1OEZW

Zn his46arg mutant of human cu, zn superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
124
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVHEFGDNTAGCTSAGPHFERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Amyloid-Like Filaments and Water-Filled Nanotubes Formed by Sod1 Mutant Proteins Linked to Familial Als
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 124
sequence length 153
chains with identical sequence X, Y, Z
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oezW00
1JCVA 2Z7ZA 1Q0EA 2AF2A 1UXMA 3QQDB 2R27A 2AQNA 2JCWA 1YSOA 1OALA 1CBJA 1YAZA 1SPDA 2AQQA 3GZPA 2C9VA 3ECUA 1BZOA 5CU9A 3CQQA 4BD4A 1IBFA 1U3NA 3PU7A 2XJLA 1N19A 3MKGA 4BCYA 1SDYA 2V0AA 2Q2LA 3RE0A 4OJAA 1XTMA 1IBBA 4B3EA 4A7QA 3KM1A 1SXBA 4A7GF 2ZKWA 3CQPA 2GBVA 3KH3A 1OZTG 2AQSA 2WZ0A 1SXCA 3KM2A 4FF9A 2WKOF 2SODB 1PZSA 2AQRA 1EQWA 1SXNA 2Z7UA 2E47A 3LTVA 1F1DA 1JK9B 1FUNA 3HW7A 3L9YA 2AEOA 1E9QA 2JLPA 4A7UA 1YAIA 4N3TA 4A7VA 4BCZA 5KBKA 2C9UA 2VR6A 4MCNA 1XTLA 1E9OA 2GBTA 1UXLA 2LU5A 2Z7WA 3KBEA 2C9SA 2NNXA 2XJKA 3K91A 1OEZW 1PTZA 2VR7A 2E46A 1S4IA 5KBLA 1PU0A 3KH4A 1IBHA 3H2QA 1DSWA 3SODB 3GTVA 2Z7YA 2AQTA 3F7LA 1MFMA 1B4TA 1F1GA 1L3NA 1AZVA 2K4WA 1EJ8A 1ESOA 3L9EA 1SXAA 4U4IA 1BA9A 2ZOWA 1E9PA 1SRDA 2AQPA 1E9QB 1DO5A 1SOSA 2ZKYA 1XSOA 1KMGA 2WZ6A 4N3UA 1SDAB 2WYZA 2WZ5A 1QUPA 2APSA 1OAJA 1SXZA 2WWOA 1B4LA 5KBMA 3MNDA 1HL4A 1SXSA 2WYTA 1IB5A 3T5WA 2WWNA 4A7GA 4L05A 1F1AA 3QQDA 4A7SA 3GZQA 1JK9A 2WKOA 1COBA 4MCMA 4A7TA 2VR8A 3GZOA 1Z9NA 3H2PA 1N18A 1HL5A 1RK7A 1CB4A 1Z9PA 3F7KA 1TO4A 1OZUA 3GTTA 3S0PA 2ZKXA 1E9PB 1TO5A 3GQFA 3HOGA 2GBUA 3KBFA 1E9OB 3ECWA 3CE1A 3ECVA 1P1VA 1F18A 1IBDA 3HFFA 4OH2A
chains in the Genus database with same CATH superfamily
5CP3H 4JKMA 1P69B 5B7MA 1KCRL 3EJZC 2XSKA 1U8QB 4RMSA 5JW4N 3NG5A 3QBTB 3FRUA 5HDOA 2EDEA 1FG2B 4OJFH 3HG5A 2O6EA 4FHBD 4MDJA 4JN2B 3O6FB 5IEHB 1LDPH 2EVFA 4ZG1A 3KE0A 1NAMB 1AGCA 4CW1A 5A2AA 4HUWA 1R3LA 1L0QA 1SQ2N 1OB1B 5T3XL 2KPNA 4WZ9A 3F64A 4BQ9A 3RHWF 4RSVA 2APWA 3P40A 3GXIA 4J3BA 3U1PA 3MHZA 3ARFA 1IM3A 2XTJD 1XGPB 4R26H 4Z78A 4AC4A 2AXGA 2H2PC 1UUSA 3NGBB 1H3PH 3FN0H 3PAUA 5DZNA 1CR9L 5FHBL 4TOYL 4X6DE 3L3JA 2QQNL 2V2WB 4TSAH 3BD3A 2RQEA 3QRGL 5EZJA 4ABUA 4BH8B 1BAGA 2AEOA 5B39B 5IOPA 4I2XE 1C08B 2F53D 2XPZA 2EEAA 4R4BA 1JGVL 5F7FA 4Y1SA 3C5ZB 3WY3A 5DVMA 3FFDB 3QA3A 3BAEL 3ZYIA 2BY3A 2G75A 3J7HA 3L1GA 1FVEA 4JRYB 1RK0A 3SKJL 4S2SA 5KVFL 3FUKA 3OKMA 4K3JL 3SDXB 4NNXA 3QE5A 5FGBC 2K4AA 4NLHA 3UMNA 1RK1A 1O6TA 1TOXA 1DLFL 5EPMA 1AKJB 4EDWL 1I8MA 3GHBL 1G7MB 4DN3H 5IMOB 1Q1JL 4PJXA 2A1WH 4PJEE 4XGZA 1ZXQA 4JKPH 4F7PB 5JHBA 2V37A 3MYJA 4JM2C 5CJBA 1TPXB 3ZL1A 1KV3A 4MJID 1RUAL 3ZZQA 5DTFB 1JZGA 3GWJA 5KBMA 1F41A 1EXHA 3QCUL 1K5WA 1AIFB 1MCDA 4NZTL 1YNTF 2OZ4L 1JRHI 4JFEE 3P4OA 3ZE2B 1QRNE 3BWUF 4HX1B 4PG2C 1DVXA 3AWFA 3R4DA 5DI8B 5GHWL 5CIPH 4BKSC 5IT2H 2EJ1A 4XNDA 3WO3B 4YNYA 5LGKA 3S3CB 1GGBL 4HUNB 5IMMB 3QJOA 4GW5B 5DJ2B 4O58L 1JWMA 3WIHL 3WFCL 1C5CH 1NBZB 4LIQH 5DD1L 5AQ0A 2EILB 4PUBH 4AGOA 2YA2A 2PYFA 2VWEC 2NY4D 1MXDA 2HVJB 3KVPA 1G7IB 3P4MA 5F3FA 4PS3A 1GW6A 5KSBE 4HLEA 4MD5A 4F7EA 4XE5B 4HUVB 2VR5A 1IC4L 4X6CE 1M2VB 1IBYA 5IQ9A 4OFPA 4GSDL 3ARDB 4JHVA 1UEMA 4EF3A 2G4EA 1I3GL 3D7PA 1WDAA 1JXKA 3I6GA 5ICXB 5J5EA 4QRRB 4APQC 3GMMA 5F1NA 3AADB 2LV4A 4M8QA 4OZGF 5KTEL 4N28A 1BF5A 2DDQL 4EBQH 2WAQA 2OA9A 2ERJB 3LD8B 1SEQH 1FV1B 1JVOA 3VFGH 1ES0B 4ZNEE 1BFSA 3KPRA 1Z0NA 3ULVC 3U6RB 3BSHA 2BP8A 3ATDA 3O3BB 2HTLD 4OJAA 3UJTH 3UTSE 4JHUA 2XRAL 3MLVH 2W91A 3QUZA 3L4VA 3GRGA 2NY7L 4LLQA 1PY9A 3FTWA 5ESQB 1FH2A 3CVHB 2WZ0A 4PJDA 2YIHA 4TVPL 2WXOA 1TTRA 4AXWA 2UWEA 3FSAA 1TKWB 1RHFA 3POCA 2ZOUA 3NCEB 2GKIA 2F0CA 4NUQA 4TF4A 3HRZA 3CGTA 3PV7A 5F9DC 4F2FA 3DO7A 2OK0L 4GKZA 4M43L 1PQZB 1HDMB 1FIGH 2KL6A 2WSPA 2WTRB 2CBTA 3QNYA 5BZXA 3RVUD 3X11B 4KZEH 4I3RH 4L4VA 5TF1L 1S7XA 4YDKH 3OLGA 5L88L 4HIEB 3GBMH 1HNGA 3G04B 4OLYL 2XTJE 4MAYC 2B9AA 4WGWB 5JHAA 1Q9LB 1JPFA 3V5HA 1ROWA 2AERT 1J8HB 3K4ZA 3VG9B 5E23A 1L5GB 1CQYA 4YXLL 1P4IH 2YEZA 2X89D 1CL7L 3IMVA 2Z8WC 3ECBB 3MLTB 3QZOA 2WYIA 4NPJA 2R2BB 3O4OB 5CBAB 2Y3AA 3HMWH 1ZLVK 1XGTB 3C08L 2F53E 5IB2A 2WXLA 3GIZH 4GG6B 4YHZH 2OKMA 2WPGA 5JLZA 2AEQH 2JTDA 4U1SB 5E2VL 3GKWL 4ZMTA 3NJXA 3VJ6A 4XP6H 5DURB 3RQ3A 4RMTA 1AR2A 1YECH 2BOCB 3ARZA 1DANT 4XNAA 3TF4A 4PJFB 5F0PB 5F1SA 5K59E 1A6TB 3WFBH 2BOLA 4ZD3L 1RMFL 5L4MA 1G7HB 4FQLH 1PJWA 1BBJA 1LO5A 3UJIL 3E3QC 3U30C 2HG0A 4FQ1L 4FXGB 5IMKB 1ZTXE 1E65A 4MQTB 5JQHC 4AC2A 2MQ3A 3A6CH 5CHNB 2VXSL 4MJIE 3BPCB 4DO6A 4XOBA 3NN8B 1ZGLB 5T5FL 4I8DA 2P3YA 1ZKAA 3I85A 3O3DB 2EVJA 4WI8A 1IL1A 4OT1H 3VXSD 2NQCA 3RGVD 1ZT7B 3GSVB 4UNUA 1QFUH 2X1PA 4OGXH 5FW8A 3MLSL 2MCMA 1MFAL 4XWGL 1NL0L 1DL7L 2XETA 9PCYA 3V0JA 1MCNA 3SOBH 3Q2CA 1VJSA 3PDOB 1FDLL 5DJ6A 1SJXA 1H3TA 3ZZLA 1FGNL 3APCA 4PRPB 4ZW7A 5D7LB 3FHEA 4ERSH 4B97A 3L9BA 3T0WA 1OAQL 2XKNA 4JO4H 3B7TA 2V0AA 2PW1B 3RI5K 3EYFB 3U2IA 4IRSB 3QJHB 5LKNA 4KAQH 4XH2A 3TPKA 4YWGH 3RP1A 1LE9A 5GRXG 3DDGA 3G3LA 1HH9B 5MEND 1GJIA 5CNHA 3MRLA 5F6IC 3U9UA 4AQEA 5FM5O 4GXUM 1WO2A 1CLYH 4JKNA 4QNPE 5JYMA 5FGCB 1GYWA 3ETBJ 1UB5B 5IVXE 1KLUB 3VWJA 5B1JA 1QFWH 1MFCL 2ICWJ 2Y5TA 3GSOA 5AUMB 1TJGH 4PHXA 1QLEH 4TN9A 4UDUB 4AYBA 4QHLB 2H41A 1R34A 4JM2B 3CPUA 1LNUA 2BVEA 1W2KT 2WVVA 3C6LA 4KOCA 3ZO9A 4Z7UA 1PTZA 4KFZC 5AW4B 3O2DL 1S7RB 4L1LA 3V9FA 2JJWA 1U8QA 2VLLB 2Y7NA 3WFHB 1U8JA 4Y9FA 2JV6A 3M8OH 3OHMB 1MHCB 4W9JC 5T1KD 1FRGH 3AAZB 3KYMA 3T8MA 5I5RA 4YDZA 1YLBB 4JN2A 5IEHA 4NO2B 4RAHA 4GMSH 4ORGB 3QDGB 3CHPA 1N26A 3FJTA 1OB1A 3OJ2C 2PCXA 2R0LL 1EDQA 2YLHA 4N3UA 5FM4A 4PJAE 4TKWA 1XGPA 4F5CA 1YYML 1UWXH 2VRQA 3FO0L 4J12A 2I60L 2YEVB 2V3DA 4P5KB 4UNIA 1BZEA 1P5UA 5T1LB 4XN4A 3X13B 2ZCLL 1EFXB 1YN6B 2R9HD 4Z76B 2XIDA 1CLZL 2X4NB 1C08A 2YFOA 3JZYA 1WTLA 3TURA 4APQB 3D69B 4QAMB 4JRXB 2MPAL 1NIAA 1WA1X 2VDMH 3FFDA 5MEPB 2CHXA 4E41D 2OSLB 1LE5B 2CUIA 3MUUA 4KVNL 3GSWB 5LQBH 3F7VA 1MN4A 5TK2A 3GTTA 4LF3A 2ZSVA 3GXPA 1EERB 3H0TB 3IEAA 4HLZH 3FYIB 4JFDB 1F5WA 3SDXA 3CDZB 4N9GB 4WWKD 3RURA 1DUZB 3COOA 3RL2B 5F0MB 5D6CA 5CN3A 3VVWA 2C9PA 3BZEB 3JUYA 4FQPA 3D06A 5HI5D 1N64H 1G7MA 3WNLA 3IFNL 5IMOA 3RWGA 4AKPA 4XR8C 1KIRA 2J3SA 3QZWB 4ZUVB 4X8GA 5J7CC 5AL0A 4F7PA 3O41A 4RCAA 3RTQA 5ENWA 4NUGL 5DHVH 2HZHA 3S5ZA 3TZVD 4LEEA 4NRXA 4C8XA 1G6RH 4L8CB 5DTFA 3U1SL 3P0YH 2JNZA 1AIFA 4JO8A 3FTYA 4TYUA 5E94B 2XVGA 1RIHL 5BOJA 1PMYA 3VXSE 4HX1A 1T0NB 5DI8A 3QDHA 3IETB 1SEBA 1TG8A 4UIKH 5DJ0A 2Z0BA 2Y1YA 1YQ2A 5GRZA 5KVEH 2AQSA 3A4AA 3D50A 2E7LC 5IMMA 5AYUH 1OQOA 2BRQA 1X5MA 4GW5A 5DJ2A 4EIBA 4I9WD 1T0PB 1BZ9A 3ML9A 3H3PL 3T2QA 2Q6WB 4NWTH 3MOQA 5BNXD 5I73C 3OMZA 3LRHA 3ELQA 4OKVA 2VB5A 2HVJA 2VISB 3KXFD 2FO1A 1SHMA 4JHAH 1OW0C 43C9A 4J5VA 4X6DB 3PQYB 2JKTM 4U1JB 4ZAKD 5AW7B 2YWYA 4AV5A 4I2XB 1EMTL 3ARDA 3EHBD 1MCRA 1D2OA 1ODUA 2UZIL 2X44D 5ICXA 3SY0B 3WJLA 2QTVA 4QRRA 3K2MC 4DQAA 2PCPB 5E7FA 1FN4B 1XIWD 4V33A 5MENE 1BEXA 1UWEL 5TFSH 2ZUWA 5EDSA 1NAKL 1FV1A 4KJQD 3D39D 1GS6X 3GYRA 1EJ8A 1ESOA 5K1NA 1UB6B 3O3BA 4G8EB 3U30B 1NC2B 3HMXA 1NGWB 2CLZA 3DVGB 1TF4A 3FFOA 3I50L 4MAZA 3VFWA 5CEXB 4E9VA 5ESQA 3CVHA 3WTYA 2HTLC 3TBWA 4KDWA 5CINH 2LLGA 4YS4A 1I9JL 3QCVH 4TTDC 4ZMVA 3SE3C 1LP9F 3OPZH 3IS0X 5CUSL 4G1MA 4L05A 1CFMA 2D03L 2JMRA 2BRRL 4IBYA 5KYNA 3DSNA 3Q44A 2ARJB 2BS71 3LS4L 3FOLB 4PREB 3V55A 3WKYA 1T66C 4DGIL 2FQGA 3ZGIA 5C6PB 4I0KA 1PQZA 1HDMA 3L1OH 2IALB 4GRWH 4AGLA 1QRNB 1TFHA 3X11A 4IYKA 4NJ9H 1FLRL 4J3UA 4L48A 1DJWA 1DQVA 1PCSA 3O0RL 5D2NC 4HIEA 2O5XL 4W6WB 3G04A 2PR4L 1W0WB 5DS2A 1QRKA 4BHUA 1Q9LA 2PCFB 3CLWA 4UT9H 5BUGA 1UZ6F 2WV3A 1L5GA 3IN2A 4PJGA 1O6SA 2F58L 3WKQA 1IBDA 3PHAA 3ECBA 3MLTA 4PGDB 5I19H 5HHQB 2R2BA 3VGFA 5KSBB 4ZMAT 1XGTA 2DI7A 1A4BA 4D9LL 1RURH 4GG6A 4F20A 4X6CB 2VSKB 1T22A 4E41E 5F6IB 3E1ZA 1NDGA 5C09D 4GAGL 2NNFA 1JP5A 4U1SA 4ZFOL 2FJSA 5E51A 2TAAA 4B6ZA 1MZZA 3UL4A 2ENQA 2MJWA 2BOCA 2HT2C 4E68A 4HS6A 4KHTL 4ZX3A 1A6TA 2H0PA 4Q7DA 4XI5C 3QHZH 5HD8D 1AD9A 1RFDL 4KH9A 1G7HA 1U33A 4HS8L 2EDRA 2N7AA 5FO2A 3BIAX 4NN7C 3UTSB 1B3JA 1ZV2A 1JV2A 1Y7VA 5IMKA 5IHZA 4KROC 3BVUA 4HWZA 3B9AA 4ZMQA 4GEJA 4K4KA 1NANH 2OFQA 2Z92B 3MFGB 2FVNA 4YDVA 1FNEA 3RYMA 5I16B 5E99L 5ADOH 1OPGH 3GSVA 1T7YA 3AB0C 2C1OB 4J3WA 4KXAA 3DVIA 4AI7A 2DWSA 4G7SB 1E4XL 3JV0A 5L2JB 5L8LB 4I9WE 3MLXH 3QRBA 2ZD0A 3PDOA 4BWUA 3SODB 3S8WA 2B2XH 1ZLWK 3GXFA 2VZ3A 2XQYK 2XTJB 4K3HA 4ABVA 5D7LA 1NCDL 3KXFE 3H6AA 2VDPH 2JKSA 1BA9A 3EYFA 4XPGL 3QUYD 4JO2H 3QJHA 1JFQH 1P4LB 4PP1D 3QZBA 1J9CT 3CHXA 3P2TA 2F53B 5A3ID 2FZ3B 4P46C 3MBED 3QC6X 5F9WB 1KTBA 3FDWA 3VW3H 1HH9A 1EFQA 1Q90A 3G6DH 5FGBA 2IDFA 4JPWH 5E8NB 5LBSH 2O30A 1PF3A 1AC6A 2VW4A 2P8LA 4WI0B 1EJOL 2DMHA 4ELMF 4QHMB 3D39E 3M1CA 2ORBL 3KLSA 3VM7A 4UDUA 3OMNB 4JM2A 3ZTNL 2VUYA 3N44B 4B9PA 5LNEA 4FI7A 3ULUD 3G6JA 4KTEL 4DKDC 5ACMA 2SEBA 3QFDB 1CTNA 1S7RA 4LSSH 2YAOA 4NO0B 2VLLA 4O2CB 3BKCH 4MJIB 4PG2A 4EN3D 2WOYA 4OZ4B 3CC5B 2FHBA 3MLYL 4KKLD 1JGDB 2QPFA 1OTUD 2DQUH 1O5DT 2Z1PA 5IK3B 2YGQA 5EN3A 3P4LA 4RMQA 1VA9A 4PS4H 4U7KA 2OYLA 4S1DD 4HQQL 1D5IH 4HT1H 4EDXB 1NCWH 4DUVA 3A23A 2X41A 4XVTH 4BRVA 2O6CA 4M7KH 5D7HA 1NGZB 3L7FB 1TTFA 4FMVA 4P5KA 2HKFL 4XP4L 2NY4B 4FZ8H 2ITFA 1J8SA 2V17L 1EFXA 2ZZUT 5FO7B 1YN6A 2KMWA 2VNCA 3OPUA 2X4NA 3FO2A 1DVYA 4OLWL 4APQA 1HI6A 3DGDA 1H3GA 4V1DB 5F8QC 1CFQB 5MEPA 3U7YL 4PRBA 1GA2A 2OM5A 2R9HC 4H0IA 4R7DB 3GSWA 5C09E 2AJSH 2IXQB 4FCAA 4Z7WA 1AD0B 2EIZB 3H0TA 4N86A 4NQVB 3FCSB 1RP9A 3LNFA 1XCTB 3GMQB 1BEYL 1TCMA 3CDZA 5IR1B 2CO7B 35C8H 4PLKD 1DQLL 1XV8A 3RL2A 3IU4H 3BZEA 3WIHA 1XEDA 4ZMNA 4F7CB 5IVXB 3CFBB 5HHME 3UCQA 4WWKC 5C2BL 3QZWA 4ZUVA 3BGFB 4ZRGA 2XWRA 3M17B 2ZUUA 5HDLA 2BVOB 3SKNB 3B2DC 4JPIB 1O7SA 4X0KB 1V55B 3QGVA 3IKCB 1OAYL 4LOFA 2OI9C 5JOEA 2HFTA 3TZVC 1RZJL 3RHWK 4G8GD 1T0NA 2EC9T 1RVFH 2B7DT 5D2NB 4DW2L 4YHML 2HRGA 4M4PA 4MAYA 1SXSA 4OD3L 5DD3H 1HCZA 3MOBL 4X5RA 4F9LC 3P30H 4PJAB 3GZQA 3LZPA 2Q6WA 3UROR 3GD1C 2F1AA 2X4RA 4MB4A 2VISA 2D7OA 4JG5A 4PY7B 4KY1L 4X6DA 4X8XA 3PQYA 4XN9A 3OX8B 4P2RD 1NCUA 3BD4A 3LHPH 2OXGB 2YEQA 3DX9B 1XEUA 3EHBC 2B14A 1MF2L 1RZJC 3MLRL 3DLQR 3QNXB 4HS3B 2GCYB 3IN0A 1UXMA 4OGAD 4NN7B 2ZP8A 1JF5A 2YKLL 4PB9H 1FWXA 1UB6A 4G8EA 1UH2A 1SFDA 4L0YA 1NC2A 1OSEA 5HYSB 5I8EB 1OCCB 3OJVC 1KJ2L 1NGWA 1WFIA 3DVGA 3IKKA 4HGMA 2VAAB 4KJQC 5HI3C 3RVXD 5CEXA 4H8WH 3JQOB 5HJ3B 1GSKA 3ULUE 1PZ2A 4WHCA 1GTNA 3PJNA 4XTRD 3M7OA 5T33L 4AZ8B 4YX2L 4X2UA 2ARJA 3RVWD 3AB0B 4JG0L 1NMAH 4P8QA 5I1EL 5IW6B 3FUMA 3FO1B 1CL7I 2IALA 5L0QC 3VXSB 3RTLA 2X4SA 4ZUTB 3SOTA 2OR9L 2RAMA 4NZDA 3PHQB 5HP5A 3BGMB 1ACCA 3F7PC 4G6AD 2Q5BA 3Q1SL 4F8QA 4U49A 4BCZA 43CAB 5B39G 1DHKA 1UD6A 3NAAL 3GLAA 2UY7B 1NWOA 1X3DA 2I85A 4HFUH 4LBEB 4NNPH 3S34H 3NDYE 5EF0A 4C54A 2CK0L 4HFWB 1OEZW 1XMWA 5HHQA 1ZEAH 3FHQA 4P46B 1PU0A 5KSBA 4OLUH 2Z6FA 3QUKA 4AGQA 4UOZA 2C26A 3TJEH 4I85A 3MV7D 4YC2C 5AZ2L 2GK2A 4X6CA 1T1XB 5ID1B 2Y9RT 1I85A 2GTWB 4L5FH 1QR1A 3CCHB 3E2HC 3SSGA 5MENB 2EDOA 1KIUB 1KPUA 4KK9D 2JQZA 3H54A 1WBYB 4HU8A 4Z0BL 3TCLA 1UXWB 4LLUB 3OZ9H 3UTSA 1B3IA 1LWJA 4DT2A 3MRBB 5AVZB 3S5LG 1EIBA 2K7PA 5GSRB 3NTCH 2R0KH 2Z92A 3FT4B 2XN9A 3EH2A 3UYOD 1ODAA 2YKKA 2CKBL 2CO6A 5T1KB 3ZDZF 5I16A 3G9AB 4G8GE 7CGTA 1JTTA 3PGFL 4YIQB 1MRFL 1Q9WA 3KPPB 5FFGA 2PXYC 5CEZD 1KBVA 2C1OA 3QJSB 3MJ9A 4JFVA 1URIA 1AIZA 1L0XA 3VU1A 3TEYA 3KPOB 3VFOA 3NZHL 1YEEH 1XB6A 1BAFL 1H6UA 4H0LC 3JTTA 4I3SH 5ETUA 3AQZA 3LJ3A 3V6OC 5GGQL 4NWUH 3Q48A 4AIOA 1UD8A 5FUOL 3OC8A 3RUGF 2DBLL 3QFJD 4JO3H 3O2DA 1BGXH 4AM0B 1ZVHA 2R7EB 1VESA 3CQQA 4P2RE 4PJHE 3GHEL 2FZ3A 1GVIA 1IC7H 4PJIF 3ROOA 2PPCA 1TTUA 2J71A 4UU9B 3KNBB 4ETQB 5CWSB 4E41B 4UF7C 3ERXA 1MFBH 4NP9A 3GJFB 3SE9L 5E8NA 4A6YL 4KX9A 3S3SA 5MI0B 3MBEC 4LBAA 2X3AA 4WI0A 4NO3A 4QHMA 4H4NA 3KAAA 2XN1A 4WWKB 1D6VH 1SYSB 1I7ZB 2R0WL 1EA9C 3CMOL 1R33A 1KCVH 5KBNC 1IIKA 3AREC 2XYCA 3OBAA 3HJEA 3AGVA 2J6EL 3FH8A 3OLEA 2A77L 4AEHL 1UGKA 1BM7A 1YEWA 4R4NC 3DURB 3ZOAA 5IESH 3QFDA 4RRPA 4G8AC 3ZL4L 2GSGB 4LSRL 1NFIA 1NFDE 1O9ZA 4NO0A 2OI9B 4O2CA 3FUFA 4G3YL 2UYLB 4MJIA 3SE8L 3TZVB 1XVSA 2G0LA 3V6ZB 1NUDA 3ARPA 4OJYA 5C2UB 3I9IA 4OZ4A 2AK4A 1PNCA 3AABA 4HCRL 1JJUA 3UMTA 1A5FL 2DEYX 4EPSA 4K5LA 2AXHA 3ME0A 2E7LA 1MCJA 1A6PA 2WM0A 4D7BA 4TNEA 1IARB 4NCC1 4UQ3B 1U4EA 3QJVB 4WF7A 3CJJA 4LQFH 1OTUC 3AS2A 1QBML 4IBVA 1IC5L 1PKQE 4U1IB 1OW0A 3ZRSA 4OZFH 1AE6L 4S1DC 4JCLA 3V4PB 5FO7A 4JUSA 5BUAA 2F61A 3KXFB 5I1AA 4KRMB 2VDNH 3F8UB 4LOUD 4IMLA 1QLEB 3B3IB 4Y8AA 4ZAKB 7TAAA 3L3KB 4V1DA 1WAEA 4KC3B 2EEFA 1CFQA 5E6ZA 5EU3B 4A7SA 2ZXQA 4AE1A 3EHBB 4R7DA 4V2BA 3A67H 5JPNB 2EIZA 1T5XA 2V33A 4M9PA 4NN5B 3FCSA 4O02B 1RY7B 1XCTA 2X4OB 3N0PB 3O11B 4P07A 5SV3A 3D52A 3FFCD 4YAQA 2X6MA 5HYJD 2CO7A 5B3JF 2WOBA 3ULSB 2CU9A 3CK0H 3OKEB 5F1IB 2QQQA 1AO7D 3PWUB 3D39B 5EOCL 4AT6B 4Y2NA 3CZJA 1KB9J 2MMXA 1UQSA 2QDWA 3AFLA 3AMLA 1KELH 4HXBH 5DRXB 5BOPA 2UX6A 5FOJA 1WFUA 3SE3A 3M17A 1JNLH 5DRZB 2BVOA 4I48B 1F18A 4R7NB 1FNSL 3EBGA 2BSDA 4FYTA 3DV4A 4X0KA 5CJOH 3EGXA 1D5XA 1I8UA 3HI6H 2Y2WA 3IKCA 1A3LL 3SKUD 2HFFB 1AR1D 3V10A 1OT1A 3QAZC 1PYWB 4UV7L 3LNHA 1ZA6B 1A3ZA 3BT0A 4NQTA 3T1FB 3DETD 5D2NA 3O2VL 2XPYA 4QRQA 3UC2A 3X1GA 4OIBA 5CEZE 2Z31C 4QGTA 1NGQL 1IGIL 1M57B 2KZWA 3II2A 2XY2A 3V4UH 4IIQB 3AITA 5LVEA 3U83A 4PJAA 4X5XB 4MAUL 2IDCA 3VMNA 1IGFL 1ZDQA 4WTZG 1F3RB 2Z4QB 3WYRA 3QFJE 5LXGH 5FIEA 4PY7A 1Q72L 5A2JH 2FR4B 4M1DL 4S1SH 3EYSL 4NDMB 1RU9H 2CIKB 3SN6N 2IIJA 4C4UA 2P7TB 1OD9A 2OXGA 4TPRL 4RMBA 5I1HH 3E2HB 1EH9A 1CLCA 3DX9A 2PETA 4LCYA 5D1ZC 2RA1A 4R5XA 3HBZA 1UXLA 2FD6L 4XNZC 3UP6A 5C09B 2XWDA 5DJDB 1SFHA 1YVLA 2BSTB 2GCYA 4W9HC 4U1KB 3W9DB 2VLJA 3W3BA 4DKFH 2OJZH 5AENA 2NY3C 4KV5E 1XB8A 3SBPA 5HYSA 3BLPX 1NAML 5HHMB 2VAAA 3ARTA 1NJ9B 1F1GA 1T03L 4G1EB 4FFWC 4KPHH 5J13C 4GW1B 3SQOL 1G6VK 4JVUA 3V5KA 1DYZA 1FGVL 5GRVK 3VWKD 1CDIA 1TENA 2YLKA 3CFMA 3G7TA 5B1CA 1RZGB 2VZSA 5JXAL 1FE8L 4UNVA 4OR1A 5ALBL 3ZRCC 2Z4TA 4IU3A 3FO1A 3LXAA 2EUVA 4R3SB 4P59L 2IQ9L 5C08D 4J1UB 1TLMA 2A6JB 2ED9A 5DWPA 1RUKL 3KL0A 3V0DA 1MIML 1S2EA 2QGCA 1COBA 4LB8A 4LCWD 1V3KA 4AL8C 4FC3E 1I53A 3L1FA 43CAA 3JWDL 2UY7A 2KDYA 4M56A 3IFLH 2QJDA 4LBEA 1WCBA 4M6ML 2G5BB 4ILDA 4ODVH 4P46A 4QRPD 4WVRA 2WXQA 2YAEA 3WY2A 1SHWA 3QUYB 1KGWA 3IXTA 4PW9A 1JBJA 2E75C 5G55A 2G2NA 4BA8A 4R4FL 4I77L 3KL3A 3MBEB 4GW4B 5ICYB 1MNUL 2HTKD 2JJVA 2VITB 4KMTL 4ONOA 5CZVH 1RKRA 4WW2F 4ZW8A 3N40F 4BZYA 3MKKA 2DJMA 4J3OH 3FFCE 4HWNA 5HYJE 2BS8A 1BZOA 2Z65C 2AABH 2XT1B 3QZWG 3FONB 2C8NA 4O4YH 2VLKD 1WBYA 3LN5B 4JGMA 4TSBL 5I1CL 1AO7E 3L4UA 4S0TD 1GOFA 1USQA 1IAOB 3MUZ1 4WU7A 3VD9A 4JLRA 1E42A 1A6WH 2G3MA 4KK9C 4N4YB 2YXMA 5CU5A 2J8UA 3LEYL 3QWNA 4N85A 4X80H 3JWDC 4HW6A 4XHJD 5EH1A 5KWYC 2IBGA 1E4XI 3X17A 2YRZA 1KN4L 3BYYA 1NDTA 3LS5H 3QDJD 1KENL 1PZSA 3LKQA 5D72H 4FMFA 3L3HA 5T1KA 1WJ3A 3FL7A 2DQGL 1IAKB 4EN3B 1T3FB 3HW7A 4YIQA 5CGBA 2VABB 4MJ2A 3KPPA 5A2KH 1IAIH 2A6IB 3QP3A 4HBQA 3X1BA 2AZAA 3KPOA 2VXVL 1KDIA 3K2IA 4PEEA 4RFEB 4KKNA 4DEWA 1QI3A 2RCSH 5GGSA 4GKOA 4AW4A 4EVNA 1QYGL 3V0EA 2H32B 2X3CA 3WNIA 4UUJB 3SZKC 1O7DC 2NSQA 2E0PA 4JPKL 1HAWA 2C5DC 2ARWA 2CO4A 3VD3A 3H2WA 2DBJA 3BVVA 4AM0A 2R7EA 5FWQA 4WK0B 1KDJA 2LU4A 5ISZD 1Q9OB 2LOEA 4KNSA 2VR4A 3ENEA 9CGTA 1TVBB 3VGHA 3ZT5A 3HZMB 4UU9A 1FYTD 5EUOF 3KNBA 3X1EA 4ETQA 4E41A 2BFVL 4HKBB 4OGYH 1CFNB 3GJFA 5CCJA 3MRDB 4W9GC 1U8OA 5GGVH 4MDRA 3QXAA 2FIRT 1PZAA 5FPIA 3KLQA 2NY5L 4WWKA 1DQDL 3RWJA 5BV7B 1M3IA 1SYSA 1I7ZA 4IQHA 1VGEL 4JJHA 2NDFA 4DSYA 5EN2A 3KJ6L 3AG3B 1JVKA 3MRGB 4M6NH 3P1VA 1B9KA 1CGSH 2VL5B 3SGEH 4F24A 2VRKA 4HPOL 2FAUA 2X9WA 3QJRB 5GZOD 4OZGE 2D7MA 2Y6SC 3MUJA 4MCZB 4Z0XB 3DURA 4YDNA 5J6SA 5J6GA 4G5ZH 1EO5A 1FPTH 2GSGA 2YMXL 3EGSB 5E00A 3GDCA 4AV0A 2VM9A 3FTXA 4B5ZA 4DVBB 1ZT4B 3VTAA 4U33A 5I1GH 3TZVA 4P0DA 2CR0A 4CGUB 4N0YL 1OAZH 3V6ZA 1HIML 3ZQ9A 1CQKA 1ORQB 4XN1A 1DO6A 2DWTA 2AV1B 3LXBA 5DQDH 1TQWA 4NSKB 15C8L 1NEUA 1JERA 4G8GB 3BDXA 5C08E 3D18B 1TJMA 4M8UA 4F9LA 4UQ3A 5AOJA 5I74B 4ESKA 5KN5B 4U6XA 1GGTA 4GG8B 3CNKA 1KIQA 4LCWE 3N41B 4P5MB 4ZMWA 2JCWA 1IKNC 5J89A 2NY5C 3KDPB 4HF5L 4U1IA 3N5AA 3VRIB 4EKJA 1A6ZA 4J3OD 2ARJQ 4DESA 3L4YA 5HDQL 1UH4A 3CH1A 3V4PA 4UOW0 3BEVB 4AQAB 2NZ9C 3KXFA 1OK0A 1N9PA 5A16A 5IREA 3DK0A 5I0WA 1ZY9A 1R3HA 3VQMA 2IPKB 4QRPE 1RUQL 3FU6A 4KGLA 1J5IA 4KWUA 3B3IA 1YUKB 1NBYB 2Q9OA 3L3KA 3MLZL 3QXWA 4HYTB 4P2RB 4HUVA 5IIEA 4PJHB 3NEXA 2NW2B 4M61B 1KTDB 2XN2A 2AKRB 1HINL 2QGDA 4O02A 4L9DA 3O11A 4U2ZA 5AVRB 4GAFB 4CDGC 2Y7LA 2IH9A 3LTVA 3ULSA 3OKEA 1LMKA 1OCZB 5F1IA 4MQXD 2GI0A 2VLKE 1N68A 4AT6A 3EYOB 4HWBL 5J13B 3MLWH 5D7SH 4IK6A 4XNBA 4CGTA 1AFVH 3K0WA 4OTXL 4I48A 2KDGA 4R7NA 4P2OC 3AGWA 4NPYA 2D31B 4J3VA 3EADA 2QQLH 2DM4A 1NFDB 1A6VH 5FYLL 2WLIA 3QDJE 4AX3A 2FQDA 1EO8L 2DL2A 1ZSDB 4G43B 1PYWA 4HJIA 1E4WH 4HUMB 3IDMB 3HNVL 4JZOB 3T1FA 4ODTH 3NEOA 3ZK0A 3D5OF 2K6ZA 1AR1C 3CSYB 5AWNH 1EWHA 3FQYA 4WWID 4K94C 2Q8BH 5IQ7L 2V5TA 5KVDH 3MUY1 2NW3A 4JFWA 2MSPA 1SOQA 3ZE0F 1HSBB 3DETC 4Z1PA 5FA4B 3PWLA 4OFQA 3KCWA 3D1MC 4KK8D 3HRPA 5L4JA 5IJKC 1T6VN 3MA9H 3RRQA 2OL3H 4MXVF 1LMIA 4ZQTA 1PKQB 1UASA 1MQKH 2HFEA 2Z4QA 4XPBH 3H9SD 4MHHG 4PCYA 2NY6D 4XXCC 3D85D 4NDMA 1INEH 2CIKA 4HGWB 1MY5A 1O6VA 1QTYT 3IWVA 3BWUC 2EKJA 4Y7MA 5D7IB 3EDFA 2P7TA 1U8MA 3FQ2A 3LRLA 2JI2A 5TPWL 3TEUA 4AQZA 1DQQB 1DVFD 5JIHA 1FYTE 3GIVB 5DHMC 4OM0L 4XP1H 5DJDA 5GRJL 2HB0A 1FVCB 2YGPA 3CVIL 1UA6L 3DYPA 4AEEA 2JKXA 5DWUL 2BSTA 3ULAB 2H0JA 5C7XL 1J12A 3STLB 4B9IA 1L9PA 2CDFB 1AI1L 1OTSC 4NJAH 4FNLL 1P9MC 1K8IB 2ICCA 4FL4B 1FAIH 5IHWA 1TVHA 4OH2A 1NJ9A 1E90A 2PYED 3X2QB 4A2HA 2WNXA 3EJPA 4GW1A 4IKKA 3OAYK 4LSQH 2YPLA 3WGUB 5EDXA 5CU9A 4C59B 4G6JL 4NXSA 4GJTB 3OZLA 5A6LA 3P3YA 5F7HA 1A14L 4KJWC 5BPPA 2NUPB 4WEMB 5JORB 2PXYA 1RJYB 2QR0B 3NA9L 1EV2E 3U0WL 3F83A 1EEZB 4NQCE 1L3WA 2UXGA 4R3SA 2A9AA 4S1QH 5LJYH 2A6JA 1W8OA 2R0ZH 1FNFA 1WISA 2XTSA 1YPZF 4R2GC 3V6OA 3FSOA 1RHHB 3S35H 5DJAB 5B21A 3SO3C 4CUCA 1EZUA 1J1OL 3AXIA 2YD3A 5ALCH 1MRDH 3KWVA 5JHLA 3LH2L 2G5BA 1TJIH 4AYMC 4ZS6C 3K0YA 2WZPA 1QMUA 1P7QB 4KOBA 4XPFH 4RRPM 1MELA 5D71L 4ELKB 1F6AB 3EAKA 5A6MA 2CKBA 2P47B 1FORL 3GS7A 4KJYB 2ZCHL 3MBEA 4GW4A 4ZBJA 5ICYA 4LSUH 4Y4FD 2VITA 3HNTH 3CZUB 3FQ1A 4ANWA 3EW3B 4U7SA 5HHXH 4HOXA 1WFNA 1AXTH 2PP9A 1OAUL 2R29A 3AU0A 2JVUA 2Z7YA 5CSGA 4NI6A 5GJSL 3LN5A 6TAAA 4NZ8A 1UWGL 1SXAA 3P73A 4UZUA 5DMGD 3RU8H 1HTYA 5E08H 4PWHA 1ASQA 3N42F 3ZTJH 1T0OA 1OP3H 3FB5B 3BGAA 3E80A 4K3EL 4NYLB 1HOCB 2BS9A 3ARGD 2FSEA 3IFOB 4LLMA 4JFOA 4RZCB 2E9BA 3TYGL 1BECA 3JTBA 5TDNB 4EN3A 2KZ1B 1T3FA 4FG6D 3Q9QA 2EZ0C 2VABA 2X12A 2DV6A 3RWHA 3P54A 5DC0A 3GRBA 4A6YA 2Z91B 4H26A 1D5BB 5BZWA 2EDHA 2TRYA 1NCAH 1Z9NA 4NLAA 4Y2DC 3GNML 1KLGB 4MS6A 1JPSL 2E76C 1OGTB 4W4NA 3L5HA 3BE1L 3MFFB 1TYEB 1XXFC 3DXAD 2H32A 2NY2D 3FTUA 3F85A 4UUJA 4X4ME 4LPYA 2ZYRA 1MW1A 4LCUB 2YK1L 2DWEB 3EO1B 3H9SE 3FSZA 5DVNA 4RGOH 4FKEA 3UGEA 4ZUSB 3KPMB 5IWLC 2FH8A 4FN0A 4MCYA 1Q9OA 2FATH 2NT1A 4K9EH 4NFCA 1XR9A 5K1VA 2PLTA 1DFBH 1UKTA 4WGKA 2QHLA 2AAVA 3HZMA 1AOZA 3QWRA 1N5YL 4HKBA 4HCRA 1IZJA 1CFNA 5TQ0H 4JN1H 3OAYH 4ES9A 5F7LB 4A38A 1L9TA 4WO4D 5HYSG 3J8F7 2BVTA 3D8MA 4L2YA 2H0EA 3FFCB 2DD8H 5HYJB 4H2AA 4FAAB 3D51A 3PPSA 4Y1AD 3BUYB 1CU4L 1Z9LA 4KK6C 4YSPA 1AO7B 2VL5A 4X0NA 1MJ7H 2EIDA 2PYEE 1T83C 2WIIA 4Z0XA 5L7XL 5I1KH 3C2AH 4F33B 3EGSA 4KXCA 1ZT4A 2HUHA 5LHDA 5ICUA 2QKSA 1FIEA 2P1YA 1Y1UA 2D7TL 3IXAB 4TM9A 1ORQA 5FKAA 1W91A 1L9NA 2CKNA 2XG5B 3MXWL 5KJRH 1AR1B 5L4FA 2Z31A 3B2UC 1JPTL 4FA6A 3S36L 1MCKA 4NSKA 3FUIA 2AGJL 3OD3A 3D18A 4Z95L 2VRAA 5EO1B 1ZLUK 4YHLL 4Q9QH 4G7RB 1JWSB 4Y2LA 2XFXA 3SPHA 4UTAL 1MREL 2W0KA 2BM3A 2QHRH 1LP9E 3LKSB 2XWEA 4NZRL 4QO1B 4F58H 2VERN 1SF3A 3VRIA 3ZKXB 1WICA 1YNTB 2OYKA 4M00A 2EADA 4KHXL 3BEVA 2DYRB 1A1NB 1GSMA 1WZ1H 2IBZY 2IPKA 5KAQF 3LQAL 3QO0B 5D1ZA 5J6HA 4P2RA 2AITA 1K6QL 1ET8A 1UKSA 3PJSB 5AYTA 1U42A 1UZ6E 4LU5H 3UCRA 1SY6H 5LN8A 3RAJL 1MAJA 3P2BA 4CC0A 1U91A 4EMZA 4FJZA 1LO0H 4WI6A 1MDAA 2PUQT 2DTMH 2QMJA 3QORC 3MBXH 2R8SH 4N2DA 4OSUL 4PWJA 3OG6B 1JNNH 4G7QB 5TGBB 1AJ7H 2WVUA 3EH5B 2Q2EB 3EYOA 1MDTA 3L8QA 4PJ8D 3JWOL 4BE5A 1GJUA 3US9A 1C9SA 3L4TA 1NEZB 3BZ5A 4N8VB 4WUKL 3T0EC 3F2LA 5JW3H 2HLAB 3BQUC 4OZGB 2V8MA 3S88L 2D31A 3VWKB 1B4RA 3LQAC 4G43A 4FFYL 5D9SB 3IDMA 5IFAL 4P48A 3P02A 2R69A 3O9WD 3U79A 4PRID 4AMWA 1BM3L 1CD9B 3CSYA 4RMVA 4MS8C 3SDYH 3OXSA 3GK8H 5I1DA 3BPLB 5C08B 3SO3B 1JTPA 3BJLA 1HSBA 2ITDB 3NACH 3WIIH 2N56A 1HQ4B 4LCWB 1G43A 5T1JA 2HN7B 3DXAE 3SQBB 2EYRB 2W5PA 4KKCD 5C8JB 1PKQA 1XO8A 5HHVH 2AJ3B 3F58L 4YLBA 3WG7B 1KB9K 1NSNH 1V27A 2XXCB 4KO6A 4M3HA 1QSED 1UD2A 1DJSA 4MJJA 4HGWA 2XPGA 3LV3A 5D7IA 4QRPB 1ADQA 1UWFA 3WI9A 3HAEH 2A9NL 2GEEA 3LB6C 1CYXA 1DQQA 4GBXD 5BRQA 2NY6C 4ISVB 4FNTA 3FK3A 3GIVA 4Q52A 1MXGA 2RTTA 4E9QA 4LESA 1WPCA 1C7SA 4B7LA 1FVCA 3U9PH 1E9QA 1U8HB 2YBGA 2YAFA 3Q5OA 4B27A 3STLA 4XMVA 1A7RH 4BFBD 1VRSA 5E56A 4ANVA 4IHOB 4AM0Q 1F90L 2Z7WA 2XQYA 4GUCA 2JCCF 1RZ7L 2VLKB 3DV6B 4HJ0D 4Y1AE 4PLNC 4ZOBA 4Q97A 2BWQA 2LVEA 2AEWA 1VPOH 1ZLUH 3W81A 3WNJA 3G5VB 1AQKL 4UB0H 5ITFB 5D96C 3EFDL 1EGJH 1ET5A 4ELME 3S4SA 1GIGL 4JAMB 2DMGA 2DQCH 3ARUA 2AEPH 3QDJB 1CGXA 1RJYA 1YQVL 3VXUD 1UTDA 3DX3A 1EEZA 5GGVY 3QI9C 1RZKC 3B1TA 4PV9A 2B3IA 3OJDB 4WNQB 2FWSA 2VDRL 1V05A 3DA0A 5AW9B 1AQMA 4WI2A 4KZ0A 2WZ5A 2B1AH 1CK0H 3PAZA 4GINA 4F91B 3UP1A 3D2UB 2WYTA 4JS7A 4PJDF 5DJAA 3U2SB 3PGDB 4F37F 2VDKB 2UWEF 2AK1H 3K7UA 1O9WA 1RH8A 3PV6B 1HWGB 4XE0A 4RH4A 5EIVA 5FS5A 1ZGLP 3C6SB 4KKBD 3JWNH 5AL8A 2DOCA 1R3IH 4OQ1A 1UENA 5KG9B 3US1A 4OJFL 1DZBA 1O0VA 1P7QA 1HKLH 1DJHA 3EIFA 3LPPA 4CBZA 4ELKA 1LDPL 1F6AA 3NQIA 5BO1H 3Q7JA 4OY9A 4AVIA 2PP8A 1MHEB 2RR3A 2VQ4A 4KJYA 1MCWM 1X5XA 3OHXC 4N90D 4Q6YA 5E9AA 3W56A 1GGUA 4AKQA 4Y1TA 3AC0A 4JBSA 2FJGA 4Q58C 2ODIA 3AQYA 2QADD 4PJ6A 3HG0A 4YE4H 4R26L 3SE4C 1P1VA 4TULH 1H3PL 3FN0L 3S48A 2VTFA 3TBYB 5INDB 1X5ZA 3ZPDA 4IOIB 4TSAL 3WXVH 5H35A 3GB7A 1QBBA 3L3GB 3DI2B 5E1AA 3Q8CA 3D4ZA 2YQBA 3TU6A 1YJDH 3V79C 2H1XA 2NYZA 3R1GH 4GIOA 4Q89A 1WZLA 3V8OA 5C0RH 1PNDA 3FB5A 3KW7A 3QZPA 4DGUA 4YHYC 2HRLA 1HOCA 2KC0A 4KU1A 4NYLA 5FYKH 2HPTA 4FABL 1G84A 4RZCA 1MFNA 4L3CB 1M6OB 5TDNA 1WWAX 2D3LA 2O5NA 2QLVB 1PLAA 3BAKA 4FGMA 1I4FB 1YEJH 2Z1KA 3BUQA 3LKPB 1G1YA 2X2IA 4LL4A 4PRIE 5I76A 4NQCB 1OSPH 2Z91A 4WO0A 4ZOCA 1D5BA 1YY9C 2FSDA 4DN3L 5LGJB 1GH7A 2WLYA 2MKLC 1KLGA 2A1WL 3CFEA 3CN0A 3MU3A 4JKPL 1BD2B 1UOLA 3MFFA 4Z3GA 2E6QA 1UM6H 3KLHC 2DRUA 3FOMB 4A2FA 2IPUK 2DWEA 3DX8A 3EO1A 3VH8G 4ZUSA 4BKTC 1QSEE 4JZNB 3KPMA 4I7ZC 2J43A 3BPNB 2O93L 3BXNA 5DC9B 5DMIH 4AVJA 3ILPA 2DB8A 2OMTB 5IT2L 3HN3A 3TBTA 2Z0UA 1TYJA 2NYYC 3JTSA 3CLEH 3OV6A 2A9DA 3RKDD 4IM8A 3NRQA 5FOBA 3SYCA 1J5DA 1C5CL 1H9DA 1ZS2A 4LIQL 4GRLD 4PUBL 5K69A 3WJMA 3GEFA 5HYJA 3C60C 1OP9A 3CHSA 5AZUA 3RVTD 3HG3A 4QRUB 1AO7A 3VCLA 2ETWA 3BQUB 5EU6D 4P2OA 4F8TA 2KQMA 1ZS8B 4JM4L 4JFFD 4PYHA 4D0BA 2ADYA 1IEHA 2GJZA 4ELDA 2CRYA 1X9LA 4Z7QF 2QPUA 5DA0B 2C34A 3WHE0 1GTFA 1X5AA 2F8OA 2UZXB 3NJGA 4L8DB 4A7GA 3ESOA 4PJCA 3P0VH 4DP8X 2KKQA 3FRPB 4R5TA 1FJ1B 4GQQA 2G60H 1WVZA 4EBQL 2A3TA 3VXUE 4BFIA 1SEQL 3VFGL 2FYYB 1F45A 1OB0A 3NOIA 3UTPD 2YUVA 3DBXB 5AKVA 1U3HC 3A6OA 1SJVA 4OQTH 3UJTL 1SBSH 5IJKA 2WO4A 3B8SA 4Z7UF 3LKSA 3MLVL 4PG9B 3BDBA 4N26A 4QO1A 3KCPB 2NTFA 3UAFA 4HIJB 4QMEA 2E7CA 4B50A 1RSFA 3PAYA 4HWBA 3ZX1A 5CR8A 1MIEH 4XXCA 4D8PB 2WTOA 5DD5H 2LGNA 2J2ZA 3VO0A 2GTZA 4D3CH 1J88A 4DCQA 3MRPB 2XYBA 3H9SB 3QO0A 1USZA 2NY6B 3QJZA 4W9KC 3D85B 1OGAD 4RWHA 1FIGL 2WQVA 5DUJA 4A63A 4KZEL 2H47C 3R8QA 4N90E 3VM5A 1DVFB 2Q76B 4KQ4H 1F13A 4YDKL 3GBML 4XC3H 1E8YA 1ZV5A 5LBVA 5FGRA 1P9MA 4C83B 3ZKMC 1WFTA 3RWDB 1WIPA 4P4RA 1BQLH 5FF6B 5DCCA 1P4IL 4Z7IA 4Y19D 3FBQA 3ZN6A 4QI3A 5IQOA 1H8SA 2J88H 3AY4C 1NEZA 3TVMC 1JN6B 2ZXEB 3ORJA 3GIZL 1U8PB 2HLAA 2PYEB 4YHZL 4Y9EA 2PPDA 4ZMPA 1KXTB 2AEQL 1PY4A 2R2HB 1S6NA 2BCMA 1GAFL 1RJCA 4OIIH 4UYPA 4AJ0A 2W9DH 3QI9B 1K3IA 4OUOA 2J5LC 3F6JA 4XP6L 5D9SA 1F58H 3GMLB 3UGXA 2EXTA 4G8IB 1YECL 1AQHA 2YWZA 1TZGH 3WFBL 3HC0A 2FLBT 4CVXA 4YHNB 1X9QA 3QUMB 4K71C 2F68X 2VERA 5C08A 4S11A 2CQVA 5F9JB 2ITDA 3O9WC 1LP9B 1M6UA 2WUBH 4LCWA 1YEIH 1E7UA 3ZDZE 3A6CL 2HN7A 5HPMA 2EYRA 3KLKA 5C8JA 1ULVA 4M8RA 2AJ3A 3HCVA 3IRCA 4WEBH 5DVPA 2ZUTA 4ALAH 5AOMA 2CSPA 1RIUH 4KKCC 1DQJB 2NT0A 4LPTA 5AEAA 4EI0A 1B4LA 1NCJA 3OHXB 2DIBA 5AW3B 1QFUL 3IJYB 4OGXL 1KV7A 1HZLA 2RGSA 3WEMA 2VQ1A 3QG6B 3O3AB 4K7PL 1J7VR 3KZ8A 3HHSB 3KGTA 4YMPA 4HH9B 3RUGE 4Y4FB 3SOBL 1L6XA 4X9YA 4XMPH 2QKIB 4JEGB 2ZICA 2CDGB 4HAGA 1W8EA 1WFMA 3U4BH 3PXHA 5CILL 4IHOA 2CM6A 5KVGH 4ERSL 3SDAD 1OE3A 1XHHA 5C0GB 4JO4L 3IVKB 3DV6A 4PJIE 2MCPH 4FMKA 5E6UB 5EU6E 2ZKXA 5EFIB 4JFFE 2FO4B 1BPVA 4KAQL 2ZYSA 4JFQB 3ML8A 3G5VA 2IF7A 4HJ0C 4XCYA 4YWGL 3VD2A 1A3RL 4UTBH 2XDHA 4L9LC 4JAMA 7PAZA 1CI3M 3R4RA 2LFEA 2OL3B 1JHKH 2BW4A 3ARGB 3QDJA 1CLYL 1MQ8A 4QHUA 4KKAC 3MO1B 5HJDA 4E0RB 4Y2DA 1QFWL 1YYLH 3UTPE 4AYGA 3ZHFA 3GS0A 1TJGL 2BIMA 1D7BA 1HHIB 4N0CC 5CGYD 1T2XA 2ZYIA 3D2UA 4NQDD 2X9YA 3U2SA 1LILA 3BEWB 4HZLB 3PV6A 4NQED 1L9SA 3D07A 4A2GA 3C6SA 2NY2B 3DXAB 3VGEA 5IWLA 1F0LA 3M8OL 4U7MA 4OCSH 1FRGL 3OG4B 4P57B 1MFDH 4DGVH 3OB0H 1ZPLA 4CMHB 1JYXA 2XLLA 1UFUA 1OGAE 1TFPA 4XT1C 4KTGA 4GMSL 4H13C 1N2RB 5EZIL 1MHEA 4FTVD 3N43F 2E8YA 4XWOD 2V9QA 4KGJA 1KB3A 2F6AA 3CBRA 5GS1B 4XBEL 2DZEA 4OAWB 4YE0A 3WTWA 3CPLB 4ODUB 4PJGF 3FT2B 4O2FB 4WO4B 1HS6A 3EDDA 4ACTA 3HB3C 1T83A 4Y19E 4YLCA 2A6KB 2ICWA 3PGCB 1NMBH 3ZE1F 2OMVB 5FW6A 1X5JA 1YC7A 3QDMD 1BOGA 5ACZB 1JZHA 1DQMH 1NA8A 3F7YB 5GZOA 2QGEA 2VDML 2X42A 4TSCH 3RWCB 3CSPA 1R24A 4UDTB 4OF7A 4LVEA 4XZ4A 4DEPC 5B3JE 5LQBL 4QT5B 1B0RB 5L8JB 4ELMB 2OULB 2ICWI 3VXMD 1QUNB 5T8IA 5I66A 2VDQL 3CWGA 1I4FA 2B08A 5IVOA 2Y6TE 1PSKH 3LKPA 2V7HB 2VSMB 4NQCA 3SD2A 3VRLF 2FDBP 1G9NC 1W0YT 2MNJB 1N64L 1CDHA 5JDSB 5EF2A 2VDOH 5J3HC 1BD2A 3O8XD 1A7QH 1P6AB 2FL5B 5HDWA 2WBJD 1SNRA 1G6RL 3FOMA 3SGJC 2P8PB 1M9SA 3L4XA 5I1IH 3P0YL 3K46A 4QRSB 5EU4B 3ASWA 1I8IB 1GHFH 4GY4A 4QDGA 3BN9C 5FM8A 4JJOA 4K3GA 4R0LC 1HU8A 1DUYB 4UIKL 3T6ZA 2EE9A 2Y7MA 2ZIDA 4DH2A 3FT1A 4LDEB 5KVEL 2WXIA 5AYUL 3HFFA 3WD5H 5I28A 3QORA 4FQXD 3PS6A 3ZT7A 1MNNA 4IRZH 2XQYG 3PFUA 4H8HA 4UTAA 5IP4A 3UGUA 4KBPA 4NWTL 2H26B 1TSRA 2AVFA 4PJ7A 2EDNA 1URZA 1A9VA 5EEXA 2DLHA 3NFPB 2NR6C 2NX5D 2YD5A 4JHAL 3T0EA 2VXQH 4W6YB 2XA3A 3BQUA 5ESVA 3D2TA 2EO1A 1E4KC 4XCCH 4CJ1A 2JIXB 1R0AH 4KXZH 1KYAA 2UZXA 3KGUA 2IGLA 4L8DA 2J5LB 3FRPA 4X7TB 1DEDA 3TA3D 2KZKA 4JG9A 3IPFA 1INQA 4OB5H 3HC2A 3B2PA 5DMKB 2F7PA 2CLVA 1N3NA 4QOKD 4K71B 5IQLA 1HHKB 3ARBC 2FYYA 1KC5L 4AUJA 1U0QA 3O9WB 1S8DB 3FS9A 4PRIB 4IRJD 4YXHL 3VB8A 4WKXA 3ZKSD 3G6JF 3PHSA 1RZIB 4NQDE 1H9VA 4MQSB 1S7TA 1PAZA 5CINL 3QCVL 1IQWH 3DX4A 3L2MA 2GIXA 3OPZL 4MB5A 5IJDC 1MEXL 4D8PA 4LPXA 4B9GA 2I07B 2QPDB 4JRFA 4JE0A 4JY5H 3H9SA 2CHNA 4ZFZA 4G8FB 1DSWA 3L1OL 2FGWH 1I8KA 3QXDA 3PWVB 4NJ9L 4FFYA 4FTVE 3TM6A 2Q76A 1DDHA 3GUFA 4GBXB 1ETJA 4LVNC 4WTXA 1PX3A 5D1QC 2AI0H 4W1TA 2C7UB 4G72B 5CKGA 3V4VB 3T0VA 2D8KA 2ZKYA 4C83A 4UT9L 3GZKA 3D05A 4WI7A 5DO2D 5IMLB 1MWAH 3CUPA 2KS0A 1LTXA 4BFFA 5FF6A 3L5WB 4O9HL 4ZO6A 5C0AD 4DUWA 4KUCD 5I19L 5HI4D 1U21A 1RLBA 3AT8A 1SGKA 4WY7H 1JZ6A 1HYSC 3QDME 2EC8A 2FWOB 2DQJH 1U2HA 1RURL 5INCA 1AMYA 2PYEA 5I6KA 5J1TC 3HE6C 2QFRA 5FV1L 1JZ3A 3X3GH 4Z7WF 1KXTA 4O5LH 2G3NA 3EOAA 4A2LA 4U0QB 4L1DA 4Y9CA 3QI9A 4G9FA 3VXME 5AD0B 5B8CC 2ZX8A 3GMLA 3DIDA 4G8IA 5IGXH 5IJVA 4ZFQA 1OZUA 2ZOKA 3VXUB 1L6ZA 3MRRA 3QHZL 1KTLB 3QUMA 4KO9A 3VXQA 1C12B 4UV4H 3T3MF 3WN5C 3H9ZA 3ISWA 3GMPB 1OP4A 1FZJB 1KXHA 3J2PA 3DMMC 3KYAA 4P5TD 1WA0X 5C71A 1ZLEA 1GPOH 4Y4HC 4LCCC 2OSXA 2C9VA 5SX4H 4X9BA 5EU5B 1QWUA 3IDYC 2C1PB 1MCSA 3S5YA 1DQJA 3W82A 3OHXA 2JELH 5F7EH 4TQ8A 1OPGL 4HIPA 4RLDA 4HIXH 3IJYA 4N2HA 5HHOD 4UZSA 5TDOA 1KSRA 1SXBA 3QG6A 4PLJC 3SE4A 3O3AA 1KBPA 5B4MD 1BIIB 1PX8A 4QHKI 1AHWC 4FF9A 1G1CA 2QKIA 2CDGA 2GITB 5DHYB 3VFUA 4XCFH 2RFXB 4KKQA 1QFPA 1DN2A 4TRPH 4ANXA 5J9PB 5GS0H 3DJTA 5C0GA 1RUMH 2VDPL 2NX5E 3IVKA 3GBLA 3UO1H 4ZW6A 5KS9E 4RQQA 5EUOE 4ODWB 4L4TA 4JO2L 1JZ2A 2NLJB 1JFQL 3HPLB 2VR6A 1U30A 1VADB 3SDAC 1G9MH 4JFQA 3TIDB 4WI9A 1THAA 3LQMA 4OLZH 3WAKA 3VW3L 2AVGA 4FHJA 2WIMA 3G6DL 3FSWA 3IRPX 4JPWL 2P48B 5LBSL 2ZX7A 1OOWA 2J6WA 1U6AH 2UZPA 3KPNB 3NQKA 4GIPD 2WXKA 4HDIA 4QOKE 3MO1A 2OYMA 3QEUB 1SLUA 5AB0A 1K72A 1M53A 3CDGB 4QYOB 4OD1H 3ZTCC 5ERWA 4PYGA 4LHQB 2DM3A 2CZNA 1KYFA 3TEXA 1PZ5A 2ZCZA 1OM3H 4NM8H 1WT5C 5BVJB 1MAKA 3SPJA 1DBBL 3LY6A 5I71C 3BEWA 4HZLA 4LSSL 2DLFH 3GF8A 3CXHJ 4I87A 3ZDZB 2NCEA 3BKCL 1M42A 4AYFB 1OAJA 3I6KA 4HWEL 2VN5A 4LSDA 4R0LB 4P57A 1EAQA 3DUUB 1QASA 1TXKA 3WN6A 2ZUXA 4PJ9D 5C3IA 1C16B 1XF5B 4Q9BA 4ONGH 2F19H 4JQIA 3KBHE 4PS4L 4U1LA 4BH7B 4FULA 3GZOA 5GS1A 1D5IL 4HT1L 1EXGA 1NCWL 4N1CA 4OAWA 3C60A 1CB4A 5CCKH 1A2YA 3CPLA 4ODUA 5LXVA 2BY1A 1U58A 4M7KL 3BUDA 3MNWB 3RUGB 4XWOC 2BDNH 4LK4A 3FT2A 4O2FA 4MXQC 1CF8H 4GRLB 5CAYB 1NEZG 2XWJB 4N8VG 2MFNA 2NRDA 5C0AE 3LPWA 4FZ8L 4L1TA 1HJCA 2A6KA 2OS7A 3KBFA 5I0DA 2Y1ZA 3HZVB 4F93B 2OMVA 1KPRB 4PJIB 3IDUA 4ZFFB 1AS8A 3HZKB 2JXMA 3QH3A 5EU6B 4YSDA 2ZE0A 3AU1B 1QP1A 3F7YA 4JFFB 3PLYA 4NC1C 3RWCA 2AQNA 4M9OA 4AGMA 3FH7A 4WW2C 3WHXA 1X4XA 1U3HA 2VLRD 4CVZB 4BFJA 2B4CC 4UT6L 4HK0A 35C8L 5GSVA 1XT5A 5HYEA 4F37K 3IU4L 1WA2X 3UOAB 4LZKA 1II4E 4HVBA 5C0FB 1RZQA 1UATA 4NENB 1PD1A 3UBGA 5JDSA 5FCUH 4RX4A 2EUXA 3VE0B 1WGVA 3IRZA 1L0YA 4MMZB 2ZKHL 1F2XK 1R5IA 2A74C 1MFEH 5DS8A 4P2YA 1ZHBB 4GLRH 4LLWB 3O8XC 1FUNA 1VIWA 4NAMA 4QRSA 2EAEA 2YD9A 1FI8C 5EU4A 3T4YB 7FABL 2P43B 2CRIA 3A21A 3ZE0E 1DUYA 1RVFL 2NZIA 2WUCH 4FXKB 4OFIA 4LVNB 3TASA 5LNGA 5HHOE 4RFOH 1DJZA 1K8DB 3CHQA 4XNXH 4LEBA 1HOEA 3MRQB 2WGXA 4MXVE 5TK4A 5DD3L 2VM3A 2V5YA 1I1AC 4YUEH 2LLNA 3VYNA 3P30L 2P5WD 1ZA3B 3GRWA 5BQ7B 5IBLD 4ZSOE 1CXFA 5HHPA 1IGTA 3OKDA 4OF6A 1ZV9A 2CR6A 4MLIA 4J4PC 3FQUA 1JZJA 3BISA 3AY4A 3TVMA 2CXKA 2AQTA 3TH3T 3W38A 5EO0B 2X4UB 4NN6C 3NPZB 4XNUH 3UABA 1S9YB 2VOTA 4Y19B 1AMXA 4IMKC 1HCFX 2ZNWA 2JIXA 4WI5A 3NJLA 3LHPL 1J05B 3FTVA 2DQEH 2AXFB 3IDIB 1I3VA 4HKJB 4IOSD 4X7TA 1SDAB 2HSIA 1QUPA 4LHUD 4UZGA 2WO3B 3GGWB 3UAJC 1I1CA 5IM7A 3IAPA 2F7QA 1Q0XH 3WN5B 3KD4A 5FWRA 4PB9L 4ZUWB 1G7LB 3O9WA 1S8DA 1C5BH 1FZOA 1L7TH 4PRIA 4NERA 1JHLL 5F96H 3UZEC 1H0DB 1P84K 5IG7B 4L2LA 4M6AA 2CCWA 4KTYA 1WF5A 2XY1A 4H8WL 3VGAB 3H2PA 1HL5A 4LCCB 4IRJC 4OCXH 5TH2B 5E6YA 2X70B 3IDYB 2VGLM 3JYCA 3QZMA 2CGZA 1KGYE 3OL2A 3R0MA 3TNMA 2GSIB 1CFVL 4ABWA 2P5EE 1NWPA 1YMME 2NNAA 1UCTA 3EDJA 4G8FA 1SUHA 4LPUA 4XMXA 3ZKND 4FKHA 2JB6A 3D0AA 2WXJA 2WJ7A 5F0LB 2YMTA 3JT2A 2F74B 2IDTA 2AQQA 2C7UA 3V4VA 4BEIA 2FEEL 4IDLA 3WCYA 4OW6A 5IMLA 2JLLA 2CM5A 3FN9A 4HFUL 3E8UH 1S7QB 3L5WA 3T2LA 5DEFB 4NNPL 3S34L 5I17B 4J23A 5F7DB 3SDAB 4PJBF 1ZEAL 2NPLX 5L6YH 2B20A 4H8WC 4OLUL 4DPAX 2FWOA 5AW8B 3JV4A 3TJEL 5E2TH 4L9LA 1YMHB 4ADIA 1DE4A 3F01A 4L5FL 4M7ZC 4XP9H 5DK0B 4FLHA 1HHGA 1BQUA 4EI6B 1T6BX 5K9KB 1KXVC 3V4LA 4ZTOH 5B3NA 4G83A 4BZ1A 5AD0A 1HK6A 1P6WA 4QXTA 2VLRE 2PKDA 3VXUA 4QCIB 4JB9L 1E43A 4NI3A 4AG4H 4AVHA 3LNEA 3TWCH 2XA8H 4QUOA 5EHFA 1KTLA 3NABH 3FB8A 1C12A 1INDH 3RZCC 5I71B 1CI5A 3OZ9L 2BWIA 1KJVB 2QLYA 3E1F1 4J3OG 3BH9A 3MR9B 4FI6A 1FC1A 4NQDB 3WNPA 2EP6A 4NT6A 3HTLX 1WZAA 2R0KL 3NTCL 4QD2E 1W15A 4LNVA 5EU5A 4XB8A 1XF4B 5LCVA 2C1PA 1H8OA 1VGKA 1V7NH 1VFUA 2O4EA 4BFEA 5JO5B 2LTQC 3Q5YA 1SRDA 2LQRA 4W70A 4YOKA 2XBZA 5CJQH 3LMJH 2NUTB 4FTVB 5E1QA 5I18H 2WZ6A 1YEEL 1MI5A 2BNRE 1BIIA 2PPEA 5KSUB 2P5WE 5HY9A 2GITA 4HPYH 4HMCA 4M62L 4K8RC 5DHYA 4JDEB 4NWUL 2RFXA 4ODXA 5BRZD 3GBDA 2Q10A 4NCC2 3K6DA 3DRQB 2D3NA 2WVSA 4JO3L 4MA3B 1BGXL 3AS1A 1JZ4A 4UIMB 2ED7A 2NLJA 3HPLA 1QFWI 3FRPG 4U1NB 3ZO0A 3LH8A 3OGOE 4PWFA 1GYCA 4GT0A 1IC7L 1KYUA 3GJEB 3TIDA 1WYJA 2L3BA 4B9KC 2HJFB 4LE8A 1I1FA 3QIBC 3WY1A 1KBGH 4JM0A 4AW7A 3VXMB 3CXDH 4FP8H 2CGRL 4YGAB 3RA7H 2UXFA 3W37A 5CSZB 2VMEA 3IE9A 3CDGA 4QYOA 1D6VL 2FB4L 1Q0EA 1KCVL 3MA7B 4I89A 4M7JH 4N6RB 3IPBA 2A74B 4HG4K 5IESL 3SGJA 1F4HA 2MEJB 2VMFA 3O8XB 3BWAB 4OGQC 3TH4T 4AYFA 4AZUA 1D6EB 2WBJB 3AXLB 4R0LA 4Q0XH 4FQ2H 4CRPA 5F21B 1IEAA 3ASOB 1CS6A 3L3OC 2ZCKH 5EZOH 4L37B 3VI4F 1C16A 1E27A 3TEZA 1RIVL 1I1AB 4LKXB 5A7EA 4CJ0A 3MCLH 2YOCA 3VTMA 3J07A 2DIJA 1EQWA 1JPGB 1NCBH 3O6MH 4FQXB 2NR6A 3L5IA 3MNWA 4ORZC 3PNWB 4NN6B 4JREB 1ID2A 2XWJA 2XWBB 5DK2B 3T0AA 4L4VD 1E4KA 3KEHA 1YEGH 2GJ6D 3QXUA 4TVSa 3BKJH 2VDNL 3HZVA 3RPIA 1E67A 4AE0A 2NX5B 4YSTA 1VFAB 5KS9B 3HZKA 2BZCA 3DARA 4PQXA 5EUOB 3AU1A 4JFFA 1K85A 3A67L 1V54B 2FBRA 4NCDA 3VXTB 3ARBA 5K5YA 3TA3B 3B9KC 4PHZA 5ICZA 2J57A 3F7LA 3TYFB 1KWKA 4YLQT 4XBPA 4L4JA 5ESAB 4IK7A 3CK0L 4QOKB 1A3QA 5LB1A 3AJ7A 1WIOA 2AQPA 1F56A 1OE2A 3PF2A 2J8UF 2ZF9A 4ZMYA 4HXBL 2CHZA 1KELL 4IRJB 4R84A 4WW1B 2HT3C 2W0FB 4HIIA 1JNLL 4NXKA 2L7EA 5CZKA 1ANUA 1IVTA 1BLNB 2A0LD 5CJOL 5EF3A 4Z3JA 3BQVA 2CRZA 4WEEA 3POHA 1NIDA 2FUQA 3HI6L 3UPRA 4LLWA 2X0VA 1TVDA 1J1PL 3T4YA 3ZTDC 4EO5A 5EOQH 4YEFA 3QR0A 4H2CA 4KITB 4J39A 4FXKA 3MRHB 4NRYB 5D1QA 1K8DA 4PV1C 2B0SH 2J8HA 8CGTA 3W9EB 4NPKA 4DP4X 2YAMA 2JKJA 12E8H 2X1OA 1ZA3A 2A6DA 5BQ7A 3BAWA 4ZO8A 2GIMA 1I9IH 3U25A 4XP5H 1U8NB 1NCHA 2WMPB 5BRZE 1B2WH 5C07E 2PTTA 4LLYB 5DRWB 2WXGA 5LXGL 4LKCB 4HULB 3VA2C 4CBPA 5EO0A 5IBLC 1MZYA 3F05A 5C0AB 4S1SL 1S9YA 3VFRB 2EICA 4M7ZB 2Y69B 3HC3H 3I2CH 1MCPH 3ECUA 4HUCA 2E5EA 4NOFA 5B8CA 2AXFA 4BD4A 4QR7A 3AMKA 4OFDA 3WNOA 2C9XA 3GGWA 2IAMC 3VB9A 1EEYB 4CVUA 3WAJA 2JCCE 1JE6A 2KZBA 3FZUD 1CYWA 1ZSHA 2DJ4A 3WN5A 4LVOB 1G7LA 3O4LD 3P2DA 4DKFL 3QYNA 2OJZL 1AGEB 1D5RA 1F2QA 1YG9A 5H4YA 3NCMA 1I7TA 3DMMA 1H0DA 1G0DA 1BBDH 1WSST 4TUUA 1PG7X 4KPHL 4Y4HA 4LCCA 1NKGA 1MJUL 3P9MB 1DBJH 2P24B 1NMCB 3NIFF 5TH2A 2X70A 4GQ9H 2EVGA 4HCFA 2YA0A 3WLWC 1J87A 1ZDSA 2N01B 4MCNA 1G7QB 3N55A 2GSIA 3C6LD 5JUEH 2X4QB 4OZIF 1IM9A 2NNXA 2R56H 5FYJD 5FR3A 3ZE0B 4PJDE 1R1CA 2CBPA 5HHOB 2UWEE 2XWZA 2EDDA 3MGTA 5CP7A 2F74A 1Y18A 4HEPG 4POZC 4YVUA 2KHAA 3FQXB 2HLFD 4LSTL 3MJGX 1XBRA 1U4FA 2EE2A 3ZYJA 2HKHH 1KB5B 1V8HA 4ZSOB 3HMXH 3SBWA 3IFLL 1Q1PA 1S7QA 1P6FA 2EYSB 2HPOA 4L4VE 4C57C 2ZG3A 1K5NB 1P7BA 3FMGH 2GJ6E 2WQ8A 5DZOA 1CT8B 2VZVA 5F7DA 3SDAA 3CVHH 4ODVL 3EDEA 2EXWD 3QJQB 3TJHD 3MJ7B 1XSOA 5IVZB 5K39B 5KSAC 5FGSA 1NC4D 4M5YH 4OF3A 2VO8A 4X5PA 1UFGA 1YEKL 2CK2A 5M95B 5L9DH 5IB4A 3S6CA 3WDIA 5DK0A 3KLAB 4EI6A 3W1ZA 5K9KA 4EJ1C 5CZVL 5E24E 3TV8A 1IJ9A 4GFTB 1NANI 1PW3A 2ADIB 4QCIA 2AABL 1WFOA 4WHTB 4O4YL 1LEGA 5EB9A 2E7BA 1WT5A 2L0DA 4K5NA 4CN1A 4QTIH 2G0KA 4R9HA 3D34A 4HSQA 1MWOA 1A6WL 1KJVA 4FFVD 4R90L 3P4NA 4RISH 5EF1A 3PABB 3MR9A 1DBAH 4X6BB 3LRSA 4NQDA 4GO6B 4X80L 3WEOA 3I74A 5E8DH 5I8CB 1T04B 1E6OH 2GBUA 5IEKB 2VR9A 2IMNA 3L3OB 4NM4H 3LN9A 5JQ6H 5LNDA 1UJ3C 1CIUA 3LS5L 2NY0D 1SVZA 2O26U 3ZYOA 5D72L 2EYTA 3L4ZA 1X5YA 3RTQD 1FLTX 1YSOA 3LXUX 4NRZB 3SKMA 4EQ3A 2P5EB 4IBTA 1YMMB 1IAIL 2NSMA 1NIFA 1KIPB 1FO0B 2Y07L 1XL4A 4JY4B 4HMEA 1ET7A 2H1PH 4AK2A 5C0ND 3SD5A 5KSUA 2RCSL 1R5WB 2MHAA 3NSCA 1BVLB 4L3FA 3F12B 1HVXA 1MVFA 5DJYA 3DRQA 2WKGA 3BUIA 4OM1H 1PD6A 3CFDB 3CFIC 3WMPA 4NFBA 3ZHDA 4P9HC 2TSAA 1DCLA 3LRGA 3FAWA 4F15B 4UQIM 2P5PA 4N5EC 3GJEA 4WW2A 1ILUA 1HXMB 3B9KB 4R96B 4R8WH 3X3FH 3BWSA 1TQTA 3BD5A 4OGYL 4JO1H 4E9YA 4CU6A 2OP4H 1AP2B 2P80A 1I7RB 2WY3B 3VXMA 4QTHB 3R06B 3ARDD 5CSZA 3FQTB 4K7FB 5DUMH 2VLRB 3O4LE 1SF5A 4QRRD 4LGSB 4XN2A 1HL8A 4Z7QE 1LVEA 3MA7A 3N42B 4ZFGL 4M6NL 1CGSL 2A74A 4Y5VB 1XXDC 2ODHA 4B5EA 2EDKA 4RAVA 4NKMB 5HVWA 4FFZA 1BW8A 3VFVA 1BMGA 3T4AB 1FPTL 3WDHA 3O8XA 3BWAA 3GI9H 5I1GL 1AG6A 2D0HA 1D2PA 1D6EA 1L4IA 3RNKA 1JWUA 1KPVB 1OAZL 2G2RB 2X4PB 1MOEA 4L3ED 3VACA 4E42B 3V7MA 4L37A 4Z7UE 2BIHA 1AOHA 5DJZB 2VIRB 5DQDL 5AVVB 1WH0A 1XR8A 3PE9A 1JNHB 4PI0A 5FYJE 2KUTA 1I1AA 4LKXA 4MLSA 2VDLB 4HEMA 3FU3A 3GBNL 4UT6A 5E1GA 5EBWA 3DPBB 4P5RA 4IBSA 1E8XA 2BNRB 2P5WB 4BUQA 5CD5D 5ILTH 4FJ6A 5DK2A 4IMKA 1DVTA 3FT0A 2W60A 2NXZD 3L81A 4PWEA 3GBEA 1L9RA 4TQHA 5EUOA 1FC2D 1R5VB 4DKAA 4F5CE 5DSCB 4OBSA 4CMMB 1CGVA 1GOGA 3UBXI 4ZQKB 2CO2A 2IAMB 3UAJA 1YY8A 3VXTA 1JI2A 4YGVB 1F8TH 5HVHB 4LHUB 5KVFH 5EIIB 4EOWH 3V2AR 4D0DB 5DZVA 4XNQB 5IHBA 1FFNA 4MKMA 1M7DB 5F7WC 1FNGA 4KNUA 3S36X 3UZEA 2HG5B 3ZVVA 3TBVB 5FK9B 1KG0B 2ADGB 3C9NA 3HHRB 3VAEA 2B9BA 3MLWL 5D7SL 4IRJA 1AFVL 4WW1A 1IBGH 5DURD 5HXMA 1EBAA 5FKPB 2UY6B 1BLNA 3NFNB 3RE0A 2FX7H 2J4WH 1BP3B 1JUFB 5JOPD 3WTSA 2YUZA 3ZQXA 2QQLL 2GB2A 4HJGB 1A6VL 3REVB 2E7MA 5IHUH 3VD5A 1TQBC 4N6QA 4YPJA 1E4WL 4W9IC 4ODTL 3MRHA 4NRYA 3SHSA 1YYCA 2AEIT 1KGUA 1T1YB 3H3BC 5AWNL 3W9EA 3ULVH 5KVDL 3L1EA 1CMOA 1X4ZA 3MNMA 1XGQB 3FRUB 3WIHH 2V5SA 1VEOA 1QZ1A 2YD7A 3MA9L 1VFMA 1U8NA 2OL3L 1NGXB 3ECQA 3BX7C 4YL9A 4Z8FH 4LLYA 1MQKL 3D33A 4XPBL 3CN3A 1AGCB 4LKCA 4BQ8A 4CW1B 5KSAB 2DJUA 2VMCA 5I8OH 1INEL 4HZAA 1IKOP 4OJEH 2MCG1 4HHGA 4G42A 2LAGB 2VSCA 1XDTT 1KXVA 4Z78B 5D7LD 2Y23A 4PI2A 5GQBA 4XP1L 5F2FA 5J12C 4BYHA 3QJFA 1SQMA 1EEYA 5K33A 4EZJA 5IOPB 2A99A 2Y36L 4CN6A 2DDQH 2C9RA 3FB7A 3NCFB 3S37H 3RZCA 2X88A 3WU1A 4NJAL 3VVVA 3MOAH 2ALWA 1BJ1J 3MTRA 4MNHB 4QRRE 3FZUC 3QA3B 1J18A 4W93A 1MHPH 4N2EA 3K71A 4KO5A 4FQCH 2XBDA 5AKRA 4OBRA 2UZYB 1RK0B 4S2SB 4BBWA 1MCLA 2ALAA 2P8MA 4HA1A 4LSQL 4HHWA 3H53A 3JV5A 4MVBD 4WQOA 1RK1B 3N85H 3HS0C 3LZRA 4JMXA 2E9GA 2FEEI 4TVPH 4MA1C 5EPMB 1PIGA 2Y72A 1D5MA 4JM2D 1G7QA 4L3EE 3LZFL 2X4QA 1BQHG 4XGZB 4S1QL 3TIEB 1QNZH 1NFAA 5DT1H 1OQXA 1I9EA 4Q6IC 4CAGA 3FQXA 4AENB 2LABA 3HEIB 3S35L 1JCVA 3WO4B 1HJBC 3KYOB 1P4UA 4LO9A 4ZSOA 2XN0A 5ALCL 1MRDL 2EYSA 1VENA 4RDQF 5BRZB 1K5NA 5C07B 1TJIL 2CHDA 1HZHH 4X7SH 4QLWA 1F3JA 1CJYA 3PIQA 1U8LA 5K39A 2KYIA 3C08H 4AGNA 4QJ5B 1E5UI 1CXLA 4IKJA 2EXWC 5IW3A 4PJGE 5HDBF 4LSUL 5T3ZH 3HNTL 2YD8A 1CGWA 5HHXL 4AQOA 1HILB 4GSRA 4K2UH 2GYSA 4IDJH 1AXTL 4JR9H 4MD5B 1CD8A 1ZHKB 4NOBA 4F2ME 2ADIA 4FXLA 2JCCB 4P05A 3ZE1E 1RJZB 2QFPA 1XGRB 3JBG7 5KANG 5IQ9B 4UQBA 4N20A 4NB7A 3MV9A 3US0A 1OIOA 3CSTA 5HBBA 4AMKL 3RU8L 5E08L 3FT3B 3PABA 1QBLH 4X6BA 5I8CA 4IS6A 2ZSWB 1T04A 2X1WL 4ZW3A 1XTLA 2NQ3A 3IBEA 3S96B 5F71A 3CFTA 3L3OA 5JOPE 1QFOA 2BP8B 3VRLE 1JVLA 4AUYA 5A6IA 1TEGA 5C0CE 2OYPA 3WY4A 1YPZA 1J5CA 1E3XA 2P5EA 1YMMA 2NY0C 5IJCC 1KIPA 3GSNB 4PJDB 1BF8A 3MRJB 4AXWB 2UWEB 2E27L 4LEOB 1VACA 3D0VB 3KYKL 3D87B 3BFOA 1BVLA 4OLXH 4V11A 3SYQA 1S9KC 2JJTC 4FJYA 3OKNA 4MAYD 1SXZA 2WWOA 4WKZA 3CFDA 4L4VB 1GR7A 4RGOL 2GJ6B 1S7XB 3GXTA 4EIZC 4YSCA 3I75B 5BZDA 2FATL 3L54A 1WD9A 4K9EL 3BRDA 3BZ4A 1DFBL 1QKZL 3VG0H 2IO5A 4CU8A 1HXMA 1JPFB 3T2PA 5D7LE 3V5HB 3B9KA 3OAZK 5B22A 4HJ1A 1ICTA 3NJJA 1MJ8H 1QABA 2VQTA 3CBKB 4Y0GA 1AP2A 1B90A 3PQYD 4JN1L 1I7RA 4TVPD 2WBWB 4L1BA 5E4AA 1Z9PA 3MJ9H 3R06A 2E4TA 3FQTA 4K7FA 3BAIA 4I0PD 3T8VA 3VXOB 1T4KB 1VCAA 1A1OB 2DD8L 2W9EH 2C3WA 3RFZC 2C9AA 1MFCH 3D3VD 4AVKA 5JLZB 4BK4A 1VSCA 1IT9L 4OZFA 2I9LB 2Q86B 4W81A 5IHHA 5I1KL 3C2AL 5EV7A 2YGNA 3QVAA 4DP1X 3JT0A 3OVUB 4JFZH 3SY6A 3OKYA 5AOZA 4KMLB 3TESA 5ANHA 5LWYH 3CIQA 5DO8A 3T77B 1TQBB 5D7JD 4K73A 5I82A 1KPVA 2G2RA 2X4PA 3WGVB 5DVKA 5BMFH 3QJTB 5KJRL 4DK5A 5DJZA 3G6JE 4E9LA 2FECL 2VIRA 1QHPA 1F97A 4I4WB 1JNHA 2ZPKH 5D8JH 4Q9QL 4PRDB 3C6EA 4U0RB 5IUSA 1UC6A 4GSXA 2V8LA 2QHRL 1F4AA 3FU8A 3NJMA 4M48H 4KJPC 1QW9A 5T3ZD 4EIUA 2BNRA 5E9NA 4F58L 1BVZA 1IL1B 4WWOA 5B1AB 5KVFE 1OPOA 1FNLA 4WSJA 4Q2ZA 4WWNA 2APXA 1Q94B 1WZ1L 2QSTA 5E8OB 3OAUL 5CD5C 4KK5C 3WNNA 2F1BA 1R5VA 1V5JA 4N3TA 1N59A 4ZQKA 2IAMA 5DFAA 2JKIS 4M02A 1P0SE 4LU5L 1SY6L 2AJUH 4IOSA 2XKNB 5AVXB 1MCCA 4LHUA 5EIIA 5EEZA 5IKCB 4D0DA 2APTA 2DTML 4XNQA 3ETTA 1M7DA 5C7ZA 3SGKC 2R8SL 4JHZA 2HG5A 4XH2B 2AS5M 1JNNL 3OR6B 1P1ZB 3O4LB 4H1LB 5KOMC 4Z7WE 5L2KD 4Z7QB 5I0ZA 1B88A 2W0LA 3FU7B 5DU7A 3R19A 3MRLB 4AQEB 5FKPA 2UY6A 1ACZA 5JW3L 2HUEA 3NFNA 4MA1B 4FA8A 3K6SB 3ZDWA 1EX0A 1E5CA 2VAJA 3IMBA 1TIUA 1ASOA 1DEEB 1JDCA 1W72L 3LIZA 3REVA 1ETZB 3D25B 3EYQC 3WUWB 3T3ME 5JW5B 4PFEA 4Q6IB 2WVVB 3C6LB 2G9KA 3D6GA 3O2WH 3RIFK 4CSTA 4G11A 4Z7UB 1T1YA 1TITA 3GK8L 2HVKB 4UYQA 5L8KB 1U8JB 2XN9D 4DOHE 4O2EB 3NACL 1XGQA 3KYMB 3WIIL 2AXJA 2R1WB 1I3RB 1E5BA 2QSVA 4WU5A 3PWPA 5TE6H 1FVDB 3OAZH 3UEZA 1NGXA 1MUJA 2IPUG 4OLVH 1FSKC 1YNLH 4ONFH 5HHVL 4KRPD 5KSAA 1NSNL 4EAEA 1GS8A 3BAJA 1SVCP 3EOYG 1WUNT 4I3GA 3VFTB 4RSYA 3ECWA 1OAKH 3ZY7A 5FDYA 4NHCL 4Z3TA 1JCKA 4Z9KB 3U0PB 2B16A 1NC4B 4U2YA 4E5XG 5I23A 2VXUH 4OVVA 1P5UB 4A55A 1OALA 4LAJH 4YK4C 3U9PL 3PQYE 4TVPE 4DP6X 1KY7A 2J8OA 4Z5RA 1I1YB 1NAKH 1IJNA 1A7RL 3TWYA 4D94A 1BFVL 4LGPB 3GMRA 4MNHA 3Q6FA 4M5ZH 4ODSH 4ATTA 3D3VE 1TZHB 2F9BT 2K7QA 3F7VB 1PFCA 3Q01A 4P2QD 4PN6A 4LF3B 4H40A 2QPSA 2UZYA 2ZSVB 3B9VA 4S1RH 4A7GF 4PJCF 1VPOL 2FWUA 1WE5A 4PV8A 4WUUB 4Q8BA 4FLQA 3EBAA 4XMTA 3E3QE 2YN5A 1EGJL 5IBUB 5D6CB 1FFQA 1OP5H 2DQCL 2BRRH 2NY0B 3BHBA 2BY2A 3RWGB 5LDUA 2OR7A 1KIRB 2JI3A 4J6RH 2XACC 2DM7A 2XI9A 4MVBC 4PVLA 4ZMXA 4HAKA 4W9CC 3O41B 1BFOB 4NO0D 1YA5A 4V2CB 5DEZA 5ENWB 2UVFA 3RTQB 3TIEA 2JB5L 2B1AL 4NRXB 4OF5A 4K7PX 3HS8A 5CJXC 2AK4D 2PO6D 4AENA 2QVTA 3BYTA 5T3ZE 3UYRH 2VR7A 3KYOA 2AK1L 1SEBB 4MJHA 2EINB 4NIYE 5DJ0B 5BRZA 5C07A 1R3IL 3GJFK 4M5SA