1OEZW

Zn his46arg mutant of human cu, zn superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
124
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVHEFGDNTAGCTSAGPHFERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Amyloid-Like Filaments and Water-Filled Nanotubes Formed by Sod1 Mutant Proteins Linked to Familial Als
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 30
structure length 124
sequence length 153
chains with identical sequence X, Y, Z
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oezW00
3MNDA 3KM2A 1F1GA 1JK9A 2AQQA 3S0PA 1JCVA 3CQQA 1IBDA 4BCZA 4MCNA 2WYZA 1E9QA 2GBVA 1P1VA 1JK9B 2R27A 2VR8A 1SOSA 4BD4A 1U3NA 1IB5A 1N19A 4OJAA 1TO4A 1B4TA 1DO5A 2AQPA 2SODB 2LU5A 1CB4A 3L9EA 1SDYA 4U4IA 1ESOA 2AEOA 2Z7UA 1L3NA 4B3EA 2C9UA 1E9PB 2AQTA 3QQDB 2ZOWA 3F7KA 4N3TA 1RK7A 3ECVA 3CE1A 3GZOA 2C9VA 4FF9A 1SXBA 3H2QA 2AQSA 2WWNA 3GQFA 2Z7YA 1OZTG 2JLPA 4A7VA 2C9SA 1N18A 1KMGA 3CQPA 2WZ6A 1QUPA 1E9QB 4A7TA 5KBKA 2JCWA 4L05A 1MFMA 1F1DA 1SXNA 2V0AA 3RE0A 4A7GA 1B4LA 1TO5A 1E9OA 1F1AA 2WWOA 1SRDA 1SXAA 1S4IA 2WZ5A 3KBEA 1AZVA 4A7UA 3ECWA 1YSOA 1OZUA 5KBMA 1E9OB 3K91A 2ZKWA 2AF2A 1BA9A 3L9YA 2Z7WA 5KBLA 1IBBA 4A7SA 2AQRA 1UXLA 1IBFA 1SXZA 2Z7ZA 3GZPA 2E47A 3KH4A 2Q2LA 1F18A 1XSOA 1YAZA 2K4WA 1OAJA 1Z9NA 2E46A 1SXCA 2AQNA 2XJLA 1OEZW 4A7GF 3MKGA 3GTVA 1Q0EA 2WKOA 3F7LA 3H2PA 3SODB 1SDAB 1DSWA 1EJ8A 2NNXA 1IBHA 1SXSA 2XJKA 3GZQA 2WYTA 4BCYA 1COBA 3LTVA 3HW7A 3HFFA 2GBUA 1HL5A 1HL4A 2APSA 1FUNA 5CU9A 1XTLA 1PTZA 2WZ0A 1XTMA 1SPDA 3PU7A 4N3UA 2VR6A 3ECUA 3KM1A 2VR7A 2WKOF 3KBFA 1BZOA 2GBTA 1PZSA 2ZKYA 3T5WA 3HOGA 4MCMA 2ZKXA 1E9PA 1EQWA 1OALA 3GTTA 3QQDA 1Z9PA 3KH3A 1UXMA 1YAIA 1PU0A 4OH2A 1CBJA 4A7QA
chains in the Genus database with same CATH superfamily
5DD5L 4PJ5A 4TV3A 5HGDA 1JAEA 3D39E 3IT8D 1PDKA 3NIDB 3M8OL 2JI2A 4MNHA 1X5HA 4UIMA 3QC6X 3GMNA 1NC4A 1EZSA 2GT9A 5AG8A 4JFQA 5T1JA 1V7MH 5JPNA 4W9CC 5CS7A 5DLLA 4AV0A 2I85A 4M7KH 2ZD0A 1NFKA 4DGYL 4JMNA 4RNRA 1VEOA 3KWTA 3FQUA 3TJEH 3U25A 1ZHNB 1NEPA 4FEMA 4L1DA 3L13A 3T4YA 3VE0A 5IBTL 4PJGE 4OI7A 2A6JA 2P5ED 1JGVL 4NPYA 3AS2A 4YFDB 4HHWA 1MI5E 2X4UA 2X9WA 4QHKJ 3MCKB 4O2FB 2IV9A 4Y2NA 2H1PL 4L1TA 2VZ3A 4ZTEA 2WSKA 5EZJB 5HYFA 4YO0B 2IQ9H 4MCYB 1O7DE 3WIHH 4Z7NE 4LEXH 5DC0A 1E9QB 5K39B 1DO6A 1AHKA 5CP3H 2IAAC 3SDDB 3ZL1A 2KZBA 1F5WA 2B2XH 4P46D 2Z31B 2X10A 4PWKA 3V5HA 1BX2A 4QIRA 2EEAA 2YPLA 5ID0B 5J9PB 1Q9KB 2N59A 4CSPA 2XZCL 4S1DC 4WF7A 3C08H 5GS1C 1D5XA 5IIEB 4A7SA 3ZSTA 1WITA 1KYOK 2FQEA 4BH8A 1CWVA 2ZPKH 3EUDA 4MD0B 1WA1X 3ESPA 5C6TL 1UASA 2MFNA 2XTLA 4S11A 5DRNA 5LBSH 4MDRA 1A7PL 1OEZW 3AT8A 3TTYA 3LDBB 1FORL 3TWCL 5I1HH 3ULUF 3MLWL 1WFNA 1FHGA 4GO6B 1ZVYA 4X83A 4LAJH 1JNLL 1XR9B 4NQSA 4NQED 2ICWA 4LHQB 4S10A 5IBLC 3QQ3B 4C47A 3BIBX 4F15C 5FHAH 5J13C 3EYQC 5FYLE 5CBAA 1C7TA 3LCYA 1DQQA 4P49A 1XGRB 4Y1SA 4CDHA 2BNUA 5AW6B 3U9UA 4NO5B 4LCCA 4NQVA 2OMWB 1PMYA 2Q3XA 2QQLH 4MNGE 2C1OA 1LEGB 1J87A 3M1BB 5CGYC 2OTWB 4G6KL 5DK0B 1GY2A 2OP4H 3UPRA 3SPGA 3V6OC 1RH8A 3U2SB 4CSZA 3WFBL 5F97E 1TITA 2DIAA 3KH3A 2ENQA 5L88H 4HIQA 1FDLH 2H0PA 2YUVA 1KJVA 4JHBA 4XPAH 4K8RL 4N8VB 3U6XA 2YGVA 1F4AA 3MLSL 4LXFA 5SWZA 3VFGL 3II2A 1F2QA 3WY4A 4JKPH 4U6VL 4KV5F 5ALBH 1HWGB 3A5VA 4KFZC 3FUNA 4HOXA 4ZRGA 1C12B 3L5WB 3PAVA 4XCFL 2X44D 3Q3GA 3VXRB 2BNRE 3QDGA 2CUIA 5DZAA 4MA7H 5T3XH 2EDEA 4K9EL 3MA7B 4DGUA 4ES8A 3HBPA 4OFQA 3CVHL 2AJVH 2MNJB 5D7IF 3LB6C 2IOOA 1W0VB 3RVXD 2ZZUT 3TBYA 4P2YA 2VR5A 2ADIA 2BHUA 1A25A 3FRUB 3WD5L 2LLNA 3QS3A 4NZFA 3VTTA 3QFJA 4XNBA 3W0WD 5G4MA 3IJ7A 2ARJB 1XAUA 2NX5B 3VI4E 2VXVH 3WS3A 5E08H 4HUNB 4WW2B 5ERWB 2X0WA 3PGDB 4JVWA 5HJBA 3KPSE 1OCWL 3BH8B 5DWPA 1IBZA 2V6HA 2CK0L 3PABB 4QO1A 4OKDA 4YXHL 1A6PA 1HOCB 1AIFB 1TJXA 1QEWA 1YO4A 3JWOC 4YDIL 2XQYA 3PREA 4L37B 5JQ6H 3SOTA 3TPUA 4LHUD 1G6RA 3QUZB 4FABL 1IE4A 1L9QA 4XBPA 2PWEA 3RVWC 2AJ3B 3QWRA 3ZN6A 1IC1A 4RFOH 4A7UA 1GXEA 5DJ6A 1MWAA 3QCTH 4N1HB 2WSDA 1OGTA 1GC1L 5GZNA 4GKZA 2Z92B 4YHML 2EXWC 2QBWA 5C92A 3RTQD 1CXEA 2DQUH 2H6OA 4FKKA 1MIEH 2MMXA 1NTDA 1JHTB 5KANI 1D5MB 4G2AA 1CDUA 5AVSB 3FTUA 4XVJL 1QW9A 5E5RB 3NJVA 3FQNA 5HHVL 4UAOB 4PBXA 5LUMA 5DLML 1TZIB 4XPGL 4BFKA 4XNMB 1HT6A 2CLZB 5EORL 1BP3B 2VJXA 1IGMH 3T0BA 5B4MD 2CA3A 3FO2B 1NSNH 4WI4A 2P5WB 1NCOA 1XZ0B 4R5XA 1A7OH 2W07B 4C54A 3PU7A 4AUUA 2FQDA 1IZKA 4OQTH 4E5XG 3KGRA 4NUPA 3FQRB 2AAAA 4KHXH 4NGHL 2Y6SC 5SWSA 2QDWA 1YPZF 1ZHNA 4MBRA 3RILA 4G42B 4YMPA 2F53B 4F7TB 2VDNB 2WSPA 3FO0H 5F72S 3DX4A 3WKQA 3FTGB 1DJSA 1MCRA 1R46A 1BFSA 2X4QB 3N55A 2P45B 3V0AC 2WXNA 4AL8C 2X6UA 3ABZA 5I1IL 3MCKA 1F4HA 4MMZB 1DJIA 4O2FA 2NXZC 3R4DA 3ZDZB 3WXVL 4APQA 4PWHA 5KVFE 4YO0A 1CT8B 5HDOA 1YC8A 1KBPA 2CR0A 1E9QA 3EOAB 3RWEB 3W11D 3QIWA 2R0LL 5C0CD 1J1PH 3SDDA 4BD4A 3BUIA 4YN3A 4WY7H 4L5FH 2IBGA 3WY2A 4KPHH 2Z31A 4AMXA 1NGXA 3FT9A 2FIKA 3Q06A 3OAUH 4XMTA 5I6XC 5ID0A 2NSXA 2LVEA 3RBSA 2J4WH 3QEQB 4P2QE 2V9UA 2Z0UA 4TLTA 5IIEA 1I9IH 1ZKAA 1E27B 2Q9OA 4MD0A 5EUOA 1RPKA 4YE4L 5HYJD 4EDWH 4KMLB 4DK6A 1CGSL 1QFUL 2DJUA 2Z7YA 1U4FA 4AQZA 2GUOB 3QQ9D 4UTBH 1DBKH 1XR9A 2CD0A 1SM3L 1IAIL 4HW6A 5JXAL 3T04D 3QQ3A 4WI9A 4DGVH 3ZDXF 3PRZA 1OPGH 5DFVD 2C9XA 3O6FB 1LK2B 3WNOA 1URZA 1XGRA 4R4FH 5DA0B 2ICWI 5JQHC 5C1MB 2XFXB 3ULUL 4DP0X 4JM2F 4K7FB 3RFRA 3WTTA 2DKUA 3NFSL 3L5IA 4PGCB 4Z7VF 3BIKB 2OTWA 3O4LB 5DK0A 1NCCH 2YD8A 2PLTA 5AD0B 1ZTMA 4X6DE 2CDEB 5JW5B 3U2SA 5FYJH 2K78A 1X5MA 3VYPA 2XV0A 5K69A 5FFOA 1U8PB 2IDFA 4MXQC 2WKOA 4XVTL 2NNXA 5EWIL 1VENA 1C12A 2DH2A 3VXRA 4ELMF 4OFVA 4P5TC 4L4TB 2YWZA 4JS7A 1LO0H 4XXWC 1DN0A 3O6KH 3HNSH 2JJTA 2FUTA 1ILUA 3TA3D 1KB9K 5F9AC 3HB3D 2QMKA 2BY3A 1JWSB 1W0VA 5FM5O 2O61B 1CDCA 1S9KC 1RCYA 3FRUA 5TFSL 3TVMB 4MZ3A 5LQBL 2AXWA 4IU2B 1MCPH 2ARJA 3BN9D 2NX5A 1CLZL 4WW2A 1DVQA 2BLFA 4TNVK 1J5HA 2F54E 3PGDA 4WNQB 4MAYD 5CWSB 3BH8A 3PS6A 3JT0A 3PABA 3RUGF 4KH2A 4PEEA 1WJ3A 2VZSA 3VXUE 1HOCA 1AIFA 3FB6A 2JCCE 2WLJA 5DK3A 4UQ2B 4L37A 4DT2A 5E94A 2DEYX 3EYFA 4AQAA 4JGNA 1PZBA 2NY6D 4R3SB 3WFDH 3HEIB 1B88A 2YO3A 1YLBB 4OJFH 2AJ3A 3L17A 4PBDA 5SWZE 4BUQA 1I4FB 5C0GB 2E7CA 4HF5H 2Z92A 1OAKH 4U6HA 4MFHA 5ILTL 5DD3L 4H0LC 4HK3J 1ZT1B 4A6YB 3QDGE 1ACYL 1E5YA 4Z6AT 2F1EA 1HEZB 1JHTA 3GI9L 4FLHA 4GQZA 3AADB 4L3AA 3QYMA 1YY8B 4HKZB 2EIJB 4Z7UB 1ZY9A 2DOCA 4QRQA 5HVWA 4KITB 5K9QG 3WSQH 4G7VL 4LAQL 2A0LC 3PQYD 4WFGE 4Z3GA 1TZIA 2WINB 4NJAH 4XNMA 4YFLF 3VB8A 1MAJA 2CLZA 4XNYL 3MUGB 2FBJL 3RX9A 1MW0A 3LEYH 3UZEC 4K5LA 5DJDB 5D6DA 5CEZE 1PIGA 3FO2A 4LPUA 5FKAA 2Y06H 1EWHA 2W07A 3LRMA 3VJ6B 3G04B 1KEGL 3DJTA 4JFXA 4EPSA 2EXTA 4YPJA 4G7SB 2XVBA 2F53A 4F7TA 3ETTA 4BK5C 4OBRA 4BSJA 2K3HA 3FTGA 2X4QA 4QHKI 5TQ2H 2VMCA 5JHLL 32C2B 4MMZA 2OLDA 3FUHA 3SQBB 1RZQA 2P5EE 3CGTA 4I3SH 5C08B 4DVRL 4KRLB 4O02L 1CT8A 3H2WA 4TNGA 1ECYA 4NC2B 1UD4A 4GQ9L 3GHEH 3EOAA 3RWEA 3T8VA 5CAYB 4PJBB 4CVWA 4OBSA 5IKCB 3DSNB 4UIKL 4F7CB 4X80L 2ROYA 1E6OL 3HJEA 3HZMB 2XOTA 1AJ7L 1DJGA 2CM6A 3DOHA 4PUBL 5DZOA 2AABL 4FL4C 4X2UA 4ZTPL 2W94A 4KXAA 1P4IH 5ICXA 3QEQA 3AW5A 3CSFA 3NIDE 1YNLH 4PVNA 4KTDL 3ZGIA 3GJEB 5ADOH 1NUGA 2OI9C 4FXLA 3ZMNA 1E4KA 4Z0XB 1RJLB 3W56A 1H5BB 1A6VH 1DFBL 1HHKB 1Y1UA 1YEEL 5HTSA 2XTJB 1IIKA 4P2OC 1IILE 4IIZA 1JXDA 4BSVB 2BIHA 2NW2A 2GUOA 2X6MA 1TZAA 4XN1A 1U3HB 1T6WA 3F84A 2VN5A 2VR8A 3KMDA 2L4OA 4IKKA 1U3NA 3O6FA 1LK2A 4IM8A 3ZMEA 5EZOL 2HT3C 2WO3B 1GOGA 3SD2A 5KW9H 4K7FA 4R97C 1TF4A 5DMGD 3BZDA 3KHQA 4HS8H 4JCMA 1T4WA 4HZ1A 4LCVA 4PGCA 3V7AE 5EU7C 4F93B 3BIKA 3O4LA 3GBLA 4XAKD 5F7EH 5AD0A 3GNML 2CDEA 2VNCA 4K94C 2IFFL 4PQXA 2EEBA 2H26A 2XSKA 4QXUH 4PV1C 1CGXA 3UDWC 2YQ3A 3IBEA 1U8PA 4OZFG 4F8LA 4YHZL 2V2TB 3RB7A 1JG9A 1GA2A 3AY4A 4IOSA 4OM0L 1A02N 3LEXB 5AUMB 2ZXAA 1QG3A 1FFOB 4GW5B 1L7IH 3HG1D 5HGHB 4L4TA 4K07A 3OQ3B 5EU3B 1KN4L 3S48A 3H3PL 3S3BB 1R4XA 3V0IA 3VA2C 4WJKB 2Y2YA 3BKCH 4JX0A 1G6VK 3SGEH 2XWRA 3V4PL 1JWSA 4JFDB 6TAAA 2P28B 1XGYL 5AZEL 5LN8A 1PJ9A 5E56A 4WJ5B 2BIOA 2XICA 2V17H 1RKRA 1MVUB 1FC2D 3TVMA 4OLUH 4IU2A 2VUYA 4BQBA 5I8CB 1KIUB 1IAKB 3G08B 3I9AA 3X1GA 5CWSA 1RVFH 1UEYA 4OCYH 3IFNL 4ZW5A 1GTNA 4A2DA 1NIAA 5LWYL 5BUPA 3QR0A 3ULSB 1E6JL 5J1SC 4NQXB 4PIRF 3TO4B 4H40A 3VUAA 3HW7A 4UQ2A 4DH2A 3ZO9A 3BPLB 1CUOA 3VMPA 1OD7A 1RZPA 2VDML 4R3SA 1TTFA 4RFEB 4V2CB 5C0GA 2I5YH 1I4FA 5DD5H 2B5IB 4MB3A 4RA0C 5HI4D 4G9FD 3VNZA 1I7UB 4U7MA 5CGTA 5CUSH 4JO3L 2DYRB 1M9SA 4DEWA 1EGJL 3PWVB 2NUPB 1ZT1A 4A6YA 1O0VA 3PWPB 1CE1L 2K3TA 2DJMA 4U1KB 1HEZA 2R1YB 1CGWA 3JUZA 3ARFD 4J7RA 1YY8A 4U7KA 4W6XB 1FNHA 3FN0L 4HKZA 4APQC 3ML9A 5E6SB 4Z7UA 4NYLA 1MDAA 4R4BA 2QADD 4BZ1A 1BECA 2P8LB 3FZUC 1FO0L 1AR1B 5IBTH 2NX5E 1SFHA 2IAMC 3MUGA 4Y4KD 3T2OA 2MH4A 3QARA 4G8GB 3JV0A 5DVLA 2CGYA 4PM1A 4XN9A 3VJ6A 3G04A 4Z76A 1OP5H 5JIQA 4NO0B 1E8WA 2AEOA 3QZPA 4IW4C 4B53A 4F20A 2DQEH 3MCYA 5C07D 1G1KA 35C8L 1MCJA 5L4MA 1GCFA 2F7IA 1TQCC 4AYBA 1HJCA 2J5LB 2YGNA 4WLCA 3F65A 32C2A 5AOJA 3SQBA 5C0EA 3EBHA 2YBGA 3MLVH 4XPHL 4Z18A 1PGRB 4W6WB 3ZZ1A 3SZ6A 2DYPD 2XZCH 4K15A 2HG0A 2M1KA 4OZGF 4J39A 4TUJB 4YHIB 4PJBA 5AL0A 1EHAA 1MFMA 5IKCA 2FLBT 2KLTA 3DSNA 5EOTB 1KGUA 5E1AB 4R5VA 4UU9A 4GKSB 3LKNA 3DIVA 4WFHD 4YUEL 5K33A 4F7CA 2ZXBA 1A7NH 1Y6KR 3HZMA 5ECJE 1FORH 1AZVA 1C5CH 3MLWH 2G30A 4PHZA 3KVDD 5FDYA 5FO7B 1JNLH 5IROC 3GBMH 1WD8A 1GS6X 2V5RA 3JWNE 3KS0J 2BHYA 5CO1A 5FUCE 2Y1ZA 4OLXL 1JZ5A 5AVXB 4LIQE 2W91A 4Z0XA 1EVTC 1XSOA 1H5BA 1ZS8B 3SQOL 3EJQA 1HHKA 2NY0B 3DX8B 5DFTA 2P5WE 3RY5A 4KTGA 4RRPG 1I9RH 4BSVA 4I4WB 1X7SA 1F3RB 2XBDA 4L8SC 4G6KH 4JLRB 1U3HA 2N1TE 3N06B 1BFTA 1QSED 4JR9H 5GXBB 3WFBH 5C7XH 1P6FA 1GOFA 1DCEA 4OLZH 3B2UC 3MLSH 3VFGH 4RDBA 5ISZD 3QYCA 1D7CA 4U6VH 3ZDZE 1XH2A 5EZLB 5BUAA 4GRWB 3S4SG 1YQ2A 3D48R 5K9KB 3EYOA 3X2QB 1CZ8L 5E7FA 5BRPA 2W5PA 4FNTA 3G6AA 3P3TA 1JI1A 3WKPA 4HJ0D 3CVHH 3D34A 2OYKA 1INQB 3MV9B 2V2TA 4TSAH 4EN3C 4TL5A 5I1KL 1JVOA 1J0YA 3L1EA 3LEXA 3VSQA 1URLA 2PUQT 3WD5H 2R4SL 4WWKC 1EXUB 5CM1A 1JZHA 2VKXA 4GW5A 3G7TA 4XOEA 4I48B 2XWCA 3CXFA 5PCYA 3JYCA 5EU3A 4ZSOA 4UM9B 2I07B 3QEHB 2Q0ZX 5E95B 3HS8A 2CK0H 4NC0B 4JFDA 4PJIA 5CZKA 4YXHH 3VGAB 2P1YA 4ALAC 1R3KB 4IDJL 1MFEL 4HETA 4WJ5A 1CYWA 4UTCA 5J6HB 3U1QA 1FHNA 1MVUA 3VD9A 4PJDA 4EUPH 2CUMA 5ITFB 4FABH 4OW6A 5I8CA 1KIUA 1WCBB 3S9DB 1IAKA 3G08A 3LSOA 4FS0A 3FTYA 4M1CD 1SOQA 2P8MB 4JQVA 3AFLA 5IB5A 1TJIH 1XCXA 1G5GA 1GC1H 4N2IA 3MRDA 3ULSA 4NQXA 3TO4A 2XQBL 4RMWA 2XIDA 5B39A 2GKIA 43CAA 1M9WA 2C7UA 1F1DA 4LFHD 2CSPA 3NCYP 2DYSB 3CFBB 1U58B 3NYKA 5KANG 3HRZA 4JQXC 1X5XA 2Z0BA 1SJVA 4TL4A 4XVJH 4RFEA 2N01B 3K2MC 3LZOA 4UQ9A 5HHVH 1FG2B 3DUUA 3C5ZD 3FUJA 1I7UA 1UH3A 3MRRB 4HWBH 2B9BA 2L7EA 5KSAB 1GSKA 1W6LA 3PWVA 4L4TE 2NUPA 3MUZ1 4FE9A 4Y5VB 5DEGB 5EORH 4JFYA 3PWPA 4JPSA 3JTBA 3DHUA 4S0SD 4U1KA 3S36X 5D96B 2EDJA 1ACXA 2R1YA 2Z1KA 3DMMD 5BV7C 3GSNL 4OT1L 4PG9B 3IAQA 3FQXB 1GYVA 4C56D 4QI3A 4JHUA 3NP4A 2P8LA 2CE6A 3CAFA 3RZCA 2APSA 4IRSD 5ECGA 3U9PL 5B8CB 1PTZA 3B9KB 3Q48A 3BLBA 2IADB 4G8GA 1O75A 4K5MA 1AC6A 3QR1A 1H3TA 1SQMA 1AS7A 4KRPB 3WXVH 3WTSA 4NO0A 3WMQA 2Q3AA 4MS6A 1ET5A 1I1AC 1EO8L 1Y18B 1BLNA 3GMOB 1E4WH 1CVRA 1ZDQA 2AJSL 3HHMA 2XWZA 1BLIA 1ODAA 1YAIA 3OKKB 2R4RH 4RX4D 5D7HA 5AAWC 2GSIA 2WB7A 1KWKA 1IGJA 1MDTA 3BC9A 1FSKB 4I1NB 3V0WL 4AIEA 4OJDH 1BVLB 4Y4FD 5FWRA 4C83B 1X5IA 3SYAA 3UBXA 3GSUB 5D2LF 4X9YA 4I88A 1DE4B 1MIMH 2OZNA 4NHCL 5EOTA 5E1AA 1FFRA 5I5IA 4GKSA 4Z5RB 1CGSH 4HG4K 1QFUH 3BUDA 4MX7B 5FO7A 4Z7UE 5D7SL 2XPGB 1L5GB 2X4TB 4YEEA 1SM3H 1IAIH 3P73B 2CJUL 1M56B 4G83A 3TWYA 2MWCA 1OOWA 1ZS8A 3DX8A 3ULUH 3DX6A 4XOCA 5BO0D 2G5RA 4FA7B 2A9DA 1OZTG 5DZJA 3UGEA 3NFSH 3VGDA 1CQKA 1OLZA 4I4WA 5D72L 4H2AA 4JLRA 1KIRB 3R18A 4PWJA 4ZO6A 5DJAB 4ZQKB 3K0WA 4HPHA 4QOKD 3K6FA 1TQWA 2RJMA 4LB8A 4NN7B 3KVQA 5HHMB 1ECZA 4EI5C 4AJ0A 4XVTH 1JGUL 5C08E 2AAVA 5EZLA 5EWIH 5B1BB 4HAKA 4H20L 2BVOA 5E2UL 5C3TA 4QRAA 1BHGA 4DW2L 1L9MA 4XVUD 2ZWKA 3NIFF 5IVZA 3K6SB 5T5NG 2W60A 1ZK5A 5ES4B 3CX5K 3WJJA 4AG4H 4EIZC 4YZFF 4B96A 3TONA 2MPAL 4FP8H 1U8HB 3MV9A 5I74B 3QUKB 3N41B 4NB7A 1NCDH 3VMOA 1EXUA 4W68A 2A77L 5TFSH 5LQBH 4KJYB 1OSPH 4R7VA 4I48A 4ZNCD 1OE2A 4UM9A 2I07A 3IU3B 3QEHA 1MW2A 2XTJE 4LVHB 1M71A 5DHVH 2ITCB 2OL3H 3GF8A 3V5DB 4LRNL 1OB0A 3GI8H 3T6QC 1R3KA 1UB5A 1EZVX 3DV4B 3N1GC 4P9HL 5J6HA 2JJUA 3ETBJ 4IRZA 5JYMA 1WCBA 3EH5B 4NM4L 4CU8A 1AI1H 2YGOA 3BQUA 4BFNA 4BDVB 1RIVH 5D7LD 4HH9B 4PJ8C 4FGMA 5E9AA 4N0UB 2P8MA 2VJ8A 5C2UB 2FO4B 4Q9RL 4PP1D 4NNXB 2FHFA 4KKAD 4MGXA 2ZUUA 5JIIA 5DJXB 1B0GB 2I9TB 5BCAA 4WFEE 1ACYH 4GLRI 3QUYC 5LNEA 5EA0H 3NGBB 1CD0A 3CFBA 2VIRB 2W92A 2EDLA 3CZJA 1JPSL 3MBWB 4UT7L 2HKHH 4POYA 3K80A 4QTHB 1FG2A 3GMQB 1F2XK 3MRRA 1R3JB 2XN9D 2YKLL 2C9UA 4G7VH 4LAQH 4F2EA 5KSAA 3RGVD 3QRLA 1VPOL 4PJ9C 3A4AA 4KZCA 4Y5VA 4XZ4A 5DEGA 4ZO8A 5HDBF 1ZTXE 2FBJH 4LSSL 1EVUA 1FYTB 1P53A 4QDGA 4KUCF 2EKSB 2FUQA 3QJHB 2VC2L 3WTXA 4GG8B 4OVVA 4J3OC 4CRPA 3WAJA 1JZ6A 3QI9C 1KEGH 3QORC 4AK1A 4DN3H 5E23A 1MFCL 5FFGA 3LN4B 4CN6A 5I73C 2V0AA 4M7LT 4LVOB 4NN5B 4TUKL 3U9WA 3VGEA 5B8CA 1PSKL 2WCPA 2YD0A 5JHLH 2IADA 2DWDB 3M7OA 5M7QA 1S4IA 2GCYB 4JM4L 2Y25A 4O00A 3U1SH 3ROOB 2IOMA 4DVRH 4D7BA 4DTGL 3K91A 4O02H 2IQAB 1DP0A 2HSIA 4HGKC 5IR1B 3QO0B 2AV1B 4GQ9H 1Y18A 3CZUB 2F58L 4F9LC 2WNWA 3GMOA 4LPCA 3VXSB 4J3BA 2H2SC 1NEZG 3OKKA 1ROCA 1QBAA 2HTLD 4X80H 3ECBB 3SBWC 2AK4D 5EV7A 4IGBD 4PUBH 2HP4A 2AABH 3QZWB 1BVLA 4C83A 4AYID 2MSPA 1LD9B 3GSUA 4IMKC 4JDVB 3RWDA 1JNHB 6PCYA 3PWPE 4BUGA 1UT2A 2ODHA 2EECA 1DE4A 4H7VA 1DFBH 4PLJD 2QLYA 4V2BA 1YEEH 3UBXI 1UYWL 5J7CC 3FU7B 1XF2B 4WGWB 1HC1A 2BNQB 2ZXWB 3BZFA 4FZEH 1HL8A 3ARSA 4Z5RA 2K7QA 4ZZKA 3WHE0 1RUKL 4MRCA 2GBTA 3HZYB 4MX7A 2XPGA 2A9AA 3L1GA 1L5GA 3PDOB 2X4TA 3WGUB 1JXKA 3P73A 4NWTL 5DD6A 1Z9OA 3V0EA 5MHSE 2OXGA 3DX0A 2VLME 2Z8VC 4F5CA 2X4RB 3N85L 1FVCA 4BV1A 4ZFFB 2P24B 4JUTA 4L9LC 1U8CA 4BM7A 4UBDD 3T0DA 3L8QA 4KJPC 3AVEA 2OSYA 5DD1L 2PO6D 2B59B 4MZRA 2DBLH 3SPCA 1U8IB 3UC2A 5F93C 3O0RL 3UACA 3U36B 2YPVL 3U82B 3EHBB 3VG0L 5IQ7H 1KIRA 3GNMH 3WN5C 1BZEA 5DJAA 4WV1A 5L7XL 2IFFH 4PSRA 4Q74A 3ZTCC 3G5VB 4AT6B 4YHZH 5D2NB 2NY3B 2J6WA 4OZIB 3CDFA 4OM0H 2FD6H 3DRQB 2IJ0C 3ZTEA 4NNPL 1UOWA 3IF1B 5ISZE 1HILB 4LSRL 3MRFA 5ESVB 2BVUA 2NYZA 2OW7A 2LW3A 4JZJC 4P3CH 3HR6A 1YNKL 1F00I 5KN5B 1KN4H 4N90E 3GXUB 4GT7A 3LNEA 2DH3A 4R90H 2I32A 3QXAB 1U8HA 1YDPB 3V4PH 2EYRB 3WNPA 4A7VA 5FO9B 1QBML 5C09D 3X17A 3QUKA 1XGYH 4I18A 5AZEH 2EC9U 5C7ZA 1FL3B 3HN3A 5DQ9B 4L8CA 3HUJF 3IBOA 4B9KC 4QHNA 5F6HJ 4KJYA 3QUHA 1NCJA 5MENA 43C9A 2V9TA 5EEYA 3MUY1 2QVTA 2XPYA 3EDJA 1TVDA 1C7SA 4UNUA 1P7QD 4WO4A 4WEBH 3LQAC 2YMXL 3FSVA 2VSMB 3D05A 2XVLA 6FABL 3IFNH 3NJNA 3WIHA 4U2YA 4GSUA 5LWYH 1MJJB 2X89A 2ITCA 3K7UA 5EBMB 1IBBA 2WLZA 1E6JH 1NCBL 1YY9D 3WLBB 5CP3A 3DV4A 3BAYA 3F8UB 1R3HB 3T0WA 4MQTB 3ZDWA 3EW3B 3GT6A 2VLRD 1VGEL 2VLJB 4IMLA 2VDMH 3VW3L 4BDVA 4HH9A 4X5PA 4N0UA 3S35X 1MJUH 3IETB 5I23A 4NNXA 4GRWE 2Z6FA 4JO3H 5I17B 3ABGA 5DJXA 2NW3A 1B0GA 4H88L 4KK6C 1E65A 3GC3A 1CE1H 1RZ8B 2W59A 3WDIA 4ZX3A 1ZA3A 3CH8A 1BMZA 5LBSA 1INEL 2YAHA 1YEDB 1J8SA 4JE0A 3S6CA 2VIRA 2OJ1A 3MV9E 1W6WA 1BAWA 3QZOA 4JRXB 5DHYB 1P84J 3FN0H 1XF3B 4QTHA 2IDUA 3GMQA 2WXPA 3PXLA 4W9IC 4PN6A 1R3JA 3GLAA 1HOEA 1FO0H 1NGPL 4AUJA 3G6JB 4MZ2A 3QG7H 1FYTA 4KX8A 4OD1H 1NUNB 2EKSA 3QJHA 2DMHA 4GG8A 2YAFA 3EDFA 3SPJA 2FEDC 4OVUA 3E1ZA 4GAGL 5IP4A 2BW4A 3BP7B 35C8H 3HC3L 4FNRA 3LN4A 3FB8A 5J6GB 5CINL 1CLOL 2WLLA 2VDOL 3O11A 4N6RB 2WVUA 5F9WC 3ARGD 2GCYA 3H85A 3APDA 3O6LH 2Z91B 3ROOA 1K4CA 1GRWA 2IQAA 1ZHLB 5IR1A 3QO0A 2AV1A 4MQ7A 4JJ5B 3C8KA 4JKKA 2XFGB 2VMFA 2UZPA 3MR9B 3V6FB 3VXSA 4P0DA 2M83A 4KJQD 1EHLH 2FGWH 4IRJB 1IM9D 4XZUA 4YUEH 3ECBA 2XPZA 4K5NA 4TTDD 3I02B 3GZKA 2FLMA 1OVZA 3P0VL 2YLKA 3POHA 1CTMA 1KN2L 2YFOA 4HBCL 3PL6A 3QZWA 1U3YA 2R9HC 2HMIC 1JPTL 4PRBB 1VADB 4K5PA 4EZMA 1JYVA 1AG0A 2ZSWB 1LD9A 2AANA 2HT2C 4JDVA 4OLXH 1JNHA 4AVIA 5LG6A 3BJ91 4I87A 1UJ3B 5L8LB 4JHAH 1L0XA 4N2LA 3SQOH 4YL4A 1XF2A 3VD3A 4YL9A 3FU7A 3MFGB 1P69B 2BNQA 5D55A 5F7YC 2DQIH 5IEHB 2XXCB 4NERA 4Q14A 3HZYA 1OSYA 2NZ9C 2ZICA 3L9YA 4Y8DC 4I9WE 2J55A 3PDOA 3LHPL 2EZ0C 3MOBL 1Z3RA 1GZQB 5DR5L 1IE5A 2DM4A 3IVKB 2ITFA 5EEUA 1QPKA 3KPTA 1SF3A 2X4RA 2E56A 3KLDA 3ZKXB 4ZFFA 2P24A 2UWEF 5DZPA 3ZZQA 1DVFC 1N0XL 4P48A 4TVPL 2HG5B 5EBWB 1EZUA 2V7NB 4IOFC 1BVNT 3SGJA 4DP4X 5IFJB 1I85C 2B59A 2LAAA 4JY4B 5GRYA 1U8IA 4CMHB 3HE6C 4BKSC 5DQJB 1DJHA 1K9TA 3LIZH 3RWHB 1CZ8H 2XWJB 2WZ0A 5I1GH 5AW0B 3G5VA 3HAEG 4XP9L 3D08A 4AT6A 5D2NA 2YSSB 4X5LA 4AMKH 4OZIA 5I1KH 2LU3A 4B27A 3JWDH 2R4SH 1AQMA 3IF1A 3BHBB 1HILA 5ESVA 1A4JB 3GMRB 1C5DB 5JXED 1PCSA 3AS3A 1U93A 3P3SA 4I0PD 4B97A 3F3HA 4OH2A 4DQAA 2AW2A 2CIIB 5E8OB 2DJ4A 3QXAA 4PB9L 4OQTA 4ETQB 4Q2ZB 4LRIC 1NKRA 1YDPA 2NY2D 2EYRA 3OKEB 5FO9A 2C3GA 4BA8A 2VDKH 1IGYB 3QEUB 2CZNA 1FL3A 5DQ9A 3K1KC 3JV4A 2D9CA 4Z7QF 5L0QC 3R7RA 3ATBA 2JSFA 4F5CE 5G55A 3JWOL 4R96B 4IBTA 4PJEF 3UAFA 1AS8A 1SUJA 2D7TL 4LL1A 5T1DL 2H32H 3CSBA 1IC5L 4KKRA 2DIBA 1FJ1B 4JHWH 1DBBL 3QIUC 2ATPA 3SPVB 1K3ZA 5EFIB 2NLJB 5EBMA 3IWUA 3WLBA 4BWTA 5LN4A 2X2HA 1R3HA 1QBLL 1OHZA 2VLJA 4FRWA 1FRGL 4FFZA 3BP6B 1J86A 3US9A 4KXCA 2PW1B 7PCYA 3WNIA 5BRZB 4XPFH 4CAGA 5CF3A 4YLCA 1EJ6A 4FX5A 5I17A 2QVKA 2GUYA 3MBED 3WJMB 1A6AB 3W9EB 4JPIB 4JZNB 4AENB 1PCXA 2VISB 4XX1G 5GRJL 1YEDA 4QAWA 1LEIB 4LEEA 3GSNH 4Z7OB 5I1LB 4LMQI 3C8DA 1FGVL 1ZK9A 4GSRA 4JRXA 4WRLA 5LCVL 4UTBA 1YUHB 1XF3A 4NUMA 3P30H 3F12B 3OJ2C 2YQGA 4GO9A 1FE8H 3D85D 1NOLA 3W81A 5CD5D 5I9QC 1WZLA 1AGEB 4RSVA 3RY6C 2XN9E 1XGQB 2HN7B 3U9PH 5AZUA 1HU8A 2X09A 2XY2A 3VWKC 3IMSA 1TQUA 1T0MA 2V4LA 3TN0C 1O7DC 4L4VD 4XBMA 2XXFA 1DQDL 3BP7A 1EO8H 3O9WD 4IBWA 1NIFA 1PZDA 3FSWA 1KEML 3KEHA 3LYRA 2AJSH 4AM0Q 2OMZB 2JKIS 2VWEE 5EIIB 3IKCB 4WI8A 5J6GA 3DURB 2JJSC 4N6RA 5J3HD 4IIQB 3ARED 3C2SA 3B5GA 3BX7C 2F19L 2Z91A 1KENL 2ERJB 2JKTM 2CNZA 3SBPA 3V0WH 3IDGA 1FPTL 3CZKA 3P4OA 1CICD 2AXFB 3QXUA 4YDKH 2EC9T 5T5NF 3MR9A 4J3OG 3V6FA 4BYHA 5KSBF 3L1FA 4NHCH 5IV2B 3FFCE 4D9QD 4ZMOA 4IRJA 4B9GA 1QLEL 2R7EA 3I02A 3UYPB 2ICES 4J28A 5D7SH 3GINA 2AK4E 1I8IB 2CJ3A 4M5YH 4XE0A 5CLWA 1VADA 2KZ1B 4WFFD 3OR7B 2R27A 7CGTA 2CJUH 2ZSWA 3B2XA 1SVBA 4WV1C 2E6JA 1UJ3A 3BKML 5LXGL 5DEZA 1FYTE 1JZ8A 3D0LB 4MJ4A 1NIEA 2FNBA 3LD8B 4D3CH 5FLUA 1DVTA 4HQQL 3SBRA 4KKNA 5H37H 2Q2EB 3G5XA 1GZQA 3OB0H 1O9ZA 2F5AL 4NPJA 2P8PB 2PMZA 3BFQG 3V4VL 3GRWL 4XPTL 4N0CC 2HG5A 5EBWA 2V7NA 4U1NB 3S37L 2ZUXA 4Q56A 5IFJA 2IBBA 2PXYB 2LU7A 3QP3A 4H20H 3QDJD 2J1WA 4R26L 3WDJA 5T3XE 4P2CG 5E2UH 4GXUM 2QHLA 2DV6A 4DW2H 4ZMLA 2VR4A 3QIBC 3RWHA 1F6LL 5ELIA 3VXSE 2XWJA 5HGBB 5LGYA 2H9GA 4NQEA 2VXTL 4PTUB 3VD2A 2RALA 4KK9C 1WC7B 5IFHL 2MPAH 3LS5L 1RULL 2G5BB 3ME0B 4DO6A 5C0AD 4NWUL 1LO5B 2F18A 4Y5XC 1RIUL 1G7PB 3BHBA 2A77H 3GMRA 4R0LB 3LZNA 1T5XB 5DO8A 1C5DA 1IKOP 3TNMB 3QDAA 1SEQH 1BQKA 2DMKA 3TBTA 4PRNB 5EF0A 2CIIA 1G84A 4ETQA 4HK0B 4Q2ZA 2J44A 4BCYA 1SLXA 3OKEA 4CC4C 3QDMB 4GRLC 5DS2A 3BWAB 3QEUA 3FFDB 4V1DD 4LRNH 3UH8A 2YS4A 5F6HI 4YHLH 2ZWLT 4P9HH 5CJQH 1HNGA 5F7MC 1EAQA 2VW4A 1S7RB 4R96A 4BXSV 4KUZL 2OW6A 5JHDB 3LRKA 1E30A 5CGYD 1RURL 3ECUA 1EFXD 3NACL 2BO0A 2X87A 1FJ1A 1I7RB 3EADA 3KXFD 5EU6D 3N1FC 3SDYL 3SPVA 3A6CL 5EFIA 2NLJA 3MGTB 1P84K 4UQIM 1CPUA 1I7ZB 2J1KA 5AVRB 2O1AA 4M3HA 5EEVA 1EDQA 3O8XB 1AQDB 3IDUA 2P48B 3BP6A 1A6UL 1UUSA 1VB9A 3DIDA 3Q8BA 5FGSA 1JPSH 3UPAA 5B39G 4Q6KA 4UT7H 4O58H 5BRZA 4OZIE 4RMQA 3TJHD 1B0RB 1NEUA 4A37A 4CC1A 2XYBA 2YKLH 4ATWA 5D4QA 5HSFA 1NCUA 1VPOH 2EADA 4LSTL 3TH3T 1CDIA 2K9FB 4FCHA 3WJMA 3W9EA 3WUZA 4JPIA 4JZNA 3DTXB 2VISA 4LK4A 2LTQC 4TQIA 4AENA 2X4SB 1BM7A 1LEIA 3L4WA 4M7ZB 5D93B 2VC2H 4GSQA 1B0IA 1YUHA 5KYXB 5EUOF 1FNFA 4QXGL 3DTUB 3KPQB 2R2BA 3S2CA 2ORBL 1MFCH 4EI6B 2L7JA 1QACA 4LLWB 1AGEA 4XC3L 5E00B 5JA9A 2Y1AA 4PGJA 4CADB 3GZOA 3SGDH 1XGQA 1I7TA 2HN7A 4TUKH 3VVVA 4Y5YB 3WTVA 4KXDA 1DJYA 3H9SB 4NZTL 3KPRB 1R6VA 1N18A 1Y7VA 4I5BB 4LCYA 2X41A 5E1QA 3PL6C 3PP3K 3BP4B 3VAEA 2XQYK 3KLAB 4ZX4A 4E9VA 2F58H 3OKNB 2OMZA 3CC5B 1ZLWH 5TE6H 4L5FE 3AROA 3I6KB 4QR7A 1G1YA 3CVHB 1CDYA 5EIIA 1OTSC 3IKCA 3E6HB 3DURA 1TMQA 3T0EE 4IIQA 2Q7YB 3ZMRA 2JIXB 3UZVB 2K6YA 5IM7B 2ZCHL 3HG2A 1V3LA 4IKLA 5LG1A 2RAMA 1Q9OB 1MAML 4YSUA 2EVGA 2X3CA 2AXFA 3TT1L 3CFCL 3VXPB 2VKWA 3PV7A 1N9PA 1H8LA 4N0YL 1LJMA 4RA3A 1UYWH 3UBXG 5IV2A 1CK0L 4JRXE 2RB8A 3N40P 3UYPA 1RUKH 4ODXB 1WV7T 5IMOB 2GY5A 1I8IA 3WEBA 4DN4H 3D7PA 3CVIH 4BIKA 3QJVB 1Z66A 3OR7A 4AITA 2VR3A 4EUPB 1B2YA 1J5OL 2NNAB 2JB5L 1MCWM 1AZRA 3EJCA 4HUKB 3G6JE 3QNXA 5F1IB 2EYSB 3BVNB 3O3EA 3D0LA 3E80A 2ZUVA 1EJOL 2QGCA 3O2WH 5C0CA 5IMKB 2UXVA 2HT4C 5DD1H 1KLGB 5GZOD 1S5HA 1W72A 1Z9SB 3HOGA 5T1KD 3WCYA 3WUWG 4NRXB 2YPVH 4JREC 1YG9A 5FYJE 3U4AA 3ZE0F 2KBGA 4B0MB 1IRAY 4F2FA 4D0DB 5L6YL 1T03L 2E74C 1HCYA 2P8PA 3IDYC 3OKMA 1AZBA 3SE3A 2CIKB 1AQ8A 2C3HA 4U1NA 1BEYL 5H8DA 4AQEB 5HYJA 3IMRA 2PXYA 5EPMB 4NNPH 2ZWZA 1ZV5A 1GVIA 1K8IB 4I9XA 1YNKH 1RHHB 2DEWX 3LXAA 2YD2A 3QZBA 5HGBA 4OFDA 3O2VL 4HEME 4QMEA 4PTUA 4X5QA 5AB2A 2WP3O 2VO5A 1WC7A 2E27L 3ME0A 1I31A 3X1FA 4QD2E 1QBMH 3K2KA 4N2MA 5FHBL 5T1MB 2NYYC 4WZ9A 4HOZA 12E8L 1KCRL 1LO5A 3LMJL 3MZGB 1FF5A 2XWDA 1VEMA 4G6ML 4ZO7A 1ZANH 4R0LA 1T5XA 1CXFA 3TNMA 3T4AB 1HK6A 4P5MB 3UBGA 3BD4A 5FUOL 1BQLL 2QL1A 2YWYA 4PRNA 2YMXH 3QVAA 4JG0H 3RKPA 6FABH 4J1UB 4HK0A 5K1JA 2KYIA 1OP3K 2C4XA 3QDMA 3C5SB 3BWAA 4KDTA 3FFDA 2ICEB 2NDFA 1TYEB 2AJXL 1WAPA 4J8QA 4GQPH 1IGTB 5D71H 1VGEH 1S7RA 3CX2A 4BFBD 2EUWA 3NK4A 2WNGA 5JHDA 4QLWA 4WEEA 3UTTD 2I69A 3U48A 4E9XA 5B7FA 4XP5L 2A4CA 3EJZC 1Y0LA 1BA9A 1I7RA 1D6VL 3J2PA 2VO8A 1PNCA 3VXOB 4G71B 1YECL 4GG6F 3HE7D 3MGTA 4H88H 3C60C 1E2WA 4U33A 1PG7L 1I7ZA 4UV7L 4K3JL 1KLFB 3FT4B 3QJFB 2NY4B 1N8ZB 1DSWA 4JRWA 1HDMA 5HI5D 2UXFA 5GRXG 4TOYL 3OWEA 1B0RA 4FKHA 4MAYA 2J8UE 3EOYG 2K45A 4BZYA 4BWUA 4CKVX 5KTEL 3IGLA 2FYVA 3ZT6A 4Y9GA 1S7QB 1NGPH 4YHOH 5HVHC 5ESQB 4PMEA 3ESUF 3DTXA 3O3UN 4D8OA 4ZYKB 4P3WA 1E40A 2EILB 4KQ4L 3ILPB 1X7QB 1KCUL 5KYXA 3KW8A 1ZLUH 2EIMB 2G2NA 4PVLA 3GTTA 1RQ5A 3GKWL 1UTDA 3HC3H 3D4ZA 4PGDB 3ZYOA 4WDIB 4YHYC 1QABA 5AKVA 5E00A 4CADA 3ESMA 4K7PL 5CINH 1CLOH 2VDOH 4Y5YA 1QPXA 1ZIBA 4HIEB 4GAJL 4HCFA 1CR9H 1JGEB 5KYYB 5AW3B 3KPRA 4HCGA 1OT1A 3B7TA 4I5BA 2VN4A 5T5FH 1B2WL 3MV11 3BESR 5H2BB 4R7DA 3BP4A 4N0FB 3KLAA 3OKNA 3CC5A 4JMXA 2WJ5A 3GRGA 3DHMA 3FW6A 3PQYA 4LSQL 2LU5A 3CVHA 4P99A 4F8QA 3E6HA 1LYQA 1H15B 4AW4A 3FS9A 5IQLA 3P0VH 1F8TL 2JIXA 4XAWL 5BZZA 1OM3H 4U4IA 3U7WH 3NFNB 2KT6A 4M62H 4P46C 5GGUB 1U8NB 1Q9OA 1JFHA 2WLIB 4ANKA 3D33A 3U30B 2YUWA 3VXPA 8PAZA 3VA6A 5D7IB 1XDTT 2K6WA 4OZFH 1IC7L 2WWMC 4KO6A 4AEHH 5HVGB 2DMCA 3PWLB 4HU8A 3TESA 4AQ8A 1NC2B 3CFUA 3EH2A 4FJ6A 4P2RB 2HPTA 4Z7OE 5DHVB 2OL3B 3ULVE 4ODXA 1UJTA 4OCRL 3SGEI 4EE2A 2NR6D 2JCWA 1U91A 3IS1X 5AL8A 3NUKA 3V6ZB 4EUPA 1QWUA 1QKZH 4PFEA 2NNAA 3FNKA 4TLSA 5F1IA 2XDHA 5D1QD 1N64L 1OK0A 3X13B 4TVPH 1R5IB 1VDGA 3P9MA 3AXIA 2YXVA 3KYKL 4X7EC 4HBQA 4QT5B 1Z9SA 1JHLL 2NCEA 4NRXA 1H9DA 1HHJB 3VRIB 2HWZH 4HJ1A 2OK0L 4Q97A 3WO4B 2PR9A 3DSFL 3HLAA 4KDWA 3VFOB 4BWWA 4D0DA 1RUAH 4BQCA 1W0WB 4XP9H 5F7AA 4XNAA 1EA9C 2CIKA 4UB0H 3QUXB 4X6CF 2ODIA 2O5YH 1T2JA 2BRQA 4HWBA 4KNTA 1M7XA 4FFYL 5DWUH 4AQEA 1LO4L 1BWWA 5J0BA 4UDTB 2BVEA 4Y4HB 5G5DB 4XNQA 1JMXA 2Y23A 3QDJE 1HEJC 3KGSA 1RHHA 3KCPB 3NAAL 5C0JB 1ZVSB 1J0JA 2RH0A 4PB9H 5F8QC 3VD7A 1KPRB 2A6KB 2WYIA 2ISDA 3CSPA 5GS2D 3STBA 4JFEE 3APNA 4PJAF 1M4KA 4YVUA 2GIMA 2HTKC 3OKLB 4FQXD 1KZYA 3T4AA 2GFBA 4P5MA 4AYFB 3A3YB 3JWOH 4DCQB 3FUMA 4AQ1B 2NYKA 4YOKA 2D7TH 1OTTD 1F1GA 4H8VA 4O02B 4J1UA 1DBBH 1PLCA 2HAZA 1UCTA 3C5SA 1JS4A 2YUZA 4M93C 4AXWA 2WANA 2BINA 2GJ6D 4X7FC 1YEJL 1UOLA 1IB5A 1WWBX 1IGTA 4UOJA 2ZSVB 3HG1A 3TF7C 3STLB 4XBEL 2GC7C 2VUOA 1S9VB 3M45A 3F64A 3W9DB 1KCKA 1WFIA 1B6UA 3EKCA 5KUKA 2PYED 4PRPB 3VXOA 3K2UL 3VSUA 3SIKA 5KEZA 5H4ZA 2JELH 1A6TB 4FXKB 3H2QA 4NZRL 1KGXA 2CCWA 1KLFA 2VQ4A 3QJFA 3RTQC 1N8ZA 4PJBF 1WZ1L 1FGVH 1LDPH 5LCVH 1QMUA 2NXYB 2NY1D 3HZVB 4X7DC 1BZQK 3M1OA 2CKBL 4GIAA 3QXWA 1JZ2A 1S7QA 4NNYB 1WCQA 3TCLB 1E9OA 4J4PA 4ZYKA 1AC0A 4FLOA 5JMOC 4AL8H 2RFXA 3FCBA 3ILPA 3K0YA 1K6QL 1X7QA 5GS0D 3GSVB 1QO3B 2AF2A 4H1LG 4FERA 3QDME 4KH9A 4L2YA 4WI7A 5AB1A 3ZDXB 4V11A 1DQDH 4WSGA 1ETB1 1HL9A 1I3GH 3RJOA 4LCWD 4XMUA 3DHPA 2BS9A 4PGDA 1KEMH 4WDIA 4X7TB 2CO7B 2Z9TA 3PE9A 4JM2B 3QUZC 1HH9A 4WJG3 1RIHL 2JJWA 5E5UB 5JHDE 4Z7VB 3PPEA 4AYMC 1MVYA 5BZWB 1U95A 1JGEA 5EN2B 5KYYA 1HIML 1KENH 1DL7L 2YC1B 1FPTH 5DF0A 5IY5B 3TOPA 1KIPB 3ARFA 2LAGB 3FCTB 4XP4L 3VD0A 5I19L 3L3HB 2GEQA 2X3AA 4WEUD 2UZXB 1CVSC 1SF5A 4N0FA 3REVB 5GRVK 3IRPX 2GSGB 4F2ME 3W11C 4N2GA 1GS8A 3V4PB 1SPDA 1H15A 1QLEH 4LLDB 1KTKE 3H0TB 4ELMB 4IRSB 2A9ML 4FMFA 1WFOA 3TZVB 3NFNA 3KWWB 2A74C 1JWMA 5GGUA 4HHGA 2YA2A 2WLIA 1GYUA 5IF0B 5FUCC 2ATAA 4N2BA 3HR5A 5D7IA 2V5SA 5AAMC 2J71A 4A39A 1D5RA 4JGUA 3PWLA 3NJFA 4PW4A 3ZIYA 1NC2A 4P2RA 4K2UL 5DHVA 4NFDA 2AJUL 2OL3A 1NGZB 3L2MA 3Q5OA 5AVVB 4EDXB 2BVTA 3FTSA 1SBSH 4Z9KB 1CN4A 3H56A 4HJIA 3V6ZA 4PJIF 5DRXB 3QQ9C 2F5AH 2GABA 2VDMB 1YC7A 3V4VH 4Z3JA 3RUGB 3GRWH 1JGLH 4XMKL 4XPTH 3BPNC 4XMZA 3X13A 4KROB 1U0QA 1R5IA 5DFVC 3H9SE 2ZWSA 4PJDF 3S37H 1T20B 3KPRE 4X99B 2G0KA 2WXFA 4QT5A 4R26H 1CJYA 1XIWD 5HPMB 1GTFA 1UVQB 4MSWB 5E7BA 1FNSL 5E8PB 1LWRA 1HHJA 2J88L 3N9GL 3VRIA 5FYKH 5F88B 3VFOA 1IKNA 2HZHA 1Z3GL 3V0VB 4YSSA 2VXTH 1W0WA 2LR4A 3NPSB 5IFHH 4DEPB 3LS5H 4PCKA 1RULH 4U3SB 9PCYA 2VE6B 2NMSA 4NWUH 4IBYA 4W9DC 2WBJB 2CBMA 1AVAA 1H8OA 1FO0B 3W3BA 1PG7W 1RIUH 1ZVHA 4UDTA 5E6ID 4ENZA 5LNGA 3IEAA 5ABZA 3OLDA 1WT5A 1UB6B 2FQGA 2HVKB 5G5DA 4OZHB 5FR3A 1A14H 4LLVA 2XA8L 3KCPA 4P05A 4ZT1A 3PJLA 1Z32X 1QSEA 1WFMA 4QNPF 1SN2A 3GPSA 4RZCB 5C0JA 2Y3NA 1ZVSA 2VAAA 3OLGA 2J73A 3A21A 1KPRA 2A6KA 2VB5A 4WAFA 1NMCB 1J9QA 3TA3C 2HVJB 5D70L 3Q1SL 2VOTA 3JYBA 1EFQA 4TLKA 4U3CA 3OKLA 1HCVA 1JPST 4H4NA 4N22A 4AYFA 1M7UA 5JHLA 4NDMB 4DCQA 2YLHA 4AQ1A 3BN9C 1KELH 1RURH 5DU7A 5IMMB 3NACH 4FLRA 1V7NL 1ACZA 3DPBA 5AG9A 3SDYH 1E5UI 5CN1A 2ZWYA 3A6CH 2ZNXA 2Q6WB 4UILL 3VXMB 3RAJH 1TNNA 2ENJA 4U0RB 1PAMA 4BZ1L 1ACCA 3GSQB 2ZSVA 5GS3A 3CK0L 1UZ6E 2FE0A 4PRHD 3BWUF 1MCCA 1BZOA 4PJHF 1GAFL 1S9VA 3W9DA 4YSTA 2G9KA 2NY6C 1BW8A 3NIGF 4PRPA 5D8JL 5CJBA 3RDTD 4H13C 2CGZA 4LLAA 3RURA 2BP0B 3D2UB 4MA1B 4FXKA 3ZRFC 2B3RA 3ZRCC 2BIIA 3VWJB 1IEBB 4Y9EA 2FWUA 3WFHB 3SO5A 1KGYE 3S5LG 3CLEL 1FFPB 4GSDL 4JFSA 4MCNA 3VU2A 3HZVA 5EB9A 2F0CA 2ORBH 4PWGA 2QV2A 3V9FA 4YFEA 1RU9L 4XC3H 1W80A 5LXVA 2DLGA 4NNYA 3TCLA 2SODB 1KCLA 2I25N 5D1ZB 2W9LA 5HYSG 2AHIA 2AERT 2VGLM 3HZKB 4NQCD 5F7NC 5C0ND 1TSHA 4OSUL 4HKBB 4NZTH 3H9HB 1QO3A 1HYSD 2IV8A 1T89A 5GGQL 2GITB 2BVQB 2ZT9C 1YA5A 1DLFL 3C5ZA 5I28A 2COQA 2DLIA 2H8PB 4X7TA 2CO7A 3ZSSA 4KKQA 2GVYA 1SXBA 4JM2A 1H3PL 4Z7VA 5GSVA 5EN2A 2ZCHH 5E9DD 3ATAA 3AXHA 3SCMD 2FCBA 1XO8A 1KIPA 3FCTA 2BS71 3L3HA 2UZXA 5BZDB 3S35L 2WO4A 3QQXA 2MTPA 3REVA 2A6DA 1PS3A 2GSGA 3GXFA 2QKIC 2WYHA 4N0YH 1F3DJ 2XZAL 4LU5H 4KBPA 1MH5B 4M6NH 4MJ2A 4LLDA 3V4PA 5BS0D 2VDKB 4ELMA 3H0TA 2Z34A 1VJSA 4IRSA 3TZVA 5JYLA 3QYNA 3KWWA 1MFAH 4S2SB 5KVEH 1XSJA 4G6FB 3DV6A 2FK9A 5IF0A 4FMVA 2GJJA 4EAEA 3NCWA 2LV4A 2JB5H 1R24B 2H32B 5HHOB 4IHBA 3OSVA 3SODB 2ZOLB 4N0RA 2ZWNA 2ITDB 2GIXA 3REWB 3EFDL 3UAJC 1NGZA 1KFAH 3OF6D 1S8DB 3SE9L 4EDXA 4IGBB 4HJTA 1PX4A 5IJDC 3ARBB 5DRXA 1J9RA 1CIUA 4RDQG 2WM0A 4AVJA 1GZPB 3RUGA 4K94H 2ADGA 3HG5A 2VR7A 2M2DA 1Z0MA 1OHQA 4RZKA 1A3QA 3F7PC 4ZFOB 1BEYH 4X99A 3A23A 4F9PA 1MCBA 5AW1B 1EQWA 4DO5A 2E9GA 3GSXB 3SE8L 5HPMA 1UVQA 1KF9B 4MSWA 3N1MC 4J3XA 1GZHA 4RVBA 5GGVY 5B1JA 4HUUB 5F88A 1L0PA 3GSNB 3WBDA 1KGCE 1KXVA 2MQCA 3O2VH 4KV5E 3V0VA 1BWMA 3HKZA 3S0PA 1WO2A 4U3SA 4WI5A 3L5HA 2CA4A 2VE6A 4OFKA 1MCEA 3E3QE 4LKXB 5FHBH 4DF9A 4F58L 1LMKA 12E8H 1KCRH 1MCLA 1MXDA 2N3JA 2WBJA 2QZQA 1EH9A 2WVTA 1FO0A 2PCFA 3GIVB 4NQDD 3AT0A 4G6MH 4NX0A 4MJJA 2XACC 4RSYA 1LDSA 1UB6A 2HVKA 3K46A 4YBLC 4OZHA 4XN5A 5FUOH 1BQLH 3CU1A 3ABMB 5I76B 5I71C 1K85A 3CLFL 1KT2B 2JMRA 1EAPB 4FFWD 4P4KD 4RZCA 3PNWA 4P2RE 2PTTB 3QCVL 4DP2X 3BO8A 2E7DA 3H4FA 5CKAA 3BAXA 3BLKA 4HKJB 3FU6A 1L3NA 2ZYIA 4DFIA 5T3ZD 2HVJA 4M8RA 1S9YB 2VERA 4X6FB 1F6AB 3RIFF 4ZXBC 2B39A 1EXHA 1HFUA 2AJXH 3CFNA 4GBXB 3DX2A 4J2QA 4ZW3A 4NDMA 3PAUA 5ENWB 5FYKU 4P23D 3K5RA 1XGPB 2D7MA 2XVKA 3JZ7A 5IMMA 3B9VA 4XP5H 4XNDA 3TBVB 4OF0A 4WGVB 4F7KA 1D6VH 2ED6A 2ENPA 1YECH 5I0YA 2PNDA 1AOZA 2W8CA 3VXMA 1BF2A 1NJ9B 4NUQA 4UV7H 4K3JH 4PD4J 2JE8A 1AO7B 3O3DB 4UV4L 5TK2A 1U42A 5DMIH 3VMNA 4WGKA 2CAKA 4JFHE 4OZGB 4J5VA 4WKZB 3CDCA 3APMA 3ETSA 4TOYH 3ISWA 3CHSA 2QQKL 1PLAA 2KDGA 3E6FB 1MPAH 3T2NH 5AB0A 3FFOA 4FN0A 2BP0A 1WHPA 4DP7X 3D2UA 1VCAA 4U6XB 3TURA 3OMAB 4E36A 3VWJA 1I8LA 2ZUYA 4KQ4H 1OGAB 4YXLL 3WFHA 2HJLB 4UQCA 3RNQB 1FFPA 2GI0A 1I9JH 3FT0A 5FA4B 5KS9A 4PBWD 3ARFC 3Q9QA 1R3LB 4HXBH 4Y16D 4YK4C 4LHUG 4PJXA 3L1OL 4K7PH 5E2TL 3VYOA 2QADC 1F11B 4X6BB 3HZKA 4NAJA 4EXPX 1RP8A 3RLSA 4I7ZC 1RZGB 2BHZA 4HKBA 1YPZE 4Y4KC 5EULV 3H9HA 3LH8A 1QAWA 3ARDB 3GMMB 4XC1L 5CSZA 1B2WH 3U2IA 1LMIA 3C2AL 3LIZA 3OLIA 2BVQA 4JB9L 4PRIB 4TNWF 3UAAA 1E7UA 2AQ3A 2ZKHH 1FI8C 4E9WA 3KDMB 1PU0A 3TU6A 2H8PA 3BPLC 4LOUC 3IFLL 4LSQH 4PJ8D 3G3LA 2L7UA 3NCMA 4F8OA 4ERSL 1U41A 2Z8RA 2BSRB 2BZCA 1F8TH 3DLQR 4XAWH 1KC5L 2CDGB 2UY6B 2Y5TB 1XGZA 2I60L 1R33A 4OUUB 2AI0L 1X4ZA 1M2OA 4PRPE 3FSAA 1ETJA 3U7AA 2JQMA 5INCA 2BDNL 4OJAA 3OC8A 5T33L 5BZDA 5C0BB 1MHEB 4ADIA 1CB4A 2R29A 2B4CL 2J43A 4ZAKC 5GPRA 2ADYA 5AOMA 3CFJB 1MJ7L 3LJ3A 5E4IA 3LQZB 4ZUVA 3ARGB 3UCQA 4DAGL 2PPFA 4LESA 4AIZB 3T8MA 4LVNC 1WZAA 1N68A 4QJ5B 1R24A 3D87B 4E5XB 2H32A 1E8XA 1N64H 4J3OD 5HHOA 2ZOLA 2NZIA 2RGSA 4TRPL 1QFWM 2ITDA 3REWA 4FQPA 3KYKH 4OB5H 5G2NA 3SJVB 2F68X 3BVDB 1JHLH 3ZDXE 5GISL 4IGBA 4H0HB 3UTSB 3ETBF 3ARBA 2OK0H 3A0OA 2F5BL 1WAAF 3DSFH 4PS3A 3NFPA 3ESVF 3FT3B 1GZPA 4MDJA 3ZUNC 2OA9A 4MZIA 1RERA 2YAPA 4JRYB 3VI4F 4MDIB 4ZFOA 4FFYH 3KJ4C 2P4AB 3FPYA 3QHTC 3GSXA 3VQLA 4YE0A 2DDQL 4JM0A 1M7IB 2VZVA 5F6IB 1DQML 4JEGB 4F8TA 3NH7H 2WC7A 1EZVY 1R0AL 3GSNA 3AGVA 1IGFL 1YHPA 2VC2B 3O4OC 1Q0YL 2OFQA 4IRZL 1RV6X 2HJKB 1ZD6A 4ELME 4NJ9H 3ABLB 4OLEA 2CHXA 3P0YH 1SHMA 1YN7B 3FUKA 4LKXA 2H3NB 3B7UX 3GIVA 4OCNC 4I1RA 2FATL 4ACPA 5AZ2L 1KYFA 4ALAH 3V52L 3D3VB 3QPKA 4U1JA 1BZDA 2XETA 1AIZA 3WFEL 2IWFA 2X28A 3D12B 3U4BH 1EAPA 3MTRA 2HFEB 2PTTA 1K2DB 1WUNT 1CQYA 1UH2A 4HKJA 1AACA 3D18A 3DGCR 1S9YA 1XF4B 4X6FA 1F6AA 4KTEL 3MJ8B 4WUKH 5DVPA 4ILDA 3SKNB 5BVJB 1YEJH 2DLEA 2OMBA 3N1QC 2DQJL 3BP5B 4GBXA 5JW3L 3RUGE 1ORQB 3B2MA 1UQSB 3FCGA 3MRNB 4XBEH 5ENWA 1MFVA 3BT0A 1TCMA 4GT0A 2W0KA 3TBVA 4P4RB 3TTSA 4F8PA 4GXFA 2WLYA 1SBBA 5TF1L 3K2UH 4M1CC 4JPVL 4KJWD 4N9GA 5C09A 1H8SA 3L3OC 5CLXA 1NJ9A 4RGNB 3F6IA 2AQ1A 3HNTH 4NZRH 1AO7A 3CFEB 3O3DA 3NPZB 1YEWA 1BAGA 1WZ1H 4U31A 5BV7H 2D4FA 4XMLL 1HXMB 4OZGA 4PY7B 1P7QA 3MRMB 1IQDB 1TQVA 4WKZA 5D2LB 5SV3A 4DKFL 2F08A 2FT7A 1IM3D 1R19A 1OXYA 2CKBH 2MEJB 3E6FA 4GXVL 4GIOA 1AXSB 4H8WC 4UOW0 1UWGL 3HFML 4U6XA 4XB3A 2W0LA 1MNUH 4FNQA 3RHWF 1I8UA 1EPFA 1K6QH 2VLRA 2XX0A 2HJLA 1BJ8A 1ZV9A 5F2FA 3RNQA 3DMMC 3IU4L 5FA4A 1CTOA 4N2CA 1R3LA 3B9EA 3V8OA 1I1CA 1A7QL 1SY6H 2Z1PA 2DS4A 2GJRA 5JHMA 3T8XB 1RIHH 1F11A 4X6BA 1KBKA 1IFGA 2CBOA 1P0SE 3SY6A 1HIMH 4OGZA 4YSRA 4NQCE 3MRJB 3ARDA 5I19H 3DJ9A 2C34A 4WSJA 4KZDL 3KDMA 2R69H 2VDLL 1OK8A 3TNNB 1OAXH 1E4JA 1MJ8H 2BSRA 2IDSA 2HUEA 3LS4L 2BSSB 3MX0B 3K71B 2A9MH 2YK1L 2CDGA 2UY6A 2Y5TA 5D1XD 4F1ZA 1TVBB 3NIFB 4OUUA 3RWGB 4FD0A 4NPKA 1TTUA 4M4PA 5E9DE 1MREL 2QR0B 2VH5L 4L4VB 3HAEH 4Y4FC 5CHNB 5C0BA 1FZOA 2B1AL 2YRBA 4HH8A 3HI6H 5PAZA 4X9HA 2AJUH 3CFJA 2ZYSA 3ARGA 5I75B 1EV2E 1SEBB 9CGTA 2EJ1A 4WHYG 4U1GB 1O6VA 1IEAA 2E0PA 4E5XA 2B1HL 3RI5K 3B9KC 2SEBA 2FEDD 3NOIA 1V7ML 1HKLH 4W4OA 1IBDA 3SJVA 3LPOA 4KRPC 3US0A 4M5ZH 3IMTA 3U1PA 4M5SA 3BN3B 4P57B 4J23A 3TJEL 3UTSA 2J88H 3ZPDA 1D9KD 3N9GH 2DKMA 4M9OA 4N87A 2FWLB 1Z3GH 3FT3A 2B16A 2X6CA 3NZSA 2B3IA 1ESOA 1GMIA 4HMDA 3BZ4B 4JRYA 4GS7C 2NQCA 4MDIA 2VCOA 4MJHA 2IQ9L 5D7JD 3MA9L 3MV7B 4MQXD 1ZSHA 3LY6A 1M3JA 1M7IA 5L2KD 1V27A 1T2QH 4B7IA 1UHVA 1UD3A 2DM7A 5I1JL 2XA8H 1GPOL 5IQNA 2B2XL 4X8XA 3SDCC 2HJKA 1NLBL 1YN7A 1RZIA 5HDBB 2H3NA 4BE5A 4OFYD 3EJUA 4PR5B 5IB3B 4OGAD 4X98B 3BDYL 3DGGB 3EBIA 3DDFA 4OKVA 2VDOB 4M00A 3IXAB 3D3VA 3QQNA 2FSEB 5C6PB 2ZPKL 4UQDA 3MRPB 3D4YA 2R1XB 5HHOE 4FFTA 3TX4A 2HFEA 2R56H 3VSTA 1Z9LA 1BXAA 1K2DA 3GB7B 1J1OL 5I1HL 1A9VA 2K8MA 2ZXEB 2X6VA 4I89A 1XF4A 1X3DA 3SKNA 1DQLL 3MJ8A 5EC1B 5BW7A 1A65A 4P5RA 4IJ3C 3BP5A 1AKJB 4BZ1H 3NG5A 2CO3A 3AG2B 3MUUA 5AW2B 1OIOA 2PKDA 3X11B 1I8LC 1ORQA 3CK0H 1UQSA 1QW8A 3MRNA 5JXEA 2HFFB 2W9DH 3DJSA 5MI0C 2CJSA 4NC1C 3WEOA 3AABA 1F86A 4P4RA 1S5IL 3LEVL 1BQ5A 4B9JA 2OP4L 4OFPA 4OZFB 4F15B 4PP1C 3A4FA 3AY2A 4KMTH 3S5ZA 3VM7A 1WE5A 4KKAC 4QKTA 2DQ6A 2JV6A 4Y2OB 5L88L 3CFEA 3U7YH 1CFNB 3KBFA 1NZRA 4TQEL 4BKLB 3OKOB 3CLEH 1HXMA 2APFA 4FTVB 4GSDH 4JKPL 5ALBL 5AALA 1IQDA 5D2LA 4W9KC 4PRIE 3RVVC 3MC0A 4AQOA 2H7WA 2R2CA 4J3OH 1UXMA 4ODSL 3FCUB 1T3FA 1RU9H 4FDWA 1AXSA 4D0BA 4MA7L 5KYWB 1W8NA 3K8MA 2KQMA 3RGVC 4B9YA 1K72A 4G8EB 2VQTA 2YSTA 3Q01A 4OSUH 2OQJB 2G75B 4XR8C 4B41A 1T4KB 1UKTA 3MYJA 1W16A 4L9DA 2AJVL 3TH4T 1E90A 2NRDA 2IANB 4LVHC 4S0HA 4Q6IC 4E68A 2YPVA 4NOBA 4HIJB 3GGWA 4AIOA 1PY0A 2XC8A 4JFTA 4BJLA 3OVUB 1DVYA 2VWEC 2VXVL 2O5XH 3T8XA 1UWEH 2EO1A 1MWOA 2YEZB 1P4BL 3WMSA 3ZK0A 3T0AA 2WXGA 1R47A 5CJ8A 5D7EA 3U4EB 1K5NA 3IB4A 3MRJA 5DJ0B 5T1LB 1S7SB 4R2GD 5INDA 5E0QA 3E7JA 4MMYB 3TASA 5JQ6L 2QSVA 5BQ7B 3NGBC 3CSTA 1AO7E 4NSKB 1C1EH 2XZAH 3TNNA 2X70B 3MX0A 3K71A 2BSSA 1T6BX 2WNXA 3L4XA 4OZGE 3T2PA 2ZUSA 5IHBA 1TVBA 5DSCB 3RWGA 1EJFA 3QEGH 3QJTB 2OMYB 4JK0D 4FXGB 1IAMA 2QR0A 4L4VA 3BEVA 5CHNA 2DKSA 3O9WA 4PJCA 3DJRA 2ZXCA 1U21A 3CZFB 2IO5A 1OGAE 4MNQB 3T1WA 3HUJB 3FN9A 3IN0A 3QJXA 2Q3ZA 2XBZA 1R17A 2FECI 2Z7ZA 1SOXA 5J56B 3UEZA 4B7LA 1SEBA 2E3VA 3IGAB 4LDCA 3U6XS 4DJMA 4XNXL 1M1SA 2ZF8A 3H2PA 3SOBL 2RQEA 1WIOA 3LRHA 5DYFA 1ICTA 1NSNL 2WP3T 4B0MM 2ZAGA 3MFFB 1N10A 4PG2C 3C6LB 2VM9A 2FHCA 1EZLA 1VA9A 4OQTL 5FW8A 4UBDC 5IVOA 2O5ZH 3SE8H 2VDPL 4P57A 3GSOB 2PO6C 3RGHA 5F7KC 4OIBA 2FNWA 1WA0X 1PKQB 5IB4B 2VR6A 4Y19B 4N5ED 3TLRA 4HSQA 4LP4A 3EIFA 3BZ4A 4F58H 4HX1B 1U3ZA 2NY5C 1NAMH 2EUZA 3MV7A 2L8AA 3EDEA 2XV2A 3UIYA 3IE4A 3UABA 5C0BE 3SYQA 4BGLA 1GHFL 3IFOB 3TFKD 4WHCA 3KBHE 1FH5L 3QCVH 2NXZB 4XP6L 2Q86B 4FFZL 4GW1B 2CO1A 1MLCB 3LQAH 4NRZB 5AKTA 1MOEA 2K1MA 2ZYHA 2J4WL 3OHMB 4PR5A 3ZR6A 5BXFB 5IB3A 1QTSA 3DGGA 1FC1A 1KIQA 3SGKA 1XR8B 1D5ZB 5CEXB 2FR4A 2X88A 4GMTL 4TQ8A 4WI3A 2FSEA 3WY3A 3MRPA 2RHEA 5D9SB 1GYAA 2R1XA 2GTZB 4KY1L 3SGDI 1O5DT 4MD5B 1JI2A 2BFVL 3GB7A 5T5FA 5TDNB 3SJVE 3D8MA 1E9PB 4BFFA 1QSFE 1ZIAA 5I6XB 4X6EB 1KYOJ 5DJ8B 1WD9A 3EFOB 4KOBA 4F7EB 5GS1A 2MKWA 5EC1A 2IMNA 1C16B 3EZ8A 1MZYA 3HA0A 4LDEB 5GSRB 2ZONA 1QLEB 1YY9C 4AW7A 5FUZL 4G6JL 3GLEA 3S4SB 4LCIL 4UV4H 4R4FL 3X11A 2HFFA 2XCMC 4IK7A 1D7FA 1GL4B 2BNRD 4IYKA 3HG4A 4AGLA 3ZT5A 1QLFA 1XH3B 3PAZA 2HRPL 2E76C 2QQKH 4HFUH 4L1BA 5E2JA 1NCCL 4OZFA 5E6UB 1IAIM 4JGMA 4I77L 4HUVA 2ZX8A 3UJTL 3FU0A 4Y2OA 3VTMA 2N7BA 1CFNA 1NCHA 4YXLH 5IOPB 1UXWB 3EJJX 4BKLA 3K8LA 3OKOA 4CNIA 3K6DA 4FTVA 5FOBB 2KS0A 4XWOD 1S7XB 2P7TB 3FOMA 3MJWA 3V4VB 1GJIA 3V6OA 3KXFA 3KPSD 2GK2A 5KYWA 3L1OH 2WV3A 4Q0XL 4PHXA 4R5TA 3WY1A 1BVNP 4G8EA 4J6RL 4AZUA 3LNFA 2OQJA 2G75A 1E43A 1T4KA 4WNJA 1KB5H 3KS0H 1E3FA 2IANA 3P3YA 3QA3B 4G9DB 5B38G 5HYQB 4HIJA 4XVOA 1CFBA 1WBXB 3AG4B 4PS7A 1PLGL 3EYUL 4LFHG 4P5TB 2UWEB 4WTZG 4QHUB 1GKEA 4AKOA 1PZCA 3UTPE 1MCPL 3IFLH 1MCDA 1PD0A 1SVCP 3T0EC 1ZE3C 2R59A 1BPVA 4GI8A 2YEZA 2CR6A 3QWOA 1KC5H 4EO5A 5CILH 3ZUCA 4JPKL 3U4EA 1TPXC 2I60H 2AI0H 3IAPA 3WYRA 5DJ0A 5T1LA 1N2RB 1S7SA 2BDNH 3HHSB 1TEGA 3FT2B 1UC6A 3NCCB 2EXYC 1UD8A 4MMYA 3H4HA 4RGNE 5FM5M 5BQ7A 2PCXA 3AM8C 3JSSA 4NSKA 4U6YA 5DHEA 1WBZB 2X70A 1N7MH 1BQHG 1D2PA 4OJFL 4KJQC 4AZ8A 2ESVE 3FTXA 2MQ3A 3LX9A 4TTDC 1TU2B 5DSCA 3S96A 4HF5L 3DK2A 2OMYA 2DM2A 4Y2DC 3VI3F 1OF2B 4ZBJA 2DQDL 1LWJA 5D1XE 5AW4B 5FB8B 2NY7H 15C8H 2NQDA 5ANHA 4IBSA 2GAZB 1NC4B 3NQIA 2GT9B 3FN3A 1QSVA 4XO5A 1BPLB 4B3VA 2EUXA 4TRPH 4NI6A 5DURD 2QLVB 3EGSB 4Z7QB 5GISH 2WPGA 4FQ2H 1DN2A 3SDAD 4DERA 5K9QI 3CU7A 4PJEB 2CBTA 4G7YL 1A21A 1RXLA 3IGAA 1EEYA 1TETL 2F5BH 3ALWA 3HG3A 3CBRA 1F4WL 2Z64C 3NCBB 3E2HC 4ENED 1MRFL 4M8UA 1L9SA 3A4EA 3ABKB 5C0DB 4Y1AB 2FQFA 1G9NC 3P2TA 3QSKB 3MFFA 4D8PA 1XV8A 3GJFK 2EICA 1T83A 2AEQH 5KBKA 4ZDHB 4DGWC 2MCMA 1XD0A 3GSOA 4F24A 1DQMH 1U3JA 2WQWA 2BSDA 2KLSA 2KUTA 2P80A 5JIDA 1R0AH 1PKQA 1IGFH 2UYLB 5IB4A 1Q0YH 2DICA 3CZGA 4IRZH 4PJ5D 5LCVA 4XTRD 1FZKB 5DJYA 3V5HB 3UTQB 2RMNA 2VRKA 4HX1A 4I3SL 1V3JA 2FX7L 2H2PD 3NIFE 2FATH 5T8IA 4M43L 5AZ2H 4QKXB 1D5XB 2PWDA 5HDLA 3V52H 1E8YA 4YZFE 3CFDA 4A7GF 4ODHL 1YZZA 3IFOA 3V8CA 4ANVA 4OCSL 2D3NA 5L2KE 5JXEC 4G72B 2Q86A 1N6VA 3VFTB 4I0PC 4GW1A 1MLCA 4NRZA 4DKTA 5FK9B 5C9KA 3OL2A 1P4IL 4KTEH 5BXFA 3NA4A 2NY2C 4E9LA 2ICWB 1KJ3L 2DQJH 3GUFA 4RRPA 1D5ZA 5CEXA 4ADGA 4HFWA 5JW3H 1GW6A 4I3GA 1QRKA 2EE2A 5D9SA 2YEQA 4PW9A 3MODH 1A6VL 4IU3A 3U9UB 5BNXD 5F89B 2G3NA 2GTZA 2YD5A 1UACL 4MD5A 5TDNA 3UBHA 3VFSB 1DANT 4FG4A 1E9PA 4POZD 4FL4B 4W70A 4AVKA 4X6EA 1WWCA 5H94B 5TF1H 4Z7WE 3IDMB 5DJ8A 4N9OB 3KWUA 4P9ML 5F7HA 4F7EA 4JPVH 1BGXH 4P5SA 1AZNA 1C16A 2GPZA 2VRQA 5GSRA 1JZJA 2BPBA 4RBPK 5CGBA 4U1MB 1NPJA 2WQXA 4LPXA 2WTRB 4P2OB 3MSPA 3TL5A 5K1NA 5IJBC 4XMLH 3JV5A 5A2IH 2YPKB 3P4LA 4N25A 4XWGL 3MV7E 5KSBB 4DIXA 3UG4A 1GSMA 4GXVH 5F7EL 4LSDA 4WENB 2O30A 4HCRA 1YNTF 1UWGH 4ZNEA 4M7JH 3HFMH 4QXUL 3NTCL 3AS0A 4L0YA 3MBEC 2WXHA 1PKOA 5IOPA 1UXWA 3GLZA 4NZUL 4R97B 4KY2A 3IU4H 1CXHA 1KCSL 3O2DL 3FJTA 5CKGA 5FOBA 5HDBE 4RMSA 1S7XA 2P7TA 3QFJB 4POUB 2F54D 4HWNA 3V4VA 3GRWA 1MHPL 4LPYA 4IKNA 3OHXC 5FV1L 5HVFB 1OGSA 1A0QL 4AJVA 3VFVB 4WWPA 3TV8A 3QA3A 5DC9B 4G9DA 3CD4A 1MHHB 5LJYH 5HYQA 4GSXA 1U6AL 1I9EA 2ENYA 1WBXA 4WU7B 4P5TA 2DD8L 1QEWB 2UWEA 2IH3B 3NJHA 5DJZB 1ORSB 4QHUA 4HMEA 1KB9J 1RSYA 4LGPB 4OLUL 4XXWA 5SWZD 3TPUB 4HAGA 2QZ5A 1UWXK 4KFMA 4QGTA 2YR3A 3LS4H 4MJIB 4UOQA 3KAAA 3MYZA 2BOBB 4OCYL 3QDGD 5DZ9A 3AREC 3C60D 3P77B 2AVGA 4PI0A 1OE3A 1W72L 4NKDB 1N2RA 5A7BA 4DHLA 1MREH 2Z8SA 5EUKB 3HHSA 3FT2A 3MV01 2XJLA 2XV3A 3AT9A 3FO1B 4FXTA 2ZTBA 1CICC 1EO7A 1MKFA 5FYLH 4ZMPA 2AXJA 1LVEA 4WFGD 2I5YL 4PCYA 3ULVC 1U4EA 1TU2A 2WLKA 1GR7A 1PL3A 5CUSL 4FHJA 3BMVA 5IVXF 1OF2A 2WCSA 2OCJA 4OM1L 5CEZD 3FAXA 5FB8A 1MG3C 1M6OA 2ZUQB 5E03A 1SYVB 2IBZY 2B1HH 2GAZA 4TVPE 3L45A 1I8AA 3P11L 1UENA 3T5WA 3EGSA 2ZXGA 2IANE 2P43B 1ZLSL 4CU6A 4X4XB 2Q7NA 3T3MF 4AVHA 5SWSB 2PYFB 4PJEA 2VUKA 2J20A 2PWGA 4YDLC 4YHKL 4RISL 2B8OT 3QWRD 1QI3A 1BJ1J 3QZNA 5C0DA 2VM4A 4Y1AA 5GZND 1Z5YD 3LPGA 2GBVA 3H6JA 4APQB 1IZJA 3GMLA 4HJGB 1NEZB 1PF3A 3MA9H 4ZDHA 3SKMA 1IT9L 1LNUA 3B8YA 5D4HA 5F8RC 3T08A 2DQEL 5EF2A 2ADFH 3SGKC 5DUBB 2AKRB 3WV0A 5I1JH 2YJQA 3QIWB 2IALB 4XO9A 2IAMB 1J11A 1NQBA 3UZEA 1GPOH 2UYLA 3LKSB 5F9JB 1I1RA 2YN3A 2OTPA 5DUJA 1FZKA 1NGXB 3UTQA 1NLBH 3MLVL 4C57C 2FIKB 1W2KT 1XGUB 3APCA 4JO2L 1Z6JT 1ZA6B 3BKYH 3BI9X 4XMXA 2WHVA 3GBDA 4G82A 1B9ZA 1D5BB 2WWMD 3BDYH 3K4ZA 1TQCB 4BK5A 5AENA 2W88A 4DVBB 4FFVD 5JDSB 2E4FA 1ZGLB 5EUOB 1J0HA 1X7TA 3JZYA 3ILQD 4MNQE 1A7NL 2B14A 3L3GB 3HUJE 1RZ7H 3VFTA 3LXCA 1J1OH 2R39A 2EXSA 1C5CL 1JDDA 1S9XB 5FK9A 3GBML 3FMGH 1DQLH 4KMQA 3M07A 1ZXQA 4KO9A 5DT1L 3T77A 4OIAA 1A9BA 3TEZA 1EHLL 4H1LH 2R0WH 5F89A 5IUCA 2H45A 4NLAA 1I9RL 3QNYB 3MNVA 3VFSA 4PGZA 4GKOA 1S5IH 3LEVH 5H94A 3IDMA 3AZUA 1JGDB 4BSWB 3S3JA 4JR9L 2Z31D 4HDIB 5C7XL 1GW0A 4HJJL 1PKQE 2Y5EA 4U1MA 1YEIH 4OLZL 4Y19E 3BGFC 1KJ2A 2WTRA 4P2OA 4TQEH 4LGSB 3AAZB 2PP9A 3FOLB 3HS0C 4UQAA 3VD5A 2YPKA 3IFPA 4PV8A 4FG2A 4L8SB 1CIDA 4YDMA 5KSBA 4LPTA 4ODSH 3TJHC 3OLEA 1BYPA 4MB5A 5GRZA 3NSJA 2E8YA 1XTMA 1DN0B 3EOTL 3SO3B 2HLAB 1RLBA 3OXSB 4TSAL 2HTKD 2HYMA 3I9PA 4PRHB 3R19A 4LCUB 4L0PB 2BY1A 4NIKB 3AXLB 1A9EB 5FO8B 2YKKA 2OR8A 1GYWA 2UZIL 5KJ4A 3VXNB 3L6FB 1CDBA 1N8OE 3UDWA 1P4BH 5I6LA 3U6RB 4EN3B 3ZE0B 2W1NA 4ZOCA 3VFVA 3RKDD 1W15A 3OSKA 1MHHA 4JHZA 4MHHG 4WU7A 4WWKB 3FB6B 3AGWA 3US1A 5KVDE 3UGUA 2IH3A 5DJZA 1ORSA 5KBPA 3OV6A 1QPPA 4R7NA 3SB3A 1OWRM 5E94B 4ZTOL 3EYFB 1I8MA 4M1DL 3O8XC 1BEXA 5F7BA 3GDCA 4AQAB 4BFOA 4Z3EA 4PS4L 4MLSA 5AAPA 3G5ZB 2YZ8A 4MJIA 3VXRD 2BOBA 1TJIL 2VMDA 3IJHB 4LSUL 3U46B 2X2IA 5JW4M 3P77A 2Y24A 4HOMA 4U6HB 2D2CC 4NKDA 2GJZB 4MXVF 5EUKA 2HRLA 5ICUA 4KI5D 3FO1A 1T7VA 1FZMA 3A4DA 5A6MA 3IXTB 2VN3A 3HRPA 4OCWH 1ED3B 2O6CA 5D93C 4PPTA 2OYPA 2Z35B 1N3NB 1VCBC 3TH2T 5ANMB 5J11C 3DIFB 4TS6A 2VITB 1T83C 1ZV2A 4L05A 1YMMB 4QRQB 4HWBL 5JMRA 3A24A 2NX5D 1SXNA 4TQHA 1SFDA 2G60H 2QQQA 4KX7A 4K8RC 4H0IA 4XNXH 5L4FA 2EDXA 1SYVA 3SOBH 3DYOA 5EMYA 5DC4B 4CL7A 5FKAB 2OBGA 5DZVA 5DHDA 4HUXB 4UTAH 2DQCL 4P07A 4X4XA 3O41A 3QT2A 4P8QA 4JFXB 2VDPH 2PYFA 1JE6A 4K9EC 5GZOC 3QUZD 2QJDA 2UWEE 2EH8L 4S1SL 2MQGA 1KUMA 1T0OA 4ODTL 5BV7B 4OU3A 4GG6B 4JKWA 1UOKA 1RPQA 2CKBB 1NEZA 4HJGA 4ANWA 3ZW3A 1BG9A 1JD9A 1SDDB 3HHRB 5DUBA 2AKRA 1E4WL 1LE9B 2IALA 5K1VA 1GHFH 2IAMA 3QS2A 2FB4H 2WNKA 2R4RL 3EZJB 3PJNA 3LKSA 3ZQXA 5F9JA 5I82A 1FH5H 1UWFA 1YYML