1OEZW

Zn his46arg mutant of human cu, zn superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
124
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVHEFGDNTAGCTSAGPHFERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amyloid-Like Filaments and Water-Filled Nanotubes Formed by Sod1 Mutant Proteins Linked to Familial Als
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 30
structure length 124
sequence length 153
chains with identical sequence X, Y, Z
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oezW00
1E9QA 1TO4A 3CE1A 3H2QA 2WKOF 3GZQA 4BD4A 1SRDA 2C9VA 2AQRA 2WWNA 3HOGA 4A7QA 3KH4A 1N19A 1SXSA 2NNXA 1SPDA 1PTZA 1E9OA 1SDYA 1XTLA 3CQQA 3GZOA 1OZUA 1N18A 1SXZA 1E9QB 3SODB 4L05A 1AZVA 2AQSA 1UXLA 2XJKA 5CU9A 4OH2A 1CBJA 1PZSA 1TO5A 1F1DA 1IBFA 1COBA 2AEOA 3F7KA 4A7TA 2R27A 2AQTA 4FF9A 4OJAA 1IBDA 1F1AA 2WWOA 4BCZA 3MNDA 1FUNA 1IBHA 1E9PA 2Z7WA 3KM2A 1OAJA 2WZ0A 3KH3A 1RK7A 2K4WA 2WYZA 1JK9A 3RE0A 2XJLA 1OEZW 1SXNA 1XSOA 1SXBA 2APSA 2Z7UA 3KBFA 3PU7A 1L3NA 2VR7A 3HFFA 2C9UA 1B4TA 2E47A 2SODB 4N3UA 2Z7ZA 3CQPA 1EQWA 2VR6A 4A7VA 4A7SA 1YAIA 1BA9A 3F7LA 3L9YA 2WZ5A 1F18A 1BZOA 2GBUA 2GBVA 1SXCA 1OALA 2WZ6A 3S0PA 1Z9PA 4A7GF 3GTVA 1JCVA 1JK9B 1OZTG 2AQQA 3K91A 1IBBA 4U4IA 1E9PB 2ZKXA 2GBTA 3L9EA 1F1GA 3GQFA 3T5WA 2V0AA 2Z7YA 4B3EA 1EJ8A 3QQDA 4A7UA 1HL5A 1KMGA 2WYTA 3MKGA 4MCNA 2AF2A 1S4IA 2ZKYA 3H2PA 3LTVA 3ECUA 2ZOWA 1SDAB 1P1VA 3ECWA 1HL4A 2LU5A 1Z9NA 1PU0A 2C9SA 1SXAA 4N3TA 1XTMA 1DSWA 5KBKA 5KBMA 2WKOA 1YAZA 3HW7A 2VR8A 1YSOA 4A7GA 2Q2LA 4BCYA 1U3NA 2ZKWA 3KM1A 1DO5A 1QUPA 1MFMA 2JLPA 1IB5A 3KBEA 1B4LA 1UXMA 5KBLA 2E46A 3ECVA 1CB4A 1E9OB 4MCMA 3QQDB 3GTTA 1Q0EA 1SOSA 2AQPA 3GZPA 1ESOA 2JCWA 2AQNA
chains in the Genus database with same CATH superfamily
2VDLH 2KLSA 4Z7WF 2IDQA 2CGRH 3RIAF 4JRXB 3NCWA 4BWTA 2W92A 3BT0A 4FXGB 5E2TH 4CVXA 3OZKA 2B59A 1TQTA 1UXSA 4PGEA 4M8RA 4ZXBC 1K8IA 2ZUXA 3FU0A 3MV7B 4GH7B 2H32A 5DRZA 4UILH 2IH3B 5IG7A 3ARZA 2CRYA 2JB6A 4QAMB 5FM8A 4I3SH 4FNSA 4NKOB 3K5SA 3RZCD 2K6ZA 1CC3A 1HI6A 1CF8L 4N2OA 2Q87A 1EBPA 1BFOB 1IBFA 1ZA3A 1JG9A 1N3NA 2A6DA 3I6KB 3ZDXE 4C8XA 3BD4A 5C0DB 4QRPD 4F5CA 1NMAH 2V9QA 3T8XB 1S7QB 4WI0A 5KWYC 1O6TA 2VAAA 1RFDH 3DPDA 4WUUA 4ELKB 2YD1A 5EBWB 2IAMC 1BWMA 5I28A 3IE4A 3UC2A 3GRBA 4J1UA 5TDPB 1NCCL 3QEUB 5I73B 2N7SA 3OLGA 3F6LA 4Q9RL 1KY6A 2NXZD 4LVNB 4X8JA 4LBEB 5D5MA 2G2PA 4PJ8A 3TESA 2BERA 3B6SB 4PVNA 1A7OL 4J3SA 3JWNH 4TM9A 4LNRA 3VFSB 5GQBA 5FB8A 2W0FA 5AWNH 4PJAB 3QK0A 4IOFD 2WSDA 2YOCA 1AO7E 3GSWB 5C8JB 5DK2B 4Z7AA 4OZFH 1DBKH 4HH9A 2QSTA 4JJ5A 3HB3D 4G3YL 4HIHB 2OTUB 1CYGA 1A6VH 4QRPB 2OMTB 3APNA 4DGVL 5JMRA 5J06A 3J8F7 1N5YL 1AP2B 1QPPA 2BZ7A 4PRHB 5D6DA 4KAQL 1RLWA 2LLNA 3X1EA 1AFVL 1XGPB 2AJ3A 1JTOA 1HHHB 4MS8D 4LEXH 1WWCA 5CD3A 3VX1A 1RZGA 1SMAA 3ULUE 4Y9BA 5DHMC 2P52A 3TA3A 5I1AB 5DS8B 1LEGA 1YN7B 2CCVA 4LLDA 4MSWB 4F15C 1BQUA 2F53E 1EZVX 4LSVL 4MX7B 4QRFA 5ITFB 3N85L 4OSUL 1E90A 4G8AC 2APXA 5F1IB 3UFIA 3VMOA 2A9MH 2M83A 2W65A 1KB5B 4JFPB 1KTDB 2CO6A 1Z32X 4GRMB 1A47A 1KUMA 4GSQA 4Q9BA 5AW8B 3MRNB 5GS3A 5HHOD 4RETB 4Y19E 4E9QA 1WG3A 2P80D 4NUJB 4KHXL 4M5TA 1BF5A 1OCZB 1ORQA 2QV2A 2VABA 1I8MB 1JAEA 1UA7A 4G6AD 5JYMA 4XPTH 1HTYA 5IKCA 4YXHL 1ZHKB 1INDH 4OZHE 3EJSA 3P9WB 2OMYB 2E76C 1LD9A 1DQDL 1CDHA 2PYEA 2IXQB 2ZCKL 3DSFH 3F65A 3SZKC 4BGLA 1NFIB 3EGDB 1MLBB 3BC9A 3ZBMA 1U8OB 4F8LA 2R0LL 2I27N 3MPCA 4UIMB 4AEEA 2XJKA 1U3HB 2EXWC 2AV1B 4G6FD 3KJ6H 4I0PA 3NFSL 5KSAA 2MNWA 3RFZB 1F6FB 2GTWB 5J9PB 1KNOA 4APQA 1MKFA 1S7VA 5G4OA 2Q8BH 1GR7A 4LF3A 3GBML 4HS8L 4WW2C 4OJFL 3RGHA 4BFBD 2OCJA 1BQHA 2HX7A 3HIZA 1DP0A 1LVEA 2WJ7A 4Z7VE 5DJCB 5CEZD 4OGQC 5MEOA 5IVXE 3UIYA 1DVZA 1CLOL 1HN1A 5GRYA 1NCTA 5MENE 1ZWIA 4HZLB 4MNHB 5LLIC 1L0QA 4Z7NF 4KQ4H 2GY7B 5FM5M 1F5WA 2WQAA 1HZKA 2WBJD 2D2CC 2X12A 3O8XB 3FUDA 4F92B 1L9MA 5LGHL 2WVVA 3DV6B 5DQDH 1U8CB 3D08A 3FUHA 1L7IH 3FO0H 5FECA 3T4AA 1YEJH 1ZTMA 1PNDA 3PNRB 3GZKA 1YQVH 3VXRA 4S2SB 3T3MF 5CKAA 1IFHH 3L13A 4ICXA 5I1CH 1PKQA 2EEAA 4N4YB 3QUZC 5GRZA 3K7UA 3FT3A 5IMMA 4ZQKB 1S7TB 4ILDA 5KG9B 9CGTA 3QJZA 4RRPG 4WQOA 4Y5XB 2VDNH 2IWFA 4EUPH 3V0WH 3BWUC 3LPGA 4JDTL 4OLYL 4IBUA 4Z0BL 5E2UL 1MWAA 2PCFA 2AK4A 5ABAA 2ZG2A 2RD0A 2XT1B 5I9QB 1MEXH 4UT9H 3W38A 1CI5A 3IDNA 4NO5A 1ZLUH 1VZHA 5DEJA 5I18H 3FCBA 4X50A 3VSTA 3DO4A 1S5HA 4KTGA 4QR7A 2B9AA 2JLPA 1RZKC 1DL7H 1IEBB 3DRQA 2FK9A 5CGTA 3DVNA 2J8UF 5DRNA 5I15L 3BLBA 5K39B 4Z7OF 3GUTB 1T20A 3OZ9H 2CA3A 3HE7D 1DJWA 3IEAA 5KYUA 4DH2A 5DMIL 3RP1A 5T8IA 1Q0XL 2AQPA 4XMPL 4PLJC 5GGSA 3GMPA 3H3PH 4FTVA 4UZSA 3UGXA 3B2DC 1OCWL 4YZFF 4UV7L 1EK3A 1T83A 4F7MB 4J3VA 4BKSC 4HCRH 1CT8B 2Y1ZA 5H37A 3FQWB 1FG2B 2ZUWA 1IQDA 1IILE 3T04D 1F58H 3IF1A 5CUSL 1VENA 1BJ8A 5GRUH 3RA7H 3X3GL 1TVDA 1FAKT 4HWEH 1C7TA 5DWPA 1NLBH 1MJJB 3KVPA 3W39A 2R56L 3L3HA 1JWMB 4G72B 4YFDB 3E38A 3NK3A 3KYMB 3NCJL 1YY9D 2XZCL 3O2WH 3WS6C 3QWNA 3FZUC 1EPFA 4OLEA 2YXWA 3CXHK 2DOCA 1CTMA 2F7QA 2B14A 2VLJE 4LE8A 3G6AA 2XZQH 2CHNA 3T1FB 4PW4A 3RYMA 1RJLA 3S3DB 3WFDL 3CMGA 3OKMA 3QC6X 3DVFA 3HZ3A 3UTZA 3P30H 4KOBA 2FWUA 2HH0H 3QJQB 4N24A 1TZHB 2Y5TB 4TS6A 2XJLA 1JFHA 2J8HA 1PD0A 5CZXD 4DK5A 2Z1PA 1AI1L 4PJCB 4LARL 3MI6A 4JE0A 4P8QA 1E4HA 2XWDA 3P4NB 2ADYA 1HIML 3O2DH 5E1AA 3T0EE 2CGYA 2HCZX 2PPEA 4PRDB 2BRQA 2PPFA 3CX2A 1VFAB 4N1CA 1RFDL 2MCPL 2CD0A 1NAMB 3FF7A 4F3FA 4KTDH 3ZKNC 4MA8H 3MOBH 1F13A 1TQCB 1YRKA 3SOTA 4QHNB 5BRZE 3C5JA 3BUYA 4FFYH 1TLKA 4WNSA 3U4BH 1S4IA 5DJXA 2PCYA 2UXTA 2H9GB 3ROLA 3LTVA 3AY4A 1NBCA 5CEZL 1GZQB 4JRYA 3H55A 1Y6MR 4AGNA 5DZNA 2UY6B 4KY2A 1BAFL 3QORC 4CN6A 2A73B 3KWWA 4OFQA 2JTDA 4PD4K 5EV7A 5HPOA 5IVXB 2AW2A 4KQ3L 4OI7A 1JYXA 4TNGA 4WO4C 3BSHA 3ULSB 1T2QL 1FN4A 4XP4L 3PWJA 2YBRA 2I69A 2X6AA 5EMYA 3D85A 2CALA 3B1UA 3ML8A 1HXYA 4U7SA 1KGXA 1IT9L 1DHKA 1WC7A 2CRMA 1EEQA 3HVNA 2AEQL 1T7VA 4UTBH 5EC2A 1AGEA 3C5ZC 3BGAA 1UD6A 1QQDA 1Z0MA 3CSYB 1MF2H 1HX0A 3CC5B 5IB1A 3BFQG 3E6FA 4F33A 4YDIL 3EG9B 5F7KC 1J1OL 5CINL 1RMFL 5MERA 3A0OA 1DE4A 2H5UA 5K9KB 4NQVA 4ZTPH 1EX0A 1M1SA 4XN1A 4IGBD 3S37X 2B1HL 1AR1B 1B0RA 5KS9A 4LVOB 4KUZL 1BBJA 3KPRD 3LH2H 3WIHL 1CGUA 1IKOP 3B7RL 1E4KA 2IFGA 3ESMA 3QXVA 5FDWB 5DEZA 3EKCA 3H54A 4CC0A 3CG8A 5J6GB 1UM6H 1WT5A 2X70A 4QRRD 5BUAA 3O0RL 3CCHB 2PMZA 2JKNA 4QCIB 5F9DC 1XGTB 4NRYA 1RJYB 2YD5A 4Z3IA 4JQIL 3MJ9H 2YPLA 5JXEA 1G0XA 5T33H 4LPXA 2ZIDA 5DYFA 5DUMH 5T5FA 2A74A 4UM9B 4IBQA 3WFEH 3IRPX 1XBDA 1A7QH 4K07A 4O02L 4RAUB 4X4ME 3PDOA 5JQIB 1FFPB 1HNGA 2NNAB 3MDJA 1V3KA 4ZFQA 4XODA 2ZYIA 3DRTB 1P5VB 3QNZB 3MCLL 1T1WA 2CDEB 4W9ZA 1OE3A 3ULVE 3FB7A 2JKRM 1R3JB 3FFCB 1N9PA 4ACPA 1ES0A 1WFMA 4FN0A 3JV5A 5IWLC 5F3BB 2OMUB 3ECQA 1QYGH 3TBSB 2BVQA 3GO1H 5MENB 1I1FB 1SHXA 4KJQD 1N7MH 1ZWIB 1FFTB 4HZLA 5FLVA 2Z4QB 2DLIA 4QXTB 3FAXA 3VNYA 4AV5A 3RX5A 4ECNA 2EKSB 6FABH 1T1ZA 1WLHA 3AB0B 3DGCR 3O8XA 4OD2B 1SBSH 1T6VN 1QRND 1RUKH 3QE5A 5HYQA 1MHHA 4FQXD 2HPOA 2Z8WC 3FHAA 1A4AA 1AD9B 2P8PA 2F5AL 4LKCA 1QUNA 1AE6H 1UWXK 3HHSA 3K6IA 2V2WB 3HUJB 4XC3L 5KSUB 4C56D 2TSBA 3CDZB 3QQNA 4B41A 3EO0A 3T3PF 4U3CA 1R46A 4Y2DD 4AGOA 3U2JA 4OZHB 4Z7QB 4NCC2 2Y6SC 2NY6C 1NIAA 1H6TA 1ROWA 1FNGA 1E5CA 5HHMB 3DO3A 1XR8A 2E8YA 4LHUB 1OB0A 4BFKA 2MQ3A 4MD4A 3KGSA 4UILL 4YS4A 4NO0A 4WJ5B 2J7LA 1UQSB 3FB5B 1L6ZA 2JK5A 3DHMA 3F05A 3QDMB 3I3BA 4UNVA 4LEEA 3I6KA 3VFGH 5ADOL 4P2RA 3NJKA 4KJPC 1AGBA 1MEXL 4UT9L 1FQ9C 1IJNA 4ODTH 4RAVB 1MWOA 2WP3O 4WUUB 5GS1C 1YQ2A 3HPJB 1JZ2A 2F58L 1M7DB 3CD4A 2N4IA 4OCWL 1Z66A 2NZ9C 4H8PA 2AJYL 4IKIA 3LDBB 4ODWA 1JHKL 4JZJA 5D2NA 4RWHA 5T1KB 2XXFA 3JV0A 3WL9B 3V7MA 4QRUA 4YHYC 2OBGA 4NUPA 2R59A 4KH9A 5HI4C 3IMUA 1JD7A 2WUCL 1IC4H 4DQOH 1HINL 2X6CA 3FTWA 4J3OF 1QPKA 5HI5C 4JFEB 3G9VA 3P2TA 3RWFA 1YY8A 2L04A 4Y4HC 3T0WA 4L4TB 2A4EA 1UUSA 5FIEA 1JNHB 1KBGL 1RZKH 1UHVA 4HUXB 3I9IA 1ZHBA 1UFGA 2CM5A 5DEGB 1T03L 4I8DA 4K2UL 2EABA 2HLFD 5DLML 4JFZH 4U1MB 4N68A 5I5JA 3RGVA 5C0IB 1FSKB 2M8XA 1RIVH 2VQ1A 4G3YH 1AP2A 3S5ZA 2IC2A 4DPBX 2HSIA 4AL8C 1X5ZA 3PXJA 1T1YA 5F7HA 1ZSDB 2XFGB 1P84J 4L0YA 3NIFE 5JDJA 1HL8A 2Z4TA 1GPOH 1DBAH 3IPBA 3CHSA 3LKSB 3L08A 3QUMH 4TUUA 4WI3A 1I8IA 1M1XA 1Y0LB 2ICEB 3PF2A 3LN5B 4DPCX 5JQ6H 1NOAA 1KTJA 1WBYB 3CLEL 3GNML 5BRZA 3HE6C 5AD0B 5IJVA 4Y2OA 2QR0B 3J7HA 2AJSL 2IAMA 2EE6A 3UPRB 4GG6F 1Y6KR 4R7LA 2X1QA 3NGBC 4AYDC 3ZQXA 4OZIE 4QRTB 5EOQH 4M56A 3DNKA 2CMRH 2AF2A 2YK1L 4R97C 1XF2B 4U31A 2PWDA 4MA3B 4TULH 3TWCL 5GS0H 3U4AA 2W59A 5EOCH 1AIZA 3CHOA 2WLLB 3IRCA 4H20L 1T0PB 1ZA6B 1WIPA 1LQBC 5DJZB 4GXVL 4F9LA 1JL8A 1CPUA 4JFQA 4HD5A 1WSST 2GI7A 1AS7A 4Z0XA 5C0GA 2MCPH 3OAYH 3ZKXB 2OMVA 2MH4A 1MCPH 2IDSA 4ZNEA 2IH3A 1XGYL 3AREB 3HCVB 2OK0H 2OKMA 5DD6B 5I17B 1T2JA 1ETZB 4E42B 2NRDA 5HHME 5SWQA 1B9KA 2ZOLA 4YE0A 3APDA 4CN1A 2P8LA 3WIIH 3R19A 4JRXE 3UAJA 3MO1B 4L1HA 5TE4H 4F93B 5IOKA 5K69A 5D6DC 5IB2A 5D8JL 3U7YL 4XH2B 3LEXB 1IBGH 1QLFB 1YYCA 2VM3A 2BIPA 1KGUA 1JVOA 4PJ5A 4YN3A 4Z7UB 5GRVK 3SDAC 3APFA 4PGDB 4WWKB 3ARGC 2C7FA 3LQAC 3KXFA 5F8QC 4ZG1A 1B3IA 4MJ4A 5KEZA 2X53A 1G5GA 3GMLB 5KVDH 3KPRE 5IJCC 4UOW1 3VXPB 4LCWE 2YKKA 2X6BA 2IOMA 4HWNA 5I5MA 1SUHA 2NLJB 2QHRH 2RFXB 4YIQA 3D0VA 4Q52A 2DQUL 3BZ4A 3FCSA 4MRCA 4DGYL 1CZ8H 3QDJD 4G7RB 1OCCB 4RQQA 3Q48A 4N26A 3S2CA 2CLZB 2BNQE 4I9WE 4OAWB 4DO5A 2GC7C 4ODVL 3TJHC 2Y5EA 5DUPH 1OM3H 1RZ8B 1A9EB 3GSWA 5C8JA 2C9PA 3NG5A 2MTAA 2HTLD 4G8EB 1B6DA 3OPZL 1HILB 2J5LC 3AG4B 2ZKHL 5D1QD 3NYKA 3WLWD 1AXTL 2VR4A 2ZSVA 2VQ4A 3VFNA 4LOUC 3BAIA 1NKGA 1IFHL 2ICWJ 1KIPA 2IQ9L 5TE7L 3KW7A 3V4UH 5I1CL 4TTGA 5F6HI 3B9DA 1D9KC 3N6YA 5TTRA 1UACH 4N28A 4GRLA 4URTB 4Z95H 2CIIB 5EU6D 5DFTA 2A6IB 4PRIA 4ZUVB 4GQ9H 3V0AC 1B2WL 2VDQB 1EAQA 4PV1C 4WUUE 4DTGL 5E2UH 5HVFB 4RNRA 5J56B 4X7SL 5BMFH 1J0HA 4R2GC 3JWNE 3L9EA 4Z76B 4HC1H 4L1TA 1NLDH 3L1EA 3M1OA 5FKPB 2BPBA 2Z8RA 3LAFA 5ACMA 3T0EB 2LU3A 5T1LA 2BNUA 3KBPA 4G5ZL 3ZDZF 5JOFA 2K8QA 4LBEA 5D5MB 2MEJB 5INDA 2QQNH 5AZEL 2V2XB 3QZMA 1MAML 2AXFB 5TPWL 2YOAA 3L7EA 1NMAL 2PWEA 4IRSD 3UO1H 4NBXB 3WIHA 3BH8B 3ZE0B 2WKOA 1YYLL 3DO7B 4FNRA 2BFVH 2ZWLT 3BEVA 2EYSB 2OR7A 5BZXA 5I0VA 3W9DA 2IBGA 2IGLA 4HGMA 2R7EA 2WN3A 1A2YA 4J8RA 4Z7UF 3ZTDC 4CNIA 3ZL1A 5C0JB 2NT1A 3AG2B 1O75A 3C5SA 5I24A 2E7LC 2JTYA 4UBDC 3M1BB 1OVZA 4J3WA 4QXGL 4POZC 3W11D 1GGYA 2SEBB 5I8CB 5DJCA 2HRLA 3QUXA 4CKQA 1T4KB 3JQOB 3FTYA 5JDSB 5EA0L 4FHJA 4J3TA 2ITDA 2C3HA 1NGQH 1FPTH 3MRIA 4K7PX 3QQ3A 1H8OA 1JN6A 2A5UA 3S3PA 3SY0B 2NW3A 5IW1B 3SCMD 3TYFA 1JDDA 1KGYE 1HCZA 3HS0C 3G5ZA 1EHKB 5C08D 1YEIH 3QXTA 3WJLC 5CGMA 1NIBA 2R2CA 3QUHA 3HS0B 4J3UA 4FQQA 1RUPL 1ECYA 4GYBA 4RFNC 2A77H 3Q5OA 5GHWL 1Z9SA 3NRPA 4OH2A 4U6TA 2NCEA 2ITCB 5ID0B 4X4MA 4U1SB 2F08A 2XKSA 2VDKB 3QCVH 4L3EB 3RILA 3WJJA 4FABL 1MRCH 4JRFA 3ZKMC 3ZYZA 3L45A 4KXBA 1K3IA 1RL1A 1ZANL 4Z7OE 3S9DB 4NQEE 3FRPA 2ZT9C 4OI9A 4X6FA 3ZE1B 3R18A 2IQAA 5HJ3A 3KH3A 2DM7A 1VEOA 4Y4HD 2AXHA 2ADJA 3QWQB 5HYJD 4E9WA 2WVUA 3VI3E 3OMZA 4GI9A 4PTTB 2A2QT 3MZGB 5KSVB 1RU9L 2B8OT 4S11A 1UATA 4LSTH 4J3XA 5K9QI 4PJ7F 3SGDH 4YDJA 1HOCB 2GSMB 3CVDA 5HHOE 1KG0B 1WAEA 3KPPB 5D4QA 3HZKB 3NJLA 2F61A 1L9TA 1D3CA 4NRXB 5EIVA 2XN9D 1PG7H 1JK8A 1HNYA 4XWOD 3SBWC 4UOJA 1IGIL 1MFDH 3MBWB 1ORSA 2QGCA 3FO2A 3VD1A 1O9VA 1J9TA 2BINA 2CE6A 3KJ6L 5BS0E 1MFBH 1F90L 2F7IA 3EOTL 2O1AA 4LLQA 3ULUD 3IDYB 3DIVA 4I48A 3TIDB 4R2GB 1Z9NA 2V6HA 4AYBA 3TC9A 4HJEA 1MQ8A 3EW3B 4G6FB 4AIOA 1BWWA 4AQ1A 2WQWA 4EUPG 3MYJB 1M05B 5BOZG 2YRBA 1G7IA 5LAXB 2IPTL 5B22A 1L6XA 3QAZC 5EPMA 2OS7A 1CLZL 3D3VD 3GXNA 5IW3A 3IKCB 5C6TH 4AL8L 5KBLA 5C08E 1JTPA 3UTQB 3B9KA 2CPCA 3GD1C 4TTDC 4ONOA 3L95A 2KQMA 5IQNA 1ND0B 4CMHC 4FG6C 3NDYE 1XB6A 5IFHL 4HUVB 1MQKL 3RKDD 3T8XA 2ENPA 1OM9A 1JZIA 4CKVX 4JPVH 3PAVA 2A9NL 3AREA 2VZ3A 3H9HB 4ADIA 4UT6L 5I6KA 2DQHH 1PKQE 2O30A 4N8CH 4B9KC 2NNXA 5F6HJ 1I1YA 3MHZA 4PJAF 4QWWC 4BE5A 1KB5A 3CFEB 2P8LB 4P3CH 4RAUA 4AK2A 1RUAL 1KCSH 2VRKA 3QG7H 2VCOA 3EDFA 3IS0X 5D7LA 3BH9A 2NQ3A 5EBGA 3VWKA 4MXVF 3BAYA 1TIUA 2R2EA 4KO6A 4NUJA 3K8KA 5EU5A 1MREH 4NSKA 5E6IC 3BYTA 2ZICA 3C5ZA 3Q5YA 2VR3A 3FOMA 1QZNA 4J1UB 4MXQD 1T0MB 4NT6B 4OV6F 1NAMA 1EEYA 1MI5B 1KPUB 2DLHA 2W88A 1F11B 4M7ZC 2O61A 3VI4B 1G7QB 4Q6IB 3OB0K 3QJHB 3TJHD 1UGNA 5I71C 3W0WA 5E8PA 1BXAA 3ZE0F 3D18A 2EZ0C 3D2UB 1RK0B 1XCTA 3L3GA 4HMCA 5EIIG 2HTLC 2BC4A 3QFDB 1WP6A 1IZJA 2GSIA 5DMJB 5CBEA 3R06A 4X6DF 3TA4D 2BNRD 1P7KB 4OCRL 4ZFGL 2F5BL 1FH2A 4FCHA 1NCWL 4Q9QL 3QZBA 4X83A 1F4YH 3CSFA 3IJHA 2GUYA 1IL1A 4BZ1L 4A6YL 1R75A 5JORB 2RA1A 3O9WD 3EH2A 4L0ZA 1DQIA 3S37H 1UASA 2DLFL 2G2RB 5E24E 1MRDH 1J9CT 4YL4A 1PY9A 1S9KC 1OSPH 4R97B 3SY6A 4NQTA 3AGVA 2XWXA 3OHXC 5EBMA 3L4YA 5JOEA 1SM3H 4RGNC 4TRPH 4XMLH 3PWLA 1IC7L 4NC1E 4LGSB 4GQZA 1KENH 3A67L 4V1DD 5FYJU 4K94L 4ETQA 1A8JH 2H26B 3GRWL 2C9SA 3EDKA 1I8MA 3MCG1 2GI0A 3WFDH 1ERNA 3IPFA 4XN2A 4C55A 1M42A 1UC6A 2XIDA 3GXMA 1KFAH 2EO7A 5D1ZA 3VTMA 2B5IC 1EGJH 3RL1B 4G7QB 5E1QA 3EYSH 3I74A 1I7ZA 1KLFA 2YAHA 4QRUB 5ILTL 5IMOA 1UG9A 4X5WB 4IOIB 3EOAB 5CSBA 1GYCA 3EDDA 3JV6A 1SJEB 2A6DB 2VO5A 2ZWSA 1XMWA 1KSRA 1MAMH 1SOXA 3PP3H 3ZDZB 4KITB 3UJJH 4JS7A 4AT6B 4PGBB 4NZDA 3FL7A 4QEGA 5EORH 3T0DA 1PKOA 1VGKA 2HFFB 1P6AB 3BX7C 1YDPB 4S0HA 1UM5H 4O2CB 4PJ9C 5IQ7H 3ULUL 2DQJL 3STLA 1BLNB 2OSYA 2X7LA 2WP3T 4K9EH 4H0HB 1HCVA 2ZUQB 4H5SB 2Y1AA 2X1PA 3A4FA 5DJ2A 4PCYA 4W9CC 2GITA 3DV6A 1AHWA 1ULVA 2HAZA 3VWJB 3EF4A 1M7IA 3SD2A 1WT5C 1SJXA 3MAWA 3BQUB 5I1GL 1D7BA 4OD1H 4DP4X 4XMKH 4CVUA 4KKNA 5HGHA 3HHMA 4XVSL 5HGGS 1U8PB 4AW4A 5IHUL 2EXYD 4WY7H 2Q7NA 4X4XB 1KYAA 2VZUA 3B8YA 2XU9A 2Y4SA 3D4YA 4PP1D 3WEMA 4GG6A 3U25A 2CUHA 5AW4B 1KJMB 2DQGL 4L2LA 2N0KA 1O7SA 1UWYA 2PETA 3NN8A 3QNFA 4RGNB 5F88B 5ITBH 1RIHL 4O02B 2ZZUT 4YSCA 1NMBH 4I1NB 4HMDA 3C8KB 5C0BB 4LIQH 2WBJA 3HPLA 2IPKB 1R19A 4HHAB 4RDQG 3L4TA 1V3MA 5HVWA 1JYWA 1IBBA 2EIZB 2CH8A 1EHLH 2ZNXA 1OB1B 3WYRA 5EDSA 4B3EA 1T20B 1OK8A 3QDMA 1S7QA 3ESVF 4IRZA 4WI0B 5CILL 2ZYRA 2Q76A 3B2MA 5HPMB 2AXWA 3O8XC 2LVCA 4MB4A 5E9AA 5LBSH 4ZMLA 1CK0L 3EH5B 4O51B 2IPUK 1KCWA 1A7RH 4WEMB 3L5HA 3PLYA 4MJ6B 3HAEH 3DYPA 5IKCB 3IFPA 2P48B 1QBBA 3HG5A 3JUZA 4IOSA 1HXMB 1G0DA 3O11B 3OKDB 2DEWX 2UUDK 1S3KH 2Y2WA 1D5XA 2YSSB 5H35B 1VACB 3K8MA 2J88L 3BI9X 1A6PA 3DOHA 3O4OB 4XXDA 2ZPKL 2N1TE 4GEIA 2H1LM 4HIXL 2XVBA 1OTSC 3GSNB 5I75C 2E9GA 2D3JA 5IGXL 4N0YL 1F90H 4GMSH 3NSFA 2BNQB 2Y06L 4I48B 4I3RH 2QFPA 4F9LC 5I82A 3LQMA 5ESVA 1A5FH 3CLFL 4G6MH 3VCLA 4L48A 1GSMA 1NMCB 3OSKA 4Y9CA 5E0QA 1YO4A 2FTAA 1NAKH 1S9VB 2N7BA 3PIQB 4JB9L 4XXWC 1JDCA 3GZQA 4QF1B 4WFHE 1ZVNA 3Q8AA 4WFGD 2DH2A 3MV01 1N70A 1MELA 1O6SA 4EBQH 4HCGA 3L4CA 2Y5TA 3ZSSA 1CFTB 2B0SL 4FI8A 1JTTA 3HR6A 4L8SC 1XTLA 3RKDC 1RUMH 3Q6FB 1N4XH 4JW3A 3RPIA 4LASL 4KZEH 4XHJC 1UWFA 5D71H 2QTVA 3F7QA 2Y7OA 3KNBA 4AEIH 2CK0L 2W1NA 3MOAH 5JXAH 3EJJX 2HLAB 4YX2H 4EI5A 3K1KC 1R6VA 4WHYG 1YEGL 3SPHA 3ILDA 4JO3L 1CF1A 5FGSA 3UABA 5B3JE 4ZMTA 1RHHA 2YSTA 3DX2A 3KYNB 1J8HD 5I1KL 3X3FL 2W5PA 3ARGA 2NY1C 1X5FA 1S46A 4JO1L 1YMME 1FO0H 1ZS8A 2QADD 3NA9H 2MCAA 3KLSA 4BCZA 3CH1A 4GXFA 5HGBB 2FQGA 3E6HB 3C5JB 3RVTC 1G1CA 1OF2A 1AD0B 2ERJC 1OEZW 2P1YA 4M6MH 2APSA 1NPJA 4XWGH 3RJDA 1BXUA 2K7PA 1BFOA 1ZA3B 3X17A 4HLZG 1OAYL 5K93A 4NQDB 3VFGL 4ZX3A 3VJ6A 5ADOH 4HPYH 4FMKA 3UZVB 4P2QE 3RY4A 1D6VH 4KNTA 1YAIA 5I6PA 2DQDL 2JJWA 4PS7A 3FBQA 3DOSA 4P3DB 1XB8A 5DRNB 3IDXL 3NSYA 3F00A 1HDMB 1CUOA 1QTYT 2G3ZA 3PWUA 3GQFA 2BWIA 4P07A 5DJ0A 4JKMA 1NICA 2HKHH 1F02I 3HI6H 3QCTL 2DQMA 5JTWA 2HUHA 4K94C 4FHBD 4OUOA 2HWZL 3TNMB 4YEFA 3WN5B 1P7KA 5CEXB 3RURA 43C9B 3PL6A 4U7KA 5FEBA 2FO4A 4BZYA 3CDYA 2YBRB 1HWHB 2LU5A 4MVBC 3QS2A 4OGYL 4A2GA 3O3DB 2BOBB 3T71A 3JVFC 4C56E 2FX9L 3E8VA 4PJ8B 4PN6A 4I87A 4XVTH 3SYOA 3WEAA 2K45A 4ZYKB 1W0VA 3W0WE 4HOXA 4JRYD 2DZEA 1ZHNB 3PHOB 1FPTL 2LW3A 2NW2B 5AKRA 2YPKB 1QRNE 4ENEC 4HEME 4HWBA 4M7LL 1BAWA 1ZVSB 4XB3A 1DJYA 1ECZA 2Q0ZX 4LLUB 1QUNB 4JFEE 2L7JA 3BUIA 4DUVA 1FORH 3BXNA 1BIIB 1DFXA 4NZRH 1HC1A 5HHXH 4GUCA 3GZPA 1HHKA 3GRWH 4I85A 3ESNA 1F86A 4FLSA 4JJOA 3SDAA 2R4SL 1P1ZA 4P5KA 5DSCB 1H9VA 3DXAD 4GAYA 2DB8A 2K4AA 5JUEL 4ABWA 4JPKH 3BKJH 3MJGX 1OGTA 2LVEA 3TBCA 7CGTA 1ZGLB 2ZSWB 4UM9A 5ILTH 4X5WA 1UQSA 3EOAA 2GB2A 2XWZA 4OCWH 3KCPB 1REIA 1U2CA 2JV6A 3VD3A 3QIUD 4B96A 2FQEA 4PW3A 2IDCA 4BZ1A 1USQA 4C4KO 1D5ZB 5E8OB 3UTTD 3EBAA 4HKZA 1X7SA 4P2OC 2W60B 4LEOB 5BQDA 1EGJA 1H15B 1DTUA 3HG0A 1WA2X 4KMLB 3QJRB 5D7HA 3GIVB 4Z3JA 1MJ7H 4QRRA 1WFJA 5JHDB 4D2NA 4OD2A 5D7EA 4PWGA 3EHBC 4C57C 4N2MA 3FMGH 4JO2H 3UC0L 1BEYH 1I7TA 1KLUB 2B3RA 4LLQB 1D5BA 4TQHA 1NUGA 4TV3A 3V0EA 3LXAA 2SODB 1KY7A 1MJJA 4HWBH 1NUDA 2Z64C 3LHAA 4L4TA 4B5EA 4RZCA 4Z7NE 4F2MA 5BZWA 1LILA 3L9YA 2JKSA 4XVSH 1VADB 4QO1B 1BZOA 4QRRE 4A7GF 4MXWL 1PGRB 4LCWA 4XTRC 1N6VA 2VITB 2OJEA 1DZ0A 1G7IB 3ZYOA 1PG7W 5L88H 1F8TH 3ARRA 1EO8H 4HG4J 2J4WH 5FCUH 5J11C 1OQOA 4E9VA 1AZRA 2OV0A 3ZQWA 4TF4A 1SHWA 3WDJA 2YD7A 1YA5A 1N6UA 3O3BB 4Z23A 2BSSA 3ECWA 2VLKD 1FFNB 3POHA 1G9NH 3EFFA 2FH8A 3KPSB 3VG9C 4D9QD 3OX8A 5SWSE 5IW6B 1HK6A 2ZXGA 3WI9A 2Q8AL 1KTKE 4XCNA 4CJ1A 2JXMB 2IH1B 4I77H 3QIWB 1CGXA 1HEZB 3VWKB 4PVLA 3RBSA 3SBWA 4E0RA 3NZHL 2R69L 2HVKB 1WZ1L 2TRHA 3M46A 5FYKL 3S8GB 1KCSL 4B6ZA 2E7LA 3DTDA 1KGCE 2ZCHL 3C5ZB 4PRIE 2ZXCA 4U49A 4XNXL 3L16A 5GGSY 5HDQH 1MLBA 1G7PB 1E2WA 3SOBL 2N7AA 4AGMA 3EFDL 4QRAA 3NSJA 1AGCA 1MRFL 2H32H 2WJ5A 4M48L 4N6QA 5KBNC 3RFZC 1Q4NX 1MCOL 3CZNA 5HDBE 4AITA 1IE5A 4P2RD 2ZE0A 1T7ZA 4TUOA 3WE6A 5FYKD 3QUMA 2UWEB 3ZJAA 4AGLA 3DI2B 1PIFA 3H3BC 3O6FA 1HEJC 3GSQA 1HSAA 1OZUA 1DQMH 2E7HA 5CBEB 5FYLH 2DIEA 4LSPL 5JO5B 5AZEH 4DVRL 1CDCA 2Y06H 3ATAA 2ZXQA 4DFHA 5D5MF 5F3FA 3S36H 1YNTB 1MHPH 4PJHB 3ARWA 1U58A 3KXFB 1D7FA 4MNHA 3CLWA 4DGIH 2E27H 2WIIA 4G8IB 3RUGB 1E5UI 3OXRA 3WJJC 4BFFA 4Q9QH 3WJMB 3K6FA 3U0WH 1PZ5B 2HT3C 2X4RA 1O6SB 3AREC 4ZOCA 3WS3A 3ZZSA 4ZMOA 1FL3B 1PQZB 1AC0A 3A6CH 1DBBH 2V8MA 3BDBA 3D7PA 4PY8J 1ITBB 2MOVA 2FWLB 4FFTA 4PJAA 3OPZH 5D2NE 1RVFL 3D9AH 1FFQA 2R0KH 1FUNA 4FL4B 3MMEA 4BFGA 5K59F 1PYWB 5KVGL 1SXNA 4YFLI 3S36X 1C5DA 1EVTC 2Y23A 4P23D 4JG1H 1FYHB 3BOVA 4PV9A 3LD8C 3V4UL 5E5UB 4F91B 5E6IA 4JAMA 6CGTA 1JHTA 3F04A 4JM4L 1CICA 1EAJA 1F45A 3QIUB 2XIIA 4K3JL 5E7FA 2NYZA 4QHMA 2FT7A 4HXBL 1ZA6A 4MBRA 3FRPB 1L9OA 1TKWA 1P4IH 2YARA 3IXTB 4MYWB 3J07A 4PUBH 4R96A 5T3ZE 5IMOB 5HHVH 1Q0YL 1F3JB 2E5EA 4YHIA 4AH2B 2JCCB 1H9DA 3L95B 1I7UB 3HNSL 5KVGE 5AZUA 1RURH 1MY5A 1A4BA 2ZX9A 3CHXA 2NY2D 4OZ4A 5DD6A 2E7BA 2XV3A 1FO0A 4YR6A 4AXWB 2IG2L 1Y7VA 3ABKB 3DSNB 4B0MM 4RGOH 2PWHA 2DQDH 3SEPA 2CWRA 3THMH 5DHVH 3SDXF 4N3TA 2G5RA 3CSBA 1U3ZA 1E6OH 2H41A 5KTEH 4NHUB 4U6HA 1J8HE 3F64A 3GBLA 4AMXA 3POCA 2R1YA 2X9YA 4PRHD 4ZOEA 3QXWA 3CFBA 1J10A 3KYOA 4YHML 3MV8E 1ZV9A 4EZMA 2NY0C 3JWOL 5FV2A 3ULUH 1NWOA 3FNKA 2CCLA 4ORZC 3JWNG 2WLIB 4HQQH 4PG9B 4JFED 3V6ZB 5FYKE 4FQLL 2IF7A 4RQQB 1JXJA 1X44A 4M5ZH 4XPGH 5LCVH 4ZMVA 5IJBC 1WAAF 1YY8B 4JJ5B 2F74A 3GMQB 3BQUA 4JN2A 4PJGF 5J1AA 5BNXD 2NLJA 4LLAA 3TBTA 4X5RA 5BPPA 1VRSA 2GYSA 4QJ3B 4F7EB 1FIGH 4X4XA 4UMGA 3LS4H 3SDYH 4TPRH 4QGTA 2P7TA 3AG3B 4WLCA 1JPSH 2BC4B 4PJ5D 4HBCL 4IU2A 2D0HA 3WNIA 4Z18A 5HHMD 3OAWA 1LEKB 3GBDA 3ZR6A 5DK0A 4GT7A 3D6GA 2IJ0C 3L7FA 3TO2A 3L17A 1TF4A 2WSPA 2IMNA 1ZVYA 2OL3B 1WFOA 5TE6L 2AEPH 1ID5I 2X4TB 4DNLA 1E4JA 2JK5B 4LDLB 5CP7B 1QBML 1IKNA 3VGHA 1LO5A 2WWOA 1G9MH 2Z65C 1SJVA 3Q44A 4YAQB 1TJIH 2YMTA 4B50A 4IRJA 2OFQA 3QUYA 4RNRB 1E9PA 3T0EA 2PYFA 4AZ8B 4NDMA 2RJMA 3OF6D 1E5BA 3P0GB 1FCCA 2VKWA 5LBSA 1EUTA 4GSDL 3C09B 3QBTB 3PPEA 1U8IB 1ED3A 1KIQA 3PAZA 1UUNA 4Z0BH 2YWZA 2IXQA 3FXIC 4A63A 5HBBA 2BNUB 2CUMA 1YMMD 4UMSA 3DGGA 4GAGH 4GRLD 5ETUA 1C7SA 4ZSOB 1IGYB 3HB3C 3WNPA 2ZOLB 1QMUA 3TNNA 1U30A 5IQOA 4XAWL 1RUAH 3JYBA 1F1GA 4U0RB 4P99A 1N64L 3N42F 4K7PL 4NEHB 3OHXA 4NUGL 5KVDL 2FYYB 3FSVA 3SKNA 1MNNA 3D0LB 1OPGH 1P9MA 2V8LA 4DN3H 5A2AA 1QX1A 1DZBA 4WSJA 5ANMA 5C0AB 4HKXB 1NBYB 2PABA 4G9FA 4DERA 5IGXH 5H94B 2WLHA 1GMIA 1A2YB 2BNRB 4J8RB 4M93B 1IAKB 1WD8A 3BZFB 7TAAA 4QNPE 1OGAD 2BHFA 2F7PA 5F7MC 2CDEA 1L0YA 4NZFA 1PMYA 2FHCA 4L4JA 4MXWH 4QXTA 1ASQA 3WY2A 5CUSH 4LEXL 1CE1H 3HBQA 5IEKA 1VCAA 1AG6A 1UZ6E 2B0SH 5JHAA 1W0YT 2VXTH 3GLAA 2O93L 3TIDA 1S5IL 4PJXE 3B9EA 3CDCA 1LO3L 2CR3A 1CLCA 1QFOA 2B20A 1RZIA 4OJAA 1XZWA 4CMMB 4DF9A 4HKBA 5BV7H 3PV7A 3DJZA 4WHCA 2X89A 3S37L 1MQKH 1GOFA 1SF5A 4KK6D 1I3RA 3DTXA 3QUXD 4R90L 4Z0XB 4BM7A 4PEEA 1XGTA 1CI3M 2WWKT 3K4DA 4AM0Q 4WFED 2A6IA 3WTUA 4FYSA 5FAAA 4LARH 1AXSB 3HCVA 4X6FB 3SKUD 4GSRA 3D34A 4XNBA 4DVBA 3BFWA 2VJ0A 1HCYA 4W1TA 3SDDA 3DRQB 3FHQA 3ZX1A 2CO6B 1PNCA 4M6AA 2VM9A 4WGKA 1IEHA 2YLHA 3TT1H 2X4PB 3SDCB 3WL9A 3CPUA 2VABB 4D0BB 2QELA 3AFLA 1RZ7H 1MCWW 3JT2A 2WBXA 4S1SL 4WRLA 3UYPB 1X6LA 8CGTA 4GKSB 3QARA 2FBJH 1CXIA 1NA8A 3SGDI 2FZ3B 3RWDA 5F72S 2R0ZH 3P11H 3VXNA 5J89A 3BRGC 2ODIA 1ZPLA 4O58H 2UZXA 3OKNA 3BVDB 4J27A 1XIWC 3EOBA 2E0PA 5E1GA 5LGHH 1XV8A 3U6XS 5GS0C 2PKDA 1XCTB 2VLRE 3QUZD 3NTCH 3UACA 3GIZH 1QBLH 2K3HA 4FZEL 4N2HA 2QEJA 2MCG1 3BH4A 4G8EA 2O6DA 1QA9A 2VH5H 5DURB 3GSXB 32C2B 1U93A 3ELQA 1INQA 1L5GB 1JGUH 1FVDA 1RZQA 2WXIA 4HD9A 2ZXAA 1S7WA 3MACH 3NP4A 1E0OB 4KKCC 1FLRH 1DEEB 2K9UA 4FFYA 1HSBA 3S4SA 1ODUA 3S88H 4Y2NA 1UA3A 1XTMA 4JDTH 3U2SB 2ZSWA 4X6CE 3T77B 4R83A 2F53A 1YSOA 2B1OA 3F58H 3NZSA 1ET5A 1XO8A 3HEIB 4HW6A 4HJGB 4P23B 4MYPA 1AGBB 1NC4B 3DTUB 4JFFD 4HJ1A 3V6OE 4JG0H 3ZZLA 1QFHA 5CJOH 4XNDA 2A1WH 4JQVC 1UA6L 4Z76A 1XH2A 4H1LH 3ZTJH 3UJIH 5E8OA 2Z31D 1A02N 2EC8A 4M03A 3FSAA 4HGWA 2AC0A 2WAQA 4KPHL 3T65B 2Y72A 4P46A 1E6OL 2VL5B 4PJDE 3SBQA 2F15A 4LPUA 3IU4L 4ELMF 5B3NA 1AD0A 4X0KA 4Q6IC 2H0PA 4FAAB 5JNYB 4NC2B 1XXDC 1U3HD 1TQSA 1HFUA 3D69B 3Q43A 4N8VA 2KC0A 1EH9A 1CIUA 1E9OA 1GGCH 1GKEA 4AENA 5IBTL 4KKLD 1D5BB 3IFOA 2CBQA 2X4NA 4L05A 4GP8B 2CR6A 4NKMB 1FL6A 3ABGA 4EI5C 5ESVB 3VCLB 4JDVA 4YHNA 1NOLA 4GJTB 5K1NA 4UV4H 5D7LD 2CA4A 1DLFH 1UZ6F 3LRMA 1JI2A 4HFWB 4N25A 5GGSB 2B5IB 1ZKAA 2FVNA 3UG3A 1J9SA 1PG7X 3B2UD 4TSAH 5DJYA 3V0JA 1OGAE 4H4NA 4XMKL 3C5ZD 4NQSB 3KL3A 2RFXA 4JN1L 4CUCA 4HBCH 3WN5A 1CD8A 2FUQA 1IQDB 5CEXA 1MCRA 4XP1L 3HMWL 1T04A 2R29L 4DKFL 5ICZB 1FNSL 3P9LB 4PBDA 3DOIA 3QGVA 2X4SA 5C7XL 4WO0A 4GMSL 1OAXH 3T3PE 4MDJA 2ZG3A 1M3IA 1Z7JA 1T66D 2VJXA 1C5BH 5TE6H 1TYEB 3QJFB 5HYQB 3CFJA 3FQTA 2FLBT 4LCCA 3C2AL 3FDWA 5ES4B 3NEOA 1FNEA 4G1MA 1CR9H 4KK9C 1K72A 3V8OA 2YGOA 5I1LB 3FTUA 4HOWA 3KR3H 1G9ML 5F7NC 4XRCB 2DWSA 3OG6B 3OKEB 3RU8L 1H0DB 1E9PB 5PAZA 1IVTA 3TN0C 2HVKA 2ZJSL 4LSSH 2YXMA 1KXHA 4L1DA 3KGRA 3U2IA 1S9XA 1YEGH 4RISH 3ZVVA 1E2ZA 5D7KD 4CRPA 4R4ND 5DVPA 1FP5A 2C4XA 5ETUB 1I9JL 5L0QB 3HRZC 1UB6A 3MRGB 4UZGA 1NDGB 2J8UE 3O41A 3SOBH 3WHXA 3K2MC 3U1PA 1QR1B 5ACZB 2A3TA 1E6JH 4YMPA 2YRLA 2P42B 4LIQE 2IADB 3MA9L 1VGEL 2D9QB 3QFJA 3MLZH 3X2QB 5IP4A 3LKPA 4W9DC 1EJ6A 2PO6B 3AS3A 1J5CA 3IPEA 1FAIL 2JIXB 3IMTA 4OGZA 4X6DB 1OLZA 2W80C 1ANUA 1CGWA 2WTPA 3MLPA 5DI8B 1E9QA 4WW2F 4DGIL 4U3HA 4YDZA 2GTWA 1S78D 4XXDB 1VESA 3HNTH 2AEIT 1G0YR 1HHIA 2P26A 4NNYB 4IGBC 2CNYA 2DQTL 4CNIB 2D3VA 4XI5C 5HYEA 4OQTA 3V4PL 3QJSB 2D03H 2LOEA 3STZB 5LVEA 2EYSA 3FT2A 4OUUB 2QPEB 3CVHH 5AAMA 2YQBA 3L2NA 3FU5A 2UY7A 3S35L 1S9WB 4E9YA 1T0OA 4PTUB 2XV0A 3CFIC 2PW1B 3C5SB 4BV1A 5TQ2L 2VDLB 4UF7C 5FO9A 3TPUB 5FKAB 1JXGA 4AV4A 4Y16A 4KKBD 4P2OA 3KPNB 3ES6A 2SEBA 4N2DA 1TVHA 5I8CA 1OK0A 4E41E 2YHGA 4GPVA 1PZBA 3ARUA 5E2TL 1T5WA 5M94B 2FATL 1F3JA 4YHIB 1P4IL 4JGJA 4NGHH 2PTTA 2JCCA 1HEHC 5HHVL 5HPMA 4CDHA 5FA3A 1UOVA 3K74B 3FQNB 3BPOC 3BPCA 3KPSD 4FLRA 3OJDB 1URZA 1M7DA 2EDMA 3E9TA 1JF1B 2GG1A 3KEDA 5FHAH 4MJ6A 2EDRA 3L3IA 4ZQKA 1J1XL 3LN4A 4GSXA 1P7HL 1BFVL 2V3DA 3KLLA 2VR6A 1KT2A 1P69B 5DU7A 1J0ZA 3DK0A 4IK7A 4K7PY 2JWYA 5E95B 4AWJC 3MJWA 4XCNB 1G84A 3S35X 2I26N 4HU2A 4PJEB 2JXMA 3S8WA 2DF3A 2GBVA 1WAPA 4LMQI 1FSKC 2F0CA 2V2XA 4B7IA 1OZTG 4ZUUB 1CXEA 1E4WL 2QVFB 5C0GB 1RZJH 1NFDA 2GBAA 4L8CB 1YNLL 2JH2A 5AW9B 1DBJH 3LVTA 3P0VH 4TSCL 2JQAA 1TCMA 3G04B 1N7ML 2BP0B 4Y4HB 1UD8A 3T3MB 1G43A 2ITFA 4TXVB 5CR1A 1UXWB 4HJJL 3M7OA 2QSCL 4P49A 3Q01A 5LCVA 5L4MA 1IBGL 4M5ZL 5HDRA 1GRWA 3SJVD 3EZJB 5SWZA 3AXLA 5B39A 2FJGB 3VXRE 2GJZA 2K6YA 1TTFA 2H1PL 5D96C 1H3UA 5ESQA 4X8CA 3NCMA 2JJTC 4LNVA 4FKHA 3HZKA 3MFGB 4FXTA 2H0FA 3KBEA 3WDIA 1IL1B 1GGIL 1I1AD 1CGTA 3LRHA 3V0HA 3UO8B 3VFTA 5CEYA 4PJDA 1HU8A 1CXLA 3WXWH 2OSLA 1CYWA 2CKBH 1A4KA 1DJHA 3FRUB 2OXHB 3MLTB 3LRKA 3QNYB 5GRVL 3FPYA 3IU3A 3RY6A 2IH1A 1FHGA 2FQFA 3L5XH 2PLTA 4E0RB 5C2UB 2XWBB 5F3HA 4DKEH 2OMVB 2UZIH 3FAWA 1UA6H 3DV4B 2XN9E 4MDIA 1FWXA 4NWUL 4X98A 3N5AA 5CKGA 5F9OL 4X2UA 4P2QA 2HRGA 3IB4A 4HGWB 4AMKH 4J5VA 1G9NL 4OCNC 4Y5VC 1KCVL 5IMLB 1XHHA 3N1PC 2CIIA 1H3TA 3TFBA 1AYOA 2AAAA 2ZKMX 1K4CA 3MLYH 1GGBH 5JPNC 4XN4A 2VLLA 4EI5D 1B0IA 4XH2A 2Q8AH 4XN5A 4F57H 3QXDB 4G43A 2QSQA 1DVXA 3JTSB 3P9MB 5B3SB 1UKTA 3AABA 1CDJA 3KLAA 3N44B 1CE6B 4OKDA 3TH3T 4QTIH 4ODUB 3BAEH 2WYZA 3RWIB 4N0UB 4AJ0A 5GSRB 4NN6C 3QO0B 3BRDA 1P7QA 3C6SA 1IAKA 3BISA 3W2DH 2HTKC 1CICC 2CLVA 3BVNA 1EQWA 1DLFL 2AJUL 1CVRA 1M3JA 4QD2E 3BZ4B 3FCSB 2I9TB 2EVJA 4QUOA 2Q7YB 1ZHNA 3PHOA 1T66C 2BFVL 4X8XA 3RPKA 2NW2A 4UYQA 5D7JB 2PF6A 5EU6B 1F11A 2GBTA 2GSIB 1FNSH 1JZJA 3TN0B 3PHSA 5DMYA 1CLOH 2GPZA 2IV9A 5JIQA 5KVFL 3GMOA 1FN4B 2Z8VC 5SV4A 4CC4A 4M29A 1U9KA 3ZW3A 1GOHA 4LOUD 5IZ7A 1WC7B 4ELDA 1L7TH 3R06B 4N0CC 3VGBA 3EUDA 5EOCL 3IDJA 4RA3A 1BOYA 1EANA 4CDGC 1DVFD 2ZWYA 3LMJH 2EYTB 3P77B 4FLQA 4N5UA 3BT2L 4U1LA 5FW8A 3IJYB 3KR3L 3RU8H 4KC3B 2PXYA 4R96B 3BCDA 2B77A 4Y1TA 2X4QA 1I3GL 2YD6A 2VL4A 4RX4A 4OLWH 4CSPA 3MRKB 3MJ9A 3VMNA 4XE0A 4FQIL 4HJUA 4L5FL 5L7XH 4Z3HA 5CCJA 5FOBA 1Q0EA 3KCPA 3QHZH 1FV1A 2Q76B 4ATWA 3U7WH 2FJFB 1MRCL 3V0WL 1ONQA 5T1KD 3M17A 2KUTA 1BVNT 5IBLD 4NZUH 5D4JA 2FJHB 3DVGA 3BIKA 2YAFA 2P4AB 3ARBC 1NBZB 4D0DA 3G5YB 4LDCA 3PREA 3U0PA 2BFGA 3MFFA 3NJXA 4OGAC 3ZY7A 2P43B 3QHFL 3NH7H 1SXZA 3N40F 4B9JA 1PVHA 3ILQD 1I4FB 4RIRB 1TEFA 4KXAA 5CR8A 2QHRL 4RZCB 3OKOA 1RK0A 3NUKA 4WFHD 1F4HA 4Y4KC 4I13B 3LEVH 1YEKL 1T4WA 4PJ7A 4WUUD 4XNAA 2AXJA 5BQ7B 4HLEA 2BSBA 1RY7B 1COBA 5DC2A 2VGLM 1NH6A 2IAAC 2EH8L 2YXVA 2EP6A 3QJVB 3QUYC 4JFSA 2VDML 4JREC 1DBKL 1C1EH 2FD6L 3IJEA 4QF1A 2BVQB 4QOKA 4H8VA 4L3ED 1SMOA 3GHEH 4J3OD 4MA1C 4PJ8D 3KPOB 2JB5H 3BRFA 1I9IL 1VZIA 3HFFA 1OOAA 4ZOBA 1C08B 4M43L 3SDDC 3L1OH 2QL1A 2J6WA 4H5SA 4JG1L 5DJ2B 5FFOA 2YN5A 4ZYKA 1E8WA 2YGVA 1MPAH 1OTTC 1X5IA 3SHSA 3QCUH 4MTMA 4Q0XL 3HHSB 2YPLE 1RSFA 3JZ7A 2YAEA 3LZFL 3P73A 1BM3H 5CMAA 5FWRA 4NENB 4Y89A 2A4CA 2FATH 2WYIA 4ZUSB 1ZE3C 1A1NB 4IHBA 2WO2B 3I84A 1G7HA 4KK8D 3PV6B 2PN5A 3TONA 2EUXA 2F7OA 2W9EL 5IT2L 3HMXA 4KI5F 1UOWA 1Z9LA 2VN3A 3L4VA 3NN8B 5H2BA 1JPTL 1TVBA 3DXAB 4BFRA 3QUGA 2IALA 4XNUL 1P0SE 5B39G 4C47A 1NC2D 1IAIL 2HXAA 5I1DB 1A0QH 1A1MB 1BJMA 2B15A 1OAKH 1BD2B 3FO1A 4TUKH 3MREB 4PJEA 4K9EC 5FWQA 3LCYA 3QNXA 2FJUB 1LK3L 4H0LC 4LHUG 2KZWA 1I7UA 4ALAL 3UO1L 4YDKH 3IGLA 1XGUB 5HGAB 1U3NA 4ZPVA 3VSQA 4JY4A 5C3TA 4KVNL 2DAVA 4N2KA 1J0YA 4EIBA 2CXKA 2C1PB 3VRLF 1P4BL 4M3HA 5IBTH 4ZAKA 5EZIH 4HQQL 2D7PA 1LJMA 2FEJA 5B39B 1IEAA 2XUWA 3MROB 1HVXA 4XWOC 5A1AA 3WNMA 5ALBH 1TFHA 3CE1A 4GI6A 3UPCA 3WS3B 43C9A 1PQZA 1KGIA 2DQCL 2OP4L 1AY1L 3MBXL 3TFKC 2WWNA 4GIPD 5TK2A 1KPRB 5JW4M 1WV7T 3GSNA 3V4VL 4R8WL 3MMEB 1JHLL 4GKSA 2OLDA 1IGTB 1MNUL 1YJDL 3KL5A 4HT1H 3ZPDA 5HGHB 3BESR 4LQ1A 4XBGB 1WZMA 5ALCH 4I0PD 2XQYG 1EDQA 2R7EB 2AVFA 4ELME 1DSFH 1E3ZA 1CDBA 1XCQA 4EDXA 3N55A 4G6JH 4F1SA 1ZLWH 4WWPA 5I0YA 1MFAH 4QO1A 3PNWB 1NJ9A 4XVUD 3ABMB 4R4FH 5GHWH 4AV0A 1GVIA 4KXCA 1Z5LB 3DX8B 1JGDB 1OP5H 2BCMA 3SE6A 3VFUB 4A7TA 1IAOA 1RERA 3HBZA 1ETJA 5DEFA 4YWGL 3UG5A 1U92B 1RH8A 5HJBA 5CAYB 3VSUA 3KDPB 1J0IA 1OO2A 1XZ0A 3ARVA 5EZLB 1IC1A 2F68X 4JVUA 2NTSP 3IMRA 4WEEA 2UZYB 4V2CB 1UWEH 3VH8G 2EIZA 4ZMNA 2EE2A 4KKPA 1GYWA 4LSRL 1UT9A 1KN4H 2R83A 5DHVB 1QSFE 2Z7ZA 1NGZA 1J8SA 4HOMA 3MRGA 4P04A 2XETA 4BFIB 4JFOA 4DK3A 4KOCA 4G8GD 4X5PA 3US1A 4PBVC 1KFAL 2WTRB 1CS6A 4LSTL 3F7YA 4ANUA 3QZPA 1CICD 4HCFA 1KIRA 1TQUA 1TNMA 4XZUB 3AY2A 4FC3E 3CFKB 3BAEL 4H8UA 1QTPA 1CTOA 2ITEA 4N86A 3C12A 2AK4D 4R0LA 1NM4A 1FDLH 4B97A 3GMRA 1DJSA 4DN3L 4F7TA 4GG8B 4AEHL 1E67A 2KHAA 2Y7QB 1IQWL 3IGFA 1F56A 1CLYH 2LLGA 4H8HA 4RCAA 4RFOL 4M7JH 4OD3H 2IIJA 4JFXA 3NIDB 4L23A 4UOQA 2DQIL 4U1NB 2WV3A 3RTLA 3TN0A 1S9VA 3DX9B 2CHDA 2CJUH 1DO5A 4HIHA 1EDYA 5L8KB 3ATBA 1IC5L 4JFHE 2V37A 3V55A 4KDWA 4LCWB 3UP6A 1DANT 3BZFA 3TH4T 3DX7A 2EDHA 4PRHA 2VW4A 1CMOA 1JZ4A 1TQBC 4WKZB 5E94B 1J0KA 3GM8A 2VE6A 2PTUA 1N0XH 2AJVH 2AQNA 4YHOL 4GKNB 5F7DA 5DJ6B 3IAQA 1JGLH 2X09A 4A6YH 3H1ZA 4JM2B 4AMWA 4DN4H 4PY8I 1QBLL 1FZMB 4J12A 1HESA 2VERA 5DA0B 3UCQA 4AQZA 2Z8SA 1ODAA 2AMUA 4NDMB 2D0GA 2Y0SA 3Q6GH 2GTQA 4WFEE 4Z6AT 2DY2A 1LO5B 4X9BA 1T21A 5DFVC 3T08A 2DI9A 3HJ0A 2UYLB 1FV1B 1JIBA 3BQVA 2WOYA 1HKLH 1OGTB 1AMYA 1H0DA 4Z3GA 1JE6A 2NXZB 1NCDH 3ISRA 1J5OL 1NEPA 3CXFA 4NQDA 3JWDL 3W37A 5JPMB 3BUBA 2Q6WA 3PP4H 4HSAC 5KOVC 1F1AA 4RESB 1FNHA 1XAKA 3SPVB 4Z7VF 1K2DB 4FERA 2FBRA 1MZYA 4BH7A 1WWWX 5T5FH 1VDGA 4AXWA 3HB3B 1Q9OA 3P0VL 5LAPA 3UIZA 3BCFA 2W91A 1OAUH 2NNRA 1L3NA 5BXFA 4YSUA 1AQKL 4IRJD 3JSSA 5CWSB 1BV8A 1ETB1 2FBJL 3UTTB 3K6SA 4MAYC 4PLNC 1NGYA 2ICWB 3TNMA 3FT4B 3MRBA 1V54B 3LX9A 5DJYB 3UTPE 4M62H 3APMA 1DN0B 4G9FB 4AY0A 3D39E 3K71B 1UM5L 3SSGA 2KZ1B 2OMZA 4PGBA 4Y1AA 4UQ2B 5F9WC 2Y6TE 3WNKA 4RGND 1XL6A 3GFUA 3EDEA 5H35A 1I7TB 1KLUA 3L3KA 3M45A 5AYUL 5BV7C 3BN9C 1XH3B 4YE4H 4U1GC 1M9SA 3HAEA 5TGBA 2DMGA 1UD5A 3BWZA 1L9NA 3WFBL 1YEFH 3LNGA 4TUJB 4NLAA 1DUZB 3M07A 5I74C 5GGTA 3GHBH 4MMXC 2F18A 3QCUL 5D2LF 4OF0A 4TQEH 4TSAL 4H88L 2H3KA 3F6IA 1L9RA 3B2XA 3WO4C 3NIDE 1NC4D 4LRIA 5D72L 4PM1A 1PY0A 2FO8A 4WU7B 4K71C 2GHZA 2G5BB 2VIRB 3D85D 5DZVA 3SE8H 1PJWA 3DPBA 15C8L 1HOEA 2OZ4L 2PW2B 2BY2A 3DARA 1RUML 1JWSA 2E9WA 1B4JH 4W81A 2AJXL 3N41F 2XN2A 4X98B 3EAKA 2CK0H 3RG1C 4YDLB 2I5YH 3VFMA 2EE3A 1UYWH 4S1RH 1D2PA 3N42B 4KMTL 2ETWA 4XP9L 2XQYK 3HC4L 2VDLL 2FX7H 2HLAA 1PLAA 1CR9L 2EJ1A 3CVIH 2IANA 3O0RH 4IBVA 1RIUH 1C12B 4PJ9D 1O9ZA 4NO5B 2CPUA 4GW4A 4LL1A 1RHHB 4P05A 1HEZA 4LPTA 4G1EB 4RMSA 3KH4A 3UL4A 5EIQA 4WK4B 3HMXH 4ZPTA 2YEZB 3HR5B 1KJVA 5I6LA 1QSFB 1KGCD 2XY1A 4RBPK 5C09E 4OKVA 5B1AB 4NZJA 3TBVB 3DBXB 2DYPD 5A6IA 4QTIL 4Z7QE 2A6JA 4CA4A 2EDDA 2GAZB 2XBZA 3PQYE 3CU7A 4GRWB 1CF8H 2KDYA 3LQAH 5JIIA 3CFDB 2DV6A 1ZT7A 3OJVC 4Y16C 5D8JH 4PJGE 3U7YH 4NAJA 4EZLA 3GK8H 1HJBC 3RY6C 5GSVA 3INUL 3D0LA 4KWUA 1J1PH 4Y5YC 4YSAA 1MNUH 1YJDH 3FOLB 4LVEA 4P3DA 5BW7C 2HKHL 2RAMA 3L5IA 4I18B 3WUWG 1GZHC 4S0TD 2HWZH 4MAUH 1A6ZB 4G6JL 3D39B 3DIFA 4MGXA 4DP6X 1A9BA 5B7FA 3QI9D 3O9WB 1WHPA 3U48A 1LEIA 2ADGA 5CBAA 4HK0B 4PAZA 3ROOA 3ESPA 4Z5RA 2Z35A 2RIKA 2EUVA 3BP4A 1RIHH 1DJXA 1N10A 4DP5X 5EN2A 4LHQB 3P4OB 4Q4IA 1VEPA 4EN2A 5J11B 3O8XD 3C60A 1URLA 2H2SD 3H9YA 3TA3C 3PUCA 4R7DB 3SGJC 5A6MA 4ZS7L 5E00A 3WTVA 1DQJA 3GPSA 5D2LB 3ZT7A 5JXAL 3ZUNC 5AVWB 3AAZA 5D7JC 4Q74A 1Z0NA 4K23L 1MW0A 5FUZL 1PYWA 1KN4L 1UZ8B 1SUJA 1WRFA 3GC3A 3NZUA 2XQBL 1KT2B 2ZOWA 4EUPA 5B4MC 3RVTD 4BWUA 1GW0A 4UAOB 3T65A 1N59B 4RSVA 1CICB 3CSGA 2BHUA 2Y2TA 4DW2L 5F3HB 3ZHKA 2PO6D 1GL4B 1WEJH 3WFCH 2DS4A 3HZYA 5H8DA 2V9TA 4MQXD 4LLVA 5EU3A 3RIKA 1M2VA 4FI7A 5DMKB 5K9JL 5D9SA 1H3WM 4F7KA 1VGEH 2GT9A 4W9IC 5ABDE 2VXSH 5JPNB 2YUVA 4NZTH 1AKJB 1PPIA 5KSAC 1MHCB 3IFOB 2BIHA 3QZOA 4QHUA 5TPWH 4HKXA 4XMVA 3V52H 1A5FL 1QFWM 3P2DA 4XPTL 4S1QL 1MCNA 3CQFA 1NSNH 5EO1B 1NAKL 2DKMA 4IBSA 3QQXA 5HY9A 3GTNA 1XD1A 5ADPL 3QO0A 5DLMH 1BX2B 3CZKA 4JKPH 3VI4A 4BUQA 1AS8A 3D85B 4HUUB 2FBOJ 3BSGA 1GAFH 3GMQA 5T3ZH 3VFTB 5ECJE 4WW1B 1FZKA 1A3LH 1E9QB 2FLMA 3AVEA 5SWZE 5D71L 1I9IH 4XAKE 2NY1D 4RFNB 2YJLA 4H25A 1PZSA 2YRZA 4XVTL 4ZT1A 1D5IH 5DJDB 1A64A 3BKYL 3RGBA 3UYRL 4HZ1A 4BINA 4BH8A 2GHWB 3CN4A 2PR9A 4HVBA 5KANG 4NJAL 1KB5H 3BAXA 1ZPUA 3LRSB 3OAUH 5CHNA 1BGXH 1SVBA 1P53A 4DUXA 3ARBA 2P5EA 4CVZA 1A6AB 2YUZA 2V7HB 1A7NH 1IZKA 1B9ZA 3DKHA 2W9EH 3K0YA 2K4WA 1X5AA 1HQRB 1PZ2A 5IT2H 1N5AA 3E1F1 4MNGB 4NQCD 1KZYA 1A1MA 3WDHA 1TPXC 1DQTA 2D8KA 5HI3C 3R8QA 3N85H 4OSUH 4U1LB 5EN3A 4D9RE 4NAMA 4Z7IA 1DJZA 3WUZA 3VWJD 3I6LE 3TT3H 4HPYL 3CZSA 4YAQA 2G0LA 2WZ5A 2QMKA 4J23A 3N9GH 2J5WA 5IK3A 3VUAA 1CL7H 2HFEB 4JHUA 4AK1A 1OGSA 3L3IB 4OFYD 2CBMA 2EO9A 4ZS6C 1DBJL 3GB7A 4AYSA 1ACYH 1U91B 3L4WA 2VT0A 2FX8L 1AHMA 5F93C 3DJ9A 1NCCH 3F6JA 4MHHG 1V3JA 3T4YA 2RQ8A 4JFTA 5JHDA 2VXUH 1FE8H 1G1KA 1AQDA 3BLPX 3ISWA 3FCTA 3RZWA 5F1SA 3NFSH 4N8VB 2BK8A 1IM9A 3B9VA 3U0TA 3ULVH 3KGTA 2ZNWA 2VR8A 2WNWA 1FL6B 1VADA 4O9HL 5TDNB 1PDKA 1HHIB 4GT0A 5MI0C 1OD9A 4JPSA 4PTUA 5DJ0B 1BLNA 2ILLA 4DGYH 3AWFA 5ESAB 1A6VL 5IOPB 1JZFA 1SDDA 3R4DA 2ARWA 3BWSA 5JO5A 1JRHH 4OUUA 5DHXB 4ANWA 4HIEA 4YK4C 3Q9QA 5IB5A 4KI5D 1KCKA 4KAQH 2WZPA 1JERA 1WF5A 4PSRA 1OSZB 4W6YB 5D72H 2WIIB 4G8IA 3F12B 3ZZQA 2AJZB 4AG4H 4FL4C 3H6AA 2ZKHH 2W0KA 1KCLA 5DTFA 2F19H 4B60A 3GYRA 4X6CF 4FQHA 5GZOA 4X4ZA 5LN8A 4G8FB 5EBLA 2C3VA 3NT0A 3WN6A 5D70H 4KJWD 4ZW6A 1NM9A 1YMHB 1AZNA 3A6BH 4EI6A 1WCBB 3G6JE 5FFLA 2OZNA 3EZ8A 3WIAA 2W95A 2IANE 1W16A 4ZD3L 3MTRA 5C0NC 3FRUA 3JVGA 5GGVL 3MX0A 5D1ZI 3LMJL 2BS71 3EBHA 4OLZH 3CVIL 5AEAA 3OJDA 1W72H 5DZLA 4DAGH 3BFOA 2XRAH 4OGXH 3AB0C 1NFDE 2NY3C 2YD3A 1ED3B 3ARYA 3RTQD 1AKJD 1QSFD 3MV7A 5D7SL 3ZSTA 1A66A 3W5MA 2JI2A 2N01B 1OAQL 4WEBL 4Y16D 2WO4A 2FEEL 4YXLL 5I8KL 1P6WA 3O4OC 1WYJA 4P4KC 2EICA 2R1WB 5HI5D 2ESVE 4J4PD 1QSVA 1MFCL 4L9LC 1Y6NR 2VR7A 1KBVA 2DMHA 1KF9B 3GRGA 4I0KA 3ZHFA 2WYHA 2GK2A 4JO2L 2AXGB 4FXKC 4R84A 2MTPA 1R5VA 2ZTBA 2DDQH 2C34A 4ABUA 3I75B 4NKDA 2QKIA 1OIOA 4BRJA 1BYNA 2CAKA 4D7PA 2Z93A 3N41B 4N0UA 4GUOA 4YHMH 4E9SA 3WJMA 4ISVA 4PWHA 5IM7B 2X6MA 5KVEH 3CFNA 7FABL 3GDCA 1JF6A 3ZN6A 2V17L 2VDQL 2P46B 4AKOA 3TBWB 4F2ME 4G5AA 3HE6D 1MJUH 5IJDC 4UI2A 5ICZA 3KWTA 2O6PA 5IMKA 4NKIH 3PWVB 4UTBA 2J56A 3RIFK 1A65A 1I31A 5J1AB 1JZ5A 4JG5A 3T1WA 1WBZA 2WB7A 5DQDL 5GGQL 3LKQA 2EIEA 4K8RH 4OT1L 1G9MC 3F5WB 3FU7B 4MNQA 4R5VA 3O3EB 3WFHA 3V4VB 2FB4L 2NY7H 1W72A 1ZGLP 3QISA 3QDHA 4PS8A 3EYFA 2NX5D 3T0BA 4ZW8A 3WV0A 1T21B 4NBZB 2HT4D 4IEFA 3JWNC 2AHIA 1K85A 4EUPB 3NZHH 3DTXB 3VQMA 2ED7A 2NY4D 3OKLA 3QWRA 3NJNA 1GYVA 1R5WA 1TVHB 5FC9A 3U9PL 3VM7A 4L18A 5LBGA 1HNFA 4QXVA 4BYHA 4HXBH 1VJSA 1AXSA 1HKLL 2P5WB 4OV5B 2R51A 3GI9H 3WHE0 1ZV2A 4PUBL 2FT6A 1QBMH 3NFNA 1LNUA 5ERWA 1WHOA 4BWWA 1HI6B 4L3CB 3PWNB 3TS8A 1PAMA 4B3VA 1B4RA 1KJ3L 5C9JB 2F53B 1TSHA 2W38A 3QDJE 4WI5A 5ECGA 1CXHA 2BVUA 5LWYL 2PCPA 5J57B 1KEGL 4NC0B 2VXSL 1EEUA 4G8GB 2R1XA 3ATDA 1WAAE 1OAKL 4HETA 4KXZH 1BREA 5FYLL 4XCYA 4KO7A 2ZP8A 5FF6B 4AW7A 1LWHA 5BOJA 3S36L 5HD8C 1NC2B 1AYRA 3P54A 1Y1DA 5F0JB 2GUOB 4YSRA 5AYTA 4BK5A 4OF3A 5ICYB 2H3NB 3QIBC 2Q20A 3OKNB 1OY3B 4BIKA 1BQ5A 4FYTA 1DLHA 2R69A 3TBTB 4G2AA 3PAYA 1IGYA 5A3IC 2YRPA 5T33L 2I9TA 2IVFC 3L3HB 2OTUA 1DQVA 3ROLB 5EEWA 4QRPA 3DMMD 3PWUB 5DZJA 5SWZB 2WNGA 3OWRA 3AWGA 3AXLB 1YNKH 3OMAB 4G9DB 1QSEA 2ZAGA 3KW8A 1IRAY 3CFQA 1YPZE 3KYMA 3MCLH 4QDGA 1I8AA 3STZA 4ZMPA 5JHLH 4ZJ9A 4EPSA 1YEFL 5LJYH 4QIRA 4NKMA 4FQXB 5ESQB 3HRPA 1NBYA 2ENJA 3UAEA 1FIGL 2AEQH 3VGAB 1CLVA 1VKXA 5DURD 4YSSA 1L9QA 4GO9A 1JPSL 4ZK8A 1R3IL 3MJ8B 5FA4B 3VGAC 4DEUA 8FABB 4HDIB 1DCEA 1ACCA 2X4UB 2R9HD 2ARJQ 1XF3B 3ECBA 4U6XA 5ENWB 4KKRA 2OCFD 1F0LA 4NYLA 1EHAA 4JL2A 3Q06A 2AJXH 4V11A 1T5WB 4C4UA 2YFOA 2W65B 5J1SC 4R2GD 5CO1A 4QXUH 5KS9F 3QUYB 4JREB 4JR9H 5CLYA 4G1MB 1ADWA 1RURL 4YBLC 4QJ4B 1V5JA 4MAYA 1ONQB 1IKFH 1HL4A 2FX7L 3ZKND 3WTXA 3NCEB 5F9AC 4PJEF 4OZFB 1IX2A 3UZEA 4F3FB 2XV6B 4G70B 1XH0A 4GKOA 4HPOL 3SO5A 4A7GA 5TF0A 2DIBA 4P3CL 2QQKH 5L4JA 5CNHA 1S7UA 2VSCA 3V4PA 3VNZA 2WZAA 5DYOB 3GXTA 1NTDA 3U4BL 2DWYA 3BVUA 4GSUA 4YSOA 1K4DB 1KN2H 4LKXA 2NZIA 1U8QA 1A7QL 1E5AA 3W1ZA 3W56A 2NSXA 2ICCA 1C16B 5KJ4A 3SQRA 1A4CA 4JFXB 1BBDH 1UXWA 1BLIA 5C9KA 1BEXA 2ZWNA 4ZPVB 3QULA 4PRNB 1U42A 1KELL 2EC9T 4YXKH 5HSFA 2I24N 3FOLA 4A7QA 3DX9A 2D9CA 3CMOL 4IQHA 5DRXB 5JW4N 4NHUA 1M57B 3BGMA 2GJZB 4Z78A 1H15A 2QDVA 3QFGA 5CJQL 5T3XH 3RGVC 3MUGB 2NT0A 2IADA 4HK3N 3OM3B 4LVHB 5HDLA 4POYA 3QAQA 1AJ7L 4ZTOL 3CTTA 4PJFF 1I82A 1MCBA 4TNVK 2O5YL 3OGCA 3PXLA 1CLYL 3B43A 4ZO6A 4NHCH 5CIPB 4WI6A 5J1TC 4PJBE 3RFRA 5C0CA 3H56A 4NQED 3Q7JA 4OJYA 1F4XL 1UZGA 1WBXB 3HZVA 5KVFE 4FQ1H 1SFHA 2F19L 5HHPA 4D0CA 1ID2A 1A21A 5D7LE 4YWGH 2VNCA 1G6RA 1T5XA 5D93B 3ZHLA 1JYVA 3CN2A 2R2BB 3GEFA 3ZE2B 3U6RB 3C6EA 1S7TA 3HS9A 4OM0L 3OKEA 2BVPB 1MDAA 2DWXA 4QHLB 4AEIL 4QOKD 1LO0H 4WU7A 2QPUA 2VKXA 2WGNB 2F1EA 1F00I 4XCCH 1T22A 1LDSA 2WO3B 5I1DA 1MVFA 3TYGL 2Y7NA 4NRYB 4X7EC 4CVWA 3MRQA 1T7XA 5FX3A 3QRGL 1J9QA 1ETZA 4E42A 5F1IA 2WXMA 2AK4B 1PL3A 1PY4A 3BVTA 3V7AG 1KLGA 3ETSA 4L9LB 4DO6A 2A9BA 3CZGA 2VDPB 3FSWA 1QWHA 4CGUB 1FZOB 3G7TA 4FNQA 1IIIA 3WFEL 2XVKA 5DUBB 5J6HB 4IIQA 3TZVC 3UAJC 3NCYS 1OPGL 1BVOA 4OF8A 4R26H 2J25A 4HJ0D 1KIUA 3WAKA 2JKWA 3X12A 3PP4L 3ZXAC 4A2FA 4LRIC 4HF5H 1JNNL 5SX5H 5KBKA 1BQLH 2KT6A 1IGTA 3RDTD 4LL4A 3ZE1F 5IM7A 1H6FA 3HC3L 4MMZB 5IVXF 3L2LA 1EAOA 2H4EA 4LDEB 4UIMA 2V17H 3M6DA 3OSVA 4YIQB 4F58H 5TGBB 1IB5A 5CZVH 5D7JA 3DUUA 4PWFA 3HI6L 3QCTH 4W68A 4EZKA 3EYQC 1ZOXA 5T3ZL 2K8MA 2NX5E 4MAZA 1ZE3H 1FYTB 2YPVL 5C0AA 1QHPA 2OJZH 2Y6SD 4E9LA 4P2YA 4RMTA 3DURA 2AANA 1RJZA 1QFWH 2KI6A 4WY7L 3IGAA 4JMXA 4MQTB 5A2CA 4HS6B 3OVUB 3ZDYB 4IBZA 4ORGA 4TTDD 2B9BA 1LMIA 5AYUH 4AOFA 1MCHA 5D1QB 3RB7A 3ZL2A 3FB6A 2UZYA 3VXOA 3IMWA 4YO0A 1OGPA 4M7LH 3GZOA 3S48A 1ZIBA 2MJWA 2DQGH 4GBXA 3T2LA 4GFTB 3RDTB 2Z91A 3FTZA 2E6PA 4NP4L 5EEZA 2V2TA 1U3YA 4KZCA 2K1MA 4TVUA 4XOEA 5DGRA 1JYNA 4NO3B 4PJCA 1FNAA 1NBVH 3UP1A 3UPRA 4KZDH 3PWNA 3D25A 3CSPA 5H2BB 1A4KB 4MDIB 1S2EA 3CPLA 3I9AA 2FHBA 3BGFB 4LRNL 2IQ9H 4MA3A 3QEHA 5AG9A 1IBHA 1ORQB 4JHAL 2RCSH 4FFZA 3FSOA 3U36A 4R7XA 2OK0L 5DD3H 1U8HB 4X6EA 5J0BA 1JV5A 5LXGH 1D6EA 1KGJA 2QKSA 3D2TA 3TVMD 4QCIA 5SX4I 4E41D 3C6LA 1JV2B 5CN3A 3B4NA 1A6WH 4RGNE 1IC4L 1T0NB 3UBXI 1AZBA 4L1SA 1OPOA 4O58L 4CW1A 5FK9B 1JPGA 4GG8A 1DJGA 3LRGA 3ULVL 1RK1A 1RZPA 1RLBA 2RGSA 3C60C 1EFXA 4ZW7A 1BVLA 4PWIA 4I9XA 5HJGA 2NY2B 3D18B 4QHKJ 2VN6A 4L9DA 4XPHH 3H3KA 3SGJA 3V5DA 5C0JA 4AIEA 2VQ1B 2X38A 3EGSA 3WCYA 2DWDB 4N0YH 4ODUA 4ZZFA 2Y36H 5F6IC 2DWTA 3QRFM 5F1KC 3EJCA 5BRQA 3H2PA 4H13C 3R1GL 1JSYA 4QY8A 1KYDA 1QQDB 1VB9A 3MRJB 3SE9H 4PD4J 1FH5L 3GKWH 5DK2A 4Y0GA 3U79A 3M8OL 1TJGH 3V4PH 1P4LA 4TNWF 3W81A 3VXMA 3GSOB 3CSTA 3QH3A 1O9WA 1X7QA 4KVPA 4NO2A 4P9MH 1QNZL 2IPUG 5GGUA 3BUTA 3HS0A 4ZFZA 4EIZC 5CCKL 1G7HB 5KYYB 5BVPL 3M1CA 4JR9L 3TN0D 2HT2C 1OP5K 2VZ1A 1PFOA 1OANA 2YK1H 1CB4A 4PFEA 1IKFL 3Q3GA 4M8QB 4WNQB 4E68A 4XC1H 2G75A 2P5EB 3X3FH 2PW2A 1NGQL 3CN1A 4NKOA 4R4NC 1FO0L 4GP4B 4TYUA 1Q72H 2WUBL 3D06A 1RIUL 5TH2B 3GWJA 3V6OA 5C6TL 5CCGE 5D7SH 5I1JL 1N0LA 3QDJB 4KKLC 2PCFB 5DVNA 5C0DA 1FNFA 2YS4A 3NEXA 4P5MA 4D8OA 1UJ3C 1YEIL 1HYSD 2CJ3A 2GJ6D 3B2PA 4MLSA 3T2QA 4JM2F 4X7TB 3U9WA 1ILSA 4P2RB 3LOWA 3RX7A 1HH9B 4K7FA 3ARGD 4HFUH 4D8PB 5J4MA 1ZVHA 4F7CA 3R7QA 4FLOA 4JQXC 3CUPA 1GC1L 4G5ZH 4AQEA 3GSVB 4PREB 5B21A 3REWA 5JW3L 3DVIA 1VSCA 2COQA 4M6NL 2B16A 3MROA 5MENA 3BGMB 4Z78B 4O2CA 5EWIL 3UEQA 3NZ8A 3QIWC 3FFCA 4GQPH 4U2ZA 4ONGH 2G9KA 4ZMWA 5I0ZA 2XTJB 3VB9A 2P8PB 1TZGL 3ZLQC 5F9JA 4DVRH 1A7OH 5DUJA 3OD3A 4B9YA 5C3IA 1OF0A 4PP1C 3DX0A 1P5UB 4NXKA 2DQFB 2Q9OA 5MEOB 4LZKA 4AM0A 3KPMB 3MXVH 5DJAA 4FE9A 4CBPA 1H3PL 2CRIA 3MR9A 4IRZH 4K8RL 4OT1H 1A1OA 2CGRL 4HYTB 2HVJA 5I1HL 1WH0A 5GIRB 4OZGF 4GS7C 3CVHL 2NY7L 1MFDL 4P4KA 4YVUA 1I8KB 1XB3A 2ESVD 4Y1AD 1BF2A 4MCNA 1SOQA 1Q1JL 5FGBA 3GSRA 1QI3A 3M88A 4ZO9A 5FYLE 3VQ2C 3WXWL 5HYSG 2J1WA 3KE0A 4XPFH 3H9ZA 4M1GL 2WNKA 2AITA 3V6FA 3GI9L 1JZDC 1YMHA 3VXUE 1VPOL 5IQMA 2IOOA 2Q2LA 1EERB 4A2HA 4NENA 1PF3A 4ZUSA 2ZKWA 4DKEL 5I66A 5C0FA 2L0DA 2JKTM 4JFFE 1VFAA 3LYRA 4TSBH 1TVBB 1AXIB 3DXAA 1ZRUA 4N90E 3DV4A 1S7RA 4P59L 2NY3B 4LVNC 3QDAA 1L4IA 1JS4A 4MCMA 4LCYA 3E8UH 3RIFF 3SQBA 5KS9E 2XG5B 1QVOB 1S9YA 2XPYA 1CDIA 4Y5VB 3U0TB 4Y5XA 4R9HA 5C08B 3PWPA 4IS6A 3OKOB 3TTSA 4FADA 3HOGA 2GFBA 2UX7A 2W9LA 5GZOC 2E86A 5AYQA 4RRPA 5TDNA 5FO2A 5C0IA 4EXKA 1CJYA 4ZRGA 3DSFL 4GB9A 1QSEB 3UTTA 4KKAD 2WSKA 3KLAB 2BSDA 2IBZY 4KUCF 1N18A 3MJ6A 4PH8A 5IOPA 4UQBA 1GGUA 1WE5A 3MLRH 5DVLA 2NUTB 1ZSDA 4W9EC 3ULSA 3JVGC 1ADQA 4P5TD 3W3BA 4ZAKB 4ENZA 1U33A 3OAZK 4LPWA 2AJUH 1TO5A 4OY9A 1Z5YD 4D94A 3S34H 3IAPA 3WMSA 4QLRA 3BKYH 3UYRH 4OF7A 1JXFA 4XGZB 3WNJA 4MMXB 4OJCA 3ZOAA 4Y19D 1NDMA 4KO5A 4NM8H 1NEZA 4H8QA 1F8TL 3FK3A 3TEWA 1WCBA 3JTTA 4N0UE 2HFTA 3EIFA 3IF1B 3LZOA 1HT6A 2XWJB 4L4TD 1BCIA 4NGHL 3RE0A 2I07B 4NFDA 3ZKMD 3N43F 1DCLA 2OL3H 4PJDF 3DX8A 5CSGA 3SB3A 1EZSA 4PJ5E 1P6FA 2TSAA 4U1IB 4CAGA 4NO3A 2IALB 5T1JA 4HLZH 2MMXA 2JB6B 3BW9B 1UZ8A 4M1DL 5TQ0H 3T3ME 3FUEA 3WD5H 4KKZA 5C09A 4OZIF 3NJVA 4U3XA 5HGBA 2HRPH 2BY0A 3KS0H 4KDTA 4ZFFA 5D1ZC 1Q90A 1J5HA 1Q9WB 1SHSA 4GG6E 3HFML 3OKLB 3G6JB 2EVFA 4WTQA 1WZ1H 1EJ8A 4UTAH 2VLKA 1SHMA 2Q3XA 1BAGA 4PJEE 4WENB 5BRZD 2CHXA 3BPCB 3D50A 4NBYB 3N1QC 1KCUH 1IE4A 2IAMD 1G7JA 2A9AA 4W9FC 3I75A 2EDLA 2VXUL 1MIEH 1T3FB 3A23A 2NXZC 4FMFA 4NZUL 1IAMA 2HTKD 4BFEA 2CLVB 4UIKH 2YD2A 3WKYA 2FWOA 2DL9A 3V2AR 1I1AC 2VO8A 2X28A 4XPHL 3HLAA 4F7MA 4YFEA