1MCPH

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKGNKYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARNYYGSTWYFDVWGAGTTVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
total genus 33
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1984-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH02
1MQ8A 1KOAA 3RHWK 4HIXL 4MS8D 3BMWA 3L6FB 1U3HB 3VFUA 3VGHA 3A6BL 1GC1H 1CGVA 3Q3GA 4YBQC 5EWIH 2IPTH 4Q6IC 4R96A 2J12B 2AXGA 1DBJL 1KCUL 4UILL 1E4KC 1YEKH 4ZXBC 4G6KL 1PZUB 1FE8H 3OAYH 5I73B 2DMCA 3VW3H 4ZUVA 3MLWL 1CLOL 4LLVB 2NNAA 3QRGL 4GRMB 4HBCL 4MD5A 4HV8B 4PGBA 4NWUL 5TE6H 3AGVA 5I2IB 4MNGB 1KNOA 4DTGL 4GQPH 1ZWIA 5M95B 2FDBP 4GLRH 3JV4A 2F8OA 3S88L 1B90A 1MAMH 4P9ML 1JHTA 2J5LC 2EYRA 4MQ7A 1UT9A 5DJ6B 4F9LC 3LV3B 4J4PD 1AR2A 1C5BL 1UQSA 2X4SA 2JJTA 2XKSA 1L0YA 4I4WA 1FN4B 4JZNB 2P5WA 1PKQA 2V5RA 1E4KA 4KZEH 1IAIH 1K8DB 3SCMB 4XNZC 1MCPH 4E42A 2JELH 4M9PA 4L4VE 4QCIA 5HHQB 2ZOKB 2E6JA 5D7LE 1FZJB 4J3OC 2LVCA 3BYTA 3T65B 4PTTA 4I3RH 4JDZA 3GUTA 1MNUH 3C2AL 5IMLA 5DUMH 1ZHBA 3EO1B 4TNVF 4Y4KD 4YDLB 4GRLB 4O2EA 3RY4A 5E24E 2YN3A 1QNZH 3RTQA 1CIUA 3SDXB 3LZFL 5ADPH 2DICA 3IS1X 3ZDYF 5L8LB 3ZKMC 4PRHB 2RAMA 4ZO8A 3WO4C 5GGVH 4I48A 5CJQL 5EOQH 3RL2B 3RY6A 3I3BA 1J1PL 2VH5H 5E6IB 4JO2H 5L2KB 1I7RA 4CVZA 3HI1A 4G42A 5GGRY 3OAUH 4ZUTB 3FQWA 3QUMA 4U1IB 4OZIA 2O61A 1MWAL 1MRCH 1A3LH 2WQ8A 4KZEL 2H2PC 1AD0B 2H32A 4OB5L 4RGOL 1LO2L 5LAXB 2R56L 1EVTC 2NX5D 3QI9D 1H8SA 4JLRA 3VFMA 1SVZA 4O4YL 3WKML 3KYKL 3ARGA 3F58L 3SDDB 3E0GA 3HZKA 2Y06L 4YNYB 5GZOC 3BZFB 4A6YA 2W9DH 4JFXA 3TBYA 4P2RB 1QNZL 2R9HC 5L9DH 1S7TA 2F54B 3H3PL 2IBZX 3KLDA 3STBA 4GRWB 5FF6B 4LHUD 1CWVA 3BT2H 4HWEH 5EOCH 4OV5A 3QZWB 2NXZC 1J1PH 2VH5L 3HRZA 2R0WH 1V3KA 1U2HA 4DGVL 2PYEA 1K8DA 3SCMA 1KEMH 4XT1C 4AT6A 4NKDA 4KRPD 1A3LL 2NY2C 1DN0B 2CD0A 2UV3A 1Q0XH 1FNAA 2ZOKA 5JW4Q 1T3FB 1HHJB 1BD2A 4QXUH 2XZCH 1P7HL 1T89C 4RGOH 2DQHH 1LO2H 2J5LB 4DGYH 1NC4B 3HC0B 3KPLB 3GSWA 4HKXA 5ID0B 4MD0A 4Q97A 4BQBA 1A6VH 3GBNL 2WBWB 1F3DH 2Y06H 1JZ2A 2V2XA 4ISVB 3PGDB 3SDXA 5ADOL 3D0LB 2VDML 2D7TL 1DN2A 2ESVD 4HDIB 2MCPL 3SDXF 3LQZB 4JJHA 4GRLC 2QADD 1EEUA 3KPNB 2R1YA 3HUJE 3CD4A 3QB7C 2XQBL 4JGMA 1NAMA 3MACH 3OKLB 2VISB 1A1OA 2F15A 4ZD3H 1N3NA 4PJ9B 2DQTL 4TPRH 3DUHA 1Q9LA 1ZLWH 3T1FB 3AMLA 5F3HB 1I7ZA 4KKNA 3QDAA 3HCVB 1DLHA 1XGYL 3MFFB 1CR9H 1UH2A 1MI5D 1QLFA 3ALWA 4GO6B 5EBWB 3AM8C 3M1BA 4OZFB 1PQZA 5F1OB 1TZHB 4U6VL 5I74C 1Z5LA 3QXVA 4BUGA 2XZCL 3SO3B 5C0BD 2WBJA 2CXGA 3HLAB 2Q8BL 2ZSWA 4OD2A 3P9MB 1LGVA 5I0DA 2AEPH 3I75B 4Z7VB 4MWFA 4U3HA 3RFZC 1MUJA 1RI8A 4NO0D 2AJVL 3LDBB 1DQLL 3FZUD 2H3NB 1NDMA 1NGYA 1N5YL 5MEQA 3X12A 2ZNWA 1S7QA 4YDIH 5KSVA 3H7BB 1CBVH 1M05B 1U8KB 4BA8A 4XBEL 2ZUUA 1KIPA 4ZSOB 4PV9A 2YKLL 4K7FA 3JV0A 4L4TD 5IMMA 5F7WC 4TPRL 3NN8B 2HAZA 1JWSA 4CBPA 5L8JB 1S9XB 1B4JL 4MAYA 3PWUB 4PJHA 4DEPB 2AK1H 3F7QA 4XXDA 1U58A 2ITCB 5DEGB 1E0OB 1C8PA 2F53A 1DQQA 4H0GA 1HCVA 1UFUA 1XZ0B 3MRKA 4IBLT 3SGJC 1F42A 1GL4B 5D6DC 3NFNB 1ITBB 1N2RA 5C0DB 5CD3B 1IGFL 4OTXL 1OQXA 2V6HA 1I9JH 4K2UL 5L7XH 1NGXA 2H6PA 1MCDA 4G9FE 1JF1A 2VTFA 1FC2D 4FOMA 4HCRH 5DS8B 1Z3GH 3QG6B 4HIJA 1NAMB 4NN5B 2XZAL 4Y5XB 4OUOA 1BBJB 4LNRB 4OT1H 4YHML 3N1PC 5IK3B 4DGIH 1CFSB 2PYEE 2G5BA 2PTUA 1WF5A 1WTGT 3HE6B 4G6JL 3HCVA 4LLUA 1FFOA 1PLGH 1FZKB 4RMVA 4QHLB 3V6OA 4H20H 1N26A 2CPCA 3MRNA 2AKRB 4WCYH 2CUIA 4QRTB 5D9SB 1OTSD 1TZHA 1F8TL 3D3VB 1MWAB 2R2EA 2ZKHH 4OZFG 3ARFD 4L9DA 2L7JA 1V8HA 4YHNA 5DFVD 3K46A 1CXHA 1FZOB 3HI5L 5IVZA 1F6AB 3H9HA 1A7RH 4UQ3B 4GFTB 2EKJA 2B0SL 3QIUA 4KI5E 1P2CA 1AXSB 2VLRD 3P2TA 4YFEA 1I3GL 3P9LA 2AJSH 1KT2A 2VZTA 3EUUA 4LGSB 3KXFE 5IBLC 1EHXA 4LLQA 1GZPB 3CFKB 5F9WB 2M2DA 2DKSA 3ELAT 5C70A 2VR9A 1EFQA 5BZDB 3SQOL 2PTVA 4M1CC 1N7MH 5KVMC 1Z3GL 2VDKL 4FXGA 3FO0L 3QPXH 1UB5B 2VC2L 3OJVC 1UJTA 1IT9H 4H1LG 2DWDB 4JY4A 1ZGLA 1L7TH 2IC2A 3R06B 1MPAH 4Y16A 4LEXH 3ZTJH 4LKCB 4MXVF 1NLBH 4QHNA 1PW3A 4PJ8C 5C6TL 1C12A 1WBXB 2H26B 5F88B 1RZ7L 4PLJC 1S7UB 2B1AH 4QXGL 3SE9L 4OZGE 4R4FH 4L4VB 4POYA 4ZUSA 1FVEA 1H5BA 1YMME 4LSUL 1UB6B 2HKHL 1MFAH 1W0VB 1RK0A 1UXWB 2EICA 3Q6FB 2W60A 3MBXL 5GGTH 1WZ1H 3NGBC 3TJHC 1A14H 4TN9A 2A77L 3O8XD 4OLWH 4R9HA 4OJFH 3T1WA 5FO8B 4Z8FL 3GJFH 3UTZA 4NZRL 4OCYH 2B7DT 3MNWA 2CLRA 2PUQT 4HV8A 3BN9D 3MGAA 2YA0A 3P4OB 3QPXL 3I50H 3A6CH 2BSRA 2Q6WA 5C2UB 4Y4HD 3J8F7 3AXLB 3M07A 2VITB 3TYFB 5ALCL 2HFEA 3MRGB 4V1DD 4LCUA 2NTSP 2HT2C 3QFDB 2ZP0T 3TO4D 1AD9B 4GQ9L 1FGVL 1RZ7H 1P1ZB 3MNVB 4CU6A 3ROLA 2UY7A 5H35A 4HGWB 2VLJA 2PXYD 5D1ZB 2D7MA 3KWWB 3KYMB 1F6AA 3MRCA 4ZAKB 3MRBA 4IJ3B 4YXLL 4QTHA 2QQKL 1HHGB 4PD4J 1PG7X 4ZPVA 3QFJD 2DQEH 5L6YL 1A14L 1JRHL 2F5AL 4KRMB 4JM4L 2E8ZA 1EEQA 5JMOC 1OD9A 3P0YH 3S34L 1INQB 3LQAH 1LO5B 1ITCA 1UENA 5BZDA 2Y5TA 3HNSL 4L3EE 5T1LA 5IMLB 5SWZE 1JUFB 5F6IC 3UAJC 1CK0L 5F9WC 4UUJB 4G9FD 2EYTA 3IDNB 4XCCL 5I8EA 3MOQA 3QUYA 3VWJD 1KELL 5BW7A 1I3RA 1FHGA 4KK5D 4XX1E 3MLRH 2R8SH 2NLJB 2B4CH 3CFCH 1OCWL 1YNLL 4GOSA 2JJUA 3M8OH 1QQDA 5CP3H 1UM6L 1HINL 1JPTH 4X9GA 4RWYL 3HPJB 4HF5L 1T7VA 2Y36H 3PNWA 1U8IA 4D0DB 1T7YA 4EN3B 4OD1H 3SPVB 4DFHA 4JPIA 3RUGF 4Z7OF 5I30H 4U1SA 1BOGB 3PXHA 3H0TA 3O6LH 1J1XL 4HJ0C 3GBMH 1CXIA 4N8CH 1QSEB 3IDXL 2A6KA 4XPHL 3LN5B 4LCCA 4Z7WB 3V4VL 1CE1H 3QDGB 4S1SL 2IFGA 5DSCB 4JO4L 3WE6A 3S36X 1MOEA 1RURL 2BVOA 3MZTA 4XBPA 4X7SH 1LVEA 3HI6H 3DXAE 2X2YA 4X9FA 2DDQL 4HQQH 4JHAH 4OZHB 4ODXB 5KG9A 5CBAB 1TTFA 4X9HA 4EVNB 2NY4C 3OXSB 3G5VA 3MJ9A 3N06B 3B6SA 2DIJA 5C0BA 4XP4H 2F74A 4KKBC 1LD9B 1TIUA 4WHCA 3BZEA 1DJSA 1LK3H 5LCVH 2QKIB 3MBEC 3L5XH 4UU9B 4XAKE 3ARPA 2ZOLB 2AV7B 2WSKA 1T5WB 3HB3D 3VU2A 5HYQA 5D7JD 5HPMB 4RWYH 3BWAA 4HF5H 3U0PB 2BVTA 4WW2A 3TZVB 3WDHA 1BWMA 4RAVA 3TFKC 1EK3A 3L3IB 1OARH 1VKXB 2ZUXA 4G7VH 1I1AB 1BECA 15C8L 3KYAA 4AENA 1RAMA 3L3JB 5B8CA 3P73B 4JFHD 3OKNB 1J12A 3UXFA 4EN3D 3FFCB 2AV1B 5BOZG 3OAYK 2C1PA 4OF5A 2VDLH 4HZLB 1KJ2B 2GUOB 3PV7A 5HI5C 2HKFH 3MRLB 1NJ9A 4NQDA 3V4VH 3QNZB 5CJBA 1CE1L 1EIBA 3AY4C 3D69B 4U2ZA 4QYOA 3F12A 5IBUB 3QHFH 1EZVX 1YMMB 5GJSL 4E41B 4UT6H 1AGFB 4PJDB 3V0WH 4IIQC 5E8PB 1A0QH 1XCTB 2ICEB 4HS8L 4GH7B 5I74B 4M02A 5IVXA 4ELKB 5C92A 4Y89A 2J4WH 3MOAH 4DEPC 3QEUB 5ILTH 2R1YB 3BXNB 3VXUA 1N64H 2I24N 3ULUF 1U92B 1P4BL 5F44A 1UKQA 4UOJA 1HHKA 4NYLB 1VSCA 3U7WH 3VXSE 2LVEA 3QXDA 3TBTA 1YYLH 5HHOE 3BE1L 3H0TB 4JN1L 2DKMA 4OF8A 1VEPA 3DYPA 5HDQH 1JYXA 4RBPH 5CHNB 4OLYL 2X4PB 3FOMB 2F5BL 2I60L 2QHRH 4OGYH 5FECA 1T22A 3ECBA 3WHE1 2YUVA 4Z0XA 1AGEA 5C0IB 3UBXG 5FA3A 1SMAA 5A2IH 4P59H 3RP1A 3QQNA 3ARQA 1S7WA 3V0WL 3FQRA 1E4XH 2IGFH 3DXAB 2FO4A 1A6PA 4ODHL 4WWID 2SEBB 4MA8L 3ARFA 5GIRB 5HYSG 1OAZH 4RIRB 4PJHE 1XEDA 3LS5L 5FDWB 3RVVC 4OKDA 4Z95L 2C9AA 4N9OB 2DQUH 2AQ2A 2QR0A 1JE6A 1RD6A 3CPLA 1LO3L 3O2VH 2C3GA 3WD5L 4PJ9D 4P3DB 4NOFA 1KN4L 2EC9T 4QHMB 3IETA 1TCRB 1AD0A 2Y1VA 2DQIH 2OJZH 2A38A 1WCQA 5FM5O 2AVGA 3B2VH 3LVEA 2JIXA 4NOBA 3BAEL 1TQBC 2F5BH 3B8YA 1V7NH 2L0DA 4MJ4A 2GSIB 5FCUH 3MA7A 4HPYH 3T0VA 3CFEA 1FPTL 1QP1A 3DGGB 4YR6B 4M7KH 1MJ8L 3MJGX 1I9RL 4JFXB 3TBYB 5DLML 5DQDL 5IKCA 4NQDE 3EHBD 5KSBF 1NC4D 2AXHA 4QRQA 4ZFFA 3FB5A 2APBA 1KPRA 5IVXB 4EI6B 4KH2A 2R69L 3O6FB 5D2NC 1NAKH 3G5XB 2KQNA 3HRZB 4R2GC 4RMRA 3VXOA 1EFXD 5FM5M 1OAZL 3PV6A 2AABH 2HFGL 1BBJA 4TRPL 1QUNA 4MAUH 5DRWA 5JW4M 1XGUA 2GJZA 4PG2A 4JR9L 3BO8A 5JIPA 2DJSA 3PP3K 4ZPTA 5B39G 5J11C 1HH6A 2HYMA 3B9KC 1KFAL 5IQ7H 5GS2D 1YY9D 4L8CA 3C6LC 1UEYA 4QHLA 1NCWL 2BNRB 2DQIL 5D8JL 3MQIA 1F6FB 2OZ4L 2R2EB 4S2SA 4IIQA 4HJJH 3X3FH 5K9OA 2L4OA 3JBG7 3S37L 1Q9KB 1CD9B 2IH1B 3P11H 4HPYL 3RWCB 1TCMA 5C0IA 1EHAA 3VFTB 1A6TB 1MJ8H 5FXCH 1FBIH 3QIUB 5HI5D 1WC7B 1ZLUH 1AXSA 3U30B 1HK6A 3VXMD 3IJHA 3FQRB 3WIHA 3I6LD 1MELA 2A1WH 2GJ6A 3O3BA 3ARGC 5IT2L 1IEBB 3KPRA 3UYPA 1R3IH 2I5YL 4M8QB 4YHYC 4PRIE 1JNLL 2GHWB 1YC7A 2OI9C 5IB4B 4F57L 3LMJH 1E4XI 2KH2B 3LPFA 2NY7H 4BJLA 4MAUL 3QXAB 1PKQE 1MFBL 3HUJF 5GGRB 5DXWA 4YFDB 3LKPA 1TJGL 1HQ4B 4MCYA 1QO3A 3QJFB 2XFXB 3ARBC 3D18A 1JGLH 1PGRB 3BEVA 3DRQB 4GAJL 4MQSB 4GBXA 2QLVB 1FO0H 3BP5B 5T1LD 2BP3A 3WO3B 3UTQA 5J1TC 3O11A 2FWOA 3GSXB 2ICES 2V17H 2LU3A 5C08A 1XH3B 5GSRB 4QOKA 3LD8B 1UCTA 1J0HA 1XR9A 2BNQD 5EA0L 1D9KA 4YHLL 4J3WA 1OQOA 3UC0L 5D1QA 1L4IA 3QG7L 3MV8D 3EGSA 1NBQA 2XPGA 3DYMA 3H8NA 5MENA 4NO5A 3VGAC 5I19H 4M43H 4M7LT 3SGDI 1IMHC 2IWGA 2J6EL 3FQNA 4X5LA 1RIHL 4JFPB 4RFEB 5F3BB 2B5IB 4KKCC 3VGBA 1FAIL 1HILA 1KCVL 1RJLB 1Z9MA 1G7LA 4Q9RH 5DJDB 1FNSH 2NY7L 4P9HH 3RWJB 3K8KA 4MAYB 4OCWH 3TNNA 1KF9B 5GRXG 1G9NC 5DURD 1ZANL 4L4VD 4DCQA 4F58H 1X44A 1A6ZA 1JGLL 4GAJH 5D96B 3OKOA 3MRKB 2DM2A 2YEZA 3MXVL 1M4KA 1U41A 3MLZL 4WHYH 5CJXA 3P4LA 3VWJC 4HGWA 4PJ7F 1KCLA 4HIHB 2OTWA 2HRLA 4M48L 4N8VA 2G60L 2JKXA 1RHHB 4KVCH 4OGZA 2ZNXA 1HCFX 4PJCA 2OLDA 3PWJA 2LU7A 3KPSB 1BVLA 3MUZ1 3FB7A 3QG7H 3V4PH 4N1HB 3L7EA 4WWKA 4NRYB 3ZSSA 2EDXA 5LBSH 2Y5TB 2D7OA 3MBEB 2UWEA 4U6HA 2IAMA 1HIML 1SJEA 4UT7L 4Z77B 1YMMD 3JUZA 3KXFB 5HHOB 1RIHH 5HD8D 2GCYA 4EEEA 1OAUH 1AJ7L 1EBPA 3LKPB 4Q9RL 1FP5A 5I75C 4KY1H 5E0QA 4FFYH 2E9IA 2E9BA 3U46B 4G43B 5IEKB 2PKDA 4MA7L 1CD1B 2VR5A 3LEXB 4W6WB 3LS4L 2G2RB 5FYJU 4HIXH 2ITDB 5CEXB 1S9WB 4MDIB 3MXVH 4X6FA 1GC1L 4MLIA 1JHLH 2FX7H 3F7RA 4K94C 3HE7D 1ND0B 5EUOF 4FQXB 5CIPA 2X4TB 1X7QB 1A47A 3MRMB 5D1QB 1OAXH 4JVPA 4KUCF 4X83A 4KK6D 3LKOA 1HEZA 5HI3D 4JO3L 4CNIA 1NMCC 4LLWA 1U36A 3IXTB 5D4QA 1S9VA 2WK2A 1ZHKB 4KMTL 5DJCA 5EPMA 5MERA 4MJ5B 3R06A 1NCAH 1XR8B 3HMXA 4G80B 4KK8C 3EFFB 2ESVB 5I1KL 4WEMB 4I48B 3RL2A 1T7WA 2NY4B 4BKLA 2Q87A 3KPRD 4U49A 3ZHLA 3MRIB 2UZIL 2CR6A 3PWLA 1OGAA 1QR1A 3BPNB 4X99A 5JPMB 2DL9A 1J9CT 2IADA 3MYZA 1QSFA 3UTSA 1DFBL 4I18C 4QWWC 3LHPH 3GIVA 2XA8H 1JHLL 2QQQA 4IOIA 4X0KA 5FO9A 3V6OC 3SJVD 5C0FB 4XBGB 2DLFH 4L8SC 3JUYA 3O2DA 1J10A 3TP4A 3EFDH 2B20A 3WJLA 4WFGE 3GJFK 4YGVB 2EXWC 3VGDA 2W9LA 2BOBA 2F19H 3PG2A 4JO3H 1NUDA 5TQ0H 3M45A 1WAAF 4D9LL 3WO4B 5GGUA 2HH0L 3PHOB 5IWLA 2ED8A 4E41A 4XHQA 5BRZE 1X5FA 4KMTH 3EYVA 3R0MA 1FL3A 3CUPA 1MCBA 3VA6A 5IMOB 1CVRA 1E28A 2WNGA 1PG7W 3T3PE 1NCAL 1XF1A 4HKBB 5CJXC 4LCUB 1D5IL 3D1MC 5C0AD 2JB5L 2FCBA 4GMTL 2EC8A 2WZPD 2CDEB 3FRPG 3WFEH 1MWAH 2VMFA 4UMGA 1MRCL 3TVMA 5J12C 5D1ZA 1YDPB 3IRPX 4AT6B 1IARB 4ONFH 1DEEB 1EERB 3WIIH 3SDAC 3ZKND 2CRYA 5T33L 3TA3C 1FAKT 2EE2A 4OB5H 3MRJB 3CZFB 2R0ZH 2ATKA 1UACL 2EO1A 2N56A 3OL2A 2EDRA 2LE9A 4XHJC 3KLHC 3SBWA 2XXMB 3KGRA 4O4YH 4YH6A 3WKMH 2QSQA 4NIKB 4N0UE 3U0WH 3SGDH 2R29H 4NJAH 1GGBL 3G6JF 1DSFL 4HXBL 1WWBX 4TTGA 4NNXB 3IXTA 4Y4KC 2NZ9D 2GJJA 5I18H 3U48A 4D9LH 3DOSA 3MCKA 3QWOA 3UX9B 3VFWA 2EYSB 2EO9A 3PQYD 4F33B 1YQVH 1HKFA 5GSVB 4XNYH 5IHUH 1S7WB 5IROC 4EUPB 3RU8L 4BH7A 2V5TA 3S36H 1FH5L 2JCCA 1D5IH 4RA3A 4U1NA 5KAQF 5BS0E 4MA1C 3LEVH 1QSZA 4V2BA 3RVUD 5T1DL 4TUKH 1MCWM 2H1PL 3ME0A 4LFHG 1U3YA 2Z31A 1Q0XL 3BQUC 2OP4L 3HZMB 3KPRE 5ERWB 4E41D 2ERJC 2CDFB 2KZ1B 4JKKA 4HHAB 4QXUL 2V7HA 5CKGA 5E6ZA 4XPFL 3MV9B 5C09D 2ZCHH 5EBGA 4XMLL 5AWNL 1OTTD 1UACH 4EQ3A 4PJ8A 4NDMB 1J0JA 4JKLA 2JIXB 2H9GA 4ZUVB 4YUEL 4YC2B 2NMSA 5KZCB 1G6VK 1NGWA 2BVEA 3GBNH 4RISL 4IRSA 3CFEB 4YR6A 1FNGB 1U8LB 5DTFA 4MWFB 1U8PA 3UO1L 1NMBH 3TVMD 2VDMH 1OPGH 3B43A 2Y72A 3QWRD 2DAVA 2I26N 1Z0MA 2O93L 1GOGA 4LOUC 1ZT4A 1R3LB 2Z9TA 3EYOB 5B3JE 4XNYL 2DQCH 1B3JA 3FT3B 5KSBA 2DQJH 4WEBH 4GAYA 5E8NA 3ILQD 3S36L 1LE9A 1FH5H 4RGNC 2XTJD 2DQTH 4OZIF 1KIPB 2LV4A 1IM3A 4KPHH 1YECL 2CDEA 4DWHA 3CH1A 3LEVL 3S96B 4D3CH 4OGAC 4DKFL 5EU6D 2WM0A 4D9RE 5K9QG 1CR9L 1RJYB 1DBKL 1HH6B 2VDQH 3BPOB 4HMEA 4U6VH 2NY5L 1UZ8B 1DL7H 4DK3A 4GAGL 1KIUA 5HDBE 4XMLH 1URLA 1XZ0A 2A9NH 2APTA 3PE9A 5HI3C 5EU5A 4M7ZB 1K2DA 3KPPB 4U05A 4YUEH 1MCRA 1LK2B 3WV0A 4YK4C 3EO1A 1GRWA 4J4PA 5DFWH 1QSFD 3UTSD 1KPVA 2V9TA 3T3ME 2BCKB 3HE7C 1NQBA 1R24B 5CEYA 4GW1A 4PS4L 2JE8A 1NEZB 2NY6D 4OFPA 3PGCB 2GJ6B 3I9GH 2XWJA 3IAGC 1IEAA 5AG8A 1A21A 1YEIL 5E94A 2FJFB 5FK9A 5MI0C 4YHKL 3QIUD 1P53A 4KRPB 1EUUA 3TA3A 1JGDB 3KJ6H 1YEEL 2ZUSA 4ZFZB 2O5ZH 4KPHL 4PGDA 3RNQA 3T2OA 2QADB 2Y7QA 1WK0A 2J6EA 1NGPH 3UTTE 5IB5A 1NFIA 3T77A 4MCYB 5F7LB 1QRKA 5D7LA 4NO3B 1W0WB 2DKUA 3AREC 3FOLA 4GBXB 3BP5A 1YQ2A 5HGGS 1J8KA 4UTBL 4GAGH 3UTQB 5FHBH 4YDVB 5I8OL 1MQKL 2X10A 4PLOB 7FABL 2AERT 2EDHA 3Q6GH 1H3VA 1S78C 3MJ9L 1XR9B 2AK4B 3DVGB 4YDJB 1AC6A 3TT1L 4R4NC 1RZIA 4NJ9L 4LDLB 2I9TA 3BVNB 2YRZA 2XZAH 3CXHJ 5F9DC 4PJ7B 5IB2B 2YPVH 3CXDL 2AXFA 4LLMB 3QQ3B 3F6IA 3BQUA 4C55A 4POZC 1IC7L 4Y1AD 3U83A 4Q74A 4WFFE 4KWUA 3FO1B 1K5NB 3QEGH 4QHNB 2FJHA 2EE6A 4U6TA 1T20B 2HVKB 1B9ZA 5DF0A 3KNBB 1FV1B 5GJTL 2VSCA 1F90H 2HJFA 2BK8A 4OQTH 3MUGB 1SM3H 1MCOH 2Q7YA 1SY6L 1YMHB 3QH3A 5D2NE 1W0VA 2Y23A 1RULL 1LK2A 3I84A 2P24B 4RA0C 1A4KA 4ODWA 2W60B 5LJYH 1IAMA 4KHXL 2R4SL 4OLUL 4LAQL 2MMXA 2BJML 4PJCB 2EDFA 3QNXB 4X6DF 1F4HA 2CGRH 4YXKL 4DZ8B 3GZKA 3TT1H 3NCBB 4QRRB 1F11A 4YEEA 3TA3D 1I8KB 5CIPH 2JIXD 3DHJA 4NJ9H 5EOTB 1BZ7B 1NBYA 2DIAA 5JXEC 3RQ3A 1JF6A 5DI8A 3VRJA 4HUVB 2YWZA 3W11C 1XGQA 3PP3H 2J88H 2DS4A 1ZSDA 3ZE1E 2YR3A 2EDQA 5CGMA 3CAFA 2YXFA 2FB4L 5D7LB 4J4PC 1I7TB 1QEWB 4L8BA 4BFBD 5IQ9A 4R4FL 1VACB 2BVPB 3TT3H 4IIQB 1D5BB 2I07A 3L95B 1SM3L 1DZBA 4HXAH 3T04D 4PJBB 4UOW1 4YC2C 2DJ4A 3MBXH 1DQTA 1RULH 5BV7C 1WZ1L 2IPUK 5F1NB 4OM0L 2R39A 4S1QH 1V3LA 4YXHH 3BQUD 5C0CD 3N1MC 4OLWL 1IILE 4LAQH 3WYRA 4Z8FH 4YXKH 4Q2ZA 5DHVA 3PDDA 1KTKE 2WMPA 1WBYA 3RWIA 4LLWB 3PL6B 1P84K 4HGMA 4MNGE 3DX9B 2NY1D 3O4LD 5CZKA 5E00B 3RNKA 1VERA 3DHMA 5D5MB 1CGYA 4S1DC 4Y8DC 5ALCH 3O9WD 3IDIA 2ORBH 5JPNA 1QO3B 1GGYA 5GRVK 4KRLB 1JPST 2HFFB 4H5SB 2GJ6D 3GNMH 1HYSD 4XP5H 4G6AC 1LO4H 4PG2C 5E08L 3TO2A 4MMZC 1RFDH 2HJFB 3Q5OA 3BDXA 5TH2A 1OGAB 2YS4A 2PTTA 5F96L 1CZ8L 1E4JA 3PGFL 4BUHA 4NN6C 3HS0A 1SEQL 3K4ZA 4XWOC 1LHZA 3DBXB 3T0EE 5EDXA 1PZ5A 2DLIA 2XZZA 2APVA 4HG4J 4IOFC 1YUHB 3ARBA 4JZNA 1WWCA 1PKQB 4AZ8A 4YXHL 4CKVX 5JOPE 3MXWH 4DZ8A 3QP3A 3T2PA 3QT2A 3DX6B 1KG0B 4QCIB 3IDYB 4Y5XA 3N1GC 5DA4A 5F3BA 4BQ9A 1OTSC 2Z4QB 5EIIA 5GGUB 4X4ZA 5IK3A 5EBMA 3GSVA 4GLRI 2VL5B 1TVDA 4LLYB 5FYLH 3RIAF 3VFOA 4ODXA 4HUXB 1OCWH 3V4UH 4CADB 5KG9B 4F9PA 5DJ0B 2Q3AA 1JHTB 4JRXA 2AKRA 1D5XA 4Z76A 5L2KE 1XMWA 2F53E 2WBJC 3U6RB 4KZDL 3OKOB 3KPOA 1D5MB 3ZTNH 1J87A 3QIBC 5HYJB 3PJSA 1EO8L 5HGAA 3OGCB 3QXWA 1Y18A 1CZ8H 3L3GA 3NCEB 5IOPB 2DI9A 3L3IA 3ZE2F 3FFDB 5HD8C 4UQ3A 5B21A 3D0VB 3NACL 4JFFE 5EU7C 3P9LB 5F7YC 1UXSA 4FQLL 3RPKA 4IS6B 5A2JH 2FSEB 1EHLH 3GEWB 1F02I 1JYWA 2EKSA 4FFWC 4LNVA 1A7NH 2X9WA 1ED3A 2PCPA 3LD8C 1F2QA 3HI6L 4S11A 3PHQB 5BVPH 5HYFA 3ET9F 1MCIA 1JPGB 4PJEA 3SE4C 2GCYB 5FYJD 3WN5C 2XY1A 4OKVB 2G75A 1MCLA 3RY5A 2EYSA 4KTDL 5M94B 4RWHA 4NSKA 5ESAA 5FYLL 4XP4L 2YD3A 4RMSA 4ELKA 3MRRB 4X5XA 1H3TA 2D2OA 3PP4L 3C5ZC 2OYPA 3WKNA 2PXYA 3TC9A 3LEXA 2D7PA 2DB8A 2FGZA 2AJXH 3TO2B 1EEYA 3QUXB 4KROB 5DC4B 2ESVE 1AQKH 4LSRH 1D7FA 5SWSE 3CK0L 4PRDB 2CIKB 1J7VR 4J1UB 3IJYB 4YO0A 4NBXB 4UZGA 1VGEL 3MCLL 4Z7OE 5JW3H 4FQXA 5CIPB 5FYKE 3C09C 4CW1B 1KCKA 4XCNA 5DWUH 5FFLA 1F4YH 5JXAH 1IM9A 1FFQA 3HNVH 4Y0GA 1XF2A 4WU5B 4CN4A 3JWDL 4HC1A 1QFWM 3ESUF 1EHLL 1T0MB 3VXQA 2QSCL 4X4MA 3VWJA 5E5MB 4FFZH 3W2DH 3ZKQD 1T3FA 1VFBA 4O2FA 3VWKB 4Z7WE 4OAWB 1MREH 1A0QL 1U91B 4UDTB 3ZYOA 1A6WH 4RZCB 3CSYA 3D6GA 1D6EB 4ETQA 3GSNH 2YBRB 3EJZC 2XTLA 3TBWA 2PO6A 4A2MA 2O26U 3S97C 4U0RB 3DGCR 1WICA 1JGEA 1NGQL 5I71C 4M1DH 5DD5L 3KPNA 4KDTA 3KWWA 3BE1H 3OWEA 1DP0A 4JN1H 4B7IA 1XFPA 1N6QH 1HXYB 4NKDB 2VO5A 5E03A 5C0FA 5CEZE 2Z8VC 1DN0A 4JEGB 2HT3C 4PB9H 3MCLH 4XNQB 2AXGB 3VDAA 2I60H 3BX7C 2YD2A 5TDOA 1BD2B 1F4YL 5JXAL 1WJ3A 4OSUH 3P3YA 3WNLA 1IGMH 5FB8B 4XZUA 1IC4L 3VFRA 3D39E 5KTEH 5CUSH 3GSWB 5ID0A 2LFGA 1X4XA 1UM4L 2HRPL 4KDWA 1JWMA 3PHQA 4C4KT 3W2DL 4P59L 1J1OL 4KTYA 3MRQA 1OW0C 4PJFB 2FGWH 4JANA 1MREL 3C6LB 1H9VA 5C07B 2YC1A 3PABB 4XGZB 4JVWA 4OM1L 4L3ED 4EDXA 4U7SA 5E1AA 5EU4B 3CCHA 3U0TA 1PSKH 5DK2B 2DBLL 3T3PF 1FN4A 3OTTA 4OIIH 1WT5A 3C60C 1LO3H 3WD5H 1KLGA 2XTJB 3FQXB 3MJ7B 1JK8A 2WINA 1XGUB 1EGJA 1G6RA 4ZG1A 5GS2H 3FONA 1T66D 1DEEA 2EEDA 1JNHA 5JORB 5IFHH 4ESKA 1W8OA 4HJGA 4OI8A 3VFNB 5ISZB 4AM0B 3IXAB 3FQTB 1W72A 3EDJA 4ZOEA 4HZAA 3WN5A 4I18A 3RRQA 5C9JB 1YEJH 1CL7L 1UJ3B 5C0GA 5EH1A 4OCRL 4L4JA 2X09A 1R3HA 4M7KL 5ABDE 3N50A 1TNMA 3GMQB 1UM4H 2HRPH 4N5UA 1I1CA 1N5AB 2BY2A 1FRGL 4AL8H 2X70B 3H7LA 3VWKC 1ZLSH 2FHFA 4GXVH 4OM1H 2XKNA 2WIMA 3IDUA 3S5LB 2B2XH 5ENWB 3I6GA 1JN6A 3V7AE 5DUPH 4HT1H 1DQDL 1T1XA 1YA5A 5JNYA 3UZQA 3KXFD 4OIIL 4M5YH 3KHQA 3VRLE 4XNMB 3SOBH 2ADFL 3VG9B 3RA7H 1X4ZA 3V5DB 2V7HB 5ANME 5AZ2H 2AP2A 5IFHL 2CDGA 2AAVA 4LOUD 1FV1A 2FBOJ 2G5BB 3DWTA 4DKEL 5D1XC 3VRIA 5I8CA 4Y4FA 2FWOB 3GSXA 2YPLA 3RUGB 1OT1A 2BDNL 4MJ2A 4N0CC 1H3UA 1LWRA 5DJ6A 5SWSB 3D2UA 3VXSB 1GGIL 1FSKB 4TQEH 1MH5B 4AL8L 3C9NB 4WUKH 4EDXB 3L1OH 4DUXA 5IIEA 5DS8A 1ZLSL 3VFPA 4X6DA 5E70A 3V8OA 3V6FB 3DX7B 1RU9H 3TYGL 4POZD 3GKWL 2PR4H 2R4RH 5CILH 2H2SD 3SDCB 3VGFA 1E6JL 4PGEA 2NY6B 1JGUL 5DUPL 4HWZA 4HT1L 1G6RB 4PPTA 3EYQD 5B3NA 5I73C 4FFVC 2PYFB 4H8WC 4RFOH 3T09A 4N0RA 4D8PB 3B83A 1OB1B 3P9WB 3BZ4A 5DEZA 3IDJB 3FOMA 5AZ2L 1HN1A 1HSBB 2CUMA 3LH2H 1OW0A 3WN5B 1CCZA 4LKCA 3EO0A 2ENYA 1XGPB 2VXQH 4PUBL 5GGQL 1VPOL 3AAZA 5INCA 4YHLH 1I7UB 5DMJB 2DYPA 4NZJA 4GW1B 2BXYA 2NW2A 2CK0H 5JXEA 4LCWD 3O81A 4ODTH 1H3PH 4GRWH 4XC1H 3H9SD 3OQ3B 1K6QL 4LLQB 4LARL 3L1OL 4ONOA 2J6EH 3SBWC 5F97E 3FHAA 3TA3B 3DV4B 5IR1A 1AIFB 4JPKH 4R7DA 3EYQC 4R90H 4H0IA 2W65B 2J8OA 4P23D 3RJQB 5EG6C 3G6DL 4LVHC 4NHCH 4FQ2L 4OCWL 1I3UA 3MRHA 4PY8I 3TFKD 3MROB 4JZJA 1V05A 3KR3H 4L1DA 1Q94A 3QYCA 5DHYA 5J1AB 3VFGL 4FG6C 1Y6NR 4F58L 3JTTA 3OG6B 5DJYA 5IBTL 3A6BH 1AP2A 4PRPA 3TZVD 1YPZF 1S7XA 1ZVYA 3VXMA 2I25N 2M26A 5F7MC 1YPZA 3ZZ1A 3BYYA 4KQ3L 4H8WH 1AH1A 3QRGH 1U3HA 3VFUB 3MA9H 3ARBB 5H35B 4L9LB 2XN9E 4KXZH 4Y2DC 3WFBH 4QTHB 1S7QB 5BO1H 5KSVB 3RVXC 1K6QH 2CRMA 3VXOB 1HIMH 5ACMA 3MNWB 1D6VH 4K7FB 5C8JB 4PD4K 2X6MA 5JQ6H 1AJ7H 2K7QA 3SHSA 4K55A 3BPLB 2FR4A 1BFVL 1I1AD 3G6DH 5K9JH 4JN2B 1U3JA 3GSUA 1K9TA 5EO0B 2A6DB 4KY1L 3V6BR 1K5NA 4LLYA 3VFOB 4D8PA 3TWCH 1OB1A 3ARWA 2Y5EA 3O9WB 4DOHE 3U4BL 5GZOD 1DQQB 5CGYD 1EFXA 2P8PB 4DVRL 2XNAB 1FNHA 2HJKB 1T1YB 4X9BA 5D7IB 4W6XB 5IBTH 5B4MC 1D5MA 1AD9A 1IFHH 4F9LA 3NIDE 5LQBL 2P1YA 3RWEA 5I6XC 1Y18B 4PJ7E 3AREA 1E6OL 4BK5A 2NZIA 2DYPB 4N8VG 2FATL 1KJMA 1JF1B 5IVXE 2IMMA 1T0NB 3MRPA 1ES0B 2FEEI 5IUSA 2IF7A 1RUQL 1BZ9A 2ADIB 3ARFC 1DLHB 4JG1L 1PYWA 2P8MB 4CJ1A 1CFQA 4PTTB 1H0DB 4JQXA 4CVWA 1LDSA 3X13B 5TQ2L 4UUJA 4UQ2B 5EZIL 1I8IB 2OL3H 3H9SE 2VN4A 2EYTB 4OKVA 1QTYT 2HLAB 1JNJA 1P4LA 2ZSWB 1BFVH 4M4PA 1GIGH 5IEHB 4Y2DD 4PRID 3JWOC 5ESAB 5BOPA 5BXFA 4ZS7L 3I3DA 4A2LA 2UZIH 2BC4B 3ULVD 1NH6A 1QQDB 1AR1D 2EDBA 2W0LA 4GG8A 5CINH 3RZCB 4MVBD 4R0LB 5LQBH 2YRLA 3NIFF 3LHPL 3IAPA 5F9JA 4QOKB 2ZCKH 1R5IB 1DE4B 5MHSE 1XGTB 3HC3H 1VDGA 2EXYD 4UV4L 1OP3K 2YPKB 4U1KA 2FATH 1RUKL 4NWTH 1S5HA 2OMNA 1Y6KR 4JQXC 5T1KD 5I1AA 3JTSA 4KJQD 4KJYB 4C83A 3J7HA 3HUJB 2W9DL 3QXTA 3REVB 3IDGB 2F53D 4NNYB 4Q0XH 4QRPE 4PJHB 5I8KH 4R2GB 2AJ3B 3H3PH 4QRSA 1Y0LA 1JZ7A 3CDFA 3RNKB 1ZLVK 4S10A 4AIXA 3RTQB 5EOCL 2GTZB 5L88H 1F4XL 2UUDK 4M3KB 3VXRD 2Y6SC 4YNYA 4ODSL 5JZ7D 4WFHE 4QT5A 1HYSC 4MNQB 2NXZD 4HLZG 1PD6A 1S7TB 1I7RB 4CVZB 4P3CH 5GPRA 4XPBL 4OZIB 1R3KA 4Z7VE 1RK0B 1YEDA 3D39A 3FHQA 2W91A 3GIZL 4ELMF 3QQ4A 4JFDB 1HSAA 2DQFA 3OSKA 4XNQA 1BJ1J 4UV4H 2R29L 4NJAL 1KCRL 5F89B 4M6OL 4XVJL 3VXUD 1BZ9B 5ADOH 3ZKXB 3WXWL 5KSAC 1QR4A 1MHEB 4Q0XL 3OJDA 5I8KL 2H2PD 1LP9E 5D9SA 4MXWL 3UJTH 3QO1A 2CMRH 5GS1A 5IHUL 1HOCA 2I27N 1B0WA 3WNNA 3HNTL 1P4LB 1CDIA 3C5SA 4AIZA 3ARBD 2ICEA 4C56E 4ZD3L 3K0WA 3FT3A 5KSBB 1P7KA 5FDYA 4M7ZC 3IGAA 1MLBB 3QEUA 3U0TB 1T4KB 4X6CE 1K4CB 4PRHD 4K3JL 2G2RA 1AGBB 2BVQB 4JQVC 5T1DH 5JHDA 4P3CL 3KLSA 2H1PH 4JG0H 2SEBA 3FRPA 4D0CA 1JV5B 3KPTA 4CRPA 2OP4H 5DVKA 2XQYK 5CGTA 1JL8A 5HDBF 1P4IL 1UB5A 4XNUH 5KN5B 4AM0A 4FQ1L 3ULSA 3ARTA 1A7OH 2IPUG 4JY4B 1ZGLB 3R0NA 1BZQK 2AJVH 3KPPA 1AY1H 3B5GA 2AJ3A 1C12B 5I1HH 4LGRB 5D70H 2QHLA 2UWEE 3WXWH 5J06A 3RY6C 3UZEA 2P48B 4GT7A 2FIKA 1I3RB 2HG5B 1CBVL 1AE6H 1EJ6A 5HY9B 1NEZA 3LQZA 1G1YA 4Q6YA 1X5YA 4XNXL 5L0QB 2C26A 2FLRT 3ARFB 1OTUC 5JLZB 1YECH 4LEOA 3PNWB 2VWEC 2MQ3A 2NY0D 2AK1L 5IBLD 2NR6D 4FS0A 4GSDH 4PGDB 3X12B 5GRUL 1N4XL 2P5EB 4YO0B 3MGOA 4F7EB 3LKRA 1DBKH 3WLWD 3GJFB 4ZSOA 5IB5B 3ARDC 2NYYD 4J23A 5IFJA 5EORH 5ICXA 2JJVA 1T1ZB 1DL7L 1TMCB 1ZS8B 3G08A 1W0WA 5DO2C 1JWSB 3FOLB 1DEDA 4JFFA 1PAMA 5ISZD 5DSCA 1F13A 2YUZA 4UAOC 4OD2B 1J8HB 3BKML 1NUNB 2UYLA 3OB8A 4OZ4A 5KBNC 1O7VA 3RZCD 1VFBB 4O2FB 3VWKA 2NR6C 2FD6H 2VXVH 4O5LH 3GSOA 1MUJB 4HCRL 4HG4K 4O2CA 5I1HL 2UWEF 1KLUA 3O2DL 4EJ1C 4YBLC 2X89D 4H26A 2APXA 5C0DA 5CD3A 1S7RB 4ZNEA 1DBML 2NCMA 3ZL4H 4OF0A 4LVOB 5MEQB 2WBJD 3BH9B 5DFTA 1NGXB 4DGIL 4KKCD 4YE4L 3VI3F 2ZOLA 2C7UA 5BRZD 3O6KH 5HYQB 3ZE0F 4KFZC 3C6LD 5JHDB 1CDUA 4QRPB 3HAEH 1KB5A 3JVGC 3ZT5A 1YN6A 2R2BB 4UINL 3ZYJA 1JI2A 4K23L 4NRZB 1T1WA 3K74B 2QADC 1JUFA 1OSPL 4XXDB 1ZA3B 4MX7A 3ESVF 4HLZH 2P44B 3F7YA 1YNKH 3CFDA 32C2A 5I8OH 3MTRA 1MQKH 4MNQE 2B0SH 3FN3A 4WFEE 2ZWLT 3EO0B 2NLJA 1JHKL 1N2RB 5CLTA 2AJSL 3O45B 4QRTA 3AAZB 4W68A 3TESA 4YBLB 2XN9B 2APFA 4XMPH 3QWOB 4NC2B 4IRJC 4HAFA 4PJGA 1KYOJ 1WC7A 1NANI 2VZ3A 3UBXA 1NFKA 2NY5C 2VDKH 1FZMB 1H3XA 4LQFL 4GKOA 3O3BB 3S6CA 1DBMH 1U9KA 3ZL4L 5HYJD 2ZPKL 1U42A 1L0QA 4OBRA 3TN0B 1C1EL 1BP3B 1QPPA 1MPAL 4MA3B 2X7LB 1ZHNB 4JM2B 1GZPA 1LDPH 3CFKA 5EZLB 5ICZA 4MJIB 1PG7L 3ARGD 4NKOA 3SEPA 1IC7H 1KTDA 4HWNA 2VQ1A 3QXAA 4RDQG 1A9BA 3REWB 2IANB 4QXGH 3ZYIA 5F7NC 4F7MB 1ZAGA 3NTCH 5JO5B 1KXQE 1F90L 1X5JA 3BOVA 2AJUH 2FNBA 2R9HD 1MCCA 1M6OB 3QEQB 4NO0B 4WY7H 1CD8A 2IMNA 3TNNB 3C5ZA 5GGTL 1BVKB 5D7KD 3G5VB 3QEQD 4JDTH 1MHCA 3HR6A 4L3EA 5KSUA 4GUPA 1CFNA 1BFSA 1S7UA 5K93A 4PJXF 3FT2A 4NQCD 4OLUH 5HDLA 1D9KB 2BJMH 1UWEH 5LXGL 1UB6A 2GSGA 4WEUD 2A0LC 1MAJA 4HIHA 1YY9C 3EGSB 2DTMH 4NC1E 4XVTL 3ARUA 4GAYB 5E8NB 4YLQT 4U31A 2ZZUT 3SKMA 2VLJE 5KS9B 1QA9A 2YA1A 4R2GD 5DVLA 3RBSA 1KCSH 1A8JH 3QWRA 5ESVB 3RGHA 4JLRB 4Y19A 5T3ZE 2D31B 4FQIL 1A2YA 3WXVL 4MXQD 4TULL 5B38G 4WUUB 1BOYA 3EHBC 4NKIL 4BQCA 5DRNB 3KAAA 1SJXA 4Z7UA 4H5SA 3QCVL 1G7PA 4DKDC 2VITA 5JHLH 3TYFA 1QFWL 3E6FB 2QQKH 3HS0B 1E4WH 5DK0B 3D3VD 2R1XA 4G43A 4OM0H 4S1QL 2XA3A 1MFDL 1MFNA 3CX5K 3RIFF 2XXCB 2HVJB 1X5GA 3BN3B 3DETD 3FAWA 1BBDL 3HNSH 2FJGB 3QDMA 4WFED 3OAZH 4G3YL 2IBGA 2PYEB 3NIGF 4R6UA 4X9IA 1CK0H 1ND0A 2UVFA 3MRPB 3JVGA 1G0YR 1QSFE 4ODUA 3UTSE 4IRZH 2D7QA 2JJSA 2DTML 4D0BA 1KELH 3NH7L 4PJ9C 5AZEH 5I1EH 2NY3B 1YY8A 2X1XR 1IQDA 3CVHA 5DT1H 5EU3B 3CFCL 4NKOB 5KVDL 1LO5A 4JRXE 2YK1H 5DDHA 1P9MA 1H5BC 2ORBL 1I8IA 3MV7A 3PWPA 3VD7A 1NCCL 2AS5M 5EZJA 3GNML 1VESA 4PBVC 4XCEA 1I1YA 4MD4A 3QEQA 4MJ6A 5F96H 2D9CA 4M5ZL 5HHVL 3V0AC 1SEQH 2FO4B 3ROLB 1QFWH 2PW1A 3GBML 2HWZH 1S9WA 4WHTB 3ETBF 1UYWL 4ZUWA 5FOBB 4R4BA 4BH8A 4BKLB 4GBXC 1T83C 4PP1C 2LQRA 3F62A 3ROOA 5C9KA 1QR1B 5FGRA 5B4MD 4PJBF 5ICYA 4UBDD 3MXWL 1IGTA 2P45B 2LU4A 1L9NA 4HK0A 2DQGH 4EOWL 1YEHH 3GSNB 5HDOA 3WMSA 4CL7A 5LGHH 2I9TB 3K81A 5DUBA 1EBAA 4XTRD 1CIDA 4CNIB 1CICC 4U0RC 5D7LD 2FEDD 3E6HA 4RMQA 5DYOB 5DZNA 5K33A 1Z5LB 3C09B 5H94B 4ZO7A 1B0GA 2ZG2A 3BEWB 5KVDH 2X4QB 5ID1B 4HD9A 4GRMA 4H0HB 2BSSB 1T80A 2E7LC 2HN7A 1T20A 1NCCH 5CFHA 2XWBB 1EEYB 2RHEA 4Y5VC 4MNHA 2Q7YB 4JFED 5IJVB 1S7XB 4WFFD 1NDMB 1NGZB 3VXRA 4L3CA 2Z91A 4QGTA 5F1KC 1J0ZA 2P24A 4L8DB 2X4SB 2PW2B 1BOGA 3VDBA 3EZ8A 3GI9H 4JAMA 1V7MH 5I76B 1MF2L 1XF5B 3TVMB 1B0RA 4S1RH 3BMVA 5IMMB 1CDBA 5HPOA 4P23A 1CICB 3O3EB 4HIEA 1YEHL 4KJPC 4NO5B 3MJ8A 5CWSB 3SKNB 3ULUH 4HMCA 4LP5A 2GYSA 3FFCA 4ZFOA 3OR6A 1JWUA 2GAZB 4JFPA 4NN6B 5I1DA 5C8JA 3L3OA 4DQOH 3MV7D 1ORSB 4CMMB 3T4YA 3ORJA 3L9RA 4LSDA 3VMPA 4KTDH 2J4WL 3MOAL 4HUUA 3DURA 2A6DA 5CBAA 1DQJA 3BPNC 1U3HD 3DLQR 3B2UC 1X5AA 1RZJH 3QI9A 4NN7C 5EC2A 1IE5A 3G04A 1IRAY 2PO6B 5HBBA 3UPRA 4KVNL 5C3TA 1T4KA 2ID5A 2O5YH 1J88A 3W82A 3GMMB 4OF7A 3CK0H 3WLBB 1HH9A 1SYVA 1JGEB 4QRPD 3SKJL 4PRPE 2Z93A 2Q1EA 4OLYH 1VGEH 1FL6B 5E6YA 5JW3L 3QIWA 2ED9A 3KPRB 1RZKC 5IFAL 4NO2B 4YBQD 4NRXB 1IGTB 5IB4A 2OR9L 4LL9A 2P47B 4Y5YC 2P5WD 4ORZC 3FB7B 4L3AA 3HE6A 3HMXH 3L7EB 4AH2A 1UH3A 4N90D 5I17A 4O02H 3TH4T 5J13C 5C09A 2XFXA 4QYOB 3NZHH 5FECB 3WLWC 4PJ8B 1RZKL 3SE8L 4NDMA 2YWYA 1KJVA 1B0GB 2W59A 4KK8D 5DJAA 4FQCL 5D93C 2MSPA 3WFHB 4Z95H 5DTFB 2BZDA 3PWVA 1CXEA 3MLXH 5HHPB 5I1CL 1F4WL 4MNHB 2HJLB 5DD5H 4KVNH 4JFYA 1JK8B 2WINB 2Z91B 4WRLA 1L6ZA 4JREB 3B2VL 4OUUA 1LE9B 2QQNL 4QHKI 5GHWL 1LE5A 3BSZH 3UJIH 1T6VN 4LHJB 3MCG1 5JDSB 2P4AB 4P3DA 3NIFE 1RZJC 1CICA 5E7BA 3IU3A 2P49B 4ZOBA 5DQDH 4KC3B 3U2SB 4ZFOB 2R0KL 5EFIB 1JWUB 4QRSB 4EN3C 2AEQH 2YMXL 4PRIA 1FNGA 3GSVB 2FZ3A 1RZKH 4TTDC 1NAKL 5F8RC 3MV8B 1K2DB 3NABL 3ZLQC 2MHAA 1VENA 3EYSH 4K9EC 5KANI 4C4KO 4GKZA 3QAZC 3VWKD 4HEME 5IKCB 4XP1L 3ILPA 2NY3C 3P40A 3RWDA 3U7YL 3W0WA 3P4NB 1ZKAA 4D94A 5C0NC 2ZJSH 4HDIA 3D85D 1F4WH 1L9MA 3N85L 1YEDB 1RY7B 5D71L 1MJ7L 2FLBT 2VLRB 1JGVH 3DSFL 5HYIA 4P2OD 3PV6B 4POUB 4NBZB 5I66B 4A6YH 5B22A 5IV2B 3G6JA 4D9QD 4O51B 4IOFD 2QQNH 1N3NB 3LPGA 3VJ6B 4F37K 2CLVB 5IB1B 1ZOXA 1RV6X 3GRWL 5F89A 1CL7H 5F3HA 3H3KA 3TN0C 1FG2A 3QUZD 2RJMA 2ADGA 2GSIA 5I8CB 2BRQA 4R0LC 1NC2D 2X4RB 1AO7E 3BISA 3MV9D 5C09B 5F72S 4ERSL 1UM5L 3V2AR 1PBYA 4QWWD 4HUMB 1R3IL 2I5YH 1WVZA 4PJIE 4N90E 4OCSL 1P84J 1I4FA 2B2XL 1A7PL 2ILLA 3BGFC 5JW5B 4KJWD 3A67L 2QQLH 2EEAA 4YGAB 4J7RA 3WFCL 3RGVA 1FORH 5KSAB 4AMKL 2DI7A 2DRUA 4FQXC 3MOBL 2VZVA 1KPUB 4RFNC 3H9SA 2VQ1B 5I6XB 3NGBB 1A9BB 2CIIA 3QQ9C 3UPAA 4WO4A 1PKOA 4TVPL 3BP4B 5JOEA 4LDOB 1NLDH 3BQUB 5GQBA 1H3GA 4IHOB 5EPMB 5MERB 4QXTA 1S9XA 1T7ZA 2XN9D 3FO1A 4FZEL 1NUFA 5JQHC 5E5MA 1VADA 2AJZB 1TZGH 4L3EB 3QNYB 5ALBH 3S7GA 5B38B 3ALPA 1UM5H 1WBZA 2NW3A 1TENA 3I3EA 1CT8B 4WUKL 5SX5H 4UDTA 1BPVA 3ARRA 2IPKB 3ZKSD 3D9AL 3QUMH 3SJVA 3F7PC 3WFDH 3B9KA 1RU9L 3GB7A 2ENSA 3TYGH 3ZSTA 2GIYA 4IOIB 5FO9B 4YZFE 1GPOH 4JFEB 3DO7A 4FNLH 2W38A 2H32H 5ICYB 3OV6A 1Q72H 4NM4H 3MC0A 3W5MA 4PLKD 1ZANH 5EN2B 3MRHB 1M71B 4BQ8A 5JZ7C 5KVGH 2JJTC 4ZDHA 3LH2L 4MNGA 2RGSA 1A1MA 4EUPG 2EIZA 5A43C 4LCIL 4KJPD 4ZTPL 2WIIA 4Z7UF 4V1DE 2A9ML 4WUUD 3QDGE 4FZEH 4ELMB 2YD5A 2GT9B 1TZGL 1KLUB 5JUEL 1WWWX 5C08D 2CK0L 4RGMB 3BJLA 1NCNA 5FOJA 1R3LA 4PJEE 1AO7D 4OZHE 4F8QA 1TJIH 5FYKL 3QUML 5K59E 1FQ9C 2CK2A 2QBWA 3WFDL 4P2QA 5GGSA 1OAUL 3NFSH 1TPXC 3KPSA 5JIIA 4FNLL 3CH1B 1YY8B 2A2QT 2YUXA 2BNRD 5F1SA 5KSAA 4NM4L 2Z92B 1UWXH 2FR4B 3QNZA 3VI3E 3BRDA 3AU1A 1RJYA 4NUJA 5CSGA 3INUH 3VFSA 2HTKD 2MTPA 4QO1A 3WIFB 2VAJA 3LQMA 3VGGA 1T21A 4R4ND 2Y25A 1A6ZB 3ILQC 2FX7L 4KROD 1T1YA 2RIKA 1IC1A 4ALAH 5HXMA 2ATPB 2YD8A 3EOAB 3SY0A 3GFUA 1ZLVH 2A9MH 4PJBA 3CLEL 1BQLH 4MMXC 2PYED 4Y4HA 2UUDH 1FCGA 1I75A 2ITDA 3MA9L 5CEXA 3QHTC 2E7MA 3HG1A 5JW4N 3O3AB 3UBXB 3MLYL 3OXRA 1HE7A 1OM3L 2OTUA 3SDAB 3IRZA 4LCWB 5FYKH 2HMIC 4OZFH 1C5DB 4GKSB 1WBYB 3RWIB 1FSKC 2HT2D 3MV9A 3DARA 3O41B 3HMWL 5H94A 4XNMA 3QSKB 3U9UA 5D2NB 1IKNA 3X14A 5F9OL 5EIIB 3LKNB 4MLSA 3GGWA 5TGBB 4JZOB 4LMQI 3U46A 3UTPD 2R1WA 2AJYL 1ZHLB 1ZT4B 5MEPA 3BRFA 2HFEB 2WLYA 2DLFL 5DR5L 2PTTB 1A9EA 3H42H 5E8DH 4CU8A 5LGJB 3QZWA 3AM8A 5FDWA 4YQXH 5HYJA 3DBXA 2VDRH 1G7JB 4CVUA 4GAFB 5TQ0L 1Z6JT 2QR0B 2W07A 3GO1H 3L3GB 4NWUH 5IOPA 1HEZB 1RUQH 3GIVB 4F7PB 4LP4A 4DTGH 1KG0A 1ACYL 4Z9KB 3QQ3A 3BP6B 43CAA 4P9MH 3VD3A 5EZIH 2BOBB 4HWZB 3ZT6A 3RZWA 4RGND 5JOFA 4JDVB 3CSBA 4XTRC 4J8RB 2VL5A 4OCNC 3WUWB 3OBAA 5CZVL 4BSVA 1M7IB 3WBDA 4MXQC 2F54D 2BY1A 3WIFA 1S7VB 4RGMC 3KNBA 4X4YA 3PIQA 3V5HB 4MNQA 2JTDA 1CXLA 4J3SA 5CINL 4ONFL 2BY0A 3WIIL 1NL0L 5DC0A 1KPRB 4U0QB 4X99B 2EYRB 3ZDXE 1BX2A 2ZCKL 3SDDD 2R0ZL 2Z8WC 1BWWA 2P5ED 1TETH 4KTEL 2GFBA 5C6WH 4XP6H 4XAKD 4F7TA 4JFDA 2VISA 1MNUL 3AS3A 5SV3A 1M7DB 4I3SH 4DN3L 1BEYL 5AAMA 5D5ME 3TNMB 3GO1L 3GMLA 4ODUB 2V2TA 1HDMA 3DVNB 1FVDB 2CO6B 4M7LH 1VB9A 4PP2B 1LEIA 1NBYB 3IFPB 4Q9QH 3PDOB 1HXMB 5CJQH 5EOQL 3GUTB 1ACYH 3FB6A 3DMMC 3MV7B 1EMTL 1GCFA 1G7HB 2IEPA 1RUAL 1TNNA 3U9UB 5IMOA 1ZHBB 1BQHB 1XGRA 4Y19E 1OAYL 5DMIL 1MY7A 1N8ZB 1AO7A 3SE3A 4XCEB 5E2TH 5E6IC 4TUKL 5IW1B 3VFWB 4Y8AA 4E0RB 2CH8A 1VACA 4IM8A 2RFXB 1D5BA 1UVQB 3LKSA 2LTQC 4MAYC 4TSBL 1AGCB 1D6EA 3VXPA 3D48R 4ETQB 1RZ8A 3GIZH 2ZCHL 1JP5A 1N0LA 3IFNL 4KTEH 4HH9A 1CF8L 2EH8H 2OM5A 2AXFB 1BHGA 4LLMA 3CDCA 2ATKB 2K3TA 1KCRH 4RISH 5DVMA 4I3SL 5E8OA 1BEYH 5HHOD 4CVXA 1OPGL 4AENB 4XP9L 5CP3A 1EO5A 3OKDB 1P6FA 3GRWA 4XVUC 5F1IA 3BKJH 2WLZA 3BUYA 4PRIB 4Q9QL 4ODVL 5FUOH 3HNTH 3SDDA 5I1JL 4WEBL 4KK5C 5JOFB 2HTLD 2ADJB 5JPNB 4YAQB 5A3ID 5BJTA 3MUJA 4EKXA 5B39A 2E6PA 4DGVH 4GKZB 3RKDC 3WHXA 4D3CL 1AXIB 4HMDA 3Q48A 1EFXB 4XPTL 4P3WA 2CKBL 1ZK9A 5D7IA 3JSSA 4XGZA 4JG0L 12E8H 3ES6A 3T0XA 5T1KB 1QZ1A 4TSBH 4Z7VF 1QACA 3CU7A 1LILA 1BAFL 2F58H 3GJFA 3T0EC 3IFNH 2A9NL 4WENB 5CSZB 5E99H 1F5WA 1MCEA 1MIMH 5F7FA 1RJZA 2X42A 5LVEA 3Q5YA 5DJDA 2EDJA 3QA3A 1N0XH 1QG3A 1INEH 2YXMA 4EDWL 4LHUA 1G9MC 1X4YA 3QIBD 2ADIA 1J8HA 1AKJD 1GVIA 2EE9A 3C8KB 2D7TH 3IKCA 2RR3A 3E2HC 5CHNA 4DCQB 5I1DB 5IP4A 1T83A 1QSED 1DDHB 3GSOB 3QEHA 5SWSD 3X13A 4H25B 4N0FA 3HG1E 3MX0A 5T3ZH 2BNQA 1YEIH 5C0GB 4H88H 3ZMRA 5I75B 4H26B 1KIRB 3HE7A 1NC2A 3FN9A 4N5ED 3KJ6L 4EIGB 4QTIL 4AIOA 2OTWB 4N8VB 1YEEH 2V2XB 2OQJB 3DI2B 3U6RA 2OSLB 5FO7B 3D39D 5CKAA 1QFHA 1KENH 4FRWA 1IM3B 3PGCA 4GG8B 4GSDL 5GRUH 2AEWA 1N4XH 1QRNA 2CLZB 3OX8B 4WVRA 4HC1H 3QIWB 4Z7UE 4J3TA 3RDTA 3MBEA 2F58L 5AAWA 4ZFZA 4M93C 1Q9LB 3RNQB 4PJCE 3IS0X 4S0TD 5HVGB 2AEPL 4C54A 1MIML 5D5MA 2C3VB 2Z35A 1NFDE 3Q6GL 4XWGH 2O5XL 3Q0HA 1N0XL 4OZHF 1LEKB 4Y2DA 3OKDA 3O45A 5J57B 2FX9H 3QXUA 3O2DH 1VFOA 4WTZG 5LWYH 2BCKA 1S9KC 2XRAH 4PJAB 1R24A 2NW3B 3TIDA 2JLLA 5JA8B 4XBEH 1W0YT 3AY4A 4QLRA 4YE4H 3B9KB 4U6YA 4WI5A 3G9AB 2BMKB 4ORGB 1MVFA 4G8EA 5CP7A 1EZVY 3MV11 3B4NA 3MV8E 1B4JH 1CVSC 3L3DA 4JFYB 4FTVA 2YRPA 3FB8A 1J8HD 4OLVH 1WEJH 2BVYA 4I0CC 4YIQA 3VE0B 4OQTL 1ORQB 3QHZL 3SDCA 4LKXA 1HNGA 5DJZA 1NUGA 3P4OA 3BD5A 5EBMB 4LSVH 2HP4A 3BO8B 1BJ8A 4EXPX 2XV6B 4CADA 5K9KA 5GRWA 4YDVA 1WISA 2O5XH 2YPLB 2VLMD 3RUGA 1U8OA 3B8SA 5E4IA 1FYTE 3SDDC 3U7AA 4JJ5A 4KMLB 3QEHB 3C60D 3QFDA 4NKMA 4PRAA 5SWZA 5KW9L 4TNWK 3OGCA 4AIZB 1OGTB 4RAHA 4JZJC 4W6YB 4KHTL 3MRCB 1UA6L 5HGBB 3B5TA 3IGAB 5HGHA 4XBGA 3V6FA 4YDKL 1V3MA 4Y5XC 2R0LH 4U6XA 1LDPL 4Y2OA 3VH8G 2X41A 2EE3A 4N1EA 1NSNH 4YGVA 3RDTD 2DF3A 4PGEB 5F7KC 5IW3A 2QSVA 2FB4H 5IF0B 1BZ7A 4PYGA 4OLVL 1WEJL 1ZE3C 5IV2A 4O51A 3TT3L 1AIFA 1BFOA 4R7DB 35C8H 3VRJB 2ED7A 5H37G 3C60B 3VMNA 3LPWA 4JE4B 4YWGL 2AJUL 1GC1C 4HXAL 4TUOB 4YEFA 2V2WB 2AXJA 1A7RL 5FUZL 4JCLA 4LSVL 4F7CB 1INDH 1MCWW 4Q9BA 1NCUA 4LVNB 1B2WL 4J2XA 5E9DB 4RRPG 3LV3A 5IESH 5EB9A 1G0XA 2BFVL 5JHDD 4ZAKD 5KVEL 1NCBH 4O9HL 3PABA 4I2XE 4U7KA 5DGRA 3CDGA 4ZODA 5BRZB 2WWMD 2Q3ZA 4K3DH 4HWBL 5F1NA 3ARVA 1RK1B 4P2RE 5JW5A 4V2CB 5T5NF 2Q20A 4GKSA 1FZJA 4OI7A 4YDKH 3HG1D 2IJ0C 2UY6A 1DVFC 5D72L 4FTVB 4LCCB 4LMQE 4KGLA 4TULH 4PJ5A 4XP5L 3LQAC 2OTPA 2CIIB 5E9DD 3DX9A 1ETZA 1MCFA 3VXME 1GGUA 1ZS8A 3G08B 4JFOB 2DWDA 5JHLL 1QEWA 3FFCE 4L8BB 4MD4B 4O00A 3VD9A 5FCSH 4BFIB 3O0RL 2CXKA 5C9JA 3GSUB 3DROB 4OZGA 1H3WM 3DV6B 4J6RH 1BLNA 1DQMH 5K9KB 4LQ1A 1UGNA 3H6JA 5D93B 3RGVD 5IROA 2A77H 5ESQB 5E7FA 4KKLD 4GMSL 1QKZH 1DBBL 1G7IA 4GBXD 3HZVA 5IESL 3ZDYE 1BBDH 4PJXE 2V7NB 4WI3A 4M6NH 5DD6B 2WUBH 4PJDE 3SQBA 3T0WA 5KVEH 4NZRH 4OCYL 2ZG1A 2Z31B 2XKNB 5FAAA 2Q8AL 5HGBA 1FLTX 1KB9J 5I1EL 1YUHA 1SBBA 2YSSA 5ETUA 4KV5F 2X9YA 5ACZB 3O3DA 1Q9OB 2YD1A 3VXSD 4I0PA 4NGHH 4OD3L 43CAB 4JPWL 3O3UN 1BFTA 4G7YL 2RQ8A 4HZLA 1YN6B 2R2BA 2KZWA 1W72L 3KPMB 2B1HH 2HN7B 1M7XA 5BVJB 1EO8H 1GGTA 2R23B 4QNPF 2DMKA 3UYRH 5HHOA 4YJZL 3PIQB 5AUMA 3C6LA 3CFDB 5C07A 1AKJB 4M62L 4YXLH 4F7CA 4G8GE 2FEDC 5IEHA 4EQ2A 3FMGH 5D7JB 1FCCA 2DQEL 4MHHI 4WFHD 3L5IA 2GFBB 3AREB 5F6IB 1IGJB 4MDJA 3P0YL 4MSWA 3S34H 4NN7B 2DQGL 4P46D 4FQHA 4PJ5D 1A7NL 4K07A 4R97C 1HHKB 4NYLA 2WUBL 1MHHB 2FYYB 2ZSVA 5BVPL 3TBTB 1JZ4A 4XVSH 3CX5J 1IAKB 3SJVE 4JFQA 1I8LC 4FQQA 3TN0A 3O4OB 1FNEA 3GHBH 3HZYB 4B7LA 3BIAX 3MLRL 4XPGH 3BDBA 1DUYA 4K7PX 5AG9A 2EKSB 1CGXA 2VAAB 4AEHH 3M8OL 1BIIA 4JPWH 4G7YH 4KUCD 2VUYA 2AJXL 4XCYB 1EUTA 1DQJB 1CLCA 4H1LH 1NCTA 4LSRL 5BXFB 4M1GH 1PFCA 1NAML 2GW5A 1IM9D 2XOTA 3QUYB 5EC2B 3G04B 2ARJA 1T5XB 3UYRL 2ATPA 3EJYC 4PBWD 1RUPH 2ESVA 3O6LL 3U4EB 4M62H 1AGCA 5DWUL 5HYEA 2XWJB 2A73A 3IDXH 4MB4A 3GI9L 4M00A 3HNVL 1V7ML 5D2LB 2NY1B 3O4LB 2E7CA 4QRRD 2ICWI 2NW2B 3PL6D 5DD6A 5HHMB 1X5HA 2QSCH 4FFZL 4FQJH 1KTLB 4YHZL 1QRNE 2C1OA 1I7ZB 3ULUL 1J0YA 4ZS6D 5DD1L 3QDJB 1JBJA 1HSAB 1RVFL 4DQOL 5IR1B 4NCDA 4YHIB 4EBQL 5J6HB 3O3DB 2A6KB 4I0PB 4MJIE 4L9LC 5C0RH 3GHBL 7CGTA 3GSNL 1YEFL 1A4JA 3BI9X 4KJWC 2ADJA 1F97A 3D5OF 2BSTB 1N6UA 4X7EC 1AC0A 5D6DA 1NGQH 3QULA 4M1DL 4G8IA 3CMGA 5ITFB 3R8BB 5EZOH 3G6AB 4YDJA 1OARL 3CSGA 2P7TB 4EVNA 4RZCA 1N6QL 2HJLA 2E5EA 1FYTB 3CU1A 3P4MB 4I8DA 3DYOA 4K7PH 1RUPL 5J9PA 2G5RA 3KLHD 1A6AB 3EKCA 2D4DA 1IGML 5A2FA 1S5IH 4WW2B 4I4WB 1OLZA 5J13B 3HMXL 1P69B 5DRWB 4M7JH 4Q6IB 2FYYA 1U6AL 2ZSVB 4UT9H 3QHFL 1I1AA 2JCCF 1KGCD 2XACC 1XCQB 3QA3B 4YHZH 4CN1A 1G9MH 4O02L 4NT6A 5ITBH 2XWTA 2DTSA 2NXYD 5DD1H 2C1PB 4PY7B 4HFWB 3AB0C 5F7HA 2WQRA 4NQDB 4AY0A 4U1JA 5FKPA 3QO1B 3SKUD 1OAQL 1ZGLP 3OHXB 4ETYA 1K4DB 1TQCC 3QIBA 1UCBH 1BJ1H 4X4YB 5I15H 1P4BH 4WFGD 5C0CA 1RZGB 4HKJB 3W9EB 3MLXL 1JMZA 2XI9A 1IGIH 3STLB 1MLBA 1YYLL 3N9GH 4APQA 4Z5RA 3N0PB 4GJTB 4WJ5A 3BDYH 2ZUQB 3U4EA 4KI5F 3RWEB 5HDQL 4P4RB 1F11B 2D0HA 4K7PL 3RVWD 2QHRL 2IG2L 3ARZA 5A2LH 4OGYL 2OBGA 5IB3A 1L6XA 1T0PB 1IKFH 3NZ8B 2NQCA 3OG4B 1S5IL 3GM8A 1W8NA 4LLDB 4OFYA 1ZSDB 6FABL 3FO9A 3LKRB 4PV8A 2ADGB 4F37F 1U6AH 1DLFH 1PYWB 2P8MA 3H3BC 4QRRE 2H32B 3KPQB 4PJIA 4RQQB 3IXAA 4JRYB 1JWMB 1MCKA 4XI5C 3DRQA 3FB6B 1MWAA 4ODHH 5FYLE 3V52L 2H2SC 4PJ5E 1BD2E 3K3QA 4MA8H 3RWGB 3NABH 3BD3A 2IFFL 4JANB 2IH3A 2MQCA 1ZTXH 3LS5H 1DUZB 5HHNB 1WAAA 1AGEB 2DQUL 4BSJA 2FX8L 4E0RA 5I15L 2EECA 2RFXA 5FYJL 3RDTC 2X70A 1KN4H 1CLYH 1ZT1A 5I9QB 4X8JA 3RZCA 3ISWA 1S78D 4LPWA 5J9PB 5GIRA 3BH8A 2OJZL 4RIRA 1QSEE 3MRDB 3QDGD 5C3LD 3TJEH 3VG9C 4HH9B 4FFWD 3BAEH 4OCXH 4JRYD 4KK9D 1LMKA 2C4XA 4P57A 3UBXI 1FL5B 4P4KB 4IOSD 1S9YB 2JJSC 3KPSE 3E3QE 4I18B 1T04B 3LN4B 4WI6A 1T1WB 3REVA 6FABH 2H45A 1G7MB 1HHIA 3BGAA 1GGIH 5KSBE 2PXYC 2LABA 5DJXB 2H26A 2LTQB 4I2XA 3ZKNC 5IW6B 2P8PA 3VRIB 3QJHB 5CCKH 1VGKA 3PDGA 4Y4FB 5SWZB 4B53A 4WW1A 3F5WB 3V52H 4B41A 4OCSH 4YAQA 2CSPA 3OF6A 4WGWB 3QIBB 2AABL 3NA9L 4QY8B 5HHME 4O58L 1E6JH 2IAMC 5C7XL 4ZFGL 1J05B 1MSPA 2GITA 2ARJQ 4GRWF 1IC5L 4N9GB 1TQCB 5T5FH 1T1XB 1SYVB 3IU4H 4U1LB 3TCXA 2KBGA 5LG1A 4DAGH 3D39B 1A64A 3G5YA 4NRYA 5DQ9B 4TSCH 4NRZA 3MZGB 2OZ4H 4M6AA 2M1KA 1NLDL 5TF0A 4JQVA 2VXQL 1NBVH 4JO1L 2N7BA 3QRFM 3S37H 2Y7QB 3P11L 2V2WA 3NIGE 3O6ML 3TPKA 1FBIL 5J3HD 4HSQA 3S5LG 5ALBL 1MHEA 4U2YA 4UIMA 4ELMA 4HPOL 2VXSH 3MJ6A 2K1MA 1H3PL 4XC1L 1FNLA 4RAUB 4X80H 1GZQB 1XGPA 2DN7A 4PLJD 3E8UH 5CCKL 1NC2B 1T2JA 4W81A 4GUPB 2N7AA 1I7UA 4DJMA 1GPOL 1X5LA 4JB9H 5C0CE 2OSLA 3FT2B 4PBXA 5C7XH 1Q72L 2EZ0D 1X7QA 4P5TB 4JKMA 2QJDA 1YJDL 1ZT1B 2YPKA 3KR3L 4YPJA 1RZIB 1TJGH 4IS6A 3B9KD 2H3NA 2N4IA 2J8UF 5T3XD 2IQAB 3WJJC 4NPYB 3RPIB 4URTB 3THML 1KN2L 2JF1A 1FO0L 1M1SA 2FH8A 4JCMA 4PJ7A 5IB2A 4Z7NE 1QFWI 4G8FA 1ZHKA 1SJHB 2PETA 8CGTA 4TSCL 3O8XB 5JO5A 4JRXD 1MIEH 3RHWF 1YNTB 1Z9SA 3IFOA 1CLZL 5KJRH 1D5ZA 1L0XA 3U1SL 4PP1D 5I1IH 3DSNA 4XMKL 3K2UL 3UC0H 1RIVL 3O6MH 3OGOE 4GS7B 5EFIA 2Y07H 4X7FC 3O11B 5CBEA 3MRIA 4HPOH 2DLGA 2FIKB 3TIDB 5INDB 1EAJA 5I19L 3QH3B 5GSRA 3BRGC 3S37X 3P0VH 1YYMH 4K8RD 3DJ9A 5JQ6L 3OKEA 3AS2A 4LCWA 2YSSB 4BELD 1FNSL 5JOPD 4L1HA 4ZQKA 3HFML 4ONHA 1ZVSB 5FYKU 2AW2A 3U4BH 3QG6A 3OPZL 3G5YB 1Q94B 4HUWA 2BVOB 4XBPB 1IFHL 3V5KA 4LKXB 3BFOA 5I16B 4U1MB 5DJYB 3WUWG 4PJFE 1HNFA 3PWPD 1MIEL 2VZ1A 4KVCL 1G9NH 1FE8L 3VW3L 3RX8A 2E3VA 1SQ2N 5E2UH 1MFEL 4HBCH 4MJ6B 4YPGB 2AV7A 4ZYKB 4GXUN 4NM8L 2BVQA 1MVUA 5LBSL 2VWEE 4WHTA 4I0PC 5FOBA 2BVUA 2IALB 2BOCA 1R3JA 1MEXL 3A0OA 3LEYL 4UT7H 3EDFA 3S88H 3P0VL 1YYML 2OL3L 5C2BL 2NXYB 3K80A 4P5TA 2DWEA 4EZMA 3BGMB 1GIGL 1IAOA 1CGSL 4OV6F 1KB5B 1TTUA 3GSQB 3RPIA 3T4AB 1PEZA 5DDHB 4MA7H 3LS4H 1IAIL 3L7FA 3QO0A 3DECA 4NZUL 2J8UA 3QPQC 5E00A 4ODBD 3WS3A 1NANH 2AJYH 2HLAA 4IHOA 4TUJB 1YNTA 3IFOB 3LSOB 2MNUA 2BSSA 2C4FT 1FC1A 4LBEA 5E8DL 1BX2B 3OAZK 1CDCA 1OAXL 2EDKA 3C2AH 1WBXA 1G9NL 2CO7B 1U0QA 5JDJA 4YQXL 5EUKA 4R4BB 5H2BA 4BH8B 1I85A 3GDBA 5E2UL 1I8LA 1MFEH 5TH2B 4I9WE 2AEIT 3ARED 1WZLA 2FHCA 5F9JB 2IPKA 4IRSC 3SJVB 4LPXA 4FA8A 3MODL 4K94H 1BVZA 1NFDA 1FVDA 5GGVL 4P48A 3LEYH 5LGKA 3K1DA 4JFEA 5L88L 3DO7B 4HJGB 3E3QC 5ISZA 3VFNA 2OS7A 4LF3B 3JTSB 4JGJA 3UTTD 5LAXA 1KIQA 4WI7A 4WTXA 2P8LA 2D9QB 3D3VE 1JIBA 2JB6A 4KXZI 2W0KA 1NKRA 3EOBA 4L8SA 2CLRB 3GMQA 1G7QA 5TFSL 3ZE1F 1P7QD 5IW1A 4NO0A 4NZUH 3GKZA 5AEAA 2XA8L 3IYLW 2R56H 3ZHKA 5ANMA 3BKCL 1TETL 4KI1A 2NPLX 3MRGA 5FA4B 5SX4I 3S8WA 5JA9A 3KYKH 3EFDL 3F58H 3VD5A 3UPRB 3G6JE 2VLKD 2V7NA 2XT1B 3QZWG 1XGTA 2IADB 3DETC 4DN3H 4X7CC 1R3KB 3CPLB 3JXAA 5I1AB 2C3WA 4P99A 3QQ4B 5IMKA 3MUY1 3MLSL 1XCQA 3V5DA 4NO2A 3SKMB 4IJ3C 4K94L 2DWEB 1XIWA 3AS1A 2VRAA 5ESVA 3CJJA 5M7QA 1EMTH 4Y19B 3WNOA 3WIHL 3WNPA 3GSQA 2JB5H 2R0WL 2RCSL 1NC4A 3HC0A 1BJMA 5FKAA 4U1JB 1OAYH 2B39A 2VB5A 5DMIH 3VFSB 5FUCE 5IHZA 3PHOA 1KEML 3K4AA 4P2QD 2MPAL 4P5KA 1E28B 4OCMC 3KDMB 3FB5B 5T33H 1OAKH 5KSAD 3SY0B 1IJ9A 2DQHL 1P4IH 1CXKA 4ELME 1P7QB 3BZDA 1WCBA 4P4RA 3ULVH 1MRFH 3PWVB 3RUGE 5GS0D 1CF8H 2EH8L 3SDCC 1A7OL 3JWOL 2VL4A 2R2HB 4TSAH 3QDMB 1DSFH 2D3VA 4HXBH 1C7TA 5IHBA 1FYHB 1AY1L 4PJIF 4LLDA 4ZPTB 5BV7B 3UDWA 2EH7H 3REWA 3RGVC 3S4SB 2IANA 4XCNB 5JDSA 5HYSA 3TPUA 2ZCLH 1T66C 1AE6L 3BKJL 5EU3A 4JKWA 3C5JB 1UH4A 3RU8H 1GOFA 3MACL 4PGJA 3D2UD 4XNXH 1KJVB 3T2NL 2RCSH 5EU6B 3TM6A 2DJUA 3GGWB 2CKBH 4JZOA 4G5ZH 4GXUM 5KAQG 4F15B 1KGCE 5L2JA 3KYOB 1ZHLA 5DHXB 3GMOB 4UV7L 9CGTA 1QBBA 4D0CB 4ZUUA 5JLZA 1Q0YL 1OP5K 5AWNH 3DVIA 3HI1B 3ULVL 3D87B 2X4UA 4X6CB 3SKOB 4ZO6A 1J18A 4RAVB 4IRJD 1INEL 4EDWH 1ONQA 2FD6L 2VXVL 2A6JA 3H2WA 1SEBB 4LGPB 1OWWA 2HT3D 4PIRF 3SDYH 4N0CD 3OKNA 1FIEA 1G7MA 4YHIA 1N5YH 2NXZB 5SWQA 3LRHA 1AR1C 2X1QA 2RB8A 4P23C 2DQCL 1FG2B 3NCFB 3DPBA 3ULVC 1X6NA 3MUGA 5FGBC 1AFVL 1F3RB 3MV8A 5E8EB 3T2NH 4E5XA 2V5YA 4PJFA 4DFIA 2GK0A 3G6AA 5IBUG 1KENL 3SE4A 4OGXL 5CP7B 3K7UA 3C8HA 4YFLF 4NQDD 2GITB 1CDHA 1XCTA 4G5ZL 4L9LA 1NGZA 3VXRB 2JK5A 4HC1L 1QHOA 2VDQL 2IBBA 2OJEB 3F8UB 4UV7H 3KYNA 5MENB 4P46C 1QFUL 1GAFH 3VXUB 4MCZA 1KC5H 2NY2B 5ACLA 1Z9LA 2YHGA 1II4E 5J56B 5HVHB 5FHAL 5D1ZD 1I9JL 4K2UH 5L7XL 4XWGL 4LFHD 5KVFH 3CIQA 3H9SB 2P5EE 3S4SA 4LLUB 3BP4A 4PS4H 3L3OB 2VLKE 3EW3B 4HFWA 1ORSA 1HXMA 4LQFH 32C2B 1I1YB 1KEGL 1OLLA 4C57C 2XYCA 4RAUA 5HTSA 1GZQA 4M4RA 2ZPKH 3ECBB 1G7HA 3MV01 3V95A 5C0EA 1OGTA 5EU6A 1AFVH 1GH7A 2O5ZL 4QF1A 4ISVA 3I85A 4W4OC 4LVNC 4PJGB 4IMLA 5C08E 5HVFB 1N5AA 3WNMA 4M03A 3NCYP 1A7QL 2X4OA 1QBLL 5AYUL 4UNTA 4WCYL 1NGPL 5L2JB 3LKSB 4CJ0A 4JRWA 5IHLB 3B5HA 1T89A 4UDUA 3RGVB 4GW4A 3IKKA 4G6MH 3GB7B 1FL6A 4PREB 3QFJE 3FCTB 3QHZH 1SVCP 3GMNB 3QUKB 3S98A 4UTBH 2UWEB 3HI5H 4NRXA 4U6HB 1KC5L 3SCMD 2D4FA 3F6LA 5DYOA 2AGJH 4KK6C 4ZS6C 5C0JB 7FABH 3H9ZA 2YPLE 4NFBA 3BEWA 5E8OB 1R0AL 5ID1A 1TCRA 2ZUWA 3MJ9H 1JRHI 1ZT7A 1UWEL 5LXGH 4X6EA 3U36A 5E9DA 5SWQB 1Q38A 2JJWA 3SQOH 3C5ZB 2DI8A 1BQUA 1UZ6F 3FO0H 2VC2H 3P9MA 4M9OA 1DUZA 4WI2A 5HHNA 3O2WH 4K71C 4PLKC 1IT9L 5B39B 1KCSL 4B50A 2KDGA 5DMKB 1IQWL 3GHEL 1NLBL 5C6TH 3WXVH 4G9DB 4QRQB 4ZFFB 2FECL 3C9NA 1R5VA 2VKWA 2E9JA 4XH2B 3WUZA 3QEGL 1MLCA 1QBLH 3KLAA 5AYUH 3RI5F 5CAYB 4MJIA 3UJJL 4RGNB 1OL0A 1VA9A 3MV9E 3C08L 4KKBD 3T0EA 3MGTA 3MRDA 5GJTH 4PJAF 2ZUVA 4OI9A 3KHOA 4HS6A 1Y0LB 1SY6H 2ICWB 4PRBA 4D9RD 2GTWB 2D31A 4KMQA 4X4XB 1A2YB 1ZV5A 3RL1A 1RJZB 2AGJL 3UYOD 4Y5VA 2PYFA 4G80A 5GGVY 4YX2L 1MFDH 5DRNA 3AXLA 4OJFL 1R0AH 3ARSA 1CTNA 5SX5K 5FYJE 3GM0A 2BNRA 4G3YH 4N0YH 4I2XB 4KQ4L 4NQED 1HI6A 2CGRL 5FGBA 1G7IB 1SYSA 1NCBL 1BQSA 2FZ3B 3CFJA 3CFBA 3FT4A 4O9HH 1U93B 4GG6F 4FQXD 3QPQD 2VABA 2GSGB 3NH7H 5GRZA 4HWBH 5AZEL 3FN0H 2WP3T 1QSFB 3UTSB 3RWCA 4FFVD 3MRBB 2HVJA 1QFPA 4WHDA 2J88L 5GRYA 1I1AC 2AQ3A 5D72H 3T0AA 3WDJA 4P46A 3DNKA 3QDHA 3ZDXF 4UB0H 1UEMA 1EPFA 1YEGH 2F9BT 4D0BB 3C2SA 3FKUS 3C08H 3R8QA 1JFQH 4DVBA 4LSTL 1TZIB 1XGQB 2R23A 4XHJD 2HWZL 3O0RH 1UYWH 1HWHB 1HOCB 3P0GB 1WLHA 5GS1C 1SBSL 1S3KH 3X14B 4HKBA 1RIUH 1QKZL 5C0AA 1I7TA 2AQ1A 2YZ1A 4EOWH 1P5VA 3X17A 2A74A 4RRPA 4KQ4H 5HJ3A 5LGHL 4MJID 5CD5C 4U33A 5IG7A 2P5WB 5D7IE 1R5WB 2Q8AH 2NX5E 4PRDA 1NDGA 3TBSA 1FIGH 5D1XB 4F2MA 5CJ8A 3I6KB 2NY4D 5A1AA 4EI5C 4U1SB 2PF6A 2BMKA 5CMAA 4MYWB 4D2NA 1FFRA 2MKWA 4JREC 3CVIL 3T65A 4XRCA 1KBGL 3DX8A 4KRPC 1XF2B 1W72H 1T2QL 4JM2C 2P8LB 1FFNA 4JHWL 4L4TE 4XAWL 1LO4L 5E08H 1RHFA 4XCYA 4LSPL 1RFDL 4OD1L 4YIQB 3VE0A 3EJJX 3VWJB 1ORQA 3ZDZF 3O8XA