XH 4NAQA 1N2RA 4FNTA 3VXMA 4B50A 4JO1H 5KZCB 1GYVA 3L9RA 2ZXEB 3ARFC 2DD8L 4PV8A 4X9FA 3OLEA 1XH2A 2QSCH 1KTLB 3OZ9H 3U1PA 4DGUA 5C0IB 5GGSB 4PJAE 2X4SB 4MB4A 5DO2C 1I3RB 4GI6A 3AT9A 1OK8A 2YHGA 4Z0BH 2X28A 5JQ6L 2CO7B 5D9SB 2A3TA 5F7NC 5L4FA 1RP8A 3S36H 3EZJB 1MIEL 3VFGL 4ZMZA 4NBZB 5I74C 1F90L 4TUUA 4TSCH 1SFHA 3BCFA 4JG5A 2CUIA 3TO2A 5CD5C 1J0HA 3RURA 2NSMA 1OLZA 1UWEH 4NFDA 2DKSA 4ZW7A 4D0DB 1Z5LB 1W9XA 3ILPB 2Q20A 5DJCA 5I66A 1OF2B 4P2QB 3CFDB 3FFCD 4LSUL 3EHBC 3GSNH 2OJZH 3MGTA 2AJYH 3KBHE 4TSCL 4WUUE 5JW4M 5EFIB 4X7TA 4M5YL 3SY6A 4NDMB 4EBQL 5KN5B 2MNUA 5F7AA 2ZKMX 4LRIA 4JKPL 1T6VN 4H20L 4N2KA 1EAJA 4RESB 1T7ZA 3DX7A 3OGCB 2UXTA 5ISZE 4KI5F 1AR1B 4G8EB 4YEFA 4HUXA 4IHOB 1ORSB 3MFGB 1E2VA 4R2GB 4PGDB 3QYMA 3KGUA 4UZGA 1SDDB 1F2XK 1ORQA 5KSUA 3UYRL 1CXKA 2BHUA 2FE0A 2UWEA 4JPKH 4Z5RB 5T1JA 4YHZH 2CUMA 3MI6A 2IQAA 4KJYB 4KU1A 2WBXA 2IV8A 1PX4A 2K6YA 5J3HC 5FCSH 5JR1H 1FL6A 2FGZA 4TTGA 4JLRA 4W9GC 2AERT 3FU8A 3QNXA 4MD0B 4ZSOA 2X1WL 3CH8A 5KN5A 3GPEA 3MAWA 5MP6L 4F7CA 2A2QT 1S7WB 4OGYH 2VNCA 2YMXL 2XVBA 1DSFL 3TVMB 2WXQA 5E8NA 1P7QD 4H4NA 3I6LE 2E8ZA 3N50A 5F7DB 4G8FB 4F7MA 1ADQL 4Z3GA 4AK1A 1T1WB 3MNDA 1TPXC 5FGRA 4P2OC 2FQFA 3EXJA 4Q9BA 1CK0H 3VXOB 4NFCA 4KH9A 5L6YL 3FTSA 5BQ7B 2WLNA 4R7VA 4GIPD 4RA0C 3S8WA 1PEZA 1NFDE 2GFBB 4LT7A 4B5EA 2AK1L 1F41A 5GSVA 1R3LA 2Z0UA 1MDTA 1X5ZA 3C08H 1EZVX 3ZPDA 2W95A 1U33A 3I6KB 4M43L 4G71B 5LDSA 2DZEA 1R0AH 2Z31A 4BELD 4ELMA 1G7PA 1OAYH 2Q1EA 4Q9CA 1A9EB 4RNRB 2CKBL 5AVZB 3FZUC 1Z2KA 3EJYD 4UINL 5IVXA 3MV01 4LNRB 2ZF8A 4N2NA 1DFBL 5EZOL 1A02N 3RX7A 5AVTB 1MHEB 3NJLA 5KSAB 3F84A 4WK4B 2PCFB 4BQ8A 5JOFA 1LLAA 2B2XH 2ZP0T 1YUHA 3P9LA 2OMTB 4MWFB 1JPTH 2AK4B 1U95B 4O58H 4P2RA 2OTWA 5DC0A 3O4LB 5FDWA 2YPKB 3PY9A 1TKWA 2ZSWA 4I3RL 1KFAH 3LXAA 4UM9B 5EEWA 2DWTA 4BQ6A 5A3IC 3GUTA 4KZDL 4O5LH 4GRWE 4L1HA 1OTUC 3V5HB 3IFLH 3KYAA 5I6PA 2WQAA 5D2LB 4ZPVB 1OM3L 4RIRA 3VX0A 5E8EB 3HZYA 2CQVA 2F1EA 3MUUA 3P69A 4R97C 3CFCL 2XWJA 3F01A 5GQBA 2BP8B 3I02A 3UPRB 2ADFL 1EO8L 5EIIA 1GA2A 5C6TH 1CYGA 5ESQB 3JV6B 4YDZA 3ARFA 3RU8L 2Q87A 1P4LB 2OXGA 3FJTA 4JO4H 4PJEE 3FONA 1FSKB 5I26A 4POUB 4XBGB 2F8OA 3KJ6L 1X9QA 3U46A 5DMKA 2DLTA 3MRFB 4Z7UF 4Z7OE 2WQWA 1HI6A 1TLKA 3PYCA 2Y9RT 4QHMA 2XZCL 5E70A 4MAYA 4MD5B 5CJXC 3SDXA 1YY9C 2J2ZA 3E8UL 3PDOB 4HEME 2E7HA 4IRJC 5FGBC 5IVXF 2BRRL 4JJHA 5MEQA 4D9QE 1HKLH 3BPCB 5DT1H 1QSFB 2MQ3A 2VE6B 4KK5C 1KF9B 4CAGA 3UABA 4D0DA 4WW1A 1W72L 4ZDHA 5T1LD 1CD1B 4OUUA 5FYJE 1UACL 3APDA 1GTNA 1YLBB 1RIHL 4OIBA 2IPUG 3MRCB 3IMRA 2HXAA 2WVUA 1CICB 2DMBA 3B9KA 4I85A 4TQHA 3QEHA 2E56A 4X9GA 3KHQA 1DLFH 3ASWA 3E2HC 1KTCA 1FGVH 2VL5B 4PWIA 3QO0A 4X6CF 4QOKD 1JK9A 4ZFGL 4PS3A 3FO2B 5CBEB 5AOMA 3L3DA 5I1JH 3KLHD 3MX0A 2C4FT 1ZD6A 4XBMA 2CRYA 3O9WB 2HUHA 4J3OF 3SKNA 4M93B 5A6MA 4UBDD 2UYLB 3L4UA 3PHOB 5KW9L 1EANA 1T89C 3HEIB 4FI6A 4TNEA 1JTPA 5IB4B 1QHOA 1FO0A 3FH8A 3F83A 5J5EA 3MFFB 4LCWB 2JKLA 2WINB 1BXXA 3RJQB 1EEUA 2WXOA 1JGDB 1XD0A 1RJLB 2EIEA 3CFEA 4QAMB 3WNKA 4HYTB 4R7DB 2Y7QA 5L2KE 3PWPB 1LWJA 5EPMA 4UAOB 4BSJA 3H9ZA 2ZAIA 2HPTA 1B0IA 1BEYL 5IBTH 3EJSA 2EEBA 1I4FA 2PUQT 1W72B 4OFYD 1UCTA 3T0EE 4F2MB 2FEDD 5DJ2B 4UI2A 1MAKA 2BVQA 1HNFA 1VPOL 3ESMA 4F7KA 3NCWA 1R3LB 1C8QA 4DKEH 3CVHA 4R0LC 3SDYL 2A9BA 4KHTH 5E6IC 4LARH 4PLOB 2V2TA 2EJ1A 4G9FD 2VN5A 2NTSP 4CADA 5FX3A 1YYLL 3LRSB 4AWJC 1J1PL 4FXGA 4F7EB 2H26A 4HALA 3VXOA 4OZHB 3TXAA 4M1GH 4IJ3C 2NYYD 3AS0A 3STZA 1MW3A 5EU3B 3MOBL 4OJEH 4JREB 3IBEA 3BQUC 1MAJA 1NBYA 3SE3C 3LYRA 5EZPA 3ZE2B 2X4NA 2OQJA 4HHGA 4KUZL 3I3BA 4B60A 2E7LC 5H2BA 5DSCB 1X6LA 3A47A 3O3BA 4ZFFA 3H2QA 1S7WA 1SHSA 5IZ7A 2BMKA 1HAWA 4MRBA 4ENED 2EABA 1IIIA 3HE7A 1D2PA 3ZDXB 5ISZD 3VXPA 2I9TB 3GMRB 1AD9A 4X98B 3G08B 1NGWB 3QJRB 1CL7H 3L9BA 2GSIA 4R97B 2BIOA 1AC0A 5C2BH 1GOHA 1S7RA 3VTAA 3FCTB 1J9TA 4UT9H 2LGNA 3VMPA 4M7ZC 2YPLD 2HVJB 4KZDH 3RDTB 4MNGA 2O61A 4DESA 4LLWA 2FO4A 4JR9L 4FTVB 4G8GD 2BIMA 3UC0H 2PO6C 1UJTA 1AO7A 3DSFL 5AOLA 1CBJA 4IS6B 2EACA 3KPTA 2HH0L 2E6QA 5EBWA 5DLMH 2AJZA 5HGHA 4S11A 3Q06A 2ADJB 1HEZA 2ENQA 4OFKA 3U30C 1ZGLP 4URKA 1U8CB 3GJFA 4QMEA 3RAJL 4FNPA 1RZ7L 4PJ5B 1HWWA 7FABH 4TUJA 1BZDA 4GUCA 3ENEA 4MXQC 3RY6A 2JKXA 2ZUXA 1OARL 2GB2A 3TA3B 4G7SB 3OXRA 3ZHLA 2A73A 3GMQA 4WI7A 1F90H 5TF1L 5FEBA 1MW2A 3GSWA 2WGXA 3MMEA 2MEJB 4WW2C 1J8SA 4CC1A 1HKLL 4GP5B 3H0TB 4AV0A 5EBLB 3ARSA 1YN6A 3VXTA 3A4EA 1CXFA 2P5EE 4W6XB 4TTDC 4LCUB 5HPOA 2LHAA 1BFSA 1Y18B 4ODHH 1KEMH 5EC1A 5DK3A 3V7AG 3VFMA 2OMZB 1NKGA 1A2YB 2J1XA 2PCPB 4HS3A 4I7ZC 3CFJA 2JJSA 1GYWA 1DSWA 1LP9E 3BXNB 3VRJB 3BPOC 3CHOA 3V0WH 2BSRA 2NNRA 4CMMB 1WS8A 2P3YA 2XV0A 4AE0A 1NCBH 1Z32X 1HS6A 4JM4H 4X5QA 4RRPA 1FN4A 4HUKB 5GRVK 3SBWC 4JFXB 5ANMA 4HUMB 4WSJA 2Y25A 5ICXA 2Y36L 4Y89A 5KSBA 4QIRA 3UTTD 3PJLA 3QXDB 3FUEA 1A4CA 2YWYA 1QA9A 1CN4A 2NY0C 2XWBA 3O2DH 2G75A 5DSCA 5C9JB 2LU5A 5MP6H 5LJYH 1SN2A 1Q1PA 5T5FA 1AC6A 1NWPA 4PB0H 3ZIYA 3HC0B 4YHML 1ET7A 1E9PB 4MA3B 4N5EC 2VMCA 4RSYA 2OM5A 5C07D 3LIZL 3QW9A 2BPBA 2K4WA 1YNTF 4JZOA 4YWGL 2VAJA 5HHMD 1BHGA 1WD8A 1FH5L 4OCSH 1MJ8L 4PWEA 3QHZL 1SLWA 1JV2A 1EBAA 3T0VA 3BWZA 1NMAL 1LYQA 2ZQKA 5E4IA 3FUJA 4J6IA 1XF2A 1OSPL 4DETA 5D4JA 2BWIA 1I9JH 4L1BA 3EYQC 2Z9TA 5F3BB 2DJ4A 1AY1H 4O4YH 5DHVB 1CF8L 3DGGB 3GJFB 1INEL 5I1CH 2CKBH 4NJAH 2B4CC 1RJLA 4TUKL 1NBCA 3O8XA 4N0FA 2VXQA 3CPLA 4OLVH 1F4YL 1HDMB 2MPAH 2YS4A 2F5AH 2KS0A 5EOCL 3SDCA 4B41A 4NO0A 4KROB 3T3PF 1XEUA 5JTWA 3ETBF 1UZ8A 3OKMB 3DUUA 4DPCX 1BW8A 2QQNL 1PIGA 2X4QA 1U8KB 4LMQI 4XTRC 5JMOC 4E9QA 2R0KH 3AREB 3S35X 2X2HA 4ODWA 3C9NA 4HJEA 4M5SA 1XH3A 1V55B 3Q6GH 3VG0H 1OCCB 2P47B 3MRGA 1DEEA 1QW9A 2DKUA 3CFMA 3LKSB 2X4RB 2R56H 1DLHB 2PWHA 4Q4IA 8PAZA 2XETA 2IANB 1HNYA 4K07A 1MELA 2OQJB 2XIDA 2JCWA 5I75C 3QNYA 5AWNH 1Y6MR 3DI2B 1MRFL 2EXYD 3WN5A 3BP5A 4PRID 4I8DA 1MWAA 4TKWA 4UCFA 5DCCA 3GLDA 2APXA 4YLQT 2CWRA 2ZCZA 2RACA 3WFCL 3IGKA 1AGEA 4I1NB 4UYPA 2Q3XA 1Z6JT 4BFIB 3D0LB 3MRPA 1KB5A 1CTOA 4KQ0A 1LWHA 3HE7B 4YXHL 3DUUB 5BNXD 3Q8CA 1F3JA 1T3FB 3QUYD 2XZAH 2PTTA 3PQYE 3NIDE 4IGBB 4NC2B 2EECA 4PJXB 3SBQA 3JWNH 4GKZA 3K72B 5B8CB 1DSFH 1ES0B 1XEDA 1NL0L 3VYNA 3CPLB 3H1ZA 5DJZA 3JWDC 3RVVD 2JKJA 1ZJAA 3QFJB 3CC5A 1NANI 5E4AA 4FQCL 4NN6C 2D7NA 2IQ9L 2C9AA 2V5YA 3G5YA 3QUYC 2IOMA 1VB9A 2XPZA 4PJDA 1I1YB 1R3JA 3QZBA 4TUJB 1IC7H 1ZS8A 2GJRA 4U2ZA 5EUOE 1U8CA 4GXVL 4RAHA 4R84A 3O41B 2WKLA 4DVBB 3GMPA 1JGEA 3PWUA 4FG4A 2WXPA 2VISA 4GP4B 5A6IA 5DC2A 1S9XB 2VMFA 4PN6A 1H9VA 1J8HB 1YCSA 5CP3A 3RKDD 5JIHA 2EUXA 3LNGA 3BSZH 3OPZL 2D2OA 3G7TA 4J3XA 3RWCA 3WTXA 4KRLB 4H8WL 4UQDA 5KJ4A 3FTUA 3MZGB 2Z93A 3L3GB 3WIAA 4XMLL 4K23H 1GGCH 4E0RB 3ATBA 4CVZA 4S1DC 4FMFA 5CJQH 2YJLA 1IGFH 2ZZUT 3ARXA 3O0RL 4L4TE 4PI0A 1PKOA 2OSLB 3VXRD 4MNQD 1I3UA 1FLTX 4NRXB 4M6NH 1EFXD 2IANE 5TDPA 1KEGL 1F4XL 3S34L 1MIMH 2UXVA 3RHWK 3GBDA 5DS2A 3S3BB 1PFCA 4M3KB 4CMMA 5D7LA 4ZMOA 4NQXB 1R6VA 5B1JA 3RNKB 4L9LB 2BHFA 3ZMNA 5F1NA 1VDGA 1W0VA 4M48L 4YX2L 1EJ8A 3D8MA 4NCC2 3KR3H 3LX9A 3II2A 4XBGA 2G5RA 4YGVA 3FQXB 1OM3H 2DQTL 4HVBA 3P0VL 1JVOA 4K2UL 3QJSB 4WJ5A 5IQNA 1IEBB 4PJDF 1M6UA 3QWRD 5C1MB 2F74A 2BCKB 4XXWC 3OKKA 4QJ3B 3GNMH 4EI5D 2A83B 4XP5L 4NGHL 2XFGB 2IDUA 5BRZB 4D7BA 2IH1A 2E27L 5ITFB 4RAUB 3ME0B 2D4FA 3KH3A 4Y2OB 5HYSA 3WAJA 3ECBA 5IB5A 3WHE1 2RFXB 3BSGA 4AIEA 3HG2A 3QWQB 3KPPB 2CUAA 3W2DL 1C08A 2P26A 2BOBA 3CH1A 4GSQA 4KQ3H 2X88A 5KVFL 3NRQA 2Z91B 2QV2A 2FWOA 1E4KC 4NPYB 2YAFA 5EOCJ 1X44A 1UM4L 3MODH 2X4OA 1PJ9A 1WTGT 2AJZB 3K0YA 4LBEA 3TYGL 3WFBH 2NMSA 5FYKH 5M95B 5KYUB 1JWMB 4M7ZB 4NQCD 2EE9A 3MV9A 3S34H 5IJCC 3SDCC 5G55A 3R4DA 4JDZB 2R8SH 1WICA 1PZSA 3FC8A 1EGJL 5FGCE 3NCFB 5IMLB 5HTSA 4FHJA 3S2AA 3MPCA 1UFUA 1RHFA 2IDFA 2W9EL 4PJIB 1G6RL 4Q6IC 5FOBB 5AVVB 1W8EA 3UAJC 1VRSA 3T6WA 3GMNB 1TQUA 3ZBMA 3NZUA 1SOQA 3RWFA 3G5VA 1OALA 1USQA 3P0YH 4FFZL 4I77H 4XOBA 3VXSD 5JIKA 1OP3K 3ME0A 3GXTA 4OCRH 1T22B 1J5OH 2JV6A 4RMTA 4ANKA 3PAYA 4HKZB 4UB0L 1KIRA 2YMXH 4JKMA 3ELAT 2ROYA 5TF1H 3TNMB 3DROA 1NC4A 4U1MB 4YZFF 4NKIL 5PCYA 3ISRA 3N0AA 2AQ1A 3GQFA 2N7SA 3ZZ1A 2R1YB 3SOTA 2QVMA 1KB9K 3B8YA 5DUPL 4JM2D 1I9IH 1MZYA 3PIQB 1OIOA 1L9RA 5T1LA 3VG9C 5JQHC 4JPVL 5DJDB 1KTLA 5I1DB 3P3SA 2BW5A 2JNZA 4YHYB 4MXWH 2VDLB 3UZVA 3UDWC 1EAQA 3EW3B 2EE0A 3HZMA 1EXUA 4P2QD 5DUBB 3GMOA 4FXKB 3RWJA 5F6IB 2Y6TE 4LSVL 1AHMA 3NOIA 3MA9L 3VD9A 2PW2A 1U92B 4U1SA 1WFOA 3VI4B 5LCVA 2VT0A 1OGPA 2RD0A 2XQYG 4HAFA 4JO3H 1A5FL 4JO8A 3U4EA 5AENA 5IB3B 4HSCX 1P5VB 3X14A 1O6VA 4I48B 2A9NH 2FVNA 3GUTB 2ERJB 4WV1A 2H2SC 2O5XH 2SEBA 3ZDXE 1JWMA 4JRYE 4AQ1B 1DCEA 4E5XA 4YBQD 2A4ZA 3PXHA 5AZEH 3ZE2E 1WBXA 3KPNA 2DLFL 5DI8A 5LGKA 4JKLA 4WO4B 2VLMD 3SDDD 4JY6B 1T2QH 3MLXL 4D9LL 5DEFA 3OAWA 4E9XA 3TEYA 5KTEL 1GZPB 4N2MA 3RTQA 3CXFA 6CGTA 1ZV5A 4IOSA 1CXIA 2YAOA 3IDUA 5JUEL 4FNLL 4DP2X 4YHYC 3JYCA 5EBGA 3P30H 3DJRA 2A9NL 2JH2A 3O2VL 5I9QB 2WYIA 3T4YB 3HAEH 4KI5E 2OI9B 5C0CD 5T1KB 5J11B 5DJ8A 2CGYA 1RXLA 1YPZE 4YHKL 1EEYB 5I82A 5DJAB 4GG6A 1X4YA 1QFPA 4HUCA 3INOA 4OGZA 2Z64C 4Z0XB 5C0FA 4HLZH 3APMA 4GSUA 1JZ7A 3US1A 3ILQD 2ATKB 1Q0EA 2YD2A 1KMGA 1J05B 1HZHH 2EYRB 2Y3AA 3OHXB 5J1AA 1FNGB 2ORBH 2QLVB 3BMVA 3VVWA 1PEWA 2R0ZL 4MJ6B 2IVFC 1YC8A 2WK2A 2F19H 5CZRA 2IH8A 4BINA 2IANA 2R29H 4KFMA 5CM1A 5BV7H 1MVUA 1KLUA 1BXVA 1ZPUA 3ARGA 1MCCA 5AKVA 1JWSA 1EH9A 4XT1C 4R90L 1H15B 3UBGA 4DK6A 4WI0B 4U1LA 1VADA 3DIFA 4NO5A 1KY7A 3ZTEA 1AO7D 5LGJA 1R3IL 4K8RC 1GGIL 2ESVB 2C7FA 1UACH 1PQZA 1E3FA 1QOKA 1I7RA 1B2WH 3CVIH 2X12A 4DPRA 2MTPA 3L54A 5J8OA 5AZUA 4W9LC 5SWSD 2W9LA 5HPMB 4XPTL 1BVLB 4LFHG 3R0MA 2NTFA 1IEBA 1F1GA 4JDZA 2CJUH 4CNIA 5CCKH 4I77L 3D3VA 2Y2WA 4Y5XC 3FK3A 4UQ2A 3TL5A 1JXJA 1JNHA 4XAWL 3VFSA 1KIQA 4AMWA 2YLKA 5IOPB 4TTDD 1KCLA 4L18A 3CC5B 4PU2A 1D5ZB 2DEWX 5C08D 4LCCC 4PJ5E 5C0JA 5D96B 1M1XA 1KJ3L 2AEQH 3TCTA 1C08B 2KBGA 3CH1B 1RZ8B 4X7TB 2OMBA 4ZUUA 2R39A 2PTTB 5E2UH 4A1RA 5MEOB 4DUXA 2IBZY 3MRQB 3WHXA 5IF0B 3BWAB 1SYVB 3WJLA 1OF2A 3SB3A 3FNKA 2LVCA 3EDKA 2N1TE 4L8SC 1UUNA 1CE6B 1A1NA 2GW5A 3NT0A 4AT6A 2R1XA 3H3PL 5ISZB 4IOIA 1C1EH 1NC4B 1V3KA 5IFAL 3U2SB 4GW4B 3MXVL 3Q3GA 4JN2B 2XACC 1ASPA 4M7KH 4AEEA 4ELKB 3VD0A 5C97A 2AGJH 5E1GA 3LQAC 3BZEB 2VZSA 2PABA 2H8PB 5KYXA 3U0PA 4PBDA 1AS6A 1VF5C 3UTTA 3EDFA 3J07A 4G5ZH 2FYYB 4Z7UA 2J1ZA 4BSWA 1UT9A 3FHAA 3QR1A 3GSOB 4IDLA 3NRPA 4I88A 2BOLA 1A9BA 1ESOA 3HA0A 4JFEA 5DFTA 2ZKWA 4NB7A 2X4RA 4XNQA 4MX7B 3EOBA 2H0JA 5EB9A 3T77B 4MD0A 4YJZL 2Q2LA 5KVDE 4NRXA 2VXQL 2QKIB 5CKGA 5DFWH 1DVYA 5ID0B 2WP3O 2A74A 2C34A 3HHRB 2CHNA 2ZX7A 3GJFK 3MRRB 2OTPA 5DUMH 35C8H 1S3KH 3ULUC 4Y16D 5GS1B 3V4PH 2B1AL 5ACMA 4HIPA 3TA3D 5MHSE 3S3DB 1GGTA 3V4VH 3GTVA 3AABA 1N8ZA 5CJBA 2CBQA 4YIQB 2YQ3A 2ENYA 3KLDA 4Z8FL 2XKSA 4MZ3A 2O1AA 4XPAH 2Q3AA 2DI9A 1P2CA 2A6KA 4ZG1A 1GH7A 3MREB 3L4VA 5CLXA 5F71A 1FYTD 5IBUG 3BRGC 3AXLA 5F96L 3SGDI 4OGAD 2YZ8A 2QGDA 2E9BA 3ECBB 4JFDA 4P2YA 4PG9A 1YEFL 1ACXA 2IBZX 2J6WA 4PLJC 4WNSA 5SV3A 5IHLB 3ULVC 4NO0D 3G5YB 4QHPA 3J27A 2VITB 4ONFH 3DETC 1BVKA 5A16A 5EF0A 1RFDH 1RVFL 4H26A 1MHPH 1L3NA 4OGYL 4XGZA 4AUJA 3KS0J 3IKCB 3D69B 2VL4A 2HMIC 4ZMLA 2XOTA 4HU8A 4DGWC 1MFCL 3HRZC 3RFZA 2AEPL 4WGWB 5T5NF 1XX9C 4MASA 3G3LA 2WLLB 4QJ5B 1ZWIA 3WELA 1E7UA 1ONQB 1CLCA 3DPBA 1J1OH 3LKQB 3M7FB 1BJ1H 5D1ZI 2UY6A 4HBQA 1SHMA 3BIKB 4RMRA 1FL3A 3VVVA 3WEXA 4P49A 3N1GC 3PPEA 4K7PY 3S3PA 1M53A 3HLKA 5T1MA 3ZXAC 2NZ1A 4AQEA 1AKPA 1KPRB 3VB8A 1RZJL 4UM9D 3BEWA 1PFOA 1WBZA 2AAAA 3D2UD 3D85A 3DDFA 2OS7A 3WFCH 5HI3C 3CVDA 1WWBX 4XGZB 1QBBA 1S9VA 3F7YB 5KBKA 4HJ0C 1XGUB 1JZ5A 2OYLA 2YMTA 3GSNL 5DGRA 5EZLA 1KCRH 1B0GA 1U91B 1P0SE 2WZPD 3RDTD 3UYPA 4OLZH 1D6VH 4RGND 3HTLX 4FLQA 3BW9B 4YHMH 2QMKA 1RURL 4R8WL 4O51A 3RIAK 5BZWA 3V0DA 2B8OT 2H1XA 5DDHA 4MJIE 1QAWA 3OF6A 3VG0L 4U3SA 1PLGL 3JXAA 5L8LB 4XVSL 3S3JA 1FIGH 4L4JA 1M71A 2DJUA 3O0LA 1FGNH 5FK9A 1HEZB 2HJKA 5A2FA 4CRPA 4XNZC 5CSGA 3RUGB 5EORH 5DHVA 3WLBA 5HI3D 4UOW0 1EHLH 1EHAA 1U93B 4APQD 1JNHB 2BHZA 3KNBA 3KLKA 4B9KC 2VDKB 4J23A 4YSEA 1MCDA 2QHRH 2NR6C 1YEEL 2I7OA 1BFVH 1X7QA 2J43A 1Z9SA 4AX3A 5FF6A 2UWEE 4ZUWA 5IOKA 2MPAL 4X4XA 2DY2A 3CE1A 3Q7JA 5F1SA 1JD7A 3F58L 3HUJE 4KY1H 3ZQWA 5I18H 1ZK9A 2VDOH 5E94B 5CJ8A 1XWVA 3FO9A 3OZLA 1G94A 2HKHH 4NNYA 3K74B 1E0OB 1NICA 4ZYKA 4PFEA 3WEAA 2H9GB 4PCTA 5TE4L 3FQNA 2K78A 2VDML 1Y07A 1DFXA 2NY2B 1F00I 3D4ZA 1T03H 1P84K 4QOKB 3CMGA 4K15A 4G80B 5FAAA 3VGBA 5ESAB 1TQSA 4AQAA 2HMID 3NTCL 1QBMH 1FNSL 3QORC 4QTFA 2FYYA 2AXFB 3QAZC 4LPWA 4KKCC 4WJG3 5K9QG 1CWVA 1MFEH 1NTDA 2YQGA 3GJFH 3EYSL 3OXSA 4NJ9L 2VABA 1H8NA 3HG1D 4O00A 4Y4FB 4GIAA 3SKOA 3KLQA 4ATTA 4GUQA 5I1IH 1VGKB 4BYHA 4NBXB 4CADB 4F7EA 4ODVH 3RX8A 1IX2A 3BVUA 4X42A 4IW4C 1I8IA 4BGDA 3CVHB 1P2CB 1ZK5A 4E9SA 4A2GA 4AZ8A 1DCLA 2VTFA 5K9KA 4XCEB 5D7IE 1N5AB 2BNRD 3B9EA 3HNTL 4A7GF 2KH2B 4PJ8A 1IMHC 1GMEA 4XMTA 1YZZA 4X0NA 3NIFF 4HWUA 5DMJB 2ALAA 3GHBH 4Y19E 5LBSA 1RUAH 3QIUB 4JY5H 5LN8A 2P42B 5CHNB 4PHXA 1JZEA 2HRHA 3IGAA 3FRUB 3UZQA 2DOCA 2PR9A 1EJ6A 2ZOKA 4PJGB 4BM7A 5L6YH 2D03H 3GM0A 4N5UA 3SYCA 3ARRA 2B7DT 5SX5K 3O45A 3AG2B 5JUEH 1WP6A 1L6PA 2KZWA 2QVIA 4H1LH 2WLKA 3UEQA 2Z35A 1T5XB 3NPZB 4JGNA 2L7EA 3H4FA 1PQZB 4ZZKA 1G9EA 2IAMB 3O2DA 1MFNA 5FUCC 1AAJA 1M9SA 1BIHA 1RZGA 4LKCB 3CVCA 1MI5B 3WFHA 1WPCA 4AY0A 3GIVB 1M2VA 3P4MA 2E9WA 2R2BB 4PJCE 1NGZA 2P8MB 2IOIA 3AC0A 4LLDB 4F9PC 1CUOA 4CJ1A 4RVBA 1AANA 2KLSA 3SDYH 3EJTA 2GSIB 1A6TA 2FUTA 4I87A 4M62L 1AXSB 3GMOB 2NRDA 1KBKA 4Z3FA 4QRTA 2EEDA 1CU4H 2FBJL 1AQDA 4S0SD 4XMWA 5F6IC 3F7VA 5AOZA 3VB9A 3P4OB 4KQ4H 5FLUA 2W07A 4XMKH 5H35A 1DVZA 3B8SA 3I6KA 5BRZD 3GSXA 3L08A 2JF1A 3LN4B 1JTOA 3DV6B 1NUFA 3L2LA 4C55A 4F1SA 1E27A 1ACZA 4B9ZA 5ILTH 2MQGA 2J73A 3MFFA 4LCWA 3F85A 4XVSH 2VXSL 5T1KA 3U6XS 3R0NA 1PDKB 2AP2A 4EI5C 1RKRA 4RX4A 1MCIA 1D6EB 4GXUN 2UYLA 1IC1A 1T1WA 4L9DA 4PJGF 1GIGL 3ARPA 2IG2H 1AACA 1M6OB 1KDJA 1MRFH 2M83A 2O6CA 2QFPA 2WTOA 4BZ1H 4RQQA 1JYVA 4YSOA 2NY4D 4N0UA 4L0PB 2RQEA 1AZCA 4GAJH 4RETB 1J9CT 4Q9RL 2ZYRA 4WNQB 5FWRA 5CCJA 4G2AA 3I9IA 3J7HA 3BQUB 1PPIA 4JGUA 1OAJA 4JY6A 3MBEC 2J56A 3KVDD 2XN0A 4M56A 3TZVB 1MVUB 4OQTA 3U0WL 4BDVA 2IDSA 4PP1C 3KPOA 3L7FB 4TOYH 2LV4A 1M05A 3WO4B 3L95B 5A6LA 3UZEC 3BKCH 5IMLA 1BMWA 2W1NA 5TH2B 3Q0HA 4YSAA 3EXLA 3D25A 1PNCA 2D31A 4OKVA 1NKRA 3ABKB 4FD0A 1TTCA 3M17B 1A3ZA 1KJ2H 4N2FA 1EHXA 4A7UA 5EU4A 3IDIA 5D7JB 2V9TA 3D1MC 3T6XA 4PJAA 2CO4A 1Q9OA 1A6AB 1WD9A 4RMWA 3TFKC 2P5WA 1O5PA 5GRUL 1ML0A 5KVDL 4JHVA 1KXQE 4WRLA 4X9HA 5HVHB 4P2OB 4X5RA 1UXMA 3LXUX 4R5VA 1DJZA 1NAKH 2EKSA 2CU9A 1ADQA 4CN1A 2WTRA 3QZOA 1MCRA 2FX7L 5SWZD 4K3HA 2WOBA 1JPFA 2VAAB 3JV6A 3T6VA 4FFVC 2XXGA 4HLJA 4H0GA 4R4ND 4LEBA 4G7VH 4C58B 7CGTA 4P2CG 2R1YA 1CFMA 1QSFA 2DBLL 4KQ3L 2CRZA 1HL8A 1Q0XH 2Y7SA 3AREC 5SX5H 1NBQA 2P28B 2EC9T 3MJ7B 5MHSD 4O02B 3KD4A 2YLHA 3B56A 3TNMA 1JGUL 3FF7A 4OCLC 4PRIA 3RVXD 4KROC 2H1PH 4LIQL 3L5XL 2CZNA 5D2NC 1A65A 1NBZA 1OB1B 5F1KC 3GUFA 1OTTD 3DDGA 3C5ZA 4M3JA 1QTYT 3SQRA 5ADOH 3B2XA 1YEGL 3RGHA 1X4ZA 2XG4B 4QXWA 5AB0A 5BVPL 4LSPH 1BZ9A 4UQ3A 1PVHA 4MMYB 3QS3A 4LVNC 2K70A 1AD0B 1ZANL 5JXEA 3MLTB 1JGDA 1RPUA 3OBAA 1UT2A 2VC2L 3ARED 4KMTH 3ZL4L 2Q6WB 1HL5A 5GISH 3HMXA 4PJAF 3DMMB 3ZE1E 4IKNA 3F2LA 4KK8D 3RGVD 4GAYA 5BVPH 5C8JA 1N26A 4ISVB 3MCLH 4J3SA 4R83A 3HB3D 4JO5A 2PWDA 4X7DC 4UIMB 4FE9A 1KENH 1S3RA 3D3VD 3V0JA 2WLIA 3TCXA 1A14L 3UP1A 3IMVA 4WLCA 1BQRA 3GXUB 3O4LE 3TBWB 5F9WB 3O11B 1V7ML 2YEQA 1VIWA 1BX2A 3HMWL 5LG1A 5HYJD 3LNIA 3QEHB 2WVTA 2NY7L 4N85A 2MOVA 4N8CL 3QS2A 4I0PB 1ZANH 2C26A 5DC9B 5FPIA 1I9JL 1P6AB 2YN5A 5BO1L 2FYVA 1IT9H 4I3SH 3PP4L 1SXCA 3EGXA 1XT5A 2UZYA 1G7PB 1LO4H 1KSRA 2FX9L 3WIFA 4IGBD 3K72A 3JWNG 5AAMC 4KITB 3MCKB 2OULB 3TWYA 5JR1L 3OKYA 5IVNA 5C0ND 1XGPB 2EDJA 3MLSH 1E28A 5F7MC 3SQBB 3JWDH 2WBJD 1MLBB 4YDIH 4PGBA 3DURB 2BZCA 4RGNE 4HHAB 5B1BB 5DMGD 1L5GA 1EMTH 3OXSB 4H8UA 3VUAA 3EO1B 4L5FE 2OSLA 2FLRT 1R0AL 1P7HL 1CG9A 3EBIA 4CBPA 4N5ED 2PXYD 4P2RE 3HPJB 3KBPA 5SX4I 4WF7A 2BERA 5J9PB 5CO1A 5I17A 1CXLA 3VDAA 4YFLI 5EU6B 4U33A 2L3BA 2VC2B 1KJ3H 3QEQA 3MBEA 3CSFA 1AMYA 1LP9B 4J4PC 4NQSB 3S0PA 5IMOB 1NBVL 1F56A 3HE6B 4G72B 4KJYA 3FO9B 3MCYA 2WQUA 2FQEA 4TYUA 4CVWA 2XV3A 5JOPD 3UZEA 3HJEA 2XV2A 2APSA 2K45A 2XFXB 5IGXH 3IDGA 1CR9L 1S9WB 1U8KA 3ALWA 2VQUA 4NN7C 1T6BX 5EWIL 1ORQB 3TIEB 4IBQA 1IKOP 3ROOA 2HG5A 2X9XA 5IFJA 1PSKH 4DKDC 3ZLQC 1UM6L 1D5MA 4NQCA 2VLRD 4JVWA 1ZHNA 4GQ9H 1CFTB 2VLJB 3CG8A 2C7UB 1JI1A 3CSGA 4P48A 4QF1A 3WY2A 1SQ2N 5CP7A 3FCBA 1BYOA 3CBKB 1QBLL 4GRMB 4Y5VB 7FABL 1Q8MA 4WHCA 4PREA 3K71B 3KPQB 4XZUB 2FWLB 4ALAC 1UB6B 2IEPA 3PRZA 3ZYOA 3RX9A 1WF5A 5F89A 3MJ9A 4MNHB 4TVPL 2EXTA 4IOFD 5JO5B 1UD3A 2XBZA 3AGVA 3H2WA 2CXKA 5BRPA 4LL9A 3HC3H 3OTTA 4YBQC 3C6LD 2V2XB 3VI3B 1WWAX 1HCVA 5I30H 1A6PA 2DL9A 4FTVE 4NZRH 1B0GB 1MFBH 1KJVA 1ZRUA 1AGEB 5KVGL 3SHSA 3T0ED 2AJ3A 4Q6IB 5KBLA 1BMZA 4NXSA 2GT9A 3O6FD 4UQCA 4IIQB 3MJ7A 4WKXA 1THCA 4ZPTB 3O3DA 4WWKA 2ARWA 5BOJA 2YEVB 4S10A 1Q9WB 1VESA 2D2CC 4Q58C 2Y22A 4YGAB 3RWEA 2EVFA 2JCCA 3VH8G 4HUWA 1J1OL 1N6UA 4Z95L 1Z9LA 1NFIB 5FA3B 5FO9B 2DKMA 5TE7L 5ID1B 3O2VH 4FGMA 4QOKA 5TE6L 3WLWC 2Z8SA 3G5VB 4J12A 1E4XL 2DQUL 5E7FA 5TTRA 5E0QA 4C47A 3KWWB 1XHHA 2O26U 4QRUA 2GJ6D 4JGJA 2EE2A 4JFFE 1C5CH 2VGLM 4KTGA 3EHBB 3DRQA 4HEPA 4LSSL 5DZOA 4AQOA 2OAAA 5GSRA 1OAXL 4NO0B 1KB9J 1F8TL 1SN5A 3UBXI 1OP9A 1XMWA 1NLDH 1B0RA 1CU4L 1INQB 2QSTA 1LO2L 1JXFA 4DQOL 4PRNA 4U3XA 4KX7A 2LR4A 5F7LB 2XX0A 3FQRA 4MJIB 4GRWB 5GJTH 3CZJA 5INCB 4B9CA 1HOCB 4J3OD 3QNZA 2BIIA 4M6AA 5CEXB 3REVA 4Y2DD 3BVNA 5JHAA 1F0LA 1PNDA 4JZOB 4GO9A 5D2NA 4HPHA 5GJTL 5JXAL 1F6AB 4ZOBA 4FS0A 1RZJC 4QHNB 1FHGA 1NC2B 5C0BB 3WDIA 2VQTA 1AVAA 4XH2A 3ZRFC 3CLFL 1SM3H 4F9LC 2ZOWA 1IGJB 1XGQA 3H53A 5DFVD 5DJXA 5CSBA 4FQCH 4KY1L 5HI4C 4UIKH 4APXB 5C0CA 3DYPA 1NAMH 4HKJB 4ZUVA 2IALB 2L4OA 3TJHD 4N6RB 3FQWB 1P53A 2UX6A 3QG6A 3NTCH 5LKNA 4F92B 1N0XL 1S7UB 4WAFA 2YQBA 2ZOOA 4PS8A 5FO9A 3FB5A 3O3AB 4PBVC 3FFDA 3WY3A 4QRQA 1YNKL 2WVVB 4DTGL 3LZNA 4HIIB 3VFMB 1XIWD 2MNWA 3TBTA 1Y18A 3LV3B 4KNTA 3NCYS 4QHNA 3WFHB 4KHXH 1U8QB 2VYRE 1XGTB 1KBGL 1LL1A 3T0XA 3N6YA 3QC6X 5D2NB 2E46A 4NT6A 1COBA 4ODTL 3W9DB 4AYSA 1NSNL 1HL4A 5C0GA 3ALPA 3PG2A 2MKWA 1HESA 1O6TA 3V7AE 4H8VA 2X6VA 2XN9B 4P46A 4Q89A 3HR5B 1VAHA 5TE4H 2ZG3A 1MFBL 3NJVA 2AJVL 2IH9A 3IAQA 2A9AA 1HXMA 3EDDA 2M2DA 1TXKA 4LPVA 1HCFX 2A6KB 2B3IA 2CM5A 1I82A 1KDIA 4TSAL 4A63A 4LQ1A 1RH8A 4AQ8A 3EKCA 2LU3A 3LRKA 3MV9E 4Z7WE 3JZ7A 4IDJH 4AV5A 3CCHA 3M7OA 3S37L 3MJGX 4ZO7A 3U83A 5KSVB 1Z9MA 1BVLA 5DRZA 4U1IA 2R2HA 3HFFA 3P11L 4EQ3A 2XFXA 1G1CA 5F3FA 3CSPA 5JHBA 2C9VA 1MHHB 3QXUA 5EORL 2AI0L 1G1OA 2R2EA 4IRZA 4LASH 4TOYL 5K59E 2D7TH 5I1GH 1BAWA 5MEND 1FYHB 2DWSA 2IDTA 2ZWLT 3AXHA 3GLAA 4LCCB 1UJ3A 4RWHA 3QUZD 2BP0A 2BMKB 4QXGH 3WJJC 3MCKA 3ZGIA 4U0RB 5IQ9A 3RGBA 1HINL 4HSAC 4TVPH 4WFHE 1OW0C 1M57B 3SDAC 2LFEA 2VXVL 4P2AA 4P5RA 2JKIS 5JOPE 4FZ8H 1MFCH 2R1XB 3T2PA 3C9NB 3UPCA 5EC2A 2LW3A 5MEPB 2UZPA 3RIKA 5J6GA 3HBGA 3CMOH 4UNIA 2CSPA 2D0HA 5JMRA 1O6SA 2HLAB 1GJUA 1I53A 5FA4A 2XPYA 4HQQL 1DJXA 3DJ9A 4RGMB 4KKCD 1LP9F 3OMIB 5DRWB 1PYWA 1CGWA 5GHWH 2C9SA 4IRSC 2QKIC 3NIDB 3MKKA 4FZEL 4NWTH 5E00A 2YARA 1R9FA 1S7SB 5L0QC 3FCUB 1U8IA 5IW1A 1JNNL 4AEIL 1T20A 3ASNB 5C92A 4E41D 4HMCA 3NCYP 5HHME 1N5YH 4PCYA 1OOAA 4KVNH 1IFGA 1AD0A 2JJTA 1JS4A 1XSOA 1J48A 4AI7A 4PLKD 2WMPB 2IWGA 4LLMB 1FYTA 2N56A 2F8XC 4HS8L 3TU6A 1E8YA 4DWHA 5CGMA 1P1VA 2X6CA 1PG7H 1EMTL 2XWZA 4E5XB 2IDCA 4LKXB 4NO3A 1RJCA 4A37A 5L88L 2KQNA 3AU1A 1XL6A 3KW7A 1RLWA 1QSEA 3ULSA 1DBBH 4GW4A 4ALAL 4DN3H 2H26B 1T4KA 1ILSA 1E9OA 1ZT1B 3RWHB 5I17B 5C0DB 4LFHD 3BAXA 2HPOA 3NP4A 2YRBA 3MLTA 1A7QH 4A2HA 1FLRH 2MCAA 1O75A 4YUEL 1FNGA 4RNRA 4BUQA 1QLRA 5I71B 2UVFA 4QEGA 3IFNL 1W0WA 2O5ZL 3QNZB 2VN7A 3UTQB 3WAKA 3B2UD 4CU8A 2IO5A 3LJ3A 4G42A 3IMBA 1EO5A 2KLRA 4B9JA 4M7KL 2YC1B 1E4HA 3ZKXC 1YPZA 3AITA 1HXYB 3VU2A 4FAAB 2OX5A 1LMIA 4HMDA 4CA4A 4W81A 4XMPL 1KZYA 3PGFH 4XH2B 3DHMA 4CVUA 3FSWA 2WNKA 4HXAL 3TURA 3HKFA 1U8NB 3QT2A 5CUSH 4MMZC 4HV8B 1D7BA 5C7XL 3TZVD 4AQZA 5IM7B 3ARFB 4PY7A 2OMXA 5BQDA 3CV5A 4G8FA 4TULL 1FZJA 1A6ZB 3ESUF 2NQ3A 2HA1A 3S37X 1UWYA 3TP4A 2PPDA 3TJPA 1OAUL 3CK0L 5DZVA 1I1RA 1AYOA 1YY8B 1KGCD 3C5SB 5LCVL 3HFMH 3T5WA 5T1DH 4I1RA 3O6ML 3LKPA 4G7VL 4LVNB 4JY4A 3ROLA 1J0ZA 4PRNB 1ZY9A 3OF6D 4F58H 4HUWB 1Q9LA 2PMZA 3MLUH 5D4IA 4AKOA 1UXSB 3QPXH 4JRFA 2CMRH 3VFRB 3TYGH 3WFBL 4PJ9D 4Z76B 3PREA 5I2IA 2HLEB 4BA8A 4OFYA 5M7QA 4I0KA 3O6MH 3BKMH 4D0CB 3U6RA 2J2ZB 2DQDH 2OR8A 5MENB 5D7IF 2WQXA 5I8KL 4QTIH 1BQHG 1UB5A 5DUBA 2YOCA 2C9XA 2Z34A 3NIFE 2YC1A 1TU2B 4Z7QE 4NQTA 3MXWL 2ZF9A 1EZLA 4RZCA 1A9BB 3KPMB 3QPQC 1E40A 4MCYB 4K71B 2YKLH 3QZNA 1DQQB 4PLKC 3TBYA 1UB6A 4X6CB 4WU5A 1V5JA 1OW0A 3U6XA 1OGAA 3WJLC 2OCFD 2F53A 4FFZA 5HHOD 1NCDL 2EVGA 1JUFA 4GI9A 4K8RH 2H0EA 1O5DT 1HCYA 3VGGA 1NCBL 2IBGA 4PGEB 2ZP9A 5ISZA 1OARH 1NGZB 2P8MA 4P4KB 1WEJH 2HTKD 3TIEA 5AZEL 4M1CC 4A7TA 2ZONA 4MLIA 4HKBB 1KEGH 1IAIL 4LPTA 3SE6A 2G4EA 3LB6D 3VFTA 1P84J 2WM0A 4NKQB 4AL8C 4ANUA 1R75A 1GC1H 5F89B 2CR0A 2OBGA 1XXDC 3BDXA 3GI9L 3DXAA 2E5EA 4R9HA 4JLRB 3VSVA 1MRDL 1J10A 5IR1A 3TNNA 1E6OH 3RPBA 2EDMA 2VDRH 5KS9A 5E9DD 4RFNC 3UTSB 3HHSB 3VWJB 4F93B 3MRIB 4DFIA 5E4OA 1GIGH 3ATFA 4AL8L 1T89A 3SKJH 4ETYA 5HPMA 4L8CB 1F4HA 1V7NH 3D39B 3ULUH 1N5AA 1Q9LB 2CGRH 4LHUG 2JKWA 1S9XA 4JANA 2FEDC 3DX7B 2LFGA 3OGCA 1L9TA 4PG2C 3VAEA 4F5CA 5E6RB 4LP5A 1U8HB 1JZGA 2AQQA 2H6OA 2V5MA 2BNQE 4W9KC 1WA1X 3H6AA 4LSSH 4PJGE 2VQ1A 1BVNP 3B6SA 4ZRGA 4JRLA 4ZODA 1AE6H 3BAEH 4ZXBD 4KDVA 1ZMYA 1B88A 1NL0H 2NQCA 4ADJA 5J9PA 4DEPC 3T0DA 5FYLL 1CD1A 3EBGA 3VD1A 2VDNH 3BD3A 3DECA 3IXAB 2WO4A 3DPDA 1LE5B 3OKKB 1I1FA 1R5VB 3A5VA 4OIIH 5B3JE 5B7FA 4UTAA 4ZFZB 2FJFA 1RQ5A 2AABH 3PAZA 4MB3A 4YH6A 2YGOA 3QRGH 4KJWC 2D7MA 2GJJA 4FQ2H 3X3FL 1NPJA 2FTAA 2Z7YA 5J11C 2Y6SC 2JTYA 3KLHC 4MD5A 4MAYB 3N1PC 2EDDA 1DUYA 5LO7A 4MKTA 5I0YA 4DCQB 5DHMC 2CUHA 1LO5B 1EUTA 1XGPA 4N9OB 5FHBH 1MFMA 2E7CA 3PNWB 3DX0A 3IEAA 3MLVL 2KL6A 4E2OA 3ESOA 4PI2A 1VFBB 5CIPB 3WXVH 3OLGA 3L9RB 1MWAB 1LEIB 5AAWA 4OFVA 5AKRA 3QUGA 4QGTA 2C1OB 5DVOA 3PJNA 4MAZA 3GBML 5KYUA 4PH8A 1E7VA 4AIXA 1NGXB 3D52A 2B77A 4RFEB 2X70B 4XC1L 4FG6D 2LLLA 1M71B 5C3TA 1B9KA 2AI0H 5D2LA 1YY9D 4NOFA 2NDGA 4FNRA 2IIJA 4EZLA 4HF5H 3NYKA 2PO6A 4NKOA 1GPOH 3BP4B 4AE1A 4A68A 4Q9QL 4JJ5A 3DWTA 3BH4A 2ENPA 3SDDA 4PIBA 3VGHA 1T5XA 3BAIA 4YZFE 3DMMD 4EMZA 1Z7JA 1AHKA 3O41A 4WUKL 4X4XB 2FX7H 3IJSA 4OCNC 5C70A 4PY7B 3L3JA 5I1HL 3W0WD 1WAAE 5IGXL 1I1YA 1ZHLB 1CDCA 3SDXE 3I50L 4ODVL 1BGXL 3K4DA 2YA0A 2F54B 2QGCA 5ENWB 2W9EH 3O2WH 4ODXB 1DANU 3X17A 5LCVH 4X8GA 1AP2A 4M61A 4AMXA 3I6GA 5HYJB 1RK0A 3FN0H 4M29A 1Q72L 2PTUA 4WY7L 1PZ3A 2Z1PA 4G6ML 3UROR 5TDNA 1U4FA 4NLHA 2P5WD 4YPGB 5DJDA 3F7VB 2EH7L 3BIKA 3GHEL 4NHUB 2FWUA 3IJHB 1GGCL 4K23L 2FECL 3CVHH 3VTTA 2Q8AL 1O6SB 4NZDA 1YVLA 2ARJA 4P8QA 5FM5M 5LWYH 1AXTL 3L5JA 1KXQA 1WSST 3GRGA 5F0MB 4ZMWA 4X5WA 3FO1B 2HVKA 1FI8C 1U0QA 4L1DA 4IK7A 5TQ0L 5BO0D 2BOCA 1C5BH 2G9HA 2F5BL 3MA7B 3LH2L 4TVUA 1KPUA 2FX8H 3QUZC 4UZUA 1M05B 4NN6B 3UP6A 1OCOB 2OL3A 3GZPA 4GBXC 3OJMB 3P54A 3KLAA 5C0AA 1KCUL 1UURA 5ADPH 1IGCL 4BFRA 2H4EA 4IKIA 2EKSB 2APWA 5JIQA 2DM2A 4ZS6C 2BVPA 1G7HA 1RZQA 4PRIE 2PXYB 2W91A 2ZOKB 4KNUA 1H5BC 3RIFK 3S36L 3V0IA 3ZKXB 4B7IA 1F58L 5HHQB 5KZCD 4D94A 1E4XI 4DVRL 1SY6A 1FZJB 2V0AA 2NY7H 1XD1A 4GW1A 2X4QB 1SJHA 5FFGA 3SQOL 2C3WA 3JQOB 3SDAD 3TESA 4UANA 4LF3B 3M1BA 3MLWH 1T3FA 3ABLB 4B9IA 3D87B 4LVEA 1G1YA 1JZ4A 3JWOH 3QZWA 5AZ2L 4NPYA 4LB8A 1QNZH 3S35H 4U3SB 2EDOA 1DYZA 5IQ7H 2XUWA 3U7YH 3OQ3B 1NMBH 1ITBB 2Y69B 5D5ME 4HWBH 4JPWL 5EU6E 5KS9E 4A6YL 4Y2NA 2VIRA 1G84A 2H41A 1UUSA 3F6JA 4QTHB 1QTSA 2J88H 4G1EA 1X6NA 4YDKL 4OD3L 4JDTL 5F9WC 2N1KA 4Z7VE 3REWB 1D5BB 5D7LD 3GB7A 3QIUC 4TVSa 3LZFH 5CF3A 4PRBB 3N0PB 5GS1A 1JRHI 3UAFA 3VGAB 2VN3A 3X12B 4TNGA 4L1SA 2FJUB 5ABAA 2WXIA 4XVTL 4KUZH 5DTFA 3WL9B 2VZ1A 4YDJA 3L16A 5AAWC 1JMZA 3NCEB 1Z5YD 3AQZA 2ICWJ 3OLIA 1AZBA 1SYSA 1Q94B 4Y16A 4N2EA 1OAZL 3VDCA 2IF7A 4PAZA 5E6IB 1P4UA 5CHNA 1BLNB 1TNMA 5E7BA 3K6FA 4OLYH 4RISL 5JHDE 4ZNEE 2DWYA 3R4RA 4FLRA 3ZL1A 2VW6A 2YPVA 4NJ9H 2AVGA 3U1SH 3JVFC 3CIAA 3IGUA 3Q6FA 2PYFB 2UUDH 4J5VA 5F7EH 1YN6B 1JV2B 4XRCA 3Q1SH 2EDXA 2Z35B 3QJOA 4C56A 3ABGA 3QHFL 4WDIA 1J12A 3MV9D 2BWQA 4YE4H 3WXWH 4FHKA 4FQQA 1HXKA 1ZLWH 2YPVL 3QXAB 1F4YH 2FIRT 4E41A 4N26A 1CXEA 2WXGA 1A1OA 1EFQA 4NXKA 1BF8A 3BP4A 3X1EA 1TEYA 35C8L 2HT4C 4S1SL 2YD3A 3FRUA 4PJCA 1JZ6A 3D85B 3W82A 1N18A 3E9TA 1WHPA 2V9QA 4KJWD 4OLEA 1MG3C 1BLNA 4PJEB 5D2LE 1M3IA 4YR6A 1A14H 4MJID 3V4VA 5C9JA 3B7TA 1SYSB 3TN0C 4R0LB 1PIFA 1HYRC 2FX8L 1J1XL 1ACYH 4X99A 3U82B 3RTLA 1V3MA 1C5BL 2BSED 2ZNXA 3ZT7A 3D0LA 3MRPB 4QKTA 5IW3A 4DEWA 4PVNA 1XR8B 3S5YA 3P3YA 3WENA 3AXIA 4F3FB 2X6BA 3C8KB 2JTDA 3GSVB 5JPMC 2AK4D 1P69B 5GHWL 4D8PB 3ECWA 3VFGH 1MIEH 2H32H 2RGSA 3TH4T 1U3JA 2VM3A 4HGMA 4CMHB 4OF7A 1VHPA 3T77A 5AVQB 4EDWL 4LL1A 4PD4K 1BLIA 3DV4B 3HE6D 3A6OA 1HOEA 3EFDH 3KPSA 3ZKMD 3BPLB 1E6JH 4JDVB 4PJEA 3PV6A 3BZDA 1OF0A 4ZMYA 2EH7H 3GHEH 3TBBA 3ARYA 5D6DA 3UAEA 2LTQC 1BBDL 1BQHB 1FPTH 2RR3A 4JNXA 4FCAA 1IAOB 3OG4B 3TH3T 2WIIB 1BOYA 5EG6C 4E41B 3KR3L 4RH4A 3BN9C 3CN4A 5HDLA 2ZG2A 3Q2VA 4QJ4B 2EILB 2BY1A 3EYUH 3I50H 5GS0H 2RCSH 2V7HB 3G6JB 4JKNA 4TQIA 4P4RB 1DVFA 4ZS6D 3U4AA 3GKWL 4NRYA 4G8IA 2EIZA 3MLZL 1A7NH 4AYDC 1SY6L 1ZLUK 1R3IH 5EA0H 2NXZD 1V3LA 2D7TL 5I1GL 2FD6L 4J1UA 1ULVA 4YHKH 4M7LH 3VI4A 2BP8A 3I02B 5IOPA 4K3DH 4ZQKB 4YVUA 2CIIB 2KPNA 2IADA 1NAMA 2XTJB 1PD0A 1EJFA 4F8PA 4WK0B 2NTFB 1UYWL 1CI5A 4KAQH 8FABA 5FUOH 4PUBL 3WIHL 5I1DA 4HDIA 1JHKL 4XC3H 5DHXB 2ZOLB 5IEHB 1NWOA 5GGVH 1W80A 5HI5D 2AJVH 2PCYA 5DUJA 3PL6C 4KZCA 1IM3B 4IOFC 4P57A 5GS0D 3U7WL 1R24A 4KFZC 4P5KA 3VD4A 1F02I 3REWA 5FYKD 1C16A 4JG1H 2FEEI 1U3HB 1UCBH 2P9RA 3LEYH 4FLHA 4PGEA 2NY3D 3MRCA 5HGBB 3IWUA 3CN0A 4MNGE 4CU6A 5IBUB 5DHVH 1OCRB 5FV2A 1SHWA 2WZ6A 2ARJB 3HPLB 3ELQA 3HG1A 1ASQA 4PMEA 4DZBA 1CG9B 4XP1L 3REVB 1JPGA 1XV8A 4MJ5A 5DRNA 4KRPB 4NSKB 3SJVE 1AZNA 5CZVL 1JPFB 4AKQA 3DTXA 1Y1DA 2AEIT 4EEEA 2PR4L 5DK2A 1VKXA 3UTSE 4JFHE 1PJWA 2DWDA 1MZZA 2C3HA 3ZU8A 5KANG 2ITFA 3CXDH 4P2OA 4WTWA 3AUVA 4WV1C 1RU9L 1I9RH 3CFJB 1B6DA 1E28B 2X89A 1FFPB 2V5TA 4M8VA 1QEXA 5IVZA 5C09A 4QF1B 2IFGA 2YD9A 1FO0B 2VOTA 5BRZE 3JV0A 4MHHI 3U6RB 1KGWA 3HUJF 4XWGL 3MTXA 1FVCB 4GT7A 1QQDB 4KK5D 3LZOA 3AGWA 4EZMA 3NGBB 4G6FD 4GSDL 5BOZG 1TVHB 3VRLF 4LGRB 3E80A 3VCLB 3J2PA 3LQZB 2WUBL 3BP7B 2VUOA 1NFAA 1KXTA 3FB6A 1CF1A 2GTZB 4XWGH 3P4NA 5AAPA 5E8EA 4V1DD 2G9KA 3PQYD 4LQFH 4OVUA 1ZVSB 4HJIA 3RL1B 3QEQB 5IG7B 5KBPA 4MMZB 4A2DA 4ZUSA 1FGNL 5C09E 3BESR 1I9RL 3BGAA 2LU7A 3QUXC 1ZEAH 2WNXA 3ARGC 3E9UA 4MXVF 4MXWL 5JW4R 2VMEA 4MQXC 1DEDA 3P9WB 4YS4A 1KPUB 3JSSA 3RWIA 3FS9A 4CJ0A 4AIOA 4KI5C 1M42A 1G0YR 3S48A 2NNAA 3DX4A 1U2YA 1YN7A 4IMLA 1YAZA 5LBSH 1MH5A 4K3DL 1THAA 5BRQA 1E2WA 1IB5A 3A0OA 4DP0X 4CKVX 2AJYL 3BVXA 2VZUA 3T3MF 3KXFD 1BVNT 2VCOA 2VDOB 1FFOB 3CHSA 3KM1A 3UZVB 2J44A 1OAXH 5MEOA 4ZJ9A 5IUCA 1KULA 1JD9A 1HWGB 2PP8A 1DQLL 2XVKA