1OEZW

Zn his46arg mutant of human cu, zn superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
124
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVHEFGDNTAGCTSAGPHFERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Amyloid-Like Filaments and Water-Filled Nanotubes Formed by Sod1 Mutant Proteins Linked to Familial Als
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 30
structure length 124
sequence length 153
chains with identical sequence X, Y, Z
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oezW00
4A7TA 1IBHA 5KBLA 4L05A 2GBUA 2VR8A 3K91A 2Z7WA 1PZSA 1SRDA 2WKOF 2AEOA 2K4WA 1JK9B 3L9YA 1XTMA 2C9SA 1E9QB 1XSOA 1JCVA 1F1GA 2APSA 4A7UA 1IBFA 1OZTG 1QUPA 1SXZA 3KH4A 2R27A 1EQWA 3GZOA 2WZ0A 3GZQA 1MFMA 4OH2A 3ECUA 1JK9A 1Z9PA 1E9OB 2WKOA 3KBFA 1CB4A 2C9UA 1E9QA 1OEZW 3GQFA 1PU0A 3T5WA 4BCZA 1OAJA 1TO5A 1SDYA 4BCYA 4A7SA 2SODB 3H2PA 1COBA 4MCMA 2AQQA 1EJ8A 2Q2LA 3ECVA 5CU9A 2JLPA 3CQQA 1SDAB 2LU5A 2GBTA 3HOGA 1IBBA 4FF9A 5KBMA 5KBKA 4BD4A 1SXAA 3GZPA 3KH3A 1E9OA 2ZKYA 2ZKWA 2AF2A 1Q0EA 1YAZA 3SODB 1SXNA 1SXCA 3KM1A 2AQNA 4A7GF 2WWNA 4U4IA 4A7VA 3MKGA 1RK7A 2WYTA 2AQPA 3GTVA 1IB5A 2AQTA 2ZKXA 3LTVA 1L3NA 2E46A 3L9EA 4A7QA 1CBJA 1N19A 1UXMA 1OALA 4MCNA 2WWOA 3HW7A 3MNDA 3KBEA 3KM2A 2XJKA 2Z7UA 4N3UA 2VR7A 3F7LA 3CQPA 1SPDA 2JCWA 1SXBA 3ECWA 1IBDA 1N18A 1XTLA 1YSOA 3F7KA 1F1AA 1PTZA 1B4TA 4B3EA 2GBVA 2C9VA 1E9PB 1SXSA 3QQDB 4A7GA 1FUNA 1YAIA 3GTTA 2V0AA 1OZUA 3PU7A 1BZOA 2AQSA 1S4IA 2Z7YA 4N3TA 1HL5A 2NNXA 2VR6A 1AZVA 1Z9NA 1ESOA 2Z7ZA 3HFFA 1F1DA 2WYZA 2ZOWA 1UXLA 1SOSA 2WZ5A 3H2QA 2XJLA 1DSWA 2WZ6A 4OJAA 2AQRA 1BA9A 1E9PA 1F18A 1TO4A 1DO5A 1HL4A 3QQDA 1KMGA 1U3NA 3S0PA 3RE0A 2E47A 3CE1A 1B4LA 1P1VA
chains in the Genus database with same CATH superfamily
2VLRE 3IDIA 1NUDA 4UM9A 4MAUH 1NIAA 2DTSA 4L5FE 4DWHA 5I1CL 1LMIA 5T8IA 2O6PA 4U2ZA 2UY7B 3BLBA 4IOSA 5JO5B 2WKOF 4QHNB 2VN4A 4KX7A 2IPTL 3S36H 2BDNH 3DTUB 5IM7B 4NPJA 1IFHH 2YEQA 3WKML 2R2BB 4NI3A 3KPLB 4J6RH 1F6FB 3V0GA 3OXSB 3RX7A 2AZUA 3JUZA 2R15A 4YHKH 4JG0H 2CRMA 2Y5TA 5MP6L 1O5PA 3K81A 5H37A 1I82A 3C8HA 3AT9A 3MAWA 3GEFA 1KYOJ 2QTEA 4GRWB 1UVQB 1ZLDA 1NKRA 5IMOA 3RVTD 4OW6A 1L9TA 2WGXA 1I9JL 5AVXB 2O93L 3GI8L 1E9QA 1E5UI 1UOVA 2G60H 4NNYB 1JPFA 4QWWD 4KV5F 4G42A 1AD0B 2SODB 5GIRB 4G7YH 5JW4Q 2BX5A 2WO2B 1JPSL 2A6IB 4P46D 3VFRB 1DBKH 5LAXB 5I9QC 5LVEA 2D4FA 2OZ4H 3S4SB 5CJXA 3NCCB 3NACL 2DQJH 2QHRH 5GGTL 3HAEH 3FFCA 3DIFA 3OXRA 4GQ9L 2VXQH 1CDHA 3SKNB 2FYYA 3MLSL 1MI5E 3ALPA 4W9KC 4Y7MA 2DTMH 1HNFA 3MNVB 5CWSA 3BIBX 1IC7L 5LWYH 1PQZA 1Z9SA 3DHUA 5EO0A 4EOWH 3QFDA 3ORJA 4YK4B 3CFIC 2WCGA 2H9GB 4JQVA 5AOIA 3C5JB 5K9JH 3BSHA 4PRDB 2A6DB 4GKNB 3OG6B 1Q0YH 1Q72L 2C3VB 1ORQA 3IAPA 4MNHB 4XAWH 1OAQH 1MHPH 3P9LB 1XGQA 1UCBL 2CDGB 1NCWH 2OTWB 3Q1SH 2J1WA 1Z5HA 2KH2B 4L4VB 1TVBB 5L2JA 3QQ3A 3B3IB 4Q9QL 4Z0BL 3SDAD 4CMMB 2ED8A 1M2VB 3BW9B 4DZBB 1YNLL 1UD6A 1IIIA 2NUPA 3RBSA 4JM0A 2KLRA 2F19L 2ZWKA 3LIUA 4XMPH 1BBDL 2N1KA 3TBCA 5C3LD 5AAMC 2C7UB 2WXPA 3QEGH 4OTXH 4FRWA 3ZRSA 4Q97A 1S7XB 2F7OA 1Z9LA 3B9VA 1IGTB 1AXTL 5FHAL 4HISA 1DCLA 3LZRA 3MLRL 3OTTA 4R0LB 4RFEA 4YQXH 3QRGH 5DRNA 3F7VB 2JKNA 3LYRA 2B9BA 4LESA 1GGBL 1OAXH 1MIEL 2JIXA 4JFYA 4NB7A 3GNML 3M88A 1QRKA 3KNBA 1SYVA 2DQFB 3GDBA 4AGQA 1AAJA 4X5WB 2A77L 1W0VA 4LNRB 3RY6C 1JVKA 1QUPA 3MRMB 1MPAH 4YSCA 4ZD3H 3N43B 4JREB 1YQ2A 4OIFA 4NIYE 3UTZB 3VFVB 4ZS7L 2NY4D 1AGCA 3AREB 3VM5A 5TE7H 2DL9A 2E5EA 3B9KC 2WKGA 3GQFA 1PU0A 3ARUA 3PWPB 2CPCA 3OZ9L 4FKHA 4PD4K 2VLJE 4GFTB 4Y19E 4NGHL 4XNMA 2WUCH 4NERA 3PL6D 5G4MA 3SGDH 4JKPH 1KCLA 4P07A 4TSAH 4XNXL 1KJMA 1GSKA 4LLDA 2DLTA 2XPGA 3W57A 3MRCA 1NDGA 3GLZA 4B50A 5I0YA 4CVXA 4NN5B 3Q48A 5EEXA 2UUDK 5AYUH 1D7FA 1YAZA 2X4OA 3RFRA 4KJWD 4U7KA 3GSNA 2P5WE 4G6KL 5F9JA 2BVEA 3RWIA 4UQDA 5EBLB 5EZJA 5K33A 2V8MA 5I1IL 3QO1B 4MJID 1NCBL 5IW3A 1WIPA 2B2XL 1JBJA 3D25B 3VSVA 1LDSA 4YHIA 2NY1B 3MLUH 4MXWL 2O26U 1QZ1A 3U0TB 1KCSH 1AIFB 1I3GL 4HV8B 2Y7SA 1QUNA 1NCDL 2HWZH 4ALAL 5C0EB 4JRWA 3NCBB 5A6IA 1C16A 4F7TA 5IOPB 1PFCA 4J8RB 1S7QB 3C6LC 3L13A 4U0RB 4IGBD 4J3OF 2XVLA 3SSGA 1AQHA 1CICC 3DTXA 5J56B 1JDCA 2XIIA 3NOIA 3DSFL 5KVFH 2X87A 1EA9C 5C71A 2WVSA 3ARGC 3MUUA 4LCUA 4X83A 1MQKL 1UD8A 3SJVA 4LF3A 3VD9A 4UYPA 4Y5XC 3DV6B 1LO5A 5DI8A 5DLMH 3ZE0B 4G6AC 4ODVH 5IB5A 3C09B 4U6TA 4D0CB 3UP6A 5DJ6A 1AQDA 3TESA 1DO5A 4QLRA 3KWTA 2ENQA 2X6BA 4NO0A 4XCEA 4NQXA 1PLCA 4MJ5B 4JPKL 4NQUA 4PJ5B 2NR6D 3BFQG 2I07A 4IJTA 4M7KL 5J6GB 1LEGA 3RL2A 4LSRH 3T3PE 1W8EA 3G7TA 2UZIH 4LMQE 4PJ9A 4PRBB 5C3IA 1YDPB 3OX8B 3G5WA 3SKJH 1TQTA 1T1ZA 3LCYA 3OWEA 3RGVD 1DTUA 3KJ4B 1J8HB 1J9QA 1T20B 2O5YL 3E1ZA 1TJGH 2AEOA 2NTFB 4YHML 3DJTA 1JZ8A 4RMRA 4M4PA 2NY5C 5F1NB 3VQMA 4J3BA 5IUCA 5IMLB 3BUPA 2F53E 4MDJA 4ZRGA 4EBQL 2H45A 2F8XC 1KGYE 2A38A 3U7AA 4BQCA 4Z76A 1JUFB 1K2DA 3MOBL 1T03L 5H35A 3IGUA 2XVKA 3L3OB 2BERA 4OJYA 1CFTB 5E8DH 3V2AR 1RI8A 4KKLC 5E1QA 3VSQA 6TAAA 2I69A 1OGAE 5KYXA 2AJZB 3NZUA 4FXLA 2HG5A 1Q9OB 4RISH 4AXWA 5IG7B 1BEXA 3GB7B 4UNTA 3P4NB 2DLFH 3AUWB 3GSWA 4RMQA 3QORA 1CDCA 1YPZB 3LRSB 1IAKA 1M6UA 4OV5A 1YY9D 4FFYA 4WQOA 2X1WL 5HGAB 4E9LA 5AOJA 1WGVA 2NX5E 4PMFA 4BA8A 5K5YA 3B34A 4G8IA 3FCSA 4XP4L 2J88L 3ROLB 3X1GA 5JLZB 1CFSB 4EUPH 2ZYRA 1K5NB 1TETL 3GXPA 2ENPA 4JRYD 3JSSA 2R29A 3RA7L 1X5GA 2IV8A 1ZA6A 2VDPL 2HYMA 2X89A 5EO9B 4LHQB 3KW7A 4RZKA 1E5CA 4ZUUA 4YXKL 3FU8A 3I75A 3QFJB 3AU1B 1ZV2A 2ZWYA 4ES9A 4ZMOA 1EDYA 2ZG1A 3VFUB 4L29A 3REWB 3IWVA 2OMBA 1T1WA 2CCLA 4NQSB 3K7UA 3NJVA 1LVEA 4MDIA 1U8QA 4IQHA 3NZSA 2AJXL 1GTNA 2ICCA 3OLIA 5E4EB 3VU1A 4ZJ9A 4UIKH 5FFLA 4WJKB 2DDQH 4Y4HD 3MCLL 3AXLA 4NQEB 1DQJB 4QOKE 1I1FB 2QPDB 4P3CL 4ONGH 4RZCB 3TBTA 5F1OB 2Q2EB 5MERB 4RX4D 1KCRL 3VE0A 3L48A 5I71C 3MV8D 3RFZA 2A7BA 4RMTA 2PR4L 1A1NB 3L3IA 5JW3L 4YN3A 5L8JB 3O9WD 1ACZA 2R0ZL 1B88A 4R8WL 4PGEA 1V27A 4NNXA 3ZDXB 1JFHA 1U6AL 1CTNA 4PG9A 2EE3A 4Y9FA 4Z0XB 4C56A 1IO4C 1AP2B 2WXNA 3AWFA 4LEOA 3W39A 2J8UB 4P59H 1E4WL 3S37X 3OKNA 3FNKA 4MD4B 3RX8A 4ZMAT 1L0PA 1PLAA 1OSZA 2CNYA 1SDDB 4JFQA 3MV7A 4TTDD 4Z3FA 5H4ZA 1A3LL 3QI9A 4G7VH 1NMBH 3VRIB 2Z8VC 2I9TA 4JFPA 5KVDE 1C5DB 3S5ZA 4DP4X 2OXGB 3SDXA 5JMOC 2FB4L 1Y18A 4MBRA 3SD2A 1FGNH 3GXFA 4QRQB 1PKQA 4O51B 3WJLC 2JI2A 4HJUA 3UJTH 4RFNB 2ZUSA 1L9OA 1KGJA 2YXWA 4A2MA 1S9YB 3LXUX 4IS6B 4MMYB 5C08D 3V5HB 1A25A 4XP6H 4APXA 1K3ZA 4N6RA 3FOMB 2NR6C 4CN4A 4Z7OE 2CHXA 6PCYA 3VXRD 2DLEA 1S3KL 3CDGA 1I31A 1E43A 1KB5L 2VERN 3H7LA 3VGAB 5JHMA 1QABA 4Z7NB 3RGVC 4AYDC 4B5ZA 4PJ8B 2W5PA 5CMAB 2IJ0C 4KPHH 3IMSA 1HT6A 3FO2B 2AEPL 1J0HA 3CU7A 5LBSH 3R4DA 3D4GA 2FWOB 4XZ4A 1GXEA 5HDQL 2HJLA 5KSUA 4KKBD 2XPZA 3CFBA 4JKKA 1PEWA 3T09A 3U0PA 2K9FB 5KBMA 4JQIL 4YWGH 1RJYA 2G5BB 2BSBA 4F93B 1QNZH 2V6HA 2MNWA 1U8LA 2X0WA 3GDCA 3BDBA 3CLFL 1NC2D 4ZOAA 4ZMXA 3BJLA 3MACL 2EJ1A 3KPSD 5ISZA 2M1KA 1WYJA 4FTVE 1E8ZA 1M4KA 4W70A 3HLAA 3E9TA 1AE6L 4OUUB 5K1NA 4L8CA 1NGPH 4BDVB 2VDLL 1NCHA 3ARBB 5FO9B 3OZLA 4HS6A 1TNNA 3FQRA 2R8SH 2JSFA 4Z7UB 2BWQA 3BGFB 3EZJB 4HJJH 5DD3H 3H9SA 3RPIB 4BWTA 4UB0L 1GGIL 1SJEB 4OZIB 1FBIH 4LFHD 1XHHA 2DL2A 1G9NC 1G0DA 1NKGA 1KFAL 2IO5A 3A6BL 5DO8A 4NNPH 3QQ4A 4KO9A 3SOTA 4X9IA 2WNKA 4OBSA 4PJEA 1YUKB 5CZKA 2WP3T 3F6IA 5I8CA 1SYSB 1KIRB 1WWAX 3W1ZA 3BGMB 2H26B 1XGPA 3LKQB 4JG1L 4N87A 3SB3A 3QXDB 4GLRI 4A55A 4N9OB 4M48H 4R90L 3OF6A 3ULVH 1BA9A 1CBVL 2JKSA 2N1TE 2UZXA 3H56A 4G6MH 4YO0B 5I0ZA 3I6GA 5LGYA 1A4AA 1U0QA 1JZIA 3LZNA 3PS6A 3QNXA 1K8IA 2UWEA 3GUFA 1S7WB 2OKMA 4Y4HC 3QFJD 5E8OA 3KPOB 3SY0B 3ZZLA 4FKEA 1BOGA 4ICXA 2DYRB 2A9NL 3O2DL 2J5LB 1GC1H 2D7NA 2ORBL 2ZSVA 3WL9B 3RWHB 3VXMB 4DW2L 2PWEA 3VUAA 1FFOA 1WBYB 1TVDA 2Q87A 2EO1A 2GJRA 3DIDA 3Q8CA 3V4PL 4XPGH 5I24A 1KB3A 1HOCB 1OZTG 3QG7L 5HVGB 1ZA3B 4JQXC 4G8FA 5GRJH 2OYKA 1BVOA 1Y1UA 2Y06L 3KWVA 5B1BB 5JQ6L 4J12A 4HAFA 3MRFA 2ZP9A 3DETD 4XC3L 5KVGH 2PUQT 4DP2X 5I6NA 3X13B 1A3QA 3L4XA 4TTDC 5I1CH 2L7JA 3IMVA 3EOBB 5CCGE 2MPAL 4IM8A 1JE6A 2IPTH 3ZO9A 3VFMB 3UJIL 3HZ3A 1MHHB 1IU1A 2FDBP 2WWKO 5FIEA 1A65A 2CALA 3WKMH 2R0WL 1J8KA 2AV1B 1S46A 3UTQB 2JKIS 5C7ZA 4RBPK 4TUOB 5DVOA 2V2WA 5TH2B 4LSTL 5ESVB 5MP6H 5D1XC 5D9SA 1R5WB 2Q7NA 3FN0L 1T1YB 5GGRB 4IBUA 3OAZH 2JK5A 2WLIA 5DQJA 5JOPE 2BNQB 1T6WA 1A7PL 3WUWA 3WNOA 1D5ZB 1PD1A 4KGJA 5CJ8A 4X8JB 1I9JH 4U1IB 3GI8H 2XYCA 2ZX7A 4XP1L 2E7LC 1PG7W 1H5BA 3LEVH 4YFEA 1NGZB 2E8YA 3C9NB 2E86A 3CFEA 1JPSH 2E6QA 3K2UL 1JWUB 3IFNH 4MA7L 4N2GA 5BV7C 1X9RA 5DRWA 1KPVA 4AMWA 3V55A 5PAZA 2ITEA 2B4CL 4BQBA 4ZBJA 2SEBA 3NACH 4F2MB 5BUGA 1ZCRA 1UWYA 1RXLA 5GGTH 5HYJE 4QGYA 3H85A 4G83A 4Q14A 2GSIA 4GQ9H 1KWKA 1SY6L 1E7UA 4B9PA 5IHBA 4A6YL 1IC7H 4CVUA 3LD8B 4ICWA 2YKKA 3BP6A 3FTSA 1DEDA 1M7IB 1DFXA 4I88A 3SDXF 1NAMA 1AR1C 5LGHL 4F58L 4CADA 2YMOA 3ZDZB 4M93C 5AW1B 3RP1A 4R97B 4X0KA 2Y7QA 1GYAA 5EO1A 1V3KA 4XZUA 5EUOA 2GJ6A 1Q72H 2VRKA 1BREA 1DHKA 2EDHA 2IBBA 3IFOB 4ODTL 3P2BA 5EDSA 1SJXA 1UCBH 4WUKL 5BXFB 4LOUD 5DSCB 1PL3A 3VFGL 2FBJL 1U92B 3ARBD 2H8PB 4NO5A 4OV6F 1G6RA 4N68A 3SKOA 2ED7A 4Q9QH 2ADJA 4DUVA 4Z0BH 4MGXA 3E9UA 4FYRA 1SM3L 4YDIL 5DS8A 1P1ZA 1RPKA 4G80B 4PV9A 3DO3A 3ZU8A 2OSLA 1YNLH 3GTNA 3NESA 2F19H 1BBDH 1USQA 1YJDL 2CBOA 2CSPA 2DW5A 3L1OL 1OP3K 5KANI 1AO7E 2G75B 3C60B 2VLKD 5JHBA 5HI5C 1VIWA 3BGAA 2ATKA 1Z9PA 4UILL 1UH3A 4YJZL 1LP9A 2VDQB 4RGMC 5GS1C 2V37A 1AXTH 2CA4A 4I0PD 1GZHA 5FHAH 3MLRH 5FO7B 4MWFA 1GGBH 1MIEH 1KXVA 4HK0A 3GNMH 4ODSL 3C75A 3CHQA 3CQQA 3MNZB 2A77H 5L7XL 1WD8A 2QBWA 4YFDB 2QVIA 3QPQD 4N0FB 1NEPA 2B3IA 4GAYB 2QPEB 1FZOB 4WUUD 1MFCL 2YIHA 4LP5A 1I1AB 5E8NA 1DBAL 1R3LB 2Q20A 4ZAKA 3HE6B 1UYWL 4ZS7H 1JD7A 1T5KA 3PGCA 3U48A 4JR9L 4A7VA 2PTTB 3NSFA 1QHQA 3VAEA 3FO1B 2WBJD 2Y69B 3OZ9H 3KXFB 5KSBE 4PJEF 4NGHH 4NAQA 4XVUC 5D7LA 3V0HA 3FF8A 3FCBA 4UOQA 1X3DA 4XNXH 3AAZB 2VUOA 1XBDA 1ZLEA 3MRPB 3QDJB 4N24A 4UT6L 2KBGA 4OCMC 3RWCA 1OIOA 4NLAA 4QT5B 5DA0B 5FA3B 4RAHA 3G6DL 1IEBA 1TENA 1NANI 2XWJB 3QQDB 4KUCD 2WC7A 4LLAA 4FQXA 2GSGA 4R96A 3I6SA 2EXYD 2FWSA 2UWEF 3FRPG 4H88L 1IC1A 4G6KH 4I9XA 3ZBMA 3F85A 2VDKL 1JF6A 4GSXA 2V2XA 5I1IH 2BSEA 4UQCA 4ELMA 2NY0D 4OZFG 1NCBH 1W72A 2B2XH 2Z91A 4HHAB 3WFBL 5C0IA 2EIMB 1TQUA 4MXWH 3IETB 2FJHA 3FUEA 1A6TA 4NT6A 3MCKB 3TV3L 4L5FL 4EZKA 1I3GH 4JRXE 3D2UB 2C4FT 2H32H 3O45A 2VZ3A 4ALAH 2CLVB 1A7QL 1JXKA 4M02A 1T66C 5DD5L 3KYOB 5LDSA 3AZUA 1G7QA 1Y6NR 4RDQF 3T4YB 2Z34A 3TT1L 1G7JA 3KGUA 1BF8A 3DSFH 4LIQL 4OFPA 1TKWA 3UTTB 4UOZA 2VB5A 1RULL 3KHOA 3UZQA 1N2RA 4HUXA 2QL1A 1MQKH 3MODL 3NAAL 5BRZA 5JHLL 2KDYA 2X4PA 1W91A 4WFGD 5HPMB 5KN5A 1Y6MR 1J5DA 1W2KT 4O58L 2COQA 5TDOA 1BXAA 1CT8B 5JORA 3ZRFC 4OZGA 3SQOL 2BP8A 5LNGA 3CH1B 4CSZA 2XTJD 3KH4A 4X4XA 3ZXAC 3ZIYA 1NGWB 5ITFB 5DZNA 4WV1C 3IJ8A 1JNNH 4WV1A 3QNFA 3V4VL 1I3RA 4P3DB 4WDIA 3H1ZA 4GRMB 1URZA 3AADB 5B21A 1RZKC 3ECUA 5JIMA 5F7EL 4LOUC 3IU3B 3B2DC 3QEQB 3JWNC 1OEZW 3KWUA 3BYTA 4N2AA 2O5YH 2F61A 3CGTA 3M17A 4S1RL 2MJWA 3KLDA 2JQMA 4MS8C 1FFQA 4F27A 3LRGA 1G9MC 5FCSH 4V1DE 4AYFB 3DGDA 2Y5EA 4LRNL 4Y2DB 5DJCA 4ETQB 5EU6E 5GSRA 3KPQA 2X5PA 5FOBB 4WO4A 3DURA 1UTDA 3EGXB 5C07E 2CR0A 4XRCB 1A6VL 2PO6B 4OCNC 1T03H 4A68A 3QUZC 5J9PB 4OF6A 2FZ3B 2X4TA 5F88A 3P11H 3U4AA 3FQXB 3LKRB 3TV8A 3ULUL 1U8PA 5AW6B 5FGSA 2VR3A 4TVPE 3FRPB 5F70A 3BPNC 4MMXB 5ID1A 2EE2A 3C5XA 5DUBB 3RI5F 3QZMA 1BD2A 4OZFB 5CILL 2XJKA 4BK8A 4PB9L 2LT9A 1A4KA 4XPTL 1YCSA 1TIUA 4EIBA 5EUOF 3TBWA 4WKZB 5F7MC 1QFWI 2J88H 4FCAA 3SE8L 4AL8L 3AJ7A 2D7PA 1TETH 3P1VA 4QHPA 3T77B 5GRWA 4TLUA 3RA7H 3MX0B 1SJHA 2VDPH 4K71B 2X3BA 2WBJC 2DQ6A 4JJHA 3LSOA 3RIAF 4YXKH 1CG9B 3BDYL 3QEHA 5JPMA 2EINB 4N2NA 5BJTA 1ULVA 4TULL 3PCYA 1O5DT 4OR1A 3HG5A 4FXGB 4MA3B 1BW8A 2XQYK 3SCMB 1U8HA 3V6FB 3V95A 1C12A 4A2DA 2AJXH 2WNGA 4HUVA 2P8MB 1JOIA 3WDJA 3GSOB 3T0BA 4HIJA 3MRJB 5DZOA 1JYNA 3CFMA 1TT6A 2EXYC 1ZVNA 3MCLH 4FG2A 3UACA 1PY4A 2DH3A 2FX9L 4P3CH 4X6FB 4A04A 1DQDL 1LP9F 3Q8EA 2DWEB 3TWYA 2NY0C 3A4EA 2KZBA 1KCRH 3JTSA 3W5NA 2QQKL 4N22A 5IB4A 3V52L 3TBYA 2PR4H 4ZFZA 5EBWA 5JW3H 3QDJD 2YQ2A 2R0ZH 1BAWA 1O75A 3PAYA 4WWID 1N6QH 1I75A 4HKJA 1PPIA 4R8WH 3DO7B 4JE0A 2DRUA 5H94B 2ODHA 2W0KA 3FU0A 4ZMWA 1CGSL 3MMEA 4YFLI 1Z2KA 2PF6A 4GAGH 1U3HC 2NZ9C 3D3VD 1U3HA 3MKKA 5L4JA 5AKTA 1BF5A 1X4YA 3BZDA 1JHKL 1XGYH 2A9CA 2VABA 1E4WH 3MV9B 3IJYA 5ACZA 4CC1A 3P77A 4PTUB 5FS5A 3QWNA 4UOW1 1TYRA 1A3LH 2OQJA 2ZUQC 3T9WA 5GS3A 1GKOA 3SPGA 2FB4H 2X4QB 5E23A 2FBOJ 7FABL 5FB8B 2XTJC 1IBBA 4N9GB 5EMYA 2GK0A 4TNFA 1GHFL 3HE7B 3FT2A 4P5SA 2ZKYA 4Y4FD 2ZWSA 1MN4A 2WTOA 3EFOA 2GY7B 4EE2A 5DZAA 3DXAD 1ED3A 3R1GL 2GIXA 1FL6B 1WEJL 4LXFA 2BVPA 3BP4A 1PW3A 3BEWB 4GS7B 3C6EA 1KB5H 4MX7A 4C57C 4BK5A 4P2QB 4GQPH 4ELMF 1UA6L 2EYSA 4KZDL 4GIOA 3DNKA 4B9IA 1Y7VA 5ESAA 2AEPH 1U8KB 1K4CB 4JKWA 1INQA 5IJDC 4PG2A 3U9PL 2CG9X 1Z1WA 4OKDA 2HN7B 2LE9A 4JQIH 2V7HB 4X0NA 3T8MA 5DQDL 3QEQD 4TNWK 1A47A 1QATA 2M83A 4H26A 4KAQH 1IIKA 3CVHL 4MNGB 5HHMD 1RCYA 1L9PA 3WKQA 5IEHA 1CPUA 5SWZD 1VGEL 5DS1A 3IDIB 3MACH 4NN6B 1M1SA 4UM9B 5E51A 5C0CE 2R39A 3HR5A 3JXAA 2W80C 4Z23A 2B0SL 2VDLH 5EG6C 5IGXL 4CMHC 5SV4A 3O41A 1P53A 1KT2B 4IEFA 3BAIA 3QIUA 4MZ2A 4OZGF 3JYCA 2V3DA 3TJEL 1PD6A 1S9VA 3GC3A 4LU5L 5A40E 1AFVL 3L2MA 2Y5TB 1Q1JH 3E8VA 4UQAA 1IC0A 4UB0H 2GHZA 1GGIH 3WFHA 5E9DA 4EN3D 4YL4A 1MW3A 1YYLH 3L3JB 1FHGA 4XXCC 3A6BH 1KFAH 3F83A 5PCYA 3OAYH 3VWJA 3L9YA 5MEOA 1E9QB 3QWOA 5D2NC 3BCFA 3NUKA 1F1GA 1JPFB 1ACCA 2YAOA 2CXKA 1CYXA 2EP6A 1FZKA 1J48A 2YPLE 4G42B 4JG1H 4XH2A 1T22A 3BZ4B 5KSAA 1TZAA 3UPCA 4R90H 5HSFA 1U8CA 2DLIA 1KUMA 1CBVH 1HJCA 5D4IA 3X3FL 4B0MM 1KJ2A 4Y2NA 2W81C 4J39A 1K5WA 2KL6A 3QIWA 3KEDA 3MO1A 1BG9A 3FFCB 2BW5A 3DIFB 3OXRB 4JY6A 4MLIA 4HEME 2FYYB 2A9NH 2FNWA 3O2DH 3F05A 2ORBH 3CHOA 4HZLA 4WFED 4LGSB 5CWSB 5AL0A 1W80A 4DW2H 2JCCE 2FO4B 3LS5L 1Z9SB 3QUYA 4F9LC 1A7BA 7PAZA 1ZLUK 1BVZA 5JNYA 3HZYA 4LCCA 4FI8A 5EO0B 3V4PH 1CI5A 4OFDA 3QFDB 3LKPA 1UWEL 3D08A 4E42A 1A7RH 3MZTA 3QG7H 1BXVA 1JGEA 4X7SL 1DR9A 3MN8A 4AQ1C 2Y06H 5JQ6H 1SHSA 3CSGA 1ORQB 4LASH 4U3XA 4GXFA 3SO3B 3EG9A 4RSVA 4PQXA 4XC3H 4HDIB 1YEFL 2OCCB 4YLBA 2Q10A 3TH3T 1T7WA 2H3KA 2OLDA 2RCSL 2VWEE 3EBHA 5L2JB 4IMKA 1YMME 2YXMA 4IKJA 2YD4A 3O4LE 2XCMC 3THML 2J1KA 3QQ9D 3UJIH 1MFVA 1MEXL 3NJMA 4JKNA 2R0WH 3B9EA 1OCZB 2OCJA 3TCLA 4JFDD 1YEJL 1FRGH 2NUPB 3IYLW 5MEQA 1YSOA 4LSTH 3EJTA 5F9WC 4GSUA 5GJSL 4LOEA 3GTTA 3FN0H 5TQ2L 2CUMA 4PRIE 3MRHA 3QWRD 4NRYA 3UG3A 1A7PH 4UDUB 1BAFL 4RAUA 4KO5A 4GMSL 3OR7A 1RSYA 2NW3B 1WISA 4RFEB 5DRNB 2QFRA 4XP1H 1DJIA 2EDTA 3AC0A 4HK3N 2JIXB 4JFYB 1EFXA 4U31A 3P30L 1SYVB 2F2HA 4J7RA 3K2UH 4OCSL 4MA7H 5AW8B 2OMZA 2OR8A 4FFZA 5IV2A 1MH5A 5KVDL 3GO1H 2NW2A 1WD9A 3G5VA 1NPJA 1ETB1 2VRQA 1F3RB 1WDAA 2B4CH 4UZSA 4JEGB 4XMPL 3ZYIA 3VW3L 4F1ZA 1FYTD 4XC1L 2IBGA 4DTGL 1U41A 2BK8A 4JDVA 3AS2A 4Q56A 1AGCB 5J6SA 5EEYA 1SY6H 2LTQB 3WS3A 1DUZA 1N26A 4A6YH 3B9KB 2A9AA 4GKSB 3ZKMC 4K73A 2WQVA 4XNMB 5LGHH 3WGUB 5ALBH 5EOTA 5A3ID 1I1CA 4GI6A 3WKNA 6FABL 4J3OD 1A21A 1QFUL 4PJGE 1M6OB 1KJMB 4WTWA 4LLDB 4LCWE 4F7PA 4AT6A 2XPGB 4R4BA 3M86A 3MRCB 3OHMB 1NDGB 4PJFA 3ZY7A 4E9RA 2P49B 4ODTH 4CVXB 4ZMTA 2BY2A 4HOXA 4WUKH 2OW7A 9PCYA 2YQBA 2X4OB 3KBFA 3VFGH 1RZ8A 2FBJH 3GSNB 4YHOH 5I1JL 3MUGA 4IOSD 3RWIB 5EZJB 5KG9A 4J4PC 4AK1A 2R2HA 2JQAA 4CVZA 3BE1L 1TJIH 4FHBD 1NFIB 3HG1E 3BEVA 5DCCA 2LU5A 1SM3H 1SHXA 4YDIH 3KJ6L 1OGTA 2P4AB 4TQ8A 3KH3A 3HLKA 2WQUA 1QUNB 2CIIA 1RZIA 1YJDH 3BZ5A 3L1OH 1C16B 2Z3FA 1M71A 1S7VA 3FOLA 3B56A 5LDUA 3DTXB 1CICB 3RNKA 4RGOL 2H3NA 1J88A 4IHOA 4HWZA 3RILA 1K4DA 4PJBB 5LUMA 3G08A 4AYBA 1MFEH 1X5IA 4LCUB 1UUNA 2YBGA 1H8OA 4MAYA 1H9DA 1AOZA 3SJVB 4UQEA 1QO3B 4XR8C 1TYJA 4ODSH 4KNUA 5E94A 5BMFH 4JZJA 4O4YL 2CUIA 5D1QE 1JG9A 4N3UA 1LO5B 5DI8B 3BZFA 4OD1L 5IB5B 4BZ2A 2YKLL 5AL8A 3ZHFA 1MFCH 3LQZA 3JVGA 5DJ6B 1AQDB 1DBAH 2RIKA 3UAFA 1SXSA 2E76C 4NO0B 1YAIA 3DBSA 1HYSC 4XCEB 3FFCD 3IE4A 2IDQA 1OZUA 3AY2A 4XWOC 1UYWH 3BKML 3ZMRA 1S4IA 1LEGB 2W94A 3IJEA 4JR9H 3PHOA 2A9DA 4PJ9B 3VGFA 1Z9NA 4WFFD 4D9QE 1T1ZB 2W9EL 1REIA 2AK4B 1NLDL 4YX2L 1N64L 2G3NA 4Y5YC 3QQ9C 4IU2A 3MDJA 1UB5A 4MDJB 5TK2A 1EAJA 5JIKA 3VD2A 4X5XA 4ZUWA 2KUTA 4UT6H 3VYOA 2ZG2A 4KHXH 4Z76B 3T4AA 3QCUL 5FCUL 4UIMA 1K2DB 4JG5A 2GBUA 4H88H 1BJ1H 5ALCL 5GGRY 3ZR6A 1D5XB 5EEWA 4HF5L 2VDKH 3PYCA 4Q74A 5FK9A 5KYXB 3AQDA 2HG5B 2I26N 4TLTA 4XO5A 1SJVA 3WFBH 1GYWA 3REVB 1QR1B 5C9JA 4JN1L 2IPUG 3DGGB 3GSWB 3MSPA 1YQVH 4TTGA 3N91A 3TV3H 4L5FH 1IAKB 2OSWA 2WVUA 4ZNEE 1XGTA 4OV5B 1AIZA 4I0CC 3P02A 4I3SL 1A7QH 5DD5H 3FONA 4CA4A 12E8L 1EAOA 3FCSB 4FD0A 3TT1H 3W37A 1ZSHA 2R4RL 4LIQH 1RULH 2JIXD 3FQ1A 1ZA6B 4K5MA 3MODH 3NAAH 4NQCD 1HEJC 5JHLH 3CSYA 3NMEA 3OAZK 1Q38A 1E4HA 2Q2LA 3I75B 4ZUUB 2VL5A 4QMEA 4O58H 1RJCA 1VADA 4YXLL 1HN1A 3SQOH 1E7VA 1IGCL 4L29B 3WNLA 3BD5A 4KKAD 1QI4A 4EJ1C 3R7RA 1CK0L 1KIPB 2ENSA 3EUDA 2F5AL 1F6AA 1Q0EA 3GZKA 1U93A 4MDIB 1D2OA 1U8QB 3V4VH 3ULVD 2J43A 2B5IB 4QRPD 3PAUA 4G5ZL 4LBEA 5F7EH 4BHUI 4PW9A 3PLYA 2Y9RT 3E2HB 1JYXA 1WA2X 1AQ8A 2XLLA 4APQC 2VTFA 1AHMA 4KK6C 2HFTA 1R5VA 3L81A 4GUOA 4S1RH 1V7NL 1ZV5A 1JNLL 3TBTB 4E2OA 3RFZB 1XIWA 1OY3B 3L3IB 2YC1B 4LRNH 2BVUA 2CH8A 1DO6A 2IFFL 3B7SA 5T1MA 1TZIA 4P5MB 1PLGH 3MBEA 2QV2A 4PGEB 4NNXB 1B4TA 4PG9B 5CLXA 4C56B 4AYGA 3QXVA 1A6VH 3LZFL 4KDTC 3TJHD 3KLHD 1PX8A 3WJJA 1X4ZA 2XN9D 2OA9A 1YO4A 2VDRB 1TVHA 4R7DB 3OKNB 3ULUH 1PJ9A 5FKPA 2PPCA 3DBXA 1OSZB 5GHWL 4A67A 2O1AA 1H15B 3QI9B 2QSCL 4OUOA 2I9TB 4JFPB 4YC2B 4CDHA 4A2GA 4GT7A 2KHAA 1KBGL 3IPEA 3SDXB 4C58B 5CILH 1Y18B 2X4UB 15C8L 4GT0A 1PKQB 3MUHL 4PB9H 2X2YA 3CE1A 4XPTH 3NSYA 1QBBA 5IREA 3IN2A 5D7HA 4H2CA 4MA1B 4UANA 3SE8H 4APXB 5HI4D 5IQOA 4PJFF 3ECQA 5CSBA 1VJSA 4Y2OB 5M94B 3MJ8A 9CGTA 3SJVD 5AVWB 2VMEA 1NGXB 1KTJA 3L8QA 2QGEA 1IQDA 3R8BB 4KOBA 2NNCA 4F33A 4WWKA 4YSAA 3GMPA 2FUQA 2FE0A 4JDTH 3BDYH 1JP5A 4OF5A 3MJ7A 4M56A 1WGOA 3L08A 4TULH 4XVTL 1MAML 3Q9QA 3JV4A 3NP4A 4G70B 2X6CA 4NO0D 4WHYH 2DM3A 2HJLB 1UKSA 5KSUB 1NOAA 3MJ9L 3V0FA 2EC8A 1TDQA 1BZ8A 3EUUA 1MSPA 4KDWA 4PJ9D 1P84J 1RJYB 1IE5A 4XGZA 4PRHA 4NZ8A 2OL3A 1U8LB 2Z65C 1AHKA 1E4KC 3UP1A 3T0AA 4EZMA 2FX9H 4QTHA 3US0A 4FL4B 2FX7H 3IGFA 1INEL 2CK0L 1DQDH 4H5SA 4JO8A 1KYAA 1VA9A 4HAKA 4NI6A 5ISZB 4FLOA 4PVLA 5A16A 4O9HL 2V3FA 3GJFH 3HLAB 4JK0D 4L8CB 2QQKH 3V52H 2D3JA 1KGUA 2XKSA 5DO2C 4FNPA 5E56A 1QSED 1YZZA 2GAZA 4HS6B 4HU2A 1I85C 3FQRB 2N0MA 2JJSC 3D0LA 2HTLC 4HMEA 4MJIE 1PZAA 3H9SB 5ANMA 4ESKA 2JJWA 3B83A 1BVNP 4TNWF 1L6PA 1JHKH 3BO8A 3MKGA 4HIXL 5BO1L 1RKRA 1IB5A 4H1LH 1CFQA 4LGRB 4HCRL 3QORD 1A64A 3CXHK 1H3PL 4PJEB 2E4FA 3ZHLA 3VRLE 7FABH 5B3SB 1XGPB 4FZEL 3ZHNA 1HQRA 2CJSA 4O02A 1YA5A 1GHFH 2RTTA 2YS4A 2UZXB 5F2FA 4AX3A 2R4SL 3HBGA 3PFQA 3R1GH 4H0GA 4LVOC 4OKVA 3ULVC 1QLRA 3FO9A 1WEJH 1K8IB 2UWEB 3SZ6A 4G43A 1ZT7A 3VRJA 1Q8MA 4N0UE 1O0VA 5E8OB 2KC0A 3D09A 1BOGB 3VTTA 4ODBD 1UA6H 2J6EL 2ZSVB 3FQWA 3NIGE 3OKOA 4KZDH 1KDIA 1TFHA 1TQCC 2FJFA 4JFEA 5IQ7L 1FFOB 3OGCA 3FHAA 4DCQA 1GC1C 3NN8A 2YGVA 1VERA 5FHBL 3U9PH 5F7KC 3BAEL 2LR4A 5CUSL 4G8FB 1YY8A 4U05A 4P2OC 4P2OA 5DQDH 2PCPA 3KLHC 1AXSA 1RZJL 5T5NF 3FT1A 1EO5A 3LN4A 5ILTH 2R7EA 3MRFB 1VGEH 5DMGC 2HLFC 3KVPA 1SFHA 5H8DA 2Y3NA 1BMGA 3NCEB 4DESA 3UZEC 3UZEA 5IFAL 4XCCL 5I66A 4HX1A 2B0SH 1WTGT 1FO0L 5IGXH 2ETWA 1SXZA 5MHSD 4QRTA 3UC2A 4HPYL 4IRZL 3EH3B 2CHWA 1DVUA 3CN2A 4JO1L 1TR7A 1F4AA 3FUKA 2IDUA 4U1LA 3TJEH 4PY8J 4R83A 1OLZA 4PLOB 5E24E 1HKLL 4LU5H 5FM5M 3LNEA 1JJUA 5C0GA 2V2WB 1CGUA 4XN2A 4U1KA 1Z3RA 5D9SB 1OOAA 3TA3A 2OM5A 3MV7D 1BFVL 2JK5B 3QI9D 4GSDH 5KZCB 3BQUD 2WLIB 5DQJB 5E03A 2CKBA 3WUWB 1COBA 3CU1A 2AQQA 4FOMA 5AZEL 3UFIA 1V54B 5I1EL 5DVLA 4OLUL 1H5BB 5F96L 2XWZA 1RK1A 4XVJH 1JWSA 3G6JA 3VJ6A 4JRYE 2BCMA 3CFEB 4TVPL 3WD5L 4OGZA 2O5ZL 3STLA 1KPVB 4YXHL 3X3FH 1JDAA 3COOA 2QELA 4W4OC 2Z6FA 3SZKC 3L45A 4XNBA 2X2UA 4ZI8A 1CYWA 3S8GB 2ZAHA 1PIGA 2ADFL 2AS5M 2GSIB 4RGND 4JVWA 4K8RC 4MHHG 1SNRA 1ZS8A 2WAHA 4XXWA 4DKTA 5HBBA 5HYIA 3BP6B 5BW7C 1L9SA 1NAMB 1UWEH 3VCLA 1AR1B 3PWPE 4CADB 4L4TB 4DT2A 4PLJC 4X7SH 1YYCA 2J1ZA 3FT3A 2Y7QB 3FAWA 3K2IA 2Z1KA 4X0KB 4XZUB 2GJ6B 5EO1B 5EUOB 5CO1A 3MV8E 3QEUA 4ENZA 3QAQA 3N2JA 2XFXA 3UCRA 3KDMB 3QBTB 2X7LA 1YEFH 1KJ3L 4Y9EA 5DVPA 3QYMA 1UD3A 3EW3B 4XVSL 2RCSH 2HXAA 2WXFA 3BKYL 1NLBH 4NO5B 1M42A 2HCZX 5FGBC 1G6RB 3HEIB 2ALWA 2IAMA 4FQIL 3SKOB 2ADJB 4XOBA 3THMH 4OGXL 1MEXH 2Y07L 2EVHA 3Q44A 1SUJA 4Y9CA 5D7JC 4PV9B 5D7JA 3QFGA 5C3TA 1XH3A 1YEJH 2BCKB 3X1EA 5GJSH 3LX9A 4L05A 3W0WA 5KSVA 4HC1L 4PV8B 5TQ2H 3EGSA 3HS8A 3V4UL 1TJXA 2XC8A 5AVVB 1DQLL 2ATKB 2W91A 1BAFH 1MCOL 5HDOA 5DHVH 5FXCH 1LP9B 4GMSH 1VESA 4MXQD 4MWFB 5C08E 4WSJA 3SDDA 1AQMA 2NQDA 4HK0B 5C0AD 2X53A 3OF6D 4IW4C 2Z8WC 3P30H 1Q94A 4WTQA 4HOMA 4OCSH 4A38A 2QKIA 5KVDH 3S3CB 2BXZA 4YZFE 5FUOL 3HIZA 5E6UB 3ZE0E 4BH8B 1XSKA 4CU7A 3BXNA 4P2RA 2YFNA 3K6OA 3NQKA 4PRPA 3BVVA 2YD3A 3EFDL 3JWNG 5HVHC 3VW3H 4WCYL 3RY4A 1P4BL 3SE9L 3PGCB 3VI4A 2BSRA 3I9AA 3RQ3A 3AGVA 3KPRA 2KERA 5EF2A 1IKFL 2I60L 1RZPA 3WCYA 4AZUA 1ZGLM 5D7LB 4MFHA 4S1DC 2CR3A 3D0AA 3L5JA 2VN5A 3B5HA 6FABH 1QFUH 1YRKA 3KPSE 2NXZB 4WI6A 5E5RB 3RWCB 2PYFA 4FN0A 1I1RA 3UTSB 4YGVA 1MXGA 1IEBB 4BFIA 4R96B 2GSGB 4TM9A 3BQUC 2P42B 1GYUA 5TDNA 5I1JH 1WITA 4AM0A 2G2RA 3BE1H 5F9OH 4ELMB 1J9RA 1MCQA 2VZVA 1W72B 2IAAC 3OKYA 3BUIA 5C0IB 4NRXB 2VDOB 4WJ5A 3VXNA 5IHHA 3RJOA 3KJ6H 5ESQA 1A6TB 1HZHL 1N6UA 4IRSA 1HEZA 2CGYA 2X4NB 4NT6B 4Z3JA 3MVSA 4ZFGL 5CGMA 5CN1A 4HBCL 3O45B 2Y1VA 4FQCL 4HUMB 4OZHA 3UAJD 4HSAC 1YPZE 2IWKA 1G7QB 3ARSA 2AQSA 4PWIA 1UZGA 4ALAC 2P80A 2ARJA 2LLGA 1G7JB 4RGOH 3MCG1 3IK2A 1ZLWH 2OMYA 3UZQB 2F54D 4PGBA 1N2RB 2OCFD 4HUXB 4YUEL 3CZJA 2K6YA 2NZ1A 1FH2A 5KN5B 1DLHA 5FDWA 4O4YH 1Q0XL 4K3EL 3ZTCC 1MCLA 4OD1H 3I74A 4OZGB 3FN3A 2YKLH 4TRPL 3OAYK 5D93B 3QFJE 4MQXC 1QFOA 5E2VL 3ZPDA 3FTUA 4NC0B 5K1JA 4WV1B 3I50L 4KVCL 1I3RB 2EYTA 2VIRA 2DQMA 4FAAB 2H4EA 3ENEA 1D9KC 3WUZA 2A4ZA 2W9EH 5TE4H 3SGDI 3E6FA 3L4UA 1NLDH 1P6WA 3K4AA 2Z0BA 3LXCA 3M17B 4NQDA 3VGEA 4YX2H 2YD2A 4NBZB 4Y16C 2BC4A 4CBPA 4QXUL 1N64H 1BIIA 4JPWL 2WSDA 4XBEL 4GBXD 4FFWD 1E42A 4P9HL 4XNAA 3G6JF 5DJCB 5JPNA 1LNUB 5GSRB 5GS0D 4AOFA 2HH0L 3DURB 4C59B 8CGTA 4FA8A 2EH8L 3HZKA 1RIHL 2PWFA 2XTSA 3D06A 1YEGH 3QCUH 4MCZA 5FCUH 4K7FB 4JFZL 5C09D 3TCTA 3M6DA 3QUZB 4TUUA 4XODA 4KRNA 5ALCH 2X4TB 4PSPA 5F88B 3ZTDC 3ARFD 3WIFA 4AV5A 2B39A 4LAJH 4HF5H 1U8PB 2J8UE 2ZYHA 4MCMA 3F12A 4JPSA 4G9FD 5DEFA 3S7GA 3TT3H 1WFUA 1L6ZA 2F08A 1CYGA 5I76A 3WN5C 1U3JA 5CGTA 1XCXA 2R1YA 1BD2B 1CF1A 1VACA 4ODXA 3BVTA 4BV1A 4A63A 4BINA 1VPOL 4HZ1A 1OHQA 5TDPA 3FUMA 5A2BA 1A4KB 3OHXC 1OPOA 4RESB 1FVEA 4I3SH 1KG0B 3QSKB 4J6IA 1KCVL 4U0QB 3RL1A 2XWRA 3TBWB 3E6HB 4IBWA 3L1GA 4PHXA 4U1MA 2LLLA 1QYGL 2WXRA 1SJHB 5HYSA 5HGBA 1ETJA 1AHWC 2Q86A 3NEOA 2WWOA 3ZTNL 3MNDA 5E4OA 3QEHB 5JPMB 2IG2L 3FU3A 4YXLH 2DJSA 1IGCH 1KNOA 1QP1A 3TTYA 2F74A 1UEYA 2DMHA 3PABA 4L1SA 4XHQA 1CK0H 5K9OA 1IILE 4ZAKD 3ZE1E 2F5AH 1UC6A 4IDJL 1U8HB 4AYEC 1BZ9A 1C12B 3BWAA 1F0LA 2MTAA 5J1TC 4JLRA 4UNVA 4HUVB 3K6SA 5I5RA 4G5ZH 4JFFD 4W6YB 1X6NA 4HIJB 4JFUA 5D96C 4E9WA 1DN0A 3VWKA 2OYPA 4R84A 2LFEA 3FCTA 3IXAA 3PIQB 1E4JA 2ENYA 4L3EA 3VXSD 2UVFA 3Q8AA 1V7NH 1JNLH 2BW4A 4PGCB 3JTSB 4FQHA 3L6FB 4HOZA 5BOZG 5IB4B 4H8WH 3TBYB 4LCIL 4ZFZB 1ZIAA 5EBWB 1THAA 3VFPA 2IFFH 4GNKB 1HHGA 4J8QA 2EUXA 3B2XA 4HKJB 1UGNA 4FHJA 2N4IA 4KXDA 2G9KA 2RBLA 3FHEA 3ABZA 4FQXD 2GITB 3LZFH 1JFQH 3G5YB 2UYLB 5LAPA 3UAJC 3MMEB 4Q4IA 4Z18A 2D31A 1J1XH 1U3HB 3Q2WA 2VABB 2BSED 4Z7UE 4DEPC 3HMXL 1H6UA 2CO3A 1BQSA 3IJYB 3QPXL 4JE4B 1F3JA 1SOXA 1Z9MA 1F4YL 2EQDA 1KTCA 2OQJB 2QSCH 3NPZB 2ZUQB 2VLKE 3PQYA 2AXWA 5I1LA 3H42L 3CX5J 5L9DH 2QGCA 4L1HA 15C8H 2CO6A 1CUOA 1OOWA 2GK0B 1KN4L 4LLUA 2VN6A 5DHDA 3FT2B 1T6VN 3H3KA 4ANKA 2H3XC 2B16A 3EFOB 1USZA 4A2EA 1GTFA 4U1GC 2QHLA 3CBJB 1ED3B 1ID2A 3OB8A 2DI7A 5BRZD 3BP4B 3P3RA 4LLVA 4MX7B 2HFFA 3HAEG 2J8HA 2EYSB 1NOLA 3MLZH 4E41A 1BPVA 4LQFL 4WWNA 4XVTH 4I77L 4OJEH 1MAMH 5ESAB 2WZPD 4FFWC 1OWRM 1QEWB 4N1HB 3HC0A 2J5WA 4IOIA 1MAKA 3JV0A 5E5MB 1CIUA 1DANT 3MJ9H 4G8AC 1GS7A 2AEQL 1J11A 1MFDL 2ADGB 2Y0SA 5IBTL 2PXYA 3BPCA 4OZHF 4H26B 1UZ6F 2FHCA 4NEHB 3RWFA 2B8OT 2GJJA 1RV6X 4DJMA 5I1DA 5IEHB 4DGYL 1HIMH 1ZLVH 3K2MC 4M8VA 5D70L 1M7XA 4MJ6A 1MRFL 2CK0H 1OALA 2MHAB 4P2CG 3WO4C 3HJEA 4KQ3L 5J89A 1MJ7H 5J06A 4O9HH 2OZNA 3ZTJH 2E0PA 4WO4D 2EZ0C 3IDNA 4CMHB 3O41B 3RTLA 4IEFB 2KQNA 1CR9H 3ZDWA 1ZANL 3QIUB 2C9VA 2AKRB 4MD5A 3B7TA 4L8SC 1UWXH 3FBKA 4L8SA 1S9VB 3LXBA 5FC9A 5BQ7A 3L4WA 2YUWA 3O0LA 3RGBA 3OLDA 3PHAA 1YNTA 3RKPA 3UL4A 2LU3A 4HIXH 5BO1H 1KTBA 2Z8RA 2LAAA 5E9DB 3WFHB 4HCGA 4URKA 4WTXA 2ZUYA 5D7IE 2JB6A 4JFOA 4FQ1L 4MQTB 4HCRH 1BD2D 3VWJB 4AEFA 4JCLA 4OF3A 3SYCA 1EPFA 5KJ7E 5MEOB 1J9SA 3QWOB 3QZWA 4DETA 4JW3A 1U3NA 5D2NB 1EDHA 2ZX8A 4UYQA 4XH2B 1FZKB 2ATAA 5KSAB 1T22B 4W6XB 3FU5A 5C0BA 4KROD 1U8CB 1R3KA 2VZOA 3QCTL 4P23D 4WFGE 5IROC 2R4SH 5I8EA 1KJ2B 3EO0A 3BLPX 1NPUA 5I30L 1DQVA 1R33A 1XTMA 3QIWB 3CLWA 2IANA 1J5IA 1EWHA 3KS0J 1AKJA 3S8FB 3QQXA 2DD8H 4JY6B 1S7RA 2C3GA 5EDXA 2FECI 2J6EH 4HZLB 3DX6A 5IQ7H 2CO2A 3HAEB 1DZBA 3QUYB 3VI3A 4JCMA 5JNYB 3HZYB 3CFTA 4LCCB 4QF1A 1FE8L 3KLAA 5JORB 3LKPB 4E42B 1XGZA 1ZT1A 3BAEH 1ILUA 1JGEB 5CUSH 4N0RA 4H40A 1E5AA 2HT4D 3NRQA 2FVNA 2PP7A 4PPTA 5ITBL 1RZJH 3PDDA 2X6UA 4FHKA 4MKMA 2E74C 2FD6L 2XYBA 5ACMA 2FQDA 3ETSA 4AYMC 1BVNT 2RJMA 4XI5D 1C9SA 5IFAH 4UQ3A 4XCCH 5KS9A 1QFWL 1FO0H 4WVRA 1BZEA 5CZXD 4HPYH 4IRZH 1QWNA 4JO1H 4OCLC 1WUZA 4NKOA 1NMCB 5CD3A 4DERA 3CHSA 2XG5A 3TCLB 1HKLH 3NCYP 4I1PA 5MEQB 4BJLA 2I7SA 4YAQA 3F6LA 1B2WL 4N8PA 3RG1C 2J57A 1QEXA 5HXMA 3MRKB 4OM1L 3MRHB 4PRNA 2WJ5A 4NRYB 1PDKA 5DZVA 3ESOA 3L1EA 4LCVA 5AZEH 3OR7B 4XB3A 2IALA 2WSKA 1DVSA 4OLUH 5F96H 1EFXB 2J71A 3FH7A 5E6SB 2AZAA 5I1KH 3WD5H 2O5ZH 5I82A 2MQ3A 1MH5B 4ORGA 2NW2B 1V5JA 4YXHH 4LOVA 3G5VB 1MDAA 1UT9A 1N67A 1RIUL 4NPKA 5F3FA 4XOEA 2PNDA 4JDVB 1OHZA 4FQLL 2ADFH 1DSWA 2B4CC 2A0LD 5F1IA 3F7QA 3WS3B 4GOSA 1DUZB 4MVBC 4GW1B 3CIAA 1NCNA 4FULA 2X10A 1T21A 4FF9A 2CAKA 5JW5A 5EOTB 1TZGH 1BJMA 2GQHA 3BSZL 1G4RA 3TJPA 4QI3A 5JA9A 4OF0A 4P5TA 3V0VA 4AT6B 4R4BB 3HHSA 3T0ED 1NCGA 4G2AA 1LEKA 4PJFB 1D5MB 5GRUL 3QDJE 4J2QA 3GRGA 3O6ML 1KJ3H 5CGYC 3QAZC 3MUGB 4XVSH 1NIFA 3ARTA 4K3DL 1P5UA 4V2CB 4JNXA 1WBXA 1ITBB 5BPPA 5KG9B 2R2HB 4CVZB 2CNZA 5FAAA 4FQIH 4HJTA 1D5BA 1DDTA 4Z7WA 4OGXH 1KPUA 4Q8BA 3D3VE 1QRNA 2Y07H 1ADQA 1OGTB 4NO2A 3GJFK 3BI9X 1ORSA 1YC7A 4I4WB 4KROC 5T5NG 2CIIB 1JYWA 1BYOA 5E9DD 1RZIB 4P23C 4MD0B 2RGSA 4HC1H 4H44C 1M71B 3HMWL 3U30C 3V4UH 1S7VB 4UBDC 2BZCA 1DQLH 3FOLB 4H13C 1MCOH 3RNKB 2HRPL 4IHOB 3NG5A 1OAYH 1K4DB 4HWZB 3APNA 3LQMA 3S5LA 3G08B 4N5ED 5ES4B 2GK2A 2O30A 4MAYB 4BH7B 1B9KA 3K8KA 1JAEA 2UZPA 2ROXA 3ULUD 3RAJL 5E94B 3DXAE 4KKCD 4JZJB 4G1MA 1H6EA 4M7ZC 4HXAL 3BZFB 1A8JH 1TSHA 3BH9A 3HS0C 4Q6IA 2AABH 4MSWA 2PW1B 3LQZB 5FUOH 2HT4C 3N5AA 2E56A 5DGQA 5HI3D 2VSMB 5B3JF 2EDOA 3EFDH 4Q2ZA 4K94L 1UJ3C 2DAVA 1AG0A 1P4BH 1MJUL 4WCYH 1UB6B 3SE9H 2GSMB 3CFDA 2FEEI 5I74C 3PHOB 1R5IA 3UTOA 5EORH 4KZEL 4YE4L 3TH4T 2BNUA 4W68A 3CFJB 1IKFH 4G3YL 4TSCL 2I60H 1U3ZA 1GR7A 3QEQE 2MFNA 1N68A 3DJRA 4IU2B 4BFJA 3CHXA 3EYFA 4M8UA 4YIQA 2A2QT 2P46B 3UBXG 1XF1A 1P69B 4KV5E 1EXUA 1MCFA 2ZD0A 1NBCA 3HRZC 4X5XB 4ZUWB 3X12A 2Q0ZX 1TLMA 3UYRL 1PYWA 2Z7YA 3HFML 2F5BL 2EVFA 2F58L 4H0LC 1OAKL 4UIMB 3VFOA 3D85A 4GLRH 1WFNA 2ZOWA 3CK0L 3D30A 3AWEA 5DJXA 5FA4A 1AZRA 2VR4A 5FK9B 1C08A 1X9UA 3ZMNA 2PWDA 3EIFA 5F97E 5JIHA 2C9AA 4UZGA 4ZO6A 1EGJL 4F2FA 1HZHH 3QJHB 3VI3F 3NABL 1ROWA 5AKVA 4I2XE 4IBZA 4NKDA 1XGTB 4CU6A 4FQCH 3IGAA 2NY6B 4ZMNA 5FF6A 3ESUF 2E9GA 3FONB 3ATBA 4R5XA 3ABKB 2VLJD 3N85L 1YECL 3T2PA 1FI8C 3KDPB 3GSRA 2A0LC 4FJYA 1W0WA 4YUEH 4BUGA 1FC2D 2MEJB 4JPVH 3GZOA 3CSYB 2WW8A 3CG8A 4LSVL 4EKJA 2VL5B 5TFSL 2CO7A 5KS9F 1Q0XH 5HYQB 1VADB 4K3EH 4OFKA 1NAKL 5HYFA 4OAWA 4TRPH 1QSFD 5FKAA 1Q9KA 1RURL 1XGUA 2UXTA 4PP2B 5E2VH 1F6AB 2X70A 4XBMA 1IGML 3FO0H 1U93B 3T0EC 2Q5BA 4WFEE 3UDWC 3I50H 4KVCH 4PTTB 5KVFE 3IDYC 4RLDA 3UDWA 3ME0A 2A74A 1KB9K 1FDLH 4LBEB 2DQCH 3PWNA 3RWEB 1QPPA 1BFOA 3TVMD 1N59A 3NFNA 1JGLL 3MR9B 3EXLA 4AQZA 3X14A 4B96A 1R5VB 5TF0A 4F92B 2BO0A 3GS0A 3I9GL 2J21A 4UOJA 1CLZL 1IX2A 1WF5A 2P52A 4QXUH 4X8XA 4JPWH 4XBEH 1XIWB 3T2NL 3UAEA 3Q05A 1H19A 2G2PA 4AQAA 3DLQR 4P9HH 4RA3A 3WTXA 4NM8L 2HH0H 1TZIB 4YHLL 5TQ0L 3MBEB 2EH8H 4TPRL 4TL5A 3SHSA 1RIHH 1V3MA 2AQPA 2IQ9L 4I18C 4XBPA 5ICXB 3UBXB 2NPLX 4QUOA 2HJFA 2XG4A 4JFZH 4ZZKA 3G9AB 3L9EA 5I17A 1TVHB 4FXKA 3DBXB 4UT7L 2VR7A 4N5EC 5SWSD 1IM9D 1TTFA 3EF7A 4F7KA 2W0FA 3ULUC 3OL2A 1C1EL 4HWNA 3APCA 4GEIA 3TWCL 1FJ1B 4OY9A 2BSCA 1LO4L 1X5JA 4YSTA 1VPOH 2GABA 2BY0A 4PJIA 5CP7A 5I0XA 4R4FL 2QDVA 3SBPA 3AMLA 1KCVH 2FJSA 5HI3C 1CD1A 1J9CT 3QJUB 4JHBA 4L0PB 3VH8G 4JHAL 4PMEA 1K9TA 1LQSR 1QYGH 4MAYD 3MJ8B 2B15A 2GFBA 3L5WA 5DR5L 2Y1AA 2BIPA 4AL8C 1IQDB 4OF8A 4F33B 2Z9TA 4WWKB 3GMPB 1QI3A 3G6AA 4X80L 1F8TL 3BIAX 4B41A 3ABGA 3BKJL 1KACB 4QRRA 2IG2H 4IKNA 1FG9C 4XNDA 5JR1L 1B4LA 4Z7WF 5EIQA 3I6LD 1FYTE 1G87A 3JV4B 1WLHA 4XMLL 4BWUA 3V5KB 3AY4A 4YEEA 3TEUA 4ZUSA 5IM7A 1I7RB 3WG7B 5KBPA 1EHAA 4IDJH 1JL8A 3QB7C 4ZW8A 3C2AL 4JKLA 1OGAD 1NICA 4NS0A 1P5VA 4KU1A 2ZP0T 4JM2A 2R69A 1GMIA 4GRLA 4XGZB 4PRHB 5FV1L 2OL3B 4Z8FL 4NZDA 3W2DH 3C5ZA 4QTHB 4F9PA 5EEZA 1BAGA 1FIGL 3CDCA 4GKZA 4H5SB 3UBFA 1RPUA 3BWUC 2OMWA 4MNGE 3T71A 1UVQA 5A16B 4HGMA 1G1CA 2C34A 2AJYL 3TBVA 4GUPA 3VTAA 5KYUB 1WIOA 4LCIH 1RD6A 3T6QC 1U2HA 5D1ZD 2GAZB 1RLBA 5JXEA 3WNPA 4W9GC 1SHMA 1WZMA 1ZPLA 2ADIA 3D0LB 2YAPA 5ANMB 5LAXA 1A7NH 3BO8B 4WK0B 3HNVL 3SPCA 3HMXH 3QPXH 2Z31A 4XMZA 3S4SA 4YHZL 4PBVC 1F4YH 4FG6D 4ZO9A 4L3AA 5I15L 5KBKA 1A9VA 5CU5A 3UTPD 3HKZA 1H3TA 1PF3A 2AK1L 2X1PA 4ONOA 2EUWA 2HLEB 3WNKA 3U4KA 3TPKA 3S35L 1R3HB 2MOQA 3KM1A 2ESVD 1HQRB 4O02B 5AW5B 5B39A 1KN4H 3DHMA 3POCA 4PV1C 2IPKA 3L4YA 3C5JA 2FH8A 5F3BA 2X1QA 5T1DL 4YSQA 3FB6A 4OKVB 32C2B 2F7QA 1RFDL 1QLRB 5IR1A 2XOTA 1HDMA 3AS0A 4HWEL 3NJKA 1IL1A 4G43B 4N8CH 1ZT7B 3ATDA 4IJ3C 3FTYA 1HAWA 3TVMC 3VRJB 3VH8B 2CDGA 1P9MC 2NT1A 4UV7L 3X1FA 2OTWA 1ZVSA 4L4VA 4XNUL 3FQWB 3OKOB 2ZCKL 2AANA 4JFEB 4LQFH 1TQCB 1E27B 3FFCE 4HKZB 4I77H 1ZLWK 3FT4A 4HJGB 5CBEA 4CMMA 2E27H 3OGCB 4DCQB 3O0RH 5K9QG 3NN8B 5I1HL 1JI2A 4WFFE 2Q7YA 4X6DA 4DZBA 5ELIA 1YY8B 3HZVB 4PJCA 1MFDH 5KVEE 2FR4A 3QXAA 2WQSA 2GEEA 3K4DA 4P2OB 2PCPB 1JRHL 3O6LL 5IBTH 3LN4B 3M46A 4HWBA 3V7AG 4DGYH 2C7UA 1ZY9A 1O9ZA 5D70H 4Y4KD 1MRFH 2I5YL 2AQRA 1XIWD 3C5SA 4KQ3H 4CAGA 1IGTA 5I66B 2LGNA 1KV3A 1NH6A 4HX1B 4WSKA 2AQNA 2AVGA 4QRTB 3MBED 5B7EA 4WI3A 1PMYA 3FQ2A 3PDOA 1TITA 1ZANH 2PPFA 3CDFA 4HETA 4K5LA 4U1LB 4ZG1A 1ZTXL 1NFDE 2VN3A 4GSRA 2VR5A 3H3PL 4DPRA 2VUYA 4U1KB 3ZYZA 3ASNB 4U1JB 3OZKA 3QO0A 2L7QA 3BVWA 2WLNA 3QUMA 1ZWIA 3TLRA 3T8VA 4KFMA 2G4EA 5IWLC 3UTZA 3QJVB 2CKBB 5EOQL 1MCWM 1O6VA 2OYMA 3AREA 2FATL 5GSVA 2F53A 3DMMA 4KFZC 4Q89A 2BOLA 5AB9A 4M43L 4TNVK 1MFMA 5J1AB 1ILSA 1RK1B 4JX0A 1JWSB 1DVFC 3G6JB 4ZDHA 1DVFA 3VJ6B 1VCBC 2UY6A 3F64A 4TUJB 4X6CA 4NQCE 3STLB 3F84A 4R7NA 4U6YA 4WI0A 4HLZH 4O2FA 5IJCC 3HUJA 4JG9A 1XSJA 2JJTC 4DO6A 5I30H 1NTDA 4WWKD 5HVWA 5KJRL 3UGXA 2EDLA 2D7TL 3HBPA 4R26L 5CINL 4QHKJ 4YBQC 1IBYA 3TO4A 1CGWA 1ZS8B 3GS4A 3W3BA 5F9DC 5F3HB 1ET5A 3FF7A 3SPIA 2NX5A 1QLEB 3FAXA 4CC4C 3ULVE 5D1ZC 1QW8A 1FE8H 2FCBA 3F2LA 1OKEA 3DRTA 4PJIF 5BO0D 2H6PA 1AIFA 1HC1A 5FFGA 1HI6B 3FT3B 2F1BA 5DJYA 1CU4L 5ITBH 1IAOA 3U9UA 2DQEL 1VZHA 2FD6H 3QEUB 3T6VA 5IOPA 5G55A 4J8RA 1AYRA 2XFXB 1TQVA 2X7LB 1G43A 5J11B 4OLXL 4OQTL 2DY2A 5CGBA 1B6UA 2AAVA 1SPDA 3N1FC 1SXBA 1O7SA 5AYTA 3CTTA 5CP3A 2IAMB 1HCZA 2MH4A 1BGXL 1I8UA 2OV0A 3V4LA 3MUZ1 1LQBC 5EU4A 4Z7VA 5D7JB 3QZBA 3VDAA 1XH3B 5EU3A 4GKLA 4XNYL 5JTWA 2NQCA 1B2WH 5KVGE 5CSZA 3W0WB 1YVLA 3LS4L 4E9QA 5KSVB 1IZJA 4ABUA 5CCKL 4JM2F 3TBBA 5EBGA 4OM1H 1WZ1L 4PJ5A 1MWAL 2DMKA 4E0RB 3B1UA 1E9PA 4J1UA 1KBBA 1S7TA 4NZFA 3V10A 2WIMA 1J8HA 4N2FA 3SDDB 4WI2A 1AS7A 1Q94B 3SJVE 5IBLC 4GAAA 5F1NA 1SBSL 1UJTA 3DWTA 2QKIB 1AMYA 1MCCA 3QUKA 3QZNA 1JZDC 1XH0A 2EXSA 5DVMA 2WANA 1JGVL 3BXNB 4PRPB 4QXVA 1M9WA 5DXWA 1RIUH 3KBHE 2QADD 3IDJA 5HVHB 2APSA 3CNKA 4J5VA 3ARZA 4FQLH 4IBTA 1K8DA 4QHUA 4Y4KC 2D2OA 5EZLA 3PNWA 5DHMC 3KPRB 2AJZA 4LAQL 1HXYB 2IH8A 3SO5A 4BQ9A 3I84A 1Q9OA 4NYLA 2KDGA 4N0CD 3VFWA 3W11C 1OB1A 1HWHB 4F57L 3GB7A 3RDTC 5J12B 3BSZH 5SX4H 1ODUA 3DX8A 3RYMA 2DWYA 1T89A 2XWXA 3T5WA 2IQAA 4TUKL 1YMHA 3V6ZA 5TE6L 4YGVB 5GQBA 3GBEA 5GRUH 1R3JA 4BFIB 3MBWA 4WHCA 1P4LA 2Q7AA 3O6MH 3DRQA 3PNRB 3TONA 5TDNB 3VXTA 4AM0B 4K3DH 5DJ2A 1IZKA 4N28A 2G2RB 3DVIA 5G4NA 1JF5A 1MW0A 1PY0A 1YC8A 3O11A 5T5FH 1ZLVK 2OBGA 3JVFC 1XV8A 5F89A 4YHPB 1DBML 4WJ5B 3VXNB 5ESQB 3RVXC 3ZR5A 1HEZB 2FQFA 3EOAA 2C5DC 3RTQD 3VFUA 1PY9A 3TA3D 1OCOB 2BIOA 4Y9BA 4X6DF 4M7LT 4OZHB 3M07A 2ITCA 4S1SL 3LTVA 4PJCF 3HMWH 4FTVA 1JZFA 2XXGA 1UWXK 1H3WM 2TSAA 1IRAY 2OMYB 2JCWA 4NQEA 4PGBB 4I5BA 1RZFL 4H8UA 3IDGA 4LL4A 1DLHB 2AQ3A 5E1GA 5FDWB 1PTZA 3RAJH 4B9FA 4ZX4A 1A4CA 5C7XL 1AMXA 1IT9L 1D7BA 3JT0A 4KXZI 4HXAH 2WN2A 5FDYA 1H3VA 2EC9U 1WFIA 4ACPA 3O81A 4XOCA 4B6ZA 2A73B 2ERJC 3KLQA 1IJNA 4GRWH 2AV7A 5MEPA 5CCHE 4Z0XA 3BUDA 3H6JA 3KYNA 3BJ91 4UTAL 5IUSA 4FQPA 4ZFFB 1MJUH 2FL5A 2EYTB 2VIRB 3ATFA 1MKFA 4TLSA 4YE4H 3SYAA 3RHWF 2ARWA 3D52A 4G3YH 4TSCH 3E6FB 1ZIBA 4UTBA 3CUPA 4NQDB 5ACZB 3VRIA 2DYPD 1ASOA 1QHOA 2DJ4A 1BIIB 4RCAA 4QTFA 4Y16B 5C0JA 1AO7D 1KEGH 4XCYA 2OXGA 3B4NA 4HXBL 5CAYB 4BKSC 4UDTA 5JPNB 1DL7L 1EX0A 2ITDB 4PVBA 3HZKB 4RFOL 4BGLA 3HFMH 4X6CF 2F5BH 2F58H 1OAKH 4MCZB 5MHSE 3HUJF 3CK0H 1ZHLA 3I2CL 2QSVA 3WIFB 2IAMD 1AZUA 3F7YA 1LE9A 1I9EA 2VLMD 2WY3B 5DEFB 4PR5A 2CMRL 2VZTA 1EVUA 4L9LC 4L9LA 4WK4B 1HQ4A 4ADGA 1EGJH 1ZJBA 4IOFD 4PGZA 3MV7E 2R1YB 3VACA 1VACB 4ODXB 4ABWA 3NABH 3FO2A 2FHFA 3W0WD 2R1XA 2B1AL 1PEZA 1I1YA 4Z95L 2BLFA 3SDXE 2VDMB 1FVEB 3OHXB 4F24A 1MCIA 1PKQE 2OJ1A 3RL1B 2FEJA 3D18A 3JV5A 3LHAA 2QADC 4GW5B 1U21A 1YECH 1MCHA 1Z3GL 2JF1A 3N85H 5FGCB 5FO8A 3MLPA 1BLIA 3PWVA 2FT8A 5HGBB 2B1HL 4E9VA 2Q86B 3P73A 4LSVH 4YBLC 2EEBA 5TFSH 5MI0B 2NNRA 4W9CC 1YNKL 4JO4L 1OW0A 1DJGA 1NAKH 2CLRA 1KNOB 2JI3A 2A1WL 2F74B 1RURH 3S35X 3PABB 4PBXA 4P2RD 4PRPD 2BVYA 4Z7VF 2P5EB 1IFHL 4RGNE 5K9OB 1LO3L 3QG6A 4Q52A 1IGMH 3IU4L 3BWAB 2VDQL 4EVNB 2VLLB 3MFFA 1K85A 5AEAA 4OSUL 2MPVA 3U4BL 3VWKB 3QDHA 3LVTA 3AU0A 1JGLH 4F1SA 4OZIA 3FCTB 3AQXA 3IXAB 4MXVF 5DC9B 5L4IA 4JRXD 3N1MC 1CLZH 1F1AA 2ICEC 1J87A 3T2NH 1SN2A 4GINA 2IGFL 1KOAA 1HHHA 3VFPB 1VF5C 4CJ0A 5LKNA 3IJ7A 2CDEA 5F0MB 5BZZA 1SYSA 4NM8H 4Z5RA 1UWGL 2E7CA 3BGMA 2H26A 4YHLH 4FP8L 5TQ0H 2IDCA 3RTQC 4FQ2L 4OBRA 5LXVA 3NJNA 4TPRH 4XMKL 5HYJA 1EV2E 2IQ9H 3WDIA 1FQ9C 2D31B 3IRCA 2OMXA 3AG1B 4JGJA 4NSKA 4DEPB 2GEQA 3MRLB 1F3JB 4OFVA 3QZWG 4UT7H 2KPWA 4B95C 2Y7NA 1DVTA 1VRSA 2A9BA 4IRSD 4KI5F 4X98A 3B37A 2YD5A 1C1EH 5I2IB 3TWCH 5GGSA 4MBOA 1JZJA 3VXMA 3PQYB 1LO4H 3DK0A 4X9BA 5K9KB 5KBLA 2H1LM 2Q1EA 2N56A 3VX0A 4R4FH 1RLWA 2CO6B 2CPUA 4Z7OF 3UABA 1L3WA 2VNCA 4LLUB 2VC2B 4EOWL 1OAUL 1J1OH 2XETA 3LXAA 5BVJA 2DOCA 1FSKB 3K3QA 4JHAH 4BSJA 5C0AE 2DYSB 2DKUA 3ATEA 4V1DD 5DR5H 2ZCLL 3S3DB 4LLVB 2UWEE 1F8TH 2J25A 3ABMB 3HCVA 3A47A 3BKJH 2FT6A 2RR3A 4X80H 5G2NA 1CLYL 5A2KH 4B9CA 1I8LC 5JR1H 1I8LA 4E41B 4HUUA 4RNRA 1GYVA 3U6XS 3NPSC 4XMLH 3HC0B 4IOIB 4F8TA 1X44A 1EZLA 2FLRT 3C2AH 3UTQA 2DQDL 5IK3B 2QVKA 3IFLL 3K74B 2PXYB 3BPCB 2ATPA 1XF4A 5DHXB 1J9TA 2YGPA 1A9EA 2DWTA 3RWFB 4Z8FH 1R5WA 4JRLA 5I1DB 1GCFA 5T1KA 4NQDD 1OF0A 4MJ6B 1FIGH 4OTXL 2BNQA 4LPXA 1KENL 2AJYH 3SDCD 1ZGLB 3IDNB 4YQXL 3RWDA 2HFEA 4KNQA 1T7YA 2EXTA 4MD5B 4PWGA 2VDLB 5BQ7B 4L8SB 1ROCA 5E6RB 3DC0A 2P3YA 3RUGE 2XRAL 4LSSL 3DHPA 1MPAL 4ZD3L 3HNVH 5F6IB 1KCKA 4YHZH 3E7JA 1XB8A 3QIBD 5B4MD 3ZOAA 2JB6B 4F2MA 4JFOB 2F1AA 3HG0A 1L4IA 3EJCA 3WO3B 2NY3B 5I15H 1XTLA 3DIVA 5D6CA 5HHPA 1P7QD 2AK1H 3G04A 3K71A 5HPOA 3QZWB 1XGRA 3NRPA 4PWEA 3RZCD 3S35H 5L8KB 1UUSA 3LQAL 4LPTA 5C0BB 3E8UL 2CCVA 4N3TA 3TASA 1R3KB 4GO8A 1O9VA 3BKCL 2HT3D 4O5LH 4Q6KA 1OV8A 2BHUA 4TVUA 4ZMPA 2AVFA 2XJLA 1LO0H 1CQYA 3EO0B 1ZPUA 2X4RB 3ZT7A 3ZZ1A 3GXNA 3PFUA 4HWEH 2XICA 3HVDA 4C4KO 2XX0A 4UV7H 3NCJH 2IANB 1AKJB 1RL1A 3P4MA 4PS4L 5GJTL 2CHDA 1S7RB 4XNUH 2X4SA 3F8UB 1AACA 1VZIA 2ZCKH 5GGVY 1WBZA 5MEND 2B3RA 4OIBA 4NPYB 1IBHA 1II4E 4HJ0D 3VI3B 4QF1B 2YUVA 1IAIM 1QFHA 2BSTB 3KLAB 5I1HH 1E8YA 4M9PA 4FFTA 1ZT1B 5B7MA 1OT2A 4KI1A 4N2CA 2NZIA 5I6MA 2UXFA 5LCVA 2HWZL 1JRHH 5L2KB 1G7IA 3NQIA 5J6HA 4L3ED 3C60A 1IARB 3NIFF 4L3CA 1BBJB 2D9QB 2M2DA 1XAUA 4XE0A 5EUOE 2I5YH 1RZJC 1AI1L 3Q5TA 4BZYA 2P47B 2QEJA 4YGAB 4UQ3B 4XHJD 3GSQB 5KS9B 4YDVA 3O4OC 4FNRA 4RMUA 3WELA 1MCWW 1O6SA 2XVGA 2OSXA 1QG3A 2APWA 4NKOB 1FZJA 3FSVA 5CD3B 1ZTXH 3MNZA 2XG5B 3PAVA 4ODVL 5JYMA 3HN8A 1MJJA 2ZJSL 3H3PH 4I7ZC 4N0FA 2O6FA 3EADA 4YAQB 4HG4J 1U8MB 3T6WA 2CA3A 2J6WA 3S5LG 4PRNB 4X8GA 5EOQH 1PDKB 3X3GL 4OZIF 2FATH 5HHNA 3PQYD 2UZIL 4KTEL 5EU6A 2PTTA 3GIVB 1BFTA 4PVNA 4QKXB 4U6VL 5C07A 2IALB 3FO1A 3WS6A 1LEIB 2F8OA 4M43H 4GG6A 1IKNA 1WFJA 2DIJA 2P9RA 1TJGL 3A21A 3IFPA 4WU5A 4XPHL 1N9PA 3FUJA 2EABA 3CDYA 3TPUA 2CKNA 1HXKA 1A9BA 3QNYA 4ORGB 5IVNA 5T33L 4UCFA 2HTKD 3V8OA 1EBPA 2F18A 4QT5A 4RMSA 5KJRH 2F9BT 4FX5A 3MGOA 5FGRA 2OI9C 2D7TH 4R26H 5CINH 2JKRM 4KK8C 3S96B 4LOFA 4AE1A 3V7MA 5F1IB 5I6PA 3O6FA 3UGEA 4AITA 1ZHBA 3QDAA 1Z32X 3BN9D 5IVXE 1BZ7A 3VG9C 2EH7L 4JANA 2BNRD 4JFFE 1T21B 3GF8A 4A6YB 5JW5B 1S78C 3HNTL 3HTLX 5AQ0A 5D7LE 1BDYA 4P4KA 3VXSE 4P5TB 1UWFA 3E1F1 1CU4H 5D5MA 1SEQL 3HHSB 1RUKL 1LEKB 2DQEH 1HS6A 4FABL 3TZVC 3Q6FA 3TZVA 3IMWA 3VD5A 4YDLC 5DURB 3PXHA 5FW8A 4OLXH 4OQTH 1EANA 3QIBC 1CZ8L 3WHXA 5B4MC 2YPVL 4EF3A 5HD8D 1P5UB 1WBXB 3MLTB 4UU9A 3GBNL 3WTUA 5EC1A 2DMCA 1D5BB 3G5ZB 1BGXH 4Z7WB 1KPUB 3CAFA 1QRNB 2IMMA 4ELME 3H4FA 5F21B 4NO2B 4QAWA 4GPVA 2EIBA 5HJDA 1DQML 5DVKA 5ANHA 4XNYH 2HT3C 4K0OA 5GPRA 1QFPA 3LS4H 4QLWA 1TFPA 1G9EA 2L4OA 5CCKH 1UACH 3S3PA 3U30B 4Z7QF 4DAGL 3SQBA 3ELQA 2MCMA 3F01A 4XN8A 4FQQA 1ONQA 1OSPH 1E2ZA 3IU3A 3S5LB 5I5JA 1TJMA 3APDA 3IPFA 5I26A 4G5AA 1IBGH 3LH8A 4NHUA 4G1MB 2E6PA 2FUTA 5BRZE 4M7ZB 4AYFA 4ENED 3KPTA 3BH9B 1SBSH 4Q6IB 2VW6A 4PY8I 4Y2DA 1BQ5A 4MSWB 1WG3A 4OZGE 4HIQA 4JO3L 2MCPL 4GUCA 2IAND 1JGVH 4HCIA 4P2YA 5CEZE 5IQ9A 3U2JA 1JZEA 3P3SA 4GI8A 4HU8A 5GZNA 3O3DA 4LKCB 3O4LD 2HG0A 2K1MA 3CFDB 4G6FB 5I74B 1R5IB 5C0NC 3GZPA 3FQXA 3LKRA 1I4FA 1TZ8A 2BNUB 4IRJA 4LAQH 3H9HA 4XHJC 2YMXH 5IFJB 2Y7MA 3SE3A 1NMBL 4EI5C 4EI5A 2X0UA 1MCNA 2K45A 4F57H 4YIQB 1JNHB 3RPBA 3S36X 4WW2A 1ASQA 1EXUB 2QSQA 4AMKL 4TUKH 1UCTA 5TE6H 2VL4A 3IMRA 2Y1ZA 1PYWB 3RIFF 3VFOB 5IMKA 1CVSC 1ET7A 3D85B 4WKZA 5KOMC 2WXMA 3ARVA 2WINA 4G7QB 1H3UA 2DQTL 5DJXB 5FA4B 4UAHA 3FUNA 4IK6A 5KVEL 3WFDL 4U1HA 1BQUA 4FA6A 1C08B 1YLBB 3ES6A 1NWOA 2FGZA 3OJDA 1VLXA 2W9LA 1DBMH 3GPSA 2VDKB 2VSDA 3ARDD 4QYAA 3RKDD 4ODUA 4A2LA 4BZ1A 5EFIA 2PYEB 2WWMC 4FXGA 4MA3A 3MBXL 5I18L 1BD2E 2VLRB 3IGAB 4XMXA 1UXLA 4YHYC 5EF1A 5FF6B 5C0CA 2HTKC 4DGUA 3ALXA 4CNIA 3B7RL 2XNAA 1DUYB 3UC0L 3MRJA 3O8XD 3WKYA 1ZGLP 1KMGA 1S5IL 2VSCA 2IFGA 2FEDC 4FI7A 5T1LA 5I73B 1IGJA 1W0WB 2DLHA 1RZFH 3BP7A 3JQOB 1LK2A 3QJQB 4LCWD 1NFKA 4FNLL 5C7XH 1IT9H 3II1A 3D0VA 4DP5X 4DSYA 4B60A 2VMDA 3ESPA 2XZZA 5FKAB 1AY1L 3LEYL 1MFAL 3EAKA 2X70B 3AVEA 4UTAH 3HZMA 3ME0B 2A74B 3DGCR 3GRWA 2C26A 1OE1A 3PWNB 1IVTA 2HLAA 2WJ7A 1BFOB 2CU9A 1N59B 3NFNB 1LWJA 2QLYA 4N8VG 4NUPA 1E8WA 3X14B 4PTUA 2G2NA 1Z7JA 3P0GB 2APFA 5HHOA 1L6XA 3ZO0A 3PAZA 2NCMA 5F7FA 4GG6F 4AQAB 3WY3A 1A6WL 1N7ML 4HJ1A 1ZKAA 2FBRA 1DL7H 5DHEA 3V5DB 5E0FA 4LPUA 1XMWA 3SPVA 4RFOH 3DECA 4P9HC 4WI5A 5IB2A 4XBPB 4HEMA 1MI5B 1NCUA 2HJFB 2XG4B 2ED6A 1OK0A 3U6RA 1YUHB 4YS4A 3CVBA 5E2WL 4FXKB 3LNGA 4P49A 1NIBA 2XXFA 4X7FC 3PUCA 4AIZA 3HI5L 2F7RA 4R2GD 1VEOA 1OTSD 3OSKA 2W0FB 2L04A 1V3JA 5B39G 2GTQA 2NYYD 5FYKD 2YXFA 4JM4H 3LVEA 4PJIB 5CP7B 1BWMA 1U8KA 5J8OA 2E9IA 5BRPA 2B1AH 2I27N 2P45B 4Z95H 5I8OL 3GSNL 4IIQC 2VWEC 3SDYL 1CD1B 5GRJL 5D5MF 3WN6A 2W88A 3NFPA 1GKEA 1Z3GH 1L0YA 3BESR 4HQQL 3ECWA 3QUXD 2GFBB 3L5WB 4G8GA 4B97A 3UPRA 2B1HH 2ID5A 4MYPA 4OLZL 5KVGL 1UZ8B 2ZUWA 3KMDA 3G6AB 5BNXD 1NIEA 3ZTEA 5DZJA 4QRRB 3VGDA 5ACLA 1ZVYA 2EO7A 1H6FA 1YNKH 4JO4H 4POYA 4OT1H 3SOBL 1UENA 2A1WH 5JHDA 1KT2A 3L5XL 3OKDA 5E6YA 5EIVA 4ZUSB 5I5MA 1LO3H 3IU4H 2X28A 2WQWA 2VDQH 2WN3A 4KRPB 2DQGL 4LIQE 2UVEA 3F04A 1P5VB 2HX8A 2ZOTA 3EDDA 4JM2B 4OSUH 4GRLB 2N3JA 3D39A 5E7FA 5IVOA 3U4BH 1FNGA 3C5ZB 4PLKD 3K72A 4GKZB 2YAFA 1ZAGA 3L3JA 2OMWB 5B1JC 5B1JA 3T0EE 3VXUD 3TBVB 2CLZA 4GUPB 3ZYJA 2KZ1B 3ZDYE 2IGFH 5AVSB 3TN0D 3LEVL 1UWGH 1MJ8L 2QDWA 4KUZL 4FP8H 4HIIA 4FQ2H 3BZ4A 4WGVB 5EPMA 2K8QA 1LDPL 3D85D 4XMKH 4ZXBC 2ADIB 4ZXBA 3IFNL 1DQIA 4NJ9L 4KJQD 1JCVA 5DHYA 3S3SA 2BVOB 1HX0A 4EQ3A 5DMYA 3DUUA 4HS8L 4UQ9A 2YD1A 1E6JH 2Z31B 1WTLA 2WLYA 3ILQC 3O8XC 2E7HA 4AEIL 5K69A 4K5OA 4LDOB 2YRBA 5HDWA 1CDJA 5E9DE 1CGYA 3U2IA 4PJGA 3MNWA 1SQMA 3RVUD 5CEYA 4DP7X 3JWOL 2RQ8A 2FEEL 2FO4A 2VE6B 3KPMA 5KAQF 4BBWA 5CKGA 4JN2A 4MDRA 1P6FA 3FU7A 5B39B 5KTEH 1UT2A 3M7OA 5LGJA 1VFBA 1E5YA 1OAUH 4NWTH 1WJ3A 1XB3A 2IPKB 4WW2F 3AMKA 4UT9A 4YVNA 1CDIA 5F3BB 3OV6A 4KO7A 3ULUE 3FB6B 4C8XA 5IR1B 3HG1A 1H