1A6UH

B1-8 fv fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords B1-8 FV (LIGHT CHAIN)
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6uH00
4JY4B 4HKXB 1K3ZA 3QJHB 2NY7H 4KMQA 2N7BA 4PJGB 4B7IA 3T4YA 1YPZF 2IH3A 3I84A 2XA8L 1RIHH 2PCPA 3UPCA 2JB6A 4RGMB 3ZHKA 1CI5A 4NZRH 1C5CL 4ZSOB 5J1TC 4HC1A 3NCYS 3TZVD 2BOCA 4P2RE 5EU4A 1R5IB 3GK8L 2PYFA 1V3MA 4HWEH 4HFUL 1HHKB 1G9NH 3DHMA 4O5LL 4WWID 4GW4B 2NY6B 2VN7A 2NR6C 4QHUB 1YEJL 2MCPH 3HN3A 3H9HA 1KCVH 3O3BB 4JFEB 2YKLH 3JWDL 1QP1A 3C8KA 5IV2B 5JMRA 4RFEA 3NFSH 1X7QA 3QDGB 1YN6A 3CSYA 4Q9BA 5J11C 3JWDC 5HYQA 1N0XL 3TPUA 1PG7W 1IAOA 1S7XA 1TETL 4NN5B 3VXOA 3ABZA 4WO4B 3MRMB 3QG6A 3MV9A 3VMNA 4XP5L 2ADFL 3QUMH 4K2UL 4K9EH 3L3HB 5IQ9A 1CFNB 1S9YA 4MAYD 4Y5VB 1QO3A 6FABL 1BZ9A 1V7NH 4KJYA 4XPGL 2BHUA 1Z3GL 5HHMB 1JWMA 3SDAD 2VR9A 4CW1A 3K1KC 4QHMA 1A64A 1T04A 3GMPB 3X12B 3ILPA 5JHDA 1T21A 5GGUA 3IRZA 4E0RA 3DI2B 4QRPE 5KVGH 1FO0B 2BVTA 4LLQB 3T0EA 1HOCA 4RRPG 4OCSH 4XVTH 4OLUL 4RNRB 1R3LB 3STBA 2YD4A 4X0KB 1WBXB 5GISL 4PJDF 1OAZH 2NXZC 3N9GH 2Z31D 2A73B 3U36A 5SWZA 4YE4H 3WXWH 3C08H 5ISZE 1U8JB 2RIKA 5DUBA 1N0LA 4Y1AD 1H5BC 4DKEL 2BFVL 2IG2H 3GJEB 3DNKA 2DD8L 3S97C 4PV8B 1FG2B 4FABH 2GK0A 2FHBA 4AT6B 1K2DA 4LCYA 4FQ1H 4JANA 2WWMC 5KSUB 3F58L 3REWA 4FXGA 3SCMD 3WL9B 4L4TE 2PR4L 5E2JA 4LDEB 4JZNB 3P4MA 5FYLE 3TYFA 1HSBA 2YSSA 4MQSB 3IDNA 4NP4H 2MMXA 1WWCA 4YXKL 4H5SB 7FABH 4GG6B 3IDUA 1EGJA 1KTLA 3HC4L 5FYLL 2NY5H 3DMMA 4CL7A 3S35H 2G9HB 4L8BA 1M7IA 2CDFA 3MC0A 3ZL4L 1T1WB 2R39A 1EO5A 4G43A 3UP1A 4JPWL 2YBRA 2FIRT 3VXME 1N2RA 2PYED 3FO2B 3B83A 4GMTH 2E7HA 3IDXL 2P5WA 3O8XB 5K9QG 1YNTB 3FZUD 5D7SH 2FX9L 2W60A 4Z7QE 1RJZA 1T0NA 3PL6C 4MJ6A 5KN5A 1S5HA 3QUMB 3OAUH 3BZEB 5GSRA 1FYTD 1QZ1A 1MI5E 4GLRH 2NXYC 3QCTL 5DEZA 5I1CH 4B50A 3TBTB 3HI6L 4Y16C 4OKDA 5BW7A 3F6LA 2KDGA 3BE1L 3LN5A 4DGIL 1A6UH 1AI1H 1AO7B 3T8XB 5L2KE 4JFXA 2G2RA 4UTAH 3BGMB 5FFLA 2AJYH 5DI8B 1J0HA 1P4IH 5IHZB 1HHGA 3T2NL 1YEEL 4TSCH 2DYPB 1MIML 1OAQL 3HE7D 4YK4C 3VMPA 1PW3A 5I19L 2XPGB 3MRJB 4LLUA 1ZA3B 4ZUUB 4YEFA 3CLFL 1CL7L 3NCFB 4N8CL 3UCRA 1MCJA 1F11A 2AXJA 5GPRA 3DURA 3T0DA 4XAKE 2NX5E 1CICD 5F21B 1WVZA 3RRQA 2X4NB 3NCJL 3TNNB 5IMOA 3MV8D 3MOBL 5KVEH 2CRZA 5JQ6L 2B1HL 3MV7D 3BUTA 5F9JA 1CVSC 2P24B 1LEKB 4NQVA 1GHFH 2FECL 4G6JH 1I1AA 3UTOA 5BMFL 3QJFB 3QXAA 4KY1L 1NFIB 4PJ8B 3O4LE 4GG8B 1R3KB 5ANME 5HDQH 4MDIA 1M4KA 2FLBT 3O6KH 3WN5A 3QFJA 3I2CH 1GC1H 4JHWL 1YUHA 1BVZA 1OAKL 5EORL 3ULSB 4PBVC 2I9LA 3FB7B 4TVPH 1T5XB 3WXVL 5E6ID 2F15A 4IIQB 5DTFB 5DVLA 3N85H 3T2PA 2ZWLT 3OL2A 4LKXA 5CBAA 2IALB 4P5TC 4XPTH 1DUYB 4JFOA 2XV6B 4BELD 2W65A 3V6BR 3S96A 4BSWA 1UQSB 2GTZA 5GGVL 1LEGB 5IBUG 3BQUC 1NGZA 2UVFA 2NLJA 1XZ0B 3QIUD 5T33L 3S6CA 1K6QH 3PP3H 4FNLL 3VFGL 2QBWA 1IAII 5JPMB 2Q76B 4HUMB 5IB2A 1BIHA 3KPNA 4G9DB 4Z7VB 4YXHH 2AK4D 3MYJB 4JB9L 4I2XB 4L8DA 3BPCA 3VH8B 4WJ5A 1C5DB 4RDQG 5LJYH 3HS0B 4QOKA 1E6OH 2H2SD 5TF1H 4GBXD 3VFVA 1MCWM 5HGAA 1DQDH 3KPSB 1ADQL 3FO1A 3RI5K 4N0YL 2R0ZL 4N0CC 3HMXA 1U8QA 3L1OL 2DDQH 1KJ2H 2EDHA 1XF3A 2EH7L 3LV3B 2VSDA 1EUUA 1XIWD 5FHAH 3HTLX 3JWOH 1F4HA 4KKLC 5E9DB 5TJWK 4AIZB 4M6OH 1UENA 1EZVY 2J12B 4Y4KA 4P3WA 4JGUA 3R8QA 2DQTL 3BVNB 4KK9C 4UU9B 2DI7A 3UJTL 4C54A 1FNAA 4JG0H 1PAMA 4JKLA 3CFCH 3BYTA 1OVZA 1FVEA 1Q9OA 2R9HC 5JDSA 3V5HB 3QDME 3BT2L 3HHRB 4KV5E 3MRIA 3Q1SH 1K8IA 3FRPG 4ZNEA 2DQJH 1CGTA 1WC7B 2Q6WB 3F7VA 1F6LL 4NRXA 5HHNA 1PSKH 4GQ9H 5IKCA 5DD6B 3GSNH 4QYOA 4HUVB 1IBGL 3CJJA 5AWNH 4X99B 5AAMA 2CH8A 4WFGD 4MGXA 4KTDH 3KLAA 4DCQA 4YQXH 4LCWA 1FP5A 1D5ZB 1ULVA 3UTTA 2JB5H 2QADB 2VZVA 4N5EC 2YD2A 3V5DB 3LD8B 3KXFA 4PJGF 3BX7C 2D9CA 3TJHD 4YC2C 4F8TA 4U1IB 3SE4A 4ZDHA 4MCYA 4RIRB 5BRZB 1CDGA 5L8LB 5CZVH 3D3VD 3NTCL 1DN2A 3MNWB 5DJXB 5JXEA 4HIJB 3TA3B 1WCBA 5C09B 3I6LD 2EDOA 2F58H 1RIUL 1S7WA 1Q8MA 25C8L 4X9IA 1QFWI 3ZKMC 5BXFA 4JQVA 3BPOB 5F7EH 3NAAH 1A2YA 4P59L 5B8CC 2VLKE 4LEOA 4RA0C 1HHJA 1DQMH 4MDJB 3LVEA 1HIML 2XACC 1HSAA 3EO9L 3BRGC 3BN9D 1A7RL 1HILB 3GJFK 3UYRL 1R24A 3P4OB 4AG4H 4U1LA 3HZKB 2ARWA 4U31A 1I7RB 3FB8B 1PLGL 4LARL 3VE0B 1HH6B 2A83A 1RK0A 1I1YA 4KAQL 4R7NA 3FOMB 2C9AA 5E5UB 3ZO0A 1PG7L 1ZT4B 4Z7UE 1FNSL 3GMMA 4X98B 3RWHB 1UZ8B 1RZKH 4OM0L 2OTUA 2W9LA 2YA2A 1EDQA 5HHOD 4PP2B 1MFDL 1L0YA 2BVPA 2QHRL 3MRFB 4YPGB 3TBVA 4XXDA 4IRSA 4P0DA 1UVQA 5B4MC 2PW1A 1S7QA 4PJAE 5BS0A 1JGLL 5CGTA 3GSNB 3N50A 3I75B 3ILQD 1W72L 1LO0H 2X4OA 1B9ZA 1FVDB 4RRPA 5BZWB 4NO0A 1DUZA 4BSVB 4U1MB 2Q87A 4I3RL 3VXPA 1I1FB 1FJ1B 1I9IL 5DT1H 2Q86B 4X6EB 3OJDB 2H26B 4Y19B 5DVMA 5IFJA 5FO8A 3CX2A 3IJYB 5D7IE 1W8OA 1YEIL 4NKOA 4EOWH 3MGOB 3T77B 4MS8C 4DEPB 5EH1A 5KSBB 4O00A 1QA9A 1UADC 4DUXA 4HGWA 3TEUA 1YECH 1OW0C 4K55A 2CIIA 2DQDH 1BX2B 4RFNC 4YHOL 3ARDC 3ZHDA 1IRAY 4XCFH 4IRJD 2RAMA 5DC9B 5F89B 2YZ1A 4GG6F 2BJMH 2YXMA 1A0QL 2O5YH 1NAKL 4UT6L 3RX5A 1A1OB 3K8MA 4RISL 1CDYA 4AIXA 1HWGB 3PWVA 4MNHB 4U1KA 3CZJA 3ARBB 2AJVL 5LGJA 2ICWA 3WIHA 2AEWA 2I9TA 5HD8D 1M7XA 4NN6C 2AEQL 2HT4D 3JV0A 1DQQB 5J06A 3RWCA 3GSQA 1NMBH 4UIKH 5I8EB 5B3NA 5TE7L 3D85B 2YPLE 5JORA 1EEQA 4P4KC 8FABB 4KUZH 4ELMA 1DQJB 1G6RH 1TLKA 4HK0A 5CJ8A 4Z6AT 3G6DL 3HZYA 2VR4A 2ZUQC 2JF1A 4WNQB 5HYSG 4LDLB 4HZAA 2G5BA 5E5MA 1QPXA 1YNKH 3MLVH 3QDGD 1JGVL 5GZND 4NCC1 1KULA 1NANH 3UTSB 5CLWA 2WQRA 5D93C 4Z0XB 1UEMA 4GUPA 5AZ2H 1JNNL 1D5IH 2ATKB 2V9TA 2COQA 1QTYT 3QULA 1EFXB 3QQ3A 1INDH 4WUUE 2Q8AL 1HYSD 1A5FH 2YA1A 3TT1H 1V3JA 3RWFB 3JVGC 1IEAA 3GM8A 3W82A 3HC3H 1KYOK 3RA7H 5GS1B 1T3FA 1JV5A 1OGAB 4KHXH 1G84A 5HHMD 4OTXH 1J5OL 1LO3H 3MJ7B 3UDWA 3WSQL 3PE9A 3VFPB 3QIBA 3QNZA 4U05A 4YHZH 3S36H 2EZ0D 2MFNA 4OF0A 2HN7A 2R56H 3GSOB 3W5MA 4HV8A 4MHHG 4HPOL 1DL7H 4NFBA 3H3PL 1K5NA 4Q58C 4IMKA 3U0TA 5CEZE 4F7CA 3EYOA 3VWJA 5C9KA 3Q5TA 5EZLA 1A7OL 4UUJB 5BJTB 3A6OA 2IGFH 2UWEB 3ARPA 3ARRA 1FVCA 3SO3B 5D7LB 3TN0D 3AB0B 4JLRA 4MNQA 4OIIH 3O6MH 3D39E 1IM9A 4PJ9C 1S8DA 3U1SL 5TDNA 5F93C 4N90D 1H15A 3DRTB 3CVHL 4EN3D 4JY5L 2GCYA 4FQ2L 2X9XA 2R8SH 3KNBA 1MCOL 2CDEA 1FBIL 1B0GB 4NKMB 4KROC 5SWQA 3UJIH 4OAWB 4NYLB 5GRJL 2R23A 3RX8A 4G8GD 5MP6L 1MCPL 4PJXB 3I02B 4FQQA 4DGYH 5HVFB 4WU7B 1G6RB 1F8TL 3PABB 2X4PA 1T03H 4Z7VF 1EEYB 2DWEB 2PUQT 2R1YB 3TIEB 3Q6FB 3EDEA 1X5ZA 1G0YR 3VMOA 2O26U 3TO4D 4O2EA 1OWRM 5BQ7A 5E2UH 5TE6H 4HIEA 5I1LB 2XQYG 5I17B 3ULVL 1J8HB 4YBQC 5J7CC 3KJ4B 2GJJA 3M8OH 1VDGA 5A2FA 1JPTL 3ULVC 4MCZA 1AGEB 1VB9A 3OGCA 3PF2A 1NGPH 3C5JB 3V5KA 5F3BA 3O3EA 2X05A 4KRPC 3O3DB 4E42A 5CP3A 5FIEA 1G7JB 2HFEB 4HGKC 5FECB 4PRDA 5CJOL 2EIZB 1LMKA 3E6FA 5DVKA 1BEYL 5ICZA 3SKNB 1IILE 2BVYA 3I3BA 1N26A 4WFFE 3LPWA 3AM8A 4XBEH 4BZ1H 1GOFA 5KSAA 3PGCA 5GGTH 1AXTH 4B5EA 1KJMA 4L3EA 5FYKE 2VXVL 3VW3H 3EZ8A 2DYPD 5FGBA 1CFSA 1ZLSH 1WZ1L 5EU5B 2QQQA 2B7DT 1A6ZB 1GGTA 1OSPH 4N9GB 3PDOB 4YNYA 4UBDC 5FYKL 1FL5A 2J8OA 5DMKB 3RVXD 4R0LC 4R4BB 1RMFH 4EXPX 1JNHA 3HPJA 5HI5C 3WS3B 1MEXH 1FFOB 1HXMB 1AQKL 2ZCLL 1DBAL 2VDPH 4M8QB 1JTPA 4TTDD 1XAUA 4G9FE 2YD9A 1JPGB 4NKDB 2DJ4A 5CILH 5ICXA 3KJ6H 3N1FC 5IQ7L 3HZVB 3W39B 5K9KB 3GMOB 3V2AR 5CCKL 3WV0A 1GPOH 1J1PL 4PJ8D 1UCBH 4L8SB 1A6WL 1U8KA 3BKYL 4WTZA 1RUML 3IAPA 3FFDA 3QFDA 3MUJA 4UAOB 1H3VA 1AD9B 2M26A 4HT1H 5GQBA 2XXMB 1JBJA 1JYXA 4NQCE 4P2OC 4ZXBA 4JJHA 4ODHL 5D96C 3MLRL 3LEVH 1EHLH 3BZ4A 1N5AA 5IMMB 1JNLL 1IGMH 2YWYA 1J11A 2BSTB 4K7PL 3WO3B 4U6HA 5IWLC 3HRPA 1MREL 1U8PA 2CXGA 4YFLF 5C92A 1FFRA 4F7MA 1FNGB 4JM2C 1CXHA 4ZPTA 3MLXL 5I1JH 1TJIL 4BKLB 4I18B 5C07B 4EDWH 5I75B 4NQEB 3CU1A 2Z93B 2F53D 4H25A 2OL3B 4HIXL 4NQDA 4PD4J 2QQLH 5C0IA 1S3KH 3BPNC 3SBWA 3EDDA 4GLRI 1FFPA 1OAYH 1M71B 5J8OA 1I85A 5TF0A 4DN4H 3IAQA 4FQXC 4NM8H 2ZUYA 1NMCC 3KPSD 4N0UE 3NIDE 2HKHL 4YHPB 4OLEA 5H37H 1QD0A 5EN2A 1KLFA 4TPRH 3P11L 4NFDA 4QTHB 1AE6H 43C9B 1URLA 1E4KA 4W6XB 2JJUA 4OF6A 5D2NB 2EC9T 4LEXH 5E9DD 2EIDA 4LVNB 3MBXH 4NJAL 4S1DC 3FO9B 4H20L 4GAJH 3RY4A 3NCBB 1DFBL 1CK0L 3RZCB 1HH9A 2XZCL 3DBXA 3HE6D 3O2DA 4YHLH 1G7QB 2ARJB 4PRHA 2Z9TA 1ERNA 5JO5B 3OKEA 1A6AB 2C3VB 4LSVL 3STLB 1UXSA 4FP8H 4X6CA 2CKBA 4MXVE 2HTKC 1IQDA 2XFXB 3CLEL 2DQUH 4W6YB 4XTRD 2MJWA 4HDIB 3PWPB 4X9BA 5KSBF 1NBVL 1R3IL 1ITBB 3PWLB 4MNGB 3X14A 1AY1L 2QKIA 3D0VB 4NFCA 2DMKA 1VADA 4BA8A 3ARGB 2AJXL 4MJIA 4GW5B 1WT5C 5HDBF 1AQDA 4TVPD 1XH3B 2H32H 2QEJA 1KJ3L 3U83A 3ECBA 5CINL 3WLBA 1FYHB 2QJDA 4JFYA 1BJMA 2QADD 3HG1E 2J8UB 4DVRL 3ZYOA 1VENA 3NFPA 4G7YL 1QEWB 1O7SA 4P9HC 4IDLA 3EO0A 3ARTA 1FH5L 3R1GH 4DKDC 4XT1C 1I3RA 3T1FB 5BRZD 2XTJE 4XNQA 3S5LG 4XAWL 1J1XH 4DAGH 2OMBA 1VACA 2W9EH 3TBSB 3DSNA 3TA3D 2HJKB 4QRUA 4UOJA 3FQTA 4FQIH 4ZFZA 1W8NA 3MGAA 1IGTA 2NY1B 3W0WD 4P23A 2XTJC 4G6KH 4YDIH 5KZCB 4V1DB 5T3ZL 4OCXL 3MXVL 2FH8A 2ZOKA 1VGEL 1BFOB 1U92B 2V2XB 2BERA 2P8PB 1XF2A 4L29A 4JFFB 3MUGB 3WIIH 5HYSA 4RSVA 1ZHBB 3QWRD 4N1EA 4H8WL 1TVDA 2AERT 1QNZH 4LKCB 4G80A 4AEIL 5CFHA 2V7HA 1NGXA 4H8WC 1S7SB 5T3XL 3O11A 3MRPA 2OR9L 2E7LA 2XI9A 3TM6A 2F54A 1MCEA 2W0PA 3FQNB 2XKNB 2R4SH 5H8DA 2Y72A 4MD5B 3CD4A 1NMAH 3G08B 1IGYA 3OKDA 4YFLI 4OCMC 2CLZA 5DZNA 5F1SA 2VZOA 4WFHD 4LBEA 3KPOB 1KOAA 1MCHA 5D8JH 5C0BE 3FFCB 3QHFH 2UWEF 4GXUM 1WUNT 2H32B 3IDYC 4MMZC 4OBSA 3GB7B 3EFDL 4M48H 1QRNA 2WINA 4KVNL 3SKJH 1R0AH 1UM5H 3HRZA 4Y19D 3SQOL 1R5WA 3LQAH 4HJ0C 1INQA 3EGSA 3QEHB 1OP5K 3JUYA 3Q2CA 1CYGA 1OTTC 1P53A 5T1DH 1WJ3A 3RWEA 3PL6A 1JPST 3RY6C 5FDWB 2FDBP 3Q5OA 4PJXF 1X4ZA 4EQ3A 5K9JL 3HI1B 3P77B 4BJLA 5HYEA 1FFNA 4X5WB 5DJZB 2FWOA 2C4FT 2EE3A 3A6CL 4NGHH 4RAUB 1PKQB 1VEMA 2V17L 3LKSB 3O2WL 5EZOH 4PJFA 1OF2A 2BNQA 4U6VH 4C57C 4O02L 4AEFA 4WWKA 1QHPA 4HQQL 4Z7WE 3VXRD 3VGAB 5SWSD 4QHKI 2OMNA 1OCWL 3VWKC 3O45A 4BQ9A 2D4FA 1RU9L 3EAKA 5MERB 5M7QA 5T1LA 2R2EA 5GRWA 5KG9A 2HAZA 3NN8B 4FQLL 5D6DC 4YBHA 3BDYH 1CD1B 5FXCH 4AEHL 4JRXB 1EERB 4YDJA 3D85D 4WW1B 1HEZB 4OZFB 4JFZL 3SKOB 1G0DA 3PDDA 4JDVA 2VDQH 3HUJA 5FCUL 4PJEA 4ODSH 1T0MA 1U8LA 2VLLA 3BKJL 3OMZA 4HF5H 3KYKL 1OL0A 4X4ME 2H1PH 3UTSD 4HPYL 5JR1L 3T3PE 3VFOA 5I1HH 2FSEB 3NPSC 3RQ3A 4OSUH 2A6KA 3QIWB 4LU5H 4TNVF 4R3SA 5TPWH 2MKLC 4F7PA 4C83A 1OT2A 5F9WB 3QXUA 3IDJA 1HINH 1CD9B 4WY7L 1EFXD 2AXFA 4K8RL 3WFBL 1A4KB 4ZFFB 5IHUH 1NEZG 4K8RC 1MUJA 1UACH 1OGAD 3P0VL 4NNXB 4GRLA 5C08B 3D48R 3GBMH 1LE5A 3DUSB 2ADJB 1JCKA 1KELL 3O2VH 2P5EA 3BP6B 2XY1A 5E8OB 5IB5A 1BREA 1WISA 5IMLA 3LZFL 1LO4L 4GS7C 5GRZA 3QA3B 1WFNA 1Y0LA 3QSKB 5E8NA 5E6YA 3LKNB 3NMEA 5MENB 1HDMB 3H0TB 2BOBA 3QDJB 1B90A 4RWHA 2R1WB 5KTEH 3D5OF 3MREB 4I3SH 3QHZL 3TZVC 3CIQA 1RFDH 1K4CB 2WK2A 1U42A 4LCCC 5D2LB 5DD1L 3B8YA 4J6RH 3U6RB 4WUKH 2GAZA 4NZDA 4RMVA 3IJSB 1QLEL 2UYLB 3K4AA 4XCEA 5TQ2L 4TRPL 5C86A 4DZ8B 3HMWL 5BVJA 1ZT7A 1ADQA 1WAAF 2JJWA 1QKZH 1KIPA 1VEPA 5FKPB 3DXAB 1KENH 4RZCB 3B9KA 3S35X 5CAYB 1XGUB 2B0SH 4UTBL 4XP6H 2I26N 4ZTOH 5IW6B 1ZHLA 2YK1L 2QQNL 5HVHC 2CRYA 1BPVA 1IAMA 2ZG3A 3VFMB 1MCIA 4P9MH 4IEFB 4LCIL 3SDCB 4ZAKB 4X83A 4QNPF 1YYLL 4U0RB 3LIZL 4LMQI 3QG7L 2BRRH 5J6GB 4KVCH 4OGXL 1BQHG 4NWTL 1J8HD 5T1KA 2R0LL 4ENED 4MA8H 4MAYC 3VXTA 4UV4H 3ALPA 1WTGT 4JJ5B 2FBJH 4Z5RA 3RZWA 4GAYB 3O3AA 4PUBL 2NNAA 1RZJH 3SDAC 4PBWD 4PJ5A 3B3IB 4TUOB 1KT2A 5ALCH 1NANI 4OFDA 4KXZH 2MSPA 4Y1AE 1ZANL 2C7UA 5BVPH 2ZP0T 1Q1JL 4D3CL 4NOBA 3NOIA 4JGMA 5D70L 1RZGB 3TVMA 3DV6A 2Q7NA 3TNMB 5HGHA 1XGPA 2Z31C 3E6HB 2F5AL 1T1ZA 4DW2H 3RGVB 5LG1A 4Y5YC 3IJHB 4I48A 2AQ2A 2VIRB 2W0LA 1G9ML 1OD7A 4X6DB 4ZUWB 4LSQL 3TIDB 3EYVA 1NDMB 4LRNL 4LVHB 4IJ3C 1G7PA 1GGIL 3VU2A 2AV7A 1EMTH 2FJFA 3QO1A 4P3DA 4YPJA 3UBXG 3W9DB 1PKOA 4LF3B 2WUBL 3NCYP 3SCMC 1FV1A 1I8MA 1KBGH 3QUZA 3RFZC 1YMME 2J8UF 5HY9B 2D0HA 2LQRA 1N6QL 4Z0BL 5B8CA 4EI5B 1I7UB 1S7RB 3HAEH 4ZOCA 5DJ2A 1T20A 1AXSB 1YPZE 3KPRA 4FZ8H 1I1RA 3AS0A 2L0DA 2X1PA 4KKCD 1G1CA 4PJCA 3TCXA 5HPMB 3QDHA 1VEOA 3MLWL 3WD5L 1SJHB 3OJVC 1Q9KB 5ID0A 3OJMB 3S5LA 2H6PA 3B5GA 5D72L 1IC4L 5CJXA 1CGSH 1UXWB 3LOWA 4EUPG 43CAB 4QRSA 1TJHH 3FB6A 4PYGA 5KJRH 4LNRA 5ETUA 3VD4A 3FZUC 4HH9B 5IVXA 1FZMA 2XOTA 4Q2ZB 3SDDA 3HNTH 4XXCC 3CXDL 2R4RH 1MAML 1FNEB 3BUYB 2HWZL 2NZIA 5EU6D 2DLEA 2ITDA 4CADA 4FTVB 1SJEB 3WUWA 4LPWA 4RGNB 4XGZB 4OFYA 4X4XB 1H8NA 1SY6H 4H1LH 2PETA 5SX5K 5J1SC 1U3HB 4OCRH 3M1BA 5FA3A 3KDMA 4GFTB 4UDUB 3OSKA 5EO0B 1T83A 1SEBA 5ALBH 5JUEH 1AP2B 1BQLH 1W72A 4LPVA 2YRPA 4HLZH 1PZ5B 3HE7C 4LQFL 2V2TA 2MWCA 2EYRA 3KR3L 4O2FA 2ZSVB 4NUGL 2BVEA 1F58H 1NC2B 3IF1A 1BVKA 4KK5D 3TO2B 4L9LB 1BOYA 2LAGB 2Z35A 1Z9MA 4JKPH 2EE2A 3MV7E 5DD5H 3MRHA 4ONHB 1KPRA 2HVKA 5GS0H 1MCCA 4DWHA 1CICC 1N7MH 5IFHL 4X7FC 4XB7A 3BKCH 3I9GH 3AMKA 5DQDH 4PJDE 2XN9B 4DGVH 5L9DH 4M1DL 1MAKA 4L4VB 4I5BA 3HAEB 4AH2A 2BNRE 4N8VA 4JVUA 2LTQC 4JZOB 5DFWH 5GHWH 5MEOA 2FATH 3MJ9L 4HC1H 3PG2A 1MAJA 2FR4B 5DEFA 5IGXL 1MQKH 4QHNA 3PWPD 1SQ2N 3MGTA 1YN7A 1LE9B 2VJXA 4D0DA 1NBYA 1AH1A 1QSEB 3L7EA 5EPMA 3DUUB 4QF1A 2OZ4A 3BKMH 3FB5A 5E6IC 5F9OL 1RUKL 1F90H 3ARGD 1IE5A 2C1OB 4FQCL 3MBEB 4P4KA 5E1AA 4OFKA 3KYOA 2NY3B 1UYWL 3QUKB 4NQSB 4JZJB 3WBDA 5IM7B 2A6DB 3ARED 5DD0L 4S1QH 3QIUC 3L5WA 3BP7A 3X13A 1LD9B 2A6IA 2ICEB 4H1LB 1TIUA 5IB1B 3ARQA 1RIVH 2VDOH 5DVOA 5IMKA 1BD2D 1KB9K 2P8MA 2XWJA 5LCVH 2YD8A 4OQTA 3SDXA 2FX8H 4NNPL 1U6AH 1W2KT 4J2XA 1TNMA 4IM8A 3OR6A 2HRPH 4CVWA 3UZVB 5ABDE 4LSPL 4BFBD 4AY0A 32C2A 1T2QL 2VC2L 2BY0A 2FX7L 2NY1D 2H2SC 3LPGA 3QAZC 4J3UA 4M7JL 4GBXC 4QGTA 1T6WA 4PJ7A 5FO9A 4NQTA 2B39A 5KZCD 4V1DD 4QRTB 1U0QA 1U58A 1Z0MA 4ISVB 1UFUA 1CFTB 1J9CT 1JRHL 2Q7YB 4RX4D 3FMGH 4JN1L 5FUOL 5HXMA 1XIWC 3G6AB 4P57B 5KOMC 3RTQA 2AK1H 5H35A 3SJVA 4HS8H 4ZFGL 2ENYA 3IFOA 1DBBH 5ADPH 1UWXK 2LFGA 1MLCA 5KBNC 2KH2B 4MXWH 2FL5A 5ID1A 3I50H 1JRHI 5EBMA 2B1AH 1YEKH 2AKRA 2Y06L 3QWOA 4MA3A 2IH3B 3T4YB 5A43C 3WHXA 3E8UL 2PCPB 4PJ9A 1MFNA 2JB6B 3KLDA 1P4BH 3BD4A 4HWZA 4NZTH 4NM4L 1IGFH 2AJ3A 4NO2A 4OZGA 1Y6NR 3PHQA 5DJ6A 2BOCB 5EU4B 5BO1H 2E7MA 2PYFB 2PXYA 1LILA 1P9MC 1CXIA 1GGCH 2P4AB 4G7VH 5HHXH 5CWSA 5L88L 4HKJA 4P46A 1DBJH 1MJ7L 3RAJL 3D3VE 3FFCD 1N5YL 2D7TH 3H9HB 5DMYA 1MNUL 3C8KB 1T1XA 3FQXA 1EGJH 4RFEB 1X7QB 1Q0YH 1YN6B 3CSYB 3TJHC 5HYQB 3CH8A 1LO5A 1JPFA 1KCKA 4AM0A 3TPUB 3O6FA 4OV6F 2HJLA 4R8WL 1IAOB 1S7XB 2I60L 3VXOB 5D2LF 1FZOA 3QG6B 1MRDL 3MV9B 1RHHA 2Z8VC 4XVJH 4X8JA 5J13B 1P6FA 3D2UA 1FGNH 4DK6A 1YNLL 5IQ9B 1S9YB 2XRAL 4R90L 1RULL 1QO3B 2VH5L 1BZ9B 4G8FA 2PW2A 1Q94A 4KJYB 5LWYL 5GJSL 3BW9A 5I71C 3F7QA 3EW3B 5MEPA 1JWMB 4UOW1 1OQXA 4CW1B 2MPAL 1CIDA 3EYUH 4JQIH 1A3QA 5DLMH 3MRDA 4QHMB 1DR9A 1T04B 3ILPB 5JHDB 1T21B 5GGUB 4E0RB 2DMBA 4JG1H 4HEPG 3BEVA 4X80H 3T0EB 1HOCB 3LH2H 4KC3B 2A9NH 3H9SA 2EDLA 1H8SA 3U36B 5SWZB 4Y8DC 1F97A 5DUBB 2CD0A 2FZ3A 4JRXD 4PYHA 1AKJA 1FNHA 1FZJA 4GRWH 4G42A 4TQEH 3JXAA 3MLUL 2GK0B 4R0LA 1PDKA 4YDLB 4G5ZH 2F8XC 1K2DB 4LCYB 4JANB 2APWA 2VZSA 3FJTA 3SKMA 3D87B 3V6FA 3REWB 4FXGB 1E0OB 4ONGL 4H0IA 1OGTA 5EBGA 4HAGA 3P4MB 1D9KA 4V2CB 2J88L 3VGFA 3TYFB 3ILQC 1HSBB 2YSSB 3IDNB 4PRIA 4OQ1A 1WZMA 2IQ9L 2Y9RT 2RFXA 3QIWD 4IMLA 1II4E 3W9EA 4JEGB 1KTLB 1SHMA 4MA7H 3UO1L 3DMMB 1SJXA 4X6DF 3TV3L 4YUEL 4L8BB 1M7IB 2CDFB 1F5WA 4WCYL 4G43B 2YBRB 5GRUH 1N2RB 1U8HA 1CU4H 2JK5A 4U1HA 1NCWH 2P5WB 3SY0A 2W60B 1RJZB 1T0NB 1QBML 5I9QC 2YS4A 5KAQG 4MJ6B 5DQ9B 5KN5B 1S5HB 3H2WA 3GIZH 5GSRB 5C08D 2IANA 4PJGE 1NKOA 4Y5XA 3S4SG 4MD0A 4UIMA 3JTTA 4P5KA 1QBAA 3MSPA 1TMCB 3LN5B 4ZSOE 3SE3A 4JPVH 1IFHL 5HVWA 1J0YA 3BDXA 5TFSH 4ORGA 5FYJD 3LY6A 3CC5A 4GAGH 4I77L 4JFXB 4JM2A 2G2RB 4KGJA 4X7TA 3OBAA 3U4BH 5ACZA 5MEND 4APQA 3QDJD 2DQHH 1HHGB 3QRFM 2IH1A 3LSOA 1UM6H 4I0PA 4KPHH 1KC5L 5HD8C 2DQIH 2CGRL 1IC7L 1E27A 2HT4C 4XC1L 4EUPA 4LLUB 4JFEE 4TSAL 3HMXH 4P2YA 4XNUL 1JPSH 4FQXA 3QDGE 2CUIA 3QXWA 1FCGA 1F11B 4F80A 1FAIH 2UUDK 3DURB 3RUGA 1TJGH 4GRWB 3BP5A 2IFFL 1UKSA 5EUOA 2P1YA 5IMOB 5DR5L 1NFKA 5GZNC 2VZ3A 5HHVL 3A6BH 3H42H 3OZ9L 3QEQD 4GXVL 4EDXA 5F9JB 4NQVB 2YEZA 3K80A 4ZAKD 3TH3T 1G7HA 1I1AB 4NN5C 4RGOL 4WHYG 5HHME 4WO4C 1FAKT 1F4YL 4WVRA 1DZBA 3QXAB 3TYGL 2V7NA 3THMH 3UTQA 3NVQA 3L3GA 1MCBA 3CK0L 1HYSC 3NPZB 3BPLC 4MDIB 1WK0A 3WN5B 3QFJB 3C2SA 4YHIA 3OGOE 5HYFA 1YUHB 2VXTL 1PQZA 1ND0A 4KK6D 4DKFH 4XC3H 5E56A 2HRLA 3S37L 2MHAA 2I9LB 1I7ZA 5JW3L 2IBBA 2Y4SA 2J5LC 1WT5A 5D5MA 1BWMA 2O5ZL 2EZ0C 3N1PC 4OZHA 4X6BA 5TQ0L 1SBSL 3IS1X 4LKXB 5CBAB 3AU1A 4JFOB 5E4EB 2XZQL 2J1KA 2W65B 2F8VA 2FEDD 1FORH 3S96B 4BSWB 4CU8A 2OQJA 2CO7B 1KYOJ 2GTZB 4OCYH 4OB5H 3BIBX 1NGZB 2NLJB 3V4PL 3IFNL 2NY7L 2GT9A 3TN0C 1EZVX 4P2QA 5IB2B 4P2RD 3KPNB 1XGTA 4NBXB 2AQ3A 1MJJA 3KPLA 2WNGA 4OT1H 3ZTJG 4NZJA 3BPCB 4EN3C 4WJ5B 3INUL 2EDQA 3OAZK 4HWBL 4Q97A 4M62H 4QOKB 5GGRA 4FFZL 1O5DT 4XHJD 4NC0B 5KVFL 4QWWD 3VFVB 1ES0A 5HGAB 1G9NL 3OV6A 4ZS6D 3FO1B 4GG6E 5IBLD 1O0VA 1G9NC 1U8QB 3NIGF 3C5ZA 4UMGA 1KLGA 1XF3B 3CFEA 2MCPL 4M5YH 3DSFL 1KCVL 3VGBA 4P3CH 2GSIA 3IDGA 3NFSL 4JM4L 1ZLUK 1S7UA 4Y4KB 1WEJL 4JHAH 4M4RA 3RY5A 3QPXH 2DI8A 5HGGS 3TO4C 3NABL 5I30H 1FDLL 4LSSH 2R29L 4OIAA 2BX5A 4ZUSA 4CJ1A 1IGIL 1YQVH 2A38A 2FEEI 1F4XL 1EVTC 1FVEB 4EBQL 5C2BH 1Q9OB 5JDSB 3STZA 2E3VA 2DM3A 1AO7E 3OG4B 2NXZD 4PJIA 5C0RH 3PP4H 1OSZA 5GRXG 4K9EC 1DVFD 3B2VL 5DK0A 2HFTA 3MRIB 5JDJA 1K8IB 4HSQA 5ENWA 2AJZA 2J6EL 3F7VB 5E99L 4NRXB 4HUWA 4RGND 5HHNB 5IKCB 4LIQH 5L7XH 4QYOB 1MIEL 1U3HD 3CDGA 1T7XA 3D69A 1NCAL 3MODL 2R2BA 2CK0H 3KLAB 4DCQB 5DHYA 4R4ND 4LCWB 3UTTB 4M6NL 5KVGL 1QSFD 2DWDA 3C87A 3KXFB 1A02N 4WTWA 1A3LL 2X6MA 4LHUG 5DRWA 3X3FL 4X6FA 4M4PA 4ZDHB 1OAZL 2AJSH 4MCYB 4NO3A 4LASH 1FRGH 3RWGA 2YPKA 3V4VL 4HXAH 4L4TD 1WCBB 3PV6A 4UB0H 1CGUA 4OM1H 3RVXC 1DLHA 1KLUA 5GRVL 1S7WB 4MB5A 5DJ0A 4ZS7L 4D0BA 3OKMA 3LKOA 4YHMH 5BXFB 4ODBD 2VLJA 1LK2A 3QZWG 1A2YB 4TTDC 3K74B 1JGDA 4IOFD 4LEOB 3MZTA 1HHJB 1NCTA 4N8PA 1ZGLM 1ETZA 1HSAB 4JCMA 3WIHH 4R97B 1RAMA 4D8PB 1R24B 2ZJSL 4FQHA 4U1LB 4PJ8C 2ED8A 3BJ91 4R2GB 3VWKA 2J4WL 4NCC2 5EWIL 2XZZA 2A83B 3K7UA 1RK0B 1I1YB 2VDMH 3GHBH 2NY5C 1HZHH 4R7NB 1MI5D 1VPOL 5E1HB 3GMMB 1CD0A 1RPQA 4GRMA 3WFEH 5D7SL 1LEIA 3C2AH 4GT7A 5EOCL 2OTUB 3IVKA 3KPQA 2K7PA 1RUAH 2BVPB 1EH9A 4Z7VE 3MRQA 3TBVB 4XXDB 3V4UL 4IRSB 1EHAA 2RCSL 1CE6A 3WMSA 1UVQB 2PW1B 4D9RD 2E9BA 1S7QB 4I2XE 2OTWA 3C6LD 5BS0B 1CXEA 1X6LA 4KV5F 3FN3A 3S7GA 4MB3A 2X4OB 3KPSE 3GRWA 2O61A 3DX7A 2X4TA 1QOKA 1DUZB 4NO0B 1P4IL 1GIGL 2R15A 2OR7A 3VXPB 1PX4A 4K94H 2GUOA 4YHYB 5IFJB 3P30H 3ULUH 5E9DE 1IARB 5FO8B 1GGBH 2NX5D 2HP4A 1JHKH 4NKOB 4UDTA 3LKPA 1IJ9A 4AZ8A 4F2MA 1QA9B 5AYUH 3OF6A 1RSFA 4HGWB 1QACA 4CAGA 2CIIB 4JQXC 4OZIA 1DCLA 1N64H 4S1RL 5GS0D 1YMHA 3HI5L 1A4JA 1RV6X 3UPRA 1D6VH 3HE6C 4G3YL 3BHBA 4KZEH 2PO6A 4NQXA 2AEPH 1LGVA 3CH1A 1T7YA 5B38A 4G6JL 2MTPA 4M7LL 3PWVB 4U1KB 4W6WB 2I27N 3GHEH 4Q9CA 2AV1A 3WFCL 4XTRC 5LGJB 1FL3A 2ICWB 4TVPE 4RAVA 1EBAA 2I9TB 5FGRA 3TZVA 5JXAL 4QTIH 3RWCB 1AGDA 1MELA 2NTFA 3GSQB 4M61A 3DI3B 3U7YH 3ZDXF 1NCCH 1GC1C 3LS5L 2VWEE 1NGYA 1C1EH 4ZQKA 5JORB 4ELMB 5BRZE 4I1NB 3QYCA 4I8DA 4HK0B 3DROA 4XPTL 3HNSH 3HZYB 2NW3A 4JFDA 1E6JL 1RURL 3F12A 1WIPA 4JGJA 2C4FU 2QADC 5DWUH 3LD8C 2BVQA 2G5BB 5E5MB 2VWEC 3MLYH 3NA9H 1T7VA 4BUGA 2APTA 1P5VA 5F7UA 4GUPB 2EH8L 2VXUL 2GY7B 2QR0A 5E2WL 3MV9D 3MOAH 2CMRH 3TA3C 3QULB 2H45A 1ZEAH 2HVJA 3L5IA 3QQ3B 1MRFH 2FB4L 3H7BA 2YOCA 4MAYA 4YFDB 4CMMA 4HKZA 2EYTA 5B3JF 1IEAB 4GRWF 5DC0A 5DDHA 3J8F7 1MHEA 3P9LA 2BSSA 1DQDL 1T3FB 3SDAA 1JV5B 1DBML 2YHGA 3OKNA 2CRMA 1RZ7H 5T5FH 4S2SA 3QIBB 3QNZB 1Q72H 1KJ2L 3WEXA 2HN7B 3ZYZA 1P84J 4HV8B 3A0OA 4KZDL 3BEWA 1U36A 2BNUA 1K5NB 4X7SL 5DMGD 3U0TB 4F7CB 1D3CA 3AXLA 3EYOB 3JWOC 3VWJB 4ORZC 5EZLB 2GHWB 3RL1A 5LXGL 4U3CA 1U3ZA 1A3RH 1FVCB 2JCCA 3BWAA 4HKBA 4JLRB 5SWZD 4XI5D 4MNQB 5GGVY 1XF4A 4NPYA 1IM9B 3U7AA 1ZAGA 1MFEH 1I9JH 1S8DB 3A67H 5TDNB 1H15B 3QCVH 35C8H 4OLXL 1A6TA 5IT2H 3NCEB 2GCYB 4Q9QL 2ZNWA 3BH9A 1FIEA 4PP1D 3KNBB 1U95A 5IK3A 2CDEB 5HYIA 5IOPA 2GYSA 1NJ9A 2ZNXA 1NGQH 5SWQB 2IWGA 4OUUA 2R23B 1B0WA 5AWNL 5IEHA 4Y19E 1HNGA 2RQ8A 4FQQB 1K85A 2JB5L 4U33A 3VG0H 3T1WA 2JKXA 2X4PB 5KSBE 1JI2A 4KRNA 4KQ3H 3S34H 5BZDA 4WEUD 3E3QE 3G5VA 4O2EB 1NLBL 1L7IH 4PJBA 5BQ7B 1X6NA 4HIEB 2PYEA 4S10A 2O5XH 3P0GB 3MA9H 3FCTA 5HDBE 5DK2A 4DEPC 2VLKD 4MCZB 3RDTA 4XXCA 3TJEL 3OGCB 1FYTA 3V5KB 5F3BB 1RUQH 3O3EB 1NAML 3QHTC 3RWDA 3T08A 4E42B 5EBWA 3G5ZA 4J1UA 4OFIA 4HJJL 4U6XA 4ERSL 2JE8A 4PRDB 5IIEA 5E7BA 3FN0H 3E6FB 1LDPH 1OAXH 5ICZB 1H9VA 4XP1L 4GO6B 5FGCB 5CEXA 1N3NA 5IEKA 2KKQA 4P49A 3CSBA 1AR1D 2YZ8A 1EIBA 5KSAB 3PGCB 1ZT1A 4RWYH 4JO4H 1KJMB 4L3EB 5T1MA 2X1WL 4UT7L 5HBBA 2IMMA 1F6AA 1CFSB 5DK3A 4XVSL 3GMRA 3IXTA 2ZUVA 1QSVA 1RQ5A 4YNYB 5B39A 3L95A 3QNYA 1FL5B 3UC0H 1E4WH 5HI3D 3UTSE 4RFOH 4UNUA 3VJ6A 4IDJH 4E41A 3FO0L 4ZFOL 4LSTL 1CFBA 2EEAA 4LPTA 4KI5F 2YPVH 2AJUL 3GGWA 4M02A 1QG3A 5I1DA 1JNHB 3HPJB 3MV8A 3O2DH 3BN3B 3WDIA 1MSPA 1LK3H 3WUZA 3EYSL 3F5WA 2CKBH 4LVOB 2F5BL 5SX5H 3K3QA 1YA5A 3OKLA 5ICXB 1B2WL 1I1AD 1OGAE 1ZA6A 1GJIA 3L5JA 1ZMYA 2XA8H 1S7TA 1CFQA 3NGBB 1NCUA 1U8KB 2VKWA 1C5CH 3MJ9A 3FFDB 3T3MF 3RJDA 3CVIL 3QFDB 3GK8H 3KWWA 4N5UA 5GS1C 5IR1A 1BFVH 1CLCA 5E6IA 2UWEE 1HWHB 5MHSD 2DQDL 2C4XA 1YEJH 3F62A 4P48A 5TH2A 4PRNA 2OX5A 3QZWA 4ZXBB 3UPAA 5D71L 5HYJD 4XZUA 2X4UA 3BZ4B 1IM3A 3MA7A 1N5AB 3IAGC 3QIUA 1XF1A 4U6HB 1U8PB 2C3GA 1N0XH 4F7MB 3ZYJA 5IUSA 4ZPTB 2ATPA 2V2WA 4ZOEA 3MRKA 2AK4A 4XP5H 2ADFH 4H25B 4WHTA 1KCUH 4NQDB 3EO1A 4PJXE 3RJQB 4K2UH 5FF6A 1B0RA 3CFKA 5C0IB 4X9GA 1FFPB 4XPAL 2P8LB 4QOKD 6FABH 4XPGH 5HVGB 1Z3GH 4AJ0A 4KJQD 3WFHB 5FV2A 1TNNA 5EN2B 1MCLA 4LAJH 2ZUWA 1G6RL 3C9NA 4GKZA 5EUKA 1J8HE 1CFVL 2OS7A 2VMFA 4GKSA 5TDPA 2EIBA 3PIQA 1JL8A 4OLUH 3LEXA 1HH9B 2Y7QA 3DBXB 4WUUD 4LFHD 4PRHB 5GISH 3DETD 3OKEB 5AZ2L 1SMOA 4U2ZA 4H26A 1UXSB 4X6CB 2CKBB 2QLVB 1IQDB 3VXUA 1F3JA 4DKEH 2BFVH 4ENEC 4MMXC 1INDL 3TT3L 3TT1L 1NQBA 3X14B 2QKIB 3SEPA 1VADB 4RAHA 1LO3L 3V0VA 4FS0A 4MJIB 3AVEA 1TQCC 2R0KL 4YHZL 3S36L 1OWWA 1AQDB 2EDXA 3ECBB 3WLBB 4KI5D 4JFYB 4LCWD 3UTTD 3DVNA 3D39D 4WEBL 3IU4L 4FFYL 3HC0A 3IETA 3NFPB 3HC4H 3EO0B 4RBPK 1Y18A 4TSBL 2QTEA 1I3RB 3ZL4H 2X5PA 4OIIL 4XNQB 3L9RA 5KW9L 5D1QA 3QUXA 2B8OT 1VACB 3IDXH 1JZ7A 4QRUB 2FX9H 3FQTB 2GITA 3PXHA 4ZFZB 1BIIA 4ELMF 5E8EA 1IGTB 3DVFA 3KS0H 5F1OB 4P23B 1X9QA 3QCTH 3VXSD 4Z95L 4PJHA 3HI6H 1NCBL 5F1KC 3BE1H 2ZOKB 3KHOA 2AVGA 1K8DA 1TZHA 4DGIH 1JHLL 3GMQA 3SDYL 3MV01 1XF2B 4L29B 3UTPE 4OGYL 4Y2OA 5HYSB 4KKCC 3VA6A 1YYML 3DX9A 1NH6A 3U48A 4G80B 2V7HB 1NGXB 3T2NH 1MIMH 1OAQH 4R2GD 5I19H 1H3PL 3O11B 5INCA 15C8L 3MRPB 5EU6E 3VH8G 4MAUL 1D7FA 1T66D 2PKDA 2EE9A 5JOFA 9CGTA 5F7WC 4WW2A 1F00I 1CL7H 2F54B 3ULUF 5ELIA 5J3HD 3M45A 1WAAE 4N0FA 4QHLA 1AFVH 3JTSA 3IXAA 4ZNCD 1FC2D 5HHOA 1NGPL 2ZSWA 1IGYB 3IGAA 5DYOA 3NCJH 5C07E 3GI9H 3OKDB 3VFRA 4IRSD 3MCKA 2CLZB 3FQUA 4LRIC 2DS4A 5FM4A 1HHHA 4LBEB 4QNPE 5BS0D 1NGWA 2B1HH 4D9LH 1BOGA 3EJJX 5ACMA 4BZ1L 2Z91A 5BMFH 3GNML 3K8KA 1OOAA 1EJOL 4I18C 4NO0D 5I75C 5HHPA 4KY1H 2C3WA 4LLDA 1QRNB 2WINB 5D2NE 3HRZB 4KK5C 3MRBA 4DKAA 1R5WB 3O81A 1ORSA 1INQB 3EGSB 1OAKH 4UNTA 4WV1C 5EORH 5KANG 3RWEB 3PL6B 1L6XA 2X4QA 1HQ4A 1NBZA 4MA1C 5INDA 5D2NC 2NXYB 4LVNC 2BMKA 4PB0H 4CN4A 1FFNB 4IRJA 5GGVH 2FWOB 1YJDL 1QLRA 4U1GB 3PWPE 1EFQA 5T33H 1W0WA 3ZE0F 4ALAH 4PJFB 1OF2B 2BNQB 3VFGH 1ZSDA 2GTWA 4FNLH 4JPKL 4MNGE 5E2TL 4WWKB 1EVUA 3KJ6L 4PD4K 1MWAL 3UZQA 1FQ9C 3O45B 4YK4B 4G6FB 3DV4A 4JB9H 4CVZA 1I3GL 5T1LB 4Y4FD 2R2EB 3G6JA 5KG9B 3GBLA 1X5XA 4JKMA 3KLHD 4KDWA 3VD5A 2J8UE 3LDBC 4YDJB 3ARGC 3FKUS 4N0YH 2CR6A 1GSMA 2R0ZH 2XTLA 4JDVB 3HUJB 1EO8L 4PJEB 1EXUA 2ICWI 3LEVL 1EHLL 3QQ4A 1T0MB 3AREC 1U8LB 2IBZX 4PR5A 1B4RA 2D4DA 2VLLB 5ILTH 5K9QI 3ES6A 4JREB 3UJTH 1XCTA 3VFOB 3WKNA 2A6KB 4TNVK 5DGQA 2Z8RA 4V1DE 4R3SB 4EDWL 4F7PB 1KIQA 4C83B 3AS2A 3IDJB 3JV4A 3ESVF 2AXFB 5F9AC 5IB3A 3RVTD 3CCHA 3BT2H 4QGYA 4M7ZB 4JFFE 4NQUA 4J8RA 2NY1C 4Z78A 1MHPL 3TLRA 2ESVA 1MUJB 4NM8L 3ULUD 3QRGL 4GJTB 4ODWA 4N1HB 4NWUL 5F7MC 1RZFL 3DHJA 4TPRL 1IBGH 4GRLB 4D0CA 5KVDL 1FPTL 4Q9RL 1LE5B 1T22A 5E5RB 1CGYA 2UUDH 4Y4HA 2P5EB 4GAJL 4CNIA 1J7VR 5IB5B 4M43L 3VWJD 4YHLL 2EECA 3TN0A 1Y0LB 5E8NB 3PDGA 4YEEA 3WKMH 5JW4N 2BOBB 4MNQD 3NTCH 1TVBA 4NZUL 1IM9D 3MLPA 4K7PY 4LLVA 2DLFH 1UCTA 2D9QB 2Y6SD 4EN3A 3FFCE 1QYGL 2BC4A 3ARFA 1RIUH 3FT3A 5E24E 2GAZB 4HWBA 5I18L 4XCEB 1MFAL 4QO1A 5BVJB 4G8GA 3KS0J 4P59H 1ZT7B 1WF5A 2XWTA 1WIOA 2HH0H 3V52L 3VD9A 2A77H 3EFFA 3WFDL 1KIPB 1D5MA 3FQWA 5J56B 3B9KB 2R1XA 5IBTL 4H88L 3Q3GA 3OXSA 5HGDA 2EO1A 1NDGA 3EO9H 1ZHLB 4OV5A 3TBWA 1A7RH 3RWJA 3UYRH 3L3DA 1TCRA 3BH8A 3L3OA 4XPFL 4Y2DD 3O4OC 4LARH 3CFIC 4I13B 3TO4A 5I1GL 4KAQH 4LP4A 5IJKC 1J05A 1PG7H 4LOUD 1FNSH 5HHQA 1PKQE 5I74B 2W9EL 5T1KB 4OUOA 2CK2A 4OJFL 5L2JA 2VN4A 3VXTB 2WQ8A 1H8OA 1UWEH 4Z5RB 2Z0BA 1MFDH 1J0ZA 3V8OA 3O3AB 2QHRH 1HK6A 2NNAB 4KTYA 3QWQB 3OAZH 4PJ5B 2VDNL 1KT2B 2FGWL 5F97E 1F2XK 1DP0A 2J6EA 4XHQA 1FZKA 1JGLH 5CD3A 1W72H 3QR2A 4UOW0 4XMLH 4BQ6A 5F96L 4JRXE 3VGAC 2C7UB 5C2UB 4X6CF 4U3HA 3TVMB 3DV6B 4YC2B 4I3RH 3P73A 3CXHK 2ZPKL 1I9IH 2FH6A 5HGHB 1XGPB 3ZE1F 1P7QA 1ZLUH 1T1ZB 2DQGL 1YEHH 1YEIH 4I48B 3D0LA 3KYMA 3ZMRA 4ZYKA 1FSKB 5DJDA 2QSVA 2R4SL 3CX5K 3EYVB 2E9WA 1G7PB 1OPGL 2AV7B 2FJFB 3QO1B 4JE4B 4M9OA 4P3DB 5C0BD 2N56A 4F7TA 2JIXD 5JLZA 4YHOH 3BGAA 3PNWA 1TCMA 5CP7A 1FV1B 1I8MB 2DLTA 3GEWB 3QUZB 5GGRY 4M7KL 4EIZC 1CLZL 4O51A 5B8CB 5DJ2B 1A0QH 1JTTA 1NAKH 2VLRA 1T20B 1A14L 1ZTXL 2H3NA 4UT6H 3KPRB 4PLKD 5FKAA 3QIWC 4C58B 4CU6A 4PJCB 5DURB 4NRZA 4KDTC 1LHZA 2AJVH 5KS9A 4PV9A 5F9WC 5C08E 5ID0B 3GKWL 3S5LB 4PY8J 2H6PB 2OZ4H 2RGSA 3EDJA 4LSRH 2Q8BL 2Z4QA 5E7FA 1TZIA 4QRSB 3FB6B 4R4FH 5TE7H 4LNRB 4KWUA 5ETUB 1JZ4A 5GGQL 5IVXB 2VSCA 3GUTA 1FZMB 3SDDB 4F9PA 2E6JA 3U7WL 5MENE 1DUYA 3G5YB 3G6DH 3QDJE 3RKPA 5E8DL 4ZXBD 2D31B 2ITDB 1ODAA 4CADB 5LQBL 3WUWB 4NGHL 2BSED 4TUKL 5FYJL 4KJWD 1C7TA 1JGVH 4TTGA 3M1BB 5FA3B 1A47A 1S7VA 3KDMB 5DRXA 2P7TA 4S1SL 4WI2A 5D2LE 4OQTH 1SEBB 1JNJA 4F37K 1E4XL 1JNNH 5GXBB 1W72B 2W38A 4JFQA 4KUCF 2F53A 2V2TB 4UT9L 2EYRB 1M1SA 4O2FB 2Q8AH 3DXAE 3WYRA 5EZJA 2MQ3A 5E03A 3IF1B 1BVKB 2R69L 2ZUUA 1N4XL 3BDYL 2JJTA 2Z35B 3VRLF 3WSQH 1JGUL 1F42A 3MRHB 4NC2B 4XWGH 5ESVA 2X10A 1KPRB 2HVKB 5ESAA 1H0DA 4BK4A 5C8JA 2VDQL 4R96A 2VTFA 4RFNB 2LE9A 3G04A 3R0NA 3P0YL 2WLYA 4HPOH 3H3PH 5BV7L 4IOIA 1X3DA 3PWNA 1XGYL 3HE6A 1A7OH 3RWIA 4HFWA 3L6FA 5D7KD 4ZAKC 4I5BB 4HWNA 4U0RC 4AH2B 2XYCA 4N8VB 5IESH 4K3GA 4LU5L 1F3RB 5MEOB 3DIFA 4GAFB 3U1SH 4J3SA 5DEFB 2NY2B 1CGWA 4QHNB 5JHLL 1BF8A 4JY5H 4GMSL 3MGTB 2WSKA 1YN7B 4FQ2H 4NN6B 3V6OE 4MJ4A 4D0DB 1NBYB 3G9AB 4KK6C 1MCOH 3L7EB 5EPMB 4QF1B 7CGTA 3FB5B 5I1EH 2HYMA 4U1JA 2DL9A 3WE6A 4DQOH 5GRJH 3SOBL 4P4KB 3I3DA 5E1AB 1MCPH 5MP6H 5KSVA 3KYOB 4PJFF 2HFFA 4HJGA 1ZXQA 3D9AL 2FEDC 3V6OC 4M1CD 3RIAF 3DVGA 1F8TH 2K9UA 3OKOA 3O2VL 4X6DE 2OSLA 5CUSL 3L5WB 3BP7B 3X13B 4XPBL 3MRLA 2A6IB 4PTUA 4U7MA 4AL8H 5IMKB 2P8MB 2XWJB 4XVUD 2RJMA 3SDXB 1MJUL 3ULVH 4DOHB 2XXCB 1KEGL 3OR6B 4I3SL 1JPTH 1RFDL 3JSSA 3LN9A 1VFBA 32C2B 3W0WA 1W0VA 1VGKA 4XHJC 3S8WA 3HUJF 2R0WL 4QWWC 4WUKL 4P23D 5AUMA 4PJEF 5MI0C 4ZS6C 5IBLC 4PJ7B 5FO9B 2A0LD 2OI9C 2VDLL 4PRPA 5CJOH 1SM3L 1U58B 2C5DC 1BEYH 4YXLL 5F7YC 5F9DC 3OR7A 4U1NA 4JR9H 4XMKL 5K59F 2AABL 3RTQB 1KJ2A 5H35B 4S11A 3SJVB 2GJ6A 3IFOB 2VXVH 2P42B 1MLCB 1UB5A 3ARZA 2FL5B 4C56A 5ID1B 5EBMB 1WZ1H 2AKRB 3QWOB 4UV7L 1HCVA 1ZK9A 4FTVE 4MA3B 4RGNE 5J0BA 3WHXB 4PJ9B 1ZVHA 5EZIL 1CTOA 4HWZB 3BMWA 4OCWL 3AUVA 5EOQL 2AJ3B 4NO2B 5C0DA 4OZGB 3PHQB 2AXHA 5DJ6B 4IBLT 1DVFC 1QSFE 4NN7C 2PXYB 1RK1A 1QFHA 4KROB 5D7JA 4Z7OF 4LSUL 2XKSA 4RGNC 5ALCL 2DTMH 2ZCLH 1AQKH 4AENA 5CWSB 1DBAH 3QNXA 4HKJB 1RZJC 4P46B 1U3HC 1V7ML 2JTDA 2BXZA 1X5FA 3PGDA 1U8NA 4QXGL 3RVVD 4R4NC 2GKIA 4ZOBA 4F57H 2EDTA 5IROA 1T1XB 2J8HA 3FQXB 5EC1A 1CDIA 5IQ7H 5C0AA 3MLZL 1UWGL 5CCKH 1J1PH 3ARWA 4H0GA 2CLRA 1F3DH 1JPFB 1LO5B 1A6WH 1QRND 4AM0B 2VABA 2IAMA 3O6FB 3EOAA 1DBKH 2HJLB 5DJ8A 5FGSA 1IGCL 3MACL 4O58L 1INEL 1FZOB 3S3JA 1RHHB 5I16A 1CLYL 4MHHI 4JFHE 2XN9E 1YMMD 4X8JB 3T65A 3D2UB 4L4VE 1QVOA 5FV1L 1WQVT 4OGZA 2XG5A 4KDVA 3QUYA 2VL5A 4G8FB 2PW2B 1Q94B 1CXKA 1MJ8H 3BW9B 4KRPB 1KEML 3DPBA 5MEPB 3MJ8A 4ODHH 3MLRH 1KBGL 3U30B 1NAMA 3MTRA 1JNLH 4R6UA 4IOFC 2FJHA 5I8OL 3EOTL 3MRDB 4K7PH 5LBSL 3S3PA 1A7QL 2BNQD 1MREH 4ZD3L 4MD4A 1BBDL 1LQSR 1TENA 1QSEE 3LKQA 4FZ8L 3PHOA 4WWKD 2ORBL 3VXRA 2DLIA 2W0FA 1MFBL 5HDLA 3MLXH 5SWSA 3BEVB 5F7KC 1RD6A 3K8LA 2DBLL 5DD3L 3H9SB 4HIXH 4EUPH 4L3CA 4KKNA 5T1LD 5C6TL 1HCFX 3CMOL 3QISA 4D9RE 1VFMA 5KJRL 1TJHL 2FZ3B 3NIFF 3NIGE 1AKJB 1HI6A 2HKHH 1FZJB 2V5YA 4G42B 2HG5A 3UXFA 1CF8L 3SGJA 4CDGC 4R0LB 3P11H 4DUVA 2WBJA 4OI8A 3PUCA 4ZFOA 5KVMC 3SKMB 3JWNC 2WP3T 3V6FB 3KHQA 4NJAH 4H20H 5ITBL 3C6LC 1OGTB 1CK0H 1D9KB 4MSWA 1Q0XH 5J89A 5ALBL 5JUEL 4PRIB 1CDUA 4RMSA 3VFUA 1CL7I 2DOCA 1RZ8A 2RFXB 4LSVH 3MRRA 5B22A 2WMPA 3L3JA 1G7IA 4IMLB 3CLEH 3L5XL 3R4DA 3W9EB 3ZT5A 1I9RL 3F65A 1NBVH 1PY4A 1F58L 4PY7A 1AY1H 1U8HB 4LHUD 5I8KL 4KKBD 2JK5B 4U1HB 1OAUL 1XF5A 3SY0B 5J6HA 3B9VA 4QEGA 3IDIA 4GRLD 1C12A 4EI6A 5GS0L 3CZFA 2FECI 2IANB 1KJ3H 1UJ3A 2BNRD 1MHHA 4BFEA 2X4SA 4LDOB 4Y5XB 3RKDD 5GS0C 4UZGA 3BKCL 2XA3A 4MD0B 4UIMB 3JTTB 4ZO9A 3RVWD 2P5ED 4P5KB 4PJCF 3U4EA 4DVRH 1BZ7A 1AGCA 3FL7A 1Q9LA 1F2QA 1ORQA 3GSVA 1A9BA 1FH5H 4ORGB 1JFQL 1QHOA 5EA0L 4JM2B 4O9HL 4X7TB 3NZHL 5ACZB 4APQB 4XAWH 4WU5A 1IEHA 2XT1B 5I1AA 2IH1B 1V8HA 3LSOB 4I0PB 5IVXF 5TGBA 3IFLL 3BPNB 2P44B 1E27B 4EUPB 1I4FA 5DHVA 1Q38A 3NACL 4OD3L 4YHKL 5IVZA 2NYYD 5F7HA 4FQXB 1RVFL 1PJ9A 1VERA 1NMCB 1F90L 4HXBL 5T3ZH 3AGVA 1V3KA 3RUGB 1WV7T 1VGEH 1FN4A 4P5MA 4ODXA 1NC4A 3BP5B 3ZZ1A 4ODVH 4PY8I 3B9KD 3MV9E 5EUOB 3HLAA 1ZGLA 2QSQA 5JNYA 1CE1L 1TDQA 4AEIH 1XGQA 5EOTA 3L3IA 4EDXB 5CBEA 5T3XH 2YEZB 3WNMA 2YUVA 2OR9H 4OD1L 1G7HB 1IQWL 5LCVL 1MY5A 1OY3B 2XNAA 3QQNA 4Y8AA 2V7NB 3UTQB 3ME0A 5J13C 3L3GB 2HRPL 5DF0A 1T2JA 3MOQA 5DRZA 5HDOA 5JHDE 4YHIB 3I6GA 1PQZB 1ND0B 1PYWA 3T0EE 1ZHKA 2F9BT 1RJLA 4X8XA 2MHAB 1I7ZB 1AGBA 3QB7C 4PJ5D 5D5MB 5CIPA 4KTEH 4X6BB 4OZHB 4G8EA 5SWZE 3OTTA 1NCDL 3AU1B 4C4KT 1CTNA 2GIYA 3QI9D 1IGJA 5I0DA 5DMGC 3VDCA 2AK1L 2OQJB 4F7EA 1BVLA 3CUPA 3E2HB 3T0VA 3EFDH 4PB9H 3TVMD 3MRNA 1AC6A 2M8XA 1FL6A 4KVNH 2GT9B 4P2QB 1T7ZA 4PRBA 4U1SA 4XI5C 5DJYA 1XGTB 5EB9A 4DTGL 2ICES 4JAMA 1MJJB 3W11D 2NY4D 3BXNA 3KPLB 4NDMA 1F3DJ 4KHTL 3VD3A 3O6LL 1SEQL 4HK3J 1OD9A 2C1PA 2YC1A 5BOZG 1Z9OA 3CAFA 5GGRB 5BO1L 4PP1C 4Y0GA 5SX4I 2X70A 1ES0B 2XTJB 3DO7A 4XP9L 3QDAA 3N0PB 4G7VL 1CG9A 1IZJA 3C8HA 3A6CH 3QUZD 4J4PD 2CO6B 2V17H 3C5ZB 3O2WH 3P4NB 1KLGB 3PV7A 4M00A 1U2CA 3CFEB 4O02H 3Q6GH 1SMAA 5CHNA 4HQQH 3ROLA 2L7JA 4JVWA 2GSIB 2P5WE 3IDGB 3ARSA 1S7UB 4WI4A 3SDXF 1OCWH 4DFHA 2D03L 4XCNA 3JBG7 4O4YL 3C60D 3MLTA 1RU9H 4ONOA 4YWGL 3ZDXE 2VQ1A 4J3VA 4DJMA 3PQYA 4ZUSB 4OCLC 4RBPH 4FQLH 4K3EL 1CGXA 3MUZ1 4NUJA 2G5RA 3LAFA 1OLZA 4PJ7F 3STZB 5FYKU 3GBNL 4PJIB 3SDDD 2ZKHL 1OSZB 4HUUA 5DK0B 4JO3H 5EU6A 5FCUH 1H3UA 4D9QE 4X7CC 1B4JL 5ENWB 1NLDH 2AJZB 3X11A 4IS6A 1JF6A 3EYUL 4JQIL 4HUWB 5BW7C 4OFYD 3BKJH 3VFTA 2X1OA 1K3IA 2WUCL 3CDGB 3BMVA 3D69B 5JR1H 2R2BB 3GRWH 1AR1C 3R06A 1L7TL 5DHYB 2KPNA 2H2PD 1NFDA 4FFVD 3IDYB 2DWDB 4X80L 4GSDH 4HMCA 4OLVL 2UVEA 2VUYA 5C1MB 3FOLA 5DRWB 4WY7H 3ARYA 5B3JE 4GRWE 4X6FB 5I8CB 4BH7A 5C0CA 2HFGH 3GIVA 2VDRL 4K8RH 3WFBH 4NO3B 4OZGF 2HLFD 4XBPA 2R2CA 4XNZC 1MCSA 3RWGB 2OJZL 4MZ2A 1UH4A 3DX8A 2YPKB 4RMUA 4WV1A 3ZTNL 3PV6B 5HI3C 3P0VH 1J12A 1P1ZA 4TQEL 3EUUA 1DLHB 5JIIA 2VZUA 1UB6A 4G5ZL 3FRUB 1KLUB 1ZVYA 5DJ0B 4S0SD 4D0BB 3OKMB 1TXKA 1B6UA 2WZPD 4FOMA 4K23L 3LKOB 1XR8A 1F02I 3LHPH 3WIFA 2VLJB 5FB8A 1LK2B 4DVBA 1F6FB 1I75A 1JGDB 1KCSL 3LZFH 3QFJE 4YZFF 1LO4H 4RQQA 1ETZB 1I1AC 4MWFA 4JRYA 4FQHB 5MHSE 3VWKB 1MWAA 2NY2D 4ETYA 3QHZH 3N1GC 3ULVF 1I8IA 5HYJE 3WDJA 3EYQD 5DD1H 1T6VN 2YUXA 1J88A 1ZLWK 1T1YA 1NCWL 1WGOA 3UJJL 4GRMB 1QLEH 3ARGA 4TRPH 1LEIB 4J3OC 3HMWH 4X5XA 3IVKB 4YAQA 2EC8A 1XH3A 3KPQB 5E4EC 3MRQB 2IEPA 4UTBH 5I2IA 3AREA 1CE6B 2QQNH 4QXUL 2NY6D 2OTWB 3NZ8A 5LAXA 3ZDYF 5ESQA 1PVHA 4QOKE 4YGVA 1PZUB 1TITA 1KB5L 4JFED 1BD2A 3LIZH 1EEUA 3U4BL 5ADOL 4MVBD 2O61B 3DX7B 1JZ5A 2X4TB 2DQHL 4OGXH 2I24N 1DANU 4NWTH 4KPHL 2R0LH 4BZ2H 5DS8A 2GUOB 2MKWA 4CRPA 5JZ7D 4WO4D 1KJVA 5C0EA 4HS6A 4PUBH 4UDTB 3LKPB 4KJQC 4F2MB 1FAIL 1JUFA 4YX2L 1XFPA 2KL6A 3EJZD 4RX4A 1AJ7L 4OZIB 2VQUA 3RTQD 5FHBH 1YMHB 1ZANH 2ZG1A 1DQLL 3SJVD 4PRAA 1Q1JH 4D3CH 4PTTA 5D70H 3A6BL 1A4JB 3H42L 3UPRB 2BHZA 5EIIA 3BHBB 2PO6B 4NQXB 1ONQA 1RZIA 3DETC 5J12B 5DJCA 3CH1B 5B38B 4ZNEE 2F5AH 1GAFL 4XBGA 1CQYA 2DRUA 1S9KC 4QRRA 2WLZA 2AV1B 4XCCL 2HKFL 1FL3B 1G9MH 1M6OB 3SGDH 4LSQH 4RAVB 3TZVB 2NPLX 4LRNH 3IDMA 2UZYB 4KI5E 2DICA 3MFGB 4UQ3A 4LCWE 1QLFA 3UTTE 5A1AA 5CEZL 2G60L 3G5XA 1AGDB 4M61B 2NTFB 2PXYD 3KXFE 5CJQL 1U91A 2WUBH 4WENB 5F3HA 3SGKA 3E1F1 3F6IA 1NGYB 4ZQKB 5SV4A 1N6QH 1ACYH 4OLYL 4Z0BH 4P46D 4AQ1B 3O41A 4QHKJ 3DROB 4KI5C 2NW3B 4JFDB 2CKNA 2FD6H 3F12B 4JM2F 4OCYL 3HAEG 4FN0A 2BVQB 4O2CA 1P4LA 1Y6MR 3QXDA 5HPOA 5HVHB 5JW4Q 3T3ME 3MLWH 3WD5H 3SE4C 5D1ZA 3O6FD 1IC4H 3VXSE 5IJKA 2HTLD 1G1YA 2ED7A 2D7QA 2QR0B 1PX3A 4OT1L 4LLAA 3F7YA 2HVJB 3EKCA 3D2UD 1IKFL 3H7BB 4MAYB 4CMMB 3RUGF 3CXDH 3QCUL 4HKZB 1TQBB 2HWZH 5DDHB 1MHEB 3P9LB 2BSSB 3WCYA 3O8XD 2VZ1A 3OKNB 4JQVC 1I9EA 1A6VL 4ZOAA 5EUOF 4S2SB 3AFLA 4M5ZL 2CLVA 5EO9A 3WEXB 3QXTA 5F8RC 1BF2A 1JI1A 1S9VA 1HKFA 3BEWB 2BNUB 4N0RA 4H1LG 4ESKA 1ACZA 3VRJA 2EIEA 2ADGA 3B43A 4R97C 3AXLB 5E08L 1I8KA 1DLFL 3S98A 4M7LT 4JFPA 4R2GC 1AO7D 3H9SD 4LQFH 3RL1B 3BOVA 2LABA 2P45B 4PREA 2JCCB 3BWAB 1KIUA 1T66C 1W0YT 2OL3H 3HFML 3OKYA 4HKBB 1YQVL 4HLZG 1XF4B 1T5WA 2ZUTA 4NPYB 3RL2A 4QXTA 1JF5A 5D1XA 1VA9A 3DARA 5J3HC 3WS6A 5C2BL 5BS0E 3GZKA 1AKJD 2DL2A 4HULB 3O3UN 4LIQE 1A6TB 5D5MF 1MPAL 4CBPA 3BH9B 3CGTA 3TWCL 2VXSL 1U95B 5IK3B 5IFHH 5IOPB 1NJ9B 4OUUB 1T89C 4IRSC 1QRKA 1JYVA 3LS4L 3W5NA 5IEHB 3FRPA 4HZLA 1LWRA 2LVEA 4M1DH 1I8LA 1D9KD 3MZGB 4ELKA 4FRWA 5A16A 1X5HA 3V6ZA 4OZ4A 1C16A 1I7TA 2DLHA 3MJ9H 4KDTA 1TFHA 1EO7A 4OLWL 1JGEA 5BZDB 4HIIA 5IGXH 3G5VB 1PGRB 4YHYC 4PJBB 4LASL 1FRGL 1IC5L 2PYEB 5CD5D 4HXAL 4XRCA 3BD3A 3FCTB 4LHJB 5DK2B 2XQBH 4NNYA 1R3JA 5F9OH 5FOBA 2JLLA 2FCBA 4FQCH 3RDTB 5JOPD 1FYTB 2DBJA 3KYNA 1S78D 3RWDB 1UYWH 3BYYA 3G5ZB 5EBWB 3EJYD 5C7XH 4J1UB 3DVIA 2CDGA 4U6XB 4HS3A 1IMHC 4JHBA 5DD0H 5IIEB 1NSNH 2EXYD 3U46B 1NCNA 3BWUC 5CEXB 1N3NB 3OAYK 5IEKB 2BVOA 1S5IL 5A2IH 4QLRA 2UZIL 2ITCA 4F58L 3SE8L 4APQD 2YR3A 4FQJH 3UBXI 3BI9X 4PG9A 1U8MA 1ZT1B 3MXWL 4NNPH 4BUHA 2A6JA 5T1MB 4R7DA 5A2JH 4ELME 4LGPB 3PHSA 4I0PD 5FM8A 1F6AB 5DFVD 4PJIF 4Y4FC 4LSPH 3GMRB 3IXTB 1T2QH 2GJZA 2VC2H 2FX7H 4M7JH 4P4RA 3KLHC 2P47B 3GO1L 5B39B 3L95B 4B41A 3H3KA 3QNYB 3WFEL 3C2AL 5JA9A 5AAWA 3VJ6B 1MVUA 3O9WA 1P69B 1EJ6A 2GW5A 4E41B 1QQDA 1JRHH 3NCCB 1CS6A 5FM5M 1ED3A 5FUOH 4JN1H 1D5XA 2CQVA 3ZKSD 3GGWB 5I1DB 3MV8B 4ZFGH 2IBGA 1PG7X 1YEFH 3M07A 3QEQA 2WIMA 1MF2L 3F5WB 1EHNA 5DRNA 1MHCA 1X5AA 4ZUVA 1TTUA 3OKLB 1Z2KA 1NUNB 2DQEL 3ULUE 5J6GA 1ZA6B 1OARL 4CDHA 1HN1A 1S7TB 1CFQB 2XWBA 3VRIA 3RVTC 4NM4H 2HT3D 2WANA 1IEBA 5FUZL 3ULUL 5I1IL 4K94C 3KWWB 5IR1B 3ULUC 2QSCH 5E6IB 3HR5A 4TUOA 4XH2A 5L88H 1EV2E 1MJ7H 3RAJH 4MNQE 2E27H 5TH2B 4PRNB 2XY2A 1N64L 3P3YA 3QZWB 1N5YH 4JO2L 4XZUB 2WIIA 1MNUH 2X4UB 4IMKC 1IM3B 3MA7B 1KN4H 1BAFL 3QIUB 4FHBD 3CDYA 3VWJC 4P2RA 1BGXL 4R8WH 4P9HL 2ATPB 2I60H 1KXVC 2V2WB 3MRKB 4U6TA 3ZHLA 4NT6A 2AK4B 5FO7A 2K3TA 4MB4A 4WHTB 3EO1B 1VKXA 4IRZL 1BJ1H 2Y6SC 5FF6B 1B0RB 3CFKB 1YNLH 2XRAH 4R90H 4QTIL 1RULH 5LWYH 3RNQA 3OXRA 5CLTA 5DMJB 5GJSH 3U7YL 3W9DA 3V0WL 2B2XL 1NCCL 2DB8A 4C55A 5C09D 3ZE0E 5E95B 3V95A 1X4XA 2MPAH 4YBLB 3GSXA 2VO5A 1P84K 2C26A 2MQ0A 1XCQA 3C5ZD 4BK5A 3C9NB 4GKZB 3EDFA 3ET9F 5EUKB 1MCKA 1EPFA 4TOYL 3ALXA 4GKSB 5TDPB 3HZMA 3PIQB 4K3DL 3LEXB 4Y2DC 2Y7QB 3BZDA 1Z5LA 4HUKB 4H26B 4LOUC 5T3XD 4I9WD 3LRGA 4KK8D 4OI9A 2CMRL 4MJ5A 3VXUB 1F3JB 3P2TA 2Z8WC 3L3KA 5FGCE 1JJUA 1M05A 1A1NA 1H3XA 2DIAA 1UH2A 1DVFA 2OJEA 2AXGA 4OZFH 1EK3A 1H5BA 4QRPA 4OZIF 1H3WM 4L3EE 1RZ7L 2GSGA 3V0VB 5IP4A 1FIGH 4ONGH 3DOSA 5FM5O 3QP3A 1CVRA 2J88H 4K71B 5ISZA 1QSFA 3DVNB 1DE4A 2IQ9H 2ZOLA 5ERWA 3H9ZA 3HC0B 3IETB 4L3AA 1G7LB 3UO1H 1Y18B 3BDBA 4YUEH 5FGBC 2X7LA 4WCYH 3P40A 1U41A 3WNNA 3L9RB 5D1QB 3QUXB 2PF6A 3UMTA 4L4TA 1AC0A 1QFOA 3RIFK 5KAQF 3VFWA 2BDNH 1QBMH 5IT2L 2X1QA 3BP4A 2GITB 1X5YA 3CXHJ 1BIIB 5E8EB 4FZEH 5FA4A 5TE4H 2F19H 1DQTA 1NGQL 3X3GL 4FA8A 2AGJL 4PJHB 2VLJD 1HKLL 4G6ML 3CX5J 2EXWD 2Y5TA 2L4OA 1IT9H 2DIBA 1K8DB 3S88H 1TZHB 1DEEA 3GMQB 1IFHH 2IJ0C 3BGFC 4LVOC 4PLKC 3VXMA 4Y16A 2FYYB 2LU4A 2M2DA 4YDVA 2DMCA 1QBLL 3DX9B 4PGBA 1KFAL 4KQ3L 3NGBC 2BRQA 5C70A 1GXEA 5INCB 1GYAA 3DYOA 1KC5H 1Y6KR 1IC7H 2KQMA 4PGZA 1MI5A 4W81A 4XC1H 4TSAH 1ZS8A 4K3JL 5JOFB 4RMWA 2O5XL 3ARBD 4WW2B 4XNUH 3K0WA 4N0FB 3I3EA 4QHLB 3BISA 5I1KH 3JTSB 3IXAB 4K7FA 5HHOB 5L2KA 2ZSWB 2X41A 1XR9A 5I15L 3IGAB 1T4KA 2IFFH 5DYOB 4ZXBC 3BO8A 1G9EA 2NY0B 3MCKB 3ZLQC 3FQUB 4KJWC 3C6LA 1HHHB 5DR5H 3TCLA 5HHVH 3IKCA 3OZ9H 1NGWB 4GXVH 3GM0A 1BOGB 4LFHG 4DN3L 4KU1A 2JCCF 5K93A 4I0CC 2Z91B 3ALWA 4RGOH 2ZCHL 1F4YH 1DSFL 2RR3A 4RWYL 5HHPB 3TYGH 4LLDB 2IFGA 3CK0H 4Z77A 1EX0A 4U7SA 4UILL 2ARJQ 5CSZA 4UQ2A 3MRBB 2NX5A 4NKIH 1ORSB 4KMTL 2VXTH 1HHIA 3GJFA 1I85C 3S37H 1E4WL 4X7DC 2X4QB 4PRHE 5D7KE 1HQ4B 2O5ZH 1NBZB 5TQ0H 5INDB 3WJLC 4PFEA 1KPUA 4X6CE 2VISA 4OF5A 2BMKB 4IRJB 2IPTH 1QLRB 2EYSA 4LK4A 4OCNC 5A3ID 1W0WB 2IBZY 3O4LA 3ZE1E 3V4PH 4OLZL 4P5TA 5ANMA 1AD0A 1ZSDB 2GTWB 3BSZL 3GMNA 3IFNH 3TESA 2PO6D 2CKBL 1YC7A 5M95B 4PJBF 5EULV 4LCUA 3ZE2F 1J1OL 3BQUA 3ORJA 3QT2A 4F33A 1KCRL 4JO1H 4LQ1A 3VXNA 2GY5A 3NH7L 4MJIE 3T09A 5F71A 3TF7C 4HBCL 3DV4B 3RU8L 4CVZB 2DQCL 5D7LD 3INUH 3MNZA 4HWBH 3G6JB 4FFZH 5KVFH 1BFVL 1BJ1J 1CDBA 2YD1A 2IADA 4XPHL 5HJ3A 2A1WL 5JIKA 1MRCL 4M1CC 1EXUB 4JFDD 3DSFH 3QQ4B 3VXQA 4PR5B 4NSKA 3U9UA 1DJSA 4JM4H 2B5IC 1WEJH 5LVEA 3ES6B 4I4WA 1XGRA 3NABH 1XCTB 3PWJA 1IL1A 1FDLH 2R29H 3WO4C 4MX7A 3ETBF 4XVUC 1IGIH 1ROWA 1F4XH 5GSVA 4N9OB 4EBQH 1KIQB 5F6IB 1KCUL 3JV4B 4BFIA 4JN2A 1D5BA 5IB3B 3CCHB 3BPLB 2VYRE 5F70A 2Y07H 4J8RB 4Z78B 4QY8A 4K7PX 2ESVB 1AIFA 3B2VH 4P23C 1S9WA 4U6YA 2BCKA 2A0LC 2J6EH 4ODWB 5E99H 1OP9A 4ODTL 2J5LB 1MIEH 1NL0L 4D0CB 2Y36L 3OWEA 1NCAH 3MODH 5ITFA 1T22B 4R26L 2F54E 4M6NH 4Y4HB 1WBZA 5GS2H 4RMRA 3SPVA 2VDKL 4CNIB 1A3LH 1CR9L 1UM4L 3QDMA 3X3FH 1U8OA 3EOBA 3TN0B 4LLMA 2E7LC 12E8L 5MEQA 4YHNA 3VRLE 1TVBB 3LRSA 3V4VH 2WP3O 4LLVB 4EN3B 2BC4B 3C09B 3ARFB 3SQBA 3FT3B 2EDYA 4ZS7H 2DLGA 2HLAA 5F1NA 3RPIA 4LLYA 3OHXA 1QRNE 4G8GB 2XWTB 2YMXL 3EFFB 3RVVC 1D5MB 1HYRC 1KGCD 3FQWB 2R1XB 3Q3GB 3OXSB 4ZTPL 4L8CA 2VR5A 5HGDB 4J3WA 1NDGB 2OK0L 4OV5B 4XNYH 3TBWB 3SGDI 3EOYG 5H94A 3RWJB 2ZJSH 1P7KA 1TCRB 3L3DB 3MLSL 1KUMA 3BH8B 3L3OB 4YDKL 2J4WH 3TO4B 5EWIH 4XNXL 4TULL 3Q0HA 4CUCA 1DN0A 1J05B 4JDTH 1VPOH 1KN2L 5HHQB 4A2LA 3O0RL 4PJFE 2BNQE 2LV4A 2VLKA 2P46B 5EOCH 3MMEA 5L2JB 3CFJA 5DQ9A 3RDTD 3P9MA 2DJUA 3UTPD 4WI7A 2YUWA 4A6YL 4M93C 3LEYL 4TUJA 3V4UH 2RCSH 4U1GC 1FZKB 4LGRB 4PG2C 4TNWF 4G6AD 5CD3B 3KPMA 5IG7A 1CLOL 4WWKC 4Z7UA 1K4DA 2APXA 8CGTA 5J9PA 4KQ4L 1GIGH 5EBLA 5CZXD 4CN1A 3P73B 4M6ML 3HUJE 1P7QB 4PJEE 3EYFA 4F37F 2V5SA 2W9DL 4L5FH 5C07D 4WDIA 4NQED 3D0LB 3KYMB 4ZYKB 5DJDB 4PJAA 4Z8FL 4ZG1A 3V79C 1AFVL 2CJUL 3KLSA 4E41D 5KOVC 5K59E 4NHCL 4Y89A 4F7TB 1UZ6F 3WNPA 1CBVH 5E00A 5JLZB 3FTGA 4YO0A 3PNWB 3GI9L 4S1RH 5CP7B 4XMPL 4O51B 1CXFA 3HI5H 2VXQL 2AEIT 1OW0A 3U9PH 3UX9B 5HI4D 4D9LL 4G3YH 3ARDA 2H3NB 2VLRB 4JREC 4F9LC 5D7IA 3HNVL 5FKAB 4M7LH 5L0QB 1AHWC 4NRZB 1WZKA 2V6HA 5KS9B 3WFCH 3RZCD 3LMJL 5EDXA 1C5BH 4PV9B 1IVLA 5JXAH 4XP4L 4M7ZC 4HUXA 4TYUA 2XZAL 4Z7OE 2D2OA 3T0AA 2Z4QB 4C4KO 2P5EE 4KKBC 2ERJC 1TZIB 2A2QT 5AEAA 3VFNA 3LS5H 2AI0L 2JELH 4PJHF 3ZDZF 1JWSA 3GUTB 1IAIL 4UINL 4GRLC 3GSUA 3LCYA 3RKDC 1E6JH 1RURH 5HYJA 2H41A 2X89A 4PB0L 3UTZA 1GZQA 3RVWC 1DDHA 3B6SA 4ALAL 4CVXA 1JWUA 1S7VB 5DRXB 1FE8L 2P7TB 5DC4B 4WRLA 4POZD 2X1XR 1KIRA 1KG0A 5IJVA 2EH8H 3VG9B 2VXUH 3T2OA 4JFQB 1KB5A 3MYZA 4PGDA 5E2WH 2YPLA 4WW2F 2F53B 4A2MA 2VQTA 3MO1A 2FB4H 5EZJB 4Q6IC 4KRMB 1WTLA 4B53A 1LP9B 1JF1A 2NYYC 2HJFA 1DBMH 5AZEL 1L9NA 2I5YL 4HCRL 3DLQR 1QFUL 1ZLWH 5AG8A 5ESVB 3JVGA 2VERN 3UAJD 5ESAB 1H0DB 1I3UA 1TTGA 4YR6A 5C8JB 4R96B 2X44D 3OKKA 4FXKA 4NOFA 3B9KC 3G04B 4KZDH 2YD5A 3IB4A 4X7SH 4EEEA 4IOIB 3PWNB 3GI8L 5ILTL 4J3XA 5DA4A 4WUUA 3HE6B 3RWIB 4PGEA 3K2UL 5LXGH 4HFWB 3L6FB 3V7AE 4JFFD 1U2HA 1MCWW 3NIFE 5HGBA 2F74A 5LGHL 2RHEA 4PJ5E 3MNVA 3DIFB 4JCLA 5I74C 3VXUD 5FEBA 4IHOA 1SVCP 4OLXH 2DN7A 4NJ9L 4Z76A 4Q9QH 1UA6L 2L7UA 1MCRA 3ZKXB 2NQCA 5I66A 5GIRA 4ZUTA 3E0GA 5DMIL 4U1JB 3WE6B 1MVFA 1NEZA 4OD2A 1OB1A 2CIKA 3CVHA 5KSVB 2HFFB 4HJGB 5IFAL 1IC1A 1BZQK 3RIAK 1TVHA 5L6YL 5C9JA 3QI9C 3DVGB 1R5VA 3D39A 3OKOB 5CKGA 2DI9A 2OSLB 2EDJA 2FHCA 3F7RA 3TVMC 3MRLB 4PTUB 2DQFA 1OM3L 1NLBH 1QFWL 2XQYK 3FAWA 3OX8A 4GW1A 4WTZG 3VCLA 3WKML 3G6JF 3W11C 3GKZA 2NY4C 4UNVA 5D1QD 3QUXD