1YPZF

Immune receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
230
Chain Sequence
HGKLEQPEISISRPRDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHIFLDKEYKKMEASKNPSASTSILTIYSLEEEDEAIYYCSYGEGSSGFHKVFAEGTKLIVIPSDKRLDADISPKPTIFLPSVAETNLHKTGTYLCLLEAFFPDVIRVYWKEKDGNTILDSQEGDTLKTNDTYMKFSWLTVPERAMGKEHRCIVKHENNKGGADQAIFFPSIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 230
sequence length 230
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzF01
1KB9J 3NGBB 3GBNL 4HKBA 2JB6B 3GRWL 1RZGB 1DQQB 1QBLL 2YOCA 4Z76A 3U4EB 1JRHI 1YYMH 4ZFGH 3EJJX 1HSAA 1WWBX 1ZEAL 4KZDH 4HULB 3O2VL 1CFQB 4PJBA 4PV9A 1F42A 4HKXA 4EOWL 1PX4A 1E27A 4MCYA 4HWUA 5F9JB 2R2BA 2IG2L 4JPWL 4LSDA 1RZ8B 1Q38A 2KZWA 2FWOA 2J5LB 4ONGL 3UDWC 4JM2C 4W70A 4G9FE 3ZHKA 4EN3B 5DDHB 1RZJH 5EBLB 5DRNA 5D1XC 3SY0A 5I75B 3TJHD 3DGCR 4XPFH 3U0WH 1OLZA 1IT9L 1CR9L 2A83B 2QTEA 1ES0B 3KPNA 2DIBA 4HX1A 1KPVA 1GAFL 2P5WB 5E5UB 5HI3D 5IROC 4LKCB 3CXDL 4WWKA 3MOAH 1OP5H 4QRRD 1OF2A 1YQVL 1I1RA 4FA8A 3IT8D 3D2UA 5EULV 4HIXH 4KKLC 4Y16A 3RA7L 4TUKH 3PWPA 4JFOA 3T3PE 5KVMC 2ZCLH 3AUVA 3S34H 1GGIH 2D03H 1DQJB 3BVNB 3V7MA 5SWQB 4QRPB 1CG9B 2ZOLB 1XGTB 4YH6A 5JW3H 1ZLUK 3QDHA 2E6PA 2HFEB 2R0LL 3PWUB 3S36H 4PJFB 5E2WH 2XPGA 5I2IA 2Y1VA 1RVFH 4I48B 1EZVX 4JGUA 1BQSA 1CICC 1VPOH 1AGCB 3EDJA 1CE6B 1KV3A 4UT9L 4FQQA 1NLDH 2FGWH 4ZPTA 4GXVH 1QNZH 4IRZH 4MAYC 4BUGA 1C5BL 1NCDH 2AK4D 3DVNB 1VGKA 2YBRB 2YUVA 1CWVA 4NKIL 5J1AB 3REVA 2PO6C 3GMMB 5I1DA 4ZDHA 1HINH 2FHCA 4Z7OF 3BWAB 4XNUL 5CINH 5C9KA 1INQB 3ZKMD 1ZLWH 1E0OB 3FQWA 2NZIA 3SDAC 4ODBD 3OKOA 4DTGL 4PJXA 1HQRA 5I17B 4HWZA 4YXKH 2WUBL 2H26B 4GLRH 4RIRB 2GSIA 4NC2B 3DX8A 1L0QA 4XP9H 3RQ3A 3MRHA 3QDJA 3QFJB 5D1ZD 2EYTB 3QRFM 1M71B 4PJEB 2ZUQB 1CTNA 1AKJD 3Q48A 3B83A 3L5JA 4DOHB 5D9SA 1FZJB 1ZV5A 1KGCD 1K2DA 3SE8L 2NXZC 3KPRE 3NFPB 2AXGB 3MCG1 3U9UA 4PRPB 4U1SA 3BE1L 3S37X 1DR9A 3TNMB 3U4BL 2ZUVA 2J4WL 1PG7W 2DOCA 5MP6H 4NFDA 3UZVB 3MX0A 3D85A 1QFUH 1FL5B 1XAUA 2ENSA 5IBUG 3W82A 1RFDH 3WDIA 3WNPA 3L95A 4KTYA 2I5YL 4Q6IA 4KMQA 3CK0L 1A21A 5MEOB 3FFCB 4M7LL 4IM8A 4H25B 5DD5H 4LCCB 1ORQB 2MSPA 2IADA 4QHKI 4R26H 2W9EL 2M8XA 5CMAB 1CXLA 2AEPH 5ITBH 4IS6B 3BZEA 2P8PA 2WQRA 2P24B 3LRHA 2Q86A 4O9HL 1AI1L 3H9SD 1DBJL 3OKLB 3G6DL 1D7FA 4OF7A 2WBJD 3I3EA 5HD8C 1CLZH 5IIEA 4P23A 5DK0A 1JHKH 1IILE 4EBQL 3EYSL 1RU9H 1B4RA 4K3GA 4I9WD 3G6JF 3WHE1 5I9QC 2FD6H 2MQ3A 5JXAL 1AQDB 5I15H 5MEQB 3LEVH 4HCRL 4ODWB 5ISZB 3CH8A 2SEBB 3FRPA 3UX9B 3J7HA 1YNKH 4QY8B 1UFUA 3QXTA 1NFDF 4WW2C 5GIRA 4N0FA 3B5HA 5SX4I 1DFBH 3T04D 1ONQB 3OL2A 1AGFA 1JUFA 4OLUL 1C7SA 1GYAA 4JB9H 1PJ9A 5J12C 1J8KA 3QP3A 2BXZA 4GW5A 1ZLSL 1DVFB 1F3DH 2C3GA 1WWAX 1IFHL 5CJQL 5DI8A 3ZTJG 2PXYC 1MCRA 3T0VA 1G7IB 1VFAA 1ZHKB 5HGDB 5JA8B 1FV1B 2DIAA 2PUQT 3TCLA 4XH2B 4Y1AE 5D7LB 4GG6A 2YSSA 4DGVL 4KXZI 3CMOL 2IFGA 5DMGC 5CJBA 1M05B 3RL2A 1HYSC 5C2BL 1FE8H 2OL3H 4KK9D 1VESA 2UVFA 4FMKA 1T04B 3U6RA 1D5ZA 3GHBH 4FQ2L 3ZHLA 2HA1A 2KQNA 3MFFA 5HGBA 4JG0L 5ESQB 2EYRB 3RWCB 3E6HB 3V4UL 2IH3B 1UZ6E 2DQFA 3HE6B 1INDH 3HI5H 5GS0H 4HWBL 3VMNA 4JPVH 3F58H 2VXUL 3WLBA 3C5JB 1I85C 4HC1L 4MD0A 3A6BL 4NOFA 5FM5O 2VAJA 1HIMH 1KB5A 3IFLH 1JPFA 5DRWA 5KSAB 1WZKA 4F7TB 3FZUC 1KJ2L 3KPSB 5F93C 43CAA 1EAPB 1OARL 3G9AB 1KLUA 1HHIB 4O2EA 2BSTA 2NTFA 3RL1A 1E6OL 4JFEE 4LCWE 3VRJB 4PBWD 5FO7B 5GRXG 2DBLH 1PZUB 4FTVE 1FGVH 5TQ0H 4X4ME 2X1WL 3MBXH 1A7OL 2CMRL 2E8ZA 5DRXB 3GSXA 1EJ6A 4PV8B 5IUSA 4QRRA 5L7XL 5EU3B 2OP4L 3MYJA 5E2TL 4LF3B 2VYRE 1MPAL 2GCYB 1ZHLB 3O2WH 4F9LA 2F58L 3MA7B 1ND0B 4GQ9L 4J1UB 4HIHA 4JG1H 4PJCB 3KDMA 1QA9B 2HH0L 1I7UA 1BOGA 5FAAA 3JWDC 1F2QA 3MLYL 3O6KL 5TFSH 2FDBP 1MCBA 3WIHL 3QCVL 3UTZA 3FOLB 1YDPA 4TNVF 1L6XA 1RUPL 5IFHH 1QRNB 5HHMD 4KRPD 4YXLL 3MRIA 5AG9A 5HYQA 3FB7A 2FX8L 3PXHA 4P2OC 1VADB 4PGEB 1A7NL 1FG2A 3BQUB 3K4DA 1S7UB 4CDGC 3V95A 1Z2KA 5ADOH 1HQ4A 3V2AR 1JK8B 4R97B 5L2KD 3MO1A 1MOEA 4F3FB 1MJJA 2FO1A 3ULUC 3V6OC 4ETYA 5DSCA 1CK0H 1U8OA 2IFFH 4YGVB 5EN2A 2AK4A 3ETBF 8CGTA 4WJ5A 2YMXH 1Q9WA 2ED8A 3WJLA 4FQXB 4ELME 1C12B 2OYPA 2OJZL 3BN3B 2E27L 5JZ7C 4HJJL 4HS6A 3RVTC 1JZ8A 4YHIB 3S88H 3GSWB 2PYFB 5ACMA 5IB1B 2PKDA 4Z7WA 1ADQA 4X6CE 4XP1L 5HDLA 4FXGA 2ESVD 1QR1B 4KH2A 3ZT6A 1D5IH 4P5KA 2RB8A 4H8WL 4U2YA 5AZ2L 3D18B 3R1GL 1TTUA 2GK0A 4NKDB 1A22B 5GS1B 5I1IL 3C2AH 4KRMB 3OAYK 1CE1H 5D1ZA 5DJZA 1BQUA 2VXVL 4AL8H 3TBVB 1AKJA 2HVJA 1F02I 5JXEC 5C6WH 3QQ9C 3RNQA 5J6GB 4E0RA 1YEFH 2OTWB 1ZLUH 4V1DD 3RWDB 3CFBB 1SBSL 4FFYH 3BMWA 4YUEL 4Y16C 3WL9B 1QFPA 4PUBL 3GSRB 4K7FB 1XF2B 1W0VB 2C1PA 2FX7H 1KJ3L 3RTQC 4LFHG 1G7LB 3O6FC 1EO5A 4YR6B 2Q6WA 3KPQA 5IB4A 3AXLB 3VFNB 3P3YA 1XF3A 1ZTXL 4UQ3B 1SJVA 2NY6C 4K8RL 4Y4HB 3OAUL 1T3FB 3CSGA 1OGTB 1R5WB 2HFFB 3KG5A 4LLWB 3RVVD 4HK3J 3H9SA 3TYGH 5E1AA 2WBJA 4N1EA 1KENH 5J13B 2HTLD 4OLZH 4OGYH 5C0FA 2MHAA 5I18L 3VFPA 1HNFA 3TO4B 3K4AA 3S4SA 1N0XH 3KLAB 2JIXB 4HXBH 1RZ7L 4PFEA 4UILL 1U91B 2IAMB 1H9VA 5KN5B 1Q0YL 4L1DA 1FNEB 2O5ZH 4UDUB 2Z91B 3OKYA 4L3EB 2ZJSH 5FK9A 5ID1B 3L9RA 4LHUD 1LP9A 2VERN 1FVEB 4EEEA 4U1HB 4JHWL 3OB0K 5C08D 1AD9A 3TBSA 1AXSB 2X4SA 5C8JA 4HWEL 5DYOA 2VQTA 2IBGA 3ALXA 3GMNA 4FQ1L 4KQ3H 4XCFH 5EO9B 4U0RC 3EYUH 1JYVA 3QJHB 4Q9RL 1YPZF 1QYGL 2I27N 1A7PL 1ZANL 2P47B 3ZYOA 4KAQL 3CFEB 1DLFH 1C7TA 1VHPA 4W6YB 3PHQB 4YE4L 1G9MC 1DBBH 3SOBL 4KHTL 4TRPL 3E3QE 3DROA 2ZCHH 4HXAL 3PE9A 4LKXA 2XACC 4WI4A 4P3DB 4U6XB 4JFYB 2DMKA 4F37K 1LO3L 2C1OA 5ESAA 1X6NA 4YFEA 4M62H 3PNWB 4XVUC 1UJTA 3OB8A 1S9VA 3VFUA 2VLME 2XQBH 1S78D 5DFVD 4PGDB 1ZAGA 4KHXH 5IFJB 3RRQA 3WSQL 1RY7B 3FONB 1N5YH 1KJMA 2DF3A 3IXAB 4N5ED 3N1GC 3HMWH 3F6LA 4IDLA 4ZFFA 4WW1B 2XRAH 4OQ1A 4YPGB 1RJCA 4OCMC 2F5AL 4FFWD 4P23C 3WIIL 1JYWA 4S1QH 1A0QH 1NCAH 2ZSWA 3GMLA 3FMGL 2HRLA 3MV7E 1T0PB 4HJ0D 3QZWA 1XR8B 4LPYA 4POUB 3ZYJA 1J1XH 2C3VA 4FQHB 3SDXF 1BBJB 3LOWA 4HPOH 1OD9A 3DTXA 3TYFA 3VGAC 1MQKH 3DGGA 3DYPA 4JFFD 4K3HA 2A9NL 4IRSB 4X5WA 5IW1A 3BDXA 3QWRD 5GGRA 5BS0D 1X4YA 2Q3ZA 1A47A 3ARBB 5A2IH 2QSCH 1HWGB 4BH7A 2HN7B 1CFVL 3MR9B 4XPAH 2H6PA 3AFLA 3OBAA 5A40E 5HHPA 1FZMB 4L9LA 3HHRB 2R9HD 1K3ZA 2EDRA 1HDMB 5AUMB 1TTGA 1N59B 2F8OA 3P9MA 4CAGA 3W39B 3AS2A 3JXAA 3V6BR 2FZ3A 4CW1B 5DJ2B 4NRZA 3VGDA 1CXKA 5JQ6L 5CLWA 5HDBF 4MX7A 3FRPG 4YAQB 5L2KA 1KTLB 3U30B 1FO0L 1SEBA 3WDHA 3P77B 4LLMA 2X9XA 3LCYA 2D31B 1ZA6A 4MJ5A 4UV7H 3PP4L 3MRBA 4NC1E 5C0EB 1LE9A 2J88H 1UYWH 3K2UH 3TIEA 1IAMA 2AXHA 3FO2B 1J87A 2E7HA 1G7QA 4PYHA 4R4BB 1BBDL 3K80A 1HI6A 4DN4H 2OTUB 4PJ9B 4KJWD 4LOUC 4ENEC 2H8PA 1B0GA 1RMFL 4NQDD 3WLWD 2R56H 1GGUA 1KIPB 2Z93A 3QH3A 5ILTH 1G7HA 3VGEA 2ESVA 1EAJA 1SJEA 3ABZA 2DLFL 5DD1L 1KBGH 5EUKB 1TVDA 1MREH 3RWJB 3MXVH 3V5HA 2KH2B 4NKMA 3TJHC 3RPIB 5C0AD 4N8VB 2NNAA 1U58B 3D87B 2B7DT 2JJSC 4DVBB 4JDVB 3QDGB 3F7VB 5ACZA 4LARH 1UZ6F 4V1DA 2F5BL 3MOQA 2G60L 4CN6A 5CBAA 1IGFH 4KI1A 5E2UL 5TDPB 1XGRB 4EVNA 4X6FA 4F9LC 4X6DB 4ZOCA 3MRMA 5I1EH 1CFNA 4JDZA 1BJ1J 4RGNE 4Y88A 1Z5LB 2WBWB 3PL6D 1ZS8B 2RBLA 4AMKL 4U31A 2EIZA 1BF2A 4JFPB 4PBVC 4ETQB 3HC3H 4GRWE 3S96A 1D3CA 2BVEA 1C08A 3VGBA 3G5YA 5EIVA 1JGEA 2I60H 3V4PH 3BP4B 3GMPB 4K55A 3HNSL 4B50A 5E6ZA 5BVPH 2I9LB 2XYCA 5IEKA 1VDGA 1WZ1H 2VITB 1I7RA 3DIFB 3O2DA 5AD0B 4ODHL 5T1KD 2BNUB 3O4LB 1H3XA 2JELH 4NO3B 1NDMA 1U8NB 2H1PL 3EO9L 4XNXH 1F11A 1QTYT 4EUPB 1BD2B 1PW3A 1QVOB 2FEEL 3WJLC 2E7LC 4NO0B 1HYRC 5FGCE 5TE4H 2FHBA 3OAYH 1B0RA 3B2VH 5I8EA 4Z7VA 1PKQE 2XN9D 1MFAH 4XVTH 4HJGA 2OR8A 5E5RB 4LHUA 3ZKMC 3UJIL 3QUYC 2B4CH 4OLWH 1VGEL 4YZFF 3NZ8B 5IMOA 4PJXE 3ARXA 43C9A 5C08A 2PTTB 4Z7QE 4MXWL 5DMKA 1DTUA 5C1MB 4KMTL 4PRHE 1NGQL 3VXSB 3L7EB 5E8NB 5E8PA 2UZIH 5I8CA 3BX7C 1IEBA 3UCRA 3QEQE 3FO9A 3OR6B 1BIIA 4U6TA 3QDJE 1HKLL 1GOGA 2NX5D 1GXEA 5GGUA 1WTGT 3GO1L 4ZUWB 1SJHA 3SO5A 2OM5A 35C8H 4DKFH 2BVTA 4FQJL 1WIOA 5C3TA 3ROOA 2EH8L 4EDXA 3BO8A 5FYKD 1UCTA 5T3XL 4JANA 2AABL 2EYSA 4QHNA 4X7SH 1H3PL 1L9NA 2DLIA 4XMLH 15C8L 2X70A 1NKRA 1NAKH 1LWRA 2XWJA 2UWEF 2X6MA 5B39A 4M48L 4Z77A 3WS3B 5FIEA 1JPGA 2DL9A 3EOTL 3QPQD 5JDSB 5I71C 4ZUSB 3MLXH 5EU4B 4ODXB 5EFIB 3H0TA 2DDQL 3QCTH 4Q2ZA 1FNGB 5DC0A 4I4WB 3X11A 5GS2D 1QUNA 5T1DL 1AGBA 3I50L 1YY9C 5FUOL 3UJTL 1T20A 3HZYB 3PQYE 4XC1H 3MRQA 1JRHH 1P6AB 2ICES 4HUUB 3MNZA 4X4YA 4PYGA 3KHQA 1NC2D 5F9OL 2HLAB 3K8LA 3QIBB 1CD1A 2WBJC 1URLA 3OGCB 1VFUA 3IRPX 5IT2H 1H8SA 5D1QD 2DD8L 1CGUA 4TVPH 3V6ZA 1MAJA 3OB0H 2NW2A 5FYLE 4CU7A 1GOFA 3DSNA 1BFSA 2DQDL 1WICA 5EZIH 1MF2H 3IJHB 1T7WA 3W0WD 3MCKA 2CXKA 4JFFA 4YFLF 2VL5B 1EBAA 2HKFL 4A2LA 1KN4L 2B0SL 3IU4L 3QWRA 5BS0A 1KACB 2A6IA 4Y4FB 4WV1B 5C3LD 1BLNB 4RFNB 2Y07H 1PSKL 3T3ME 2N56A 1OTUC 3PGDB 3DJ9A 3NACL 3TBTB 2EDTA 1J88A 3WKNA 2BNQB 4PJ8D 3CVHA 3S37H 3HNTH 4ZYKB 5KW9H 4KUZL 2JCCB 3UYRH 3OPZH 3FT2A 2V5SA 2VDQL 1BPVA 4I3SH 1YC8A 3QI9C 4GG6E 1T21A 4YDIH 4XCCL 1A8JH 1NGPH 4L9DA 1CT8A 2A0LC 3S4SG 2VN7A 3THMH 5HY9B 1CGSL 1A7RH 2NY4B 4APQD 4YEEA 3AC0A 2A74A 3DI3B 4PJ7B 3E2HC 3QQ3B 4KK9C 1Y6KR 2ZG2A 1AGEA 4WHYH 2P8LB 2HJFA 3OHXA 5JW5B 3IDXH 5F21B 2X4OB 3T0BA 4PPTA 3LDBC 5BRZD 3O3UN 5DD6A 5KS9B 5FHAH 5EUOF 1KEGH 3M1BB 5CJXC 1ZA3B 2HT2D 4NQDA 4Z0XB 1LNUA 4ELKB 3D39E 3MYZA 1PZ5A 1T2XA 3UTTD 3LSOB 3FHAA 3BEVA 1P4IH 5DRZA 4KTEL 1IC5H 1A6AA 4MAUH 4Z5RA 3FOMA 4QTIH 4G5ZH 1R3HB 5C0AA 3CLEL 1T22A 1X5XA 3KJ6L 1G9NC 3I02B 5J11B 4WCYL 4QRQA 5H94A 1DBML 3EJZC 1A6TA 2CK0H 1AHWA 1S7QB 3DI2B 3HLAB 2GSGA 2XTJD 3TT3L 3VWKD 5IQ7L 3UO1L 4GKNB 5D93C 1AQKH 1IAII 3HS0B 4P2QB 4PTUB 1RURL 1UQSB 1DUYB 4ONHA 4YHZH 5HYJD 1UGNA 4U6HB 2HTKC 4I3RL 1HXYA 2F54B 1HH6B 4LPUA 4FXLA 5GISH 1X5FA 5EUOA 1L6ZA 4X5XB 3VA2C 3L3IA 3PL6A 4HGWB 2LU3A 3PV6B 5DEFB 4F15B 2NY5H 1AGDA 4E41E 2DQHL 1AJ7H 4HKZB 2BCKA 4L9LC 4OSUH 3MRFB 4X8JA 5ICXB 1OGAB 1A64A 4LCIH 2RR3A 1Q1JL 4XNYL 4LLVB 4KRPC 4OAWA 3QZWG 4X6BA 5F7EL 2A6DB 3DECA 3BRFA 5E94A 5HHXL 3DNKA 3QNZB 4WU5B 1OAYL 1UKSA 4K94H 3S7GA 5GZOD 3KWWA 3DXAD 3QJFA 3SCMD 1P6FA 4WFHE 5CZVH 4EQ2A 4Y19D 1G84A 2H32A 4MDIB 5T1KA 1GL4B 1EGJH 2VDLH 4EI5B 5CSZA 5DTFA 1LDPL 3HZMA 2ADIB 5DUBB 3H7LA 3AY4C 2WINB 3EYFB 5IW6B 2IALB 3NIDE 5LBSL 4ODVL 5D2LE 5DJDB 3C2SA 1T83A 2X4RA 5EPMB 4OIIH 3RU8L 5I19H 2ICEB 4KZEL 3PWNA 4XNZC 4JPIB 2XN9A 2WM0A 4PB9L 4Z7WE 5CCKH 2YPVL 1BIHA 1TJGH 3BP5B 4M00A 4X6EB 5E0QA 5I6XC 3MROB 5IK3A 1GPOL 2DI7A 3QHZL 3MV9D 2XKNA 4MNGA 1FZKB 2EKSB 1BJ8A 2P1YA 4R90L 1BFOB 3NIFE 2VXSL 5FGBA 4QLRA 2R8SL 1IJ9A 4P59L 1XR9B 3QEHA 3T8XB 4WO4B 2AKRB 2NX5A 3RWIA 5KG9A 1OAZH 3BD4A 1NKOA 1ZT4B 4JREC 3BXNA 4JVWA 4YX2L 2R2EA 5BJTA 2X4NA 5SX4H 1CF8L 1KGCE 1DQML 3OKDB 5C0IB 5EZJA 2BDNL 3QNYB 1WCBB 5D8JL 2FLBT 3F65A 5E2JA 2V5MA 5M94B 3GSVB 3QO1A 1C1EH 3P4LA 2VDMH 2OCFD 4ZS7L 1RZKC 2BC4A 3G5ZB 4HHAA 3G5VB 4Z7UB 4BZ2H 2YD2A 5DQDH 1A1MB 2Q7YA 1IQWH 1QSFD 3P11L 4WUUE 5L2JA 3WXVL 3NCEB 4KXZH 5D7KD 1ZXQA 2BY3A 1YY8A 1IM9D 3Q6GH 4TULH 4W4OC 2V17H 2AQ2A 3E8UH 4RDQF 1IQDB 1KT2B 4GW1A 1G7JA 4IJ3B 4DZBA 3VXNB 4ORZC 1NC2A 4M9OA 3TIDB 1SY6H 3CFDB 4U05A 3RVVC 2BVOB 4G43A 4JFXA 4LSSL 3SDCB 1MY7A 3ZKXC 1S9YB 1MNUH 5ESVA 2IEPA 5EO1A 4HK0A 3MJ9H 5D1QA 3WIFA 2OK0L 5I1LA 2RFXA 4J3UA 3JWDL 4D0BB 4KPHH 4QHMB 1A4KA 4LHJB 3LKNA 3PDOB 5ALCL 3VXRB 3G08A 4LDEB 4MA3A 3W0WA 3JUZA 5HGHB 4DEPC 4OT1H 4UU9A 5DS8B 3ZTNH 4LRNH 3B5GA 2O61B 4JRYD 1JGUH 3MCLH 3GMOB 3W11D 2QSQA 2VR5A 3IF1A 1UZ8B 1MFBH 4G3YH 1SYSB 5IB3B 1JWSB 4XGZB 4K71B 1A7QL 4PJ8A 5E70A 5FFLA 4YDJA 5FUCE 1BWWA 1U8KB 1CL7I 2NY0D 3ULUL 3ULVH 3NAAL 3TPUB 1P7KA 3FTGA 3CLFL 1WT5C 3RWFA 3U2SB 3SDYH 4YBQD 3SDDD 3M8OL 2VLKD 3SE3A 1J18A 4LVHC 5F1NB 2FO4A 5DR5L 4EDWL 2KQMA 4ZUVB 3RWHB 1LK3H 3P9WB 4MZ2A 3VGFA 4QHUB 3AM8C 1GZQB 3IVKB 1T5XB 4APQA 2YD6A 1MLBB 4YO0A 1TPXC 3Q2CA 5FYJL 5CWSB 3CFKA 3B6SA 5EZLB 4K9EH 4ORGA 2BOBA 4X80H 3O8XD 3N85H 1HSBA 2V9TA 4MD5B 4LHUG 1DSFL 4K3JL 1AIFA 2AAVA 5D72H 3S3PA 5IVXB 3SGEI 4P9ML 3GSNA 1KELH 5BRZA 5ALBL 2BOCA 4URTB 3LKRB 5HI4C 2AJ3B 2VMFA 5GSVA 4JCMA 4NCC1 2QADD 1MVFA 1ZGLB 1RZIA 4LSRH 1MHCA 2GYSA 2VC2H 1I3GH 1MSPA 5D2NC 4GFTB 5F71A 3UTTA 4HMEA 3CZFA 1SJXA 4OLVL 3HR6A 4A6YB 2NLJB 2LTQC 4PS4L 5SWSB 4ZFOL 4MQ7A 5D71H 4GO6B 4NT6B 2UV3A 1D5BA 2EDWA 2P4AB 3VWJB 4OZIA 2YPKA 3VD3A 1PQZA 1R3JB 4OFVA 3LIZH 3EGSA 1CGTA 3G04B 2ITCB 4HJ0C 2VH5H 3GMRB 1J8HD 3HC0B 3S8WA 3U83A 3ZE1F 5F7WC 3VWKA 1JNHB 3EOAA 1CN4A 5T3ZH 4JY6B 1U3JA 1NBZA 2DQTL 5HYJA 2R4RL 3I2CL 1G7MA 5T1LD 1KN2L 4JY4A 1FFPA 2ZSVB 1R6VA 3JWOL 1NC4B 4L29A 1ETZA 4MJIE 4L8DB 4CADB 5FO9B 2FEEI 2XWTA 2EE3A 3P0VH 4NFCA 4G8GE 3QG7L 5HHME 2JE8A 5FXCH 5BO1H 5JW4N 3KNBA 3WN5A 1UWEH 2DAVA 1WAAE 1BVKB 3TBYA 4GMSL 4P4KD 3C8KA 1O7SA 5MI0B 4XI5C 3BH9A 5TGBA 3T0EB 3GKWH 4NHCL 3VRIA 3DXAA 3SCMA 3LN5A 1U93A 2O93L 4L8BB 4Y19A 1EEQA 4D3CH 5GGSB 2R2CA 2DN7A 4CVZA 1Q72H 3D0LB 4FFZL 5EO0A 5B4MC 1XH3B 1CLYH 1BF8A 4G9FB 4OJFL 1DEDA 5IWLA 5EC1B 1F4XH 1KXQE 1JNLL 1E28A 1SYVA 1I9RH 4YDVB 4WI2A 2BNRD 1FL3B 1OAQH 5IHLB 1VFMA 3ORJA 5DJAA 1ROWA 5DLML 2CLZA 4KJWC 1S5HB 3ARSA 3WLWC 2ESVE 3RNKA 1G9ML 3K2MC 1K4DB 1WEJL 3GB7A 4AENA 4NN5B 3MV9A 4YWGH 5LWYH 5CEYB 4KK5C 1DBAL 2DQGL 3GI9L 2B1HL 3OZ9H 3UPCA 4U49A 3S9DB 2JF1A 5KSBB 3U0PA 1T0MA 2GJZA 1QBLH 2BVPB 3QXUA 3CPLB 3TN0D 4OV5B 2QKIB 1YJDH 4X9BA 3ZDZE 2CRZA 1DJSA 1MCLA 1ZEAH 3GGWB 3O2VH 4Y5VB 3O3AA 4J6RL 3SQOH 1VKXB 4JZOB 2V2TB 1AHWC 2EIBA 4EUPH 4NGHH 4EOWH 1FVCB 3FQNB 3QDAA 4P57B 4XRCB 3FB8A 3VI3F 3M17B 4XBPA 4PJIA 4ONGH 2BP3A 4AJ0A 4HUWB 1F8TH 1K4CA 4FNLH 4U6VL 3WMSA 4Q9CA 1IM3A 3FL7A 3RX5A 1QSFA 4S11A 3V6FB 1DANU 3FB5A 5C9JB 1A3LL 2AGJL 2Z35A 1R24A 4PGCB 4QT5A 3KPPA 3BUTA 1IM9A 5SV3A 3WHE0 1RK1A 1IT9H 4S1RH 5ETUB 2ADJB 3G5XB 2YEZA 3BH8A 4LLUA 5CIPA 4RISL 1GAFH 2EDKA 1ZGLP 4H5SB 4R96A 5C6TH 1QSVA 5KVEL 3SQBA 4AH2A 4F7MA 1EEYB 2UZYB 5ANMA 5F7DA 3RA7H 1D5MB 4OCWL 4J2XA 4ISVB 1S3KL 4QGTA 5D7IB 3A6CL 2IWGA 3IDMA 3DX6B 3VXUD 2FB4L 1T83C 5KVGH 4HEPG 4Z7VE 1JMZA 2AEIT 4HUNB 2ITDA 5HVWA 4JRYA 3DYOA 3U0TB 1X4XA 2R0LH 4LVNC 4C4KO 5ABDE 5C08E 2NZ9D 3PWJB 3HZVB 3EFDL 3QFDA 2YD5A 4RMRA 4BH8B 4NWTH 5K9KB 5DJXB 5FGBC 5DHVA 1TCMA 3L3DA 4J3SA 1F97A 3SDDA 2E7CA 2VLKA 3MRKA 5IB2B 3WXWL 4E9LA 3L7FA 1AE6L 2IPUG 5I66B 1EFXD 1C5BH 3IXTB 5GJSL 3FRUA 4NKIH 4MJ2A 5D96B 2DM4A 4EXKA 4NQTA 4KQ4H 5D7JC 1S7SB 1KYOK 1H5BB 3MV8D 2JK5B 3CJJA 3O8XA 4XNUH 4EIGB 3DV6A 3Q6FA 2V2WB 2BHUA 1KB5L 2G2RA 1V05A 1IEHA 4DTGH 3EO1A 1R5VB 4JFDB 1WFOA 1HHKB 5EOQL 3NIFF 1F00I 4M61B 3FAXA 3BKYL 2FSEB 3RIFF 3CSBA 4GBXB 3ZDYE 4OZHE 4CJ1A 1T2QH 4FQLH 2DJ4A 4M93B 5F7NC 1UM5L 4FQCL 4Q0XH 2OR9L 3MODL 1ZVSB 3BGMB 3LRGA 2IGFL 1HHJA 1Y0LA 1C5CL 5EIIB 3RKPA 4N0UB 3GM0A 3IDYB 3EZ8A 1NCTA 4D0CA 1II4E 1B2WL 3IKCB 4BSWA 1INEH 5D1QC 4XP4L 4AK1A 2GTZA 1C8PA 2CD0A 2OZ4A 3IAPA 1XZ0A 3ULSB 4OCYL 1J8HA 3P4OA 3TGXA 2YUXA 3NH7L 1BQHA 1BECA 5EA0H 4JFFE 3GJFH 1DN0B 3CK0H 1G6RA 5BS0E 2W9EH 3LKSB 5T1LA 4Y1AB 3JSSA 5CD3B 1GGCL 1PYWB 1FZOA 1V7ML 2WBKA 2CDFB 5JPNB 3CXHK 1XEDA 1FG9C 4F33A 1AI1H 5ENWB 1DBJH 1P2CB 1TZIA 3G6DH 2HLFD 4KJQC 4KGLA 4PJ8C 4UDTB 5LQBL 3EYSH 3O45A 1K5NB 4P4KA 3VXMD 1LO2L 3WE6B 5FA4B 1QQDB 3DHMA 2Z92B 1J11A 1T7XA 5JXAH 2YZ8A 3O4OC 4M8QA 1KIRB 1T1XA 3HUJA 3T65B 4JM2B 1T2JA 2AJXL 3MQIA 1ADQL 1NGYA 3VFWB 2H3NA 4G42B 4WDIB 4UNVA 2CDGA 5IOPB 1CLOL 1WLHA 4YHKH 2GT9B 1NCNA 2OQJA 2BNRA 5TDOA 4RGMC 5JW4M 5EU6E 1ZLSH 4Y4KB 4JFEB 4LCWB 4NQDE 5CJQH 5FDWB 1YEJH 2HT2C 5HHVL 1WWCA 4FTVB 5IG7B 2Q8AL 2WW8A 2CIKA 3VE0A 5I8OL 2G5BA 3CDFA 4PJAA 1G0XA 3NFNB 4NYLA 5A16A 5JORB 4K23H 1MIEL 2QQKL 3UPRB 3CMOH 1DBKL 2AJYH 3I6KB 4QHLB 1MQ8A 2D0GA 4PRID 5C09B 1XGQA 5C2BH 4HQQH 5H37G 1J12A 3TN0A 3HPLB 4R6UA 4Q9QL 4MS8C 4XNQB 4UIKH 4ZG1A 3GUTB 1P84K 4OF0A 4JG0H 5I76B 4TTGA 3HKFA 3V4UH 2F53D 2H2PC 2XTJC 3ES6A 1SM3L 4LPCA 3NA9H 4HWBH 1AFVL 4G9DB 2WZPD 4MCZA 5JDJA 2PW2A 1XGPB 5DGRA 3A6BH 1EEZB 2ZUSA 4FQIL 3T0AA 3INUL 3TVMD 5DWUL 1CFBA 2ZUUA 1CD9B 2W0FB 5FO8A 1IKNA 1OARH 5IF0A 1NDGA 4MAYB 4QRPE 2CJUH 4RWHA 5DJ0A 3WN5C 5CFHA 1E6OH 1JWUA 2NY2D 3BPCB 5GRJH 1UXWA 4AYFA 4PJGF 4MHHG 2PO6B 4PY7A 4NCC2 4N0RA 2CKBB 1FYTD 5DK2B 4ELMB 2P5ED 1AD0B 3IFNL 1X3DA 4QRTB 2CLVA 3DV4A 5L7XH 2CDEB 3L6FB 2OP4H 3SDAB 3HRZA 5JIHA 5E2TH 1SHMA 4BSVB 4X6CB 1MPAH 3GRWA 1W0WA 5IBUB 1FFOB 1L7IH 1IGCH 5HJ3A 1JV5A 1ZHBA 1DQLL 2DWDA 4WHYG 7FABL 2HH0H 5ELIA 3RUGA 3AROA 4K7PY 3VXUA 3O6KH 4PLOB 3FB6B 4LNRA 3L1OH 1MLCA 2WWMC 1RV6X 1QFHA 3IDGB 1RUPH 1LEGA 5ID0A 1K8DB 2DLGA 4YXLH 3MSPA 3BZ4A 3VXTA 4XAWL 1XMWA 2NXZB 4KTDL 2FX8H 1IC1A 4YJZL 3GBMH 4NBZB 1UVQB 4MD4A 2AP2A 2IPTL 4XPBL 4O58H 3WEXA 4NNYA 3VD4A 1A7NH 4BQCA 1IGML 5C7XH 1MUJA 1TCRB 2NX5E 4RZCB 5DQJA 4NFBA 1OAKH 5ERWB 1KJVB 1TQCC 1D6VL 3HB3D 4P3CL 3V5KB 3QFJE 4F7EA 3EYVA 1EFXA 1PX3A 4BZ1L 3RHWK 5FOBA 1JI1A 1TVHA 4PD4J 5MEPB 3TZVC 1NAML 2EC9U 2VLLA 1S9XB 2DKMA 2E27H 2EXWD 4HJJH 3CDCA 3MV8A 1FFQA 2X42A 5F1SA 4A2MA 4P9HH 4UTBH 1J05B 4B5EA 1IARB 1IEAA 3AU1A 3WFHB 1EHXA 2XICA 2V7NB 4PJ5D 4BQ9A 2A6KB 3WKML 2VDOL 1G9NL 2IBZY 1MIMH 2W9LA 5D5MA 2YPLD 3H42L 5CZXD 1T1YA 5DJYA 5F72S 4BA8A 3VD5A 3BEWB 2NY1B 4P99A 2VXVH 1J86A 1NUNB 3ZDZF 1FORL 2BHYA 3ARFC 3QO0B 3LS4L 3HAEH 1P4LA 4N8CH 3GIVA 1KCRH 3U7WL 3RDTD 1U2CA 1R3IL 5J12B 4XNMB 1V8HA 2FL5A 4ZAKD 5FECB 1T4KA 3OTTA 3LEYH 2LVEA 4PUBH 4WFFE 3OJDB 3CC5B 1FYHB 2E9IA 1S5IH 2ARJA 2AW2A 4J8RB 4L3CB 4ZFZB 4HV8B 4PG2C 5ISZE 4AEHL 2GITB 5AZEH 3I84A 2XFXA 4K8RH 5CKAA 3UTOA 5FHBH 4OI7A 4NO5A 3WO4C 3GEWB 2DI8A 3EYQD 1PG7X 4M7ZC 1BM3L 3FQRA 3MUZ1 4MYWB 1A1NA 1U36A 4A6YH 1OSPH 2HVKB 2NY0C 1RJLB 4XWOD 3ZKQD 1IAOB 5F3HB 5C71A 5B38A 3VXMA 1IAIH 4GRLD 3CU1A 3NN8A 4YBQC 3X13B 4Q6YA 5I18H 3BT2H 5HVHB 1MHEB 3L3KB 2MPAL 5BZWA 4HBCL 1QSEB 4PJHB 4WFED 1Q0YH 1T1ZB 5DHYB 4LSPH 5EORH 4JAMB 5C0BB 5J3HD 1T0NB 4O2FB 3OF6D 3KXFD 2QEJA 1JGDA 4TVPE 4UQ2A 3O8XC 3QXAA 2IPKA 1C5DB 1IKFL 4F80A 4JHWH 5L8KB 2HT4D 1EXUB 3ALPA 5EBMA 2DQUH 2F74B 5ICYA 4FQ1H 4P0DA 1FNSL 2QADC 3MV7B 1FNAA 4NJAL 1WV7T 1A7PH 5C0JA 5L88L 2QQLL 4RNRA 1JFQL 4KAQH 4R7DB 1MHHB 3SO3B 2ZWLT 2ZKHL 2EH7L 1ZGLM 2IJ0C 3SOBH 3AMLA 3KLSA 1MCPL 4KHTH 4OZIE 1CFTA 1RZKL 5E6ID 1AH1A 4JHZA 4NQCD 4HPYH 4PRIA 4HXAH 4NSKB 3S5LA 3HPJA 4LCYA 4M1GH 5JOPD 1YEIL 4JO2H 2FYYA 1IAIM 4X7EC 2Q1EA 5I1JL 4JRXD 1JF5A 3DOSA 2F53A 5JQHC 4HCRA 5C0DB 3DO7B 1XT5A 1D6EB 4OZHF 5CKGA 4U1IA 1OM3L 3WSQH 3H9HB 2R1XB 1DEEB 3HG1E 4C56E 2ID5A 2C3HA 3O3DA 4PJCE 1I1AC 1NL0L 2VABA 4HKBB 2L7JA 4IMLA 3TVMA 3U1SL 3KAAA 1NBQA 4Z76B 1FIGL 5MEND 3PHSA 2X4TA 3U36A 1HSAB 2L0DA 2F5AH 2HFGH 3I3DA 4HLZH 3STBA 4XP5L 4PJBB 3FMGH 3FN0H 4JCLA 1PKOA 4PV9B 1FYTA 3BUYA 4HKXB 2P5EA 1E27B 4Z0BH 4MCYB 3GSOA 3V8CA 4E42A 3VFOA 2R2BB 3DXAE 2HWZL 1BQHG 1RAMA 4Y19E 2FWOB 3PGCA 1G1CA 3IJSA 2QHRL 2LABA 1HEZA 4JO3L 1Z0MA 1V7NL 2CXGA 4AT6A 2BFVL 3A6OA 4FG6D 5DD3L 5DT1L 1QSZA 3CX5K 1PVHA 5DRNB 1WBXA 3STZA 2AK1H 3SY0B 3EIFA 1CFVH 3PG2A 3EO0A 5EU7E 1BEYH 4XPGL 3RJDA 2XNAA 1I8MA 1I9EA 4MNHA 3KPNB 2RCSL 5E6YA 3S3JA 3GHEL 1KPVB 3UAJD 3EZJB 1JNNH 1NMBH 2DQEL 3MV9E 4WWKB 3QULA 2YD4A 2B39A 3CCHA 4HC1A 5CJOH 5E2VH 3D2UB 4Y16B 5IKCA 3LN9A 2P8MA 5JQ6H 1KJ2A 2IBZX 3PWPB 4JFOB 4N9GA 4N0YL 1WZLA 1JZ7A 1GH7A 2ENYA 2WUCL 3D6GA 3TN0C 4IOSD 3PP4H 4R2GC 3KLDA 2B20A 1N5AA 2NY6B 3W9DA 1UACH 2R2HA 4K07A 1FVDA 1CL7H 5CEXA 1UH3A 4GRWB 5K33A 3MRRA 5I2IB 5AAWA 1P4BH 4XP6L 3KYOA 4OFDA 5EWIH 3SJVD 4IIQA 1QSFE 1MFDL 2FECI 2R29L 2DLFH 5DD1H 3DUSA 3MUJA 4JQIL 4FQQB 4PJ5A 4RX4D 1DLHB 4ZPTB 3WIHA 1IKNC 1N6QH 4JZJC 1P5VA 4P46D 3TJEL 2YPLA 4YQXH 3P30L 4HAGA 4CNIA 3ZKNC 1B3JA 4XCYA 4OD2A 3REVB 1A5FL 5I1DB 5CHNB 4ZDHB 3SGEH 5JLZB 1F45A 5EZOH 3U9PL 3RDTA 2KUTA 3FQWB 5ANME 3PABA 2VDRL 5E2UH 3OKOB 4ZAKA 5D6CA 2XKUA 3B9AA 1NCWL 4PJXB 3NIGE 1LDSA 1HQRB 3F7YB 4HWZB 1I8LA 2J8UA 4QXGL 2DI9A 1JF6A 2GSIB 1FPTH 2NY7H 3DX8B 4AMKH 3MRHB 3QDJB 2W60B 3MACL 1CGXA 3PWLA 4JRYE 5L8JB 4OLEA 1PAMA 5D9SB 4BK4A 3BKJH 2VSDA 1K2DB 2NZ9C 4LRIA 3DWTA 4U1SB 5B22A 5IMLA 3QCUL 4YC2B 5L6YL 5MERA 4OFKA 1UKTA 4LQFH 4GRLA 3D85B 4ODHH 5AWNL 1T5WA 3DYMA 3L95B 4Q6IB 1HHHA 1GIGH 4U4BA 2M26A 1WFTA 5IBLD 2IADB 3WJJA 3MC0A 3I6LD 3MLZH 2OI9B 2YD8A 4UUJA 3OF6A 3KXFA 3T2NH 5KBNC 3KS0J 4CGTA 1KFAL 3BZEB 4N90E 2P8PB 1Q9LA 1F6AA 3B5TA 1FSKC 1CS6A 2Q86B 2BVQA 3UJIH 2YKLL 4W6XB 3UBXA 2DYPD 1X5ZA 5IIEB 3LKQB 1DQJA 1QG3A 4MXWH 4BFEA 5GS0C 2QSVA 1NGQH 1CG9A 6CGTA 3MPCA 3GIZL 3C6LD 4JKMA 5LGHL 1NBVL 4QXWA 1EH9A 1EO7A 5FF6A 4HIIA 3GO1H 4GAGL 4QYOA 4PJFA 3BKCH 3LMJL 3C9NA 2ADGA 4PJEF 1NGXA 4FQJH 5I16B 3BQUD 3UTSD 2BVYA 4NUGL 5GIRB 3KHOA 2CRIA 5E6IA 4NQCA 4Y5YA 3T2PA 2AABH 4S0SD 5FKPA 4LCUA 2P44B 1AGFB 1DCLA 2FJHB 1JUFB 4H1LH 5DQ9A 15C8H 1JZ2A 2VISB 5KTEL 3KYKH 1J8HE 4R0LC 4GW5B 4M48H 2YBRA 2ADFH 3MXWL 4QXUH 4JRXA 3EOTH 4FQXD 5DI8B 2UY6A 4KI5E 4PRAA 2PCPB 2X4QA 5KSUA 4KV5E 3EDEA 4NZDA 2DDQH 1INQA 2C3WA 1VFAB 5FCSH 5BCAA 2D9CA 3TCLB 4GG6B 4KU1A 1VCAA 2YSSB 3CAFA 5CEZD 3O9WD 1CD0A 1OTTD 1R3KA 4P5TD 1CDYA 3RL2B 1J0KA 4GSDH 1FCCA 2R1WA 5MENA 3U6RB 1D5ZB 2HLFC 4LEXH 4M5YH 3MFFB 1TITA 5HGBB 2CIIA 3UEZA 4UOJA 3LD8C 2DD8H 1ZK9A 3ILQC 1TQBC 3NCBB 3NCMA 4P2RD 2DQFB 1I8IA 2Y5TA 2DQDH 5LGJA 3FJTA 1H8OA 3WLBB 1YMMD 3PP3K 4MD0B 3GKZA 4M6NL 5T3XD 1KPUA 1Q9KA 1KN4H 3D39B 2F19L 2B0SH 3IU4H 1MFEL 1JPFB 1MAML 3QUXB 1IL1A 1JP5A 1LO4L 1PSKH 43CAB 5AG8A 1KLUB 4O2EB 2CGRL 4OD1L 5CSBA 2BSTB 2IQAA 2NTFB 3R8QA 3NACH 3RL1B 5D1XD 4LCCA 4KJYA 3LB6D 3U79A 5T3ZE 4OQTL 4YHOL 4PJAE 5B38G 5T1MA 5IV2B 4QRRB 4WFGD 4XCCH 4GRMA 5FYKL 3RP1A 3OKLA 2C4FT 2CKBH 4NJ9L 3JV4A 4HIHB 4FQPA 4ODTL 3KDMB 1F58L 1I7UB 1BOGB 4JE4B 4QKXB 4XCNA 4TUJB 3BDYH 3H3BC 2EDFA 3UTZB 1BQLH 5E8OA 1YDPB 1H15A 4E41B 1DN2A 3LHPH 3QDGE 5HHNA 3OG6B 4AEEA 2VLRD 3MRIB 1DE4A 3WUWA 5HYQB 3FB7B 4RMWA 1OP9A 3L3OA 1FG2B 1KNOA 3SJVA 4X6DE 1JL8A 2R0KL 2X4UA 4KTEH 1LE5A 3MO1B 1FBIL 3LV3A 4RX4A 1CICD 1MJJB 5A2KH 2A1WH 4P46A 5DSCB 5EN2B 1U8OB 2AK4B 4WJ5B 4ZQKA 3S5LG 2NY2C 1G7IA 1Q9WB 3CLEH 3Q5YA 1FV1A 3OMZA 3C09B 3HNVL 3QUML 5EBGA 1VACA 5D2LB 2EXYC 4XPHL 4HS6B 3CDYA 1KCLA 4F58L 4QF1A 4FXKA 1N0LA 3WNKA 4Z7WB 3GFUA 4LPTA 4FXGB 4PR5A 4P5KB 5D70L 4P4RA 4LU5H 1FO0A 5F9AC 4I3RH 3O4LE 3RUGE 4I2XA 5L8LB 4PJCF 1NUFA 2GK0B 1UM4L 3BW9A 4AEIL 3D9AL 4JHAH 3ZTJH 5D1ZB 5DJZB 4Q9BA 5DJCA 3IETA 2CK2A 2DQHH 1AKJB 2HVJB 1S7XA 4NN6C 3P4NA 3RNQB 2ZOKA 2YRPA 1T03L 2LQRA 4E0RB 1F4WL 2KZ1B 1MFCL 5IFAL 5DVKA 3OX8B 3DX9B 2IH1A 1OAYH 4UI2A 3VXSE 3LPWA 1P7QD 3B9KD 5CLTA 3VMPA 1HCFX 2A77H 5GGVH 1HH9A 3ALWA 4JKLA 2V7HA 5I71B 1UWGL 4ZUUA 5FO7A 2XA8H 4G7VL 4JO1L 3HB3C 4QOKD 3GSNL 2C1PB 3P73A 2GEEA 4WUUB 1LDPH 5IB4B 4ODVH 1XF3B 4UZGA 3PGFH 2VSCA 3BPLC 4XMKL 4LMQI 3MV8E 3RU8H 1SQ2N 4G8FA 2QV2A 4PB9H 2ICCA 3KYAA 2Q3AA 4ZOEA 2DYPA 3H9SB 5E1AB 5KZCB 2WBJB 1QEWA 3TV3L 3QHZH 4IIQC 1VERA 5CP3H 1YC7A 1Y6MR 3FOLA 4F9PA 5HD8D 5C0FB 2MHAB 2VXSH 1Z6JT 3BRGC 3C6LA 3VFPB 3KR3L 1BX2A 4P59H 1BJMA 2PNDA 4G6FD 3S4SB 4UV4L 5CZXC 1W72L 1IGIL 3JV6A 4YX2H 4UT7L 2XZCL 3BQUA 3UTSA 5EDXA 5FK9B 4JKWA 1KPRA 4K7PL 3L9RB 3NGBC 5TDNA 5D8JH 1LP9B 2WIMA 4F3FA 4J3VA 1T66D 3LZFL 4ZAKC 1AD9B 2LAAA 3TBSB 5C0GA 2X4SB 5C8JB 2AJVL 5DYOB 3GMNB 3ROLA 4FQXA 1I8LC 3N0PB 4DZ8A 5A1AA 5FKAA 3WFCH 4RMQA 2YHGA 5IJVA 1NGWB 1ORSA 5F70A 5GPRA 4U1KA 2VNCA 2J6EA 4XCEA 4I3GA 2GJ6D 4XAKE 1KCKA 4NZRL 1AR1C 3O9WA 5EH1A 3HFML 3N9GL 4XVJH 1FAIH 4OGXL 4P5TA 4EN3C 3DROB 4LKXB 5TQ2H 3E2HB 3QA3A 2R69L 4JFZL 4RCAA 4HZAA 3C08H 1GHFL 5EG6C 2C1OB 4KKBD 1HYSD 1YEHH 2XZAL 2BNQE 4XWOC 3VXME 3RY6A 3RIAK 2A38A 4GRLC 2VLJD 1M7IA 1S9VB 3TH3T 3VFUB 4HIEA 4P2RA 3ZHDA 1U6AH 1CDUA 2ED9A 3W9EA 3VXPA 4L8CA 5DUPL 3WJJC 1YMMA 1MRFL 4DGYL 1ED3A 1KJMB 2BSRA 2WMPA 2GKIA 5IJKA 4PJ7E 1JZ4A 3BD5A 3UDWA 2APWA 4ZFFB 3H3PL 4JKPL 3ELAT 4HAFA 1W0VA 1X7QA 3FZUD 1NEZA 1RIUL 4XWGL 5E8DL 3DMMD 5D1XA 5C2UB 2ZSWB 1H8NA 3IAGC 3GMLB 2HKHH 4EQ3A 3ARTA 2WIIA 2W65A 1TXKA 3QZWB 1JGLL 2D7PA 2C3VB 3ESUF 3M8OH 3V4VL 1JE6A 3JTTA 1WITA 3DTXB 4W68A 5DR5H 4EDWH 5D93B 3S98A 1KOAA 5IROA 3DGGB 4JLRA 3MLUH 4X5WB 5IW1B 5F7FA 1S7TA 1GVIA 3HAEG 3I6GA 4OM0L 5E6IC 5FYJH 4BH7B 2Y6SD 2H6PB 4OB5L 5HHPB 3KLAA 3IRZA 3UBXG 4G8GB 5HHMB 4AIZB 4O00A 5ALBH 4RAUA 2VLRA 4PLKD 2V5YA 4N5UA 3P9MB 5TE6H 1OP5K 4AY0A 4RBPH 2XY1A 2FZ3B 5K9OB 4NRZB 4P2OD 3ARYA 5T33L 1J1OH 4M1DL 4OLVH 5L2KB 1RIHH 1SEBB 4I77L 1CICA 1JTOA 4OCSL 4X4XA 3ULVF 3PDDA 4LLMB 5C0RL 4MJ5B 5FA3A 3MRBB 2J8HA 3UC0L 5F7UA 1LE9B 3JTSA 3ULUD 3TIEB 1FYTE 2ZUQC 3X17A 1NCBH 1G6VK 4XNZB 3MLWH 2DJSA 4PG9A 1HI6B 1BREA 5IESH 1NCCL 5E5MA 3AS3A 1JN6B 2H8PB 1B0GB 4KV5F 4XC3L 3QH3B 2Z93B 3RVTD 1G7HB 5I6XB 4PGJA 4X99B 1TJHL 2ESVB 1SJEB 3I2CH 1TJIL 1NFIA 3PNWA 5INDA 4GRWH 1QLFA 1KN2H 4FG6C 3V5HB 1LHZA 1OCWL 4U1NA 4NKMB 3V0VB 1U8MA 4WEUD 4JREB 2NNAB 4PJDA 4OZGA 2R0ZL 3QG7H 4LCCC 1U0QA 2Y9RT 3UAJC 3R06A 5ACZB 3AS0A 4GMSH 1ZLWK 5JXED 3QQ9D 5GS3A 1YYML 5CBAB 4GT7A 1Q94A 1TDQA 2ARJQ 2D0FA 4EVNB 1P7QA 3B9KA 3F12A 4X6FB 4KZDL 3CZJA 1MJ8L 2J3SA 3MRMB 1CFNB 4JDZB 5CSGA 4FFZH 1ZWIA 1XR8A 5HPMA 4QOKA 2VIRB 2V5RA 3DUUA 4OJFH 4K3EL 1MI5D 2EIZB 5F7YC 1JNLH 2GHWB 3NMEA 3OKEA 3RTQD 3O6FD 4NN7B 3MRLB 3BPNB 1I3RB 1N7MH 3S96B 5DLMH 4NRXA 1C08B 4LPXA 1HOCA 3G5YB 1VEMA 3ZKXB 4CVXA 1JGEB 3ARPA 1LO5A 2L7UA 4XPFL 3U0WL 5EOTB 3NCJH 1T7YA 5IEKB 3IDIA 3S3SA 1I7RB 1KF9B 3GI9H 3UYOD 3WS6C 4K2UL 2WQ8A 1I1FB 1NDMB 4OCXH 4P46C 4OIBA 1F11B 1N64L 2RIKA 1ZMYA 1LEIA 3BZDA 4CW1A 4HIXL 4BJLA 5JW4Q 3SKJL 1B0RB 5I8EB 4TUKL 4Z7VB 5F8RC 1G6RL 4HJGB 4LHUB 4LGPB 5GQBA 3MNWA 4WW2A 4OZFA 1JHTA 3BP6A 3WUWG 1GGIL 2OXGA 4KK8D 5IMOB 2D03L 43C9B 5C08B 1QPXA 5DMKB 5CBEA 5AAMA 2IAND 2CR3A 4X6DF 5E8PB 5JW3L 5I8CB 1IEBB 2Y23A 3FO9B 3NPZB 3T2QA 1BIIB 5HYFA 2KDGA 2CRMA 1TETL 5GGUB 3HE6C 3S36L 1A3LH 2AGJH 5E2WL 2OTUA 1SJHB 3ILPA 1EZVY 1HKFA 3ESVF 3KJ4C 1BAFL 1O7VA 4B0MM 2GJ6A 3ROOB 4EDXB 1VPOL 3BO8B 4XPTH 1TPXB 2EYSB 5KSAC 2FGWL 2CUHA 4GUPA 4GXVL 4TSAL 2X70B 4IRZL 2GUOA 1NCDL 2XWJB 4N8VA 1FP5A 4Z77B 1JPGB 2PW1B 3LEXA 5KVEH 3OKNA 3CSPA 2VLJA 1U42A 5E08H 1HINL 1N2RB 3H0TB 4U7MA 4Q2ZB 5CZKA 4XVUD 3X11B 4WFEE 1U3HD 3X12A 4CMHB 3IS0X 1AGBB 3A6CH 5IBLC 1T20B 1V3KA 3KXFE 1DDHA 3FCTA 5KJRL 4OZHB 1CBVH 2E6QA 3MRQB 4P2QD 4UMGA 3MNZB 4X4YB 1I85A 4OBRA 5LG1A 4OUUA 3SBWC 1L0YA 4QXTA 1CD1B 5IVXE 1NPUA 1ZS8A 3DMMA 5I1CL 4KC3B 3C5SA 5EOCJ 2HT3D 3V6ZB 1OGAD 2VZ1A 3C6LC 3NCYS 5GRVK 1H3UA 4CMMB 1JGVH 3WXWH 4EI6A 4NHUA 1AE6H 3MCKB 4JFFB 3BQUC 3CD4A 4HF5L 4IHOA 1RUAH 4NQCE 4NRYA 5BS0B 5MP6L 2A6IB 4LLDA 5GRYA 2VITA 4R97C 1JNJA 5JOPE 2EDEA 1MWAA 3SKMB 3X14A 1RFDL 2QQNH 1NMCB 4NDMA 4M6AA 3T4AA 4JRXE 5DD5L 1KB5H 2NMSA 4YDLB 3CVHB 4R26L 4MNQD 4FQXC 1I3UA 1WIUA 3BMVA 1AO7D 4IEFB 5EOQH 2ZCKL 3FT2B 2AEPL 1VFBA 3BKYH 3W5NA 3OKKA 1T21B 3DETC 1ZT7A 1CT8B 4P2OA 3M45A 3D0VA 1Y18A 3O9WC 1YEKL 4FQCH 1OTTC 2OR9H 4P5TC 4S0TD 2A74B 4U1JA 1A6VH 3FQTA 3MODH 1NCUA 4ESKA 2HAZA 2IGFH 2BMKA 1AGEB 5GS1C 4ZUWA 1B2WH 2HJFB 3VFMB 3BKMH 3OHXB 3RY6C 3V6OA 4XP4H 1IRAY 2YWYA 5DD0H 1TNMA 2E3VA 3QPXH 5DD6B 1QFWI 2NR6C 4OCYH 5EU6B 2WP3T 4DUXA 4NQDB 3T0EE 1LNUB 1UM6L 1QD0A 3U4AA 3FKUS 3FT4A 4LOUD 4XMPH 1P69B 1NANI 4ENED 1PZ5B 1N6UA 3BEVB 5BV7B 3CFCL 5IJKC 4HUXA 5DRZB 1A6AB 3IFOA 4Z5RB 3FOMB 1BGXH 5IQ9A 3LVEA 5C0AB 1T22B 2GQHA 4MJ6A 2YC1A 5IHUL 3LB6C 1NUGA 4QRQB 5H94B 2JCCF 1FQ9C 5LQBH 2PYED 3DLQR 1QLEL 2VL4A 1A6TB 5DUMH 5JXEA 4BFBD 5I30H 1AHWB 2GSGB 2OL3L 2HJKB 3BOVA 3OGCA 4ONHB 1CIDA 4ZFOA 1RUMH 3VGGA 5J13C 4HG4J 4MHHI 4DAGL 1HXYB 1LILA 3V0AC 4Q7DA 5KSBE 4PJ7F 3GM8A 3BD3A 5F6HI 2AJXH 4AIXA 1ADQH 3HI5L 3TO4C 1INDL 4H1LG 3L3IB 3PL6B 3W2DL 1T80A 5GS0L 3RAJH 1MI5A 1AGDB 3VXRD 2DLHA 3F58L 2BCKB 1JYXA 3RTQA 3MRCA 4I18A 1NEZG 3O6FA 4OAWB 5KS9F 3IFLL 4U1GC 4X6BB 1FH5L 2OJEA 4UINH 5JOEA 1I9IL 2Z4QA 5JMOC 5E94B 5HHVH 5I8OH 4RFOL 4NC0B 3KWWB 3QJFB 3QHFH 4L5FL 5IHBA 2DQIL 4I0PD 2H32B 4PTTA 2QQKH 5T1KB 4X0KB 2DBLL 4TOYL 5T5FH 2NTSP 1OB1A 3RZCD 2DTSA 5CSZB 5DTFB 4M4RA 3HZMB 5IR1A 2NXYD 5DJ8A 4MSWA 2X4RB 4Q9QH 3QIUB 4RQQA 5HY9A 4PRBA 3PWNB 9CGTA 1WJ3A 2XN9B 1B6DA 4LVNB 1LK2A 1SM3H 4JRWA 1GZPA 5IK3B 3VH8A 2XKNB 3QUYD 3ZDXE 2IANA 3LKPA 2X4OA 1A6WH 3QEHB 2B1AL 4IOIA 3RWIB 2NX5B 5D7IE 4FQIH 2XXCB 4WI8A 1FLRH 4PGZA 5BJTB 2R2EB 2N1KA 2X4NB 3P9LA 1AY1L 3DRQA 3ZE2E 4FZ8L 2VXTH 5BZDA 3D3VD 3OQ3B 1GOHA 2KBGA 4ODSL 3QO1B 4XBEL 3ULVC 4QRSA 1CK0L 2BC4B 4HHAB 4YPJA 3B9KC 3GJEA 4NNXA 3LH2L 4ZUTA 2Q7YB 1VB9A 1NJ9A 1WTLA 5I1AB 5L2JB 2FR4B 1U3HA 4MDJA 2V9RA 4M6MH 1YY8B 7FABH 3S88L 4PGBA 1J0HA 5KAQG 3I6LE 3L3JA 5ICZB 4R7NA 4GKNA 3HS0A 2DRUA 1D5IL 4P2QA 2X09A 1YY9D 2D4DA 3QBTB 2X40A 1I9JL 2XQYG 4GW1B 1G7JB 4DZBB 2A6JA 4PLJC 1K6QH 3ARBC 4QGYA 4G43B 4JFXB 4CUCA 1MRCH 4XAWH 1OT2A 4KTDH 3PIQA 5IGXH 1KEML 3C2AL 1BJ1H 1CE1L 5ESVB 2IPTH 5EO1B 2HFTA 5D1QB 3WIFB 4AL8L 3KYNA 4JFDE 4H26A 5I1LB 1OGAA 3DURA 1OT1A 5HYSA 1A4KB 1J0IA 5BVJA 1YEFL 3LKNB 3G08B 2AS5M 3B9DA 2OTPA 4MA3B 4P3CH 3UTSE 4S2SB 3OAZK 3UMTA 4UU9B 4BZ1H 4OCRL 1HZHH 4WNQA 1ZT1A 5HDQL 1YQ2A 2X2YA 6FABL 5C70A 1T66C 4N0UE 4OFPA 3NZHL 4NKOA 2J2ZA 4KVCL 1OTUD 4U33A 4TSBH 4Z7UF 4PJ8B 4YDJB 2GK2A 3K1DA 4MNQA 2VR4A 4ZO7A 2FIKA 3DRTA 1P7KB 3SGKA 1AO7A 3FTGB 2AEQH 4HWNA 5DEGA 2FEDC 2JLLA 4LGRB 3RWFB 2I9TA 2EDHA 3BI9X 4PJ9C 4RGOL 2VDOH 2FO4B 1G9NH 2LFGA 4FZEL 3SN6N 3QI9D 1KENL 4APQB 4YO0B 2A0LD 3WYRA 3F7PC 3CFKB 3B6SB 4KUCF 1XIWB 2MWCA 4IRJD 4ORGB 2BOBB 3LPFA 4RRPA 1HSBB 4JN1L 1N0XL 1T89A 4HXBL 5DZLA 2Y06H 1AIFB 4KKBC 3G6JA 4OZFG 1JHLH 3GNML 3DVIA 1UJ3A 1OP3K 1R3IH 2MOVA 4GAFB 3UXFA 5BRZB 4RGMB 4GS7C 4JN2A 3T1FA 4AQ1B 2BOCB 5EB9A 5GSVB 2X4PA 3V5DA 1NFDA 1YMME 2HG5A 1KCVH 2GFBA 3GSVA 5T3XE 3U7YH 1RZIB 4O4YL 1MHCB 3UTTB 4XVSL 1BZ7A 5DC4B 5JPMB 1FN4A 3DBXA 3L3GA 3CZFB 1RPQA 4KQ3L 5DVOA 4MQ7B 4WTXA 1MCWM 1A6ZB 4JZNA 1D5BB 5I0DA 4OZIB 2YPKB 1WFNA 3DMMC 1PQZB 1DLFL 4RMSA 3EGSB 1SVCP 2O5XL 2DLEA 1DBBL 1WZMA 3NCYP 2PYEA 1R0AL 2JJSA 3DO3A 4WFGE 4DUVA 2ZCHL 2VDKL 3TWCL 2XTJB 3VWKB 3QNXA 4DQOL 3EJZD 2AJUH 3VFVA 2MPAH 3CVIH 1NBZB 1CZ8H 3BIBX 4BQ8A 4IOFC 4OTXH 1G7MB 3V7AG 3QYCA 2YD3A 4JY4B 1E4JA 1FFPB 4KGJA 2I26N 4L29B 1ETZB 2HTKD 3HG1B 3TH4T 2Y6SC 1YJDC 2ATPA 2XQBL 5C09E 3P0YL 4QHMA 4C56B 5JO5A 2XWTB 3VXRA 4ZSOA 1BVZA 3PWVA 4QNPE 5IVXF 4IDJL 1B0WA 4CN1A 3KNBB 3WN5B 1NH6A 2VLRE 1N5YL 1FAKT 1UA6H 1KLGA 3TBYB 4PLKC 1UADC 3C8KB 1FNSH 3BIAX 2FCBA 1U41A 5TGBB 1MEXL 5J9PB 2DMBA 3VRIB 5L88H 4H20L 3DXAB 3SCMB 5GSRA 1U93B 3KPRD 4S1QL 4XGZA 4Y19B 5ADPL 5BQ7A 4CU8A 4I0PA 4W6WB 4CVZB 5EO0B 1DUZA 2B5IC 2EH7H 4JPKL 3P4MA 1J1XL 4HMCA 3RZCA 3F5WA 4M5ZH 4HPOL 3SKNA 1E28B 1SYVB 3VXQB 1YEIH 4O51B 3BESR 1M7DB 2G5RA 3Q5OA 5DJAB 2FBJL 1HILA 5I1JH 5AYUH 2E7LA 3AS1A 2ED7A 2CLZB 2QSCL 5ECJE 3RNKB 2BSED 3S35X 4AENB 3MV9B 3QUYA 5CJ5A 1OM3H 4U7KA 1JWMA 5F3BB 5IMMA 3O6LH 2C7UA 12E8H 4LLQA 3U0PB 4TTDC 1QLRA 1NL0H 3U1SH 4PJDE 4OZGE 4DN3L 1TQCB 2GJZB 5INCA 4HS8H 3ZSSA 4HZLA 3O2DH 3QAZC 5F1IB 1OQXA 5TF1L 4O02L 3MUHL 4GMTH 4WU7A 2VDNH 4XP5H 3O3AB 2NY3D 4BFIA 3D3VA 3FB8B 4NNPL 2HWZH 3QIWD 4LIQL 1UYWL 4PJIB 4DJMA 5HXMA 1LMKA 2QHRH 5KVFH 5JHLH 1K4CB 1IM3B 2X9YA 4Y8AA 4JO3H 1QSFB 3FB5B 1V7NH 1FNFA 2Z35B 1R24B 4GKZA 5DD3H 3KPPB 1IM9B 2BRQA 2R56L 1RK1B 4I18C 3MA9H 3MLVL 2KPNA 2YEZB 1KBGL 3BH8B 4WV1C 3GHEH 1B4JH 1T7ZA 4UTAL 4LLUB 4RFNC 5CIPB 4CBPA 1VENA 4R96B 2UVEA 3JWOC 4AH2B 4MA7H 5ANMB 5F7DB 4NQXA 5GZNC 5KSBF 1BVKA 2VB5A 1OD7A 4F7CA 1W8OA 4OI8A 4M7LT 4LARL 4Q58C 4ALAL 3TA3D 3T3PF 5B8CA 2XZQL 1IGFL 3C60D 2ITDB 2Z9TA 3RX7A 4L8BA 4DK6A 3MMEA 4JRYB 4H0IA 2H9GA 4KK8C 1IVLA 2Y36H 1A14L 3QFDB 4RA0C 5M7QA 4R8WH 1WWWX 2NY0B 5DHVB 4Y8DC 3L3DB 3HN3A 3HC3L 5DVMA 1C16A 3SDDB 4MB5A 3IU3A 4LCWD 2DB8A 3L7FB 3QI9A 3WD5L 3P30H 3FRUB 5BVPL 3B43A 1WZ1L 1A5FH 3VG0H 4JM4L 3MLSH 4IRJA 3OG4B 1BZQK 5DMJB 1IGJA 3Q6FB 3U9PH 5JIIA 4XNXL 1HHGA 5BXFA 2BVPA 2G2RB 2W07A 2VLJE 5E7BA 2VDRH 4PY8I 4I0KA 3EO1B 3VH8G 1NCWH 4DFHA 3B2VL 1FJ1A 1U3HC 2QADB 5D7IF 5DVLA 1I7ZA 3T4YA 4WENB 5HI4D 3V7AE 3MRPA 1QSEE 1RZFL 3CVHH 4PJHE 4GG8A 4OLWL 3OKMA 5CJXA 4G6AD 4D0DA 5C0BE 5DJ6A 1KCUL 4MVBD 7CGTA 1NAMA 1Z9SA 4JR9L 2VJXA 4N8PA 4KWUA 2CO6B 3OAZH 4Z95H 1HHJB 1Y0LB 4Q97A 4D0CB 4F15C 4BSWB 4DKFL 35C8L 1YPZA 2HT3C 2GTZB 1AXIB 3L5WA 4ZXBD 1XZ0B 3HMXA 4RWYL 2ADJA 1J8HB 1F90L 1WC7A 5AWNH 1QBMH 1BQHB 3EW3B 3TESA 5L9DL 3Q3GA 4X7SL 4XMLL 1EHAA 1G6RB 4WUKL 4HBQA 2IMMA 2VWEC 5T1LB 1KCSH 3MLXL 1H3WM 1D5MA 5DF0A 25C8H 3QCTL 1FZOB 2BY0A 1KYOJ 2UZXB 4NZTH 4KROD 5BV7H 4F33B 2AJSL 4I8DA 1TZIB 1A6UL 2FHFA 1JRHL 3SGKC 3O45B 4P4KB 4OUOA 1OP3H 1FCGA 5GGQL 1W2KT 5LGHH 1NBVH 1S7WA 4BFGA 5HYSG 5C0CE 3NPSB 3RHWF 3WUZA 4GAGH 4XI5D 3TO2A 3BISA 3ZMRA 3BZFB 3KPRA 4M8QB 5TH2A 1T1XB 3HUJB 5DMIL 4OGZA 4NUGH 2YD1A 1NGYB 2ZNXA 2H3NB 2A73A 3LKOA 4WO4C 2OMNA 3O41A 3KVQA 5CP7A 3ULUE 3V6OE 1T89C 2CDGB 5B4MD 2VDPH 3HE7D 3O3BA 1PLGL 4MGXA 5EZIL 2UUDK 2D4FA 1UJ3C 1JZ5A 4Z7NE 2OQJB 2P48B 2BNRB 5TDOB 3SDXA 5KTEH 2DIJA 3AY4A 4PJBE 5I74B 5TF0A 1MCQA 3MXWH 1AP2A 1ZSDA 1S7VA 3QDMD 2Y07L 1CTOA 1I8KB 5FYJE 3VE0B 2CIKB 2G5BB 4PJAB 3A0OA 4JKKA 4NYLB 5A16B 4LAQL 1YEGH 3S37L 5EIQA 5KW9L 1RI8A 1RIVL 2YXMA 2CKNA 4KK5D 3UYRL 3CIQA 3QG6A 1XGQB 5JUEH 4YDIL 4DVRH 2X1OA 4RRPG 2H32H 1U8PA 3THML 2NY1D 1ACZA 3B3IA 4KRNA 4AQOA 4QCIA 4IJ3C 4JDTH 1ZVSA 3BGMA 4WEMB 4Y2DD 4FABH 1OAXL 1U3YA 3HCVA 1OSZA 3ARGD 3QIWA 4MCZB 2PW2B 3HI6H 3I9GH 1MCWW 3PWPE 4JM2F 5HTSA 3RKDD 4B41A 1MFEH 1MI5E 1MAMH 1PDKA 3CGTA 5DMYA 1CQYA 5FO8B 1LO4H 2QR0A 1FFNA 5IF0B 1NDGB 2CGRH 4OD1H 5DJ0B 1JWUB 4XXDA 2F15A 1UXWB 4TNWK 1P4IL 4PY7B 4W4OA 3ZE0E 3T09A 3LKSA 3GK8H 1R3LB 2X9WA 5CD3A 4QTIL 1FGNH 4LASH 3IGAA 1EK3A 2CLVB 1SEQH 1YN6A 5FYKH 3OWEA 1NQBA 4BZYA 4I0PC 1TIUA 5DZNA 1W0WB 5HJ3B 4ODUA 1JV5B 5FUZL 2J12B 2AV7B 2VZVA 1ZHBB 3RZCC 1K5NA 2CQVA 4UIMA 4ODTH 5F6IC 3TA3A 3JVGA 4D8PA 3ARDB 2NXYC 3RUGB 4D94A 1AQKL 1N8ZA 4QNPF 2VOTA 3SEPA 3BJLA 1OAUL 3C60A 2X41A 4LNRB 1MLCB 4YHZL 1LEGB 5GS2H 5ID0B 4LSTL 4M4PA 1PD6A 4YIQA 3BZ4B 5GISL 2J6EL 3VXTB 3VFWA 1U8QA 4KFZC 3WDJA 5CEZL 3WNMA 1KC5H 4MD4B 4WDIA 2XG4A 3WEXB 4NNYB 4KVNH 8FABB 2APXA 4OSUL 5GRWA 1MUJB 5DQJB 2R0KH 5A3IC 1E4XL 1OWRM 3GDBA 3SKOB 1FL6A 4LCWA 1WT5A 2AV1A 4F7EB 3EYVB 1EFXB 4WRLA 1U3ZA 2GY7B 5FOBB 4OLYL 1EHNA 4HKJA 1M6OA 2I24N 2VLLB 3AM8A 4ELMF 1EGJL 4NM4L 4C58B 3MV8B 3IDJA 5C6PB 1CXEA 2HRPH 1FSKB 4GW4B 5D7JD 1HN1A 4BYHA 4OIIL 3AU1B 2KL6A 3D69A 4GJTB 4JJ5B 4X6CF 5I19L 3IYLW 4GXUN 4K3DL 4CDHA 3ARED 2FIRT 5I76A 4Z7OE 2GJJA 4CVUA 2BJML 1P9MA 1UEMA 5D5MB 4B53A 3D9AH 5DJYB 1T1YB 2W1NA 4OKVA 3RWEA 3O11A 2HYMA 5D2NA 1P4LB 4AEFA 3BSZH 1JPTH 1H0DA 1OAZL 3GIVB 1MFCH 4L3AA 1QFWH 5L0QB 2FL5B 1T4KB 1A9BA 3WFEH 4ZXBA 4HFUL 5H37H 5F7MC 1NANH 1U8IA 4G7VH 5B8CC 3GSNH 3CH1A 4WIQA 1C1EL 5KVDH 2ARJB 2VDML 5JTWA 2NW3A 1G9EA 3WNNA 4BZ2L 3GI8H 32C2A 3BAEL 4CRPA 4BSVA 2XFXB 1F5WA 2UWEA 4NO5B 4ZO6A 1IQWL 3EJYD 1KTDA 5F44A 5K9JL 2XIDA 3FQRB 2NYYC 2F8XC 4MNQE 1A1NB 5JR1L 1AO7E 4M7JL 3LQZA 2V17L 3VCLA 3WFBH 3F7RA 5B38B 4KJQD 3VXMB 1OPGH 3NN8B 2ICWA 3KR3H 1NFKA 1SY6L 1RJYA 3OXRA 1HXMA 1CI5A 4Z8FH 5BZWB 1WBYA 1MNUL 1IGIH 3ARWA 4NN5C 3MJ9L 4UT7H 3WFZA 2XZCH 4OLXH 4IRJC 5I1HH 2X89D 4LSVL 1JGDB 5EOCL 2N4IA 4UQ2B 3QXAB 1QFWM 2IPKB 4G6JH 3HE7A 4MQXD 4OF3A 3BRDA 1XGUA 4HUVA 4RGND 4GKSA 5E8EA 2Y7QA 3MRDB 4UB0H 2X7LA 2RHEA 5EBMB 5GGSY 3ZTNL 4DGIL 4L1HA 5ICYB 3GJFB 1EHLL 2HJLA 1UCBL 1NFDE 3C8DA 3QDMA 1JGUL 2BXYA 1B88A 5C0JB 4ZO8A 1A4JA 2D7NA 4RNRB 1Q0XL 4G3YL 3UBXI 1XF4A 4WHTA 3RBSA 4NZRH 3ULVL 3HFMH 1CFTB 4PRIB 3S5LB 3HPJB 2R69H 4LCYB 1GHFH 3V0WH 2E7BA 2FYYB 1F3JA 3W5MA 3RY4A 1DQDL 3BEWA 1KG0A 4X9HA 3VJ6A 4MS8D 2VZ3A 3L5HA 2F53B 3E0GA 4Y2DA 1FC2D 4X80L 4QRRE 4RFEA 4PJHF 4U1IB 3ARGA 5D72L 2H2PD 2DWEA 4YHLH 5LGKA 5DUPH 4DGYH 5FECA 4LQ1A 1JPSH 3O3DB 2VABB 3STLA 3WHXA 4IMLB 3TVMB 4J23A 1IGTA 4PRHD 5JW4R 3RJQB 3IJYA 3H3PH 4JKPH 3QEQD 5E24E 2X4TB 3U36B 4LSRL 4UT6L 2NY2B 2VC2L 1MJ7L 1RIUH 4G6KH 5E8DH 4ZPVA 2UUDH 1TTFA 5E7FA 3IDNA 1FYTB 3BUYB 2E7MA 1JGLH 1REIA 2P5EB 3H7BB 3MV01 3GSOB 4WY7L 4E42B 1RJZA 1QO3A 3EOBB 3ME0A 3PGCB 3IJSB 2JJWA 4L4VD 3TT1L 1EVTC 1MH5A 2VH5L 4OM0H 4AT6B 2H2SD 2CO7B 1WBXB 1Y6NR 1XFPA 3STZB 2AK4E 4OB5H 3L3KA 3EO0B 1J10A 3ET9F 2XNAB 5E9DD 3MOBL 1I8MB 3MRNA 1S7RA 5D96C 3GSUA 2IQ9H 1EVUA 3PQYD 2WWMD 1H5BC 1VEPA 3I75A 4LEOA 3QQ4A 3QULB 1D5XA 2GAZA 3CCHB 3T0DA 4PP2A 4OF6A 3AB0B 5IKCB 2P8MB 3NVQA 2CLRA 5CIPH 1UWEL 4M1DH 5FB8A 1KJ2B 4N9GB 4C54A 4NP4H 5IBTH 2E6JA 4OCSH 4PREA 4DWHA 5FYLD 5DEZA 4YK4B 2J7LA 3GKWL 5C0RH 4OQTA 4Z7NF 4ONFH 1O5DT 5IMKA 4MA8H 3PJSA 2NY3C 4PJBF 1N5AB 1L4IA 3RGVD 3W9DB 2R2HB 3K46A 2FJFA 1FVDB 1GRWA 2ICWJ 3C5ZB 3BGFB 4G8IA 3TZVD 3HI1A 4YHYB 1MVUA 5CEXB 2XG5A 1DL7L 5D7JA 3QIWC 3IDYC 4WGVB 3CDGA 4XC3H 1F4XL 4YXHH 5IEHA 2E9JA 3KYOB 1I9RL 5I1KL 4IIQB 3VW3L 4JQVA 2Z31D 3DUSB 3AREA 1EMTL 1NSNL 2VUYA 3LQMA 4PJ5B 1XCQA 3SPVA 1X5GA 2VQ1A 3CX5J 5C0DA 2YPLB 5DHVH 5KSVA 1OOAA 1D9KD 1ITCA 3VXOA 4CNIB 4KDWA 4YWGL 5LWYL 2R0ZH 1U2HA 1A1OB 2LAGB 4XCYB 4OD2B 4F7PA 5CGMA 2AXJA 3OZ9L 5E4IA 4XZUA 1DEEA 3OJVC 3ZSTA 3ARFD 3IDUA 3H9SE 1F4YH 3RDTB 2ERJB 1NLBH 3MRJA 3PABB 4ZAKB 5D6CB 1MWAL 5I73B 1Z3GH 1YJDL 3S35H 3FO1A 4I9WE 4ERSL 1MJ8H 4X9FA 4NQVA 4GXUM 5FYJU 2J8UB 3SQOL 1U95A 3TA3C 3JVGC 3ZYIA 4NGHL 5DK3A 5HVFB 1BFVH 1I7TA 3KPMB 3TCXA 4K3EH 3QUMA 3QRGH 3C60C 3PWLB 2EDOA 4YDKH 4NPYA 1F8TL 4FNLL 3ZE0F 3D39D 2EIEA 1LP9E 4GRWF 1ACYL 3QUXD 5IMLB 4OD3H 1MHPL 5FV2A 4ZNEA 1QZ1A 1RUQL 4BM7A 4S1RL 5MERB 5IVZA 5B3NA 4GRLB 1S9WA 4Y4KC 4C83A 2WK2A 1T5WB 3Q1SH 3TNNA 3UROR 3GJFK 4K2UH 3VFTA 3VFRA 3F62A 1HHHB 2GW5A 1N64H 2OZ4H 5C6TL 5KOVC 3HAEB 1BZ9A 1NEUA 4YNYB 3OXSA 2Q8BH 4UUJB 1R5IA 3KXFB 3SKJH 4U6YA 4BQ6A 2MKWA 2X89A 1Q9LB 1G6RH 1I1YB 1F6AB 5FEBA 2BVQB 1ZHNA 4ZO9A 2W0PA 5DURB 3UBXB 5DGQA 1S8DA 4U3HA 5KVGL 4BKLA 1UXSA 4PJXF 3LN4A 4Z7QF 4E41D 5FF6B 5E00A 1CVRA 2DL2A 1TETH 4HIIB 1P9MC 4QYOB 4G6AC 2EKJA 4TPRL 4H0HB 5F1OB 3C9NB 4MVBC 5D7SL 2ADGB 4AM0A 4XBGB 1NGXB 3N1MC 1BAFH 4QWWD 4NWTL 1U92A 3D5OF 4WI7A 5E6IB 4NQCB 3EYOB 4Y5YB 4WFHD 1QKZL 2AI0H 1YPZE 5FKPB 4LCUB 3HTLX 1DLHA 1YMHA 4TSAH 5DQ9B 3VU2A 5LCVH 1YN7A 4J12A 2W91A 3CSYA 4ZXBC 5CJ8A 1DQTA 4JRXB 2C26A 2ZUWA 4KQ4L 2M2DA 3H6JA 2APFA 4PRAB 5B39G 5CHNA 1W72A 2X4QB 5KSUB 2R1YA 1UB5A 5JLZA 3U48A 2RAMA 1MJUL 1PKQA 1BP3B 4HS3A 5KJRH 5C07D 4HH9A 3RVWD 3O6ML 1R3KB 3F7YA 5H35A 4PRHA 4DUWA 2P7TA 4KROC 2WLZA 2R1WB 1I1AD 3QEQA 5MENB 3VD9A 1T2QL 4FQLL 2C3XA 2W60A 5I1CH 2CIIB 4Q0XL 4LSUL 4BELD 5CAYB 3NBNA 4L4TD 1I8IB 2Y5TB 5LGJB 1A2YA 2B2XL 4IMKA 2AJZA 3V9FA 2G75A 1INEL 4PRDA 4L4VA 1E4XI 1EO8H 4HF5H 1KPUB 1Q9KB 3NFSH 1I3VA 5L2KE 5GHWH 4PRNA 3FQUA 4OCLC 1IL1B 3HE7C 4V2BA 4HUKB 5EA0L 3SDXE 3T3MF 3MREA 2IQAB 5DO2C 4WUUD 5E9DA 2FATL 4KJYB 5GGTL 1XCTA 2R4SL 3MBEB 3OR7A 3PQYA 2ZCKH 3X3GL 4YHNA 1UC6A 5T1MB 2JJTA 4YHPA 1UENA 4GRMB 2JTDA 1U8HA 1JF1A 2R15A 4GG6F 5KZCD 3LKQA 3HA0A 5JHDD 1XF5A 1YEKH 3JV4B 1YECL 4HUMB 1YYLH 3I3BA 4JVUA 4LP5A 4P3WA 4XCNB 3GBNH 1UEYA 3GRWH 3GSQA 4WEBL 4X9IA 3TFKD 5E8OB 4LDOB 1H15B 2NY1C 1W8NA 5HHNB 5I16A 2MFNA 5HDBE 3RGVA 1DE4B 4R2GD 3WUWB 3RFZC 4V1DE 4Y2DC 1EUTA 3TZVA 2V2XB 1WK0A 3ARGC 2EEAA 2W59A 4YHKL 1UM6H 3L3OB 2FJHA 3BYTA 4LMQE 1XGYL 2IG2H 1KNOB 1YEDA 4JPWH 4NQED 3SJVB 2VISA 4FFVD 1FRGL 4JEGB 2X4UB 2Z31A 4U1MA 3RKDC 1X5LA 4WI3A 3CFCH 1LE5B 3LV3B 2OSLA 5I1GL 5E4EC 1YEJL 1ITBB 4G7YL 2PCPA 1RHHA 4P46B 4TSCL 1EJOL 5GXBB 3NCFB 4ZQKB 3F6IA 1WFUA 1D9KA 3KPLA 3RIAF 4K23L 5IHUH 1K3IA 2BRRL 2I07A 1VACB 3ZT7A 1CR9H 3ZKND 2AJYL 1QLEH 3ARFA 4QF1B 4FXKB 3U46A 5CGYC 3E3QC 3BGAA 4HQQL 1QP1A 4PR5B 3CXDH 3K7UA 4P4RB 1HCVA 1FO0B 4NOBA 4UIKL 1NGZA 1YQVH 2X44D 1K9TA 4DAGH 1IBGL 4I2XB 5GGVY 5HVHC 3BW9B 3W2DH 3NTCL 3NA9L 4HH8A 5DJCB 3KJ4B 3IETB 3QT2A 1LEKA 1S7XB 3P4NB 2ZOKB 4O2CA 4PG2A 4KKAC 4R4NC 3D39A 2VAAA 1FH5H 2GTWA 4LBEA 3QUXA 1I9IH 4FHBD 2BY1A 2DM2A 4I5BA 4RFOH 2CJUL 2IH1B 5GRJL 4L5FH 1KXTB 3VI4E 1OL0A 2DQIH 2ORBL 4EJ1C 1CXHA 1HH9B 2V7HB 4ZUUB 2YA1A 5H2BA 4TOYH 4QTHA 1CIUA 3P73B 3RWGA 4UT9H 1GSMA 3DSFL 2XY2A 1PEWA 5IV2A 3MUGA 5DZOA 3SO3C 4NO2A 2FH6A 3NIDF 1UT9A 5D2LF 1L7IL 1IGCL 4G8FB 2MKLC 3LS5L 4P5MA 2DYPB 4Z7WF 2VZOA 1QEWB 4TUJA 3MRGA 4MJID 2XWBA 2YD9A 3N1FC 3L1OL 3FFDA 4JQVC 3S6CA 5D6DC 2O5YL 4XTRC 3AREC 4E41A 4G8GD 1I4FA 3C6LB 5GS0D 1BX2B 1GCFA 1T6WA 2B1AH 5SWZD 1M7XA 2WAHA 2WUBH 3GBML 3MNVA 4YZFE 3LRSA 3JV6B 4O58L 5D2NE 3UTSB 5C7XL 1AY1H 4FZ8H 3CUPA 4N0CD 1OAKL 1KPRB 5TDNB 2AXFA 4ODSH 4XBEH 4CU6A 3SE8H 4M7KL 4JO4L 5C0GB 1CGWA 3BE1H 3LH2H 1TVBA 3RI5K 4NC1C 3ROLB 3FQXA 1MCDA 3HZKA 3U4BH 5D2LA 4DZ8B 2AVGA 2J4WH 5FKAB 4UBDD 4TN9A 4LLYA 5HHOD 5IJVB 1ORSB 4U1KB 1LQSR 4P9HL 4UTBL 2I5YH 4XCEB 3FT3A 1WIPA 1LO0L 2UWEE 2WWKT 4NWUL 4M7LH 4M6OL 2OBGA 3O9WB 5C07A 2W9DL 4TQEL 5F9DC 3EJYC 4P5TB 1I9JH 1CFSA 2B8OT 4DW2L 3QA3B 1I1AA 1KEMH 1MIML 4YEFA 2YA0A 5JOFB 4O9HH 4FMFA 3D25A 1M7IB 3EUUA 4L4TA 4HIEB 4P2RB 5DFTA 4EBQH 4JY5L 1RULL 3ILQD 4N8CL 4HT1L 1KCRL 4WWKC 3W9EB 3VXPB 1GC1C 4L8CB 3NCCB 1YMMB 3OX8A 3DX9A 1ED3B 2BSRB 4OCRH 4HCRH 3LEYL 5CGTA 4H1LB 4JFQA 5HDQH 1GGTA 1LP9F 1U8LA 2UYLA 4MQXC 6FABH 3C6SA 4QRUA 4CJ0A 1S5IL 3NZHH 4HDIB 4CKVX 1X7QB 4L8SA 4RGNC 1NEZB 4WUUA 4MWFA 3MGTA 4KVCH 5D1XB 5AZEL 1BVLA 4OLUH 3QDME 3K1KC 2WIIB 2W65B 1F4HA 2EDLA 5BOPA 5FHBL 1G0DA 2ZUXA 3QUKA 1IFHH 3JTTB 4B7LA 4RGOH 2BSSA 3KS0H 4FZEH 4RDQG 4A6YL