1MCPH

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKGNKYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARNYYGSTWYFDVWGAGTTVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1984-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpH02
5E8PA 5MI0C 2A83A 2D31A 2IFGA 4RGNE 1LMKA 4PP2A 4TVSa 3ET9F 5KG9B 3DBXA 5CEXA 1UM5H 1IGTB 3MRNB 3SE4A 2ITDB 1Q0YH 3PF2A 3SGDI 2DYPA 2VWEE 4FFZH 4ZUVB 3SDYH 1JWUA 3RL2B 1C5BL 4TUJB 4ELMF 3O8XB 5C6PB 3CFKA 5IOPB 5GGVL 4OZHB 2DAVA 1YEHH 4JLRB 4LRIA 3BGAA 1MCSA 2I26N 5AZEH 3IU4L 4X4ZA 4Z7WA 1GAFH 1QA9A 5EFIB 5I1HH 2Z0BA 4PJ7A 2YA1A 4L4TE 1AXSB 1CXIA 4JRXE 5EO0B 5D72H 1DBJL 4Y5YA 5C0IB 3TO4A 3OXSA 4XNMA 4AL8H 2CKBB 1VCAA 3UTOA 5GPRA 5JIHA 1S7XB 3VXRD 5D7JA 4P23D 3QXAB 4BFGA 1WFNA 3RWGB 4NWTL 4Y4KD 5HVFB 1QSEE 5FDWA 1CFQA 5IFJA 4DGIH 5IESH 4WHDA 1QRNE 1YDPA 4KQ3L 1PY9A 3EFFA 4MA1C 5DHVH 1QYGL 4L8BB 3ZKQD 5LCVL 5JXAL 2X1QA 3RVXC 3QFJB 1CT8A 4X6FB 1CDYA 3VFRA 4PV8A 3T0EE 1UACL 3VI4E 5BO1L 5AYQA 2WUBH 1J8HE 3MRHA 5IHUH 5BMFH 3LDBC 2WNGA 3SE3C 2F74B 2R69H 2FNBA 1EGJH 4Q9BA 3ULVH 4J3OC 3SHSA 4YR6B 1JRHL 5D1QD 4FFVC 3RNQB 1JYNA 5JQ6L 1CGVA 3LKSA 2FD6L 1A6PA 2FH8A 1R24B 5HHNB 2RCSH 3DXAA 2QQLL 3NFNA 5E2VL 3LHPL 3P4MA 5J9PB 3FB5B 1FIGL 2B4CH 3LIZL 1FSKC 3GMQA 1FJ1A 1FVCB 1RI8A 3W0WB 1N6QH 1K8DA 3CMGA 5E8DH 1DE4A 5IV2B 1HOCB 1NC2D 1B90A 1QP1A 2B39A 1OM3H 1AQDA 4GG6E 4ETYA 4HFWA 1X5JA 1IVLA 1X4YA 1BP3B 3M17A 5DJZB 5FB8A 1FNSH 5SV3A 3ZO0A 3V5KB 1BLNB 4U1JA 3S96B 1ETZA 3QUZA 2X4QB 3Q1SH 4Z7QF 4RGOL 5CCKL 5DMGC 1LEGB 1P5UA 1UENA 3WNKA 1NDMB 2P1YA 5CHNA 5JPNA 4H20L 5EOCJ 4QOKB 2P24B 4KDVA 2HJKB 4MXVF 4FQCL 1F4YL 1MLBA 4JQIH 5J11B 3ARBC 3MQIA 4PS4H 3QDJB 1AGBB 5EC1A 3B9KD 4FTVD 4NOBA 2OL3B 4PRIE 4O02L 5T33H 3RPKA 2FYYB 3HLAB 1CI5A 1UQSB 1AH1A 3L3OB 1JV5B 1NPUA 1C08B 1AIFA 1WWBX 4HPYH 4IHOA 4LCCB 3HG1D 1WEJH 3VG0H 4XCNB 4FFVD 3ZKXC 4KK9D 5F7UA 4NBZB 3IFNH 2XZAH 4XGZB 4JFPB 2BOBB 3BPCA 2J3SA 3BZEB 1F58L 3HC0A 1PW3A 4HBCH 1RIHH 4GKZA 1B0WA 3L5XL 4QXUL 1RK1A 2DQIH 1E6JH 2NZ9C 3L3HB 4XB8A 4YX2L 3BUYB 3SKOB 2FO1A 3VXNA 3QEGH 4UT6H 3HI1A 2P5WA 2EIZB 4PUBH 3W5NA 3DV6B 2YEZA 5T1LD 4WDIA 5EU7E 3N50A 3LKRB 4HMDA 5KOVC 1U8IA 2V5SA 4NO0A 5C09A 4Z95H 4E0RB 2FDBP 3MACL 4JO4H 2BSRA 2NMSA 2XTJC 3DYPA 4WI7A 3W2DL 5KANG 4ZO6A 4Z0XA 3FO2B 3N1PC 4ODUA 3NZ8A 3TO2A 3SQOL 5DMGD 3D87B 3KYOB 4S0SD 2B0SL 4KJQC 3L5JA 4GXVL 1ND0A 4WTZA 4OZIE 4OKVA 3BVNA 3EBAA 4XPTL 1NGWB 3ARBD 4NJ9H 5HHOD 3VWKA 1N4XL 2C3GA 4P2QA 4TUOA 1GGTA 4AENB 4Q74A 4P59L 2BNRE 2FIRT 2KZ1B 1HSAA 2ZUQC 2C5DC 3I3BA 5F7DA 3VFWB 2QTEA 2VZUA 1C1EH 2H3NA 4YEFA 3G5YA 4YAQA 5HPMA 2UUDH 1U8QB 2PO6C 4QXTA 4P5TC 4KHTH 1YYLH 4UMGA 1I7RA 5GS1B 4L1DA 4TQEL 3VW3L 1AD9A 4M61A 1B3JA 2B5IB 5HDBE 4YXLL 3PWJA 1EZVX 3QEHA 3QPQC 4Z0BL 2NZ9D 4F15C 5DD6A 1W0VA 3BDXA 4CMHC 1NEUA 4MAUH 2YC1A 2IGFH 1HNFA 1KCRL 2IG2L 5BJTA 4ZXBC 5D2NE 4S1QL 1KENL 5EOCL 4XNUL 4F7CA 1WK0A 1QFWI 2HFFA 2W9DH 2ZCHH 4RFEA 4Y2DC 2P46B 3ARRA 5B3NA 4IRZH 4MDJB 1N2RA 4P4KA 1CN4A 1DEEB 2UV3A 4GO6B 2A2QT 4JDTL 2Y9RT 1YNTB 4XNQB 4Z9KB 3MV8B 4M8VA 1JWSB 4O2FA 1HILB 3ZDZE 3K0WA 4D9QD 3C5ZB 1TQCC 1UJ3A 3C9NB 2A9MH 3X3GH 4EOWL 3L5IA 5TDNB 1Q0YL 5FFLA 5I8CB 2OCFD 3FQXA 4Q9CA 5C0CA 1MRFH 4YDVB 5ID0A 4HWEH 3D48R 4OSUH 5DS8A 5T3ZD 5GS0H 4H88H 1AD0B 2VIRA 5AZEL 4YHNA 2DI9A 1M7IA 1GAFL 4OD2A 2PO6D 1WGOA 4Z7VB 1S7QA 4P5TD 4X4YA 2E7MA 3S5LG 2Z93B 5J6HA 5CFHA 4AL8L 1FYTD 1IGTA 4WHYG 1CVSC 4U1HA 3PWPB 4OCWH 4ZOEA 1RUAH 5B39B 4ZUVA 3RL2A 1SYVB 4LHUD 1UWXH 3O8XA 3U0PA 1HHJA 1SYSA 3QPQD 5M7QA 3N1QC 4JLRA 3AVEA 2VLLB 4X9HA 4DGIL 5IESL 3L7FA 3ORJA 3SKNA 1WBZB 2HLFC 4ZXBD 4H8WC 3I85A 2F5AH 3BW9B 3JWNC 1A6WH 2VKXA 3H0TA 3VRJA 3VXUD 4HXAL 4Y2DD 5FYKD 2EE3A 4DWHA 2YA0A 1BF8A 4LSTH 2VITA 5JQHC 4QHLB 1LHZA 3JZ7A 2DB8A 4F7TB 5CJBA 4RMWA 2VSDA 4UTBH 5BMFL 3OJMB 5IHUL 3M1BA 4NGHH 4OI7A 5CAYB 5DGQA 1JI1A 3UBXB 3LQMA 4OT1L 4I18A 4L8BA 4N5EC 1ZEAL 2H6PA 2PETA 3KXFB 3O4LA 1MRDL 3DROB 1SJHB 3DXAE 3QFJA 1JNJA 2CO6B 1NCDH 5I74B 1ACYH 1G84A 4B0MM 4HX1B 5F93C 1CFSA 4GQ9H 2EDEA 2B4CL 3DVNA 4YJZL 4G8FA 1GC1H 4AY0A 1N6QL 4LSSH 1DVFC 1CGSH 2EEAA 5E8DL 1HHKB 2F74A 4BH8B 3O2DA 4HIXL 1C16A 3V6OA 1OM3L 4N0UB 5SV4A 3MV7D 1FNSL 3GJFK 2J6EH 3T3PF 4GKNA 5GXBB 1HQ4B 4C55A 1A3QA 2IFFH 5HHNA 1IAII 2XZQH 5BRZE 1KXTB 3F7VA 4JFHE 4X0KB 2CLRA 1W72H 3Q1SL 2BVQA 4M8QA 2HLFD 2QQQA 3S97C 1LO5A 3U79A 1GGBH 4G8GA 3W0WA 1VEMA 4EUPB 3B4NA 3ARFC 3BGMA 4NC2B 3L3JB 3WFDH 4JQIL 5CJOL 4PS4L 4FQ2H 3JVGC 1XZ0B 4PJXA 5DJZA 1X6LA 3V0VB 4EQ2A 3DX9A 4U1SB 3D18A 2A74B 4GFTB 1F6AA 1MCPH 1MLCB 2QLVB 4HPYL 3RTQD 4JKWA 1WEJL 3VG0L 2AQ3A 1V8HA 4UI2A 4WW2A 3IFNL 4K3HA 4N5ED 2XZAL 4HIIA 4K7PH 4YFEA 5HGHA 1IT9H 2OLDA 2LV4A 5D1XC 5DC4B 1KJVA 4HBCL 3LKPB 1RIHL 1KGCE 4N8CH 1T80A 5KSBA 5L8KB 1ULVA 1YPZF 3WXVL 4LVOC 2DQIL 3ISWA 1E6JL 2VAJA 3GDBA 2FYYA 3HLAA 4NP4H 1DCLA 4X4MA 1G7HB 4F37K 2FO4A 4J2XA 1DVFD 4UT6L 1XR9A 2Y7QB 2P5WE 3D0LB 4PUBL 2AABH 3RWFB 2AV1B 2J2ZA 2J1KA 4PYHA 1JZ7A 3MLUH 4D94A 4TTGA 5C09E 2BJML 3MPCA 4RMRA 4HXBH 2R0WL 3NGBB 1XF4A 4FNLH 2FGZA 4QRUB 4IMLB 1BOGA 3S88H 3BKCH 3SO3B 5DHVB 5E7FA 5JORB 2YPLE 4M03A 3AREC 4ZFOL 5C9KA 5A2IH 3ARFD 1TETH 4P57A 2ICWI 3QDGD 2APXA 3IJYA 3H8NA 5C07A 4NJ9L 3KPNA 4ZUTB 4Y4HA 1DEDA 1H3VA 5GGTH 4P2QE 4C56D 4BQBA 5JZ7C 4C83B 2GCYB 1U95B 1KCSH 3NFPB 3R0NA 3MRGB 5FK9B 3B9DA 3H9HA 4PJIF 1JTTA 4Y19D 4ZOBA 1C1EL 1HINH 3M07A 1UH3A 4JCMA 4Y8DC 2DQGL 3O11A 1EO8H 3T2QA 3FN9A 3L7EB 3SOBH 4KHTL 1YYLL 5LGHH 1G1CA 4XI5C 3TIEB 1G7LB 1AC6A 5GGQL 3TA3B 5D1XD 4BFBD 1KB5A 4FN0A 3BKMH 5KZCB 5F96L 5IIEA 1MCLA 3I3EA 1FFNB 4ZNCD 3T1WA 3VH8A 3WIIH 4MAUL 2IGFL 3AC0A 2VUYA 2ZCHL 4OIIH 3DJ9A 1P1ZB 2Z92B 4JFFB 1TCRA 4IRZL 1NUFA 4F37F 2AV7A 2C1OA 5AG9A 2IAMC 1EX0A 1U92B 3MLTA 3HMWH 5L8JB 1HYRC 4QRPD 3DVGA 1YNKL 3RRQA 1N5AB 2DQJH 3IFLL 5I1IH 3ARED 2A9ML 2Z31A 3X3GL 3WUWB 5C0CE 3QUKB 1CBVH 2BVOA 3CLEH 2DWEB 4N9GA 4LCUA 5JZ7D 1BVLA 1Q9KA 2Q7NA 4JVPA 5CD3A 2V5YA 1TVBA 5HDQH 4HD9A 4H88L 4L3EA 3Q6FA 2PKDA 2YD8A 4XNQA 1RZJC 1YZZA 5IF0A 5LGKA 1ONQA 4D0BA 1D5XB 1IGJB 3FO9A 2G60H 1OAUH 1A1NB 2W91A 3C9NA 1WITA 4XI5D 4K9EC 1T1ZA 2JELH 1F3DH 2JB5L 5D93C 4OCWL 5I8CA 1RUAL 4GKSA 3FCTA 1NFDA 1SVCP 5IBUB 3BMWA 1ITCA 3HI5H 4PRNB 4Y4FA 3RJDA 2CR3A 1II4E 4M02A 1T22A 2F5AL 3OF6D 1D9KC 5T1KA 3TNNB 3C6SB 4JZJA 2IMNA 4CVXA 3VRIA 2Z93A 5IMMB 2XYCA 2NXZC 4JG0H 1ZKAA 3QJHB 4X83A 4QRRD 6CGTA 1TFHA 2IAMD 3MRQB 3SBWA 4HUUA 2AJ3A 5B39A 3KR3L 1ZHBA 3KLAB 2NY1C 2RFXB 2OK0H 3VDAA 4LIQE 1E0OB 4NGHL 4ZFOB 3C8KA 1PDKA 4KC3B 4K3DH 4AIZB 1B4JH 1FNFA 4S1SL 1RIUL 4P3DB 5L2KB 4QXGH 1ZGLA 4PJ8C 3FFDA 1TZHB 3O4LE 1ZLWK 2DIBA 5I9QB 5IVOA 1NCDL 1CK0H 3U6RA 1ACYL 2E3VA 3P0VH 1A7PL 2WK2A 4WCYH 3TN0C 4GQ9L 3K8MA 2H26A 4OZFG 5FV2A 5EZJA 4LSSL 4RWYH 1CGSL 2Q76B 5GSRB 5GRXG 4PJIB 3MCLL 3V6OE 5F6IB 5CIPB 3BQUB 3V5DA 5TDOA 1F3JB 4JZOB 4S2SB 4YPGA 4X99A 2ZKHH 1A22B 1VERA 3WKNA 4O2EB 3IXTB 1F4AA 2NX5B 3KXFA 5EIVA 4MVBD 1PKOA 4OZ4A 1SJHA 2IFFL 2H2PC 2XZQL 3OTTA 1OY3B 3DIFB 4G8EA 3L3KA 4JRYD 1PYWB 3VG9C 4JFDD 1W72L 3E2HC 4PREA 2VZVA 3WN5B 4G6JH 3T0VA 1S9VA 1FLRH 3W9EB 2AEPH 4J3VA 4YK4C 1J0ZA 5A3ID 1D9KD 3CVIH 4G8GE 5EOQL 3EYVA 3MMEA 3IDGB 2Q7YA 4BH8A 1JHLH 3WFDL 2NXZD 4WY7L 4FQ2L 3EDFA 3NBNA 1BD2E 4PJXE 5H35B 5BW7A 3HUJB 4JAMB 4PTUB 3PGFH 5I8EA 2ITCB 3IDJA 4NPYB 4J7RA 2Z9TA 2NY1D 5D2LA 1MCPL 1IZKA 1RMFH 4PRDA 3QDAA 3DTXA 5F88B 4KXZI 3Q5OA 1NGYA 3MV11 1T89A 9CGTA 5DR5L 1T7YA 2VSCA 4S1RH 4EUPA 1IT9L 5K9OB 4PJ8D 4B50A 3ULSB 2EC9U 1HDMA 4M43L 5FYKU 4N8CL 4P2CG 3B2VL 5KSBE 1XZ0A 3F8UB 3TN0D 3C08H 1TIUA 3KG5A 4X4ME 2VQ1B 4JHZA 3MROB 2OQJB 4KK5C 1MCJA 3JSSA 3H7BB 4WEMB 1GOHA 2AABL 2PR4L 3DO7A 5ADPH 2A38A 3OSKA 1U6AH 2AW2A 2GKIA 3AMKA 3CD4A 4N0YH 3MR9B 5GS2D 4HXBL 3FTGB 1FG2B 2H2PD 3NPSB 3PHOB 4FNLL 1ZLVH 1JHTB 2ZWLT 3WUZA 5FYJE 3S88L 3BKCL 1NGXB 2P4AB 3QNZB 2L7JA 5EUOA 1TETL 4HLJA 1GGIH 2AXGB 1MOEA 3RWFA 3BYTA 3QG6B 5C07E 2X44D 2W38A 5FA3B 3TIDB 1KCSL 4JJ5A 2P7TA 3F7PC 4C59B 4MJID 1KV3A 3B8SA 3RUGE 3WLWC 3MLVH 1CXKA 4R2GC 5B21A 4QRUA 5CSZB 1HINL 5FUZH 1T1XB 1XFPA 1E6OH 4A6YH 2X1OA 1EO8L 4K23L 3SOBL 5LGHL 1L9MA 2BFVH 4PGCB 4NZDA 1NCBH 2NY7H 5C08D 1NANI 2K1MA 2F53B 3LQAH 5DHYB 3H9SA 3NTCL 5F1NB 4NO3A 4RIRA 4I4WA 3IDIA 3TJHC 4LFHD 4CU8A 3V6ZA 3GI8H 5IK3B 1AFVH 4TRPH 1U95A 5IQ9B 3WIIL 3PHSA 5FK9A 4OCMC 4R4FH 3GIVB 5IGXH 4QRTA 4KK5D 5F71A 4JO2H 2FJHA 1EGJA 2FLRT 1I8LA 4AH2B 4KHXH 1F13A 4OIIL 1B0GA 5CGMA 1TQBB 3L7EA 1N64H 1DTUA 4LEOA 4R26H 4HK3N 3MV9D 2NQCA 2XXMB 1G7LA 4LHJB 2ZG2A 1SHMA 2KQMA 4S10A 3D0VB 4JKMA 3K7UA 1W72B 1RHFA 3HMWL 1WAAA 2ZUVA 5I1DA 2HMIC 2R2EA 2DJ4A 2DQJL 4HZLB 5I1IL 4P9MH 3WDHA 1Y6NR 3HZYB 2DDQH 4H1LA 4HUXB 1RUML 1K6QH 1BFVL 3FAWA 4N90E 5I1AA 3TVMB 2K7PA 1CICA 4HC1H 4QT5B 1CBVL 1A7BA 3CLEL 2Z92A 2QBWA 2Z8RA 3OWEA 4JFFA 1IGML 4OCYH 3EFDH 5HDQL 3IS0X 4L3EE 3TH3T 1JFQH 1U92A 4R2GD 1UYWL 1E27A 4ETQA 2WW8A 3UTTD 2G60L 1IM3B 5C0EB 1FVDA 1OAUL 3V6BR 1H3TA 4PJCF 2JELL 4W4OC 5CWSB 4NNPH 1MAKA 4HV8B 4M3KB 3SY0A 1NFDE 3W39A 3QUKA 3TJHD 5I1GL 4ONGH 3NFSH 1WCQA 3WD5H 2DLHA 5GISH 3K81A 4XCCH 3HI5L 2QJDA 5DA4A 3MRPB 5DVOA 4GLRI 3UDWA 2XA8H 1LD9A 5ICZA 2FJFA 5FUOH 4PR5B 1QHOA 4UOW0 3TC9A 2M2DA 4JR9H 1A1NA 2R0LH 1FPTL 4JG0L 1PVHA 2V17H 2YUWA 2CIKB 5HVGB 5IVXA 2HMID 3WJJA 4PJDF 3G5ZB 3L6FB 4JFXA 4PRNA 3RWDB 3P4OB 4UT9H 4J6RH 2UVFA 1X6NA 1BIIA 3VD7A 1NC4A 4K3DL 5AWNH 3JTSA 4ZUSA 3TNNA 3EOAA 5DJ2A 2BC4A 2HH0H 4QXGL 1IKFL 2YHGA 4YWGL 5DQDH 3RKPA 5IMMA 1IGFH 5B38G 2JJSC 3QJHA 1PJ9A 3SJVA 1CK0L 4MA3A 3HE7C 4F3FA 3P0VL 3QI9D 3EYQC 2MNUA 1OL0A 2XNAB 1Q9OB 4N8VB 4BSVB 4PP1D 5E4EC 5FGBC 5ACLA 5BVJB 5KN5A 5DK3A 3U4BH 3C2SA 4ZFOA 1YA5A 2CGRH 4MMXC 3ZSTA 1RK0A 4Y8AA 4ONOA 1SEBA 2ZKHL 2KUTA 4UNTA 5L2KA 5BZDB 3IRPX 3LRSB 1FFOB 1TZHA 1CQKA 2P8LA 2XA3A 1UT9A 3QUYA 4G6JL 4ZMAT 2ZUWA 5J4MA 1FLRL 3GSOA 2OMNA 4XCYA 4KUZH 4Q2ZA 2UWEA 3VFTA 3AM8A 1NUDA 4CU6A 4G9FB 3HTLX 1OCWH 4O5LH 4NKDB 4YHYB 5FYKH 1MCCA 5IHLB 4YHMH 7FABH 1UM6H 1BFTA 5D1ZC 3S4SG 2ZOKB 4W4NA 1RURH 2JK5B 5J13C 4O2EA 1UJTA 4EI6B 2VWEC 5IBTL 2PXYD 1A6VL 5D2LE 2IH1B 4EIGB 1RMFL 5JHDD 5T5NG 5E8EA 1HXMA 3ZDXF 1MH5B 3PWVB 3VXMA 3WN5A 3P4NA 4OGZA 1BF2A 3HMXA 3DRTB 3BEVA 3EGSA 1FNHA 4OLXH 4S1RL 2VDMH 2Q86A 3ZYZA 4Z7NF 1R3JA 4GUPB 1R5WB 3BISA 3LV3B 4DJMA 4M48L 1A7RH 2XPGB 5EN2B 1H15B 2JTDA 2IANB 3HE7D 3O6FC 4K3GA 4JAMA 3TH2T 4R8WL 4ZFGH 4L8CA 3AAZB 3O3AA 1GOFA 5FHAH 2HFTA 1X5HA 2KDGA 3PDDA 5HVWA 2YRLA 2HRLA 3QAZC 4U6TA 3OKMB 4GRLC 1E28A 4HH9B 3DUSB 1F6LL 4QGYA 4IOFC 4I2XB 5FO9A 2DM3A 5T3XE 3I50H 2KH2B 4JM2F 4PBVC 4WWKC 2H32H 5DDHA 3QQ4A 4KWUA 2NY3D 3LS4H 1BWMA 2B1HH 3FT4A 3T0EC 1H5BB 4RGND 3QZWB 4H8WH 5DEGB 1QFWL 3LKQA 4WW1A 3WV0A 5EUOE 2XN9B 1KIPA 1ORSB 3H7BA 4HW6A 1WBXB 4X7FC 3O3EA 1TXKA 5D1ZD 3TCXA 4RX4A 5F9JA 3IVKA 3MRLA 4R97B 5F1SA 3WL9B 4P3CH 3EDDA 3MLVL 1YMHB 4XBGA 5FUZL 4C57C 3LQZB 1E6OL 3PNWB 3CAFA 3HZKA 4IM8A 4PJDB 2BFVL 4CUCA 4OKDA 4L4TD 4JRXD 2VLJA 5DEFA 2AXGA 1ORQB 3H9SE 5CD5C 1UXWA 4LSVH 3MLZH 3O6FD 3GI8L 1AFVL 4TRPL 4UQ3A 4JPKH 4P2OC 4DZ8A 1NAKL 5L8LB 4M6NH 5IGXL 5ESQB 4NQXB 4Q6IC 1CTOA 4GAYA 1QSED 5K9QG 2YUZA 4JO2L 5JW3H 4UAOB 4ZOCA 3ULVE 5ITBH 2BVYA 4GRLD 1KIRA 3Q48A 2EO9A 1QRND 4ZFZA 1N64L 4MYWB 4R26L 3VXRB 3UYPA 1YN6A 1JGEA 4P23B 4PGCA 5F70A 3H9YA 1OGTA 1A8JH 5DHYA 5F1NA 4PBXA 4Y4KB 4WWKD 5HDLA 2WP3T 1WAAE 4JPWH 1VHPA 1UEMA 3WBDA 1YYML 4YDKH 3QXDB 1DFBH 1OB1A 3QBTB 3T0ED 4NQUA 3CFCL 1JGDA 4P9ML 5BQ7B 1BREA 1VENA 1J8HD 3STLA 1ZHNA 1K6QL 1ZVHA 2CK2A 1NCWH 3ZE1E 5EIIA 1ZSDB 2OXGA 4ACPA 4GAFB 3MLPA 1DLHA 4JKPH 3JV6B 3SGKC 5CKGA 1PBYA 3HR5A 1JPSH 3FOMB 2J6EA 1V5JA 4QRQA 5MI0B 4P5KA 4X6EB 1JFQL 4LBEB 2BSSB 4OLUH 3BN3B 2X89A 4XH2B 2R1XB 4R3SB 1FCGA 4RZCB 2O5YH 2W9EH 5D1QB 2ICWJ 1Y18B 1A9BB 2HTKD 2M1KA 5CD5D 4QT5A 4KRMB 5EU7C 4ONGL 3VGGA 3WD5L 1WIPA 5GISL 3SE9L 5CJQL 4XCCL 5KSUB 4P2OD 4U1MB 3BUTA 2F8OA 4YZFF 4O51B 3MO1B 2XA8L 4ONFH 5F9OH 2QHRH 4YGVB 1LE9B 1NC2B 5FUOL 3CX5J 4NYLB 4I0CC 3SGJC 1MQKL 4JR9L 3GSQB 1YC7A 2R0LL 2VKWA 3HFML 4PY8I 1VFOA 3ULUE 2V17L 3IDNB 3CVHH 4HV8A 1U93A 4UZGA 4QEGA 2F5BL 3WNMA 5IVXE 2EYSA 3P9WB 2Y5TB 4PRID 4XP4H 4BKLB 3FT2A 3MRPA 4UT9L 4J6RL 1X44A 4MA1B 3UO1H 1PSKH 4I3SH 2EDLA 3LB6C 3VXOB 1S7UB 5AWNL 1WZ1H 4Y5VA 5ICXA 1IEAB 1NKOA 2HH0L 5DMKB 5E94B 3B9KB 4FTVB 1DBAL 1IGFL 1H3GA 4EEEA 4I9WE 3SJVE 1DQTA 4PJGB 5T3ZL 1MHCB 3T8XB 1CGXA 1G0YR 3RY4A 1Y6MR 4R0LB 3DYMA 3HG1B 2P49B 2R1WA 1T0PB 3U4BL 2R0KH 2CGRL 2J8UF 1NH6A 5D2NC 4FQ1H 5D71H 3BP4B 4JDZB 1LO2L 1QNZH 3UPAA 5HYJB 3C60C 2GT9B 1EHLH 5GGTA 4WU5A 1SY6H 1CL7I 3ILQC 5KS9F 4X6CF 4L3AA 3DUHA 3FT3B 1MRCH 3KPLB 2UWEE 2X4TA 4WI3A 5T1LB 1OCWL 4O5LL 4JN1H 3RKDD 5HJ3B 5ILTL 5FYKL 4B7LA 4NKIH 5MEOB 5F7FA 1RURL 2K9UA 4UV7H 1S7SB 4U6HA 3S3SA 3ZDYE 4E5XA 5I1LB 1GIGH 4K3JL 2MJWA 1N8ZA 2BNRD 4FXLA 3OX8A 4IOIB 5DUBB 1JVKA 4IS6B 3VXME 3LB6D 4LRIC 1EAPB 1T1YB 4GS7C 3WS6C 3BEWA 4XMKH 3MRFA 2VDML 3ZHDA 4L8DA 3K8LA 3ARBB 5HHOB 1PQZB 4UILH 2AJZB 4DCQA 3TO4C 3GJFH 1A7RL 4XNZC 4ORGA 3OKKB 5ALBH 5IFAL 3CFEA 2IPKB 1PD6A 2NXYC 1WCBA 3HPLA 1F3RB 4OLVH 4EI6A 4ZFGL 5HHXL 4JFYB 2QV2A 1RZJH 5FHAL 3BWUC 3O9WC 4UDTB 3ZKXB 2CLVA 3J8F7 4LKXB 5AUMA 3PWVA 2NY0C 5GRVK 4HKBA 4R4BB 4WFHE 5DJCB 1MCWW 4K9EH 1Z0MA 2AXJA 1YY9C 3C60D 1P7QA 3HHRB 3I75A 3WO4C 1QVOB 2W60B 1H15A 3IGAA 5SWZD 3ILQD 2IANA 1J7VR 4NDMA 5F9DC 2ZSWA 4M7LT 3LS4L 5GGVY 2SEBA 1NFIB 2B1HL 2OMBA 1YQVL 4H8WL 2DMCA 2CXGA 2R39A 5D96C 4HWBH 5D9SB 5KOMC 3W82A 4FQHB 5MEQA 2AK4E 4K07A 5JDSB 2I9LB 1J86A 2XTJB 2AXHA 1T7VA 5IEHB 5C70A 2DYPD 4P3CL 1T83A 5HYSA 1KEGH 1RFDL 3QXVA 5T5NF 1K8IB 4U3CA 3UJTH 1U42A 2OTUA 3VFOB 3A67H 5DEGA 3THMH 1IAKB 3QCTH 2PYFB 2VLJE 1BGXH 4TULL 5E2TH 2JCCA 3TO4D 1J1XH 2QL1A 1WBXA 2ADIB 1CDUA 3V0WL 3UTPE 3MLZL 4ZPVB 2YD5A 5I76B 2NXYD 5D7JD 5JOEA 2ZUQB 3DVIA 4NZRH 4M6NL 3O9WD 1P4LB 3HAEG 2PO6B 3UEZA 4P2RA 4DUXA 4P5TB 4FXGB 1WVZA 5JW3L 4JO1L 2NY0D 3G6JF 2ORBH 3BZ4A 1FYTB 1KNOA 3PNWA 4PJHA 4F9PA 5HYIA 1MEXH 4U6VL 4LHUB 2I07B 2J8UB 3LSOB 4FQIL 2BVUA 4F15B 2PTVA 3O2WH 4YDKL 1GXEA 4CMHB 1DANU 3CSPA 1GJIA 4ZXBB 1E4WH 1W0YT 4V1DA 4LCWE 2D7TL 1NCWL 3VXUB 4Y2DB 1BQSA 2WINB 4JKPL 1DL7L 2Z91B 4TYUA 3NN8A 4P23A 2G5BB 1P7KA 3VDBA 4JM4H 2N7AA 1H3UA 5L2JB 4OQTH 4OLUL 3DXAD 1A6AA 4D0DA 1TQCB 1WTGT 1EK3A 2O5YL 1G1YA 2DWDB 2W9EL 3RVVC 4KZDL 3BDBA 3PDOB 4HCRH 1KPRB 2EDOA 1ITBB 5HHPB 2GITB 2VLRE 5K9JL 2X41A 4U49A 3REWB 1S5HA 5A43C 3FOMA 2R4SH 4J3WA 5KSVA 2V7HA 3IFPA 3QUZD 3MNVB 4ONFL 4JFHD 1RZKC 5F9OL 3RWJB 2QHRL 4R3SA 4G9DB 3CJJA 3UPRA 4YHLH 5C0BB 4D9RE 4HLZG 2Q8BH 5EU5A 3MV7B 4JANB 2RAMA 1MPAH 5C0JB 3WCYA 1I8IB 5FXCH 1WFTA 1UM4H 5A2JH 2GHWB 5LBSH 2H32B 2OJEA 3QH3A 4PJAF 5K9KA 1R3KA 2HKFL 1X4XA 4WHYH 5EC2B 4XP4L 5KSUA 4YXKL 1OAXL 3UO1L 4I3SL 5KAQG 4NQSB 5ETUB 1AP2B 3LEXA 3S35H 3BN9C 1WZ1L 1FZJB 2BNUA 4O9HH 4FABH 1YEGH 2N1KA 1S7TB 2UZIH 2LQRA 3NOIA 5LG1A 3QT2A 2GJ6A 5F8QC 3QIUA 1SJEB 3IDNA 4X6DF 4NCC1 1J1OH 2ILLA 1KGCD 1XGTB 3N85H 5DFWH 2AXFA 3C8DA 1NCCH 1XGUA 2EDYA 3RTQB 1QLFB 1D6EA 3RVVD 4BKLA 1DQQB 4RRPA 3ZTJH 2R0KL 1JF1A 1XEDA 5LKNA 2G5RA 2DM4A 4JB9H 2P5WD 1Y0LB 1QNZL 2EXWC 3V5HA 1J5OL 4GRWH 4WRLA 2DQCL 4NO0D 5C09D 1G6RH 4QKXB 4YHPA 3CSGA 3U9UB 1NEZB 3F7YB 2Y72A 1DVFB 3FL7A 1MRCL 3MBEA 4M5ZL 3SE3A 2QKIB 4ODBD 4BQCA 4A6YA 1AGDA 1R0AH 5EBLB 2YPLD 2IPUG 1UJ3C 4JDVB 2Z4QA 4NKIL 1MCOH 5B4MD 3FB6A 1HCVA 1O7VA 4UV7L 3ROOB 1BFOB 1XCTA 5FIEA 5HYJA 2IQAB 3KJ6H 3CUPB 3QNYB 3VWKD 3HPJA 1LNUA 4HHAA 4P2QD 5DD0H 5E8NB 4MD5B 4M9OA 3VGHA 4ELMA 2PTTB 4XZUB 1N0XH 3ARFB 4KMLB 4XMKL 3KPLA 3QDGB 3QWOA 5IHZA 1BQHB 4UILL 1HEZA 2YD7A 4C56B 3A6CH 4U0QB 5FM5M 4D0CB 1B0RA 4WO4A 5ALBL 4OLVL 4Y19B 1ZANH 4LLQB 5GGUA 3DURA 1I3RA 2J8OA 1RZJL 3MC0A 4LCYA 3TBVA 4YXHH 4U1NB 4KV5E 3P9MB 1TLKA 1JNLH 4MNHB 3GGWA 3IXAB 1EAPA 1GZPA 1T1YA 2NLJB 3O45A 4K9EL 3ROLB 2ZOLB 5D1XB 4HC1A 2EXWD 3ARBA 4QY8B 4ODWA 5D8JH 4JFOB 5ACZA 2N4IA 1LDSA 1LILA 3ALXA 4XBPA 4P4KD 3OKKA 3WIHA 4MJ6A 5AZ2H 3X11B 1OF2B 4L4VA 1B6UA 3T2NH 2DMBA 3TBTA 3P30L 1C5CH 4G6AC 1JZ6A 4M6AA 2EDHA 4R4BA 1U36A 4LMQE 2R2HB 32C2B 4KI1A 5C0CD 3X12B 4DOHB 1FDLH 3NCJL 5DQJB 4QRPB 4ZUWA 3AREB 4MNGA 4LP4A 3UJTL 2KKQA 3GMNA 3U2SB 1BPVA 2FECI 2AK1H 3THML 1S9XA 1UVQA 3QCTL 1BGXL 3BD5A 4XT1C 1UG9A 2JCCE 5C0GA 5I1EH 1J1XL 5F7EH 2P44B 3NA9H 3PABA 4RBPK 3AXLA 3WIFB 2VXSL 1UZ6E 2BY0A 1YEFL 4YBHA 1ZS8B 4Y89A 3C6LC 5HY9B 1XIWA 2DL9A 5ISZE 3WE6B 1Z6JT 4P2RE 1IGIH 4KAQL 4JGJA 2JJTC 3TWCH 1DDHB 2ORBL 4JKKA 3VFSB 1GCFA 1S9YB 3U1SH 3F6IA 3VFOA 4PJHE 4J3XA 4EDXB 1NKRA 1TJHH 3FQRA 1MEXL 1MJ8L 4ODTL 4I3RL 1QR1A 1YNLH 5DJYB 3ALPA 4G7VH 4YO0A 2YBRB 2WV3A 2WLYA 1JGUH 1TVHA 2NZIA 4YC2C 2YA2A 1E4WL 4HZAA 4V1DE 1AY1H 4WHCA 1EFXA 4G6AD 4WHTA 5EZOL 2D4FA 4KFZC 5FGCE 5CP3H 4WW2C 4QRRB 5TH2A 2IAMB 2CDEA 15C8H 3OKYA 4JM4L 2ADJA 3IKKA 5A40E 3O4LD 1EBAA 4LHUA 1ED3A 1JP5A 5GGRA 4Y5XC 4DKAA 2HP4A 4K3EH 5I16B 5BOPA 3KDMA 3DETC 4HCRL 4YFDB 1CR9H 4JPIB 1EEZA 3MRRB 3L3DB 4YE4H 4Y2DA 3S37H 2Z91A 1U58A 4WI8A 4X98B 1ADQA 2G5BA 1MAJA 1NMCC 5E03A 3FB7B 2CJUH 4PGEB 2FZ3A 3NIFF 4FXKA 4AT6A 1YEDA 5E8OB 3NIGF 1M6OA 4YHLL 2Q8BL 3EO0A 2ADFH 4KMQA 5D93B 1ZVSB 1FO0H 1QEWA 4G8GD 5SX4I 1GRWA 4ZFFB 4YBLC 2X4PB 3RPIA 1D5BB 4R7DA 3I6KB 4FQJL 5LBSL 2DKUA 3L9RA 4AIXA 3REWA 1BD2D 1N26A 4JFDB 4Y4HC 3QEUA 5EU4B 1L6ZA 4OIBA 4XAKD 1UB5B 1D9KB 3RWJA 3S35L 1NCUA 2X4SB 1QFHA 4P48A 3QO1B 1FZMB 4FABL 1LP9A 2NXZB 5C0BA 1KCUH 3ZKMC 2JF1A 4GAJH 4HIJA 2ZUTA 2ED9A 4JVUA 2D7NA 2GJ6E 1MJUL 3KS0J 2NY1B 1J1OL 5I0DA 5DD1H 4KROC 3VI3F 1DQJA 3N85L 1I7TA 1RU9L 1NCCL 4NFBA 4PRHA 1ACZA 5DJ0A 5I17B 5EC2A 2QQNL 2FEEI 3DETD 4LLYB 4NQSA 4JE4B 4J3UA 1AGEA 1AP2A 4JB9L 3JWDC 4PJ8B 4M6OH 1AGCA 1CQYA 3MJ7B 5JR1L 4YEEA 1G6RL 3ZT6A 2IPUK 3TN0B 3I9GH 1SJEA 1FV1A 3SKMB 3VFUB 2GFBB 2V7NA 5FYJD 1QLFA 1G9MC 5DEZA 1R0AL 3QYCA 1T5XB 3QR2A 1OQXA 2DLTA 2Z31C 4LDOB 1MCOL 5EBWB 2QSQA 5C07D 5DRNB 4PJFB 3VG9B 4Y4HD 3KJ6L 4BZ2H 1F2QA 3E2HB 5DD0L 4I3GA 3VFMB 4QTHA 5T1MB 3B9AA 4YK4B 5IB1A 4ELME 5SWQB 5HSFA 3F7YA 4HUWB 4EZMA 2VC2H 1WQVT 4K55A 5C0DB 5KAQF 2OS7A 2XZCH 1N0XL 4M7ZB 1T7XA 2XQYG 4A2LA 4PY8J 5JOPE 1CE1L 5FOBB 4HGMA 2GTWA 4QHMA 1MFCH 1I1YB 1OARH 4LAJH 5MENE 5EO9B 3WDJA 2V2WA 1BJ1J 8CGTA 2WWKT 4U1LA 3ROOA 5L0QC 4MJIB 4ZD3H 4QCIA 1MIEH 3CUPA 2WAHA 1RV6X 1RZFH 3MRCB 4YXHL 3KPPA 3S36H 3RWHB 1I1AA 4Y4FC 3FZUC 1JNLL 1T3FA 5F9WC 2AKRB 3U82B 3CH8A 2PTTA 4BELD 3MJ6A 1BBJA 5C08B 1NCNA 4PB9L 3TLRA 4PD4J 3JVGA 3MFFB 2AP2A 4JZJC 3GHEL 1FZKA 4C56A 2CK0L 1Z9OA 1P9MC 1MUJB 5AZ2L 3DECA 4Y19A 2E8ZA 3VXPA 2E7LA 3HC4L 2X9WA 4L4VE 3T2NL 5FECB 1U8JB 3HE6A 4WU7A 2BOCA 3P9MA 1C5CL 3GK8H 2PCPA 2YWYA 2Z31D 4FZEH 4R7NA 3MV9B 1H3PH 3BX7C 4N90D 5H94A 4WFEE 2FJGB 3QHZH 2CLZB 5D1XA 3MUY1 3WFEH 5C0AE 4TNWF 2APVA 5KVMC 4L3ED 4UB0H 4DVBB 1MCDA 1R5IA 4MNGE 1OF2A 1OLLA 2A73B 4Z18A 2AK1L 3ARDA 4LPTA 1OGAA 5I1EL 3ELAT 2ED7A 3CVHA 4LAQH 3BPOC 3HZMA 4LLAA 3WLBB 4R2GB 3TJEH 5TQ2H 5DC0A 4PB0H 1RZIA 3UTTB 1HKLH 4Y4FD 3FZUD 1IGIL 4U33A 1FNEB 3AREA 3E6HB 4U1GC 3LD8C 3SE8L 4Z7QE 5HGAA 2DICA 3T4AB 5T1KD 3MX0A 12E8H 4NKOA 5E99H 3QIBA 4GRWB 1G6RB 1BOYA 2HG5A 1X3DA 4G7VL 2DM2A 4ZTOH 5BW7C 2F58L 2OSLA 1JGUL 3PL6A 1PZ5A 1RJYB 3HI6H 5LAXA 1WIUA 1AY1L 3WE6A 2VXVH 4WI9A 2C9AA 1CDGA 1NDGA 2NNAA 2HVJB 4OF3A 2LU7A 5FUCC 3DX8B 1S9YA 4PRPA 5E00B 1HHHA 1T89C 3LEYH 5EZIH 3TYFA 15C8L 4EDXA 3GMRB 1LE5A 5JNYB 4G43B 3V4UH 5I71C 1SY6A 2DJUA 4KQ4L 1A1MB 4NKQB 4K3EL 1YPZA 5IKCA 2Z8WC 1CR9L 3OF6A 3V7AE 3WFCL 4GQPH 2X4OB 4OZGB 1CDHA 4PRBB 4U6XB 3S37L 4RSVA 5IVNA 1HI6A 1JRHI 4L3CB 5DJ6A 1VEPA 1YY8B 3TPUA 4HIEA 4G3YH 1I9RH 1MF2H 2JLLA 3VGFA 1D6VH 5CBAA 1ZMYA 4HIHB 4NNXA 2ADFL 4S0TD 3ZE2F 1BECA 1FO0L 1S7RB 2Y1VA 8FABB 3CXDH 5TDPB 1CXLA 3ABZA 3GJFA 3L3DA 4K7PY 3X3FH 4QGTA 3ZHLA 4HPOL 3VFNB 2FWOB 2IALA 1JF6A 2RBLA 2BVTA 2C4FT 3F5WA 4X98A 4NWUL 4CGTA 4XPBH 2C1PB 2C3VB 2C7UA 3BZFB 5DRWB 4N68A 1MCEA 3U46A 2VO5A 4YFLI 4OGXL 1LP9E 4CDHA 4GAJL 4F7MB 3ARYA 3F58H 4GT7A 1ZGLM 4IJ3B 4ZFFA 3P0YH 1JUFB 3PP3K 2BRRH 1D5BA 3OKDA 5JHDB 4U3XA 3T4YB 1T0NA 4PRHE 5EU4A 1BAFL 2AQ1A 4TVPE 3K1DA 4JQVC 2P47B 2CRZA 3K3QA 4HWBA 4LLVB 3RDTA 1N59A 2RGSA 1CE6B 4M6OL 3N1GC 5DFTA 5HHQB 4Q9RH 4BFIB 3HRZB 2FX9H 4L29B 3HE7B 1T7ZA 3ARXA 3I9GL 5F1KC 1A5FH 3REVB 5DMJB 4JHAH 4LKCB 5T3XD 3EYUH 1Z9MA 1RUPH 4JCLA 1UCBH 4X5XB 2I24N 4LLYA 4KKCC 2E7HA 2B2XH 4FA8A 4X8JA 5GGSB 5IB5B 4UT7H 1EO5A 4HWZA 4M4PA 4BZ2L 2XQYK 1ZLSH 5CMAB 3NH7L 2NY3B 1YEEH 1N3NA 4RGNB 2ICCA 2XOTA 4MB5A 2VC2L 4XVTH 2XZCL 3RZWA 3IDMB 1DQDH 3TZVC 2EIBA 3DNKA 2VLME 2EKSB 5KW9H 3GMLB 1OP9A 4TOYH 5B8CC 1KSRA 4JY4B 5D1ZB 3DHJA 3LPGA 1KJMB 2PUQT 1MFCL 1OARL 4D8PB 5J13B 1J0YA 3PV6B 4HKXB 4HGWB 5C8JB 3H9SD 4ZD3L 3UBXI 1OD9A 4PJFA 1J18A 1PG7W 1RZFL 3KGRA 2PYEA 4XPGH 3VFMA 1YMMA 5LGJB 4MWFA 3O41A 3UDWC 5IEKB 5ID1A 1HZHH 3RHWK 4L4TB 4JRXB 4GW4B 4XPHH 4K7FB 5FA4A 1G7QB 5GRYA 4PGBB 3ULVD 2MMXA 3S37X 1LEIB 1NUGA 2QSVA 5DK0B 4GBXC 4WEBH 3ARVA 3O6FB 4LSQH 4K2UH 4JPVH 1RZ7L 5C6TH 3BH9B 3ULUC 4OQTA 4PLNC 4Q9QH 4P49A 3SKJH 1QSEB 1CD9B 4OZIF 1A6TB 1KCLA 1Q0XL 3WJJC 1E4JA 4U6YA 3RWHA 4GRLB 4R96B 1FO0B 1QRNB 4KKCD 5KSAA 1A9EB 1AHWC 3X13B 1EJOH 1H3PL 2GSGB 2KPNA 3QCVH 4J4PC 3QHZL 3UZQA 1CICD 4Y1AA 4EJ1C 3KYMA 3QIWA 4WWKB 4EIZC 2FEDC 2XWJB 5DF0A 1A21A 4N0FA 1U8MB 5T5FH 2DTML 3DRQB 3T0EB 2HJFA 3ZYIA 4NRZB 1J8HB 1QPXA 3TZVD 2D2OA 2YRPA 4TUKH 1F6FB 4HS6B 2X4RA 5FYJU 1OGAE 2EDKA 1Q1JH 4AM0A 3TM6A 4C4KO 3WS3B 1I8KA 4LAQL 3S5LA 4LPYA 4XP1H 2FJGA 4PJBA 4OLWL 3GSXA 2HYMA 4DZBB 1C5DB 1GGCH 2Z35A 4PB0L 3S7GA 4LLUB 3T3PE 1HKLL 3INUH 3C09C 3HS0A 5KVFH 1U8NB 3G6DL 3QUYC 5T1DH 3ARTA 5EU3B 2A73A 5F89A 3O3DB 1L4IA 12E8L 1IC7L 4GG6B 4GBXD 5E99L 2AEIT 4X4XA 1DUYA 4M93C 3T3MF 3ULUD 4P2OB 3ZDZF 2V6HA 3BPNC 3WLBA 4ZTOL 1A14H 2D7PA 2X7LA 3RHWF 4Q6IB 2Y06H 1UH2A 1WZKA 1QFUL 4F8TA 4K71C 3PGDA 2OTWA 4OFDA 4MLIA 4MD4B 1NC4D 1OT1A 25C8L 1T5WB 4YH6A 4OAWA 4PRPE 1I8MA 5FCSH 3LEYL 5EZIL 3MLRL 3WEXB 1EO7A 1Z5LB 4Z7WF 1S7WB 2FEDD 3OKEA 3SDDA 1VGKB 3FQTB 3L5HA 4JO3H 4PRIB 1KN2L 5I8KH 4PJ7F 4I9WD 3SJVD 1JMZA 1HSBA 5CEYB 3OB0K 1YPZE 1UB6A 3HCVB 4OGYH 1BX2B 2OTPA 3L3IB 5J12C 2DD8L 2CD0A 1CU4H 3ZYOA 5JIKA 4Z78B 2EKJA 5E00A 5D6DC 1T04A 4Z76A 3GSNA 4R4NC 5BZWA 3E1F1 4G3YL 1I9RL 1MF2L 5GS0C 1ZWIA 4JFZH 4ZS7H 3QUYD 4J3SA 1NGQH 4PTTB 1MFAH 3N0PB 1V3KA 1NGPL 3CXDL 4BFEA 1MNUH 4NSKB 2APFA 3VD4A 2WIIB 2Q6WB 3MREB 3X3FL 1D5IH 3DUUA 2HFGH 3O4OC 4YHOL 3RWEB 2VDOH 5IVZA 1YY8A 4XPBL 2UY7A 2P8MA 3FONA 1DQLH 2CIIA 3U7YH 1XF3B 5ENWB 3VXMD 2DQFA 4HIHA 2FATL 4M62H 4W4OA 4EVNB 2YUVA 3KYNA 4OZIB 1YN7B 5L6YH 1S7RA 4HDIB 4ZYKA 4MNQA 4ODSH 1JN6B 3P0YL 5TDPA 1L0YA 2H8PA 1JYVA 4ZQKB 2NR6C 5D70H 3VFNA 2FWOA 3KVQA 4WUKL 2BNRB 2YPVH 4HEME 1OSZA 1S7VA 2ED8A 3CGTA 3GKWH 5J1AA 1I9JH 2DQDH 1OPGH 4Q9RL 4U1KB 2PW1A 4WFHD 2FX9L 4ZUUA 1YEIH 4RWHA 4YLQT 4R4ND 1T4KA 3D39A 3GUTA 2VZ1A 5DMIH 3R1GH 2XICA 4OI9A 3QUMA 3EYUL 4WI5A 3B6SB 5GS0D 2GK2A 1I9IL 1Q94B 1T2QH 3SDAA 3S98A 5D2NB 5J1TC 1PKQE 5K93A 1GC1C 1UCTA 4LLVA 5D5MA 3C60B 1U8OB 1A47A 3KYKL 2E27H 2JJSA 1AXIB 2AK4D 1ZLSL 3PWNB 5DSCA 4RX4D 1XR8B 2BCKA 4J12A 3DOSA 5E8PB 2A83B 2D31B 3QQ3A 1W8OA 3PXHA 3MRBB 1Q9WA 4NBYB 1OAKH 3ARGA 3HZVB 1DQDL 4AEFA 3JTTB 5KW9L 4TOYL 5CEXB 1SBSH 4P4RA 3IYLW 1CD1A 3BP6B 5TE4H 3B3IA 2DYPB 4NC1E 5GGSA 2VLJD 3CLFL 1JWUB 3LVEA 5FHBH 3IAGC 2GSIA 4BA8A 4PJCA 3CFKB 3UTPD 1IL1A 3AS2A 3ARWA 2PYEE 5CP7A 3AROA 1YMME 1U8PA 4GS7B 1OVZA 5IR1A 2FECL 1QA9B 1G0XA 2G2RA 1HZHL 4KDTA 4LPXA 4XPHL 3TO4B 3OXSB 4XNMB 5CP3A 2WBKA 4XNZB 2YXMA 4WTWA 4WEBL 2MHAA 4AEIL 1KJMA 4JPVL 2NXYB 5D7JB 4D8PA 5C6TL 4X6BA 3PV6A 4NQEA 4HKXA 4UINH 1A7OH 4Q9QL 3QEQA 3SKJL 2ZG1A 3O9WB 2O5ZH 4G8IA 1RZKL 5FDWB 1CFQB 2GK0A 2NY0B 2BHUA 3LEVH 4G7YH 3MRDA 4HMCA 5FYJH 1K3ZA 1YDPB 2P43B 2XRAH 3UZVB 1FNAA 3EFFB 4NOFA 5C1MB 1EJOL 2A6DA 3MLWL 3WO4B 4Y5VC 4MD0B 4AK1A 1OP3K 1FL6A 4Y1AE 1OAZL 2OM5A 4OCSH 3ZT5A 1OW0A 5TF0A 2WIMA 5T5FL 3VFRB 3G9VA 4PV8B 3CFJA 3WNNA 2X89D 3MSPA 2RR3A 5D96B 1QSEA 5C0FA 2XKSA 4BSWA 4H26A 3RIFK 2R1YA 4OTXH 4IRSC 1Q1JL 1QRNA 3HNTH 5CGTA 5BCAA 3X13A 1WWWX 5DK2A 3LKSB 1BZ9B 4XP1L 2EDXA 2JKXA 2VLRD 4PJBE 3VJ6A 4IEFB 3DXAB 5EZLA 4RAHA 4F2MA 2K3TA 4JHWL 3P4MB 5DUPH 1U8MA 3T0EA 5KVFL 4M7KH 3GMQB 1FJ1B 1MI5A 3TYGL 1J8HA 1K8DB 1DE4B 3JWDH 5B39G 3QRFM 4D9RD 1EAJA 1CDBA 1AQDB 4N1EA 3SDXA 4DUVA 5HI5D 3PXJA 5FB8B 1G7PA 3B83A 1NUNB 4U1JB 1EHNA 1ETZB 3QUZB 5BRZB 2DM7A 2Y06L 1SEQL 1C5DA 5DGRA 4ERSL 4APQC 3AGVA 2NY4C 4F33A 1G9MH 5CHNB 5JPNB 4OBSA 2XFXA 5F3BB 4OV5A 2W59A 1DQMH 4DGVH 2VDKL 2OR9H 1MLBB 4HF5H 3T09A 1J11A 2CO7B 2XTLA 4TPRH 5EC1B 2H45A 2XACC 4JO3L 5I8KL 4ZDHA 4KKAD 4OFKA 2ERJC 3HKFA 3IKCA 2VDNL 4NQCA 4QXWA 3UBXG 4KK6C 4OGYL 2DLIA 2YD4A 4IHOB 4LQ1A 5C2BH 1CU4L 4JN2A 4IRSD 5CS7A 2BVPA 3BFOA 3MLYL 4OFPA 3BPCB 3EJJX 3WHE0 1PG7H 5HYQA 1P7HL 2EO1A 4GKZB 4CADA 2D9CA 3VGEA 3RIFF 1RK1B 4JFZL 1DR9A 2NW3A 4HJJH 3RX5A 2V5TA 5CEYA 4W81A 3VXNB 4PRAA 1MFAL 2GI7A 1VKXA 3U4EA 2P5WB 1VACA 1BX2A 4XC3H 2YEZB 2DIJA 4WDIB 3SGKA 1U8IB 1D5IL 1BM3H 4MXWL 4NO0B 5C09B 4IRJA 1UZ8A 4DK6A 2HFGL 2QQKH 3O2VH 2VDOL 3K2UH 4DVRH 1T6WA 4NCDA 3K2MC 4XVJH 4Z0XB 4X7EC 4ODUB 3NZ8B 3T77A 3TO2B 3UMTA 4NM8H 2NY4D 1DQLL 3U7YL 4EUPG 4LIQL 2YPLB 3C2AH 2AJUH 1ND0B 1WIOA 2YD6A 3PV7A 4M62L 1Z9LA 3T65A 5L6YL 4OKVB 3BVNB 4MNQE 5DO2D 4CDGC 1KIQA 4ODSL 3VWKB 5D70L 4P2QB 5FAAA 5BXFB 4OM1L 1PX3A 2YPVL 1BMGA 1T0MA 3RWEA 3IAPA 5F7DB 4KK6D 4HG4J 1KCKA 4YQXL 3IT8D 2H3NB 3G5YB 4YAQB 2WBJA 1N0LA 1PGRB 5HPMB 2YSSA 1HH6A 4X7TB 5JUEH 4QXTB 3QULA 1I9JL 1YECH 2DQDL 3V4VL 2V2TA 1I7RB 1QLRA 1YEIL 1IAOA 4MXQD 2BXZA 4JFEA 5MP6H 2I9TA 4F9PC 1ZT4A 1P7QD 1AD9B 3D39E 2AJSL 5DMIL 3R1GL 3PWJB 4HG4K 3QEHB 5TF1H 2BNRA 5DD6B 1W0VB 3UAJC 2YC1B 1VGEL 5BJTB 3H6JA 4FQQA 1QO3A 1JNHA 4CW1A 4F7CB 5D5ME 2C3XA 2HFFB 3VXTA 5B22A 2E27L 1FGNH 1N2RB 4P4KB 3UCRA 2VDQL 4G42A 1VFUA 5IB3A 3N9GH 4NT6A 4RAVA 2DQTH 2ESVA 4CL7A 3KPTA 2MWCA 1WBYA 1Z3GH 3P9LA 1CGUA 1UJ3B 5C3LD 1UA6H 5SX5H 2W1NA 4M6MH 4Z6AT 1SBSL 5KSBF 3KNBA 3EO9H 5TE4L 5C0CB 3C60A 4NHCL 5FHBL 4PJCE 2BNQA 2JIXD 3RZCA 5DS8B 4BUHA 3P73B 4YNYB 1HWGB 3MNZA 5ITFA 2VIRB 4FZ8L 4UOJA 4YHNB 1M7IB 4HJGA 5LXGL 3ZKNC 4OD2B 4F80A 3MRBA 5ISZD 1WZLA 3HZVA 4P2RD 1S7QB 4X4YB 3JUYA 2AAVA 5F8RC 3VXSA 1H8OA 3JTTA 5J6HB 1WV7T 3DSNA 2F54A 4U1HB 1BEYH 2D03H 3BP6A 4NQEE 3V52H 2CKNA 2GEEA 3QEQE 4H25A 1HN1A 4NQVA 3U0PB 2J12B 1HHJB 1SYSB 3UC0L 5T3XH 4MDIA 3UAJD 2HFEA 1V05A 1PEZA 5F7KC 3L7FB 5FYJL 3SKNB 4Y16A 2XRAL 3WS6A 3LOWA 4V1DD 2F19H 2X4UA 3H0TB 3VRJB 1GZQB 2VITB 4BH7B 1GGYA 4HK0A 3BT2H 4EI5C 3BYYA 1X9QA 1X5LA 1T03H 3QIUC 4OJFH 3O9WA 1IARB 4HT1H 3WUWG 3M1BB 5FO8A 4B41A 4FQXA 4KK8C 4OTXL 1KUMA 1NMAH 3HNTL 1R3HA 3WFBL 1MFBH 4I18B 3VWJA 2H6PB 4NRYA 1JCKA 5I0ZA 3IS1X 1E4XH 3ECBB 3O4LB 5IT2L 4MD0A 4MJ4A 3QXTA 3UJJH 1KB5L 3CH1B 4LSDA 1IQDA 5IROC 4J23A 5DUPL 3GMPA 1CFSB 1LO0L 1UKTA 3DVNB 4MAYA 4G8FB 1MI5E 1I1CA 2YPKB 5KS9A 5HXMA 1FZOB 3MBEC 4WI2A 3JWDL 5I75C 1C16B 2VR4A 3UYRH 5IBUG 1K5NA 2NYYC 3SDXE 1N5YH 5DRXA 3LKOA 1BZ9A 3LQAC 4GKNB 1XGPA 3GSUA 3F7VB 2CLRB 3QWQB 3VD3A 2BVQB 2GAZB 3NCYS 2ICWA 4GAGL 2ZPKH 4M8QB 2BP3A 3QISA 2X09A 1CFVH 1G9ML 4F7EA 1LO5B 2A6IA 2K7QA 4G8GB 3ZDXE 1DQML 4H1LH 2VMFA 1S5IL 4DGVL 3BGMB 1LO3H 3OV6A 1QZ1A 2OR9L 1AR1C 1LWRA 4HF5L 2VYRE 4TPRL 1BD2B 4PJXB 4YFLF 4EI5D 3E0GA 1QBMH 2A9NH 2GJ6D 3DX9B 3QIUD 3D18B 4YC2B 1DBMH 4WO4C 4WTXA 5B38A 1F6AB 5BRZA 5JXEA 4NQCE 1ODAA 4HKZA 5C2BL 4KK8D 1NFDF 1FP5A 1CTNA 4WW2B 2AEQL 3LH2L 3PG2A 3CMOH 1S9KC 4HIIB 5F3BA 1PG7L 4HAGA 5HGHB 5KVDL 1LK3H 1I3GL 1KLUB 5AD0A 1KJVB 3RVXD 3I02B 3CDFA 1BWWA 2V9TA 4WNQB 5KSBB 4PJ9A 4Y5XB 5D4QA 4Z7VF 4HJJL 1WTLA 2FO4B 2V5RA 4UIMA 4CJ1A 3D25A 2ATPA 1BZQK 1XR9B 1WUNT 3MBED 4XC3L 2YKLH 3VD9A 4XP9L 1BM3L 3CXHJ 2QQKL 5GS1C 3O2VL 3G5XB 3I84A 1NMCB 3WJLC 3ULUH 1DBBH 3K2UL 5HYJD 1XF4B 5FO7A 3S4SA 4XVJL 1ZT1A 3IF1A 4NKMA 1BOGB 4NM8L 3D3VA 2Y36L 3MUGA 3C2AL 2AJUL 4P57B 1PX4A 3IJYB 3MLSL 5C07B 5JHLH 5JOPD 3KPNB 1I3UA 4Y4HB 3ZT7A 2NW2A 3P11H 3TBYA 3CFDA 4WO4D 4OF7A 5MHSE 3NIDF 3RUGB 5GJSL 3H9HB 3RVTC 3ZZ1A 4NNYA 1JE6A 4TNVK 4UTAH 1XIWC 5IB4A 5DJXA 3V8CA 3TV3H 5EWIH 1FORH 3OAZH 3L5WA 4QHNA 3O11B 1A3RL 1J10A 1YECL 1XF5A 2YPLA 3O6KH 3HC3H 3QUXA 2VE6A 4QHKI 4JHBA 5INCB 4LGRB 3MUZ1 3L3GA 1GOGA 3G6JA 3IETA 4PG2C 4JFEE 1KB5B 4XX1G 4LSUH 5EH1A 3QRGH 5IIEB 1KC5H 5BXFA 4NN5C 5ANMA 3VH8B 4H5SA 4JG1H 1VFAB 3M8OH 2IBZY 2YXFA 3RGVC 4L4VD 3PWLB 1CG9A 4PBWD 4GOSA 3FQNA 4X7TA 2VERN 5E6ZA 1ZHLA 5DI8A 1FGNL 1TCRB 3PP3H 2ZP0T 4WFED 2AV7B 2C1OB 4CAGA 3T04D 3RX7A 3G5VA 2EH7H 3MLTB 3GEWB 5C0AD 1T66C 2DQTL 2ESVE 2EDFA 5JO5A 3DVGB 4RGMC 3D2UA 2MPAH 2AGJH 4AZ8A 1UA6L 2Z31B 4M6ML 3OZ9H 4LHQB 4PJ5A 1KTDA 3OXRA 5GZNC 3RI5K 1IM9A 2XQBL 3HMXH 3B9EA 3EO9L 2DQUH 3BD4A 2E6JA 5F7HA 2BVOB 4Q97A 4N9GB 4LCUB 4OLZH 1BVLB 1Q9KB 2BNQE 5CD3B 1TVBB 1D7FA 2CRYA 3MNWA 3PDGA 4L3EB 2EC8A 1JJUA 2XTJD 3Q6FB 3RVTD 1XIWD 1H3XA 3HNVH 3RAJH 4N9OB 3U0WH 5IF0B 5JPMA 1ONQB 4D0BB 3FO9B 4KJQD 3TBSA 3WXWH 3VXSE 3OKOA 1FL3A 5DZLA 1UM5L 3BDYH 4LVHB 1T1ZB 4MQ7A 4XNYH 2F54E 4TNVF 2E8YA 1BEYL 3W11C 2D03L 5L0QB 4GKSB 3FCTB 1NFDB 4FFZL 5CINH 3SDYL 3V52L 1EXUB 2ICES 3NCCB 2QR0A 3BRGC 4D9QE 5I19H 5T3XL 4Y4FB 1JGLH 5F9WB 3P73A 1VFMA 3G04B 4YNYA 1YEHL 4NBXB 4PJAA 1V3JA 3RGVD 1T22B 5DTFA 4NZUH 1XGRB 5T1KB 5I1HL 4U7KA 4PV9B 1EFXD 5D72L 4JZJB 4XMPH 4CVXB 3E6FA 3VRIB 4AQOA 5JIPA 4WJ5A 3BT2L 4UV4H 4HUUB 2AJ3B 2R0ZH 1T03L 1ZHBB 4LRNH 1MSPA 4JGUA 4OJFL 3P40A 1A7QH 4TSBH 4X6DA 1QQDA 3N1FC 4HT1L 5TGBB 1CZ8H 4CBPA 1MREH 3C8KB 3H3BC 5GZND 1A6UH 4LSRH 1MFBL 4B53A 1WISA 4OUOA 5J8OA 1ZGLB 3FFDB 1GZQA 1WICA 4UQ2A 4ZPTA 3UJJL 3X17A 1XGYH 5HYEA 2EIEA 4BH7A 3U6RB 5IW6A 1BHGA 5L9DH 3ULVF 3RI5F 2H26B 3DI2B 5JW5A 1HKFA 1PFCA 2WUBL 5EZJB 5KS9E 1P69B 1EERB 2N56A 4X6CE 4TN9A 2OZ4H 2R69L 1EGJL 3NACH 5KVGH 3ULVL 2FR4A 3BPOB 3V5DB 5TDOB 1WAAF 2HN7A 2ZJSH 3TT3H 4YPGB 1N5YL 4X99B 3UTSA 3FRUA 4OF5A 3ECBA 4OZ4B 1RPQA 2RCSL 4G8EB 3L3KB 4NRXB 2Q3ZA 3CH1A 5CZXC 4ZO8A 4PREB 5DMYA 3ZE1F 1S9VB 4U1GB 3LD8B 2BY3A 1CFVL 2EDRA 1R5VA 3D5OF 4IDLA 3WFHA 1KBGH 2YPKA 1EMTH 3EYVB 1CLZH 3MMEB 1TZGH 1FZOA 2Q7YB 5E9DA 1LO3L 3HB3C 5ICYB 5C0BD 1A3LH 1R3IH 1GL4B 5BVPH 4NO2A 2G9HA 2A9NL 3C6LA 5I8EB 3SKUD 1DBML 3IDJB 4CMMA 5D2LB 4QYOA 3I6LE 4LASH 4PRDB 5EU6A 4PRHD 2JJTA 2GAZA 3DTXB 5E24E 2UUDK 1I1AC 1NGYB 4TVPD 3AS0A 4CVUA 1RY7B 1J05A 2IWGA 3SCMC 3QDHA 4OCXH 3DSFH 1LK3L 5I71B 2XT1B 1HDMB 2ARJB 5MEPB 5LVEA 4RCAA 1BD2A 4N8VG 5IJVA 2KL6A 5FKPB 4IOSD 3VU2A 5BV7H 5T33L 2R29H 2BXYA 5E08H 5CZKA 2EE9A 5HGBA 2D9QB 4W6WB 2E7LC 4NO5B 2X4NB 4GW1A 3DO7B 3HE6C 5EUKA 3PGCA 1JPGB 2YKLL 3EYFA 4EN3A 3SGEH 1Q72H 4HUVA 2YMXH 5IVXF 1NLDH 3QO0B 2BSTA 3NCYP 4FG6C 3ZL4H 3ULUL 1KLUA 1DBBL 3UTZA 3I02A 4XHJC 4QO1A 4WNQA 4JVWA 3OB0H 2FIKA 4Y5XA 5I66A 2P5EA 1P84J 3D3VE 4Q0XH 1VPOH 4DTGH 4G5ZH 2Y25A 2EDDA 1KLGB 3QEGL 5EUOB 3WMSA 1S78C 1CF8H 3HB3D 1RUQH 2VLMD 3ARDC 1HWHB 1GSMA 5JHLL 2RQ8A 1PY4A 4WUUA 5E5MA 4BZYA 2VQTA 3P11L 5HI4C 1KN4H 4ZTPH 4Z95L 1OSPH 4JO4L 3G5XA 4JJ5B 2P7TB 4XAWH 1J9CT 1QBBA 5DD5H 4KDWA 1P84K 3CCHB 4UTAL 2VDPH 3PQYE 2E6PA 3TV3L 5EWIL 1FORL 1I1AD 1OWRM 3FKUS 2EYRA 1KB9J 3SCMD 4ISVB 1L7TH 1LO4H 2MQ0A 3G6JE 3OJDA 5DA0B 2WUCH 3H9SB 2BDNH 4NO3B 4RIRB 4I4WB 3IDIB 4ALAH 4LSUL 3QRGL 3QIBC 1IEBA 1KC5L 1UWXK 2UWEF 4N0CC 3V6ZB 5ANME 3DVFA 4N0RA 2HVKB 3RUGA 2L7UA 4QRTB 2VL5A 3PL6C 2FJHB 2YD3A 3PUCA 5A1AA 3HE6D 1EA9C 4FQLH 1B0GB 1XH3B 1MJ7H 4LEOB 5H37H 4FG6D 5INCA 2Q8AH 3OR6A 2BMKB 2HRPH 1JF5A 2EH7L 4XHJD 5CJXA 4GXUM 1O7SA 3DI3B 1OTTC 3QZWG 5I1DB 4KMTH 3N06B 2R2EB 2DLEA 4P5MA 2AGJL 2CUMA 2FL5A 1EBPA 1VFAA 2YD9A 4POUB 4H1LB 1RAMA 1I7UB 4PJ5E 1S78D 3PP4H 2X1PA 3ARDD 3HMXL 5I1AB 3P2TA 3HUJF 3PWLA 2DQUL 1ZK9A 1CICB 2IJ0C 2W9DL 1OGAD 4W70A 5ERWA 3HR6A 4YGAB 4J1UA 3RWIA 2DTSA 3PIQA 3CDCA 4OLZL 4XVSH 2EDWA 5GGSY 2OYPA 1FBIH 3TZVB 1E27B 4E41A 3D6GA 4ETQB 4LF3A 3RAJL 3U0WL 3VRLE 4RFOH 1PLGH 3WXWL 1FVDB 3HAEA 3RWCB 3QNXA 35C8H 4XNYL 3SY0B 2E9WA 4XXCA 5JLZA 1MRFL 3W39B 5J89A 3QIBD 4HWEL 5I9QC 3IJHA 3WYRA 3MXWH 5I19L 5HHME 1JGLL 1FE8H 4OSUL 5GS0L 2H1PH 5I1KH 3O6LH 3TFKC 4PJAE 1LD9B 3PL6D 4LGPB 5ICZB 2FJFB 4NZUL 5INDA 3F12B 4GBXB 4XMPL 3GNMH 5F6IC 4PRPD 4UV4L 1MHHA 3T08A 2R0ZL 1OTTD 1I3VA 4FQPA 1EXUA 4LRNL 4XP6H 5IVXB 4TSBL 1A7QL 4X6DE 2MKLC 3D9AH 4JFXB 3MV01 3E3QC 4OIAA 1CZ8L 1BIIB 1WF5A 3G04A 1NC4B 4PG9A 3JTSB 1A6WL 4LSRL 4ZUSB 4OF6A 1XGRA 1CLOH 3EOAB 4PV9A 5DJ2B 3RDTC 2BC4B 2COQA 3OAUH 3GB7B 3ILPA 4LSTL 3X14A 5DURD 1D5ZA 1P9MA 1XGYL 4L9LC 3N1MC 3SJVB 4MA3B 1L0XA 2XV6B 4F3FB 2Z8SA 2XWBB 3BHBB 1E4KC 1NGZA 2VOTA 3FRPA 1ZT7A 5KN5B 4UTBL 5I15H 5TGBA 5C0NC 1IFHH 3NACL 5KVGL 3EOYG 3MRIA 3EO1A 1RK0B 2EEBA 1SEBB 4V2CB 5D6CB 3UTSE 1KXVC 3QWRA 1AO7A 1C12B 1ZV5A 1CCZA 3C09B 2X70A 2P8LB 3CZFA 1IC5H 2MSPA 5CUSH 3U36A 4NC0B 3TFKD 3QUYB 1ZA6A 2ZSVB 3MGTA 3GSOB 4WGWB 2NY2C 4H0IA 4XCYB 4Q2ZB 2UWEB 1KBGL 3VFTB 1GC1L 1AGFA 1EMTL 2R2CA 1TZGL 1TJIH 5E9DE 4M93B 1U3YA 1INEH 4DFHA 2OR8A 2Q87A 3ALWA 3BPNB 2AQ2A 3CPLA 2WQ8A 4RRPG 4KKBC 3MXVH 4NC1C 2J6EL 4XNXH 3VMNA 4NCC2 4K71B 5EU6E 3BGFC 4NRXA 4E42A 1JK8A 5E8EB 1VEOA 1HXMB 4LEXH 1U3HA 3VXMB 4I13B 3P4NB 4X80H 4FMKA 5TPWH 3QDMA 4LVEA 3BEVB 4NQTA 2BRQA 3EGSB 4EQ3A 1GGBL 3RDTD 2Q86B 3AUVA 4OCXL 3DSFL 1R3JB 2DKSA 2D4DA 2AJXH 4JRYE 5ICYA 2I60H 4UUJB 4QWWC 2XKNA 4L8CB 3O3AB 2WBWB 5J12B 2MQCA 4P46A 5CSGA 1F4HA 2IADA 1E28B 1Q72L 2YMXL 3EYSH 5KSAC 3IJSA 1NLDL 4GXUN 1IGYA 1ZHKA 4K7PL 4NN6C 5FO9B 3ZL4L 2ADGA 1RJZB 4GMSH 2ARJA 4KUCF 1CLCA 5MEPA 3QIWC 2V2XB 4ONHA 5DDHB 3QQ4B 2P5EE 5FKPA 1VPOL 2NY2D 3FT4B 4NP4L 4DTGL 3D1MC 4OGAC 3LKQB 4WW1B 1F4WH 4MQTB 3SDCA 3JV5A 1SM3H 3LPWA 1KIPB 4M00A 1CF8L 4FMFA 4NO5A 2X4NA 3O3EB 1JPGA 4WUUE 4QHUA 2AK4B 4ENEC 3CK0H 3MLUL 1F3DJ 4OD3H 4DAGH 1KN4L 5F9JB 4ZTPL 3QO0A 5TFSH 3MRLB 3IVKB 1OSPL 4XAWL 5DD5L 4XCFH 4CKVX 2VDPL 3EYOA 5J6GA 3OKLA 4XBGB 1A4KA 2PYED 3GSWB 4BK4A 6FABH 1KFAH 1YMMD 2BHZA 3CSYA 3V79C 5CBEA 3HZKB 3MLXH 1KLGA 1L7TL 43CAA 1LO4L 2VLJB 5FF6A 5DEFB 3LKNA 2WUCL 1JNNH 4GSDH 2BDNL 5IMLB 4HUMB 1UXWB 4GH7B 5GGTL 1I7ZB 3BXNA 4U31A 4UQ3B 3D69A 4DZ8B 2H9GA 1CFNA 3CCHA 3UROR 4DGYH 1HQRB 1U8KA 4GAYB 4YDIH 3AS1A 1KIRB 2XY1A 5MERA 4ZFZB 4I0PA 5KSAD 1MJ7L 4ISVA 1H0DA 1YN6B 1JGEB 4UDUA 3VXQA 1HHGA 2Q8AL 2PW2A 1OGTB 3NVQA 2VABA 2HRPL 3B5HA 3DX6A 4U4BA 3BKML 4Y1AD 1A4JB 3QIWD 3SDDC 2E9IA 1OB1B 3AU1B 1K4DB 2HVKA 4JQVA 4OGAD 4C54A 1JGDB 4MHHI 4GRMA 4LCWB 3STLB 1U91A 1ZHNB 3PP4L 1CDIA 4AQ1B 1U8HA 3U4AA 5EIIB 1A2YA 4ENED 4KRPC 1DLHB 5HPOA 4XVSL 1XH3A 3HR5B 5EPMA 4KV5F 3RGHA 4QRQB 4P5KB 5FM5O 1OAQH 2BMKA 1JYXA 4U1IA 3IU3A 3LPFA 4E41E 1XCQB 3RY5A 4L5FH 3ZTNH 5FKAA 1PLGL 2LTQC 4HQQH 5E2JA 1T2JA 1QYGH 4Y2OA 4DFIA 1WFUA 1D5MA 3NIFE 1I7UA 5LCVH 3JWOC 4RA0C 3NIGE 35C8L 1WZMA 4BUGA 1T20A 2VLRB 5I1JH 1HK6A 1W0WA 2GJZA 4NIKB 5GJTH 3MXWL 1LK2A 1FE8L 4Z7OF 3WIHH 5DQ9A 1UACH 3WLWD 5I1KL 3TZVA 1G7JA 3MJ9H 5B8CA 2DMKA 4QHKJ 5JQ6H 4QTIH 4LHUG 3GNML 3TNMA 4K7PX 3RWCA 1V7MH 2CDGA 1YC8A 2AI0H 1RUKH 4OCLC 1ZLUH 3IDXH 1KTLA 1PEWA 1UADC 1U93B 2CPCA 4XP6L 5E2VH 3DMMC 3LHPH 3SDDD 2EYSB 3D9AL 3FT2B 2BHYA 3LIZH 3VI3E 2JCCF 4ZG1A 2G75A 3QJFA 3NMEA 4Y5VB 5ICXB 5JOFA 3F12A 4KRPD 1CFTB 4GBXA 3KPOA 2YN3A 4GG8B 3B5GA 3BE1H 4NQDA 4ORZC 1QSFA 1FC2D 3MYZA 3ARQA 2ZG3A 4PJEA 1QTYT 3GRWA 4X9IA 2OK0L 1G0DA 5FGSA 2J5LB 4JZNA 3L95A 5I15L 4IRSB 2R1WB 1AHWA 3SPVA 5D7LA 1HE7A 3ZSSA 3SDAC 4OLEA 4J4PA 4FQCH 1B4JL 4HWNA 3I6GA 1OP5K 1EEYA 4WU5B 1AO7E 3GB7A 4M3JA 3MZTA 4O02H 1KULA 5E0QA 1ZLVK 5F7YC 2VISA 5CUSL 3CFBB 4YIQB 4WCYL 2FRGP 4BQ8A 2XWBA 3BHBA 4QF1A 2XWTA 2X4TB 1UEYA 3ARGC 4RWYL 2A1WH 4G80B 1INEL 1F58H 2A77H 2DKMA 4MNQD 4U6HB 3GMOA 5D6CA 4E5XB 3MXVL 2H41A 1RHHA 2GUOA 2LAGB 3DMMD 5SWSA 1MVUA 5ELIA 5GSVA 5FDYA 1RZGA 2OXHA 4LQFH 1C12A 4APQB 1N8ZB 1TDQA 2NY4B 4LEXL 3OX8B 4YX2H 2ZSVA 4X80L 5DVNA 2AEPL 1H5BC 5TPWL 3V4PH 3QDME 3BEWB 3CVIL 5CGYC 3MRFB 1NBYA 4KDTC 4L8DB 4DCQB 3BO8A 1JHLL 2I60L 4ORGB 1C7SA 1MELA 3W2DH 3CFEB 3PGFL 4BYHA 1WCBB 3HPLB 1ADQH 3D39D 2EDTA 1B9ZA 3Q2CA 4AMKH 5E5UB 1JPFA 2CLVB 3O3BA 5AUMB 4HKBB 1F4XH 3UX9B 3SDAD 5FUCE 3EYSL 3MJ8A 3P77A 1U8LA 4XPTH 4MQXC 1P7QB 1NEZG 3I75B 4JGMA 3CU1A 4DK3A 4GMSL 4RMQA 1HHIA 3IGAB 1QACA 4NDMB 4UUJA 4MCZA 1OW0C 1CIUA 2ZSWB 3VCLA 2VH5H 2SEBB 3C08L 4LNRB 3UTQA 3EYQD 5B3JF 3VGAC 1F4WL 3ARGD 1SM3L 4EXPX 4KGJA 5E56A 5ADPL 5MEQB 1AXTH 5D6DA 1U6AL 3TEUA 3LAFA 4DAGL 3EZ8A 4OD3L 2O61A 1T21A 5TFSL 3RY6A 4TQEH 1ERNA 4N0YL 4MX7A 3MRMA 3VDCA 4YXLH 5HYSB 4BSJA 3EOTH 5EOTB 1RJZA 4Z0BH 4XCFL 2YR3A 3MCKA 4Z7UA 4OFVA 2V2XA 2IG2H 1G7MA 1BQHG 1XAUA 5CGYD 2OTUB 4ZAKA 4TVPH 5E6IC 4CNIB 1RQ5A 2JCCB 1GGIL 1JNNL 1X7QA 4GSDL 4N5UA 4PJGF 3T1FA 5BS0A 1DJSA 2W65A 2JIXB 2NTFA 2AK4A 4JDTH 1MWAA 2VXTH 1M7DA 1EHAA 3KJ4C 4NQED 3QEQD 4DGYL 5ISZB 3OKNA 4P2RB 1BJMA 3GJEA 4JREC 3KPMA 3GSWA 3R4DA 4YDIL 4EOWH 3BZ4B 2UY6A 1KNOB 4A6YL 1NCAH 5D1QC 2WZPD 1VADB 3V6FA 5EG6C 1BJ8A 4PJHB 4DKFH 1NBZA 4MQXD 1NCBL 2NY7L 3D85A 2DBLH 4FFYH 3LQAL 2VLKA 3O81A 4I5BA 3AB0C 1QOKA 1I7ZA 5EO1A 3TBWA 4HUKB 3AFLA 2IBBA 5F7WC 4R4FL 4V1DB 1HQRA 5D7SH 2OZ4A 4KHXL 5F44A 5FGCB 3VA6A 3CSBA 4HS3A 3K1KC 3NN8B 3FQWA 4IOFD 1P7KB 1FCCA 1DUZB 4MSWB 1M7XA 1OAQL 1A4JA 2A6KB 5A2KH 1A6AB 4D0DB 4WI6A 3GSVA 4BM7A 4L5FL 2B8OT 1X5YA 3ZTNL 3FFCA 4HQQL 3AU1A 3PHQA 1G6VK 2DOCA 1K4DA 3BWAA 3WHXA 4KTYA 5F7LB 5E6ID 3STZA 3W5MA 4JM2C 2DDQL 1MI5D 4RA3A 4HXAH 4LCWA 5FOJA 3MOBH 5FYLE 5L88H 3ZE2E 5I1JL 4HC1L 3B9KC 5IBLC 2EYTA 1S5HB 5GJTL 1YEJH 4OCYL 4IRJC 3WSQH 5I30H 3EFDL 5KSVB 3WIHL 2V7HB 1H8NA 3IFPB 5K33A 1XCQA 4R0LC 4KJYA 4NUJA 3MJ9L 1J1PH 3UPRB 3OGCA 1CD8A 5EU5B 4KK9C 4QTIL 1A1OA 1IMHC 4OT1H 3VFPA 1ZEAH 4OD1H 1V7ML 1KOAA 2AI0L 2R23A 1RUKL 1MRDH 4NNPL 3KPRA 1FN4A 3IDXL 5ESAA 2VLRA 2OJEB 3QH3B 5K9KB 1R3KB 3NFSL 1QHPA 1FVEA 3DGGA 2AEWA 4NQCD 3LEXB 2M26A 2VAAB 3BAEH 2BNUB 4HIXH 2WBJC 2O5XH 4EI5B 2Y07H 5IM7A 2GJ6B 3CC5A 3QIUB 3BE1L 4NQDE 1XMWA 3CIQA 1IC1A 1QSFE 3VE0A 5IHBA 2AXFB 4AYFA 1XGUB 4PJEE 5A2FA 5CILH 1D6EB 4LDEB 2GTZA 3CX5K 3BP7A 4JM2D 1RZ8A 5D7LE 1M05B 1JF1B 1DN2A 1XGQA 2VRAA 3LN4B 4JY6A 5CJOH 3V5HB 1CFTA 5DT1H 5IBLD 5DQDL 1CDCA 43C9B 4GG8A 4IRJD 1JWMB 3NCMA 3V95A 4YHPB 5C9JA 2HT2C 1AR2A 2DN7A 4NN7C 3RNKA 4KVCH 2LABA 3LDBB 3EUUA 3MBEB 2W07A 4CVWA 5I75B 4LLMA 4UOW1 4A6YB 1ES0A 1AGDB 1MHEA 1V3LA 4IRSA 5HD8C 2A1WL 3V0AC 5IMKA 4WV1A 2OJZH 2Z4QB 2A77L 4MHHG 5IB2A 1HNGA 3FB6B 3KPQA 5CJ5A 1XCTB 4PPTA 3LN5A 3WXVH 3EJZC 5SWSE 1F90H 2BVEA 1LNUB 3HPJB 4HHAB 4LQFL 1K3IA 1N6VA 5GIRA 1I4FA 3MRKA 3RZCC 4ELMB 5MHSD 3CFBA 4YIQA 3U7AA 4YDJA 1FSKB 3MZGB 3V4PL 5DJDA 3DX7A 1CXHA 4KUZL 4ZODA 5I2IA 2WBJD 2YZ1A 3QWOB 3KPSA 5IHZB 3QA3B 1HEZB 2BJMH 1D3CA 3H3KA 2KBGA 4G80A 5MENB 4YHML 1ZXQA 7FABL 1UM6L 1B0RB 2R0WH 4WO4B 4V2BA 4JFED 4YHIA 1I75A 1ADQL 5GGUB 5IMLA 1X5KA 3DURB 4AMKL 1I3RB 3MRJA 4LCYB 5F1IA 1F97A 1QFWM 3TBVB 4APQA 4CVZA 5J1SC 4LLDA 1FFPA 1PAMA 3GGWB 5HVHC 1F4XL 3DV4A 1GZPB 4ODXA 4Y0GA 4Y16C 3O45B 1REIA 3GHBH 4OLXL 4S1DC 1MFDH 1G9EA 4ZSOA 2NY6C 1R3LA 4LOUC 4ODWB 5A2LH 3OJ2C 5ACZB 4XBPB 2HT2D 2PTUA 4MJ6B 1ZAGA 2RJMA 2VH5L 1LP9F 4XVUC 2IEPA 2CH8A 1TPXC 4L4VB 3U9PH 2DLFH 2ESVD 2DQGH 3TBTB 5HD8D 3TCLA 4FQXC 5CIPH 1AXTL 5GGQH 3MGOA 1INQA 3VWJC 5F96H 3EJZD 5C0AB 5H2BB 3EOTL 2BNQD 4Z7UE 3I50L 4ZUWB 3RZCD 5EIQA 4MCYA 5ESVB 4MNGB 4LNRA 3GMNB 1BZ7A 2AJYH 3IAQA 4TVPL 5D7IA 1JZ3A 1S9XB 1UVQB 4MAYC 3VFVA 3FO1A 5C0GB 3VXSD 2ID5A 5BS0E 3PABB 2I5YH 5SWZE 3AXLB 4MJ5B 2F8XC 5CEZE 2VXTL 2F54D 4O4YH 4BJLA 3JV4A 2CSPA 1XIWB 2GY7B 5FM8A 3T3ME 3BZDA 5EOTA 1YNKH 3IFLH 1HXYA 4HK3J 4MB3A 4LL9A 4PLOB 3ES6A 5F3HA 1EDQA 2LU4A 1B2WH 1NCAL 4Y16D 4FHBD 4LFHG 3Q5YA 4S1DD 4UU9A 4DKFL 5IW1A 2MCG1 2NY6D 4LOUD 4CNIA 1MCFA 3FQRB 1S9WB 1H9VA 2DBLL 4FFYL 4ODHH 4I48B 1QR1B 2JIXA 4NN5B 4LSVL 2VLKE 3TT1H 4LARH 4YO0B 2MQ3A 5ADOH 4XVUD 4Z7WE 1TVHB 4JPKL 7CGTA 3RGVB 4BQ9A 3MA7B 5KG9A 4PJ7E 5ISZA 5JXEC 5D7SL 3MA9H 1EFXB 3U48A 4WHTB 4M9PA 4FQXD 3MRNA 5ITBL 2ZCKH 2EE6A 2JB5H 2ITDA 4M7LH 1VADA 5TH2B 1YY9D 3VWJD 2CDEB 4KI5E 2ADJB 2NY5C 4TUJA 5F1OB 3BIAX 3QHFH 5IOPA 1ED3B 4OZHA 4RGMB 4JPWL 5GGRB 4PJ9C 2X9XA 1DFBL 2MTPA 3FFCE 4N1HB 3WO3B 3KDMB 5EFIA 2YK1H 4MAYD 2RIKA 1AXSA 5EO0A 1EEZB 5C0IA 3MOBL 2CKBA 3HRPA 1IAIM 5L88L 1S7XA 1U58B 3QXAA 1JPSL 1YEJL 5TQ0H 3ZTJG 3WSQL 3KR3H 3RWGA 5I30L 5EORH 3FHAA 1DUZA 4MSWA 4X9BA 5DLMH 2A6KA 4EXKA 3GBNH 2FZ3B 3RTQC 4FXKB 4AT6B 1YEDB 1J1PL 1M6OB 1IC4H 3EO0B 2B1AH 1QEWB 4S1SH 4OD1L 1RIUH 1EPFA 4MLSA 3KPRE 3RPIB 3MTRA 4R7DB 3L9RB 1P6FA 4X6FA 3QEUB 1A7PH 2OI9C 1AI1H 2ICEB 4W68A 4YBQC 4KGLA 1KTRL 3I6LD 5BRZD 5JXED 3EW3B 4F9LC 3BAEL 3MCLH 4M1DH 1CXEA 1YEKH 1LP9B 1LVEA 2DIAA 4YR6A 3RNQA 4HIJB 1QSZA 2O5XL 2Y07L 3QUXC 3B5TA 3CVHL 1R24A 1UH4A 3ESUF 2FGWH 1KPVB 2VXUH 3OB8A 1DQJB 1I7TB 3IRZA 4PJ9D 4OFIA 4PRHB 5J9PA 3FB5A 3OL2A 5CILL 5DJ0B 1CDJA 1KACB 1KLFA 1PSKL 1FVCA