1MCPH

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
222
structure length
222
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKGNKYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARNYYGSTWYFDVWGAGTTVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
source organism Mus musculus
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
total genus 33
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1984-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH02
3J7HA 5DJCB 1SJEB 1EEUA 1FIGL 1J5OL 4HF5L 4OF5A 4YHPB 4PJFF 4F37F 2YD1A 4FTVA 2AABH 3RWCB 1RK1A 4K3DH 3JWOL 4OJFL 4N5ED 5JUEL 4QRTA 3FAXA 1F90L 2WLZA 4HK0B 4ZO6A 1A7NL 4OF6A 1BZ7A 4NUJA 4HF5H 5IR1A 3GO1L 4P23A 1KSRA 4MJIA 2B4CH 1BVLB 4XCFH 3K2UL 2I07A 2OZ4L 2BP3A 2ARJA 2OL3H 1B90A 1ITCA 5CZVH 4MJ5A 1HH6B 4IOIB 1MIML 3UTTE 2YD4A 2D0FA 3NFNA 3FOMA 1U8QB 4IDJL 2GI7A 4ENED 1D5BA 4Z5RB 5CWSA 4EN3D 3FB6A 2EO9A 1C5CL 4YXHL 1T1YA 5DJYB 1KJ3L 2ZUQB 3VFTA 4H26B 5DFTA 2I9TB 2NYYD 1S9YB 1JJUA 4GW5A 4ZNCD 2HT2C 2BVPA 1CD1A 1TPXB 3CSGA 1S9VB 3BZ4A 4DQOL 3QQ9D 2Q86A 1T2QL 1MQKL 3O11B 1MIMH 2E7HA 3WLWC 3KXFD 1U2CA 1CGUA 3A6CL 5FV2A 3F5WB 4UAOB 4F8TA 3TF7C 4IRSB 1HHHA 1U91A 4NGHH 1TZIA 4D0CB 2E7LA 5EWIH 2R2EB 3HE6D 4JO3L 1IC1A 4PJBA 5DJDB 4DGIL 1INDL 5EU4B 2VDLH 3RL1B 3U0TB 3X11B 3K1DA 4M6NH 3NA9L 3QR2A 4NQVB 3GHEH 4R4NC 5D5ME 1OGAD 4HWBL 4M8VA 1DQML 1GGIL 2OCFD 3DI2B 2VDQH 2HTLD 4QWWD 5ITBH 1LK3H 4MDJA 1BIIA 5DGRA 1MCOH 3ARFC 1WFUA 4DGIH 4MD0A 2QQNL 2HH0H 5KS9F 1CLCA 4XBEL 1XR9B 1MI5B 3MFFA 4OLYH 1I7ZA 3VGDA 1BD2D 2FYYA 4NKDB 2CRMA 1RZKC 4XTRD 1OP9A 1F6AB 2OL3L 1INEL 1MCOL 3EO9L 5DO2C 4JFZH 2OR7A 1G9EA 1B3JA 1CE6A 5EIVA 1N6QH 4IS6B 5JHLH 1WEJL 3E6FB 5TQ2L 4BQ6A 3RGHA 3A0OA 3STZA 4XXDB 4Y5XB 2VZTA 4M3KB 3VMPA 4RNRA 2AKRB 3L5XL 1BBJB 3GRWL 1T6WA 3HZMA 5IVXA 1HQRA 2V7HA 1OVZA 2DTML 3BWUC 2F54A 4JEGB 1H3PH 3VWJA 5F3HB 4OFIA 1PZUB 4Y5XA 3O2DH 1LO3L 3IRZA 5F93C 4CU6A 4N68A 4POYA 5EOTB 3KPSD 1IKFL 3FTGA 4R96B 4L4TB 4G7VH 3NCMA 1HILA 1DQMH 4YC2B 1OT2A 5D7JA 3VD3A 3NFPB 2AEPL 5DVOA 2APTA 1NEUA 3BEWA 4AMKH 3U1SH 3V6ZB 1QHOA 5HYJA 4PJEE 1XMWA 1KIPB 2YC1A 4BYHA 1HHJA 3G6DL 4PJGB 3GFUA 4XMPL 1P6AB 4JKKA 3C08H 4ERSH 1PZ5A 3MRCB 2QKIB 5DO2D 4WGWB 1WQVT 1CD8A 4OCLC 5D1XB 3X14B 4R26H 1XGRA 4E42B 1BM3H 1HIML 4HXAH 3QZWG 3KPMB 3LKOA 2FGZA 4LLVA 1F4YH 1PAMA 4PY8J 1U8QA 4MMZC 3PQYD 3NZHH 5HI5C 1CFNA 3UDWC 4OM0H 1QKZH 3FZUC 5D1XA 5KOVC 3QDMB 3X14A 1YPZB 4HJGB 5DUML 2QKIA 4BZ2H 4NHUB 2V2WB 4J3TA 1LP9E 3AREB 3JWOH 2J8UB 4DK3A 4X99B 4RAUB 4PR5B 4DAGH 4MZ2A 4NQEB 5DZOA 1IGIH 1L6ZA 2ZUWA 1YY8A 3TWCH 4DEPC 4OCRL 3NA9H 4OLZH 1KOAA 2GUOB 4GXUN 3VG0H 5KOMC 1QBAA 5SV4A 1A7QL 4WFED 5BVJA 4YUEH 4FQIL 3TT3H 1DVFC 4FFZL 1RZJC 5E5UB 3D69B 2V2XB 2DWDB 3MJ9A 1GC1L 5SWQA 5K59E 5K9KA 4XNMA 2GAZA 5A3IC 1UQSA 3ARGD 5E6ZA 4Z0XA 3HFML 4ALAH 1D5IH 1CLOH 5JXAL 4Z7UE 3L3GB 2VYRE 4JFYA 4LP5A 1AD9B 1SQ2N 3HC4L 3TO2B 4XP4H 2E7LC 2UWEF 3A67H 5L9DH 3IJSB 2R0LL 1UACH 2XXCB 1J8KA 3D69A 2N56A 4I4WB 5CEZE 5D93C 4QTHA 4K3EH 1MCIA 3GHBH 1H9VA 4RFEA 2X4SA 5IVZA 3VXPA 3RAJL 3WDHA 1ITBB 4NGHL 4C83B 4KI5F 2PR4L 4UBDC 2Z92B 1K9TA 1W72H 5D7LD 5IHUL 3BH9B 2NXZC 5EB9A 1IC7H 1DBAH 1UEYA 1CLYH 2HG5A 4N0UA 3QIWD 4NBZB 4S1SH 4DKDC 1VGKB 1A02N 2R9HC 5DEFB 4NO0B 4PJ9B 4ZOCA 2VL4A 3O6LH 2OSLB 1CGSH 1FH5L 5T5NG 4JAMB 4FMFA 4H5SB 4NYLB 3QDJB 5EUOE 5C3TA 2ENYA 4KROC 3QA3B 4K55A 2CUIA 1AI1L 1DL7H 5A3ID 3K4DA 1ZK9A 4Y2DC 1RIHH 3HPLA 3SKJL 4WUKL 2CMRH 3V5HA 2OS7A 1MQKH 4B50A 3D0VB 5FA3A 3RVXD 4PJXF 4XAKE 3RGVB 4YHZL 4LSDA 3NIGE 5E2JA 3C5JA 3GSWB 4Y2DA 4KUCD 5DZLA 4OZHB 4YXLL 1FNSL 3CZJA 4LLYA 1RV6X 3LKSA 2ILLA 3D6GA 1HZHH 4GQ9H 4EXPX 4K9EC 2EXWD 3REWB 4U1SA 2HJLB 1OSPL 1RZJL 3KPNB 2NR6C 4Y4FC 4XNUL 3VFRB 3FB6B 4V1DD 3GSRA 1OL0A 2EICA 1H3PL 4PRPE 1UKTA 5JOFA 4CAGA 4LASL 2XKUA 5ICZB 2YPLB 4ZODA 2IQ9L 3DWTA 5E8OA 2FGWH 1RUMH 1A2YB 5CGYD 4M43H 1KB9K 1V5JA 3D5OF 1ACZA 4JVPA 5A2LH 4QRQB 4K7PX 1HQ4B 4XAKD 3CDGB 5L2KE 1BZ7B 1X44A 5T3ZE 2NW3B 2X4NB 2V9QA 1A3LH 1RUKH 5J6HB 4LASH 1HH9B 1NCTA 4FFZH 4KKCC 4MNQB 3ZKMC 1EO8H 4ZOBA 4WENB 5TDPA 3S6CA 1V3MA 3GMRA 2FGWL 4TN9A 1JPFA 1A3RL 4KTDH 5IVZB 2YD7A 3VXSD 5GXBB 4MAYD 5ITFB 3PWPE 2DQTL 2HFGH 1EFXA 3R1GH 4I2XE 2BMKA 4L8DB 4WW2A 3CLFH 5DVLA 4ZG1A 5FKPB 5D7JD 2J8HA 3MR9A 3O41B 3DVIA 2GYSA 5D6DC 1RJLB 3F12A 2R1XB 5EBWA 4JANA 1MCDA 1NLDH 2IPTH 1QRND 1R3LB 1EAPB 3D39A 1UADC 2X4UB 3GM0A 1XCQA 2BX5A 3MJ7B 1RZFH 2XRAL 1YUHA 4U31A 3F7YA 4NDMB 3P9LB 15C8H 4HKXA 5D1QA 3DLQR 5CJQL 3T0EC 4CBPA 3RTQD 3BMVA 1RUAL 3CH1A 1ONQB 4I77L 4X6EB 4KVCL 2W60A 5I1HH 4RAVB 4Z7VB 4FQLH 2C4FT 3CVIL 4S1DC 3BPCB 3T4YA 2HMID 4TSCL 3IDJA 4R90H 3RIAK 5HDQL 5E9DA 5D1QB 2FIRT 3X13B 5DVKA 4F3FA 4X6CE 1LO5A 1MCRA 5BRZA 3ALXA 5HHNA 1ZLVH 4LNRB 3GMLB 1BGXH 3QIBB 3VXNA 2YPVH 3NCEB 2MTPA 2Y4SA 4CN4A 1M71A 1QRNE 2PO6D 4EDXB 5D7SL 3QFJD 4HWZB 3QBTB 1XCTB 5HHNB 5J1AB 4GBXA 1KLUB 1BQHA 3QEGH 3QUYA 3O4OB 3MUZ1 3HNSH 5ACLA 2EIZB 3SDYH 1HK6A 4P23B 5GRUH 2YUXA 3VFPA 2C7UB 3V6OE 5SX5H 3V6ZA 5HYJB 1HZHL 2X1XR 1Y6MR 4I13B 2NY7H 2PYFA 2YWZA 5CHNB 2DQDH 3SE4A 4U1HB 3AC0A 1CTOA 1VACA 3TBYA 3LVEA 1JRHI 5KS9A 2WM0A 3SO3C 5C0ND 2HFFB 2CRZA 3GZKA 3QQ9C 3E2HB 1GGBL 2MQ0A 1YNLL 5AZEL 4D9RD 1ZWIA 4OD1L 1I1FB 3T1FA 4PJ5D 5HGHB 1EPFA 3ULUE 1FYTE 4WFHD 4XP5L 3BZDA 1LDPH 5E6IC 3RUGF 3EOTL 3IB4A 3ARGB 2WIIA 5BV7H 1AD9A 4Y4KB 4PJDF 1FVEB 3UX9B 2EDTA 3U36A 1EEZA 2ICEB 2D7TL 4H20L 4NZJA 4OD2A 4PJ8C 2AQ1A 1XZ0B 4YBQC 3WYRA 4BM7A 2VDRL 4KFZC 2A83A 3O2VH 2NZ9D 1E4WH 5HGHA 1WIOA 2HVJA 2FR4B 1Q1JH 4V1DE 5KW9H 3LV3B 3MRBA 3GMRB 4O9HH 2Q20A 1GHFL 4PJIA 1YJDH 1PDKA 3CFKA 4ZS7L 4HMDA 3EGSB 3KXFA 4DCQA 1Q0YH 3F65A 3K46A 4L8BB 2ADFL 4LOUC 1BFOB 1QBBA 2ZNXA 4HS8L 3LIZH 2DN7A 3L3JB 3IKKA 1T0MB 3FN9A 1EJ6A 1Q9OA 3LKQA 2VUYA 5IESH 1K4DA 4HS6B 5D1XD 4KKAC 3UTOA 4QHUA 2I60H 3W39B 3LH2H 5IT2H 2BSTA 3SKJH 1PKQB 1EO8L 4YFDB 5C70A 2AXFB 4X4MA 3FQTA 4L3AA 1P7KB 4R4ND 5TPWL 1DN0B 5L6YH 5BJTA 5DEFA 5B8CA 1E6JH 2DM3A 1FG2B 1RVFL 1BAFH 3RPIB 3RUGA 4C56B 4YHZH 3MXVH 4FFYL 4MX7B 1NH6A 2XXMB 1BFTA 4LAQH 1KC5L 3O81A 2R0ZL 5GRJH 4N0FB 5BQ7B 2DM2A 2I26N 2MSPA 5EOTA 4BFIA 3FB7A 4LHUA 1TMCB 3NCFB 2P8PA 1FVDA 3MRRA 4JFFB 4I0KA 4HV8A 3BUYB 3ES6B 2JIXA 3VXRA 1P6FA 1GZQB 1T1XA 3O9WB 3MJ8B 1H3UA 1A6UL 3O8XA 2I07B 1A0QL 2YWYA 2ED8A 5D2NC 2WIIB 1J1OL 4MQ7B 2GJZB 4HV8B 5F8RC 1NCWL 2VKXA 3E0GA 4ONFH 4UT9H 2AJSH 2ZOKB 4X7SL 5KVEH 1YEFH 1VCAA 3VXUA 3OKDB 2XWTA 2BDNH 3VWJC 2J5LB 1G9NH 3TH3T 1U41A 2X9XA 5HDQH 5E2VL 3RX5A 2X09A 1HI6B 2J7LA 2ESVE 1MI5D 1E28A 3TNMA 1T04A 2HFTA 3ZYOA 5CJXA 1ZLVK 2ORBH 4MQSB 1KELL 1DVFB 4CU8A 3QDMA 2HJFB 4ZAKD 5E8OB 2CK0H 4H0IA 2PTVA 1OAXH 5IFHH 3AVEA 5J4MA 4HXBL 5IBTL 1OGAB 1MJUL 1NLDL 1WAAA 1N0XL 5I1IL 2VABA 3JTSA 5D7IA 1E4KA 2WAHA 4S1RH 4FTVE 3S4SB 3DRTA 4NZTH 4WCYL 3U6RA 2YA2A 1DQQA 2XA3A 2QLVB 1LWRA 4WI8A 1TNNA 3OSKA 1JZ5A 4JO2H 4QY8A 4HEME 2Q7YA 2G2RB 3RWJA 3H8NA 3VU2A 4J6RL 4R3SB 5DUBA 5IEKB 1X5LA 4E9LA 3BPCA 3HZYB 2LFGA 1CICC 32C2B 3TPUB 5EO0B 3I6LD 1HYSD 3UAJC 3FQTB 4I9WE 2GJ6E 4XPHL 5C08E 4GLRI 4QY8B 1K8IB 2KZWA 3PHQB 3DMMB 4OFPA 1WGOA 2W0PA 1E6OH 2CLRB 1M7DB 4HZLB 5TGBA 5BZWA 4R6UA 5IQ7L 1D5ZB 2VDRH 3RFZC 4NRXA 3O6FB 5C0BB 4IDJH 2VDOH 2VXQH 2OJZL 1CFQB 2V7HB 4K7FB 4LHJB 4FQCL 2RIKA 4F7MA 5E70A 2Y72A 4F80A 3GNML 5B4MC 4ZO7A 5C0IA 1VGKA 5DLML 5BRZE 4XRCA 1DVFD 4YPJA 2R0ZH 1UB5A 4M7ZC 4OV5B 5D1ZA 4LARL 4DVBB 1AD0B 4FP8L 5JW4N 1M7XA 3IDGA 2B39A 4ZOEA 4G8FB 1IQDB 4GS7C 3VFGH 1CTNA 3K8KA 1CD9B 4ZTOL 3MC0A 3WCYA 3CIQA 3NABL 5FK9B 3UBXA 1SJEA 3WE6B 2D4DA 2XQBH 1TTUA 3T3MF 5JW4Q 1DBKL 2XV6B 1WWBX 3IU3B 4WEBL 2RJMA 4JRYA 1EK3A 3IAPA 1XF5A 2O61B 1ODAA 4XX1E 1JWMB 3QCVL 5DC9B 2QHLA 1NMBH 4XH2A 3PWVB 2ZUYA 5DJ6B 5E94A 2CSPA 4IOFC 3DO7B 4U1KB 5IW6A 3HE7D 1H8SA 1LE9A 3DX8A 1MREH 3WFHB 3FQXA 3BDBA 3CFEB 2Q8BL 5D7LA 5IW1A 2SEBA 2QQKH 3OKMB 1KJ2L 1JPSL 5IG7A 4UIKL 4XWOD 3GI8L 1QBLL 1U8KB 4HC1H 2GSIB 3FONA 2DTSA 2C9AA 4X9HA 2VQUA 4C56D 3KPLA 2QR0A 4N0UE 2JJSC 3QIUD 2KQNA 3V2AR 1KBGH 2AK4B 3O0RL 3D85D 4N5EC 2X70B 1YUHB 2PTUA 3QFJE 3P4NA 3ARBB 3LEVL 4JPVH 4WUUA 5L88H 1A1MB 3KG5A 5GGTH 3MNWA 4LSRH 3GJFB 1IAIH 4UAOC 2F9BT 3GI8H 4PJHE 2VL5B 4A6YB 4PTTA 4UINL 5AUMA 4PJFE 4XVSH 4LNVA 1MHCA 4ODUA 2ITDB 2FH6A 5GS2H 3D2UB 4HPOL 3QHZL 3QUMH 4P2QE 2R4RH 3LRGA 3ARFD 5E9DB 4CDHA 2O5YL 4P46A 4OSUH 4OFYA 4QHLB 3NCJH 2E6PA 2F74A 2VDKH 3HR6A 4UQ2A 3SCMB 4JHAL 1H15A 4AM0A 4MAUL 1FFPB 4WEBH 4KK8D 3OAZH 4Q9QL 5F7NC 1T3FA 3QUML 1TJIH 4OCXH 3MJ7A 1RJYB 2K1MA 3LRSB 3A6BL 2X4UA 4JKPL 4YDVB 5A40E 5T3ZH 3GMNA 4LCCC 4PS4L 1AXSA 2DDQH 5F9OH 2P8MA 4D9QE 1JTPA 5DS8A 3W9DA 3PWJB 5C6WH 2BVQB 2FATL 3QIUC 3MJ9L 4N1EA 1NC2A 4FHBD 3EDDA 3GHEL 5E9DE 3P0GB 5BOZG 4XHJC 2BRQA 3QPXH 3UZVB 5DS8B 1H3VA 3UPRA 1NDGB 1BVKA 1AXSB 4YHOL 4XNQA 4XNZC 4RIRB 5JPMB 1FNEA 3GSXB 1J12A 1HKLH 1FVCB 3VFGL 2FZ3B 4M4PA 1FC1A 2WQRA 2VKWA 5FB8A 4KHXL 3LEYH 4NHCH 1EVUA 2DBLH 1JGUH 2H2SD 4ZAKC 1FL5B 2NX5A 2HFEB 5EUOF 2VQ1B 2AK4E 4N8VB 4OV5A 4YHPA 3IDMB 1EZVX 2OI9C 3RGVA 3EOYG 1F8TH 4O4YL 3FB5A 4KK5C 4KK8C 2BOBB 2IG2H 2JJWA 4L3EA 3NPSB 4HFWA 3MLXL 4JPIA 3PGDB 2E27H 3CXDH 3IU4H 4F9PC 4ODTH 3D85A 1EVTC 4P4KB 4GKOA 1LE5B 3CPLB 4K7PL 3VXNB 3VFRA 4W70A 5L9DL 4ZNEA 5IOPB 2VZUA 3MRNA 3P4NB 5JIHA 4NSKA 3SPVB 1F3JB 4HFWB 1OPGL 4JY6A 3OKNA 3MRCA 4QOKA 4JN2A 3PNWB 2D0GA 3OGCB 1G7MB 1LK3L 1GGUA 2E3VA 4TNVF 4WJ5B 5EU6E 4Z0BL 4JRYE 3OHXB 3KLAA 3K7UA 4JFEB 4R9HA 2UY6A 5I0ZA 2F8XC 3BN3B 3HI1B 4AK1A 3O6LL 1GRWA 3G04B 3UBXG 4XPBH 3MRKA 4LKCB 4MHHG 2ED7A 3TO4B 1QLEH 1XF3B 4RFNC 1T21B 2Z8SA 1LO0L 2HVJB 1MF2H 1F4WL 2MWCA 2VDPH 3NH7L 3ARDD 4FQHB 4W6XB 1RPQA 3HMWH 3KR3L 1YEDA 3HFMH 1LD9B 1UWGL 3W2DH 4LVNB 1G7LB 1WTGT 4QHNB 2ZSWB 1Z0MA 1ED3B 3DV6B 3GIVB 1N3NB 4OQTL 3FCTA 4U1IA 1Z0NA 1MCLA 4OM1L 1CL7H 3CDYA 1YY9D 4QGYA 2DOCA 4G80B 5BVJB 1IILE 1V7MH 1GZPB 1UWGH 4BK5A 5C0CB 2LU7A 5LAXA 1FLRL 1NAKH 1XIWC 3A6OA 4PRBA 5KJRH 3RA7H 2QQNH 5DMIH 3P4MB 4U1IB 1I7ZB 3C6LB 3C5ZA 1JGLL 5INCB 4ZUVA 5F7DA 3KNBA 2XTJC 4NWUL 4W68A 2PKDA 5JW3L 1N8ZB 3F8UB 2VIRA 1JI2A 4FRWA 4JR9L 3TO2A 1YC7A 4OI7A 4OZ4B 3OAYH 3TV3L 5IJVB 1FLRH 4UV4L 5DJAA 4YR6A 2IALB 2VZSA 2VDLL 5HGAA 2AI0L 5FEBA 2Q3AA 1ZT7A 3SCMC 4RX4A 5JXED 3QIBA 4RFOL 1FAKT 1BM3L 4P2CG 3PWPB 5DD0L 1LEKA 1OHQA 5CMAB 1C12B 3MOAL 3ULSB 2VDMH 1DQLL 4JRXE 4X98B 2UZIH 1KCUH 4JFXB 3GJEA 2NTFA 5GJTL 1GGCL 4YHIA 4PGDA 2Y6SC 1WWCA 5DK2A 2ITCB 4KI5C 1H15B 3MODL 4XBPA 5HY9A 5C0FA 4M1DH 1INQA 2NTSP 4XNYL 3I2CH 4LSSL 4P57A 5D6DA 3T2OA 2VLRE 3RTQA 1OLLA 4U2ZA 4M48L 5DR5H 2IH3B 5GZOD 4JDVB 1J5OH 4DJMA 3DUUB 3QIWC 4M9PA 3I3EA 1UH3A 2R0WL 2VR9A 4E42A 1JHTA 5EZIL 5IMKB 5HHOA 4OF0A 5KSUB 3O45A 1WBYB 1BBJA 3HZMB 1X9QA 1DBJH 5ID1B 3ILQC 4M6NL 1JGLH 1YYLH 3BVNA 1JHLL 1CIDA 3QUXB 4ODXB 2VSDA 5D7KE 1ZLWH 1KLGB 4JHWL 1NCBH 3ZE0E 3HR5A 4QRUB 5EU3A 5EBLB 3MRBB 3TPKA 1R3KB 3RVUC 1BJ8A 3AY4A 4Z7NF 1ZSDA 1YN7A 4MYWB 3MLXH 1K3ZA 2YN5A 3U9UB 5HHVH 4ZUUA 4PJHB 4V2BA 1CICD 2XNAA 3LQZB 2PXYC 3GGWB 1NGQH 1WC7B 4M1CD 4OCSL 2ATKB 3HCVA 3BXNB 4JY5H 4FQJH 2DLEA 1FZJA 3QI9B 1GGCH 1BZ9A 3HC0B 3C2AH 3OMZA 5EPMB 3JSSA 5CINL 2R23B 4Y19E 3SKUD 1YDPA 2XY2A 4M93C 3T0DA 1K2DB 1KG0B 3WEXB 4NQDA 4R0LA 4HIEA 5GRUL 1KTDA 2NNAB 4NQSA 4B7IA 1UJ3B 3GSQA 3PUCA 3O6KL 2VN4A 5DMYA 5I17B 5AWNL 2VZVA 3IETB 3P4LA 3SOBL 3MUJA 1A64A 1KYOJ 5ESVB 2B4CL 4AM0B 3PXJA 3C60B 3J8F7 3RPIA 3RUGB 4Q2ZB 4DUWA 1KT2B 2X4QA 2J8UA 4PJDB 1IRAY 1KB9J 1ZTXL 2V2WA 4YAQA 1R0AH 3H7LA 3NH7H 1B0GA 4PJHF 4U6YB 4IIQA 4X80L 5BV7L 2ITDA 1BIIB 1NBVH 1QFWM 1CGTA 3OGOE 1S7RA 4FQIH 2R29H 3AB0C 5EOCH 5IM7B 2DIBA 4HHAA 3PQYB 5EIIA 4ODWB 2CLRA 3H3PL 3UYRH 43C9A 4WI7A 3TP4A 4V2CB 2XWJA 3CNKA 1MCCA 3UEZA 2AJUL 5D5MA 2ZUSA 5B39G 4NBXB 4LPCA 5TE6L 1NMCC 1R5VA 2DQGL 1NEZA 4X9IA 4M43L 4XBPB 5HY9B 4QRPB 1YN6A 2CD0A 3UTSB 4NRZA 4G9DA 2DIAA 1ZHBB 2OTWB 2XTJD 2NTFB 5IBLD 2GTWA 2X89D 1FO0L 3VXPB 1JP5A 1Q0YL 5C0JB 3SE3A 2OL3A 1LNUA 5IW6B 3NIFE 4XPTH 3VCLB 1D5BB 2A38A 2X1WL 3K3QA 1B6DA 4HKJB 1KACB 2QQLL 3VD9A 1JPGA 3LRHA 3UZEA 1YNTB 5ALCH 4XBEH 2WANA 4YHLL 5EU6A 4OCWH 2E9WA 1HQRB 2Z4QB 4RISH 2JB6A 3RP1A 1W0VA 5ITFA 1R0AL 1ZT1A 3WIFA 1KV3A 3RUGE 3PL6C 4KAQH 1I8IA 3RWFA 4O9HL 1PY9A 1RU9L 3BD4A 1GIGH 4RGMC 4X4ME 3QXTA 1T0NA 1QFWL 4S2SA 1QEWB 4ODXA 3UJJH 5J6HA 4M6OL 2R0LH 3MLTA 4NQEE 2DQDL 3CVHB 5E2TL 4QRSB 4PRDB 1J8HA 5IFAH 3BP4A 1UG9A 2ZSWA 2J4WH 1MSPA 1U36A 3FT4B 4X8JB 4XCEA 4U1JA 3Q3GA 3KHQA 2NY5L 1ZXQA 2QHRH 4JM2A 3CVIH 1YEDB 5F7KC 1FZOB 1ZS8A 5HDLA 1QSEA 3CVHL 4FS0A 1QFPA 4RGMB 2P5WA 5AWNH 5F44A 4Z7VF 5DRZB 3PV6A 1T7VA 4U6VL 3WIHH 5C0DB 4LP4A 4H88H 3ZKMD 2ERJC 2YPVL 4LIQL 4BKLA 5J6GB 2A6KA 4KQ4L 1VKXA 5GRWA 3K74B 4DCQB 1N6VA 4PP2A 3C08L 2NZ9C 4NUGL 3QCTH 4ZFZB 2R1YA 1HEZB 2EYTB 3TPUA 2DQHL 4S1QH 3MYZA 4XP9H 4R3SA 1XFPA 5DUBB 5IEKA 5DQ9B 3SJVD 4KK6D 4MDIB 2AXGB 2B5IB 1A4JA 3PWNB 4PJAA 5J6GA 4HKXB 3UC0H 3IYLW 4M7LH 3K2MC 4DKEL 2AJXL 1H0DA 3EFFA 3PWPA 2EO1A 4DZBB 5I1DB 1ZHNB 2F8OA 2FR4A 4ZS6C 4UZGA 4X4XB 4WHTB 3QDJA 3MMEA 4E41A 1MVUA 2Y07H 1TDQA 1A6UH 4O58L 5FDWB 1EUUA 5BVPL 2EE3A 4C56E 1VPOL 1FBIH 1T4KA 4L8DA 2VXSH 1EHNA 4KTEH 5IGXH 5HGDA 1NCUA 3KJ4B 1D9KB 2W9EH 3MLZL 4LSPL 5FO8A 3SBWC 1BD2E 1QO3B 1A21A 1RFDL 3HAEH 3IS1X 3AAZA 5ILTL 2OQJA 4XPHH 4Y4KC 5HSFA 3EYVA 2O5ZL 3GSXA 1EAJA 5CBEB 5E6YA 2BXZA 1HIMH 5JO5B 3T65B 4NN7C 3DV6A 3MRQB 2LAAA 1QOKA 1A7OH 3VFNA 1L7TH 4EUPB 2FHCA 3O45B 3UZQA 5B38G 4PREB 4P2QB 4C4KT 3SO3B 1JHTB 5DWUH 5H8DA 5SWZE 1G7HA 1X4XA 4LMQE 1A47A 4HXBH 5CEZL 4HUWA 4LQFH 4TVPH 5C8JA 1M71B 4U1MB 5EA0L 4G7YL 2V9RA 5C9JB 4WRLA 4ISVA 1ZWIB 3TO4A 4MCYA 4PRIB 4U0RC 5FYLD 5IV2B 1L4IA 1RZKL 5A2FA 2FNBA 4HIXH 5EZOH 2YA1A 1DBMH 1NCWH 4ONFL 4X0KA 2YD3A 2UWEE 4OZHA 4QKXB 1K3IA 4ZSOE 4I3GA 5C9KA 1NBQA 4OGYL 3SCMA 4G3YL 4HIJA 5F3BA 5J13B 4HKBA 3TN0B 2WQ8A 4NN7B 2MPAL 3NABH 4BQCA 4PB0L 5C2BH 5EZOL 4WV1C 5FFLA 5TF1L 3MZTA 2JK5B 2R0KH 1HHIB 1MRFL 3U6RB 4L4VD 3SDAD 5CEYB 2X89A 1UENA 1RJLA 4UB0L 3K1KC 3QEHA 1FZOA 5ISZA 5C08D 3B9KC 2X44D 3LQMA 1G6RB 3IFLL 2ARWA 4C54A 5FM4A 3GIZH 1Z2KA 4PJGE 1BD2A 3N1GC 2DQCL 1T66C 5I8CB 1GIGL 5E8DH 4UU9A 5EU6D 5F7EH 4EN3C 3O2VL 1KN4L 5E2UH 4LF3A 3DXAB 1AFVL 4CMMB 2FECI 1JVKA 3U0WL 4G80A 5IWLC 1BWMA 3ECBA 4LVOC 5CMAA 2VLJE 3T4AA 2RGSA 12E8H 3OB0K 4PJFA 3QQNA 4LRNH 1U93A 1A4KB 1MHHB 3VFMB 3WFEH 3S5LA 1VPOH 3WUWG 2A6IA 5ALCL 1VENA 2NY2D 3U0PA 5F88B 2A74A 4H1LB 5K9JL 2KL6A 4UMGA 2AKRA 3MMEB 5EG6C 3DURB 4E41B 5C0EA 5AZEH 4KC3B 4M4RA 3MGOB 3S34L 3ZE1F 3BRGC 2D4FA 4IMLB 1A4KA 3TYGH 2YKLL 4PRPB 3S3JA 4LHUB 1EO5A 1IGFL 5I1JL 4MS8C 3UTSE 4YDKL 3QG6B 3MRGB 1U58B 5T3XD 1CGYA 2OP4H 4H20H 1I3RA 2D7TH 3EIFA 4MLSA 4XVJH 1ZHBA 4Z7QE 1NLBL 1V8HA 5D7SH 4JRYD 2WUBL 3HS0A 4JO2L 1I7UA 1FG2A 3ZL4L 1DN0A 4AEEA 1QSEE 4F9PA 1MIEH 2HKFL 1WZ1L 4XC3H 3PP3K 2XTJB 3H9ZA 1KC5H 1MWAB 5B3JE 2H32A 4ODUB 4XI5C 2WIMA 4Y19A 3HZVB 2W65A 3FRPG 5E2VH 3BGAA 3RGVC 1R5IA 4PGEA 1I7TB 4PJBF 1E27B 2H32B 2VLME 2B1HL 1S7QA 3NCBB 2FX8L 4LFHG 3DHJA 5FYKU 1PG7L 2ADFH 4OIIL 1FGNH 5IB2A 3GMOB 1SYVB 1UWXH 4WWKB 4BA8A 4Y2DB 1CR9H 3QUYD 4WI4A 1CS6A 2QV2A 4GH7B 3DYOA 1TVHB 1YNKH 3H9YA 3E8UL 1DEEB 2JE8A 4KROB 4KZDL 3HE6A 1B9ZA 3MUGB 1RURL 1J18A 5L2KA 4R96A 3ROOA 2OMBA 5FF6B 2X5PA 3U7AA 5IVNA 1OAYH 4NZDA 4BQ9A 2AJXH 3FQRB 2CKNA 1X3DA 1MJ8L 5CWSB 4XB7A 4KJPC 3W9EA 4Q9RH 2W0KA 1VFUA 1DFBL 3TBSB 1UZ6E 4EVNB 2R56H 3MGAA 4KKCD 4OZ4A 1EHLL 3V8CA 4Z7OF 5FOBB 4HIXL 4JY4A 1HCFX 1TJGL 2BY2A 1UXSA 3GGWA 5I66B 1I3VA 2W9LA 1LMKA 4YGAB 5F6HJ 4N0CD 1VESA 2MFNA 2HKFH 2P46B 5DD6B 4FG6C 1MHEB 1QEWA 4NKIL 1SBSH 1JGDB 2PXYD 4RRPA 4WCYH 1MWAL 5HJ3A 3VFOB 1Q38A 2OJZH 3NMEA 3KYMB 2DI8A 2EH8H 5E08H 2FHBA 2DKUA 3EOTH 3WUZA 1J0ZA 1T2JA 2ZPKH 4AIZB 2YRPA 1IQWH 2Q8BH 4P9HL 1X5ZA 4JG0H 3S35H 5I71B 1BVKB 5CBAA 3NACL 4FNLL 4JPWL 4KMTH 1NUFA 3HNVL 1KFAH 5JHDE 3DVNB 1NANI 2W91A 4I0PB 2F54D 3T04D 4YC2C 5I30L 1J9CT 4ODTL 4JJ5B 3VFSA 1S5HA 2F53E 5K9KB 3OJVC 5FYLL 1C1EH 2DWDA 4OGZA 2PO6B 5E24E 1BFSA 2Z8WC 5GGQH 2IAMC 1PW3A 3QIBD 1AR1D 1B0GB 2NY7L 3HI6H 1MQ8A 1QFOA 4BZ1H 4N90E 3ULUC 4ZS7H 3QEUA 3WLBA 3BP6A 3IJHB 5B39B 8FABB 3LKNA 3M45A 3QQ3A 4PJ7F 4K3DL 3VGAC 3WIHA 5F3BB 1U92A 1OF2B 1YC8A 5C09A 2R1WA 5IMMA 3RRQA 3H9SA 2P48B 2NXYC 4YHIB 1PBYA 2PW1B 1JNLH 4J23A 1KGCE 3MNVB 3VJ6B 3C5SA 3CFEA 3VMOA 4HC1A 3LEXA 2Y06L 1T1YB 2CLVB 2QQKL 5DJYA 4WHYH 2A6JA 1EDQA 5KS9E 2RCSL 4K9EL 1S8DB 4OV6F 4ZUSA 1NFDF 2VN7A 4BSVA 1N2RA 4MS8D 3JWNC 3HMXA 3IAGC 2F5AL 1N5YH 4OKVB 3MTRA 1A22B 2GHWB 3H2WA 4RMVA 1KBGL 4OZFB 1MFEH 1NANH 1XGYH 5IHZA 1RI8A 1KB5B 4DOHB 3OKEB 4U7SA 5EOQH 1DANT 1S7XB 5JLZA 1EO7A 1KFAL 4ODBD 4W4OA 4LBEA 5DZNA 1TQBC 1IGYB 4XZUB 2VXUH 5T33H 3B83A 5I30H 2SEBB 5I17A 1N5YL 4PTUB 3GSQB 1LO2H 2PW2A 5DJ8B 3DV4B 2IMNA 2YUVA 4AQ1B 4QOKE 5FV1L 4JN1H 5L2JA 3FO1B 3GRWH 4EIGB 5LXGH 1NCCH 5CJ8A 2FO4A 3QYCA 4UT6L 3NCYS 2I9LA 3QH3B 2P44B 1DQJB 2VXUL 1BZ9B 4E5XB 4JFYB 4MB3A 5EH1A 4YXKL 1H5BA 1Z9OA 3V7AE 5LGKA 5FUOH 2WINA 3BUTA 1TQBB 3HCVB 5HPOA 1QRNA 3WFBL 2I9LB 4LCWB 1LEGA 2EDJA 2VZOA 3QNXA 4NN5B 3D9AH 4APQB 5BZDA 3GMNB 4J4PC 5TH2A 4WU7A 1E6JL 1DBBH 2BK8A 4MAYA 3EFFB 2RQ8A 1X5IA 5KVDH 2ZPKL 4JREC 5FHAH 4YH6A 1U8PB 4OD3L 3X12B 3BKMH 1CZ8L 3KPRA 1T2QH 3D2UD 3B2UC 4XPFH 5FHBL 3L3HB 2D9CA 5FYKE 5JIIA 1ZT4B 2C3VA 2IBZX 2N4IA 3KPQA 4GAYA 2DYPA 1P4LB 2A6KB 2VTFA 1FG9C 3GNMH 5AAWA 2I27N 1I8MB 4OZHF 3CFCL 1C12A 4HJ0D 1Q94A 3QO1A 4TSAH 1D6EA 4FQQB 4Z18A 3KS0J 3BGMB 4MJ2A 1A5FL 4NFBA 1FYTA 1S5IH 4HW6A 3T3ME 2E7MA 3U4AA 1JMZA 3MV9D 4J6RH 1TITA 5DYOB 5GGUB 2YEZA 4L3EB 5EU7E 1IKFH 1AKJA 3T0XA 4P9MH 4BELD 1IE5A 1UCBH 2QQQA 3KNBB 1JF5A 5F9JB 2HG5B 1A7QH 5BXFB 1ADQH 3DUHA 4NNYB 5I1LB 4Q97A 4QNPF 2R69L 4U6XA 3NTCL 2ENSA 4JKWA 4DVRH 5GPRA 3D9AL 4Y16A 4O5LH 3CC5B 1JWSB 2VXTL 1UZ8A 4JGMA 2NY3D 1UM4H 3WSQL 2ED9A 1YDPB 1AHWA 3PXHA 1FZKB 4B7LA 3FJTA 1RMFH 1KJ2H 1ETZB 3U7YH 2HA1A 3MV8D 3ZMRA 2XZAH 5I18L 5GGSA 4HZAA 4LU5L 3GHBL 1GGIH 2BERA 4HJJL 1P9MA 2XOTA 4PJFB 1XF3A 4J12A 5CP7B 1AC6A 1IZJA 3HE7A 4TSAL 3EJJX 2BVTA 2D7OA 3HHRB 1E4XH 3RNKB 1D9KD 3KR3H 4NRYB 4TVPE 4PGZA 5FYKD 2JJTC 3T77B 1TENA 3JV4B 1T66D 3NPSC 4UINH 5ERWB 3MRLB 1B4JH 3SGKC 2AABL 4JG0L 3U1SL 3C9NB 3V0VA 3I02B 5KVFH 5LBSL 1G7MA 4ZO9A 5I9QC 1HKLL 2Z31B 5GJTH 5T5NF 2FL5B 4RRPG 2OI9B 1QLRB 4CW1A 4K7FA 4KHXH 1WEJH 1KCVL 1WV7T 1OSZA 2XKSA 5I71C 4MXWH 1G6VK 43C9B 4Y88A 1PG7W 4FXGA 3V8OA 4L8SC 4WHYG 1QSED 4MAUH 3DX7A 5EOCL 3QXVA 4GJTB 1FYTB 3L5XH 5BV7C 4WWKD 2JCCB 5GS0H 4TRPH 1P53A 5KSAC 5DURD 2ADJA 5L2KB 1I85A 1RAMA 3GSUA 3EZJB 4JKPH 4XHQA 4JR9H 2EKJA 5JOPE 1KJ3H 1JK8A 3G9AB 1LO2L 4JFDA 3G6JF 3BJ91 3P0YH 4LQ1A 2HN7B 1F02I 3V4VL 3SDAC 1FL5A 2NX5B 3O9WC 4R7NB 4PLJD 3SE8L 2GT9A 4NQCD 1FP5A 2NY0B 4NO5B 1CK0L 3CFDB 2XWBB 3PQYE 1FSKC 5EWIL 5D2LB 2A73B 2BNRB 1OAKH 1U3HA 5F89A 5GGVH 5I0DA 5I1EL 2OLDA 3G08A 5JXEC 2OTUA 5IB5A 5JQ6L 4MJ4A 1J0YA 1MOEA 2FX7H 5JNYB 4R4BA 4X6FB 5D4QA 4C59B 3U83A 1S9XB 1OAQL 4LGRB 3IS0X 5FK9A 2V2TA 1KN2H 3HS0B 1MF2L 1KXTB 5DQDL 1DN2A 5JW5A 4AIZA 4N8VA 4G8FA 2CKBB 1UJTA 4YWGL 4GRWE 3PG2A 4F7TB 2VLRA 1VACB 4ODHL 5HHXL 4OKDA 4GRWF 2GJ6B 1JYWA 4PRAB 1A1OA 1MNUL 4FQPA 1J7VR 4M5ZL 5ADPH 1JF6A 4OZFA 2DMKA 1CD0A 1MCNA 4D9LL 1CYGA 1BQHB 3D2UA 1HE7A 1QRKA 1SM3L 3MA9L 4F57H 1S7TA 5J1AA 3G5YA 1W72A 4OUOA 5KANI 1EFQA 1JHKL 5C0AD 1FFOA 5CUSH 3SKNB 1N4XL 3KYNB 3VXUE 4Y19D 5HHQB 5EN2A 4S11A 5CJQH 3GMQA 5FECB 4OLWH 4X9FA 4WO4D 3FQRA 5HYEA 4YHKH 3BW9B 1IL1A 3ZE2E 2QL1A 4PRNA 5HVHB 3PABA 1CQKA 5FIEA 3VJ6A 4QRRE 3RKPA 2UZYB 2H32H 4UV4H 1RFDH 5J12B 1HHHB 1U91B 2B4CC 5C6TH 1NGWB 4YO0B 5B3NA 2K9UA 3F5WA 2GITB 2HH0L 3C2AL 5BXFA 4PJ8B 4NQEA 3VXOA 4KAQL 1G9NC 1MCSA 3MROB 1DSFL 1IAII 5JIKA 3L5WB 3V7MA 3ZHKA 4XCNA 1VFMA 4GS7B 3AUVA 4CMHC 1OAQH 1X5GA 3WFHA 4M6OH 1EH9A 1SVZA 5GZOC 4LRIC 4HCRA 5F1NA 4K71C 4OIBA 4OUUA 1YMMD 1P7QA 2CRIA 4HXAL 4MA1C 3VWKD 4YR6B 1DUYB 4KPHL 1AY1L 5ESAB 4AY0A 1DJSA 4TNWK 4BH7A 5IBUG 3GRWA 1RZ8A 1LDSA 2BMKB 4PRDA 5CBAB 1OOAA 3EO1A 1U8HB 3G5XB 1XR8B 3PHOA 4P5KA 3F6LA 1QVOB 4RISL 5FA4B 3O6ML 4IHOB 4KJPD 3ALPA 5C08A 4KKLD 3IETA 1U58A 3I9GH 2JB5H 4NJ9H 5EC2A 1OAKL 1JI1A 4G6FD 1C5DB 2X4SB 5C2BL 4YHNB 3DUSA 4KTYA 3MXWH 3P30L 1IC5H 3EDJA 4MCZB 4TUOB 4PG9B 2CKBL 1BGXL 2EDXA 4EUPG 4XTRC 1LEGB 1ZLSH 4N9OB 3TT3L 1T4KB 1SJXA 2J3SA 1TXKA 2AAVA 2FX9L 2PTTA 3KJ6H 1U0QA 2IH1B 3QHTC 3RHWK 3O3BB 5E99H 1WICA 3ES6A 4JFOB 1I8KB 2AGJL 3BIAX 5GS0C 4RBPK 1OAUH 4MJID 5TGBB 5DJZB 1MAML 4WU5B 2IQ9H 2IMMA 4C4KO 4F7PB 5B38A 3EJYD 4KK9D 4JZJB 1GAFL 5C0JA 1ZOXA 1S9WB 1KN4H 3ULVE 4MNQE 4J3VA 1FL3B 1TFHA 3OR7B 1W0WB 4XPGL 1QBMH 4S0SD 4NN6B 4R97B 5JW5B 1MVFA 3SY0A 1PYWB 5HD8D 5F9WB 5GQBA 4J7RA 3SKOA 5C86A 3FFDA 2DI9A 4K3JL 3QFDA 4QXGH 1OTUD 3FOLB 5FDWA 5GGVY 4DUVA 5JHDA 3QWQB 1ADQA 1MRFH 4GSDL 1YZZA 3O6MH 4PLOB 3JVGA 2D7PA 3H42L 1FAIH 5I1CH 4D9RE 5IB3B 3UJJL 3NFSL 4HX1B 3RWGB 4CVZB 1NAMH 3S37L 4F3FB 1AGDB 3TJEH 4RGOL 2XTJE 4GAYB 1TZIB 2BNQD 3GIZL 2IPTL 2XYCA 2ATPA 4KRPB 4LSSH 5DJ0A 1DE4A 1PQZB 5HI3C 3VXMB 3P0YL 1EIBA 1RSFA 2CLZA 3VFUB 4G6KH 5ESVA 4XBGA 1VKXB 4EQ2A 1KTKE 1IT9H 3TVMC 1X5AA 3GBNH 1LHZA 3Q48A 3CMOH 3ARSA 3JTSB 4MA3A 2AI0H 1KJVB 3DI3B 5DHVA 4AT6B 2MJWA 3HC0A 1CU4L 1NC4B 4C55A 1MFAL 1W0YT 4H8WC 3GJFH 3QI9A 3O41A 4Y0GA 5GGRY 5GSRA 1G6RL 3RZCA 2BVQA 4ZPVB 2CGRH 3B9VA 4HLJA 1H3XA 1YEEH 5AD0B 2DLHA 2WBWB 2FO4B 5INCA 1ZTXH 3ILPB 1MCWW 3P4MA 2XY1A 3CJJA 1J1XL 2V17H 3T4AB 4AQOA 2BVEA 1NAMA 4YHLH 3UO1L 5KSBE 4ZQKA 1RHHB 4LDEB 3EYQC 3IDIB 1RIHL 2Y07L 3OV6A 3PL6A 4AEIH 3OQ3B 1QZ1A 4IHOA 3E6HA 3ME0A 2ZCHH 3VXUD 5HI3D 1DBML 2F53D 4DW2L 2XKNB 3GIVA 4CDGC 2C3XA 4ELMB 4MNGA 3QNZA 3D48R 4PD4K 5FUZL 2YEZB 4YHYC 1YNLH 5I75B 3C8KB 1FFQA 3MA9H 3MFGB 4F57L 5I15L 3MACH 5D6CA 5C0GA 2UUDH 2IPUK 1DDHB 3K8MA 4CGTA 1DBJL 1IGIL 3V6FA 4JZJC 1YYMH 3LIZL 4IM8A 1V05A 3TO4D 3FFCB 3STLA 1BJ1H 2XPGA 3VGEA 4ZXBA 3RZWA 3RGVD 2NPLX 2Q3ZA 3BISA 3BGMA 4Y8DC 4LKCA 4BFIB 5HVWA 2HT2D 4QOKD 4Y16B 3BQUA 3CX5J 3EAKA 4NKIH 1CDYA 3MOBH 4K94L 3KYKH 3T2QA 3QHFH 2DRUA 3C6SA 2X41A 2Z0BA 5DRXA 4BZYA 3CX5K 2G5BB 4KRLB 1NEZB 2R1WB 5IMMB 1OP3H 3UMTA 1IGMH 1R3HB 3WIHL 4NZRH 3OGCA 5HXMA 3HC4H 5E2WL 2W9EL 3MLZH 2OP4L 4UNVA 1MRCL 1FAIL 2BSSA 3HNVH 4CKVX 2EDHA 1E27A 1WBZA 4ISVB 3DRTB 4P5TC 3I6GA 1J1XH 2V17L 3B5GA 3C60D 5EN2B 4LVEA 5C07A 3V0WH 1Z6JT 4L5FH 1F58H 4ZD3L 1QSVA 3C60C 1RHFA 3EZ8A 3TA3A 4DFIA 1BREA 3Q1SH 1MRDL 2WINB 1SMOA 5ESQA 3WN5B 2V7NA 2CRYA 2BCKB 3R4DA 1CXIA 3ARGA 2PCPA 4OCRH 2IAND 5AZ2H 3HN3A 3I02A 4GUPB 1MCPH 1CIUA 3P11H 3U9UA 3OKLA 1CWVA 4ZUWA 5HDOA 4MLIA 3PE9A 3BE1L 3QDGE 2NY3C 4ZYKB 5JOEA 1UWXK 1E4XI 5I6XC 5FO7A 3MV7B 1NJ9B 3NCCB 1C5DA 3VRLF 1MFCH 1RUML 1UM6L 3TBYB 4TULL 2BY3A 3LV3A 1YYML 1IGFH 5I1JH 4ZYKA 2HAZA 1UWEL 3Q2CA 3UYOD 4KTEL 4XVTH 4OZHE 1S7UA 3VD4A 4GUPA 1OW0C 4I77H 1GL4B 3GB7A 4WUKH 3PGFL 4R4FH 4NO2A 2IPKA 2DS4A 4F15B 3PP4L 3ZDZF 4EI5A 1QACA 3IXAA 3QZWB 3UYRL 1NC2B 4RMRA 5A2KH 3NZ8A 4O2CB 4K3EL 4X4XA 4X5XB 4Z95H 3WS3B 5I76A 4XVTL 2HRPL 12E8L 1FVDB 2HTLC 4QWWC 4B5EA 1X5KA 4X5WA 2X4PA 4RBPH 2R8SL 1IFHH 4JDVA 4P5MB 3BN9C 4M7LL 1EUTA 1E4WL 5FKAB 4P3DA 4F7CB 2GT9B 1AE6H 1S3KH 1AQDA 1UYWH 3MROA 4FFVD 1I3GH 1QBML 5JPNA 2VJXA 1KPRB 1JBJA 1BOYA 4NO3A 4UU9B 3O0RH 2EYTA 1JNNH 3KS0H 4X6EA 3SE9H 1PEZA 1P5UA 2M8XA 4Z7UB 5CGTA 1FFRA 3QXDB 5I8CA 5FGBC 4NWTL 4ZTPL 3KPOA 4BK4A 4GO6B 1IL1B 5D9SA 5J11C 3WS6A 3W0WE 1GGYA 1VGEL 4EDXA 1OTSC 4KVCH 5I1HL 2VZ3A 4K9EH 2PYEA 1MFCL 2VXQL 3D85B 2E6JA 1FRGH 4L1DA 1U3HD 2DLFH 4CN1A 4HKZB 5HVHC 3ZDYF 3OAUH 4Z6AT 4J3SA 1Q72H 3EYQD 2PW1A 4GRLB 4F9LA 3V6OC 3KPSB 1R24A 4HK0A 2BXYA 2XG5A 1FORL 3BZEA 4U1GC 4XP1L 3MLUL 2ICWI 3N9GH 1HILB 4UB0H 4Q6YA 3CAFA 4R2GB 5DTFA 3GJEB 3RNKA 4UIMA 1NCDH 4X6BA 3QG6A 2VO5A 3HE7B 3QIWB 3BGFC 3BW9A 4QTHB 1FNFA 3GMQB 5FECA 5F7LB 4NPYA 5LGJA 1K4CB 1JNJA 1HYRC 2XZQL 3OL2A 5K9OB 3LMJH 4IOIA 1I1CA 1FHGA 3T0EE 1I9JH 2BFVL 3IDYB 3BPNC 2ICEA 4EI6B 1OD9A 3M07A 3TCLA 1J05A 3PL6D 1MIEL 5H2BB 2ATKA 4KXZI 1NQBA 4ZFFB 3AS0A 3QHFL 4PD4J 4PB9L 3X3GH 3LD8C 4U4BA 5E6ID 5L2JB 3CU7A 3ULUF 5EUKA 5IF0B 2NY1C 5TE7L 5KTEH 4YBQD 3KPSE 2OXHA 1J11A 2D03H 3WJJA 4QXUH 4QRUA 3DXAA 5T1KA 1EHXA 3N1QC 4WNQB 3I3BA 4OCMC 1BPVA 1K85A 4NQDD 3QCUL 1N5AB 3LS5L 3QT2A 3QEHB 2F54E 3ZHLA 2AJ3B 1NDMA 1T20B 4DZ8B 1NLBH 3TH2T 4GW1B 4LEOB 4UDTB 3ARED 5CJOL 2JJTA 1XIWB 3JBG7 2BNRA 1D5ZA 3L3JA 3VWKB 2Z91B 2IFGA 1MJ8H 5F72S 2AEWA 4U1SB 5MHSD 4OT1H 5J9PA 1IARB 3RY4A 1QYGL 2XTLA 1ES0B 1I1AB 1CFTB 1W8OA 2WP3T 3DX9A 4PJAB 5GRVL 1RQ5A 3FO2B 3P77B 4TSCH 2H6PA 5TDNA 5BV7B 5MI0C 1HHKA 2C3VB 2ESVB 2GY5A 1IEAA 3C8HA 4Z7WB 32C2A 1IMHC 1AO7D 3MLVL 2C3WA 4HS3A 3PDOA 4LKXB 2Z92A 1XGYL 3T0AA 1CI5A 5IT2L 1I1AA 4P5TA 4MA8L 1VB9A 3P9LA 1B0RB 3BDYH 2C4FU 5T3XL 3MJ6A 1D7FA 2W0FB 2VR4A 4K8RH 5TPWH 3BD5A 3RI5F 5L6YL 3B9AA 2C5DC 4F7PA 4M7JL 4HGWB 1OCWL 4YDIL 1OGAE 3FFCE 4BFGA 1AXTL 4N8CH 1UM5L 3OBAA 3GK8L 4Y19B 4C57C 5CGYC 4DQOH 1X4ZA 4HJ0C 3AMKA 4YQXH 4LSVH 2QSCL 3QDGA 4YFLI 3MBEB 4OTXH 3BD3A 4Q0XL 3QQ4B 3VDBA 3OZ9H 4KKBD 3CC5A 3HA0A 4KKBC 1JZ2A 1N26A 3BKYH 4AEHH 1OP5K 3ARPA 4FG6D 1VFAA 4Q6IC 4AEFA 1A0QH 3MRGA 4NKQB 2CUHA 1G1CA 6FABL 1AD0A 2A1WH 3HR5B 5EU3B 4P4KC 4N5UA 1RUQL 3ISWA 4R7DA 3O3AB 1S7XA 1ZKAA 4QHLA 2YPKA 2FX8H 1JUFB 3BJLA 3GM8A 4YK4B 1QSFB 1XGPA 2Q76A 2UZXB 1LQSR 1F00I 3MREB 3C09B 4WFFD 2X05A 2VDPL 2W1NA 4WHCA 5IB1B 3FHAA 3O9WA 1CFNB 1XGQA 5I16A 4YNYB 4HKJA 4OUUB 2A77H 3D18B 1A1MA 3BT2L 5J7CC 3X11A 4YDJB 4OGXL 3I6KA 4QNPE 3HI1A 3JWDC 4Y5VC 3T0ED 2O26U 2WUBH 3RDTB 4XNZB 3D0LB 5IFJA 1ND0A 3U2SA 3LHPH 1HHJB 2IADA 3CLEL 3C5JB 4M3JA 4O2FB 1TVHA 3CFBA 3ARBC 5JTWA 4HT1H 3O11A 1GSMA 1VDGA 1A3QA 3G9VA 4NHCL 4RMWA 3QIUB 1MNUH 4N9GA 2IWGA 1PKQA 2Z35B 5KVDL 5KAQG 1U6AH 4NC2B 4HAFA 1GXEA 3VI4F 2GK0B 1OY3B 1F5WA 2I60L 1ORSB 1U8NA 3BAEH 3DGGA 1UXWA 1C5BH 2CK2A 3G5VA 1FGNL 3RWHB 3WS3A 2IG2L 3VDCA 3L5HA 2EEAA 4EOWH 1QSEB 4XC1H 1PVHA 1KCVH 4IMKA 4E5XA 1AGCA 4GG6F 1N8ZA 6CGTA 3LZFH 4ZUVB 3QFJA 4XXDA 3DROB 2RCSH 4NN5C 3DARA 3S97C 3ARXA 5FM5O 2DLGA 1AIFA 2J88H 5IBLC 2K7QA 3ZL4H 3S9DB 1V7ML 1FL3A 3IGAA 1TQCB 2E6QA 2EKSB 3R8QA 4XC3L 5JPMA 2FYYB 3FCTB 4IMLA 2YMXH 3LQAC 2ZOKA 1QR1B 5BW7C 5I1AB 2QSCH 5H37H 4QXTB 3CK0H 4R8WH 1BWWA 1J8HE 3C5ZC 4D9LH 5KVEL 3DX6B 1SEBB 2YBRA 1J0JA 4LLUA 5L0QC 4WHTA 1YNTA 2VLRD 5H94A 1F4WH 4OZFG 4HDIA 1KB5H 1G9MH 3LN4B 3S88L 3MRHA 2PUQT 1WBZB 4P2RB 3E8UH 1NGXB 4HIHA 3S35L 2M1KA 5C0BD 3UTSD 1OAZH 5DTFB 3UP1A 3U7YL 2X1QA 2ADGA 1H3TA 4JPWH 4LBEB 4TPRL 4JDTL 1FIEA 5HGDB 1PQZA 3VFPB 4PGBB 2C3HA 1FNGB 2ZCLH 1NBVL 2NYYC 5LG1A 1P7KA 4WI9A 4GG6A 3EYOA 3T0BA 5MI0B 4MXQD 5DLMH 2VITA 3BSZH 5EFIB 3VA2C 5FYJL 2EDLA 1URLA 4NM4H 4ZUSB 2NQCA 5J3HC 4GKSA 4HC1L 3I6GB 2DWEA 3DGGB 3PV7A 3SDCC 1N7ML 3O3EB 2G9HA 1CE1L 3SDCD 1YEHH 1ROWA 5IVXE 4UI2A 4CW1B 3TIEA 3SDXE 1XEDA 4JN1L 1PZ5B 3QO0A 3UCRA 1MJJA 2GTZA 1Z9LA 6FABH 4UT6H 4LCIH 5HHMD 4ZFZA 4HAGA 5IVOA 3T8XA 4ZFGH 2BNQE 1P4IH 4PP2B 1YMMA 2AQ3A 2OR9L 1A9BB 2KDGA 4JFZL 3ULVC 4TUKH 1NMBL 2EIBA 4TYUA 3HLAB 2XWTB 2X4PB 3JWDL 4HIEB 5T1LD 1D6VH 2ZP0T 1BVZA 4Y5VA 5SWSA 4TUJA 3B3IB 2NY4C 5ID0A 2FJGA 1MFEL 3GBML 3GK8H 5HDBF 3WD5L 4HFUL 3RZCB 2PETA 4PJEB 3C8KA 4FABH 4PBVC 2PXYA 4JPKH 4P59L 4U3CA 4FTVD 2J5LC 3V9FA 3JTTA 3BYYA 5ID0B 5JMRA 5DUMH 1Q9WA 3WXVL 3WJLC 2J2ZA 3EYSH 1TCRA 1KXQE 1U93B 4XPAH 3CZFA 3BPNB 1MJ7H 3T08A 3U46A 3BPOC 3O9WD 2FSEA 1Q9KA 1CLYL 5MP6H 2ZUVA 1B88A 2EDKA 3QUXD 1N64L 1UT9A 3BGFB 2OX5A 2X1OA 4Z9KB 5BS0E 3MLYH 4I3RH 3QUMB 5DK3A 1MEXH 4MJIE 2X40A 4XP6L 2V2TB 3MRMA 5DUPL 3DETD 3BAEL 4JE4B 5DD1H 3MBEA 4GRLA 3FT3A 1KB5L 3S88H 5MEOB 1T22A 1G7PA 4ONGL 1OTUC 3SE8H 3V0AC 5EO9B 1G0DA 3BPLB 4D8PB 1U3HB 3QPQD 2IPUG 2DJSA 2XT1B 2W65B 5LGHH 4G9FB 3LKOB 1JPST 3BT2H 3TIDA 2XWBA 3VD7A 3H9SD 1MWAA 2NXYD 4PJCE 1JGEA 4MGXA 4HBCL 3Q5TA 1Y0LA 2BNQB 4JVWA 4O51A 5CS7A 4KJQC 1BQLH 5J11B 2MCPH 1AO7A 4YXLH 3QDHA 4TQEH 3L7EA 3HG1E 2FATH 2E8ZA 3UAJD 4ZFOA 3BQUD 5DRXB 3D0VA 5FA3B 2VLJB 3MJGX 3LEVH 4JHBA 3FZUD 4JPVL 2X4TB 2HJKB 1OPGH 4UT7H 3I50H 5TQ2H 3QXAB 5C71A 1EX0A 1CXLA 4GAJH 3DX8B 4MQXD 1BQLL 2K3TA 4U1KA 1U8JB 5BRZD 2BY1A 2OTPA 2PYED 4HG4K 5IB3A 4TTGA 4JO3H 5KJRL 4P4KA 2F58L 5C8JB 1F11B 4XC1L 3HZVA 1XGQB 5I16B 3UTQA 3B9KD 1DANU 1OSZB 2A9NH 3ZT6A 1FZJB 1VEOA 3OJ2C 2EH7L 2VB5A 1NC2D 3BHBA 1P4IL 2J12B 4K94H 1F8TL 1KXVC 3WIIL 4ZDHB 1WCQA 5KVFL 1MELA 1UACL 2XG4A 3WL9A 1TJIL 3QEQE 3MLTB 3FO1A 1QR4A 4JCLA 3GEWB 4GMTL 4GRWH 5JQ6H 2EKSA 2AEPH 2GSGA 2FSEB 3MV7A 1HH9A 1QFWH 3CFJA 5BCAA 1CDHA 1MHEA 1KCUL 2NY6D 3IJYB 4WI5A 5B3JF 3PHOB 2B1AH 1MFDL 4ZDHA 4TRPL 5IHZB 4L29A 4Z78A 4XPGH 3QP3A 3MCG1 5EORL 1FNHA 2DBJA 4X8XA 1EHAA 1P1ZA 1B2WL 3HE6C 4Z0XB 4GAGH 2Q6WA 2GAZB 2JB5L 2MQ3A 4OCSH 3I75A 4WEMB 3B3IA 4Z76A 4W6WB 1JYVA 3NVQA 5I1KL 3HE7C 4PG9A 2DBLL 4J3OC 4XMLH 4TNVK 3GUTB 5HGGS 4HWBH 5KZCD 3MA7B 3ESUF 1NFDE 3MLYL 1MI5E 2R0WH 4YHNA 3B9KB 4HBQA 1FJ1A 3HG1B 4PJBB 5DJDA 3BH8B 5D7LE 3HI5H 4P5TB 1OWWA 1PEWA 3QIUA 5CZVL 5HYJE 4MXVF 2CDFB 4TUKL 5DSCA 1C7TA 5D8JL 1XR8A 5GS1C 2WMPA 2R0KL 5TDNB 4EI5C 5D5MB 4JFPB 5H37G 5JA8B 2I25N 3QUYB 4M6MH 4GQ9L 5DGQA 3AROA 1RMFL 3BQUB 1WLHA 3WIIH 3OKKB 3V6OA 3QWRD 3G6DH 3RWDB 3UJTH 1T1ZB 3T3PF 5I6XB 1ZT7B 2W9DH 2FEEI 4RGNC 3VH8B 1KTLA 4LQFL 4TVPL 1ZVHA 4OLUH 4ZS6D 4JJ5A 4G6AD 5E95B 1WSST 2R29L 3FOLA 4G9FD 3VRJA 2DYPB 4N9GB 4X4YA 3W11D 1QSFA 1XGPB 2Q76B 3QUKB 3SGKA 2DTMH 3CDFA 4Z7OE 1GJIA 2G5RA 3BEWB 3AM8C 4PRHD 4WO4B 2WZPD 1HXMB 4D9QD 5HYFA 3RWEB 2ITCA 1ZA3B 3CCHA 1I9IL 2ADGB 3QRFM 1LK2A 3TV3H 3WNLA 3CMGA 2VLRB 4DAGL 5FYLE 3TZVD 4NUGH 4OQ1A 2C3GA 4QYOA 1YEIL 1AP2A 2EZ0D 5EIQA 1FNEB 3R06B 4S1SL 3MRIA 3QNYA 5D70L 5DRNB 5EDXA 3ZDXF 4HD9A 3AM8A 1D6VL 5JDSA 5DRWB 4NZRL 3H0TB 4PJAF 5HTSA 2IJ0C 3D3VE 3QPQC 1A7OL 5JA9A 3WO4C 4J8RB 4MMXC 5FOBA 2VRAA 3HRZA 1INEH 3EO9H 1QFWI 4PGCA 2UVEA 4OZIE 1DQJA 3RVXC 1ZLUH 1D9KC 1BQHG 3CUPA 3MXWL 4JO4H 1Q72L 3OXSB 1MLBB 3WHXB 5DRWA 3T65A 4MD4A 1NBZA 3QNYB 1VHPA 2LV4A 5DRNA 3X3FH 1Q9LB 2P1YA 2H8PB 1R3IH 3QUZC 5EZLB 2CMRL 1T7YA 1R3KA 1NBYA 3IKCB 5IIEB 1RUPH 1XH3B 2APXA 2YRZA 4P49A 1FGVH 4XZUA 4Z8FL 3WNMA 5IB4A 3GSWA 2BNUB 2AJUH 5FA4A 4Z7WA 4UQ2B 1HEZA 3MRDA 3O2DL 1TJHL 43CAA 5IMLB 3MOBL 4PY7B 4NQTA 1HHKB 1AY1H 5GSVA 5HD8C 3VXMD 3ULVF 1AKJB 4MJ6B 1CFSB 3REVA 2FWOA 1XAUA 2BCKA 4FQ1L 4QT5A 4GRWB 1FO0A 3P9MA 4OLWL 4WI6A 1T5WB 5AUMB 3O6FA 2K7PA 4JQIH 4DUXA 2UZIL 3ELAT 2Y7QA 3S7GA 1T1ZA 5I1DA 1AR1C 4S1DD 2GK0A 5IEHB 4HCRL 3UPAA 2MMXA 2MHAB 1BQUA 2Y36H 1BFOA 3KPPA 5F96L 4OCWL 4P57B 1P4BH 4I48B 4ELME 2MCPL 1WFNA 4KZEH 4PRHE 1ZVSA 4KRMB 3IT8D 3MRMB 4M62H 2EDDA 3TN0D 2Y5TB 3LS4H 4PJDE 1ONQA 3KLSA 4QCIB 2Y9RT 4Y16C 4XP1H 1A3RH 5F9WC 3QULB 4IRJB 2P42B 4JN2B 2Y36L 4PP1D 2H2SC 3FTGB 3QCUH 4GKZB 4FFVC 2EDEA 3ARVA 3HPJA 5C07D 1OT1A 5CSGA 4J4PA 4PP1C 4KY1L 2AXHA 1MAMH 3TZVA 4PYHA 1IGCH 1N6UA 4PRPA 4LMQI 1Z5LB 2VDNL 3LN4A 3IJSA 4XAWH 3QUZB 3U7WH 3NOIA 3MPCA 1XF1A 3QJHB 4KMLB 3O3BA 2YN3A 1EV2E 2JB6B 4F8QA 2VISB 5IB1A 4JPIB 4P2QA 3B2VH 1FVEA 4BSWB 4J8RA 4EBQL 2YD2A 2YD8A 3U4BH 3VGFA 2UYLA 5LKNA 3PGFH 1M6OB 4PBWD 4MZ3A 1JYNA 4FXLA 1UZ8B 5A2IH 4AENA 2C1PB 5EULV 4E0RB 2VLKD 2GSGB 4X6BB 1VA9A 3RWCA 3P0VH 4U1HA 1VFAB 1QO3A 4XVJL 1YMHA 4AENB 4NFCA 4JY5L 5E2UL 1NPUA 1MFDH 3KJ6L 1C16A 4G43B 3G6JA 3QCTL 1CGVA 4U6HA 2P8LA 1U3ZA 3BHBB 2PCPB 1LILA 3WUWB 1I85C 5D2LE 1C1EL 3OKOA 3SE9L 1FNSH 2YPLA 3P4OB 1FZKA 4GKNB 4AT6A 4OCYL 3SHSA 4HWZA 4YIQB 3WFEL 4YQXL 4UV7L 1A7RL 5C07B 5ELIA 2H26A 4RDQF 3JXAA 4MA1B 3BZFB 5EFIA 3QDMD 2DQIL 1CGSL 5D93B 4K71B 5EA0H 1QP1A 4TNWF 3L5WA 3LKSB 4XWGH 4YAQB 2X4TA 3TZVC 3MACL 3WLWD 1HINH 4ORGB 4K3JH 1K8DA 1P2CB 4CMHB 1ZT4A 2NW2A 3QUYC 3SJVB 2A0LD 4O2FA 3L6FB 5KG9B 3KWWA 2IADB 4FXKA 5GS1B 4KV5E 1RK0A 3M17B 4BUHA 4WFGE 4JFXA 2JKXA 3NACH 4WWKA 4MA8H 4F7CA 2GQHA 1QFHA 4GQPH 5J12C 3VI3F 4QEGA 2BVYA 1KTDB 4P2RE 2VSCA 5EBMB 3LB6D 4OZIF 3FB8B 4Z5RA 2EEDA 3OX8B 2IANE 2P7TA 1MREL 2BRRH 2DM4A 1XF2B 4JANB 1UZ6F 5C0GB 5DJAB 3UBXI 4WW1A 1FO0B 3P9MB 1T89A 1KEMH 5D9SB 2QADC 4FOMA 1SEBA 2YBRB 2AJZB 2ZZUT 1QLRA 3CLFL 2QADD 2JELH 3BYTA 4Y7MA 1GPOL 4HUMB 1WZLA 3LDBC 4R97C 1PGRB 4NNPL 3WFDL 3GI9L 1ZGLP 1F3DH 4OBRA 1YECL 4O00A 5DVNA 4CL7A 2D9QB 4W6YB 2AV7B 1WK0A 3L3HA 4F2MB 1IC4H 1CT8B 5ICXA 5C0BE 2I5YH 4DGYL 2OQJB 2XQYK 3QI9C 4ZNEE 4ZTOH 3IDIA 3IGAB 4UOW0 4XAWL 1RZKH 1Q9KB 1FCGA 3MV9E 4DVBA 3C8DA 4NNPH 3WFDH 4NQSB 4D0DB 3V4PL 4A6YL 1ZEAH 3BVNB 3QUXA 4HWEL 4WU5A 3W5MA 5F1IA 3VWJD 3QQ4A 1NDGA 5C0IB 3VRLE 3MV8A 1I8KA 5K59F 3QCVH 1T6VN 2OXGA 2A74B 2YUZA 3MJ8A 4QHMB 3JV6A 1LDPL 3BUYA 4S10A 1HN1A 1WF5A 5F89B 3ZTNH 1P4BL 1YPZF 1K4CA 3LZFL 1WIPA 3MBXL 3LEXB 3LKRA 5DJ8A 3VMNA 2JCCF 3IFOA 4BZ1L 2AEQH 4D0CA 3ULUD 2NY0C 3KLAB 5LCVH 4Y5YB 1FGVL 4Z8FH 4RA0C 2HVKB 3H7BB 1AGBA 2Y5TA 2QHRL 1SBSL 1WIUA 2NX5D 3V5DA 2ICES 4PR5A 1IGCL 4QRPD 5L7XL 1NSNL 3TT1H 3X3GL 3EHBD 3C2SA 3V5HB 2X7LB 1KPVA 4BKLB 1IGJA 4X9BA 4BH8B 1X5JA 4XT1C 1NCNA 4WI3A 1CU4H 1KLUA 1F3JA 3I6KB 4G5ZH 4RGNB 1TETH 3RBGA 5IOPA 1UC6A 2WV3A 4MAYC 2DWEB 2Y7QB 4ODSL 5L8JB 4G3YH 3BQUC 4Y1AA 3CU1A 4GKSB 3WFBH 4BJLA 4XWGL 2WW8A 2WK2A 3LPWA 5J57B 2NLJA 2XN9A 2WBJA 1I9JL 4MQXC 4I0PA 4OLXL 1KYOK 3V52H 3BP4B 4X8JA 3GMPB 4XCEB 5K33A 3UPCA 4Y2OA 4DGVH 4QRSA 4NNXA 4PY7A 3LS4L 4LPXA 4KDWA 3JV4A 5ERWA 3UROR 4PRBB 1K8DB 5GHWL 3OJMB 1OTTD 5DWUL 2AVGA 1RIUL 2EE6A 3M8OL 2Q7YB 3ZSSA 3ROLB 4RWYL 4U6TA 5KZCB 1TVDA 3RVWD 3WIFB 5B38B 4PJGF 1U95B 3C6LC 3DOSA 2DIJA 2VDNH 3D18A 3SDDB 1IZKA 5LXGL 3STLB 1FE8H 4XMKH 5BZDB 2ARJQ 3L95A 1N3NA 3VXRE 5EBGA 1MAKA 5SWSD 4BSWA 5IJVA 3WBDA 5FKPA 5F88A 4OJFH 2BNRE 5JUEH 1V7NH 2FCBA 3W0WA 3MV8B 1FV1A 3LKPA 2X4RB 4RMUA 3HUJB 4UTBL 5F1SA 4HWBA 4P2YA 5F7UA 4PB0H 3R06A 3Q6FA 1J1OH 4PJXB 1TETL 2ZUQC 1RZGA 2R69H 5E00B 1AGEA 3F7QA 1Z9SA 1UA6L 3SGEI 3V7AG 2NX5E 4G9DB 2CDGA 3L9RA 2Z31C 1LGVA 4Q7DA 3FO0H 4GRMA 3GSVA 1L7IL 5A43C 3ZLQC 3F7VB 3QDGB 5SX5K 3VRJB 4MD0B 3WSQH 4GG8B 3WN5A 1YPZE 5T5FH 4EKXA 4HFUH 4CNIB 4K2UL 1J0IA 1FSKB 5IB5B 2HT4C 2PYEB 5C0BA 2Y5EA 4HHAB 4P59H 3TBTA 2P7TB 4N1HB 4HGWA 4LVHC 5C7XH 4XNXL 1I3GL 1L7IH 4X9GA 2JJVA 1JNNL 4Y2DD 5GS2D 4S1RL 5DMIL 1NSNH 3TT1L 4LLMA 1S7VB 3IXTB 3MUGA 4LLQA 2Q87A 1UCBL 3PIQA 3LMJL 2V5RA 4MSWB 4P4RB 2E9JA 1B4JL 5DJ0B 3TA3C 3TA3D 4U7KA 3RZCC 3RDTA 4I1NB 4JB9L 3S34H 4YDLB 3UTPD 4LDLB 4NSKB 1CLZL 2GCYB 3U48A 3UJIH 3S4SA 7CGTA 1JNLL 1ZV5A 3LSOB 3OAUL 4MD4B 2RAMA 3MRJB 1CFBA 2XFXA 1RZIB 3U9PL 5T3ZD 1JWMA 3O8XD 2CR6A 3QDJE 1HSBA 5EUOB 4F9LC 1M1SA 3BWAA 4U49A 5H2BA 4JRYB 3WKML 2D03L 3FQUB 4LCWD 3U36B 3ULUL 4OQTA 1X6LA 5DMJB 1JZ3A 5ISZE 3WV0A 2Z31A 1AE6L 1I8LC 3CSPA 1D3CA 3C5ZB 3W0WD 4UDUA 1AXTH 4N8CL 1T04B 5FO9A 1GYAA 4HEPG 4KV5F 4WVRA 1IEBA 1T2XA 4PJCA 3MYJB 1BF2A 1PKQE 3RWFB 3D39E 4L8CB 1IKNA 1NAMB 2ZG1A 2ZUUA 1FVCA 4DN3H 5C0CD 4L9LC 4MWFA 3B4NA 1IGTB 1NBZB 1KCRH 5T1KD 4IMKC 3O3UN 4PV8B 4P2OC 3WMSA 1EA9C 3MGOA 2OK0L 1A6ZA 4M5YL 3ZKXC 4IDLA 4UUJA 1EEQA 5FYKL 2IH1A 3MV7D 4JQVC 4BH7B 1A2YA 2YKLH 4JFFE 3VXSA 2EDBA 3K0WA 3IFNL 1MUJB 3WNKA 1IJ9A 1I9EA 3ZYZA 1UM4L 1IAOB 1I75A 2VDML 1KCRL 2DL2A 4HQQH 3U4EA 1T21A 4M5YH 1MY5A 1CL7L 1A9EA 5E0QA 4LLYB 1J0HA 1F2XK 4OSUL 3IDJB 4H25A 4I2XA 5C08B 4HS3B 1MHPH 2VR5A 4WO4A 1JZ6A 1BHGA 1KIUA 1ZVSB 1I9RH 3PIQB 2LABA 4FQJL 4K2UH 2H9GA 2WBJD 3GSNB 4MQTB 4LLMB 4E41E 3DBXB 4L4VB 3SQBA 4M03A 1M4KA 3SDCB 5ADPL 1SYVA 1HSAA 2FH8A 4G8EA 1MEXL 2DKSA 1OAZL 3VXTB 3VFVA 3WXWL 4Z7UF 1NUNB 3QDJD 3THMH 1JCKA 2X9WA 5EOCJ 2PO6C 1FPTH 2OJEB 4JFQB 2F19L 5CP3H 3STBA 1QHPA 3MOQA 3EFDH 1OGTA 4U3HA 4PJ9A 1YEKH 3GB7B 1FNGA 3G6JB 3ARUA 3TNNA 4I0CC 3LPGA 1U8KA 3FONB 2JIXD 3VXRD 4JPKL 3EOAA 5CIPA 4WTXA 4S2SB 5JHLL 4NZUL 1RK1B 1AGEB 4YDIH 5HHVL 4YJZL 1GZPA 4M7KH 4LLDB 1CXHA 2CKBH 4HIHB 3DSFH 5FYLH 4F33A 3D25B 3TYFA 1WT5A 1YEKL 2C1PA 3Q5YA 3JUYA 3OKDA 2NY6B 2ZOLB 1JV5A 3EJZD 5CZKA 4G8IB 4P2OB 2VAJA 4ETYA 1W0VB 4YHMH 5I66A 3ARYA 3FMGL 4L9LB 4NZUH 5C7XL 2HP4A 1OW0A 1SM3H 4Y4KA 1GOGA 3NBNA 3V5KB 3BWAB 3MBEC 3SDDD 1IM9B 2IAMB 4DOHE 2LE9A 4NOBA 5GRXG 3OR6A 5D96C 1S7UB 3GMMB 4AYFA 1FIGH 5E7BA 3SE3C 1AH1A 4KUCF 5JQHC 4LSRL 3FL7A 2HJLA 1KJ2B 1FZMA 1JRHH 3CFJB 4KVNL 1NC4D 1PX3A 5E56A 1U2HA 1JPFB 4JFEA 1IEBB 4PJCB 3O6FC 2YK1L 2VH5L 4JB9H 2QQLH 1WWWX 4MSWA 2OR8A 1DQDH 3F6IA 2O5YH 4X80H 5DFVD 1JK8B 3AREA 4Y4HB 5HPMA 3M1BB 1T89C 4DFHA 3RWJB 1BEYH 4U7MA 1X6NA 2BC4B 1RZ8B 1CFTA 2HLAA 3MSPA 4HQQL 4NJAL 5C2UB 4Q58C 4HK3N 2WWKT 4Q9QH 3N85H 1OP3K 5GGQL 1BJMA 5IK3B 3ZE1E 4F58L 1C8PA 4LK4A 4PY8I 3LKQB 1Y18B 1GOFA 3W82A 3DUUA 3MCLL 4F7EB 4PYGA 1NFKA 3ARWA 4B0MM 1QLFB 1JZ7A 1PSKL 1JPTH 4NO5A 2EC9T 4NQCE 2KPNA 1D5MA 1RU9H 5SWSE 4L8SA 1CDGA 4X83A 3IDUA 3KPOB 2OSLA 3PWNA 4FQ2H 4OQTH 5D2NE 2RFXB 3NIDF 2ZCKL 1D5XB 3TWCL 5GS0L 1F4HA 1ZE3C 3SKOB 3FB5B 4P4RA 1GOHA 2W60B 3QWRA 1J10A 2EIEA 4JFDB 2Z93A 2G5BA 3WXVH 3ZO0A 1NGYB 2VQ1A 3NFPA 5JR1L 5IHBA 1NCBL 3C6SB 5JPNB 4WFGD 4L3CB 3VGBA 1P7QD 1CXEA 2QEJA 4P3DB 1GC1H 4QGTA 4RFEB 3AS3A 1F3RB 4JZJA 4EOWL 4G9FA 5D2LF 4I18B 2GKIA 3TBTB 1JL8A 4PRPD 1FV1B 3V6FB 3VFWA 3CUPB 4HUWB 1CK0H 3WFCH 2X2YA 4HWNA 4KQ4H 2DICA 5MEOA 5EOQL 2XN9E 3MLRL 2J8UE 4E41D 3W5NA 4OFVA 5CKAA 4MJIB 4N0CC 2YZ8A 3RU8L 4ONGH 1MFBL 3P73B 1IAIM 2C4XA 1A6TA 2DDQL 2R4SL 3MRIB 1U95A 1LNUB 1BLNA 4Q6IB 3DIFB 1AP2B 1HI6A 1CE6B 2N7AA 5D2NB 3RZCD 5I1KH 2D3VA 2XZAL 4F7TA 5EBLA 1MCBA 3NGBC 3V4UL 2GUOA 4LL9A 1ZT1B 5DD6A 2X4NA 2NW3A 4YHOH 4JRXA 4LHQB 3HI5L 3WL9B 1R24B 1U8HA 3G5XA 1WISA 4JQXA 2X4RA 3VGGA 5EU7C 2EIZA 1PLGL 1H8OA 4GAFB 2CO7B 4X4YB 5MENE 1INDH 1G7LA 1WUNT 3KPRD 4BSJA 2NY0D 1IC5L 3P30H 1A6AB 3FQUA 3H6JA 2EZ0C 3MV11 2G9HB 5SWZD 3HNTH 1UQSB 4NQCB 2HLFC 5JW3H 1HSBB 1JRHL 4GRLC 4NRXB 5CLWA 1A3LL 1RUKL 5MEPB 4G6JH 3CXHJ 1BBDH 5ITBL 4NP4H 2WUCL 3W9EB 3GSRB 4DKAA 4OD3H 5TQ0L 4KK5D 2CR3A 3VRIA 3P2TA 1NUDA 3L3DB 4O5LL 1FQ9C 4IRSD 1I4FB 4EDWH 2ZSVA 1YEJH 1IGML 1YMMB 4R7NA 3KXFB 3KDMA 3BP5B 5IVXF 2L7UA 1F4XH 3V79C 1R3JA 1IBGL 3P40A 1I1AC 4PJ8A 1R5VB 3WFCL 1P9MC 3IAQA 2ZCHL 1SJVA 2IGFH 1I1AD 4AJ0A 4M1CC 1IM3A 1M05B 1QG3A 4OM1H 3OKMA 3E2HC 5FUCC 1RUPL 5FYJU 1I4FA 1T1WB 3BKJL 3BH8A 2J6EA 4ZD3H 2MHAA 4YDJA 1MFBH 5C0DA 4H26A 1MFNA 2JCCA 1XIWD 3CGTA 3SDDC 3B5TA 5D7KD 1NAKL 3DX7B 3U4EB 1L6XA 2VABB 5D7IB 1I7RA 4M1GH 1KPUA 1F90H 1IAOA 1S7RB 1VEPA 5IK3A 4CN6A 1NDMB 1T20A 2VXSL 1CDUA 1DL7L 4P2RD 4IIQB 1WFTA 3MR9B 3K81A 4X6DE 2CJUL 4U1GB 1GH7A 5GIRA 1ACYH 2H1PH 3U4BL 5I74B 4ELMA 5C0NC 5GSVB 3GSVB 1VFOA 2YC1B 1AJ7L 4G8GD 4YZFF 3DJ9A 2HMIC 4JLRB 1E28B 3S36H 3BEVB 3LCYA 4MWFB 3RX7A 2WBKA 4AL8L 5ENWB 3NIGF 1I8IB 1UGNA 2B2XH 5M95B 5DJ2B 1S9WA 4G6JL 5E6IB 1ERNA 1D9KA 3TN0C 1XF4A 4DN4H 5D1ZD 4FABL 2CO6B 1PX4A 2C7UA 5D1ZC 2NY3B 3FMGH 3IDYC 3QEGL 4WI2A 3N50A 2VE6B 4L4TE 5JNYA 4UNUA 2G75B 3LAFA 5KSUA 3CDCA 1MRDH 2QSQA 2E7CA 2JELL 3VFWB 5DR5L 1KIQB 1F6FB 2R2BB 1WITA 5GGSY 1S3KL 1ZHNA 3T1FB 2A6JB 3GMLA 1AC0A 5HYSA 3MRKB 4JFFD 1OARL 3D25A 3I50L 3HPJB 3TYFB 2BSSB 5BQ7A 4XP6H 2EEBA 1HNFA 2MOVA 1AGFB 4ACPA 1RK0B 3M17A 5B4MD 1NCAL 2Z93B 3MO1A 4ZTPH 3EDKA 5C09B 2B5IC 2R1YB 1HHGB 5DD3H 1KB5A 2EXYD 3BP5A 4JFDD 4OLYL 5GRVK 3VG9C 1S7VA 3IXTA 4LLQB 2EDNA 2P5WD 1KIRA 4YUEL 1ZGLM 3LH2L 2IBGA 3S35X 1ULVA 3EYFB 4F15C 3UC0L 4AEIL 2ZWLT 2OJEA 4PJ7B 4WW1B 3O3EA 4JKLA 3BZFA 1MHCB 4MA7H 3ZDYE 2DLFL 2HT3C 3VE0B 1S8DA 5DQDH 3ARZA 2Z91A 5HHQA 4NBYB 2V5TA 3KJ4C 1FFOB 4JFHD 4KJWD 4WUUB 4PJ7A 3GSOA 1Q94B 5EU4A 1YEGL 2Z35A 4QT5B 4G6AC 3QNZB 1FYTD 4L4VA 2OMNA 1FBIL 2EXWC 4G6ML 4U6HB 4Z7UA 3V0VB 4YHYB 3L6FA 4M61A 5KG9A 5DMGC 3TJEL 3PWPD 4GXVL 3C60A 5E4IA 5T1LA 2HTKC 1WBXA 2VMFA 4JQVA 3KYMA 4HULB 4KQ3H 4LRNL 1YEGH 5E4EC 3JUZA 1HOCB 4M1GL 5DF0A 2XZQH 4OFYD 4XMLL 1DR9A 5ANME 1YYLL 4R0LB 3FT2B 1YEFL 1TCRB 1ZMYA 1S9XA 4JFHE 2BSRA 2AJYL 5IROA 1YQVL 4DKFH 4AZ8A 4ZMAT 5CAYB 3EKCA 1AJ7H 4O2EA 1T80A 2VIRB 4PJ5A 5C92A 3LB6C 3IFLH 5I1AA 5DD3L 5KSVA 4YE4L 1YEJL 4G43A 3WNOA 1Z5LA 2V2XA 1EJOH 3O4LB 2P8PB 4LRIA 1RJZB 5ECJE 4LGPB 4IRZL 3TZVB 4WDIB 4HMEA 4ZOAA 5HI4C 1HYSC 4PUBL 3MGTB 5EC2B 5HI4D 5CD5D 4QLRA 2Q8AH 5T1DH 4XCYA 5C6PB 4L3CA 4P48A 1F6AA 1TTFA 2IF7A 5FGSA 4OLUL 3BEVA 4Q9RL 1HXMA 3BE1H 4Y4FB 3OPZL 3DROA 3RQ3A 2DYPD 4KK9C 4DGYH 1TCMA 3TLRA 5IHUH 5HYJD 1BX2B 3JV5A 3RVUD 2AJSL 3PJSA 4XNUH 4H8WH 1MVUB 1CXFA 3SO5A 1KPUB 3MV9A 2XFXB 2BOCB 5J1SC 3VFVB 3VE0A 4UTBH 4J3XA 1DLFH 1A7PH 1XGRB 5HVFB 1HSAB 4YZFE 1SYSA 3CFIC 2HJKA 4ALAL 3V52L 1LO4L 4FQXA 4KH2A 4EEEA 4WFFE 4D3CH 1HDMB 5KN5B 1PYWA 2GSIA 4JDZB 1MAJA 1Q0XH 3AFLA 3T1WA 3H3PH 5I8EB 1AGFA 4Y16D 3GSUB 4R0LC 5CGMA 2NY5C 1XGUA 5IB2B 2DB8A 5F96H 5EORH 1WZ1H 1JGEB 3O2WL 1S7QB 3VGHA 1QNZH 1DFBH 3CSYA 1ZANH 4JM4L 2APWA 4I0PD 3HB3C 1EAPA 3OR6B 1H3WM 1QQDA 3ULVL 4JZNA 4LSVL 1QRNB 5E8PA 4EZMA 4KJYB 4X7SH 3IXAB 2HJFA 3QZWA 4WTZG 2F5BH 3D87B 5ETUA 4KI1A 4UUJB 2IPKB 5IROC 5FGBA 2F53B 2BDNL 2DQJH 3DRQB 2WWMC 1A14L 1WZMA 2APBA 4JRXB 3IJYA 1JF1B 1HXYA 3PL6B 4TOYL 1BECA 1AI1H 5KSAD 4NRYA 5LAXB 3UDWA 2KZ1B 2VAAB 5ADOH 4P9HH 1DBKH 4M8QA 4PLNC 3OAZK 4QRPE 2KBGA 5FO7B 1YY8B 2Y25A 3WO4B 4K07A 5DC4B 3U46B 3KYKL 1GPOH 4I4WA 2HT3D 3L1OH 1QUNA 2AEQL 3MRFA 4LSTL 3KPSA 5TDOB 4LLAA 3HUJA 4M7JH 3ORJA 4JM2D