3BKCL

Crystal structure of anti-amyloid beta fab wo2 (p21, formb)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVNLGEQASISCRSSQSIVHSNGHTYLEWYLQRPGQSPKLLIYQVSTRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQASLVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
total genus 52
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcL01
1NFDB 5DT1H 4L9LA 4QRPE 3MBEC 2FLRT 4PTUA 4JQIL 2NY2D 4O58H 3P4NB 4BYHA 5C86A 3RVXD 2CDEA 3CFCH 1N4XH 1YDPA 3IXAA 4Z7WF 1FG2B 1RK1B 2CLVA 3ULSA 1HXMA 3E6FA 1KXQE 1J8HD 4U1JB 1DVFD 3UTQB 2EYRB 1FGNL 3ZKND 4X9HA 4WI9A 3T0EE 1A6AB 1RFDH 2VH5H 1OT1A 1H15B 3DMMB 3DVNA 4KKNA 4Z9KB 2LAGB 4WNQB 3C08H 3ZHLA 5I71B 5JW3L 3RNQA 3QBTB 4I0PC 1FLRL 1MHHB 1I1FA 4AENB 1IAMA 2XA8H 4B7LA 5KOVC 1S7RA 4LGSB 4FQXD 3QIBC 2VDRL 5FUZH 3GB7B 3EO0B 5DDHA 2HMID 1F58H 3IYLW 4Q74A 4POZD 4OV5B 3FQNB 3ZDXE 2APVA 4CN4A 1A4KB 3CK0L 5C0ND 1QHOA 5EZLA 2A1WH 3ZDXF 5IEKB 4X6CA 2UYLB 2VIRB 4LSTL 1TCRB 3FRUB 4ONFL 3DBXA 2F8VA 3VFGL 3RJQB 1BM3H 3GSWB 1MCWW 1NC2A 1MSPA 3MR9B 3AREB 5IB3B 1OB1A 4LFHD 4QRRA 3QUYC 1B90A 4LCYA 3N1GC 2EEDA 3HNSL 5H35A 3EAKA 1RAMA 3K2UH 4QY8A 4MXWH 1M7XA 4QTIL 3IGAB 5DUBB 4RISH 4KZEL 4K71C 1RUMH 3QA3B 3SE9H 4FQHA 3PDDA 1N6QL 4HGWA 3TT1H 3IKKA 3QULA 2NY7L 3IETB 4A6YB 3X3GL 2FB4H 3AY4A 2EZ0D 3EHBD 5IEHA 5T1DH 4IRZH 5E8PA 5J57B 3BXNB 4APQD 1P4IL 1YQ2A 3BKCH 3VFTA 1JNLL 2B20A 3ARXA 2K1MA 1MH5B 1YNKH 9CGTA 4GS7C 3UTTE 1CBVL 3JV4A 2CIIB 1JGLL 2V5YA 5JXEC 2QHLA 3O2VH 4Y2OA 3GEWB 1JZ4A 2CR3A 4XVUD 2IAMB 2VWEE 3QYCA 4GRLC 5IB2B 4LKCA 4XP9L 2OYPA 3ZHDA 1S7TB 2XNAB 1F4XH 4Q97A 2EYTB 5C70A 4H0GA 4TUJB 4LFHG 4Y89A 4JPKL 4C56A 3FCTA 1IC1A 1ZTXH 4PGDB 4U1LB 3I3DA 1H3PL 2P5WD 3VXSD 4WHCA 3TV3H 2Q6WA 1JWUA 1G6RH 1U92B 1IVLA 1JHTB 2KH2B 1RZ7L 5D2LE 4RFEA 3R0MA 2D3VA 4NWUL 3U2SB 1IGJB 2W60A 5I1DA 3O6FC 5L8KB 2B7DT 3FB6B 4MB4A 1BLNB 5HY9B 1DVFA 1L0XA 2O5YL 3OXSB 2BOCB 3HRZA 1XGRB 1XF3A 4FXKB 4HT1H 4PB0L 3SDXB 2PKDA 1CU4L 3C6LC 4P4KD 4XMPL 3NTCL 4P57A 1X9QA 4OLYL 2BJMH 2ICEA 2OTWA 3FT3A 2QHRH 4KPHL 4B7IA 3MV9E 5C08E 3WE6A 4LPTA 4HS6A 3WHXA 4KH2A 3KJ6H 5IW1B 4NM4H 1BMGA 4U6YB 4LCUA 4NOBA 5AUMA 2AP2A 1JTTA 5L88H 2HTLC 3C9NB 2A38A 4LVOC 5FYJU 5IQ9A 4PLNC 1MJUL 4FQXA 3WDJA 4S0TD 4ZAKB 2P8PB 3WFEH 4WW2C 4I8DA 1AKJA 5IQ7L 1AI1L 3SDYH 1HOCA 2WBWB 3NFNA 1LEGB 4LSRL 3T0WA 3BIKB 4X7CC 5DI8A 5KVGH 3O3DB 1ZA3B 4J2XA 1HI6A 5FGCB 3X13B 2A0LC 4NNXA 4N0CD 5IJVA 3MLUH 1ZKAA 5IKCA 3VI4E 3QXUA 5FKPA 3L7FA 3AB0C 3EOTL 2GTZA 4R7NA 5D5MA 2GJ6D 3WIHA 5DUML 3E1F1 3V6FA 5GS0D 2VLJE 1SBSL 5CGYD 1F6AB 1X5KA 2MWCA 3WKNA 5FYJE 3BPLB 2YN3A 2IALA 1UM5H 1JUFB 3V8CA 1UXSB 3O9WB 4N9GB 4U7KA 1PKQE 4NDMA 3TIDA 2M2DA 2CGRL 4K7PL 2YD6A 4WTWA 2GSGB 2YHGA 1UKTA 4RAUB 1DN0A 2VXQH 3V6OE 3WHE1 4JZNB 3L9RA 4PTTA 4WFFD 4GO6B 1BAFH 5TE4L 1RIHH 3K74B 4XZUB 4OZIA 3NCJL 3MBXL 3TBVA 4NZUH 2C1OA 4EZMA 2CLZB 3M8OL 2HKHH 1E4WL 4YR6A 3ARVA 4X4ME 3GSRB 1NSNL 1TFHA 5SX4H 3SJVE 4WFEE 4F9PA 4KMQA 2QTEA 2QQKH 4PRDA 4TOYL 4GMTL 1KJ2L 3EYFA 5E95B 2QADB 4IMKA 5JW5B 3MV8E 4OCLC 1QNZH 3LCYA 1LD9A 5A1AA 4Y1AB 1J87A 1WAAF 3O8XD 1R3LB 3FN9A 1OY3B 3PWVA 2A9NH 3VD4A 3ULUD 3QFJD 3UBXB 4UQ3A 2ADFL 1OTUD 3BT2L 4ODBD 2CJUH 1KCLA 2BNUA 2YA1A 5T5NF 3CD4A 1D9KB 1SYVB 4KVCH 4M62H 5LGHL 2F53E 5CP7A 3GMQB 1T0MA 4DQOH 5C2BL 1UWGH 3TNMA 5IHBA 2XY1A 4LNVA 4YHIA 4IRSC 1PG7H 1TQCB 5FGBA 3Q1SH 1EBAA 1FYTB 3RFZC 5E5RB 5IVZA 4DAGH 1JZ6A 2F19H 3GMMA 5FYJL 1AXIB 3F6LA 2P45B 1AE6L 5GRUH 2HG5B 5IVOA 3GSXB 3MJ9A 2Z31A 4CADA 5FDYA 3L5HA 2NY2C 2CQVA 3LAFA 5CZVL 2H32A 3RVXC 5IMOA 2DS4A 3I3BA 4DUWA 4L8DB 1MI5B 1OAQL 3QO1A 1NLBH 1Q9KA 1FL3A 1KFAL 4QHNA 2IH1B 3EJJX 5E2JA 4PLKD 2OJZL 2I5YH 3C87A 3GSNH 3FQUB 5HYJD 3OZ9L 1AR2A 4NC1E 3S88H 5IFHL 1I8MB 3G5YA 3ZKNC 4PRAA 1X44A 2GTWA 4V1DD 4PRPE 1CIUA 4MDIB 4PJ8A 3J7HA 4QHMB 5LJYH 5SV4A 5MENB 5B39G 5IHZA 3ZKMD 2NCMA 1ZGLP 4NQVA 3H0TA 4H8WC 4BQBA 4XH2B 1DUYA 2HJFB 5EB9A 5TJWK 2C3HA 4D8PA 4LGPB 4L4TB 3SO3B 4KK6D 3V4PH 3DROA 5BV7B 3IKCB 3VI3E 3V7AE 3PABB 3W81A 4F8TA 2DBLL 2GJ6A 4YO0A 2AJ3A 4PJFB 4WWKB 4YUEH 1E27B 4G43A 1FRGH 1HCFX 1I8LC 3V79C 3L5XL 2PYFA 1H0DA 1FORL 2HMIC 3UAJD 2YEZA 4N8VG 4E5XA 3BPOC 3ARDD 4EUPG 1NGQH 4X6FB 4POZC 1IGML 2G9HB 1A14H 4JFFA 1FVDA 4HZLB 3Q5YA 3RJDA 1KLGB 1RUQH 1QTYT 3IJSA 4BK4A 1Z5LB 2EE6A 1KN2L 3SDAD 3OGCA 2GAZA 4PRID 1CFTB 5DD3L 2NY3C 1QFOA 1LO3H 1MRDL 1ZLWH 4JY6A 1VDGA 1DQLH 2DQHH 4RFNC 4YXHH 4WGWB 2WUBH 3VFVB 4J3XA 3VFPA 2XKUA 3LRHA 4J4PC 1GXEA 4NIKB 4O4YH 2EDDA 2P42B 5IHUH 1RIUL 5TDPA 3ORJA 2V7NB 1VEOA 2VDLH 2IBBA 4L4VA 5DHVH 5C9KA 1F11B 5ACZB 5DK2A 1CK0H 5CWSA 3DJ9A 3RVUD 3G04B 3OKDB 3EOBA 5EC2A 1YEGL 1T2QH 3O8XA 4XCNB 4XPHL 4Y4HB 3QXTA 3PQYB 1L7TH 1MQ8A 3FN0L 4LPVA 4ZSOE 2HFGL 5FK9B 4JZJA 2NY4B 5IB4A 3MLWL 4WVRA 3T3MF 4E41B 2EDQA 3GRWA 4H0HB 4APQC 3HMXH 4PS4H 4ZO9A 1A2YB 1R3KA 3DHMA 2FJFA 2VLRB 3HE6B 4D3CL 1A7RL 3CSGA 3QEQB 4OF6A 3W39B 3WN5A 5CD5D 4OD3H 2D03L 4NOFA 3GGWA 1QKZL 3FOMB 1DSFL 2DB8A 2E9JA 1JL8A 4XVUC 3N06B 2VJXA 4PY8I 1RQ5A 4UU9A 1MVFA 4ODXB 4M43L 3V2AR 4LCWD 4NKDA 5CS7A 4TNWF 1IEHA 3QPQC 2J6EA 4EUPA 3T4YB 4NHCL 4WHTA 4ETYA 3L3DB 1YY9D 4L3EA 3VFUA 1T4KB 4FTVE 4XPBH 1UB5B 4P5MA 1EK3A 5C0BB 1XGYH 2CO6B 4XXCA 1WIOA 2G5RA 3CZFB 3OKLA 1UM6L 3Q2CA 5HYJA 1VADA 3AUVA 4C54A 1G7JB 2EE3A 2FX8L 3IDJA 4ZOEA 1B88A 5IOPB 2Z0BA 2PR4L 4O5LH 5C6PB 1XZ0A 3AS2A 3MRBB 2GITA 1J1XL 1UM4H 3D25A 4WENB 2QQLH 4GUPB 2XTJE 4C4KT 6CGTA 2APTA 3J8F7 4GRMA 2N1KA 2MCG1 5HI3D 4OZHB 4IRJD 3MZTA 4K8RL 4UT9H 2ZCKL 1BQHA 4NNYB 4AL8H 4JFZL 1KBGL 3UYRH 5IBLD 5SWZB 4K23L 4F2MA 1ZWIA 3B2VL 3BWUC 1MFBH 3W2DL 1XGQB 3ARDA 5EPMB 4Z7VA 4GW1B 4LNRB 4YQXH 3PGFL 2E7CA 5DFTA 5TE7H 4X98B 4WUUA 1GOHA 4OLVH 2IBZY 4ERSL 1M71B 3SDAA 4MQSB 4NN6B 1P69B 3SEPA 4MDJB 2R8SL 3HS0A 3HC0A 4PP1C 5I17A 1VKXB 3O45B 3TBTA 4KUZH 5GS0C 1G9NC 4NC2B 3VW3L 1ONQA 1A2YA 3MLVH 4ZFFA 3TJEH 5BMFH 2EH8H 4KROB 4Z0BL 1KCSH 5JMOC 3MCLL 1BZ9B 5A3ID 3RIAF 3WD5H 2CD0A 4P99A 2ADJB 3S37L 1ZHBB 3KPSD 1U58B 1YJDC 3HG1E 4ZXBD 3FMGH 4HUWB 1DEEA 1KIQA 4AM0B 2QLVB 2XWJB 1UJ3C 3R1GH 5ICYA 3NZHL 1QHPA 5JHDB 1AXSA 3CLEH 4WU7A 5EC1B 2GSIA 4WHYG 1A5FH 4X6BA 2RFXA 2A6IA 1QP1A 4H5SB 1KPVA 4OLUH 4H8WH 2AS5M 2OZ4L 5HDLA 4E42A 4LMQI 1QFUH 1Q1JL 3FQWA 4NO3B 1O7VA 3FHAA 3P0VH 3DUUB 5HHNB 2DTMH 4PYGA 4UTAH 4R4ND 5JORB 1WIPA 4LKXA 1OP3K 3BP4B 5DVNA 2LV4A 4FQCL 1CICD 3MLXL 2WNGA 3WJLC 2B1HL 3FB7A 3ULUC 3GK8H 3IDXL 2UUDK 1MCIA 3FQXB 4HX1B 5DJYA 1O5DT 4P2QD 4S1SL 3QHFH 1OTUC 1FFNA 1WTGT 5D1XA 1OARL 5DMJB 1KYOJ 4M6MH 4AEIH 1MFEL 5GXBB 3LSOA 5DMGC 1N3NA 5D2NA 4BFEA 4XNXH 1RZKC 3QNYA 1F90L 4XC3H 1JHLH 1TZGH 4UUJB 4CJ0A 5IIEB 4AQOA 1BOGB 1CVRA 4FFZH 1XF2B 4CNIA 4OIIL 3GUTB 1UZ6F 5C07E 4G9DA 3ARRA 3I6KA 2M8XA 2AABH 2ZSWB 2AI0H 2YBRB 1MEXL 2OK0H 3NPSC 4KDWA 4OFPA 4ZS6C 4PBVC 3CSBA 4XNYL 4OF5A 1HILB 2AJVL 4RMVA 2FHFA 1G6RB 3GMNA 4JREB 2AXHA 4UNVA 4HDIA 5EUOF 3MXWL 3REVB 3LKPA 5GPRA 4LRNL 3CGTA 4R6UA 2CDFB 1BIIA 4BFBD 2P8MB 5T1KB 2MHAA 2HRLA 2HFFA 4PLKC 5I73C 1I1AB 4HGMA 1AHWA 1ZA6A 2H8PB 3ARFD 5I8KH 1KGCD 4FQIH 4N0RA 1T66D 4OZHF 4JFDE 3EYSH 4F7TA 4ODHL 5F9WC 4H20L 3SGEH 5D7IB 4WHDA 5D6CB 1JWSB 1CD9B 5KSBB 4YHYC 2ARJQ 3Q3GB 5I9QC 1RMFL 1TZHB 4MJ6B 5DJ8A 3DXAD 1NL0L 3S7GA 1SM3L 1CLZH 3RNKA 1J86A 3OL2A 3RX8A 3HTLX 5DJXA 1LE5A 2VQTA 1KN4H 5DQJA 5C0AB 3U6RB 4LLWA 4YDJA 3C09C 2HH0L 4QWWC 1GPOL 1L4IA 4JDVB 1KCVL 2AAVA 3UAJC 4K55A 4YDIL 5GQBA 4PREA 3MRPB 3IF1A 5I76B 4XPFL 1UEMA 3D2UD 2ADIA 2DQDL 4PJIA 4RZCB 5D7LE 2B1AH 1R0AL 3UJJL 1NCBL 2G60H 3UMTA 3LPWA 4KUCF 1N8ZA 5IWLC 3TJHC 1AY1L 2WSKA 3KYNA 5IG7B 3DX7B 3TWCL 3U4BH 1ZHNB 4B0MM 4K2UL 4HLZH 4UZGA 4RWYH 5ECJE 2X42A 1MFCL 1MJJA 3HAEA 3TA3A 4JKKA 2B2XH 2Q20A 4JY5H 1LO2L 2H26B 2F54B 3IDMA 2AQ1A 4ZUUA 1NJ9B 1A1OA 5FGSA 1ZGLA 4UT6L 4DZ8B 5FKAB 1QG3A 3QJFA 4N68A 3WSQH 4P2QA 3H7BA 1K4CB 4Z7QF 4GW5B 4UOJA 2VXVH 2HVJA 3MYJA 4I0PB 2V7HB 1FCCA 5DEGA 4L1DA 1FFPA 2PN5A 3NACL 4JPVL 4KQ4H 3GIVA 3IFLL 3MODL 2NXYD 3QIBB 3PDOA 5CFHA 5TDOB 2IPTL 5GS0H 3STZB 1G9NH 3UTSD 5H94A 1R5VB 1NMBH 4O2CA 1W0WA 3MJ7B 4M3JA 5TF1L 2XI9A 3DGGB 1DBJH 4J23A 3PL6A 5E99H 5C09D 1M7DA 5I1JH 1JZ3A 5ISZA 1INDL 1YJDH 1BD2A 3LKOB 1BBDL 1YY9C 2V5MA 4ZPVA 2C4XA 1U3ZA 2DTSA 2Y07H 1MJ7H 3KLSA 4OV6F 2R1WB 4YHML 2N56A 5A43C 5MHSD 1X5LA 3EYOB 5I2IA 4GSDH 5HHMB 5FIEA 2YD3A 3QUYB 5D72H 1E4KC 4H88L 2B0SH 1HHKA 1FZJA 1ETZA 4R26L 3KPQA 3HI6H 1Q0XH 4X9GA 4LSVH 2NYYD 1OCWH 5I74C 4RQQB 5TPWH 1XF4A 4HUUA 2P1YA 4FQQB 4K71B 1MVUA 2VKWA 1BZ7A 2WUCH 5T1MA 1AO7D 1H5BC 3AROA 4O02H 3UZQA 3MBEA 1TJGH 2BVPB 3DX7A 3QNZB 4XP1H 1D5BA 2QSCL 1VENA 4U6HB 1G7QA 3GZKA 3GSNB 4XB7A 4IRJC 3BE1L 4GRWE 5J0BA 4I48B 5HGAA 2YWZA 3H9SD 1FE8L 3QFDB 5SWSE 4GS7B 1RZKH 3T8XB 5J56B 4GRWF 3CDGB 2RBLA 5DR5L 4J8RB 2FX9H 1XCQA 1C5BL 1MCLA 1PW3A 2X89A 4K07A 3MNWA 4JAMB 4OCRH 4ODTL 3PWLA 3AM8A 3V4UL 2ORBL 4IEFB 1G7IA 4HFWB 5I0DA 2KUTA 2ZCHL 2DICA 3KPMA 5IR1A 3MXVH 4G3YH 3JZ7A 5I1GL 1EVUA 2AGJH 1CFVL 3ZSSA 4QHLA 5C7XH 3I6LE 4HXAH 3TCXA 1KENH 1CFQA 4MS8C 3QUML 4NQEA 2BOBB 4N0UB 4DKFH 5A3IC 4NZJA 5T1LA 1EERB 2AXFB 3TH3T 3O6FB 3LB6C 4ZXBC 2EDHA 3VXUB 3PV6A 2HN7A 3QIWD 4QRUA 3GJEA 3V5HB 4MNHB 3C6LB 1UZ8A 4YXLL 1HYSD 3OJDB 4JQVA 4DVBB 5I19H 5DHYB 1JPST 2UZIH 2DQTL 1AD9A 4J1UA 3P2TA 1RIVH 4JDTL 2FATL 4X4YA 3HLAA 35C8H 4KKBD 3MRIB 1X5AA 2CKNA 1IAKA 1A1NB 2J4WH 4MNGB 3MJGX 4UTBL 3L7EA 1HQRA 2MPAL 1F2QA 4ZPTA 4LVOB 1K2DB 4O51B 2RR3A 1QRNA 4WW2B 4ELMB 1CICC 1TZIA 5DGQA 1EVTC 4KHXH 3WUWG 3G6DH 3EDFA 7FABH 1IM9A 3F7QA 2V5SA 1RUAL 4TQEL 3DYMA 1S8DA 3D3VB 4BH8A 2R0LH 4M4RA 4LSQL 4OI8A 1U8LB 4HG4J 3BP5B 5FO9B 3BQUD 3IDYC 5B3NA 4JFED 3LEYL 3AB0B 1DBAL 5LWYL 4BZ1L 1JYNA 1CFNB 1BVLA 3DLQR 4WEBH 3G5ZA 4ZUTA 4OAWB 5JXEA 1MFNA 5E9DD 1DDHA 5JDSB 2MCPL 2Z9TA 1DBBH 1LHZA 1U8PA 2EDRA 4GRLA 3I50H 3BWAB 4LARL 3TYGL 4KI5E 3GO1H 1OPGH 5CILL 4L8SA 1IBGH 3EIFA 4JFOB 4J3TA 4ZO6A 4M00A 2FIKA 2UVFA 4G9FB 2VXUH 4J3UA 4KQ3H 3BP7A 4KI5F 2V2XB 3QR2A 2IG2L 4QOKE 1AO7A 1DBKH 1U8IB 4ONHA 4FQJL 4X6DA 2WP3T 4G8IA 1CZ8H 3MMEA 2ERJC 4IOFD 1YN7A 1LDSA 4NUGH 1HKLL 3U4AA 4P2RE 3TIEA 4PRHA 3NCYP 1Y6NR 3GJFB 2KZWA 2H41A 4OFKA 5EBMB 3ARFC 5CZXD 4MNQE 1FNFA 3CFEB 4PJBB 5GGQH 2FYYA 5I1KH 4NQCE 3EO1B 1U8QB 2FRGP 2XZQH 3STLB 1D6VL 5DJDB 4M8VA 2NQCA 1I7TA 1FZKA 1A6WL 5IBTL 1QLRB 4GAGL 2XN9E 3I02B 3WFCL 4PJDF 5GRJL 5C0IA 1NBVH 2BY2A 4PLJC 1GCFA 2CIKB 3DV4B 4NT6B 3WFHB 3RVVC 3TYFB 3FQTB 3L3GA 3UTZA 5BRZD 2VZ1A 5DD5L 5DHVA 5F7HA 1H3WM 1K5NA 1GJIA 1JK8A 3MLPA 1I9RH 5JHLH 1JN6A 3CJJA 2X05A 2UWEA 1NAKH 1S5IH 1WBXB 4ZNEA 5BS0B 4GMSL 3X12B 4AG4H 2PYED 1TNNA 3QEGL 3RUGB 2YSSA 4MX7B 4WI4A 3WL9B 2R2BA 4HIEA 3IDIB 1MQKL 2X1PA 3PWUB 1MHEB 4LHUD 5F71A 2DYPD 3ZKQD 1A6ZB 3DRTB 4P9HH 5KSAD 4WY7L 5C0RL 3WV0A 4OD1L 4OZ4A 4ZTOH 2NY2B 5AZ2L 1PEWA 1IC4H 3VJ6B 5DUPL 5JMRA 1SY6A 2ZG1A 1R3IH 1IC7H 4BH7B 1J8HB 3C8KB 5TH2B 1A0QH 3NN8B 3O6KL 4JFXA 5IF0B 4R3SB 4XCFL 2DRUA 4YFLI 3BGMA 1ODAA 5HHQA 3TZVC 3OJ2C 4KRNA 3DUSA 1SJHB 3B9AA 4U1SA 4JANA 1ZK9A 4YIQB 5BO1H 2DKMA 4N0FB 1U8IA 5DMKA 4HK3N 3OAYK 1RZJC 2OMBA 3NABH 4JDZB 1IGIL 4KTDL 1J18A 4JM2C 4JRYA 3UPRA 1RUKH 1HYRC 1W0VA 1ORSA 1W2KT 1HCVA 4PYHA 5E8DH 3D39A 4OCSH 2AXJA 4LHUG 4NWTH 1P2CB 2NXYC 1JZ7A 1QZ1A 2VXTL 3GBLA 4HWUA 2ATPA 4XBPA 3FO1A 3CDFA 5E9DA 3F12B 2BVOB 1T03L 5E7BA 5H8DA 5B3JE 5C0FA 4EKXA 2P24A 3QQNA 1PQZA 3MOQA 3OKNB 4PJCE 4P2OD 5B3JF 4X6CE 4XP5L 1R24B 3HZYA 5E94A 1UQSB 3WIIL 5E2TH 3D69B 1I85C 4GAFB 3RL1B 4G8GA 2H9GA 5MP6L 3H7LA 3DVIA 1QSFB 4RFNB 3N1PC 5B4MD 4IRSA 1FCGA 4QHUA 4QRRE 3X12A 2CK2A 1C08A 2ENSA 2YZ8A 4D0BA 3DVFA 1N59A 1VFAB 4AT6B 5ITBL 5D7SH 5FHBL 5C0EB 2FHBA 3S96B 3HMWL 4HIXH 3DWTA 3P11L 3WLWC 4H26A 1PKOA 3GI8H 3O4OC 3TO2A 4CMMA 3WYRA 3B5HA 3KPLA 5EH1A 1E28A 5K9KA 3FFCD 4OQTH 2ITDB 3WEXB 1QACA 2BP3A 5K93A 2IADA 1KTKE 5BXFB 2ARJA 1GZQA 4XXDB 4JE4B 5AD0B 4APQB 3FZUD 3MOAL 3MO1B 5GJTL 1MCFA 3VH8B 3VD5A 1DFBL 5B21A 3QPXH 1UXWA 2CRIA 4M1CD 5EORL 3QDJB 1FC1A 5F9OL 1EEZA 1OSZB 3DRQB 4P3CH 1Q9WB 3U46B 1KIPA 4LLUB 3H3BC 4G42B 1WJ3A 2DWEB 1M05A 2OTUA 3QDMD 3EDDA 3EKCA 6FABL 4F3FA 5DQDL 4LHUA 1MUJB 1FC2D 3TO4A 4KZDH 1X5HA 2DYPA 3CVHA 5IFAL 1WSST 3MLTB 2Q8BL 4C56E 3HE7D 4M3KB 2OL3B 2P5WB 3VXSB 4UDUA 4IBLT 4AYFA 2RCSL 5I1AA 4R7DB 1WT5A 1RURH 1RZIA 1KTRL 5HHPA 3UC0L 4M9PA 4EDWL 5KSUA 1J88A 1A9EA 4M7JL 1MCOL 4OI7A 3EFDL 1SEBB 4ZDHB 4ZFGH 1IGFL 5HJ3B 4L9DA 4Q9RH 2I07B 2ZUVA 3QIWC 3WJJA 3PWNA 3X11B 5DC0A 4P4KB 5LAXB 4K3JH 1HYSC 4G6JH 2VISA 1FNEA 4PJEB 1GC1L 1IEAA 1K85A 3O2DH 3OXRA 5DRZA 5C92A 3BO8A 2BRQA 3IFPB 1WBYA 1I3RA 1UB6A 3HZVA 3DSFH 3T08A 3PJSA 2DQGH 1NAMH 3NAAH 2AJUH 3CX2A 3O4LD 4I2XB 1I4FB 3NMEA 3FT2B 3RWGB 4WJ5A 3CFJB 4ZQKB 5GISH 1Q72L 4XNUL 1I3GH 3GBNH 1N7MH 2IBZX 3RPIA 5KVFL 5JA9A 4NYLA 5GGVL 3Q6GH 2W1NA 1PZ5B 3OWEA 4X5WA 5ALBL 1Z0MA 1YA5A 5ID0B 4P2OA 4DGVH 1HSAB 2NW2A 1EHXA 4JZOB 1NC4D 5I1EL 3DO7B 3U36B 4WU5A 3X3FH 1QSEA 5D5ME 1M4KA 4GAYB 1LEIA 4KJWC 4XMKH 3CVIL 3RY5A 4DGYL 1EEYA 3RWEA 5E00B 2JB6A 4HBCL 3VE0A 5I30H 2AERT 3CPLA 1U91B 3DSNA 3ETBF 1QLFB 4N8CH 3O2WH 3WNPA 1KJMA 1MJ8H 4GAJL 3OKKB 4RCAA 1UJ3B 1INEH 1J0ZA 2VQ1B 3H3PL 1B3JA 3WNOA 3VFWA 4U2YA 4GLRI 5AWNL 1YN6B 3RWCA 1N5YL 3G6AA 4OZIE 3BYYA 3C60D 4IOFC 1GOGA 3CU1A 5FYLD 3CLFH 5FDWB 4OZIF 2B4CC 5C3LD 2ICES 3C6SB 4XCYB 5CZXC 4YHNA 2Y25A 5JOPE 4HMDA 2OJEA 4YHKL 2ADGB 1LO4H 3QCTL 4ODSL 5JUEH 5GSRA 3A6BL 1DQQA 2P7TB 3RWFB 2W9EL 3GM0A 4UV4L 3QFJB 5E08L 4ZUWA 4XVTH 4PJ5D 1DLHA 1S7XB 5BJTB 4DW2L 2R56H 1OGTB 2XACC 3CCHA 5I8EB 4ALAL 1MFAH 1KB5A 1SVCP 2V9TA 2DM7A 1KB9J 5B39B 5IK3B 5EA0L 1XF5A 5HYQA 2L7JA 4FQ2L 4ZG1A 5MI0C 3WIHL 5IM7A 1YY8A 3JTSB 5TQ2L 4QRPD 1UKQA 4JO4H 3SCMD 4RAHA 1A7NL 1G7MB 1U8JB 3QUZD 3RTQA 3NPSB 3FTGB 2E7HA 1XGUA 1FHGA 5IROC 3D48R 3LMJL 4HJGA 4TVSa 1OAYH 12E8H 5KSAC 5KS9B 1GGBL 2AEQL 4N8VB 5HDOA 3DURA 5C0CB 3ROOA 2V2TA 2H1PL 4ISVB 1LO0H 1EZVY 5IBUG 4LOUD 1WFUA 4NCC2 4UOW0 3OR6B 4TSCL 4KKCD 1JJUA 5D9SA 3KYKH 4YHOH 1PDKA 3ZYJA 1IAII 4Q9QH 2Y36L 1FNGB 4HH9A 1AGDB 1TTGA 1ZS8A 1WC7A 3QP3A 4UV7L 5F1OB 2I9LB 4MXQC 4V1DB 1FNSH 3FO0H 1S7WA 3LHPL 3U82B 4F7EB 1X4YA 4D2NA 4NZTH 3KPNB 4K3HA 3KDMA 5F9WB 4M93C 4ZYKA 3WFBH 2BCKB 4PJ7B 1U8NB 1AXTH 4YHYB 2AQ3A 5J6GA 3B3IB 2HFEA 4M8QA 4JCMA 5I9QB 1AQDB 3LRSB 4ZO7A 4Z6AT 3V7MA 3L3JA 3PP4H 3HZKB 3QUXC 2R2EA 2N4IA 1OGAA 4AIXA 3R8BB 3C09B 1IGTB 2FR4B 5J1TC 2XY2A 1D5ZA 2OL3L 1J05B 4LLVA 3W11C 4C83B 4JFFE 1S7VB 4NQXB 4XP6H 3SKJL 1YEKL 3MA7A 1S5HB 1QVOA 1C5DA 2K3TA 4LQ1A 1AGFA 4OLEA 1H9VA 2JELH 4X6EA 5GGTA 5KG9A 3EFFB 3PV7A 1MREH 3UDWC 4CRPA 4Z8FH 4IIQA 5F7LB 3CMGA 4PRIB 1OAKH 1CE6B 1NCDL 4AH2B 3LKQB 3MJ9L 1JF6A 2ZCLH 4KJYA 1KCKA 4MMZC 3C60A 1I9JH 2D7QA 2Z35B 4U3HA 4Y5XC 2EICA 4G7VL 4OLZH 2DJ4A 1JI1A 3D18B 3MRJA 3VFNA 2ZUTA 3TN0D 1YEJH 2CKBH 5ESQA 1AFVH 4L4VE 3RIAK 1KTLB 5LKNA 5E56A 1KG0A 1LE9B 5J1AB 4WRLA 3DTXB 4QXGL 3WS3B 1B2WH 4D0DB 3BHBA 4FZEH 2OQJB 3P30H 4PB9L 3B5TA 1ORQA 1OM3H 4KK5D 1AGBB 4PJ5A 3UTTD 3MV7B 2W07A 1B4JH 4M7LH 4PG9B 5DTFA 2W65A 4OF3A 2Y06L 1P7QB 1WQVT 5I66A 1UCBL 4JPWL 4ENEC 4QXTB 3DECA 4M5YL 5IB1A 2AV7A 3SPVA 1T21A 2BSRA 3TT3L 1MWAA 4M1CC 3VRJB 4NRZA 5DJ6A 4TVPE 3JWNC 4HIIB 5F6HI 1FZOB 4NJ9H 4M6OL 2C4FT 4MJ2A 5MENE 3QUZA 4G80B 1QLEL 2H2PD 4LCWB 3BP6A 4PD4K 2GJZB 5DJ2A 5ADOL 1ZANH 4IOIA 4JKPL 4P3DB 3RAJH 3HE7C 3LKSA 1S3KL 3RA7H 2OCFD 4KY1L 3MACL 4YJZL 4L3EE 5D96C 4EI6A 2VUOA 3SGDI 3LPFA 4GXUN 5MEOA 2C3WA 4X7EC 4PJFE 3U9UB 2DDQH 5KS9F 5HHVL 1F4YH 2ICWJ 1NGZB 3ME0A 4IJ3C 1VFUA 5FXCH 5FO8B 2VC2L 1PGRB 1NUDA 1OOAA 3MOBL 2LTQC 4LIQH 1V8HA 3MROA 5ANMA 2AK1H 2FSEA 5C08D 3UTPE 4HAFA 3FB5B 4OM0H 5F96H 1NMCC 1T3FB 1Q0YH 5I74B 4LSUL 2B4CH 1UCTA 4LL9A 2A6DA 3SY0A 3I9GL 4WUKL 2YN5A 4DTGL 4ZTPH 1IC5H 1R3HB 4F9LC 4Z76A 2R4RH 4PUBL 2WWMD 1H5BB 2AEPH 1CFBA 3GMOB 2HWZL 3QI9C 4XNZC 4WCYL 4M4PA 4CU7A 4OLWH 1YEIH 5E6ID 4DCQA 4OGYH 4PJ7F 1MIEH 4HIHA 4EXKA 1J11A 4PY8J 2IQAA 4IRJB 2A77L 3WFDH 4V2CB 5DMIH 3VWJA 5FUOL 3GRWL 4Y8AA 1A6UL 4WO4A 2BHUA 3F7YA 3BRFA 5TF0A 4F7MA 1DTUA 2YD8A 3K8LA 4Z7VE 1HINH 5CJXC 4JR9L 4KAQL 1QBML 4H25A 3PQYE 3HPLA 4WUUE 3BKYL 1VESA 1OF2B 4Z7VF 5FYJD 1R5IB 1VPOL 1U0QA 4Q6IA 3RPKA 5J11C 4N0YH 1SYSA 3L5IA 3TBSB 1YMMA 1P4LA 1T0NB 3KLAB 4HEPG 4NM8L 2J6EL 2ZJSL 2JJVA 2AV1A 2CDGB 4UB0L 2WBJD 3U7WL 2WIIA 2VLRE 1HIML 4LLMB 2VDKL 2HT4D 4NZRH 2D7PA 2BFVH 4LU5H 1EJOH 1ZT4B 2J3SA 4ODVL 4XMLH 3KPSB 1XIWA 1J5OH 3QCVH 5DO2D 5IV2A 4ZXBB 1ADQA 1T1YB 3ESVF 4XAWL 5DRNA 4FABH 3NH7L 3O0RL 4X4ZA 5BVPH 1IEBA 1CGSH 2UZYB 4MCYB 4GW4B 2VDNH 3FONB 4RGNC 3SJVD 4WFED 3MRLB 5B22A 3LQAH 4MA8L 1OQOA 1N64L 3UTTA 3MV8D 3ARGA 5F1IB 3X14A 4S10A 3KPPB 2CH8A 1LDPH 4LRIC 4R0LC 3MRKA 5IFJB 3JTTA 3H42H 2FZ3A 2FBJL 1KLUA 4RA0C 4F7CA 1E4KA 1CG9A 1EMTH 3K1DA 1Z3GL 4HC1H 2G75A 3ILPA 1TNMA 4NSKB 3Q48A 5K9QI 1CICB 1X3DA 2DWDA 5FYKH 1IT9L 2WZPD 2F53D 1TVBB 5C9JA 3JV6B 3IU3A 2IMNA 3R06B 4XNMA 3FRPG 2JIXB 2PTTB 3OR7B 1QYGH 4XX1E 3PGDB 3BSZL 4KTEH 5DRWA 4JN2B 1ND0B 3IDYB 3I2CL 5KJRH 1LGVA 4LCIH 1WBZB 5DA0B 4OCWL 4JKWA 4P59L 5D2NE 5FEBA 4NPYB 4MWFB 3H2WA 1XR9B 1NGPH 1K4DB 4G8FA 5DK3A 4YXKH 3JV5A 2FWOA 3HB3D 3SKOA 2CK0H 5ITFB 4M6NL 3M45A 1L9NA 3B6SA 3QH3B 5HGHB 5SWQB 1TTFA 5ACLA 5DVLA 5HHXL 4NNPH 4YX2L 2Z91A 4R4BB 2WINB 2WV3A 4GBXC 3KGRA 3W82A 2DL9A 1BF8A 4HD9A 5DS8A 2JK5B 3WO4C 4C57C 5T5NG 3KLHC 4X5LA 4Y16A 1EHNA 3ZE0E 5LQBH 4PRPD 4FFYH 4KK8D 2R4SL 5ENWA 2VDQL 4RNRA 3VDBA 3T0EC 2ERJB 2MFNA 4ODUA 3ZE0F 1BHGA 2SEBB 1VGKB 4Z7UB 2A6KA 4AMKL 5HYSG 3ARFB 1QBBA 2YPLA 2NNAA 2VSDA 4I77L 5AZEL 1YEFL 4W70A 1MPAH 3OX8A 2F74B 4UDTA 3MLRL 1EXUB 2OSLA 4EI5D 4H1LA 3HFMH 4JB9H 5FUCE 1CLOH 2IJ0C 3LH2L 5JHDE 1YECL 2FL5B 3GSUA 3S3PA 4J6RL 3FFDB 2X4PA 1T1XA 4FS0A 4KFZC 4KTYA 4LVHB 5GGSA 3DXAB 2P44B 5ID1A 2ENYA 1XCTA 3BW9A 4LLDB 4LPXA 4Z95H 2JJTA 1M7IB 3NOIA 1E6OH 1IGYA 1PKQA 5EBWA 5EO9B 5FA3B 1DQMH 2BVQB 3MGOB 3FRPA 2PW2A 4WFGD 4P5KA 1U8HB 2WBJA 1M6OA 3IAPA 2VMFA 3HNVL 3KYOA 5JW4Q 1WZ1L 4NO0A 3SGKA 4CVZB 2E7BA 3VFOA 2VH5L 3C5ZA 4OQTA 3JUYA 2P43B 3D2UB 2BSTB 3D85D 3F58L 3LPGA 4G6FD 4PJIE 4M5ZH 4ONGL 3BZFA 2ICWA 4M02A 5K9OB 2OR9H 3C08L 5CJ5A 4FP8L 1KEMH 3QG6B 3ZL4L 2OR7A 2XG4A 5J3HC 3SJVA 4JFHE 3OGOE 1RSFA 5HI5D 5EZIL 3O6MH 1ZT1A 1FO0H 1NGXA 2IPUK 2WBKA 4JHWL 2XKNB 1JPFB 5HGGS 3V7AG 5FUZL 1X4ZA 1C5CH 3MRGA 4OM1H 4UILL 5CD3A 2RAMA 3GSQB 4FXGB 5EU4A 2C1PA 1SHMA 3HCVA 1G7PA 1TQBC 2BERA 2DI8A 3LEXA 2ZG2A 3TZVB 1J1OH 2LQRA 4NC0B 1U93A 5HYSA 5I1LB 3OHXA 4POYA 3VXQA 3GMRB 4WDIB 1KIRB 2VQUA 4JM2B 4XVJH 1BM3L 4S2SA 1VA9A 4UOW1 1ES0A 1NCTA 1NGYA 2XPGB 1B0RA 1QUNA 3K2UL 2YXFA 2NXYB 1YQVL 3QG7L 5CJBA 2P5EA 3UTSB 1BFOA 5EUKA 1WWBX 3AU1B 3RKDC 4JQIH 4FTVD 3A6CH 2H2PC 5D7IE 3TT1L 2FJHB 5C09B 4MSWA 3SDCC 4BFGA 1A9BA 2AJSH 5A2LH 1MCWM 1DQJB 1U3JA 1NAMA 1KV3A 1FVCA 2FB4L 4U33A 5ISZE 5CEZH 1BD2E 2MQCA 5GZND 1RJLA 3QEUB 1JNHB 1VACB 2HA1A 1T1ZB 1FGNH 3KYMA 5DXWA 1EEQA 3BKCL 4GOSA 1LNUA 4DFHA 2Z4QA 1ZLVK 4OGZA 4LASH 3EYVA 5CBEB 1U8KA 5DRXB 2NZ9D 2OM5A 3S4SB 2J88L 2XTJD 1CGWA 1FL6A 1IQDA 1P84K 5CBAA 1FLRH 4Z7UF 4UNUA 4F80A 1DLFL 5DJ0B 4HKBB 4HXBL 3MNZA 4NQTA 2O61B 1N5AB 4X4XB 4YGAB 1WFTA 2MSPA 4JO2L 3TV3L 1RY7B 2VDRH 3TPUB 5JO5A 5E6IC 3M17A 4K3DH 5FECB 4ZUVA 4J3VA 5EFIB 2QKIA 3OKMB 3FOLA 3P77A 4LHQB 3VFSA 3H9SB 5H37H 4PY7B 5K9QG 4HWZB 3WXWL 5LXGH 5IT2H 3VWKA 2X1XR 4IHOA 2X4UA 3LN4B 3CU7A 2NX5B 1KEGL 4LSTH 4OT1H 2IFGA 3C2SA 4BK5A 4ONFH 1D5XB 2Z93B 3VFGH 4P9ML 1KULA 5D1ZD 1HHGA 2BJML 2QHRL 2BDNH 2FH6A 5DA4A 3HUJA 4OZFH 2VABB 1BWMA 4LEXL 5CSBA 2R1YA 3BKJH 3HNSH 3QCUH 4NM4L 3ZTJG 5DJZA 2OXHA 3WUWB 2X4OA 4F33B 4KRPC 5DD0L 3HG1D 5L88L 2XKSA 4QTIH 2C26A 5GGRA 2YC1A 5IVNA 3V0WH 4KZEH 3DV6A 3V6OC 4NQEE 4XPTL 5EOTB 3SDYL 2JJSC 4ZFZA 1VB9A 2NY7H 4X5XB 2A83A 2IFFL 5DO2C 5F3HB 5KVGL 2HJKA 3X3GH 1D6EA 3CFIC 3EUUA 4LCCA 1EDQA 1FNLA 3BH9B 4CJ1A 5L8LB 4UBDD 3QIWB 4WV1C 2ESVA 1FL5B 1MCPH 4LGRB 1CL7H 1HQ4A 1P4IH 4NKOB 1HDMA 4Y5VC 2DQIH 4BUGA 1KOAA 4PJ9D 3G6JB 1T83C 3U7YL 1LK2B 1FGVH 1EUUA 3KR3H 1BX2B 4KJPC 1CBVH 3OKOA 2R15A 4OFIA 3BD5A 1T0PB 1I85A 4XGZA 1OLZA 2Z92B 3FB8B 3L95A 4S1RH 3RGHA 2F5BH 4PJXA 3TFKD 1PBYA 1R3JA 1SJXA 2ZOKB 4W81A 4D0CB 1MLBA 2ZZUT 2E7LA 1Q8MA 4JPKH 4LMQE 2YUXA 1QRNE 4GG6A 3LIZL 1H3PH 3WLBA 3JVGC 1QQDB 2ZOLA 4U1MA 2PO6C 1ZVSB 5HXMA 5F9DC 5FGRA 3U4EA 3BMWA 3BQUB 4KXZH 4GG8B 4NZUL 4K3GA 4JFEB 2JE8A 3EOAA 4MAYA 4PJGB 3KJ4C 1GHFH 1XH3A 1U3HD 4BQ6A 4QO1A 4HJ0D 5IGXH 2WANA 2ZNXA 3HB3C 4EOWH 4K94L 1HHJA 4QRTA 3NTCH 4XMPH 1RJYA 5JZ7C 3HPJA 4F7PB 4OLYH 3ABZA 4RMQA 1QO3B 2BC4B 3SQOL 3OJVC 2GT9B 2ED7A 2EDTA 2APWA 5I16B 3T65B 5GRWA 3QDAA 1WK0A 4W6WB 1LO5B 4EJ1C 4HMCA 1LEKB 4NC1C 4U1HA 3K4ZA 3VRIA 4X6DE 1MJUH 2XWTA 3VRLE 4DQOL 5HYFA 5IQ7H 1UWGL 4U1NA 2EKJA 3VXOB 1U95A 1AI1H 4X8XA 4LSRH 1NBYA 5HGDB 1PG7L 3NIGE 4X6DF 1TJIH 4PRHE 3VRLF 5CJQL 3B9VA 4N0UE 4DAGL 4PGEA 4M61B 2F19L 3TEUA 1X7QB 3PNWB 2VL5A 4LEOB 4EI5C 1CDJA 3L5WB 1X4XA 4UIMB 5DUMH 3NZ8A 5GRVL 4ZNCD 3RDTA 2PCPB 1NCCH 1BIHA 2RB8A 5D1ZA 1SBSH 3L3HB 3PIQB 3RKPA 4EN3A 3QQ4A 1RJZB 2B5IC 2Z8WC 3C5SB 4W6XB 2VZOA 2VYRE 3CUPA 5EIIA 4KUCD 5BRZB 2CKBA 2AEWA 5D7LD 3P4OA 4PFEA 4NKMA 3CXDL 4K7PH 3RZCD 5MI0B 2LFGA 3U0PB 3OAYH 2UWEE 5ABDE 1KPUA 4NQDA 1FFOA 3PHSA 4OD2B 2G5BB 4ZNEE 1K6QL 2PYEB 1N0LA 2X2YA 1INQB 1C16B 2DJUA 5TE4H 3MBXH 4X99B 3VGBA 3L3KA 1EZVX 2EC9T 4PG2A 4Q2ZB 4I5BA 1E4WH 2VO5A 5KSAB 4QGTA 2NR6D 1NSNH 3EGSB 3P9MB 1T04B 1BJ1H 1VFBB 3JWDH 4PJ9A 2NW3B 2X4RA 4IMLA 3C2AL 1E0OB 4MZ2A 1EFXD 3QDGB 4EVNA 2I25N 5FF6B 5ERWB 1Q94A 3RWHA 1IFHL 3F5WB 4ONOA 1A14L 2UZXB 5TQ0L 3NFPB 3BT2H 3LQMA 1VHPA 2MQ0A 4K8RC 3MRNA 3FT4B 4NUJA 1Y6MR 2R69L 4I3SH 1NUGA 5KTEL 2Q1EA 4M93B 4NQSB 5LGHH 3G5XB 1JZ2A 1UH3A 2DD8L 3OKYA 4G9FE 5C2BH 4YHLH 5DD6B 2EIZA 4G6AD 3V0VA 4GFTB 2C9AA 2W0FA 4JRYE 2P47B 4YXHL 4YDVA 3LEVH 5FYJH 3S6CA 3IRPX 3QXWA 3D39E 1WCBB 3DVGA 2CMRL 2DQCH 5D71L 4ELKA 3ROLA 5MEPA 4HIJA 1T2QL 3P4MA 4Y5YA 5ESVA 1EGJA 4JLRB 3RBGA 4W68A 3T1WA 1NDMA 4RX4D 4A6YH 4G6KH 1KIUA 2OJZH 4GT7A 5GZNC 4Z78A 4B41A 3OZ9H 1QR1A 4HZAA 1WV7T 2D31B 4JFPA 3OV6A 3O3UN 4G8GE 5ACMA 1SJVA 5B8CA 2DI9A 4Y5XB 3MRRB 2JCCB 2ZKHL 2NZ9C 1SY6L 3IDNB 5JNYA 4J3SA 1AGEA 2XTJC 3RUGE 4NO5A 1X6NA 2X4TB 2A6JB 3KPRA 3RQ3A 4PJAB 4AIZA 3OJMB 3FFCB 5SWSD 3L5XH 3M1BB 4XRCB 1FORH 4XPBL 4PJHB 5HI4D 4HSQA 2H3NA 4PRNA 1F3RB 1IGMH 3CSYA 3FO9B 3BEVA 1AP2A 2E27L 4Y2DA 2JTDA 3LKRB 3IDGB 4Y19A 1JWMA 1IQWH 1F45A 2NY6D 1GIGH 2VZSA 4X8JB 4NZDA 4L8CB 4E0RB 3QNXB 2DQUH 5DD3H 1RUPL 1KPRA 1VCAA 1MRDH 3QDMB 1RVFH 5FOBA 2VLME 3V5KB 4O5LL 1KT2A 4MLSA 1NMAH 3I6LD 5GS1A 3REWB 3K8KA 2QSTA 5FM4A 3MSPA 1S7QB 1P6AB 2QQLL 4YHPB 1EX0A 5L9DL 4YPGB 2P46B 3MLYL 2NY1D 2VRAA 1TVHB 1RIUH 2NY5L 3HE7B 2ZNWA 3LS5H 1CD8A 2DM2A 1FVEA 4Q6YA 4UQ2B 4YHZL 1MRFH 3LS4L 3QUXA 1ZMYA 1SJEA 5D96B 4BFIA 4UT9L 1EFXA 1K8IB 2X7LA 1RPQA 4AL8L 1B0GA 2VAAB 3QIUD 3V6ZA 1YEGH 4XPHH 5HDBE 3SDDA 1MFBL 5GS3A 2LTQB 3RGVA 4MB3A 3L3OB 2HFGH 3MUHL 3AXLA 4WI8A 5HDBF 3BPCA 2R0ZL 5F1KC 2XWBA 3W0WA 3P9LB 1KUMA 2I9TA 1FO0B 1FV1B 1A7RH 1W72A 3IT8D 4ORGB 4XPGL 1HEZA 1IKNC 2APFA 4TTDD 2IPUG 1T22B 3QI9B 4XNZB 4JHBA 1A1MA 1QKZH 2A74B 2X70B 2ZG3A 1I7RB 1CT8A 3O4LB 1QSFE 5ELIA 5BMFL 3TFKC 4M43H 4JPIA 3BRGC 1I1YA 4CW1A 3BX7C 4P46A 3B9KD 5DD1H 4MD5A 3VXRB 3VG0H 4YEFA 4NHCH 1CFSA 4P23A 2J2ZA 1H3VA 3CLEL 2AK4D 3MGTA 5T3ZH 4NRXA 4U05A 1NLDL 2IGFL 2ITCA 3RWDA 5IB5A 4S1DD 4OLUL 5J9PA 1YEDA 5ETUB 5J11B 1UM6H 4U1IA 1NC4B 3CVHL 3T4AA 2NTSP 2EO9A 2GK0A 4KI5D 5J1SC 1QSEE 1U3HC 4LSSL 2AQ2A 3FAXA 1ED3A 4P4RA 3S5LG 5GGUA 4JRXB 2DTML 4UTAL 4QRQB 4U31A 1GGUA 3MRCB 1FN4B 1XT5A 1Z9MA 4QOKD 2YR3A 5DJAA 2HJLA 4MHHI 4HBQA 1ZHLB 3MRDB 1KC5L 3T77B 1ITBB 1BECA 1V3KA 3T1FA 5IVXA 4P2RD 3DI3B 4QXUL 2MOVA 4RBPK 5ICXA 4G6ML 1AD0A 1F8TH 4K8RH 2ZCKH 1HXYA 2W9DH 4JFZH 5D6DA 1KBGH 4K23H 4NQCD 1ZHKB 4XC3L 3MUGB 3B2VH 4GKNA 1JZ8A 1I3VA 1OP5K 2OI9C 4R0LB 5D7JD 5MERA 2OMNA 3PGFH 3S35L 4FMFA 4ODWA 5GZOD 4MCZB 4PJHF 4OZGB 2FGWH 3BZ4A 4ERSH 4PGBA 5I18L 2OK0L 3P0YL 4LQFH 1X5JA 1DANT 2Q7YA 4KKLC 2R8SH 3KNBB 4B50A 4QCIB 3E3QC 4NO2B 3DOSA 3O3EB 3S34L 5FB8B 4F9LA 1LWRA 1QPPA 2IANA 2VLLB 1NCWL 5H2BB 3BAEH 1P7KB 3L5JA 4MAUH 3QI9A 3V5DB 2QR0A 1CYGA 4X0KA 4Z0BH 2QSQA 3MCLH 4KROC 2E6PA 1HZHH 3S37H 1DCLA 1MF2L 5CMAB 2IH3A 1YPZA 2X1OA 5INDB 4I2XE 5B38B 3QXAA 3TP4A 2ZUSA 1YNTA 4ZS7L 4UINH 3D0VB 3RZCC 5T5FL 5I8KL 4FA8A 3KWWB 4QRPB 5IW6A 1X5FA 2D4FA 3ARBC 3SCMB 3L6FB 1HHIB 1YMHA 1LP9A 4LP4A 3V0AC 4RIRB 2EH7H 4ZFOA 5E2UL 5D1QC 1F4WH 2F5AH 4JFQB 4GKSA 5I1HL 3MV11 3WIFA 2NR6C 3KAAA 1T2JA 5BV7H 1Q1JH 3WO4B 1IRAY 4WW1A 4XI5C 4G7YH 5EZOH 4JO3L 3T0EB 3MRFB 1UVQA 4FQCH 2J7LA 3MLXH 5J6HA 3MUZ1 3VA2C 3O3BB 2B1HH 3RWJA 3ZTNH 1BP3B 1A4JB 3IDXH 3MPCA 2PXYC 1AIFB 4PR5B 4S1SH 4HGKC 2EXWD 3GSVB 4LBEA 3LQZB 1OARH 4NCDA 4RAVB 4UNTA 3TVMD 2NTFA 1MFEH 3AMLA 1UH2A 3PHQB 1S9YB 3QT2A 3QHZL 3HI5H 2AK4A 3PWPA 4G6AC 1BBJB 1Q38A 2CRYA 2ZPKH 4L8BA 4OIIH 3SE4A 2ZP0T 4RWYL 4BSWA 4EDXA 1MEXH 1KB5L 1NEZG 1BJ1J 5JPMB 1GVIA 4XWOD 3ULVH 2E3VA 1IL1A 5INCA 1OGAE 1C12A 1ZT7B 1MCSA 4XNYH 5IMMA 2AJVH 1SMOA 3KXFB 2BY1A 4IS6A 4O2EB 5DEFB 5JOFA 4R2GD 5HPMB 1CN4A 4XBEL 1YEHL 5KVMC 3MXWH 2VB5A 3T2QA 4BQ8A 4LRNH 5ESAB 1HH6B 2HLAA 1NC2D 2QQQA 3NCEB 5TDNB 1HSBB 3ALWA 4QRRD 4P2RA 1MAKA 3RVTD 5DQ9B 1G0YR 2MMXA 1MLCA 4TYUA 2VKXA 1I1AC 1JGVL 5CP3H 3H9YA 1QD0A 1L9MA 1A6TA 3VCLB 2DLFH 4KQ4L 1S78D 2YD1A 3EYUL 4ODHH 2EKSB 5JOEA 5KSVB 4H20H 4UT7L 43CAA 3O41B 2CLRA 3GKWH 4Y4FC 4XHJD 3C8HA 2XV6B 1WWWX 3DX9A 3MRHA 4Z7WA 1RMFH 2EC9U 3TN0B 4DGIH 5I1IL 4OZFA 1SM3H 1TPXB 3MX0A 1DBJL 3NGBC 2HVKA 2BK8A 4TNVK 2Y9RT 4LLYA 5E8OB 1I7UB 1K8DA 3NCYS 32C2B 1TQBB 5F88A 5C0DB 3AS1A 3MLSL 2P8LA 4MD0A 4OZGF 4FRWA 4U6XB 4GBXA 2BZDA 3M07A 2XICA 3KPOA 3B8YA 2HH0H 2EIBA 5C0CE 3NCMA 1GPOH 4PJ5E 1KCVH 5HI4C 4TUOA 3FQRB 4I0CC 2CSPA 1SVZA 3G5VA 4QTHA 2C7UB 3BH8B 5F89A 2GCYA 4XPFH 1PY9A 2NY6C 3SKMA 2DQDH 5CINL 1R0AH 5EN2B 3HI6L 3WMSA 1Q0XL 5DVKA 2YMXL 5F1NB 1F3JB 1T7YA 4C56D 2X4QB 5BOPA 1Z2KA 4G8EB 3IJYA 4KK9D 1Z6JT 3SBWA 3AAZB 1NEZA 4EBQL 4OF0A 43C9B 2DI7A 4K2UH 4QRSA 5IHLB 3SDCB 1BFVL 1CXHA 1MFCH 5D2LB 3U9PH 1O7SA 4XP1L 2DQFB 4Q0XL 4PV8A 1LO2H 5GGTL 4PIRF 1F13A 3TH4T 3TNNA 4HV8A 4L3CB 3QO0A 1XGTB 3ILQC 1NDGB 2NLJA 3QIUC 4MHHG 1MHCB 3GM8A 3UXFA 3KVQA 1UG9A 1JIBA 1RHHB 4HCRL 1BGXL 2L0DA 3MV9B 3QWOB 5FYLL 3PHOA 4G5ZL 5ANME 4NJAL 3ZLQC 4OCRL 1QR4A 1F6LL 4P2YA 1OTTD 1FZMA 2F58H 3ARED 4JFYA 3I6GB 3TVMA 1JGEA 1KJ2B 2M1KA 5EU5A 3A6OA 4I1NB 4G3YL 4I3RL 4K7FB 4DZBA 4M1DH 1PYWB 2EIDA 2O5ZL 3VD3A 2IPTH 1AKJD 5E6IB 4HXAL 4KVNL 3UBXI 4Z77A 5C7XL 1X6LA 1YUHB 5CIPH 5TF1H 1T20A 1UJTA 3HI1A 5JIPA 1I8KB 1KNOB 1WTLA 2M26A 3B9KC 4XPAL 5KN5B 4PJCA 1U6AL 4YAQB 3DYPA 3ES6A 4ETQB 3P73B 4OF7A 1MWAL 4XCEB 1BBDH 4JY4A 2J8UA 3CFDB 4YHMH 5JIIA 1N2RB 1H3GA 2VLJB 4HKZB 3DGCR 4FFVC 2X4NB 3TBWA 3IFNH 2DJSA 1Z9OA 1G9ML 1N6UA 3MV7E 4YNYA 1A7QL 1I3UA 3N9GL 4H88H 5DLML 3QEHB 3ECBA 5J89A 4HHAA 5EZJA 4R26H 2IAMD 4Y4KC 1Y18A 4KI5C 4KRPB 5F7DB 1YMME 1S7SA 2XRAL 3S36L 1JF1A 5JQHC 2IMMA 5L2KA 1AR1D 3BZEA 4P5TA 1DUZA 1IM3B 3QZWA 4Z7NE 1NFDA 5C8JB 1MCKA 2F8XC 1QBAA 1NANI 3S98A 3HZMB 3G6DL 4N1EA 3BI9X 2XFXB 3P4NA 4WV1B 2R0LL 3A67L 1B6DA 3HR6A 3MRMB 3NFSL 2X1QA 1FG2A 1ZVYA 1RK1A 3BE1H 1HWHB 4Y5VB 3ARWA 1FE8H 1DQTA 5CLWA 4U1JA 4NHUB 5JOPD 3MV8B 5BQ7B 3UTQA 2EYRA 2AXGB 5DR5H 1C5BH 5D7JC 4C59B 5DK0B 2GQHA 2X5PA 1A6AA 1H15A 3WBDA 3N1QC 4NP4H 2IPKB 3DMMA 4BELD 4WNQA 3V4UH 1MFDL 3QXDB 2ORBH 4OCNC 1NH6A 1OPGL 2J5LC 2ZCHH 4DK3A 4NBYB 1IBGL 3MJ8B 5I1GH 3QWQB 1MHHA 2F53B 3ALXA 4Z5RB 1NFIB 4AENA 2VXUL 1CFVH 3IRZA 2PO6B 4BQCA 3NPZB 3QUMH 1Q9LB 3GB7A 3EO0A 5I0ZA 5BVJB 4OV5A 3KJ4B 3FQNA 2Y6SD 5D2LF 1DJSA 1A4KA 3SE3C 5DYOB 3B43A 5ICZB 2D4DA 2FO4B 1JV5B 4L9LC 2Z31D 3CXHK 5IEKA 2XZQL 5CEYB 2WWKO 2UYLA 2VIRA 3D87B 2DQTH 1TCRA 3FRUA 4JDTH 2NXZC 3AFLA 1EV2E 3LZFH 3GSWA 4LLQB 2YK1L 3MR9A 1NGWB 5GSVB 1ZAGA 3AREA 5IB3A 1ADQL 1E4XH 2CRZA 1JHKL 4FG6D 4UTBH 2D7MA 2MPAH 1NUFA 5EU3B 4GRWH 5F7UA 5DMYA 4PRPB 5KZCD 5A16B 1I9RL 4LAQL 1F5WA 5IMKB 3IGAA 4PJ8D 5DUBA 2OP4L 1T89A 1RZGB 4K7PY 3QA3A 2DIBA 3W5NA 1DP0A 1RV6X 4OGXL 1RUAH 3U0TB 1KCUL 4AG4L 2JJSA 3GMLB 2EXWC 4LSQH 5FM8A 3IETA 4A6YA 1ULVA 2YPLE 3LEYH 4EI5B 3SKNB 1N0XL 4P9HL 5LWYH 1JGUH 4BZ1H 2FJGB 3BXNA 1DE4B 3VI4F 3V52H 4ZD3L 1V5JA 2VLKB 1MH5A 5E70A 4FMKA 2B5IB 1KELH 2CIIA 3VXPB 2MCPH 4JFFD 2E9WA 4PGCB 4XWOC 2IAMA 2EYSB 4W4NA 3TYGH 1T5XB 5IB2A 1JRHH 5CILH 1S7TA 2XNAA 2EYTA 3WS6A 4O9HL 4TUJA 3E6HB 4RRPA 3L1OH 4CDGC 4R2GC 2IG2H 4PGDA 2DQEH 4FQJH 4U1LA 1U8MB 5BCAA 4Z5RA 2Y7QB 3D85B 1JPGB 4G6FB 5E4IA 5BO1L 1U92A 1TITA 5GIRB 1HKLH 3WNNA 1JHTA 3K1KC 3K80A 3QQ9D 4QF1B 3U2SA 3VFMB 2EEAA 1IGJA 4L4VD 1FQ9C 3FB6A 3VFRB 1BLNA 4OCSL 1QFWL 4U1KB 3OXSA 4X80L 5HY9A 3E0GA 2BOCA 1S78C 1GC1C 4NWTL 5HYEA 1D6VH 1XGRA 4FXKA 2IC2A 3SDXA 3OPZL 1QEWB 5IBTH 8CGTA 4ZSOB 3JXAA 3WFCH 1REIA 3AY4C 5JLZB 1JYXA 2ZSVB 4MJ5B 1EHLL 1B0WA 5DWUH 5IW1A 1X5GA 1ZLVH 1OQXA 4U6YA 2CXKA 5DD5H 1IAIL 3UBXG 3JSSA 3CC5B 3C9NA 1F4AA 2X9WA 4TVPD 5E2TL 3BESR 1XEDA 2OS7A 4ZAKA 2P8PA 3QEGH 1LEGA 1T1WB 5MEND 1UYWH 3BIKA 5HVWA 3CAFA 3O3DA 2V6HA 1ZA3A 4JM4H 2R1XB 5HD8D 3GKZA 4GXUM 2DQJL 3X13A 4BA8A 4R97C 1OAXL 3VXNB 4PD4J 1VFOA 5M95B 2YD9A 5MEQB 1NKRA 3NCCB 2P5EE 4KK9C 3IJHB 2XYCA 4L3ED 5D93C 4FTVB 4HIXL 3MCKB 1EIBA 3O11B 2FNBA 3GI8L 4HMEA 5K9JL 2ATKB 3MTRA 4OQTL 3F6IA 1F6AA 1K3IA 5GRVK 2YXMA 1BQLL 3MRQB 4OJFH 1JUFA 2YA0A 2YPKB 3O6KH 3UTPD 1UXSA 3BVNB 3O9WA 4N9GA 3UCRA 1DVFC 2ARWA 4XCFH 3Q6FB 3OKEB 3QPXL 4HKJB 4HW6A 2R0WL 2GSGA 4RAUA 4JZNA 4WEMB 2NY0D 4N1CA 2XTJB 5E2VL 3KYAA 4XZUA 5DEZA 2COQA 2VITB 5JXAL 4HF5L 2CLZA 4RFOL 4MXVE 1UH4A 5F8RC 3GSRA 5TE6L 4GQ9H 1U8OB 4HUXB 4KGLA 4XCCL 1P1ZB 4FQXC 4CAGA 2VXTH 5FV2A 4DEPB 3F7VB 3VI3F 4CVXB 5JW5A 1JPTH 3CFKB 2CO7B 4Y1AA 1T03H 2A9ML 1R3LA 4HS3B 3PQYD 5IJKA 5C0NC 4QT5B 3UBXA 4WUUD 5E5UB 2LVCA 2I24N 2Q76B 4HULB 8FABB 4MJ4A 1FJ1B 1BVKB 4WFGE 2Y5TB 4XP5H 1Y0LB 2EDEA 2DBJA 2UY6A 2Y72A 4K3JL 1D9KA 1SYVA 3LDBC 5EBLB 5ILTL 3WIIH 5E24E 1CGUA 3IXTB 2DOCA 2JKXA 5E8EB 2EXYD 3GMQA 3IB4A 4Z0XB 2VLRD 1BPVA 3DIFB 3HUJE 1C1EL 3R4DA 5E5MB 3DSFL 1FYTA 4W4OA 4JKLA 1NAML 1MCNA 4RSVA 1ZLWK 4L1HA 3HG1B 3BDBA 4DWHA 4JJ5B 5GRYA 1AR1C 5GISL 5ITBH 1AGCB 4Z18A 2HG5A 1N6VA 4GJTB 5HGBB 3T2OA 3HMWH 4U3XA 3R8QA 3P11H 2PNDA 3GSXA 3GNMH 5FHAL 1BQHG 4L29B 4WI5A 4MGXA 2EZ0C 3EHBC 4YGVB 3TC9A 4PP2B 4L8DA 1MI5A 4ZODA 2ESVE 2YD4A 1CE1L 2XZCL 4UAOC 1KTDB 2IH1A 3MOAH 1DZBA 4FOMA 4DGVL 5GJTH 3U83A 1DFBH 4PV9B 4OGAD 3FQUA 1R5WB 3X3FL 5EORH 2R0KH 4IMKC 4XMKL 1I8MA 1Q9OB 2BNQB 4MDIA 4QHMA 3ZYZA 1DBMH 3MFFB 4PJXE 5MENA 4OIAA 4TUKL 6FABH 1AC6A 5DQDH 4XH2A 2HJFA 4TSBL 2AJYH 1PAMA 4HUVB 5IFAH 4L4TA 1XR8B 4MQ7B 5D1XD 2EDNA 3IKCA 4GG6E 2R23B 4NRYB 3S3SA 1B4RA 3GBML 3N85L 3PABA 2VE6B 1BEYH 3D0LB 4PJFA 4WWKA 1E27A 1RZ8B 2AKRB 5F9JB 4GG6F 5FGBC 3UC0H 5C07B 4EDWH 3RP1A 3CFBB 1A3LL 3RL2B 5EOQH 1ZSDB 4M7JH 3EFDH 2N7AA 4X6FA 1IGFH 2G9HA 4HZLA 1KLGA 1U3HB 1QA9B 4PRBB 3GJFH 5EUOB 2FECI 1KJVB 1Z5LA 4OKDA 3TCLB 4P4KC 2V9QA 1GC1H 3QQ3B 3W9DB 1CFTA 2AJZB 3D5OF 4MQXD 4PGZA 1S9XB 1HH9B 3VD7A 3QJHB 4XVTL 2A73B 4HK3J 4HKXB 4NCC1 3VA6A 2P48B 3VFVA 15C8L 2RIKA 2C3GA 5DFVD 1IAOB 3TBYB 2V7NA 4XX1G 2I26N 3RWIB 5CSGA 3IAGC 1F11A 4JFDB 5GGVH 5ACZA 3GMPB 2V2WB 4FQ1L 2OI9B 3Q0HA 3G04A 3OKDA 5JHDD 1JGDB 4JO4L 4XCNA 4Y4HA 4N0CC 4BSVB 3EW3B 3PQYA 5SX4I 5I75C 5CSZB 5DVOA 3BN9D 3MZGB 4XBGB 5ALBH 2WW8A 3I75B 3W9EB 4MQTB 5FK9A 3DX6B 2C3VB 4E41A 1O0VA 1RD6A 12E8L 1GZPB 2DM3A 3BYTA 2E7MA 3CVIH 1HNFA 1NBZB 5C0GB 1OAUL 3G6JE 2UVEA 5CGYC 5CHNB 2VLRA 3HE6A 5CIPB 3QEQA 3W39A 1LO0L 4HBCH 4L3AA 2X40A 3FOMA 3QXVA 4NKQB 4N90D 4ZOCA 5D7LB 3CH1B 4ODXA 4M48L 3RZCB 5EWIL 5CEXB 4GAJH 2D0GA 3H3PH 4C58B 3ARBB 4NQDE 4JFHD 1TTUA 2YZ1A 1G1YA 2XOTA 3T4YA 3OAZK 3L3DA 5EOCL 4KJQD 3WFBL 5EU6B 3ZDZE 1OD7A 5D1QB 1FNAA 5AWNH 3B4NA 3ZYOA 1T4KA 3OAUH 4HG4K 1UB5A 5C0BA 5I8CB 4WI3A 4BM7A 1L0YA 2L4OA 3TA3D 1F02I 2E6QA 3QQ9C 5KVEL 1I8IB 3CZFA 4K9EL 4YZFE 1A3QA 2PTVA 5F3BB 3WXVL 4YHKH 1G7JA 3QCTH 4ODSH 4DJMA 2WIMA 2E8ZA 4YZFF 3O8XC 2AW2A 5FA4B 3GSOB 2PW1B 4D94A 5IOPA 4UV4H 4PBXA 5E08H 4GKZB 2PXYB 2D9CA 4JHZA 2R2HB 3MRBA 4DW2H 3T3PE 4ALAH 1CVSC 4XP6L 5DJCB 1ZLSL 4I4WB 4JZJC 4GUPA 2XQYG 3GIZL 2JELL 1RULL 1G7LB 3T3PF 3LN5B 3MREB 4OZHA 5EA0H 4QLRA 4FQ2H 2EDOA 2W59A 3WIHH 3WN5C 4OFYD 4NNYA 2GUOB 4DKEL 2ZCLL 5SWZA 5IMLB 3U0WL 1A7NH 3ZYIA 3HR5B 5CJOL 1XGQA 4MJIB 5EPMA 4GW1A 4LNRA 4OLZL 4X98A 3PL6D 4HS8H 1CD1B 3LMJH 4O2FB 5ISZD 1YEJL 2CKBL 1AFVL 3HAEG 3L3IB 1BD2D 1S7UB 4UI2A 1A22B 1M71A 1JNNL 4MDJA 1B2WL 3O3AB 1L6ZA 5JQ6L 4FZEL 3K81A 5I6XC 2BVUA 5C0AD 3O45A 3QUMB 1F3DH 1VKXA 1NUNB 1FAKT 4LPWA 3PWJB 4I3GA 4TSCH 4I18B 1HHHB 2FIRT 1G7HB 1DL7L 1BZ9A 2ADJA 1ZHBA 1U58A 4UV7H 5F7MC 4HUWA 4OQ1A 2Z8RA 1FSKC 4AM0A 1P9MA 3EDEA 5L2JB 2XWJA 3ZKMC 3SGJA 4Y4FB 5JHDA 2VOTA 5LVEA 5EC1A 5LCVL 3MBED 4I9WD 3NGBB 4KK6C 4H5SA 4D9LL 2VN4A 3BEWB 4R96B 4GRWB 2BHZA 3KPRE 2GFBB 5BZWB 3RA7L 1QSVA 5SWSB 4NO3A 2OL3H 3DUUA 4OUUB 5E1AB 5E6YA 5HHNA 3KHOA 1DEDA 3IVKB 4MD4B 5JORA 1EAPB 4K3EL 2X89D 3ARDC 3BP4A 4YH6A 3G08B 5DSCB 1YEKH 4NBXB 5C1MB 2NY6B 4Y19E 1CTNA 2FBOJ 5EO1B 1I7ZB 3FQXA 4HX1A 4PLOB 1FFQA 4X9FA 3MNVB 1TVDA 3SDAC 4OM0L 1IZJA 1MOEA 2EDLA 4JVPA 5FFLA 4I0PD 4R9HA 1NCDH 1P5VA 1X5IA 3MJ9H 5TGBB 5JPNB 3BIAX 1Z9LA 1RK0B 2EXYC 3O81A 4UUJA 3QWRD 4JGMA 5IIEA 3B9DA 1BOGA 3QIBD 4NQED 4XTRD 4BKLB 1XF2A 2NY1B 1YEIL 3GUTA 5T1LD 1EGJL 1MIEL 2VNCA 2ZSWA 4OI9A 2YBRA 4OSUH 3S3JA 2O5XH 4JCLA 4X7TB 3G9AB 3DX8B 4QXGH 2YRPA 1W8OA 3QIUB 4OLXL 3RVUC 4F58L 4YBHA 5FYKE 1HILA 4HJJL 1YYLL 1G6RA 2VDML 3REVA 3S5LB 2BNRB 3SKUD 1UCBH 2CDFA 3E8UH 2P8MA 5F7FA 5T1KA 5HHMD 3W0WE 4AK1A 5D70H 3QUYD 4M5YH 3FKUS 4N0YL 4OGAC 4P2CG 1I1AA 1XGPB 2H8PA 4OFYA 1WWCA 5CD5C 2V5RA 4OFDA 4KI1A 1QRND 2DKSA 5A40E 2FD6L 2Q86B 4KMLB 5HTSA 4XC1L 4HK0B 4RBPH 1IM9D 4W6YB 5D7IA 1EJOL 4HLJA 5D6CA 1JWSA 3AS0A 3RIFF 4XMLL 5KSBA 3Q3GA 1TZHA 4MJ6A 5D1XC 3B9KB 5ADOH 4JKPH 5CAYB 5BVPL 1S3KH 1CGSL 4KY1H 3MACH 5D2NC 2VDNL 3VXTB 3LV3B 5C0AA 3U6RA 4LF3B 1ZE3C 3LQAL 4ZOBA 5HHVH 2J8OA 3BRDA 2YRLA 4JDVA 1KXTB 4HFUL 5EG6C 1D5MB 5JXED 5LGJB 3MOBH 5HHOB 3BUYB 3PF2A 4JVWA 3MRPA 3R0NA 5BZDB 1RZFH 4Y4KB 3H42L 5I76A 4GRLD 4QYOB 2BSSB 2XZAL 1V3MA 4LSUH 1ZVHA 5KVDL 4RZCA 3I9GH 1NFKA 5J4MA 1OLLA 1EMTL 4WUKH 4DTGH 4RMUA 4QOKB 1RHFA 2W0PA 2HWZH 4MQXC 1T7ZA 5IG7A 4DFIA 3H9HB 4WCYH 3ULUH 3LKNB 4DN3L 4Z7OE 1ZHNA 2Q3AA 4MA3B 2XQBH 5IVXE 5HI3C 2OX5A 3VXMB 4PRHD 5FO7B 2A77H 1GSMA 5KJRL 3TPKA 4Z7OF 4M9OA 2EIEA 5FUOH 4LCIL 1AHWC 2KDGA 4MNQB 1PFCA 3IFOB 1A6UH 2H26A 1T5WB 2F54A 4NQCB 5C6TL 5IBLC 3SO5A 1S9WB 4AEHH 4C55A 4PJDB 1W72L 5FUCC 1U41A 5D7JB 1NJ9A 3C5JB 2XN9B 4KAQH 1L7IL 4DZ8A 5FKAA 5IESL 3QUKB 1UKSA 1CXFA 3BKYH 1VPOH 1K4CA 2J5LB 4GW5A 3HC4L 4NNPL 4I0PA 3UROR 1S9VB 3BIBX 5EO0B 2V7HA 2ZJSH 4EUPH 2HTLD 3IDUA 3OG4B 2X4SB 4UB0H 2IANE 5C0JB 3U7WH 1CLYH 3DO3A 5SX5K 1HIMH 5I15L 4LSPL 3QWRA 2J8HA 3QIBA 5TDOA 4ZUSB 3STZA 2H6PB 1R5VA 2PUQT 2KBGA 4WFHE 3MJ7A 1YPZE 4HPOL 4XAWH 3DGGA 2A0LD 3B2UD 1NPUA 3O0RH 1IILE 4OCMC 3K8MA 2JLLA 1YPZF 1WZMA 4L9LB 1MPAL 2YPVL 4WTZA 3LKOA 3VXRE 4JG0H 4MA8H 1LP9E 4PTUB 4JB9L 5DURD 1N64H 2Z8VC 2NXZB 2R1WA 2CDEB 4X7SL 1YDPB 3EYOA 3IXAB 1LP9F 3TA3C 2CLVB 5F72S 3ULSB 4K7PX 1UGNA 1HXMB 2VZUA 3E6FB 3ZO0A 2FBJH 3QUYA 4JHAL 4R4NC 1E6OL 1Z3GH 4RQQA 3SQBA 3U7AA 4XWGL 4DOHE 4FQQA 4JRXE 1RU9L 4G9FD 3WO3B 1Y6KR 5ALCL 3HNTL 3DVNB 3T2NL 5M94B 4JO1L 4OB5H 3WCYA 3QRFM 2FEDD 2BVPA 3BSZH 3QNZA 4TULL 4JRYD 3I2CH 3RNQB 5JR1H 1AJ7L 2MTPA 2JB5L 2D7TL 4U6HA 5CEZE 2Y4SA 1UENA 1I1FB 2OR9L 3GSNA 1VGEL 4OCWH 4P59H 3D39D 3SGEI 1S7RB 2EDWA 4I48A 3LD8B 1GAFL 2AK4E 4RGNE 3PWPE 3OQ3B 3QFDA 3O6ML 4M7ZB 5DDHB 5J12C 3T8XA 2DLGA 3CDGA 4J8RA 4M6NH 1C5CL 5KBNC 4JAMA 3OMZA 4YX2H 5EZLB 2BHYA 4JG1L 4X6CB 2YD5A 4YFDB 4HFWA 3WNLA 1BWWA 4R2GB 3DBXB 2FLBT 2R4SH 4R8WH 2VDQH 1U2CA 4G8GD 1NC2B 5CJ8A 4ZFOL 1OB1B 4QRRB 4IRSD 4LDOB 4LCYB 4XVJL 4MVBD 1EO5A 2BOBA 4AMKH 4N0UA 5H35B 1FAIL 2AXFA 3DYOA 4XB8A 3O6FA 4QY8B 4FFWD 5AZEH 1P53A 1YEFH 1T66C 3VXUA 3MLRH 3SE3A 4DVRL 5D7KD 5I1CL 3ZSTA 4FQHB 2VL4A 2W91A 3V5HA 3MV01 4MNHA 3C6LA 3LH2H 4HGWB 1IARB 1YECH 4J6RH 3OJDA 3QULB 4DVBA 5FM5O 4Z7WE 4LVHC 5DHYA 3QB7C 1T7XA 3A6CL 5IEHB 2X1WL 1KCRL 1MRCH 2RJMA 5E8PB 2AJSL 3MRIA 5CEZL 1A1NA 4YC2C 1F3DJ 5EU7E 3VFTB 4MNGA 4AEFA 5JW4N 2BMKB 3HNVH 3JV4B 2GY7B 1K2DA 1WEJL 1WZ1H 2HKFL 4O51A 4ELMA 4WW2A 4LASL 2VLMD 4LKCB 3F58H 2HT3D 4ONGH 1D5IL 3D3VA 3AM8C 4R97B 3TO4D 4FP8H 1U8LA 3ZL4H 4C56B 3BP5A 1PSKL 3FCTB 5FO9A 3HMXA 3MFGB 4UMGA 1CDHA 3H6JA 5D93B 3KS0H 2GK2A 2Q6WB 1EO8L 5EZIH 1JWUB 4K94C 2UV3A 1CFNA 4NQUA 4YBLC 1UA6H 3NBNA 5ADPL 4JHWH 4XTRC 4M7KH 4RFEB 4OAWA 4R90H 2W60B 4K3DL 4UILH 5I1DB 3U1SL 2Q3ZA 5JDSA 1DVFB 3HRZB 5KW9H 3WDIA 4WHYH 3BWAA 1XF3B 1T7WA 5LXGL 5IT2L 4JFOA 2YRZA 4JQVC 3OF6D 3KXFE 4P57B 4G9FA 4DN4L 2NY3D 4OT1L 2V2XA 2ICEB 2OTWB 3FT3B 1SQ2N 5L6YL 3IU4L 5F8QC 4XVSL 4MYWB 3WE6B 4HS6B 3WHXB 5T3XE 5EULV 5HBBA 4LCUB 1QSFD 2BDNL 5AUMB 4A2LA 4J4PD 4S11A 3BKJL 1FPTH 3QCUL 1CTOA 1CQKA 1YEEL 2HP4A 3THML 3GJFA 4ORZC 5EBMA 1A8JH 5IQ9B 1YQVH 3QG7H 4FQXB 3CFEA 4PJBA 4U0QB 1AKJB 3EO1A 3V0WL 1HOCB 1U8QA 3NFNB 3RRQA 4CUCA 3STLA 5DI8B 1CR9L 5DJDA 1UACH 1HI6B 3QDHA 4NNXB 4WWID 5IJVB 2Q8AH 1QLRA 5IKCB 3I02A 5FKPB 3S9DB 3L7FB 1CXIA 2CIKA 1MCPL 3DV4A 3VD9A 4NT6A 2GTZB 4R7NB 5D5MB 1CL7L 3WFHA 5T33H 1QSED 3TYFA 3FQTA 1FH5L 3LDBB 2J8UE 4EQ3A 3V6FB 2DQIL 1EEUA 4PJCF 4X6CF 1FGVL 2BMKA 3KR3L 1TETL 2LVEA 3QDJD 2IALB 2J8UF 4FNLL 4U6VL 4ACPA 1WBXA 4E9LA 5BS0A 4S1RL 2F5BL 3HAEH 2QQNL 4NGHL 3RUGA 2J88H 4MX7A 3WL9A 5DF0A 2NYYC 4NDMB 5JTWA 3TIDB 3NA9H 3IDIA 3PWUA 4L8SC 1FBIL 1MHEA 5L2KE 2D2OA 2VXSL 1G1CA 1DN0B 1A6ZA 3DRTA 1DLFH 3L9RB 4HXBH 1NFDE 3QPQD 4PTTB 4JO2H 1YYMH 4HEME 4OZIB 3TBVB 2KZ1B 2C1OB 1QPXA 1NFDF 3VJ6A 2VR4A 4YR6B 5T3XL 1CDYA 4UAOB 4BH7A 2ZWLT 4TRPL 1J8HA 2DMBA 3C8KA 4PRDB 5TH2A 3PGCB 5CZKA 3WXWH 3EYFB 3NN8A 4YE4L 1JZ5A 1GHFL 2QEJA 5IF0A 5C3TA 1OAZH 4R3SA 1LD9B 2YUZA 1KEGH 3V9FA 4JGUA 4UIKL 5IGXL 3PWVB 4EOWL 4P9MH 5LGKA 4UQ3B 1SJHA 4YIQA 3VH8G 4N0FA 4NFBA 4YK4B 4FN0A 4JDZA 3EJZD 4LEXH 4EXPX 2BNUB 2ED9A 5DD0H 5CP7B 1V7MH 1T0MB 3TNMB 2WLZA 4YHIB 1P2CA 1WLHA 1I8LA 4LK4A 4XPTH 5IVZB 3RU8H 5GGVY 5HDQL 2IFFH 3GMMB 3F12A 1VFMA 3RTQD 1TJIL 2BVOA 4OCYL 4URTB 3B2UC 3ARPA 1ACZA 2R9HD 1T80A 1MNUL 1H8SA 4AY0A 2Z31B 3OKNA 4YDKL 3OF6A 4CADB 3U7YH 4PP1D 1R24A 3S37X 2H32B 1QBLH 5IMOB 1NCCL 1UQSA 3QO1B 3T2PA 1CGXA 1Q9KB 3D69A 4KKBC 2DM4A 1FL3B 3RL1A 4QHNB 3HC3L 1QSFA 1JP5A 4J4PA 1II4E 4XP4L 2DL2A 2R39A 4HLZG 3G5YB 1EHAA 3EYQD 5KZCB 4PRAB 2GTWB 4PJ8B 1VFAA 4AT6A 3LIZH 2ZUYA 5IHZB 2OBGA 5C0EA 4NQVB 3S96A 1OWWA 3H0TB 4HWEL 3ZE2E 1DUYB 5GS2D 4D8PB 5I75B 2FEDC 4NKIH 2ITDA 3WEXA 1UADC 3BQUC 3DROB 3ZE2F 2NZIA 3T04D 5BXFA 2JJUA 2IQ9H 4XXDA 2GJ6B 4YO0B 2AJ3B 4RGMC 4APQA 5AD0A 1OGAD 4A2MA 3WFZA 3MO1A 4G43B 1WAAE 3JWDL 3VH8A 3PGCA 2PYFB 1H0DB 3QDJA 4K94H 1RJCA 2YEZB 5D5MF 4E5XB 4JFFB 1OSZA 1FVDB 3DRQA 4C4KO 1Q9WA 3U46A 4LLUA 4G42A 2VZ3A 3SQOH 2DWEA 1EFQA 3IJSB 2NY5C 3KHQA 1CDUA 3UJTL 1MUJA 3OGCB 2GAZB 1GGCL 3MLTA 2I60H 3CZJA 4I3SL 5DMGD 2OL3A 2P5WA 3K0WA 3VXSA 2ZUQC 4JY6B 4YHLL 5IUSA 4R7DA 1J0KA 3VFPB 4Y7MA 4MVBC 3RHWK 1RZJH 1QOKA 5CJQH 5TDPB 3LEVL 4L4VB 1SEBA 4ZDHA 4FFWC 3KPTA 5HJ3A 4ZS6D 2I07A 5DK2B 3UO1L 1ACYL 5CWSB 1X5ZA 4PBWD 1C7TA 3EOBB 3X11A 5EC2B 2DQCL 3O8XB 4P4KA 5LAXA 2A2QT 3SDXE 1OD9A 4F15C 4PJEA 5C0CD 4X9BA 2ED8A 2VDPH 3O6LL 1EO7A 2MNUA 1NCAL 4JZJB 1U36A 3IFPA 3SDXF 5IB4B 3SE8L 4QEGA 4HWBH 4A6YL 4G6KL 4I2XA 4FQLL 1I4FA 1R3KB 3FT2A 3MC0A 3CXDH 3RWGA 2FJFB 5A2JH 3WN5B 3CFJA 4ZQKA 3N50A 4O00A 3GGWB 3ISWA 1K6QH 4UU9B 1PZ5A 2HT3C 5FGCE 1QFWI 3TO4C 1JFQH 3INUL 3WNKA 4NKDB 1FLTX 5GJSH 5ID0A 2E9BA 5F7EH 4EUPB 1A6PA 4WHTB 3V4VL 4L3EB 4TSAL 1HSAA 3ZKSD 5EIVA 3U48A 3VFUB 3K46A 3C2AH 4JZOA 5I6XB 3U36A 3DO7A 4GAYA 4P5MB 4BZ2H 1WT5C 25C8L 3CMOH 3ESUF 4QWWD 4YWGL 2VLKE 3OKLB 3ALPA 1IFHH 2BSED 5E00A 5L7XL 5HYJB 1VADB 3G9VA 3VU2A 5TQ0H 1U91A 1QLFA 1IQWL 4HPYL 3WJJC 3LOWA 3IDJB 1GIGL 4U1GC 5GHWH 2R69H 4OTXL 1FSKB 3GI9H 1LK3H 3OKKA 5KTEH 1UJ3A 4EIZC 2DQUL 2DD8H 3TJHD 1A7PL 2VQ1A 1CI5A 1XZ0B 2GITB 5T3ZE 2NY0B 1KACB 3D25B 4CGTA 1RVFL 1MAML 4CU6A 1NMAL 3IS1X 2D0HA 1YN6A 1BOYA 4GRMB 3T0DA 5FDWA 3LS5L 3KS0J 3VWJD 1BQHB 5HVHC 2IEPA 3JUZA 1MRFL 3C6SA 4XCYA 2CMRH 4WO4D 4F2MB 4FHBD 1A7OL 1ZWIB 5D71H 1KF9B 2ADGA 3ARDB 4Z7VB 3CH8A 1CF8H 2WAHA 2ICWI 2P7TA 4Y1AE 3RWFA 4S1QL 3WJLA 3T3ME 4YFEA 3QFJA 4WUUB 1U9KA 4Q9CA 3GHBL 1JPSL 1S7XA 5BJTA 3MV7D 1OGTA 3SDAB 5I8EA 3U30C 4P2OC 2AJXL 4KHTL 1P7QD 3UYPA 3HS0B 5DVMA 3HC0B 5I17B 3TBTB 5B39A 1AQKH 1YNLH 1YMMD 5IK3A 3V95A 3UPCA 1ONQB 2F8OA 2X44D 4ZFFB 2FX7L 5B4MC 3JTSA 4PGJA 4POUB 2ZKHH 1FYTE 3QRGL 1SY6H 1G7MA 1XIWD 1U8JA 1H8NA 3I85A 1DEEB 1KIQB 3FTGA 4P3WA 5ICYB 1C7SA 1AXSB 1E6JH 5DD1L 4WU7B 5KS9A 4N8VA 2GSIB 3OB8A 4X6BB 1MIML 3VG0L 3LRGA 2RFXB 2WMPA 5FCUH 2A6IB 3BISA 5C0CA 1ZLUK 1KPVB 3ARGD