1YPZF

Immune receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
230
Chain Sequence
HGKLEQPEISISRPRDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHIFLDKEYKKMEASKNPSASTSILTIYSLEEEDEAIYYCSYGEGSSGFHKVFAEGTKLIVIPSDKRLDADISPKPTIFLPSVAETNLHKTGTYLCLLEAFFPDVIRVYWKEKDGNTILDSQEGDTLKTNDTYMKFSWLTVPERAMGKEHRCIVKHENNKGGADQAIFFPSIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 230
sequence length 230
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzF01
2CR3A 1MVUA 4NUGH 3GSXA 5CD5D 5FOJA 4ODTH 2AK4A 4PGEA 4O02L 5EFIB 2Y36H 3U48A 1WZLA 4ODSH 1MY7A 1NDMA 1BBJB 4GKOA 2E27H 5KSAB 4NKMA 5F96L 3ZDZE 5I8CB 1F5WA 1U91B 4ODBD 3KJ4B 4UV7H 1FAIH 2EE9A 3G08B 5CZKA 3K81A 1NBVL 2VZ1A 1B88A 1H3TA 4OKVA 3LY6A 4UILL 4YO0B 2ZPKH 4AM0B 1S78D 2V9TA 3TZVC 3OJDA 5FCSH 2C1PA 1BD2E 2MJWA 4X98B 2EIZA 2J7LA 3CDFA 3CVHB 4ZAKB 5DJ6A 5E2UL 3F12B 1EXUA 5D1XC 1G7QA 5C2BH 4UZGA 2M2DA 1FH5H 5IR1A 4TVPD 3KS0J 1Q9OB 5D7LD 5E9DB 4NQCE 4ZS7L 2BNQD 5IVZA 4F7TB 1BBDL 4WCYH 2R2EB 1RIVH 1MCOH 4ZOAA 3EDDA 4I18A 3FAXA 2AJZA 3RWFA 4PV8A 3GNMH 4NN6C 1BJ1J 3ZT5A 5IMLA 1RZJH 3A67L 1JFQL 4GRMA 4ETYA 5I1EH 3IDNA 3QO1A 3UJIL 3WN5A 4XRCA 3D87B 2ZNWA 5TQ2L 3RVVC 32C2B 3GBMH 1GGIL 3MCG1 4PY8I 1YDPB 5DHVH 4K9EH 4LSSL 2A6KB 1WVZA 4PB0L 3O9WA 1CDUA 2OTUB 3I6LD 4DGYL 2L7JA 3OSKA 1Q72H 2W9DL 2HVJB 1ZLUK 3HE6A 4PG9B 1FGVL 3QIUC 4FQ1L 3IAGC 3RTQB 1T0MB 4KHTL 4OD3L 4H8WC 3W11D 4EJ1C 4U1HB 4X7CC 4OCRL 3AS1A 3C08H 1I9EA 2HFGH 4XP6H 1JPFB 1RD6A 1QSVA 3LMJL 5MEPA 1NCTA 1MRFH 1HE7A 3TO4A 4MDIA 5ISZE 3SE3A 1PG7H 3VI4E 3KPRE 1A6AB 5F9OL 4MD5B 5CJBA 1FL3A 3S88H 3QDHA 2NW2B 4DVRH 1KCSH 2R1XA 3TJHD 3CFEA 3LPGA 5DUML 2F5AL 4PP1C 3K3QA 4AH2A 3ROOA 3D2UB 2IPKB 2RAMA 1FVEB 1MOEA 4Y4KB 4CDHA 5DRWA 4EDXA 4XCEA 3W39B 3RWHA 5E5MA 3VXUB 1MCRA 3NFNA 4OCLC 3RWIA 1XCTA 4S1QL 4BJLA 1GGCL 3QZWG 1BIIA 3GSUB 5DC0A 5I1KL 4UOJA 2VXTL 3L3GA 4HGMA 4NKDA 4NM4H 3BKJL 3A6CL 3AXLA 1GZQB 1YNLL 4JHAL 1CR9H 3ELAT 1ZLSL 3QUYD 5DFVD 3KPSB 1HK6A 1PSKL 4P5KB 1EEZB 3OX8A 4PTUB 5C07D 5KSAC 5J6GA 3QUZC 1EJ6A 5DJZB 1VPOH 3QEGH 4WFFE 1BX2A 1OD7A 2EC9T 3LD8B 2BCKA 5IB5B 5BW7A 1CL7I 1AR1C 1B4RA 3O41A 5I73B 1MLBB 2CO6B 5LQBL 2E7BA 1U3HB 4Q6IC 4U6VH 3OKEA 4P46D 3RAJL 4ZODA 1DDHA 4MB4A 1MIML 2CRZA 3IKCB 5F7MC 1EHLL 4CU6A 2DQUH 5GGQH 1JMXA 1LDPH 2YHGA 5MHSE 4P2OD 4YIQB 1RZ7L 1UVQA 2VAAA 2X4PB 1MIEL 1A7PL 1RFDH 1S9WB 4EI6B 5F1IB 1BFVL 1KGCD 1TNMA 3EHBD 3VFRA 5T1MA 1RIUL 1WIOA 1KJ3H 4PRBA 4TVSa 3ET9F 4AENA 1ZT1B 4M5YH 2E9JA 3ZO0A 3CFJB 4HX1B 3ARDB 3TO2A 4YUEL 4K71C 2ZG1A 3AMLA 1F58L 1RK1B 1KEGL 2BSSB 3VA6A 4GRLC 3PGCB 4HH8A 3GGWB 4MVBD 1YECL 3SGDI 3WDIA 1VGKB 2DQTH 1AKJD 4NIKB 3UC0L 2J8HA 4G3YL 3WLBB 1K8DB 4JR9H 4LNRA 2LV4A 3WJLC 4GKZA 3VWJD 5D6CA 1NFIA 4MQSB 3FQNB 3UBXI 1OAKL 3NA9L 1OTSC 1AGDA 4TSAL 1VEOA 4RBPH 4PGJA 5E8OA 1TQCB 3MYZA 5HY9B 4O58H 5JQHC 2Y5TA 1FC1A 4JY4A 3U7YL 1VACA 3MJ8A 5LGJB 4HKXA 5EULV 4OLUL 3VFVB 1YMMB 2BSRB 2VLLB 5I30H 4R26L 3CSYB 2HT2D 1FN4B 5DJXA 1IT9H 1Q0XH 3O3EB 3FZUC 1KF9B 4ZUWB 3KXFA 2O5ZL 1AJ7L 3DVFA 3MODH 4LRIA 2CK0L 3ZDYF 4Y4KC 3U7WH 1WBXA 4QGTA 2ZUYA 4LSTL 1P1ZA 3MRJB 1C8PA 3QEQA 3WXWH 5HHXL 4JFPA 2FYYB 3U82B 4M43L 2XQYK 3TN0D 3VXNA 4WO4C 3AY4A 4YHLL 2BSED 1EGJA 5I76B 4NGHL 3S5LG 5IVXE 3KYMA 3V6FA 1U6AH 4P2QE 2ITCA 2MQ0A 1VB9A 4JRYE 5I17A 4U1LB 4HS8H 5J0BA 2A9NL 4JPKL 2DKSA 2Y6SC 4JFOB 4P49A 3RPKA 4HK0B 3LD8C 5HHVH 5DMYA 4GKNA 1MHEB 4X9BA 4M7KH 1B3JA 5I73C 4YHZL 4PGCB 1NUFA 4L9LB 3BDYH 4NHCH 1OSPL 3MFFA 2YPLE 3QI9A 3RGVB 3WFHA 4PJEA 3BP5B 2VXUH 5CCKL 4OLXL 2P5WE 4TNWF 4PRPE 5IW1A 1OM3H 3GMOA 5EU6B 2IBZX 1FYTA 4TYUA 3MGTB 2LVEA 1S7XB 5EZJA 5KBNC 1U8NB 3Q5YA 1OB1B 4FQXB 5FGBA 1FL6A 1MPAH 4JDZA 3SKMB 3F7PC 1LGVA 5GS0H 2HT3C 4YE4L 4JZJA 1SYSB 1ZHLA 4M1GH 4EZMA 2FX7H 1HYSC 2HLAB 4NYLB 2AJXH 2QR0B 1QSFD 2EH8L 4Q2ZA 3QG7H 3DRQB 4G8GD 2OJZL 2VUOA 3D85A 4KROB 3GM8A 3SE9H 1ACYH 1NBQA 4P4KC 4WI2A 4QHNB 4Y2OA 2J2ZA 4TQEL 4LAQL 3RX5A 4U1GB 1DQTA 4IRJC 4OF8A 4RDQF 3ARFD 1F4HA 1LO5B 1WTLA 4WWKC 2AXGA 3HFML 3E2HB 4X4ME 4ZOEA 4KKBC 2VC2H 3MROB 3VXTB 1KELL 3G5XA 4GKSB 5ESQA 1MJ7L 1TQCC 1CL7L 4K7FA 5I71B 3V2AR 5JUEL 2OTPA 4HUNB 1NGZB 4KK5D 3OXSA 1T2QH 5GRZA 3ARZA 3H42H 4LLYA 1T80A 1RUPH 3HA0A 4BSWB 4F3FB 3X11A 5BO1H 2XYCA 4OLVH 4PS4L 4LU5H 5HGHB 2FO1A 1ZLUH 2NY4C 1NPUA 1P2CA 4LSRH 1XZ0B 3U0PB 1PQZA 5GQBA 4TSCH 1MFAL 2XPGB 3VH8A 3D25A 1C5CL 1LD9A 1OW0C 2I27N 2W9EL 3AB0C 3B6SB 4P2RE 3HG1D 1JE6A 3QO0B 5C09E 1ZT4A 3TZVA 3WS6C 3RPIB 3SKOA 3ZKMD 2DJSA 1N8ZA 4OGAC 5GGTL 4HS6A 1NGWA 4OCXH 5EN2B 4MJ4A 4EI5B 3RWJB 1YYML 4ONFH 2Y07L 4YDLC 5TDNB 1ZLVK 3O6MH 4DAGL 4WUUD 1JIBA 5E5RB 4N0CC 3DI3B 3A6BH 4WEBL 1CLCA 4LEOA 1OQOA 4FFVC 4P9ML 5B39A 3EYSH 1CU4L 3MGOA 3C60D 1EFQA 3P73B 1FFOB 3CFCH 1EO8L 4U1KA 2XZCL 3HB3D 4AIXA 2NY1B 9CGTA 4FHBD 4P59L 3HZYB 4MCZA 5DEFB 2O5XL 1B9ZA 2EXYD 3BD3A 2VNCA 3HPJA 1G7LB 3QFJD 5JPMB 3UP1A 1NBZA 3EOBB 3QWRA 5DURD 3WD5H 1MCIA 3P4NB 2DM4A 5IROC 3WV0A 4I2XB 3HI1B 1BWWA 5DEZA 3MQIA 3VXMD 1LK2B 3PP4L 2W38A 4YNYA 3ARUA 3GM0A 3HC3L 3NOIA 5D5ME 1CE1L 4FQXC 3F58H 1KIRA 2GJ6B 5EZOL 1ACZA 1WT5C 5F89B 4PR5A 4MS8D 2IQAB 4LSVL 3KG5A 5B8CC 5EOCJ 3DYMA 3UTTB 5IESL 3S36H 4AIOA 1U93A 4WNQA 1FG2B 1QLEH 2GTZB 4D9LH 1AO7A 1IEBA 4V1DA 1I1AA 2PN5A 3E1F1 5IBTH 1FZKA 5CWSA 2X05A 3GJEB 5JXEC 1NFDB 3VA2C 4U1GC 1UADC 4Z7UF 4Z7UE 3W5MA 2ITDB 5FDWA 2A6JB 3PGFL 3L95B 1V3JA 2VZTA 5E2VL 2IFFL 2IAMA 5BRZD 2WIMA 4LHQB 3VG0L 5HSFA 3CSBA 2DBLH 2FHBA 5I1JH 1VCAA 3ARPA 4U31A 2C4FU 5IT2L 4RMUA 1UXSA 3WNMA 3DRTB 2ICWA 1KXQE 4LSDA 3P9MA 4PRID 4R2GD 4HKZB 4R7DB 3WFBH 4M1DL 3O11A 2C7UB 4KVCH 4EOWL 1V3KA 5KAQF 5JHLH 4X7TB 2NY3B 4NC0B 1P5UA 1HXYA 1G6VK 2CLRB 1BBJA 3GMQB 4AT6A 1HH9B 3DMMC 5GHWL 5I8CA 3QUZA 3DO7A 5EDXA 5C0GB 4HS3A 1U8LA 4YK4B 5ID1B 2PR4L 4LDOB 3DV6B 5D7JB 5BMFH 1K85A 1JGDA 1OAZL 2ICES 5DD3H 5IB4B 5FYKL 4Q6IA 2DBJA 3HC4L 4OFYA 5DVMA 3SGKC 5DJYA 3T2OA 2X70B 1HIMH 4S1DC 4RNRB 1VHPA 3MV9E 1EEQA 1WF5A 3F12A 5CINL 5C08E 4WHCA 3ZL4H 4EI5C 2NX5D 2PTTA 4X5XB 5C70A 1IL1B 4ENEC 5AYUL 5HJ3A 5E94B 3TGXA 5FO8A 4M6AA 3K46A 3Q6GH 1D3CA 3S4SB 5C0BB 1KIPB 2OSLA 4FABH 1M1SA 3FCTA 4OZGB 3EGSB 4OZFG 2PUQT 3SOBH 1KTRL 4JG1H 4RRPG 1X5GA 1RIHH 2Z31D 2OZ4L 5TQ0H 4OI8A 4LNVA 4DK3A 3WL9B 3NZ8B 2BJML 3FB8A 2NW3A 2EDRA 4GRLA 1DANT 2UWEF 2DYPB 2MHAA 3L3JB 4Z7WE 3QISA 5H37G 1CZ8H 1KNOB 5IEKB 1CGSH 1MCSA 5AG8A 1R3KB 5BVPH 2BNRB 3WJLA 5HPOA 4W68A 2Y1VA 3UTPD 2J3SA 2NXZB 2HH0L 1ZEAH 2GTWB 4PG9A 3SJVD 4WU5A 4PJHF 1A1OA 2DQIH 3IXTB 4HZLB 2D7MA 2AJUL 2DQFB 2WBJA 1A6TB 3KLAB 1UYWL 2YD9A 3OKDA 3IFLH 2FHFA 2I07B 3RNQB 5D1ZD 4XPAH 3ZTNH 4ZOBA 4G8FB 4ORGA 2FATL 4WWID 4PJ9D 4ZTOH 1A47A 1RJZB 5FYJU 4J4PD 4J6RH 5IQ9B 2AGJL 3TEUA 1GGYA 4Y19B 1AGEA 3T08A 5GIRA 1YPZA 3G5ZB 4H20H 3LKOA 1T89C 5D2LA 3W0WB 2X1QA 3B9DA 2BVEA 3PJSB 3LV3B 4Y4KA 4BUHA 1G7JB 3W39A 5L6YH 5BZWB 5KG9A 4KZDL 5DWUL 3QDJA 3NPSC 4L8DB 3KLDA 4JM2C 4OM1H 5EO9A 3UBXB 2EE3A 2LFGA 3HI6L 4CRPA 3GSUA 4X99B 4GO6B 5JOPD 3QQ4B 3P9WB 3ARBC 3V7MA 1X7QB 4P23A 1MEXL 1OGAE 3PV6B 3LN9A 1E4WL 4FFZL 4WO4A 5FECA 2NY3C 2EDKA 2XICA 3BEWA 1J0ZA 5HPMB 1B0RB 4GAJH 3SQOL 5EH1A 1GC1C 3B9KD 3HNVL 4LVHC 5DJZA 3OHXA 5FA4B 2GSGA 4YDVB 2GIYA 5BOPA 4YK4C 1W0VA 2VDQL 4OGZA 3VW3L 2EDDA 1QBLH 4K23H 2VIRB 3HS0B 3O4OC 5F7YC 4HKJB 4P3DB 1F8TL 4XHJD 2RIKA 1ZMYA 4L3EB 4TNVK 3LKQA 1MVFA 1PG7W 4RMVA 2ZUQC 2VTFA 4H8WH 3IJSA 4UT6L 2DAVA 5IB1A 5MENB 1OAUH 3P0VH 1OAQL 4PLJD 2KQMA 1I8IA 1E6OH 3JWDC 3QNYA 2YPVH 1M7DA 4I5BB 5DO2C 1P4IL 1U8JA 1XF2A 3DVGB 5ALCH 3I6KA 4LQFH 3PHOA 3BIKB 1SM3H 3MLSL 4OQTL 4PJFE 2VAJA 1ZT1A 4LBEB 3L6FA 4X6BA 4AL8L 2DLFH 4EUPG 5IGXL 4IS6B 3ZYZA 1ZLVH 1VGKA 1KENH 4P4KA 3NIFE 2EYSB 2CIIB 1CFNA 3IU3B 5MEQB 5DD0L 1U8QB 2ADFL 4R4ND 3B9EA 4IRJA 5CEYB 3MLUH 2D3VA 2DIAA 1ZGLA 2VSCA 1M71A 3ZSTA 3IFOA 4JN2A 3UTSD 5F7FA 2NXZC 4WWKA 5CIPA 2XTJD 4L4VA 1C08A 3NCMA 2DI8A 3BUYA 4GXVH 4KQ3L 4H25B 4Z7OE 1JYWA 1ZV5A 3UO1L 5F7NC 2E6QA 2NY5C 4QRPE 4KTEH 2NY6D 4JFDE 3CXDH 3C8KB 5E70A 4LLWB 1CGXA 3MACH 3UPAA 4MHHG 2X4TA 1UM4H 3VFVA 3MR9A 4XCFH 2VLLA 5DR5L 2HFFB 2VLKB 3NIGE 2R2HB 1IJ9A 1MAML 3RY6C 5JA9A 3VWKB 5KVFH 4JKPL 4ZUWA 5HGDA 2C1OB 3REVA 2GK0B 3QDGD 3IGAB 4RMRA 1BECA 4F9PA 3RWGB 1GHFH 3T77A 3THMH 1S5IL 3WS6A 2XY1A 1OD9A 4OBRA 5ID0A 2ZOKA 2EDWA 2IMMA 4MQ7B 2AK4E 4XNXL 3C5ZC 4XTRD 4MWFA 5E56A 4M4PA 3NCCB 3L5HA 3O6KL 3O6FD 4XNMA 1T83C 5GS2H 2C26A 3HRPA 5DEGB 3ILQC 4JY6A 1UXWB 2ICEB 3HE7D 5I76A 2X4OB 1AR2A 3IDMB 2BFVL 4OB5L 4XPHL 4EKXA 2BVQB 2VWEE 4JM4L 3H0TA 4K3GA 2IBZY 5C6TL 3LEVL 5ACZB 1A9EB 4QOKB 4HCRA 2P42B 2YUWA 2QSTA 2IPTL 4JEGB 3QXDB 1OTUD 5IV2B 1SQ2N 2BNUA 4RFEA 4UB0H 5C0RL 4JFHE 2MCG1 2I60H 1BQUA 1IGFH 1H3PH 5IW6A 5IROA 4IRSC 1J7VR 3EYUH 3PL6B 4KDTC 1WBYA 4RFNB 4JLRB 4OUUA 2R0WH 2VLRD 4HGWA 3AS0A 3DV4B 4IDJL 3ALWA 3VD7A 3VXSD 4AEIH 3BH8A 1WT5A 5KVMC 2BVPB 1TIUA 1WWBX 5B8CA 4PB9H 1QPXA 4MJ5B 4WI7A 1JPGA 1CD8A 2X09A 1QKZL 3ZHKA 2XN9D 3W81A 1U92B 4UIKH 1GL4B 5T1DL 5C0CE 2ATPA 3C5JA 2JCCB 2Z8WC 1NCWL 1A6VL 3TA3B 4PGZA 2ESVA 1I4FB 5JXEA 1VESA 5CP3A 1TJGH 1CVSC 4QNPF 5KSBF 1HHJB 1CDGA 4WHTA 5KSBE 3V5KA 4NSKB 3EFDH 1TDQA 4MAYC 5FA3A 1F4AA 5T3ZD 5FCUH 3OKNB 1Y6NR 4OLZH 4Y5XA 1KUMA 1UWGH 3CH1B 2ZJSH 4OD2B 3MXWH 3ARGD 4I3RL 1IE5A 1XGRA 5K9QG 5JO5B 3D18A 4MJID 2MWCA 1A6ZA 1MI5D 1JK8A 3L3KA 3NCEB 4S2SB 1HEZA 3RBSA 1Z6JT 1RZIA 3W2DL 4XBPB 2DJ4A 4EXKA 5FKPB 3GHBH 4DTGH 1YEHL 4BKLA 2ZCHH 5AZ2H 3FQXB 1T5WB 3DMMA 3HPLA 3WJJC 2IG2L 5FV2A 5IVNA 3LQZA 2RGSA 4HIHA 4JQIL 2V2TB 5FM4A 2YA2A 1U8KB 3LSOB 3IF1B 1UT9A 1G0YR 2E9WA 4JQVC 2AQ2A 3U0PA 4K7PL 1JGLL 5INDA 2XPGA 1FJ1B 5ENWB 3UPRA 1BJ1H 3BP7B 3DPBA 3PNWB 3LS5H 4F7MB 1I1YB 3MCKA 1QHOA 3K8KA 1E28B 1T04A 3SGKA 2BVOB 5D93B 3SPVB 3IFPB 1P4BL 4Z7NE 1H3XA 2OXGA 4NJAL 3H9HB 1YEDB 3SEPA 4EI5A 1KXTB 1KTLA 5F70A 2HLFC 5E4EC 3LKNB 4FTVD 5CFHA 3HI5L 5DRXA 1SJHA 1MH5B 4E0RB 4P5MA 4GUPA 4TN9A 2CDGB 1EHNA 5DK2B 3GSRA 3P73A 1UGNA 4JFEB 3O2WH 1J86A 2CMRL 4PV9B 3FRUB 3QYCA 4LLDB 5F8RC 4N5EC 1DUZB 5DSCB 4YHKL 3HZYA 2EECA 5FYJD 1Z9MA 5HHMB 1DLHA 1YMHB 4BQ8A 1FFNB 4HH9A 2P43B 5CIPH 3EOBA 4X80H 1SVZA 3NACH 1A4KB 1F6AB 3D1MC 4KJPD 2NCMA 3TBWB 4UILH 1OY3B 5KZCB 4DKEH 3PDDA 2DWEB 3SDAC 3MRGA 4NN5B 4XPBL 1HKLL 3QCTH 4JFFE 2JTDA 2GJ6A 3U4EB 2UYLA 2FJGB 4XVSL 2H26B 3BOVA 2IQAA 4G5ZH 3QIBD 4PRHD 1DZBA 3RI5F 3HLAB 4I0CC 1MCCA 4WIQA 4PJIF 1P84J 2M8XA 2PYEA 1M05A 2JK5A 3T0EC 1TCRB 2IANA 1BJMA 4G7YH 4NQEA 1Q94A 1TJHH 4ODVH 1QUNA 4LCYB 1AIFA 4JFQB 1KCVL 3FT4B 1T20A 3FRPA 2OJEA 2ZKHH 2ITDA 5TQ2H 2HJKB 1N0XL 1J8HD 1NCDH 3O4LE 5C0FA 1JI2A 1T22B 2EH7L 3VCLA 1P6AB 4JRXD 4L8SB 1I7ZA 5E8DL 3OKKA 5FXCH 4Y16D 1JPST 4JM2A 4M8QA 3GSNA 4R97C 5IB3A 4JO1L 5AZEH 3O3AA 1E6JL 1L6ZA 4LLUA 4U1SB 5GJSL 1T7YA 3ARBA 4J3WA 4LGRB 1SJVA 4GW5A 4HWNA 4HCRH 4QYOB 5DZLA 4GMTH 3BWUC 1MRDL 3BEVB 4XCNA 1INEH 1KLUB 3I6GA 3RBGA 5ICZB 1LO4H 4MLIA 2Q6WA 5J4MA 3IU4H 3MREA 3SCMB 4MNHA 2DTML 1AE6H 2FL5A 3FFCD 5J11B 7FABH 4HIJB 2XFXA 2ZSWA 3T0DA 3V0WH 1RU9H 4FZ8H 3S37L 2H6PB 3QEQE 3WO4C 1WV7T 2F5AH 1A1MB 5I19L 5D93C 4OUOA 4JDTL 1MHHB 2H32B 4QRTB 1KLGA 3CFBB 2CXGA 4F7CB 12E8H 5FGSA 1A7BA 5E94A 1S9XB 3QG6A 1TVBB 1UH4A 4S1QH 3TH3T 3L3IA 1N59B 3S4SA 3L1OL 2XY2A 4IHOB 3VDCA 4JY5H 4F8QA 1Q1JH 3EO1A 4XGZB 5F88A 1ZLSH 1X5FA 5CP3H 3H6JA 2CKBA 4FQ2L 3S5LB 4JAMA 2F54D 2IBGA 1QLFB 3DROA 4Z0XB 4PJEE 4NKIL 1JPSH 1IM3A 2M26A 1F45A 1WWWX 3PDOA 5JHDB 1KNOA 3GK8L 1CICD 1FYTE 2G5BB 2GITA 3RA7L 3H9SD 4LL9A 3VRIB 4UDUA 2BNRA 2F8XC 4C83B 3PIQB 5J1AB 4H26B 1PY4A 4RMQA 3LRSA 2NY0C 3UJJL 5JLZB 1J0IA 4MJ2A 3UTZA 3BZFB 4N1HB 2F9BT 5ICXB 5JIPA 1EHLH 4RWYL 4FNLH 3ZKSD 2VDOL 2P8PB 2FEDD 1E4XI 4XH2A 2AABL 5KVDH 1HYRC 4XXDB 2W0FA 1OP3K 3TIEB 4C59B 1NBYB 2APXA 4NJ9H 4DGIH 3NN8B 2B7DT 4U6XA 4XWOC 5IJKC 4BFBD 1BLNA 1QSED 3E6HA 5D7LB 1RIUH 4JG0H 4HIEA 3RY6A 1EO7A 4MHHI 5DJDA 4ODXB 4Z0BH 4HDIB 4ZSOA 4YUEH 3S34H 4D2NA 3SDXF 2YKLL 3SDXE 3G5ZA 2COQA 3BGFB 1BEYL 3PWPB 5CSGA 2W60A 2EIEA 3RWDB 3TVMB 5HHOA 2P5ED 5BZWA 3DIFB 4YFLI 1WAAA 2ZCLH 3GHEL 1CQKA 2VDMH 1AGCB 2AEWA 1N26A 4OGYL 5C1MB 1M7IA 3C5ZA 3QA3B 5I8KL 4LIQL 1T83A 1ADQL 5CZVL 4M93C 2PO6B 1FNSL 5FOBB 2X1OA 5TDOA 2GAZB 2ZOLA 5SWSA 2HKHH 1T5XB 1TZHA 1T6WA 1MFDH 3INUH 5TF1L 5CBAA 2VDRL 3BZ4A 2RFXB 1A9BB 4WTWA 3NCYP 1BQSA 3T3ME 1LEGA 2VLJB 4POZC 3VMNA 4FP8L 1SY6A 2QKIB 4WW2C 4M5ZH 4CW1A 4P3DA 1X4ZA 5GZOD 4APQB 2VKXA 4IRSA 3R1GH 2EDYA 1I3GL 4KDTA 4OGXL 3WMSA 4NQUA 1JZ3A 3EO9H 4OJFL 3D0LB 5DI8A 3TBVA 4CMHB 3K1KC 3NPZB 1S7QB 2KKQA 3B3IA 2R1YA 5D9SB 2GY5A 1X5YA 4U7KA 5IF0A 1HI6A 2AXHA 1XF5B 4M6OH 5IB2A 4QT5A 2J6EH 1ZWIB 8FABB 1NANI 1T1XA 1YUHA 2DQCH 2G2RB 3U0WH 3GMLA 3MV7B 3MA7B 3U83A 2VERN 5CD5C 3TIDA 5CGTA 3S97C 1AD0A 1HHGA 1ZK9A 4J12A 2UZIH 3CGTA 3ULUE 3ULUF 2QSCL 3PABB 4GAGH 3KPQA 4YZFE 4JFXB 4CJ1A 5ALBH 1HN1A 4JHWL 2FX8H 1ES0B 2EYSA 3GSNH 3B5HA 5KS9F 4P57A 5MEQA 3BH9A 5HTSA 1JWSB 5JMRA 1U8QA 1TMCB 4MAYA 2AXFB 4KKCC 4HJJL 3WIIL 4PJBB 4Z77A 1LP9F 4QTHB 4XMLL 1FE8L 3OR7A 2EDEA 3STZA 5JW5A 4I9WD 1MELA 1R3JA 4V2CB 3BPLB 1GC1H 1S78C 1AO7E 1FL5B 1MFBH 3FO2A 4P46B 3RWCA 5I1GH 3VXQB 3X3FH 5K9QI 4FXKA 1TQBB 4RX4D 1ULVA 2AV1B 2HA1A 2R23B 4PG2C 3JUYA 4JE4B 5T3XH 1JHKH 1ND0A 3DGGB 4LLWA 3FONA 3VRJA 3WJJA 3GMMA 1LVEA 1ZE3C 1ZVSB 5EO1A 3DX9B 1FBIH 4XP4L 5IFJB 1VFUA 3U9PH 4H1LA 1VGEH 1U95A 3UJTL 1UB6A 3WNOA 4PJAF 3JWDH 1NEZG 1LNUA 2ORBL 4JFZH 1DBBH 3MLTB 3BIBX 3WNLA 5D72L 4JPWH 2PETA 3RVTD 1YA5A 3IYLW 4XNZB 4NOBA 1UWXK 5ISZD 1JCKA 1C12B 1RUQL 1IAIH 1WEJH 5DYOA 2VXVH 4QRQA 2CJUH 2I9LB 3IDJB 1RJCA 1U2HA 4EN3D 2IF7A 1MFCH 4P4RA 3D85D 5TPWH 3TBTB 4DEPB 3CXHJ 1M6OB 4LPXA 3MV11 3UZQA 2D4FA 3QWQB 4NQCB 3NCJL 2GUOA 5EBMB 43C9A 5EU4B 4G43A 3W11C 5F1SA 1CBVL 3Q1SH 4OI7A 3QHZH 2QSQA 1OSZB 4ODHL 3QEUB 5ESAA 1KIQB 1I9RL 3ZTJH 4LLAA 3O2DH 5SWQA 1E4XL 1QBAA 5DJ2B 3UZEA 1VEMA 1MAJA 2NY5H 3S35H 4D9QD 4HJGA 2JKXA 3FQRA 3TJHC 4CMHC 3B5TA 1MCNA 1NAKH 1S3KL 3K7UA 5I1AA 3SDAA 5DUPL 5DJAB 4OFPA 2EZ0D 3AVEA 4LF3B 4WV1B 1P7QD 4R0LB 3MRQA 3MMEB 2H2PD 1DEEB 4ZFZA 3TJEL 1QRND 3VFPB 5EIIA 3QHFH 5AWNL 5DD1H 2BVPA 1CLOL 2JELL 3AFLA 3ULSB 2H8PB 3ULVL 1MJUH 1U58B 3U9UB 1VFMA 3T0EA 5ELIA 3T04D 4P0DA 1QFUL 3OB8A 5CEZD 3MYJB 4PREB 1DVFB 3V5DA 4OZFB 1U8OB 2JIXB 1NCCH 1TVHB 5DFVC 3EYQD 2BOCA 5E1HB 3CFDB 3VI3F 3HC0B 3S3PA 3TV3H 3KYKH 2O5XH 3W9DA 3KPRB 1IGJB 2Q8BH 2X40A 2D7PA 1ERNA 4QXUH 2AP2A 4BH8B 3ABZA 1GZPA 2CGRH 2UZXB 3V5HA 5EG6C 1VADB 3WFDH 4NHUA 1HILA 3MRIA 1FNEB 4PJGB 4ZUUA 2XTLA 1OTTD 4YAQB 1JHLL 2VXSH 5JR1H 4P46C 1MCWW 3QJFA 4DW2L 5GRWA 1JTPA 1OP5K 3WE6A 2GQHA 4QHKI 5EZOH 1SY6H 4NRZB 4MXWH 4S10A 3NABH 4WGWB 1FDLL 4P2OC 2EDQA 4MNGB 1YPZE 4PJDA 4ZPVA 3GI9H 5D2LE 2QHRH 2HVKB 4NO0D 3RUGA 3LSOA 3IF1A 1Z9LA 3LH2L 3PWLA 3EHBC 1YC7A 3VXUE 3ROLA 3QDJE 3KPOA 4ZUVB 2AERT 5DMKB 2G9HB 2HFEB 3TNMA 4WW1A 2C3GA 1M7XA 4F7MA 1NUDA 5I8OH 4IDLA 4JPIA 1G9NL 5EOTA 2BVOA 3B2VL 3QPXH 3TBSB 2DJUA 2XWJB 4XNZC 4X6FB 3RRQA 4NWTL 1YEDA 4DGVL 4I48B 3P3YA 3WS3B 1SMOA 3GB7A 4HW6A 4WFED 1BQHA 1IARB 1UACL 3ZDXF 1RHFA 5IT2H 2AS5M 1BAFL 4E0RA 3ARFB 3VWJC 3HHRB 1EHAA 1QLRA 4ODWB 3CMOH 1CXEA 3MBEB 4HWZB 4JFEA 4O4YH 3SDDA 3M07A 1U3YA 1G7MA 4XVUD 4EOWH 4OT1H 5H8DA 3GIVA 1LO3L 1WGOA 2PTVA 5TJWK 4WHYH 5HYJB 5BVJB 1A5FL 1DL7L 3MRPB 1BZ9B 1BJ8A 2X44D 3LRGA 4NDMB 4M7JH 4M4RA 3L7EA 1JF1B 4YGAB 3L9RA 1IZKA 2HT2C 4UUJB 2XNAA 1QRKA 2ZCKL 4ELMA 1B2WL 1K2DA 3DURB 1MJJA 3MRKA 4HG4J 2IEPA 3O3UN 3GKWH 4K7PX 1HSBA 4LLQA 4YHML 2DWEA 2Q20A 1HNGA 3LHPH 3KJ6L 5INCB 1I1CA 4WV1C 3D0VB 1NC4D 4R0LC 4MMXC 1AP2B 3U4EA 4HWBL 4B53A 3UZVB 2EIDA 5E6IB 4WDIB 3WKNA 4OF3A 1IAMA 1Z0NA 4GAYB 3FHAA 1OARL 3K0WA 4H1LH 5TE4L 1NC2B 5IJKA 2VYRE 1DVFC 5ADOH 3TN0C 2P5WD 1CLYH 3LB6D 4MCYA 5FO9B 4JFQA 1D5MA 5JDSA 3BPOB 1T7VA 3Q6FA 3MRHA 1VKXB 1D5IH 4L4VE 5HBBA 4EUPB 1NGPL 3RL1B 1T22A 2VMFA 4N90D 1CGUA 2NNAB 2Z4QB 4TUKH 3BE1L 1J9CT 4CVXB 2FBJL 4X9GA 4G42A 1XR9B 4XI5D 4XNQB 1NAML 2VSDA 5IQ7L 4OZ4A 1BFTA 4ZPTA 1KV3A 4I3GA 3EOYG 2NLJB 4X83A 4Q9QL 5F6HI 3FOLA 2I5YH 1TVDA 1P84K 3H8NA 2E8ZA 1OWRM 2VABA 4ERSH 4X6DA 1QFHA 4XMKL 3BHBA 2VOTA 3QDMD 1WC7B 5EU3A 5BS0D 1KPVB 2IADA 5IVXB 3VE0B 3MRCB 5CSZA 2BRRH 1AFVH 4WW2A 4JRYB 4PRDB 4LSQH 1PFCA 3RU8L 3QFDA 1NCAL 2AGJH 5DHYA 2GT9B 5LGHL 3MX0A 1CYGA 4IIQB 5EU7C 4XT1C 5B3JE 1HH6A 4PJ7F 4CU8A 1WSST 4QRTA 2WBJD 1CF8L 4FFYL 2D03L 3RY5A 5E8NB 1G6RB 1ZHNA 2R69H 2MKLC 2JE8A 2FNBA 3VD5A 4F7CA 2F58L 3CD4A 3VFSA 3FO0L 4D8PB 2K3TA 1XF4A 3OZ9H 1S9XA 4CKVX 1J1XH 4LCWA 4KPHL 2WIIA 4LEXH 4NO2A 4R96A 3ARFC 3GMNB 2BMKB 4OLWL 5BRZB 1MRCL 5TGBB 2BDNH 5IHZA 4KUCD 3FMGH 4X5WB 3QXUA 5DQJA 1FZMB 2ZZUT 3M17B 1QBBA 4P2RD 5EC2B 4PRAB 1EEUA 2OXHA 3EYFB 1UWXH 1UCBH 3SQOH 1O7SA 3A6OA 1Q9WB 3EDEA 2J88L 4X6CA 1R24B 5IJVB 5IEHB 4KK5C 5GS1A 5I1LA 3KPNB 1UFUA 4B7IA 3ZZ1A 2G60H 3HMWH 3TNNA 3WNKA 1U0QA 1W0WB 1B6UA 4QY8B 3ZYJA 2D0GA 3OXRB 3RZCB 1XGUA 3TCXA 3PIQA 2W91A 1T4KB 4NUGL 3MRRB 3S37X 3WLWD 2HMIC 2Y36L 1MF2L 3LZFH 4TPRH 1T66D 1KBGH 1LILA 1I1FA 2NTFA 4PD4J 1INDL 3ZKMC 5CD3A 4N68A 2E27L 3IDXH 5BQ7B 1O0VA 1PBYA 4NC1C 2WMPA 2ESVE 3MOQA 4UV7L 2FZ3B 5T1LD 4C57C 5AG9A 5D7IA 1FAIL 1H3WM 5DUBA 5D7LA 2V5TA 3VH8G 3AU1A 3EJYD 2BNQA 1MUJB 2BVYA 4HIXH 4HDIA 2ZPKL 3C60C 3BPOC 4KRPD 3S96A 2D4DA 3QIWD 4F7PA 3HB3C 4GW1A 3WEXB 3U46A 3GO1H 4Z8FH 2AJSH 3QUXB 4IJ3B 4BELD 1FH5L 2EXYC 1FRGH 2WNGA 3TF7C 3ESVF 2CXKA 4DKAA 2CUHA 4WCYL 5B39G 1RIVL 1MCOL 5C09B 1LO0H 1XFPA 4O2CA 4G9FB 1NGQH 2JB6A 1CD1A 1RZJL 5I1EL 3QH3A 3RJQB 4FG6D 4I1NB 5HYSA 1YY9D 5HGGS 4ZYKA 2UY6A 4F37F 4U7MA 1PX3A 1Q9KB 3FO9A 4MS8C 5C86A 1PX4A 3GBML 5DR5H 4JGJA 4K9EL 4LLMA 3KPPA 3JV4B 4GLRH 4BQCA 2Q7YA 1OP5H 2FLRT 4IIQC 3ULVC 4XAKD 5AEAA 5KW9H 3TH2T 4C56D 4J8RB 1J0JA 5DRNA 1CD0A 4PLNC 3KDMB 3D0LA 4N8PA 4YC2B 2B39A 1CGYA 3MV8A 5D6DC 3C08L 2NZ9D 5C2UB 2HFGL 3G9AB 4XP6L 5CUSH 3T0WA 2XZAL 2GI7A 3L5XH 2BC4A 1MRFL 1P5VA 1PG7L 2XWTA 4ONOA 3L3HB 5D5MB 3ZE1E 3G04B 3S88L 2YK1H 4FQQA 1KCSL 3PWVB 4R2GC 3FAWA 5E5UB 5C08D 5HHNA 3QUYA 2VO5A 5DA4A 1SJEA 5DT1H 4YX2H 2HRLA 4ZXBB 1YEGH 5C07A 2XG4A 1FVDA 3BQUD 5EA0H 1T21A 1JWSA 3MTRA 2BHYA 2AXFA 1WBZA 3IDIB 5IBLD 1A6PA 2GSIA 1KTDA 2Z93A 2HFTA 1ZA6B 2GJ6E 5GGRB 5C9JA 2A6DA 5FGRA 5HDBE 3I2CH 2Z91A 1RHHA 1WZ1H 4NM4L 1CR9L 4FS0A 1S8DA 4P46A 3VXQA 2IANE 3H7BA 3S9DB 4NQEE 1XEDA 2QADB 4ZFOA 1U8HB 1VPOL 3QEGL 4JJ5B 4P99A 3U0TA 5AYQA 3C6LD 1G9EA 4P2OA 1NFDF 1JN6B 4Y4FB 3BKYH 4NNYB 1UJ3C 1IKNC 3T09A 4Q7DA 4R4FH 1BZQK 2OCFD 3MA9H 3S3JA 3GSVA 1BIHA 4XVJH 5GSRB 1UJTA 3VFGH 4PJ7A 2R29H 5E1AA 2Z31C 4Y5VC 2EYRB 3EZ8A 3W5NA 5GGQL 4IJ3C 4F9LC 3CDGB 4JREC 2ZG3A 3DUHA 3Q2CA 2E9IA 5HGAA 5I75C 1LDPL 4LPWA 1LEKA 1AKJA 1T1WB 4YDKH 1RFDL 1URLA 3WFZA 5I6XC 3KYAA 2I9LA 4PJXF 1ZT7A 2X4SA 4QGYA 1U36A 1MCFA 2CDFB 2AW2A 3V6OC 5GRJH 3MV9B 1KJ3L 3VWJA 3NFPB 3LPFA 4M5YL 2XTJB 5T3XE 2OMNA 4DCQB 4QHMB 2HN7B 4GRWB 5M7QA 2BERA 5CGYD 1ZHKA 5IFHH 5EBMA 3K8LA 3P4OB 2DQTL 1HOCB 5JPNB 1BQLH 4F37K 5L9DH 1BFOB 1QVOB 3QEUA 5FYLD 3VFMA 4Y89A 4JR9L 5D1ZC 5T1KD 1OGAD 5ECJE 3O45B 5DJ2A 4PJ9C 2DQJL 3Q5TA 1PGRB 4J4PC 4J23A 2RCSH 1YN7A 2DQEL 4NNXA 4LOUD 4MJ6B 4HQQH 2AK1H 5C0ND 4X4YB 4YC2C 1NGXB 4OZGF 1DQJB 4WV1A 3OV6A 5J06A 1WISA 4O58L 4NJAH 2F53B 3HCVB 5DMGD 3CXHK 4G8EB 2GCYB 1CS6A 3PWUA 1CDIA 5I30L 2F74B 3OL2A 3VFTA 1BZ7A 1IT9L 2EC8A 5MP6H 1Q0XL 4Y1AD 2PCPA 4YR6A 5E8EA 3D9AL 4E9LA 5C9KA 3LOWA 3TN0A 5DK0A 3T4AB 1NCBH 4Y4HD 3HUJA 3MRDB 2N7AA 3GSQA 2BNRE 3MODL 3HC0A 3QXAA 4GBXD 3U7WL 1A3LH 2APVA 3B9KC 2VQTA 4U6HA 2WQ8A 3UYOD 2IPUK 1KT2A 3MZGB 4IM8A 2P24B 2I26N 4XHJC 1P4LA 2Y4SA 4PJGA 5EBWA 2EDLA 4WGVB 3HZVB 5DHVB 1GYAA 3FQWB 4YAQA 4NQSA 2HJFB 4K8RL 4NQDA 1BWMA 1HKLH 4HS8L 3N9GH 3EYVB 2X6MA 2VLRB 4PJ5D 1JWUB 4PLJC 2DQGH 4ZO7A 4ZSOE 5HHVL 5B22A 5A16B 2WM0A 2R4SH 2X4RB 3BKCH 4L3CA 1NKOA 4NO5A 1IM9B 1QFPA 1X5HA 2NR6D 2MCPH 4X4XA 4M7KL 5HHOE 1S9VA 1ZA3B 3BDYL 4L5FH 1KOAA 2CSPA 2DQHH 1WAAE 4NHCL 5EZLB 2G75B 4ZUVA 1UB5A 4LVNB 5DMKA 2J8UA 3RVXD 2VXUL 4MB3A 1QSFA 3T65B 1OCWH 3BPNC 3GUTB 1OM3L 1D9KD 2Z92B 3DYPA 4NQTA 2LQRA 5KVEH 4G8GA 3GSWB 4X6FA 3U6RB 5ANMA 2DWDB 2IBBA 1A7QL 5SWSE 4I48A 3D69B 3MRFB 1IGCH 5HVHC 1FAKT 4XPGH 1SBSH 5ACMA 3BP6A 4R4NC 1CFSA 1MPAL 4M61B 5GS0L 2A38A 2LU3A 1AXTH 3ARFA 2HJLB 5GJSH 1K6QH 4BSJA 4M1GL 4OSUH 3KPMB 2XTJC 4CNIB 3RDTD 4HWZA 1FLRH 2AJXL 3C5SA 3BWAB 3O3BB 4QHUB 1WQVT 2QLVB 1MCHA 4MJIB 3LKSB 4H0IA 3V4VH 5EOQL 2DM3A 2YC1B 3SE9L 3QXVA 1ACYL 1MCDA 4OLYH 5I8EA 3KNBB 3PWNA 1AH1A 2NY6C 2AEQH 1QO3B 2DIBA 3PQYD 3WIFB 3FB5B 1XAUA 4U1JA 4PJFB 4BFEA 3X17A 1EAPB 4NDMA 2ADIA 4L4TD 4LSPH 4ZDHA 2MTPA 4OAWB 1DCLA 3N85L 3X13A 1NL0H 5IMKA 2NY7L 1BOGB 1Z9SA 4TUOB 3O0RH 2V7HB 4I0PD 3DXAD 4HBCH 2VC2L 4D0DB 3HKFA 3K4AA 5DLML 5INCA 2GFBA 2YUXA 1S9YB 1IGIH 4U2YA 3MRNA 3CUPA 3BO8B 3HG1A 4MSWA 3VXOA 5DGRA 1WFUA 5BJTA 3M1BB 3KWWB 1RUPL 2FSEB 4OZHA 5C6WH 5KANI 4XTRC 1ZS8A 4JFHD 5BO1L 1R5WB 3O6LH 1IVLA 2C3HA 4HUVB 4OLVL 1A1NA 4LU5L 4Z7VF 3O6FC 1YN6B 2VITB 1I7TB 2V6HA 3FOMA 4LSRL 3IB4A 4QRPB 4UTBH 4WUUA 2O26U 4TSCL 5C0AD 3SDCB 4R4BA 3HE7C 1LO2L 3C60A 4WI3A 5DFTA 3EO0B 3LKRB 4NPYA 3DX8B 3MBXH 1T2JA 1S7UB 2OTWB 3PP3K 2CLZB 4Z7QF 4OCXL 2O5YH 4ONFL 1C5DB 3MUGA 3O6ML 3QFJA 1OTUC 1TTFA 4U1IA 1PZUB 1RY7B 1Q9LB 1FV1B 1EJOH 3A6BL 1D6VH 4NQXB 1F3DJ 4L8BA 1MVUB 3GSXB 3GBLA 4QLRA 3BYTA 2FR4B 1QFWH 2F15A 3BGAA 1X6NA 2AK4B 3CFCL 4PGEB 4UNTA 3VXMA 4IOIA 4RAHA 3SY0A 3SGEH 2VDOH 5BZDB 1NDMB 4Q9BA 3O81A 4FQLH 4NKMB 3TCLA 5D70H 4X8JA 1Q8MA 4YHYB 3VFWA 3MRCA 2ADJA 3QIBB 5JW4Q 1GSMA 5I66A 3WD5L 5J13B 4J3VA 1XGPA 4LVNC 4QRUA 2FECI 1J12A 1S7TA 4OKVB 1F6FB 3G6JB 3BJLA 4G7VH 1A7NH 3OJDB 3T0VA 2C1PB 2EIZB 3HNTH 5T5NG 4BSVA 1G6RA 2OBGA 4Q9RH 3OKOA 5DJ6B 1EXUB 1JGVH 3F58L 1G7QB 1NMCC 5IR1B 1EMTH 4QRRD 1CT8A 1JVKA 1I7RA 5D6DA 3S36L 3B5GA 2UZYB 5IVZB 3GMNA 3NAAH 4QOKE 2BMKA 3HZKA 5BRZA 4D9LL 4I18B 2OM5A 4JVWA 3ARGC 3P77A 2AJZB 4WFGD 3RWFB 2Z8RA 2H1PH 5IBTL 2JB5H 5CP7A 3I50H 5IMLB 4PRIA 2XI9A 4GRMB 1N6QH 2VDKH 3IDNB 3QO1B 5DTFA 4ONHA 5ESVB 3EDJA 2FIKA 5MERA 4XRCB 2UUDK 3DETD 3SE4A 4EQ2A 3WDHA 1HHIB 1U9KA 3VDAA 2D0HA 1FIGH 4M8VA 1QNZH 2WINA 5GGVY 1W0WA 1EGJL 4CN1A 2DBLL 5HI4D 3O9WB 5I1JL 2GY7B 3BGMA 3RHWF 4ALAH 4JO4H 4LFHG 2X89D 4V2BA 4HHAA 1R5VA 3WFBL 1CQYA 4XCYA 4OGXH 4O2FA 3HE6B 2LVCA 1IC1A 4KVCL 4EXPX 5K59F 5JHLL 1X5AA 3T0EE 1IGYA 4FOMA 2CH8A 3ORJA 1CGTA 1F42A 2JCCF 2R0LH 4OV6F 1QQDA 2NX5A 1IAKA 2B5IB 3LDBC 5MEPB 3IVKA 2APBA 1BVZA 3PHSA 4MDIB 3ILPA 3TO4B 1UJ3A 3IKKA 1FL3B 4MDJA 5BMFL 1U41A 5A1AA 2Q7NA 5DD3L 2AXJA 2R1XB 3CFEB 2C3VB 4JFFD 5FKAA 2BHZA 4AH2B 4MB5A 4B5EA 2Z31A 3ROOB 4Y5VA 5D1QD 1KULA 5DRWB 4EDXB 4XCEB 3ZL4L 3RWHB 4F9LA 2RR3A 3P0GB 2DI7A 4HJJH 2AVGA 3NFNB 3RWIB 1NCUA 1XCTB 3Q6GL 1BIIB 3RNKA 3U2SA 3HN3A 4FABL 3S98A 4NKDB 4KJPC 4UAOB 4PJDE 3V6OA 3SOBL 3AXLB 4JG1L 1BMGA 2X4UA 3RUGE 1RIHL 4J7RA 4PLKD 5TQ0L 4HEPG 3AC0A 2IH3A 5SX4I 3OX8B 3O4LD 2AKRA 3SJVA 1DUYA 5LAXA 5J6GB 1EUTA 3DSFL 4ZOCA 1FORH 1BX2B 2BCKB 1JTOA 3QIBC 2B1HH 1JGUH 1CZ8L 5IP4A 1FZJA 4DUWA 4LSUH 1CGSL 3JV4A 3TYFB 3O41B 5D1ZA 1EHXA 5IIEA 4PJ9A 4ZFFA 1RZGA 6CGTA 1ITBB 3FKUS 4J4PA 3UJTH 1ZEAL 1DDHB 4LVOB 5LWYH 1H15B 3D39D 2DQIL 2C3XA 4XB8A 4JFEE 4XHQA 5SWZD 2QL1A 2AJ3A 1UVQB 3IFLL 3BKMH 4Y16C 3QSKB 4XPAL 5DMIH 3ZTNL 3VGAC 4HUMB 5JW4R 3VFRB 3L3HA 5HHME 1NUNB 5T1MB 4ZTOL 4J6RL 4PRBB 3ZYOA 4AENB 3TO2B 3FRPG 1X9QA 1ZSDA 4H20L 4K8RC 3OPZH 4ELME 5L6YL 3B9KA 3GMRA 1FNFA 4OM1L 5KJRH 4LNRB 4WENB 1ORQA 1ZA6A 4XPTH 4HPYH 4GKZB 5EC1A 4KI5F 1U8IA 3P2TA 5D6CB 3ARSA 3RHWK 4RAUA 1DR9A 4HUWA 4PBVC 1XIWD 1AGDB 1FG9C 4Z5RA 3MNZA 5E8OB 1A7OH 1L6XA 2CKNA 4GAJL 4K3JH 1QBMH 1EDQA 2OL3B 2VL4A 2Y5TB 1FVCA 4FA8A 4JY4B 3VDBA 2FECL 4P48A 5CJOH 4OFDA 5FDYA 1R3IH 1QBLL 2V5YA 4HKXB 1FZOA 1OAXH 1IQWH 4U6YA 4OZIA 5DJXB 2IGFH 3P11H 3ES6B 4OCWH 5EUOA 1G6RH 1KC5H 2BRQA 3KXFB 5L88H 5ERWA 3EW3B 4M62H 4PTTA 4H8WL 1S7WA 1WBXB 1OAUL 3P0VL 3CDGA 1E6OL 2B20A 2YPVL 3AROA 5F7UA 1P1ZB 5GGUB 5GZND 3S4SG 3FB7B 3QEQB 5I15H 5ALCL 1T1WA 1YNKH 2R56H 5EIQA 1CICC 4LQFL 1SM3L 1AXSA 2C4XA 5E8PA 3VXNB 3MC0A 2WQRA 3UTSA 2BX5A 3JSSA 5IKCB 3KYMB 3V6FB 2UY7A 3HNSH 2ITCB 3PP3H 4PIRF 5I17B 2ARJA 2DLFL 2P47B 3SKNA 1CG9A 2FEDC 1KENL 5JPNA 4TRPH 1RUKH 3MLUL 1HCVA 3O45A 4IOSD 4TTDD 3MFFB 3ZTJG 1L0XA 3QI9B 4OQ1A 3WFHB 5IM7B 4PJEB 3QCVL 5B3NA 4GQ9H 4LCWE 4GXVL 1FGNH 4LVOC 1T1YA 3GDBA 5IW1B 3SHSA 5CAYB 1WLHA 4X4YA 4UQ3A 3QDGA 4KTEL 1FYTB 2V2XA 2B2XH 5EZJB 3RGHA 3V7AG 1A22B 5E2JA 3CXDL 1FNGA 2F5BH 3MACL 4ODUB 1DBJH 1UM4L 1FL6B 4XCFL 4Y5YA 1ONQB 4WVRA 4JDZB 1KJ2A 1BAFH 4NZRH 1PVHA 4X6CE 1IGTA 4JZJB 3O6FA 1ZHLB 2P4AB 2WV3A 3QNXA 5KVFL 5DD6A 2GK2A 2EDFA 3VXPA 4EN3B 3HE7A 2E5EA 1UZ6F 1AQDB 3D85B 3FN0H 4F7EA 5DS8B 1KPRB 1GHFL 3THML 5FHAH 5BV7B 2EDNA 4P5TD 1EBPA 3VD3A 4DVBA 2XKSA 2Q76B 2A77H 2DDQH 3T3PE 1CDHA 3V4UH 4U0QB 4RGND 2AXGB 2WBWB 5GZOC 2FBOJ 4WI8A 4M03A 3NIDF 1B2WH 1JZ4A 1MQKH 4N9OB 3NZHH 3U79A 2UUDH 3G5XB 1R6VA 3ULUD 2BSTA 4CN4A 4R6UA 5D7IE 3F7VA 3RVWD 5ESQB 4K7FB 4YBQD 5D7LE 2WUBH 1U8PA 1NMBH 1FPTH 5A2IH 2BNQE 4YXHH 3OJVC 2VLRA 3MRMB 1C16B 5F8QC 3JV6A 4N9GB 4LLYB 4GFTB 4X9IA 5EPMB 3VXSA 1P7QB 3GBNH 4M02A 4KFZC 4OCYH 3UXFA 1P2CB 3IJYA 4UB0L 1ZA3A 1PQZB 2I60L 4QXTA 1IGFL 7CGTA 1H3PL 3VH8B 3ZMRA 3D25B 4NBZB 3VMPA 3EYUL 1LD9B 1MHCA 2XN9A 3OAZK 2R0WL 2Z92A 1ZT4B 3TZVB 5FK9A 4ETQA 5L8LB 3QPQD 3BUTA 3I6LE 2GHWB 2YEZA 3MRFA 1NGWB 1LHZA 4RIRA 4AEIL 1EUUA 3IDGA 1J0HA 1UM5H 2WAHA 4PB9L 5D8JH 5LG1A 2VLJE 5JNYA 3AY4C 5K33A 4LEOB 1K4CA 5DC4B 3ARGA 5B39B 3MGOB 4LHUD 4UIKL 5E08H 4NN6B 4U1KB 4MJIA 3LKSA 4YEEA 2PXYD 4K94C 1MI5A 2WK2A 5J1SC 2YC1A 1L0QA 4AEHH 4MCZB 4D9RD 2OR9H 1TJGL 3AUVA 2CDEA 1MCJA 3EFDL 5FHBH 4WHYG 3WFCH 1NBZB 2DLTA 4R9HA 3AM8A 4N8CH 3OR6A 4JZOA 3NFSH 5FCUL 3FTGA 4MLSA 4OLZL 5TF0A 1N2RB 1OHQA 1UWGL 2ZJSL 4UDTA 4F8TA 3MXWL 2V7HA 4D0DA 1F4YH 3QEHA 1S9YA 4YNYB 3NCBB 4JKKA 3V4PH 1Q0YH 3EJJX 3GHBL 1KIRB 4DTGL 4PR5B 5AZ2L 1XT5A 3RVTC 1RZFL 4UOW1 4ZAKD 4E5XA 2UVEA 4EVNA 1R5WA 2PKDA 1PAMA 4HUVA 1U93B 4WNQB 1CXIA 4JZJC 2VITA 1I7TA 3BT2H 1AO7B 1IEBB 4V1DB 5C07E 4FTVA 5E9DD 1I1AB 4BH7A 4H1LG 1FZKB 4P2CG 4EN3C 1HHKB 2YD1A 5CWSB 4PJBF 5J9PA 4U3XA 3LS5L 1NGYA 3DX7A 1VFAA 4GG6A 1G0XA 5BV7C 3LEXA 3DX8A 5L2KD 1ORSA 5FDWB 2V17L 4N5UA 4MA8H 2BY2A 2W1NA 3OKMA 2IAMB 1HQ4A 3L5WA 1A6WH 4GSDH 1PYWB 1FV1A 5DC9B 4CVUA 1FFRA 1UXSB 1Y18A 4GRWH 2ICWB 3P9MB 2FR4A 2IQ9H 1GGUA 4MNQD 3O11B 1RQ5A 3EOTL 3O2WL 1MF2H 2EDHA 1VFBA 3GMPA 5BZDA 1HXYB 1KGCE 1INDH 2EZ0C 4AT6B 2C4FT 4ZTPH 1FC2D 3ZDZF 3QUZB 3DO7B 2H2PC 3RTQD 4HS3B 2LTQB 3T2QA 1MFNA 1U8LB 3IXAA 1YEEH 2ATKA 2SEBA 4X80L 1NUGA 1DQQA 3IJHA 3NACL 3QIBA 1N4XH 4PRHA 2EKJA 1Z2KA 3E8UH 3NBNA 1JGDB 1E27A 3G6JA 4Q6IB 4J3UA 4DKEL 5DJYB 1I9IH 4CJ0A 3EYQC 3QCTL 3BRDA 1W8OA 3N50A 5IHLB 4X6EA 2PTTB 4HAGA 1MCWM 5F7LB 5FIEA 4G5ZL 3D2UD 1J8HA 5HJ3B 5FO8B 2V7NA 2YRLA 4JRXA 3U4AA 4Y16A 1PLGH 2OSLB 4CVZA 2KZ1B 3FCTB 4G7YL 1TJHL 5E4IA 1OTTC 4ODVL 1ITCA 3JWNC 3LRHA 4B7LA 5ESVA 4QTIH 1IMHC 5L0QC 4K71B 1CE6A 1T0NA 3FB8B 3BZDA 3QUMA 3KPSD 2NW3B 2RQ8A 1XF3A 2X7LA 4MXVE 4GRLB 2ZKHL 4RISH 3HR6A 4BUGA 5DFWH 1NCDL 1IKFH 5FGCB 1HHIA 2MHAB 4U4BA 3OG6B 4POYA 3I3BA 2ZUSA 4IOFD 5C92A 5AZEL 3FFCA 5JOFA 3QUKA 1GPOH 1KB5A 2YZ1A 3SGJC 4AIZA 3CU7A 4J3TA 4HCRL 4WU5B 1U3HD 1J05A 4GMTL 4QF1A 3FN3A 1A1OB 1INEL 1IEAB 3UYRH 5D96B 3BVNA 1CN4A 2WBJB 1LO4L 5GISH 3CSGA 4PJCA 5T5FL 3IU4L 4LIQE 2V2WA 3OKDB 1XMWA 1AHWC 2XZAH 1AE6L 4YPGA 3T2NH 3VI4F 1I1AC 3FHQA 4JGUA 1F90L 4ORGB 7FABL 3S36X 1ETZA 3V0WL 1RU9L 2R4RH 1A3RH 5ITFA 4FZ8L 1NSNH 4PGBA 4F15C 2C3VA 2EDTA 5DDHA 1AGEB 1MCEA 1KN2H 5GIRB 1YPZB 4XVUC 3LKOB 2YXMA 5D2LB 3CFKA 4PJGE 3ARDD 2KL6A 3MV8D 5DJ8A 3GRWA 4UV4H 2F54A 5KG9B 5T3ZH 1HXMA 2IAMC 12E8L 3QDJB 4NCC2 1BQHG 5EO9B 4JO2L 5EWIH 3BAEL 3T1WA 1S9KC 1WCBA 1CICA 4JY5L 2B4CC 4GW4A 3QRGH 3H9SA 2FB4H 2FO4A 4P23B 4MNGE 3F5WA 1Q1JL 4WO4B 3FB6A 5FECB 5T33H 3BEWB 3H3PH 4Q74A 3U30C 4FXGA 5IVOA 4BZYA 3WO3B 5HVGB 4AEEA 3OHXB 2GSGB 2LTQC 2J8UE 1W0VB 1JPSL 1Y0LA 5EU5A 2EEDA 1QSFE 5TE7H 1RJLA 4WU7A 4G8GE 3TYFA 1A2YA 3P4MA 2PF6A 5IMOA 2A73A 1YMMD 4FQIL 3CSPA 3LKQB 1QSEA 3K8MA 5BCAA 4ELKA 1ZGLM 4CMMA 3LB6C 4UBDD 3QULA 4DFHA 2OK0H 2HAZA 3IJSB 5IB1B 1H15A 1JNLH 1V8HA 3QAZB 4FNLL 1AGBA 1I8IB 3QNYB 2IH1A 1M7DB 1IAOA 5KVDL 5SV3A 1U8JB 4XZUB 2P5EA 1UA6H 4H5SA 1XF2B 3I6KB 4DGIL 4NJ9L 5ADPL 4F58H 3PHOB 4XI5C 5HYJE 4JG0L 1KCRH 1WFNA 3E0GA 4Z0BL 3OB0K 3S34L 3L6FB 4X6BB 2XZZA 3WUZA 2DLHA 2YXFA 4ZQKA 5FYJH 1L9NA 3OGCA 4P4KB 3B9AA 3N1GC 2CD0A 2ZCLL 1CFNB 2VDML 1QYGH 2E7LC 4IRJB 1AGFA 1ZGLB 3N1MC 1M71B 3HG1E 3IFOB 4JN2B 4WWKB 5CIPB 2DQJH 4L4VB 3ZHLA 2Y23A 1C08B 3BUYB 1Z5LA 2DQEH 4OZHE 2HKHL 3INUL 1MFDL 3RGVD 5D96C 4OI9A 2WBJC 4WUUE 4S11A 2OL3A 3REWB 1FQ9C 2YRPA 5DD5H 5EU6D 1HDMB 2EO1A 2X4TB 2QTEA 3LEYH 3MCLH 2VZSA 3MR9B 4QEGA 4M5ZL 5ICYA 4HWEH 1B4JH 4HAFA 3TT1H 2NY4B 3OKYA 3ARVA 3D9AH 2P1YA 3SKJH 3ES6A 1UKSA 5HGDB 5EO0A 4W70A 3REVB 2MQCA 3R1GL 3QFJE 5CJ8A 4G6FB 3IDYC 2VDPH 3EO9L 3AB0B 3T77B 3WHXB 4KROD 5ID0B 1H8OA 2ZOKB 5GGUA 1NDGA 3FB7A 5I1CH 4MWFB 4LDEB 4M6OL 3R8QA 2J6EL 4YDLB 4XNMB 3O8XD 4Z6AT 4P23C 4N0UB 5F6HJ 5FV1L 4JY6B 2DQCL 3UMTA 4RGOH 3U0WL 4AYFA 1BVKA 5IVXF 5IKCA 3QUMH 4K8RH 3OGOE 3H0TB 2UZIL 3UTQA 3WLWC 1CXKA 4GAGL 2EKSA 1IC5H 2QBWA 5ALBL 1T66C 1YEJH 2FX8L 3ULVF 3ULVE 3GSNL 4RX4A 1JMZA 4YFLF 5C3TA 1OLLA 5J6HA 1KB5H 4XNYH 3CNKA 1N3NA 2BNUB 4RFEB 4YQXH 4ZO9A 3EJYC 4NQDD 5IW6B 5IM7A 2ZUVA 4YXKH 4NUJA 4HF5H 1WBYB 1EVTC 2YA1A 4JN1H 4OUUB 3QAZC 4HGWB 1GC1L 4KRPC 4TULL 5A43C 1I9JH 1EA9C 1UZ8A 5BRZE 3QIWC 3U1SH 1MFBL 5I1GL 3X3FL 1CIUA 1KPUA 1A7QH 1FSKC 5T3XL 3LKPB 1JHKL 3BH8B 2C3WA 3I9GH 4ODUA 4PRIE 2AAVA 4QWWD 1D6EA 3DTXA 3L5JA 5B8CB 1ONQA 3QWOB 5ISZA 1JPGB 2EDXA 4XNUH 1FBIL 1X5XA 1F3DH 5FYKU 3U9PL 1K3ZA 3GRWH 2ATPB 3C5JB 4EN3A 5EOQH 1VGEL 1AQDA 5ILTH 2ESVB 3JWDL 5DS8A 3UEZA 1KPRA 4FG6C 4JFZL 1DBBL 2LU4A 4XXCC 1YY9C 3C8DA 4OFIA 1JPTL 4JPWL 3K4DA 2NY1D 4WHTB 3V5KB 5FA3B 3QQNA 1FCCA 1IAIL 2Q76A 4UOW0 1WEJL 3N85H 2VXVL 2QQQA 4Y5XB 1JHTA 2NY7H 3V52H 4N0FA 4G6MH 2CJUL 2CKBL 1FNHA 4JHZA 1XGRB 5K9JH 3D18B 1MFCL 1A6ZB 2NX5E 1JK8B 3L3KB 5DLMH 3AAZA 5TPWL 3K74B 4DZBB 1HZHH 1HEZB 1RZIB 5HYSG 4ONGH 2BY3A 3WXVH 1GIGH 3MRMA 1C16A 4FZEH 4HUUA 4BKLB 4N9GA 1J18A 5IUSA 3DMMB 3HPLB 3Q1SL 3J8F7 5EPMA 3QHZL 1P7QA 3LQZB 5E2TH 4HIHB 2NZ9C 2R0ZH 2D9CA 4LPUA 1QRNA 1K4DA 3DI2B 3X3GL 1OF2A 3UYPA 1UWEL 5CSBA 1SVCP 3O2DL 3UTTD 3QXWA 1L0YA 5INDB 4ACPA 3G5YB 2N4IA 2NY5L 3S35L 4KUCF 4LCUB 3UPRB 4F9PC 4XAWH 1LO2H 1CWVA 3JUZA 2MFNA 1MSPA 1NAKL 3MCKB 1XR8A 1T04B 4RQQA 4Y2DA 4GH7B 4G9FE 3V6OE 1QP1A 2V5MA 2Q86A 3UTPE 3QHFL 3BQUC 4M7ZB 1XGQA 5IWLC 5DD1L 1KTLB 5EIVA 1IC4H 1K5NA 5IBLC 4F33A 2PTUA 5DRXB 3X14A 1MJUL 1SJHB 4P5MB 4GUPB 5MI0B 4LKXA 3NCYS 5C0JA 3BXNA 3GSRB 1CI5A 5DMJB 4U3CA 5C7XH 1IFHH 1SEQH 3P9LA 1NCCL 2YD6A 1OL0A 3EKCA 3TV3L 3KYKL 3OTTA 4OV5A 1BFSA 5J3HD 2D9QB 1DLHB 2R8SH 1R5IA 4PJ5B 4HH9B 2Q8BL 5CHNB 4QXUL 2P8LA 3C6LC 2CGRL 4OD1H 1N2RA 2HTLD 4NO0A 3WFDL 2ID5A 5GGVH 2I9TA 4HUXA 2QQLH 4XBEH 2OL3H 3FJTA 5D7JD 2VXSL 5JR1L 3MRGB 2Y25A 3SGJA 4TNWK 4P9HC 5D5MF 2VB5A 4A6YA 2AI0H 3UDWC 2KZWA 3FL7A 5JOPE 1SY6L 2UYLB 4KJYA 3C2AH 5DJ0A 4MXWL 1ZHBA 1TCMA 5F3HA 3NABL 3UX9B 3STLA 3GI9L 2QHRL 1AHWA 2K1MA 2PYEB 1M05B 2JK5B 3VU2A 3EAKA 5DO2D 4N0YL 2IANB 2VISB 4NQEB 1Q94B 1HHKA 5C0BD 1AIFB 2XKNA 1N64H 3TPUA 2E7CA 4MAUH 5I8OL 4G9DA 1X5JA 1B0GB 4DKFH 1T20B 4LARH 3QPXL 2OJEB 5CGYC 1PKOA 1W8NA 5C0FB 2L7UA 4F57H 2ENYA 3VXRD 2QQNH 3VCLB 5DQDH 1WFOA 1I7ZB 4MQTB 4N8VA 3WUWA 3OKKB 4Y5XC 5CJQH 1J11A 3NPSB 4KVNH 1EGJH 4JM2B 2DYPD 3BN3B 3GSNB 4M8QB 3OB0H 5IB3B 1PYWA 4ISVA 3Q3GA 4WI5A 3O3AB 3G6DH 4LLUB 5FAAA 4K94H 3ARBB 4HPOH 3CMOL 3ALXA 4GW5B 4O4YL 4LOUC 4OZIE 4QXWA 1IAIM 2MNUA 2NXZD 4OT1L 4XCNB 3I6GB 5C0NC 2EO9A 2Q6WB 5EUOE 1NC4A 1LQSR 3MREB 4MNHB 3OJMB 4LVHB 5IMMA 1TNNA 3WNNA 4NZJA 5DMGC 4M7JL 2ZUUA 2FL5B 4YGVA 1KJVA 3B83A 3O4OB 4MX7A 3O2VH 2XFXB 2ZSWB 4YDJA 2YPLA 3V8OA 1ZANH 2DTSA 3KPTA 1UH2A 4HFUH 3GKWL 1Z3GH 4ZUTB 3CDCA 2P5WA 4WJ5A 3LHPL 4PRPA 4Y4HC 5F9DC 1JGEA 1BVLB 2ZUQB 3JVGC 3VGBA 1KLGB 4Y19D 4GLRI 1LMKA 3BSZH 4M7ZC 2XTJE 4HBQA 3W0WD 4AZ8A 3B8YA 3QG6B 1AY1L 4GRWE 4DN4H 1NFKA 3L3IB 1II4E 5MI0C 4OCSH 1S7VB 1PD6A 5ADOL 1NJ9A 5C0IA 5I1HH 1F3JA 3EO1B 1CLYL 4K3EH 5F88B 1T3FA 2CKBB 5GGSY 5BV7H 1W72A 4JAMB 3I85A 6FABH 1D5IL 3DROB 3DSFH 4Z7WF 2KUTA 1IM3B 1KG0A 3MLWH 3PDOB 3QDMA 4TUKL 3QDGE 2GITB 5HDLA 2E7LA 2NR6C 5BS0A 4XC3H 4UDUB 1OQXA 3KYOA 1A02N 2F53E 4X4MA 4WHDA 3FQTA 1CTOA 4HULB 3BW9A 2UV3A 3LRSB 4S1RH 2I5YL 4L3ED 3UTZB 1IEAA 4ERSL 1A4JA 3MRBA 1D9KC 2Y72A 3L3OB 3OF6D 1S7RA 3QB7C 5GRVL 4QRSA 4XH2B 5D2NC 5MEND 2W0FB 2XT1B 4HK3J 3WIHA 4U6XB 5D7KD 2HRPH 2BRRL 1AFVL 1I7UA 1BLNB 3E6HB 5CEZH 5CJ5A 2DQDH 4CADA 4HIEB 4LSQL 3VRLE 2VXQH 2D7QA 1A64A 2A6IA 5DJDB 4EBQH 4BZ2L 1N7MH 4ZSOB 3RDTC 3MFGB 2MPAH 4P2RA 2YRZA 1NLDH 2W60B 3LAFA 4PY7A 3CIQA 2DLIA 3EOAA 5HHOB 2R69L 1ODAA 5LXGH 3OZ9L 2DLGA 1J1XL 1M7IB 3C5ZB 5DJCB 4LEXL 5HD8D 2QEJA 1G7IA 2VLRE 3UAJD 2BDNL 2FGZA 3FMGL 1U2CA 3VXSE 3BJ91 4I0PC 5TDOB 2ZOLB 5SWSB 2GKIA 5AUMB 1TZHB 2ZP0T 5CBAB 1EVUA 1UCBL 3BN9D 1DN0A 2XZQH 3BZ4B 4DOHE 4XP9H 4DZ8A 4N1EA 1X5LA 4MA1B 3ZKND 1LEGB 1CVRA 3KLSA 4PGDA 5FYKD 1T7ZA 2G60L 3HMWL 1JUFA 5TH2A 1GAFH 4TUJA 4KU1A 4CW1B 1NLBH 4PBXA 4YHPA 5T1LA 4L29A 4M48H 4DN3H 2VLKD 2XIDA 2LE9A 2E8YA 4A6YH 3VGHA 4IRSB 2APFA 1YQVH 5M94B 1WTGT 3VWKD 5T3ZE 1XCQA 5DI8B 2IALA 3TBVB 3LZFL 4TPRL 3LN4B 1KBGL 2N1KA 3B3IB 2R1YB 3QIWA 2MSPA 4XZUA 5IF0B 2FWOA 3IDXL 4MJIE 1U8MA 2X4NA 1C7TA 4WFHD 1HI6B 1MI5E 1I3RA 5IB2B 1CDCA 4QT5B 4QO1A 1NH6A 1T1XB 4NN7C 1YUHB 3KHOA 4HGKC 4PJFF 4D94A 3GMLB 3I02A 4HIXL 3FO1A 1HHHB 3TIDB 1AD0B 1ZGLP 1HHGB 3MRLA 5SX5K 4IRZH 3KPQB 1T1ZA 3BD5A 4Z7UA 3NIFF 3GO1L 4D3CH 4XXCA 4Z8FL 1OT2A 5E99H 2YWZA 3EIFA 4OIAA 4P57B 1RAMA 2AJSL 3BH9B 1FRGL 5I0DA 1DBKH 1TZIA 2A0LD 4KXZH 2B4CH 4MAYB 4QOKD 3CC5A 2P45B 1R0AL 4Z77B 2FD6H 4OCNC 4U1MA 5FM8A 1PDKA 3OR7B 3MJ7A 1LO0L 3DARA 4X9FA 3STZB 5JW5B 2IFGA 1SBBA 3QCVH 2P8MA 3AMKA 4C55A 4Z7OF 1R3JB 4FFWD 1NGQL 1TPXC 3L7FA 2X41A 4M7LT 4C56A 3PL6D 2Y06H 4A2MA 5F9AC 3FO2B 4FTVE 3RWCB 3CZJA 4XX1E 4FXKB 5H2BA 5CBEA 3REWA 1DQMH 5ETUA 1ND0B 1HDMA 3FONB 3VRJB 5DZOA 1XH3A 4Y7MA 5LCVH 2QV2A 3PWJA 3NIGF 2FX9L 4GG6E 2VKWA 3GMMB 3NH7H 4G6AD 5EO1B 5FM5O 1UEMA 4JDVA 2FJFB 2YBRB 3RIFF 4KTYA 5FYJE 4KZEH 5KW9L 3EFFA 3VGDA 4H1LB 1U95B 1UB6B 4M6NH 4I13B 4JANA 4YPJA 2YMXH 1LNUB 1A6UH 5DK3A 5C08A 4Z95H 3TA3D 3WHXA 3DETC 4HKBA 4XMPH 4EIGB 2AV7A 2OP4H 5CUSL 3BQUA 5K9KA 3L5XL 4KK8D 4XBGA 5DYOB 5IWLA 3HZMB 4QRQB 2OYPA 5E4EB 4N0UA 1ED3A 2CRYA 5HI4C 4P4RB 1D5XB 5JORA 1T7WA 2YK1L 4PRHE 2PW1A 4F2MA 4MA1C 4X0KA 1QA9B 2GUOB 3U7AA 5FUCE 43C9B 1CFVH 4G43B 4YX2L 5DT1L 3MSPA 3G6JE 2UWEA 3DUUA 1JTTA 1YEGL 4Q0XH 5F1NA 5GRUH 1G7HA 5EA0L 1RJYB 4YHNA 1NANH 3MJGX 5ESAB 4FXLA 4O51A 3C6LA 5SWQB 4PJ8D 1CXFA 2DMCA 4PUBH 3I2CL 1DE4A 1MCQA 1WZ1L 3LQAL 4M7LH 2J5LC 4HJGB 1A21A 3FQRB 4JRXE 4LASH 2X1PA 5I1AB 3SDAB 4PJHA 4KMTH 3WIHH 3UDWA 1MNUL 4L3AA 4WUKL 5D1QC 3MRQB 3LKPA 4ZFZB 5EIIB 5IOPB 1N5AA 4OTXH 4X4ZA 4OF7A 4H88H 4HXBH 3QWOA 1JWMA 2FGWH 3BKYL 1GOFA 1JZ6A 4WI4A 3T0EB 3S7GA 3TT3H 4KGJA 4R4FL 5B38B 3MA9L 5KOMC 3V5DB 2OQJA 1MWAB 4XVJL 3VFGL 1MFEH 2R29L 3TYGL 4EIZC 3BX7C 4PLKC 4AMKH 2BOCB 4HIIB 2DF3A 3W9DB 3MZTA 3PUCA 3M45A 1IEHA 4URTB 1PJ9A 2P44B 3U36A 1GZPB 4YDKL 3RVUD 3V5HB 4NHUB 1HILB 3MRIB 5F97E 4TOYH 4R97B 1QR4A 4PJCE 5GRXG 2W65A 4YBLC 5T1KA 3F65A 4ZUUB 1OGAA 3VGEA 2EDOA 5GRJL 1LEIA 2CRMA 3MLRH 4ZUSA 4DZBA 2R15A 4LP4A 3C6SA 4KJQC 3ZE0E 3B43A 3QJFB 2J4WH 3WE6B 1BM3H 3LS4H 2J1KA 5KZCD 1V05A 5IFHL 1RZFH 4JB9H 1BQLL 5L9DL 4PJDB 4ZPVB 3D3VD 3KS0H 2P46B 1QFWI 4KI5D 1XGTA 4M9OA 3RUGB 4GMSH 3SGEI 3PWLB 4G80A 3ROLB 3G5YA 3KPOB 4Y1AA 4LCUA 3CDYA 2RCSL 5IFAH 3QJHA 4WW1B 4O9HL 3TNMB 3WO4B 1P9MC 4HQQL 2AK1L 2VQUA 3ZT7A 4MD0A 4JPIB 5K93A 5EOTB 4Y4HA 3H9SE 2VLMD 2VR5A 5DXWA 1BP3B 3JVGA 4J3XA 2V17H 3EBAA 4Z7NF 4TVPL 5DGQA 4GBXA 5J57B 2RB8A 1MLCA 5EZIH 3EJZC 5DRZA 1F11A 3GB7B 1BQHB 1JNNH 5H35A 3F7RA 5MP6L 4RBPK 5F7EH 1QLRB 3EOTH 3SDDB 1G7MB 1NCBL 1TITA 1YY8A 2WUCH 2CK2A 3GIVB 1PZ5A 3JWOC 1QSEE 4QHLB 1A3LL 5KSVA 1RURH 2QQKH 4PJ5A 5CHNA 2D7NA 1SEBA 3SCMD 2EE6A 3L7EB 1LE9A 3L9RB 1MCKA 1FO0A 4POZD 2D7TH 2XNAB 2ZSVA 4ELMB 2P5EE 1K2DB 3MRKB 1MJJB 1YJDC 1WFTA 1HSBB 4LLQB 2EIBA 4XC1H 2NY0B 4KC3B 2FEEI 1E4KC 3DBXB 4HFWB 3S35X 3MOAH 2H3NB 3N9GL 4JFDA 1D9KA 2DQGL 4YHOH 1RULL 5D2NA 2KPNA 1KB9J 1KXVC 2R4SL 4FQPA 3BKCL 5GZNC 3CVIH 2MCPL 2DMKA 2VISA 5CS7A 4L5FL 2DQHL 1J87A 2AEPH 4MCYB 1D5MB 3ESUF 3RDTA 5JDSB 1RZKC 4UU9A 1OCWL 2DMBA 3Q6FB 1B0GA 4AEFA 4G8IA 3MRHB 4UT9H 5F7HA 3P0YH 5KVEL 2MQ3A 4D0BB 1SYVA 2C9AA 3KYNA 4XP1H 1IGCL 3PQYA 4XPGL 3T1FB 1R3HA 1SBSL 4G42B 3T0AA 5KSUA 3VFUA 4L4TA 5JHDD 4OZ4B 1AXTL 2PW2B 4OIIH 4ZPTB 5SX5H 1CD9B 4TTDC 3OAYK 1K6QL 4OSUL 4M93B 4KKCD 1FLRL 1A14H 2H9GA 3FOLB 4I0PA 3DXAA 5A2JH 3KLHC 2GYSA 4MA7H 3V4VL 2VABB 4X6DB 1JZ7A 4CGTA 4OLYL 1INQA 3BHBB 5DF0A 5T5FH 2EXWD 2AEQL 2BK8A 4HV8A 1J5OH 3KXFE 1V7NH 2XA8H 1WK0A 1KCUH 2WLYA 5EU3B 1V7MH 2AJYH 3TBYA 2IADB 4LSPL 5CSZB 5TE6H 3CLEH 1F90H 1NEZA 4WW2B 1NL0L 3RWEA 1K8IA 5HHQA 3BFOA 3QFDB 3O0RL 5DHYB 4HBCL 1KEMH 4P9HH 3GJFK 4ZUTA 1BPVA 1HH6B 4UTAH 5C0AA 4NWUH 4ZFOL 1KJMA 2M1KA 3DJ9A 1BVLA 2P48B 1D5BA 1IGIL 1ZHNB 2YD4A 4I4WA 1KTKE 3VFSB 1L7TH 3PWPD 4I9WE 1GXEA 5L2KB 1I8KA 1XF4B 4P5TC 3TVMD 4LCWB 3QXTA 2WIIB 4JO2H 5KTEH 4KK6D 2N7BA 4NO2B 4R96B 3BAEH 3O6LL 2ADGA 3PG2A 3L3DA 3VG9B 1S7VA 1YEIH 4RGNC 4ZS6D 4UTBL 5IHZB 2OX5A 3SDDC 3DX6A 1KFAH 1FNLA 2A83A 5DQJB 5CEXA 5JDJA 1MREH 3JV0A 5C0CA 3ULUC 1MAKA 3RVWC 3V95A 2PO6D 4YBQC 1CFTA 3CPLA 4MNQB 4E41D 5A2KH 3TWCH 4UI2A 4FQHA 1MJ8L 4PJEF 3MBXL 4X6CB 4U1NA 5FYLH 5GS1B 3I3EA 5I1LB 5KSBA 5E2WH 4BZ1H 4PP2A 4YDIH 3FFDA 3TNNB 2O5YL 2VLJD 4X7SH 4C4KT 3GKZA 1H8NA 2PYFA 4YLQT 1XGUB 2FJHA 4QCIA 4FQIH 5IK3B 1OAYH 2AQ1A 1EJOL 1D6VL 1OPGH 4R3SA 1QFWL 4APQD 5KN5A 1DLFL 1BOYA 3L3OA 3TESA 1I1FB 1V3MA 5MEOA 2NTFB 3QPQC 2E6JA 5CD3B 5FF6A 3DUSA 4FQLL 2ED9A 4NT6A 3NGBC 5D70L 5ADPH 3RI5K 5D7IB 3PE9A 3DVIA 4QRRA 5DUBB 1IZJA 4WEUD 3AU1B 2XG5A 2BNQB 2VQ1A 4NFCA 5JXAH 4NRYA 1JI1A 3IETA 3GJFA 1AI1H 5I74B 4U2ZA 4G7VL 1A7NL 1YEKH 3MV7D 3S96B 2PXYC 1ZXQA 4F7PB 1DBMH 4NBYB 3HNTL 4GW1B 4M9PA 4Q9RL 3U46B 4M1CD 1TJIH 4EDWH 1JGVL 4UQ2A 3G5VA 1EMTL 4D9QE 1PKQA 2DN7A 5DJCA 4MA3A 4JKMA 3WYRA 2ZUXA 3NAAL 5DQ9A 2NYYD 2DD8H 3KJ4C 2I25N 4IMLA 4O2CB 2R0KH 3MLVH 2WWKO 2A74A 4LPCA 2H1PL 1QRNE 2JB5L 5AUMA 1QR1A 1GGBH 5JIKA 4NKOA 3BZEA 2JB6B 3I50L 2X89A 1CD1B 3LQAC 4W4OC 4ZD3H 2OR7A 3QH3B 4C58B 2VDKL 1N6QL 3MNVA 1JNHA 5HYSB 3T3MF 3F6IA 4ZYKB 5C0DA 3FO9B 4I77H 1FO0H 5CEZE 1EEYA 1FIGL 4ZAKC 2FEEL 1JYNA 4KAQH 1QNZL 4LLMB 2HKFH 3KPPB 5C8JA 4KQ4H 3RL2A 3H3BC 2Q7YB 1VEPA 4ALAL 3WSQH 3PF2A 4JO4L 3RKDC 1JZ5A 5DRNB 5TFSH 3CK0H 3E3QC 2DKUA 2X2YA 4JFFA 3WFEH 1KLFA 3LN4A 4NRXA 4OM0H 3S8WA 3QQ3A 4R8WH 1Z0MA 5F7DA 5D1QA 3HRZA 3LN5A 3MV8B 2R0LL 3MUJA 2BC4B 4PJIA 4MYWB 3VG9C 4XX1G 5C0EB 3BI9X 3DNKA 3I3DA 2XWTB 4U0RB 4LRNH 1AD9A 3C9NA 3PHQA 2NQCA 4ZFGH 1LK3H 4FQQB 2DS4A 1BD2D 1HHHA 4IEFB 1IC7H 4R90L 4YZFF 3QUYB 5HHNB 1F02I 3W82A 3BMWA 1SJEB 5GS1C 1G7PA 4L8CA 3MGAA 3O4LA 5DVOA 5C07B 1FVDB 1U42A 4NQCD 5AD0A 1T21B 1TFHA 1VSCA 3IRPX 5GGSA 2Z0BA 3RTQC 4MMZC 1WBZB 1RK0A 5JW4N 2GSIB 1KTDB 2Z93B 5C9JB 1JV5A 1RUMH 2A6DB 1L4IA 3WKMH 4JO3H 3PV7A 2Z91B 1RHHB 3H2WA 4OLEA 43CAA 3JTSA 5HDQH 3H9ZA 4P3CH 5BXFA 4RFOH 4TULH 1ZVHA 4WFEE 1S8DB 2DL9A 4V1DE 3H7BB 2VDLH 3R0NA 1A7RH 1F4XH 3ZLQC 5LBSL 4ZFOB 3D39A 4AQOA 3DVNA 1FORL 5EUKA 5FUOL 3U0TB 3MO1A 5J8OA 1C1EH 3ALPA 1QFWM 5SWZA 3ZDYE 2B1HL 3BPCB 4P2OB 1JGUL 1FYHB 2V9RA 4LSUL 4B0MM 2FJFA 4CBPA 2YBRA 1HQRA 5FB8A 5I74C 3GSVB 4PJ7B 1UCTA 3EYOB 5L7XL 5E1AB 2CIKA 1P9MA 5LWYL 1DVFD 3WCYA 3ISWA 3KR3H 5HI3D 5HHPA 1ZTXH 2JIXD 1G0DA 1IBGH 3W9EB 1JPTH 4S1SH 3T4YB 35C8H 5HGAB 3DHJA 1LEKB 1JZ2A 3KPRD 1AKJB 3A0OA 3HZMA 3BKML 1QOKA 5DMIL 2CKBH 4IOFC 4UIMB 1ZT7B 2X4SB 1HINH 5GJTH 3R06A 4J1UA 3VWJB 1D5XA 4IBLT 1TLKA 2Q3AA 2RJMA 1XIWA 1QA9A 4POUB 1U3HC 2D31A 1H0DA 3OPZL 1UKQA 1ZHKB 3M8OH 5E7FA 5I18L 2X4QA 2VDNH 2YA0A 1RJYA 4B50A 3OAYH 3X3GH 3VFMB 4YXLH 2BOBA 3G6AA 5EOCH 3TFKD 1EFXD 5KJRL 3HR5A 1RMFL 1UWEH 3U4BH 4LCCB 4XPTL 4HPYL 5CMAA 1YN7B 4NNXB 4N90E 3SBWC 3TP4A 1G9MC 4NZTH 5HGBA 1C5BH 1E4KA 4WFFD 4Z18A 1A7OL 4K3JL 1QBML 3ARDC 3BP4A 2FH8A 5IOPA 1JF6A 2Z35A 5CJOL 2XQBH 2EYTA 2DKMA 4XCCH 1EH9A 3VFOA 1R3IL 3PWUB 3SE8H 1OAXL 3GJFH 1IQWL 4U0RC 3VFTB 1BZ7B 4NNPH 5FGCE 1QG3A 2PCPB 4Z78A 4YR6B 2IGFL 3O8XB 5E8EB 3C2SA 5B38A 3P11L 3QDME 4NZUH 4OCWL 3TN0B 1G6RL 5DK0B 1MWAA 1KC5L 4Z76A 4Y2DD 3SDXA 3HUJB 3QUYC 5L88L 5BS0E 3GSQB 4M62L 4HIIA 3MBED 5I16A 3QXAB 2GJZA 5MHSD 1H8SA 3WNPA 2XXMB 4PY8J 3QDAA 4U6HB 3N0PB 3X12B 5I15L 1YNKL 2R56L 5HYJD 1KT2B 4YFDB 4ZG1A 1P4LB 5EBWB 1QEWA 3SQBA 3V6ZB 3JTTA 4AY0A 4NQSB 4KRNA 4NQDB 4UBDC 3HNSL 4DJMA 1UQSA 2HMID 2X42A 1YPZF 1IQDA 4L3CB 4TRPL 5D2LF 4NO5B 1RUKL 4BQ6A 4KUZL 1E4JA 3R4DA 5E6ID 4X4XB 3SO3B 4N0YH 1S9VB 4LCIH 2BHUA 3I75A 5D1XA 1E0OB 3QQ9