2ZSVB

Crystal structure of h-2kb in complex with jhmv epitope s598
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prevention of cytotoxic T cell escape using a heteroclitic subdominant viral T cell determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zsvB00
3MGOA 2J2ZA 3C8KB 3P9WB 3UEZA 3SDDB 1WSST 4JG0H 3TT1L 3GRWL 1FAIH 1JPSL 4EN3B 1RUAH 3KPRD 3O6LH 4J8RB 2D4DA 4XAKE 3PV6A 3UJTH 4WUUD 3O3BA 1MFEL 2V7HB 3LHPH 4OM1L 2DLTA 3V4UH 1XF2B 2A1WL 4F2MB 5DA0B 3DURA 4MCZA 2AVGA 4AIOA 4PB0H 5HD8C 2R29L 5FECA 1VFAB 5CJ5A 4KI5E 1SY6L 5CZXC 3TNNA 2H32A 3H42L 2HH0H 3TJEL 3N9GL 4OCNC 1A5FH 3MYJA 1U3HA 1RHHA 1MELA 1QLFB 4WU7A 5A43C 1RD6A 2IALA 2WUCL 5AYUL 3PP4H 1F00I 3ZLQC 4F37K 3GGWA 4I4WA 3EAKA 2CLVB 3MCG1 3V7AE 1NANH 1CL7L 3T0BA 1CI5A 1BQHG 1CLZL 5LAXB 3NFSL 5TE4H 3QDAA 2XQYG 5D2NA 35C8H 1HQRA 3QIBD 2IQAA 5BZWB 2FO1A 4FFWD 4GG6F 2NY3B 3SGKC 1R3HB 3JWNC 4HGWA 4X9BA 4ODTL 5J4MA 2QSQA 5K9QG 1EVUA 4PV8B 3Q6FA 5I1CH 4Y2DC 1MUJA 1WGOA 1YMHA 1DBAH 2ZPKH 1SEBB 2JJTC 2XZAH 4QHMA 4R97B 5MI0C 4WUUA 2YRZA 3WO3B 3REVB 3U6RB 2FJGB 3OKMB 3NPSB 3EYUL 3HLAA 2FO4A 3O3DA 2Z8WC 4B7LA 4CADA 4G8GE 1TTFA 3S4SG 5ALBH 1A6TA 1PKQB 1Q0XH 1NEZB 1FZJB 3T77A 1LP9A 2FJHB 3C6LB 5HI4C 5T1LD 4ELKB 4LFHD 2PN5A 1BVLA 1WEJH 4OZGF 3DYPA 4GLRH 4NP4L 1WAAA 3GO1H 5L2KE 4M6ML 1C5DB 3HB3C 3FQUA 2P8MA 5FO9A 4BQCA 3WEXB 2BNRB 4G9DB 1YNTA 3OAUH 4BUGA 2HVKB 2NX5E 4ZPVB 4MJ5B 1X7QB 5I1JL 5HY9B 3DX6B 4PREA 3SO3B 1YY8A 3VWKB 5TJWK 4JDTL 2ZKHL 4HG4K 3N0PB 1LNUA 3GSQB 2BVPA 4FXKA 4KZEL 1V05A 1QFWM 2CK0L 4Y4FA 5EFIB 1REIA 4LCWA 1GPOL 1U8QA 2Z31B 3ZKSD 2VZ1A 4MAUL 3WFDH 1EHAA 2X89A 1LD9A 2XFXA 4BELD 2YEZA 1ACZA 3MBEB 4N9GA 4N90E 4EDXA 4D0BB 2R2CA 4K9EL 2B5IB 7FABH 1CK0L 3TBSA 3MRRA 1CR9L 1IQDA 3GJFH 1CXEA 5CEXA 5KVGH 1MFBH 2DQCH 1FPTL 4IRJA 1LDPH 1EHXA 3EO1B 5ETUA 4KMTH 1OP5H 5KSUA 5ADPL 4Y2DB 5FHBL 2C3GA 4HKZA 2YUZA 2VXTL 4IIQC 2F58H 4JGMA 2CDEA 1LK2B 1YEFL 1I3UA 1WT5A 3TYGH 4P3DB 3MLZL 1DQLL 4X6DE 3LMJH 5GS0H 2XZCH 4WEMB 4QRPB 3WO4C 2V2XA 4KUCD 1ED3B 6CGTA 5GGRA 1H8NA 4ODSL 1FH5H 1SHMA 4U31A 4EDXB 2FHFA 4QY8B 5A1AA 1WBXA 3S96B 2ZNXA 3BPOC 5J13C 1RHFA 4BZ1L 4F7TA 3VRLE 2FR4B 3MXWH 5E1AB 1ACYH 4JANB 1BREA 4KUCF 2WW8A 4NQDB 2IH3A 5ITFB 3IFPB 1D5XB 3Q1SL 5JPNB 4YDLB 1KTLB 5SWSB 4W6WB 4JFDE 1LO5B 2BY3A 2ERJB 2AJSH 3LAFA 5DUBB 3O4OB 3MRMB 3MRHB 1CDHA 1EHLL 3E2HB 1YEKL 2W0PA 3VFRB 1U92B 2APXA 2CKBH 4XPHH 3V0VA 1FYTB 1G6VK 1XCQB 4R4BB 3SKOB 3QCVL 3FOLB 4KI5D 1OSZB 1KXVC 5EU4A 1RMFL 5JOFB 2BJML 4X7SL 1MAML 2P5WD 1YECH 1AKJB 2H2PD 3X11A 3C2AH 1P5UA 3R8BB 3V6ZA 1TTUA 1GL4B 3QUXC 3RJQB 4GT7A 1O0VA 1YEIL 1VCAA 1FRGL 1J1PL 1QR1B 3CX5K 1CFBA 5ADOH 3QUYB 4JDVB 4K8RC 3V6FB 5D93C 3BEWB 1XGQA 3CFJA 1HH9A 2ZNWA 5EPMB 2IANB 5E8OB 3T1FB 1SM3L 4M1GL 4OLZL 1A7BA 3VD4A 2B0SH 4WI3A 1TJGL 5DQDH 5BS0D 3MRKB 4RQQB 2NX5A 5HHOE 4NKIH 4JM4H 4QOKB 4U1NB 1WEJL 1DQDH 4Z76B 4GXVL 3BH9B 4CRPA 3C5ZA 1S9VB 5C08D 3FONB 4QRSA 3OBAA 3STLA 4HMDA 3D25A 5J8OA 4GS7C 2DLFH 2NY0D 3IXAB 1DSFL 1BOYA 1LMKA 3C08L 4TOYH 1JMXA 2OP4L 3GBNH 4XPGH 5FF6B 2WWMD 1JZ8A 2HA1A 5ACZB 1NLDL 4H8WH 4KZEH 4QHKI 5EU6B 5CZKA 4JHAL 3Q6FB 4M7LL 4JN1L 5T3XE 2E8ZA 1KT2A 2PW1A 3T2NH 2Z8VC 4U6YB 3U7YH 2OL3L 4IMKA 1H8OA 2VUOA 4X6EA 4Z0BL 4J1UA 4L9LB 1I1YA 3JV0A 4FQXA 5JIKA 5INDA 3RZCB 3RNKB 5J56B 4GXUN 3IAQA 4GAGL 2VITB 4LVOB 3RWEB 3UZEA 5JXAH 1VFOA 3T8XB 2DS4A 3GHEH 3QRFM 2VDPL 3BD3A 5MHSE 1E28B 1MIEL 3RTQD 4PV8A 3T77B 3OB0H 2BMKB 3BWUC 1B4RA 4P2YA 3NPZB 1AE6H 4HUUA 4N0CC 2UZYB 5E8PA 4JZJB 3FB8B 4LSTH 3MGOB 2V9QA 3FFCD 4RMRA 1PEWA 5IF0B 3UP1A 5IIEA 4N5UA 2YPVL 3CX5J 1P6FA 4ELME 1X7QA 1FFNA 1CDGA 1OGAE 1SY6H 4GW4B 1IEAB 4OIIH 3GSVA 3S88H 3CZJA 5F9OL 2K7QA 1BZ7A 1T66D 4LSRH 4YDVA 2X4NB 4QCIA 3QDME 3UJJL 1ZA3B 4LLQA 3O2WH 2GSGB 2H2PC 1QBMH 2AGJH 3T2PA 1OB1A 1IEBA 1XIWA 3D3VB 5TQ0H 3SOBH 3HHRB 5F3HA 3VRJB 1J87A 1N26A 1QFPA 4XPTH 3MRIA 3RVUD 4ENED 3GIZL 1UB6A 4BZ2H 5ALCH 2C26A 1GGYA 3R0NA 3MRPA 3VH8A 3CU1A 3WNKA 5DD1L 3F12A 5DWUL 4NZUH 2XYCA 3HE7D 2Y36H 5IW1A 1T03H 4PJ7E 2AJSL 1AR1D 5KN5A 3ARGB 1R3IH 2AV1A 1JRHI 4IRJB 3VD3A 3QIBC 4WW2F 1NC2B 4PJ5E 3ALPA 3SDAC 3PQYE 1N6QL 2Z4QA 4J3VA 3U7WL 2GYSA 1BPVA 1R3HA 2ADFH 3C6SA 1T20B 3IS1X 5JW4R 3DSFH 3HAEH 5IW6B 5C0RH 2IFFL 5DFVD 5GS1A 5CILH 4FA8A 3X13B 2OQJA 2DQHH 4HHAB 3F7RA 5DMGD 4NYLB 1EBAA 4JKPH 1L6XA 2IPUG 4LDEB 1DL7H 5FOBB 3Q5YA 4XC3L 2L0DA 1T0MA 5C0GA 2FL5B 4KXZI 3VXTA 4Z5RB 1BFOA 4TNVF 1I1AD 2DKUA 3L3IB 2J4WL 1AI1H 5HYSB 1GGIH 2PR4L 3FQWA 4XXCC 3UAJC 3MJGX 3H3PL 2M2DA 1I8LA 1C5CL 4L3EA 4R7DA 2PNDA 2HTLC 5C0AD 3SKMA 5I1IL 3CVIH 4ALAH 5TGBB 4HT1L 4LQ1A 1PZUB 3OKLA 4S0SD 5BRZB 2OBGA 3TIDB 1CG9B 3MCKA 1Q9OB 1RURL 2BNRA 2J1KA 3HI6L 1RAMA 4LLMB 4IS6A 1KTDB 1E6JH 4Z0XA 2WM0A 3S35L 1AIFB 4CBPA 5BVJA 3BE1L 5DR5L 1EIBA 3L5XH 1J8HA 5CSBA 1RZ7L 5JTWA 4GRMB 4K8RD 4U1JB 1D5XA 5ABDE 3FRPG 5KSAB 5B21A 4M3KB 1QSEB 3TA3B 3P3YA 1CGWA 2XT1B 2IMMA 1K2DB 2IMNA 1S7QA 2R39A 3AREC 4W6XB 3W11D 5IWLC 5DQJB 1J5OL 2O93L 5KANI 4NSKA 5I1LB 1KULA 1RUAL 2NY2D 1IGJA 3QO0A 5KVGL 3QXAA 4PGEB 2GJ6E 1B3JA 3QIWB 4MQXD 3TBWA 5E5MB 2I9TB 2P1YA 4WTWA 3W2DH 4LNVA 2X4QB 2VKWA 1ZSDA 4XMLH 4OF8A 1FBIL 1MQKH 5HGHA 1VFUA 2A6KB 5FO8B 1DANT 4G8IB 3IFOB 3LS5L 1RY7B 4LVOC 1GJIA 1I1CA 4IRSB 3IU3B 1N5AB 4M6AA 3V4VL 1MCIA 2XG5A 4U6VL 3GI8H 1F97A 5ACLA 5GS3A 1AE6L 3VXOB 3Q5TA 1AXIB 5DUML 5JA9A 5KOVC 3CFCH 4X6CA 1NCBH 2IPKA 3KR3H 2X09A 3SJVD 2H2SC 4PGBB 4YZFE 1QRKA 2MOVA 3R06B 2NY3D 4RRPA 2GITB 2HTKC 4RZCA 1UQSA 3H9SA 3G04B 1MAMH 5EU6A 3L7EB 1G6RL 2XN9E 5BV7C 3V5DB 1BBJA 4NDMA 5F7EL 1PSKH 4OLUL 5FYJE 5T33H 3ULVC 5DQ9A 4HJJL 4OCXH 5EO9B 4G5ZH 4J1UB 3DECA 4H0HB 5CCKH 2AJUH 5ESVB 3VGAC 3VGBA 1RJCA 3RWDB 4MNGE 3ZE2F 1IAOA 3MNZB 1EGJL 1KGCE 1MH5A 4P59L 3CFDB 3LKNB 4Z77B 5I1DA 3C8HA 2YMXL 1NGXB 3UYRL 4P3CH 3VMNA 1JCKA 2BMKA 3QIWD 2DTMH 4EQ2A 3QUMH 3GSXA 3MA7A 2OS7A 5ANME 3QDGB 2YD7A 1IBGL 3TV3L 1OD7A 2KUTA 5D7IB 3UTQB 1CFNB 1KIUA 4FN0A 4MS8C 4YR6B 3MOBL 4NBYB 3WEXA 2YKLH 1RUPH 3FOLA 1P84J 3S37X 2OTUA 5E2WL 4JKMA 1I1FA 4EVNA 1PBYA 1IQWL 3F5WA 3D1MC 3WS6A 3ZDXF 1ROWA 4XWOD 2VZSA 3H2WA 1B4JH 2R1XA 4YE4L 4YEFA 5L88L 4OGZA 5FB8A 3LRSB 1MFAH 4H20L 4JRYB 3ULVF 4E41B 4Q9RL 5GSRB 1T83C 5JHLH 2FATH 3PL6B 2I5YL 5JXEC 4OB5H 4BKLA 5LGJB 1RJZA 4CDHA 1UA6L 1UXSB 4L9DA 3ZYOA 4IHOA 1EFXA 3NCBB 5BZDA 5CIPA 1T1ZB 5LWYL 4YGVB 4HULB 5IP4A 3BH8A 3BH9A 4U2ZA 3E8UL 4PJIB 3H42H 1G9NH 1IGML 4LU5L 3PP3K 1MHPH 4UINH 5IMLB 3ARGA 5D4QA 5DEZA 1A3LH 3P11H 4Y88A 4AG4H 1S8DB 3LRHA 1EEZB 3GMMA 3BGFB 3R0MA 4FHBD 3O6LL 3UJTL 4HC1A 5DGQA 2X1QA 4PRPD 5DO2C 1ONQB 1FAKT 4DZ8B 1NMAH 5DD0H 1I1RA 1UB5A 3JTSA 4JFOA 4XMKL 3QNYB 1GGBH 4NPYA 3RGHA 4M61A 5HHMD 3H9ZA 4H5SA 5D8JL 3O2WL 4KKLC 3QWRD 1A6VL 1U3ZA 3ULVE 1P4IH 4HC1H 3EHBC 4PJFE 3T2NL 2BNRD 3GK8L 4JM2D 4OF5A 2Y1VA 2A9ML 4LRIC 4HZLB 2VLRB 4JREC 4JB9L 4ZFZA 2H41A 3SE8H 3VXQB 4OZ4B 2EEDA 5DJYB 3BP7A 5I30H 5E9DB 4NZTH 3WSQH 4JZJA 2AABH 5B4MC 3LKPB 5JDSA 3FO1B 3GMLB 2LFGA 5I1AB 3U9PL 4OZIA 4YGAB 1S7TA 2Q3ZA 4OFPA 4P2QA 2C4FU 4JO1L 4X5WA 3NBNA 4JGUA 1FYTA 1CLCA 1I9RH 1IC5L 3SDDC 5GRVL 1AH1A 2VAJA 1FFRA 4MX7A 2VQTA 4XP4H 5BMFH 4HZLA 1LO3H 1DLFL 3VFTB 5FUCE 1CBVH 3HI1B 5F7FA 5JR1H 2VDRL 5EG6C 5L8JB 3RPIB 3OR7B 4Q74A 5D1XC 3NA9L 3QH3B 1A6WH 5EBLA 4R7NA 4JPKH 4DKAA 1RK0A 4NJAL 3KS0H 2LVEA 2V5YA 2WBJC 4HWBH 5T5FH 4Y5YC 5LKNA 1A6ZB 4P23B 1TVBA 3QUMA 4F7MB 3L3HB 4B50A 1OSPH 4WVRA 1NC4A 2RGSA 4HBCL 5BV7B 5C9KA 3DPBA 1EO8H 3RZCD 2P5EB 2Z0BA 4QNPF 2NY5L 4P46D 5D6CA 5EOQH 2CXGA 4K71C 1FVCA 1YN6B 4DGVH 4IJ3C 5FK9B 1N6QH 4AMKL 1K5NB 3NCEB 1CFTB 1HKLL 3OR7A 4XC1L 2D3VA 5D7IF 2BP3A 4YBHA 1JHKH 3VI4F 1GXEA 1HKFA 3U30B 4BK4A 3CVIL 4ALAL 3D2UD 4L8SB 1LK3H 1OARH 1HH6A 3VXSE 3SE4C 5T3ZH 5JHLL 2J8UB 3OG4B 1NAKL 2RIKA 1X5HA 5EOCL 3MSPA 4E0RA 2CPCA 5I76A 3VXMD 1KLFA 5J6HA 2VZVA 4KV5E 2Y07L 1C16B 1JL8A 5EWIL 3W82A 3QDHA 4DUXA 1IFHH 4HJ0C 4BQ9A 4QWWC 5AD0B 3KJ6L 3L7EA 2K1MA 2Y7QB 1EDQA 1I85A 5CLWA 4M9OA 3F7YB 1J8HB 3N06B 1FFQA 2K7PA 3SGEH 1JYNA 1KJMA 3QCTH 2NY1D 4X8XA 2VC2L 5DZNA 1KEMH 4OCWH 2VXSH 4P5TD 1UCBL 1W2KT 3QEUB 4XVTL 4K8RL 4DAGL 3FMGH 2WUBL 4QT5B 2F9BT 2A6JA 4Z78B 3QZWB 1IEBB 5C07A 1NFDF 4UTBH 2FX8L 2BCKA 4JG1H 3IVKB 4ODVL 2DKSA 4RMWA 4GUPB 1S7RA 2ORBL 4KRPC 4GW5B 1XF2A 4RAVB 4LCUA 4JFYA 4NQDD 5FECB 4NWUL 1R5VB 3WUWG 4E42B 1MFCL 5C0AE 2BHUA 2EIZA 3MRLB 1FQ9C 3C60C 1A6TB 1IKNC 1ADQA 2Y25A 4PGBA 4N8VA 1EXUA 1LE9B 3PGFL 4QHUB 3NABL 3BO8B 5DI8B 4WNQA 5JUEL 3VXNB 1CLYL 4AEHH 3RWCB 5I1EL 2BSRB 3L3GB 1FN4A 5JIPA 5CKAA 2W59A 3K8KA 1RUQL 2EYSB 1IGYB 1Q9LA 3G6JF 4PJ8B 2Y06L 2HT4D 3GKWH 4HPYL 4RMSA 3D2UB 3VFSA 1QEWA 2WBJA 2YD5A 3BZDA 3QPXL 3P77B 1OD9A 4UDTA 2LTQC 5C0GB 1U3YA 3UYPA 1A6WL 3CPLA 2JB6A 4TULL 2BOBB 3BEVA 1ONQA 4JCMA 4OZFA 1Q1JH 5D1ZD 4OI7A 4JO4H 4L4TB 2DDQL 4ZQKA 5E2WH 2F53A 1MFDL 4E5XB 3EO9L 1SJHB 4ZOAA 5JZ7D 4U1LB 4Y5YB 1SYSB 2VN4A 3KYNB 4MJIE 1MI5D 4MDIA 4W70A 1XGPB 5ALBL 3FZUD 3LKPA 3RWCA 5CZVL 2A2QT 4G43A 5E6IC 3C5ZB 4C83A 3ZE1E 4LHUD 3OKKB 1Q0YH 3IETB 1XEDA 1B0GB 2Q8AL 4PUBH 1U58B 4YEEA 4ZXBC 1NUGA 4P0DA 2CKNA 2AV1B 3MLUH 3VXRB 1SJEB 1U8MB 3MTRA 4K9EC 5KVEH 3FFDA 3O6MH 1DBJH 4GXUM 5EZLA 1HN1A 4O2EA 2YPLA 3G5YB 4I18B 4Z0BH 5F72S 4HKZB 4F9PA 4L4TD 4LSPL 3U2SB 5IVZA 2VDNH 5CGYD 3WS3B 5D7LB 3VFTA 4PS4H 2YD9A 4XAKD 2ZUVA 4NZJA 3C5JA 1FORL 1YC8A 4MS8D 4EI5C 1SY6A 5HHOD 4U6YA 1PYWB 1MVUB 5GGRB 4L9LA 2PTTA 3TESA 4GLRI 2AV7A 1CQYA 4FXKB 1J0YA 3I6LD 2FL5A 3FO0H 2NW2A 4J3OC 4MX7B 4PR5B 4Y89A 4OZIF 1ZLWK 5IBLC 5IB3B 5IKCA 5H37G 1KJ3H 1X3DA 4X7TA 4XPAL 1IGCH 2EDTA 4Y5VA 4MVBC 3SDCA 3MLXH 4CW1B 1F4WL 2AXFA 3UPRA 4HXAH 1KPRA 5DRXA 5FYLE 3RIFK 2XZZA 3ULUH 2VNCA 5ITBH 5M94B 1RZFH 2IQ9H 4U1KB 5DJ0B 2DN7A 4UT7L 2DQCL 2EEBA 5C3TA 2CMRH 3OXRB 3QUZB 1UB5B 4BA8A 2EXYD 1RHHB 2COQA 1IT9L 3MLWH 3GSNA 1WBZA 4QLRA 2F8OA 2AXGA 3CCHA 3D39D 1C08B 4EOWL 3B2VL 5ID0B 1UJ3C 1TJIL 4OD3H 5F7HA 4W68A 5LBSH 5TDOA 5I18L 4YDKH 4BZ2L 3VGHA 25C8H 3ARYA 4HK0B 4NNYB 4KWUA 4NUGL 4L4VE 5ICYB 3HZMA 4KVCH 4YFDB 1BBJB 4NDMB 1MRCL 4LKCB 4JFZL 2PXYC 3B5HA 3EDJA 3JTTA 3ZDYE 5C92A 5FDYA 1OW0C 5I73B 5HYQA 2EYTB 2NY7H 3LIZL 2AEWA 3MRNB 3WLWC 2ZJSL 1QLRB 4KMLB 1ITBB 4D9LL 3O6FB 2BVOB 4X7EC 5A3ID 4MZ3A 4Q0XH 2R15A 3RWHB 1FL6B 4LAQL 4OZGA 1H3PL 4YO0B 1G0YR 4PJ5A 1X4XA 1KN4L 3RVUC 5EZJA 3BHBA 1WVZA 1W72L 5GPRA 2NYYD 4Z95H 5D9SB 1D5IH 1ZLSH 4FG6C 1I9EA 1KC5H 3C5ZC 5D2LF 1CD1B 4PY7B 1D5MB 2HJLA 3JWOH 2Z4QB 3D39A 4XBGB 3RTQB 4LGSB 3QT2A 2APBA 2DQUH 3EO0B 4MB4A 4YHLL 5T3XH 3ARUA 5IM7B 1F4HA 3WDJA 1VSCA 3M07A 3PXHA 1P9MA 1T1WB 1CD9B 4R2GD 3QEUA 3GKWL 4KVNH 1RK1B 3O9WB 4MA8H 3SCMD 5FB8B 2VXQL 5KJRH 4U6HA 2HN7B 4XMPL 4JFFD 4YXLL 5FF6A 2EDHA 3RHWF 3TT3H 1P7KB 2NNAA 5FA3A 1QLEH 1CGUA 1BM3L 3MA9H 2DBLL 4TN9A 4YO0A 1OPGL 4MJ6A 5E8EA 4PJCA 4D3CH 3KYOA 1WICA 4PRDA 1RZJH 1CF8L 4ODWA 3VXUA 5EU3B 1WUNT 4X4YA 2AK1L 3RAJL 1DP0A 1UZ6E 2V5SA 3WIFA 2RBLA 4GFTB 5D70L 3TM6A 4HMEA 3QI9B 1KTDA 2AJVH 1JGVH 2R9HD 4PUBL 5IVNA 2YPLD 3U0TB 1UG9A 5K9QI 4U6VH 4MCYA 3IKCB 5EO1A 4JLRA 4U3XA 4WI7A 2OMBA 4K3DL 3HE7C 3HNSL 1T7VA 3EGSA 3IDXL 1NCBL 3VJ6A 2ERJC 4TNVK 4YIQA 1T3FA 2PYFA 1JTOA 5DGRA 3GMPB 2XKUA 4JZJC 5TQ2L 4Z7UB 3IDJB 1MI5B 4JFXA 3E3QE 1QEWB 2HH0L 3TJEH 1NQBA 1MHCB 3IXAA 1ZVHA 1C16A 1RJLB 4Y2DA 1P7QA 2O5YL 1QKZL 2R0KL 5I75B 4X0KA 2XRAL 2FX8H 3NZ8A 3L3GA 3WNPA 4P2QE 3MUJA 4ODVH 3QQ3B 1JMZA 2I24N 4PJHB 2BSSB 1PW3A 4L4JA 5IQ7H 4HIIB 2EXWD 5LGHH 2EDOA 5IJKA 3GJFA 5JZ7C 2Q8BL 5DJYA 2IF7A 3EFDH 3X3GH 2VC2H 4MD5A 4A2MA 4WFFD 3LPWA 3RU8L 4L3AA 1GHFH 3ECBA 5I1AA 4OZIB 5ICZB 4UIMA 5E6ID 4OQTA 3RIFF 4NO5A 1U8IA 4D0DB 2B20A 1FVDA 4M5ZH 4ZQKB 4WWKB 1U8MA 2FH8A 3GSUA 2FJHA 1IBGH 3TV3H 3Q6GH 4WV1B 1FC2D 1WTGT 3HS0A 3IFNH 5ILTL 4IRZH 5AWNH 4MZ2A 1AD9B 4P4KD 4EUPH 2DJ4A 3N9GH 1U93B 2OXGA 1AHWC 1AGFA 3BJLA 3UYRH 4AEIH 4M61B 4MD4B 4ODTH 1SJEA 2JJUA 3QFJB 5CJBA 2NXYB 3PNWA 2E27H 4FTVD 3CLFL 2G9HB 4Z8FL 4FQ2L 4Y4KD 1G1YA 1ZT4A 3ZDYF 4DZBB 4Y4FB 2A74A 1T1YA 3L3IA 3UTTD 3LRGA 3V6ZB 1YQ2A 2X70A 1CLZH 1FNEA 3I9GH 1G7JA 1SBSH 4ZOCA 2VTFA 4CVZB 3ZKMD 1Q38A 3KPOA 4RMTA 3X3FH 3HZYA 3F12B 4YR6A 3RWIA 5K59E 1FNSH 1WIUA 1Y18B 2BK8A 1QYGH 3CAFA 2B1HL 2VIRA 5T1KB 1KUMA 2MQ0A 1U9KA 4LEOB 2E7LC 4NCC1 5I8EB 3NIGF 3BXNA 2WBJB 1JZ4A 3C6LA 1HSBB 5CEYB 3GUTA 2ZP0T 1YY9D 5DF0A 3BZEA 1A7QL 5DMIL 2J8HA 1JNNL 3S34L 3OX8B 1VHPA 5LWYH 3TVMA 3CJJA 1BFVH 3NCJH 4XBPB 1P4LA 1OF2B 3UXFA 1WIPA 4QXUL 1U42A 3KPOB 4MQ7A 2B5IC 4JKKA 1MCJA 3P11L 4X9GA 3O6FA 1JYVA 1MOEA 3VE0A 5I15H 3SDDA 1G9ML 1KCSL 4HEPG 1PX4A 5EIQA 3SDXB 4HT1H 3DV6A 3PWVA 5D70H 4KQ4H 5I19L 2BSTA 1JZ6A 5A2FA 4NQVB 4TUKL 5L2KA 5DJDB 1JPGB 1S5HA 1MJ8L 4I0PB 3RWFA 3FOMA 1JWSA 3TNMB 2H32H 3WFBH 1X5AA 3WIHH 3LZFL 3CC5B 4MNGA 3U9PH 5F9WC 4XBPA 3IJYA 4UAOC 2BVQB 5H8DA 2NYYC 5GS2H 4XT1C 5I17B 5D5ME 5ADPH 4PJDE 2CLRA 1TQCC 4MXQD 4KMQA 5E8PB 3UTPD 2MCG1 1AY1H 3S3PA 1L9NA 4CU7A 4PS4L 3AREA 4ODUA 3WXWH 3MJ6A 1MCWM 1MJUH 5JOFA 3KXFB 3VD9A 1YEHL 4RGMC 2LU7A 4TRPH 2OSLB 1AXSA 1X5LA 3EYFA 4K55A 3KYMB 5D2NE 2A9NH 2E6PA 5E1HB 2GUOA 1K4CB 5TE6L 1IKNA 5A16B 4U1GB 3WE6B 3MLPA 4R2GB 2ESVD 5HGAA 5HYJB 1IT9H 2DMBA 2CRIA 2LU4A 2VAAB 2DM2A 5CEZH 5C6TL 4Q0XL 1CDCA 1OTUD 1K6QH 4NRYA 2XWJB 1DEDA 5JDSB 3TIEB 2OTPA 5HHME 4JY5L 2BXYA 4LSSH 1GCFA 3MLZH 3C6LD 4DWHA 4DTGL 4BFEA 4DN4L 4JFZH 1VERA 3OKOB 2KPNA 4M6OL 3VWKC 2AJZA 2FNBA 3O8XC 5KW9L 4EI5D 5F89B 1FIEA 4HK0A 4MQXC 1OAQL 2GJ6A 2WV3A 3TC9A 2JIXA 3H7BA 1T3FB 3PWNB 2JB5L 3S4SB 3B2VH 1ORQB 4D8PA 2BERA 3MUHL 3LQMA 1BP3B 1J8KA 3R06A 5EA0H 2DQEH 1KN4H 3QWOB 3V0WH 2XKSA 3KLAA 1AHWB 4EN3D 3TPKA 5HDQL 5DXWA 3QNXA 4HBCH 2DWDA 1D5ZB 1VGKB 2OQJB 4WO4D 4KAQL 3LIZH 1AGBA 2EIBA 2J5LB 1I7RA 3QPQD 3VWJA 3QHZH 4JFXB 1A7NL 2C7UB 2CXKA 4EZMA 4HV8B 4OF7A 5CMAB 2YN3A 5I2IB 3BH8B 2PCPA 3QISA 2ZUXA 4FNLH 5CJOL 3N1GC 3IETA 5CZVH 1RVFL 4OT1H 2E9BA 1N64H 4O2CA 5I1JH 4KK9D 4M03A 3JV6B 1FFOA 1QTYT 1RIUL 2EDQA 5DJ6A 4FZEL 4XWOC 1I8KA 3KPPA 2LAGB 2P43B 4JN1H 4ONFL 5L8LB 4K3DH 3OKLB 4FTVE 2PF6A 4BH8A 1JZ7A 3BGAA 2HYMA 5LCVL 1P84K 2CDGA 1IL1B 1IAIH 4MXVF 1C12A 2HMIC 1JBJA 1FN4B 4K23H 3LKSB 5C08B 4GJTB 5E94A 4DEPB 2W9DH 4MA8L 1OP3K 1ZGLA 1VPOH 4HS6A 3O4OC 4XCEB 3LEXA 3HNTH 1KIPB 2FATL 3GSUB 1F3DJ 4IDJL 4LF3B 2WINA 4XH2B 2XY2A 1GOGA 15C8L 4L3CA 4TUOB 2YA1A 3QHFH 5H2BA 2BNQB 3P2TA 4CGTA 3DI2B 4ODHL 1J12A 1WFTA 2DWEB 4FXLA 5CSZB 1MIMH 3O4LA 3O8XB 5HVHB 5DJXA 2XTJE 4WUKH 4M7LT 4OZ4A 4M93C 3STZB 1AD0A 2HWZH 3BP7B 1IZJA 1CDIA 5KSAC 2CDGB 4TOYL 1VEMA 3BIBX 5F1SA 5HDOA 1VA9A 2FO4B 5J06A 4HX1A 2LV4A 3WIHL 3T8XA 1DFBH 3ROLB 1E4KA 2FBJH 2ZCHL 4U7KA 4Z7UA 4OIAA 4XX1G 4YUEL 5IVOA 1EMTH 3FCTA 5D1QC 4O2FB 3G9VA 2B4CC 1WBYB 2AQ3A 1LDSA 4NNYA 5B39G 4LIQL 1NLBL 4N5ED 5IQ9A 3BKML 4R0LC 5DS8B 2FEDC 1B9ZA 5EU7C 4K7PH 5C7XH 3M1BB 2BSSA 2CJUL 1PEZA 2QQQA 4QYOB 4K8RH 4DAGH 5KS9F 4MJ5A 5BCAA 2RFXA 4ETQB 1ZVSA 1IARB 1YEGH 4LEOA 4MQ7B 3A6BH 4KC3B 1OY3B 3C9NA 3TCXA 4F15C 2OI9B 4QCIB 4G8GB 2XKNA 1GZQA 4HH9B 3VW3H 4NQCA 4N0CD 3TBTA 4PJCF 5CEXB 3G6AA 4LARH 4PJ9A 4CW1A 5L2KB 1SBSL 3SDDD 1P4LB 5IEHB 1CFQB 2EC9U 2VL4A 1H5BB 1Z5LB 5EULV 4ZUSB 3TBYA 1HHHA 3UTPE 3ZE2E 2MCPH 3IF1A 2W91A 1H15A 3D39B 1Z6JT 4HW6A 5IQ9B 1IC1A 2AJYH 4OLXL 1HXMA 3A6OA 5EBMB 1EEYB 2B1HH 4PJBF 1YZZA 3IB4A 3DIFA 1G7IB 2YPKB 2DYPD 4C4KO 5IW1B 3Q6GL 2VLKE 3B8SA 4M62H 3SKJL 4XZUB 1NH6A 3MBEC 1F4YH 3O9WA 1AGFB 1FNGA 1RUMH 2YHGA 4M7JL 3V5HA 3MODL 1J1OL 5D7IA 1NL0H 1Q9KA 3VG9C 1VKXB 5BMFL 5ISZA 2A6DB 1FNAA 3TYFA 4WY7L 3WNLA 2Z31C 1SYVA 5I9QB 2Y4SA 1MRDL 1U91A 3ARRA 3KYOB 3CSGA 1MCRA 5E9DD 3UC0H 1MAKA 4X80L 4I3SH 1OPGH 2RAMA 4XC3H 4P46B 1WFOA 5HGAB 3HMXL 1QPPA 4ERSH 1ZV5A 5ITFA 2Q8AH 2QSTA 4QRQB 1CVSC 3U79A 4ZTOL 4WEUD 2BVOA 1KCUH 1I9IH 2D0GA 3HZYB 3WLBB 1JNLH 3AREB 4X6BA 5GS0C 5L7XL 2AEQH 3Q48A 4H8WC 1HWGB 2ED9A 2SEBA 3CUPA 3DTXB 1YEJH 3KYKL 2VLJE 1XGTB 3VXRA 5KAQG 5I8EA 2F58L 3Q3GA 4FTVA 1Q9WA 2J6EH 3DMMA 4G3YL 1E27B 3CFEA 4UBDC 2PUQT 4OFIA 5GS0L 3P0VH 1I85C 3LQAC 4JHAH 4I18A 2H32B 5DEGB 3W9DB 3HR6A 4QRPE 3WS3A 5I15L 4DVBA 1VADA 2DB8A 2J4WH 1CIDA 3FJTA 1MCLA 4JPIA 4Y4KC 4Z7VB 5EBGA 5FYLL 2EE6A 1MHCA 3TZVB 4J4PA 3T0EC 3FT4A 1U8OA 1PQZB 2NQCA 3OKOA 2VERN 3DRQA 1NSNL 3OQ3B 3LQZB 4ZUTA 4DZ8A 3EJZD 3L7FB 4XNQB 2NW2B 4QXUH 2NY0C 5IK3A 2IAMD 5I8KH 4R4ND 5SWSE 2D03H 4ZFOL 5DUPL 4JFDB 4LCUB 1U8HB 3BD4A 5T1MB 1MWAA 2ZJSH 1HHIB 1OLZA 1NPUA 3GB7A 1EHLH 2YA0A 3DVIA 3D0LA 1NCDL 3MLXL 3QNXB 1TJIH 4JDVA 2FGZA 4LCYA 5HGHB 4PJFA 4YHIA 1BD2E 4L29A 1KTRL 5IFJA 1XR9B 1P7QD 1T5XA 4YUEH 5L2JA 4B53A 5BVPL 2ARWA 1MF2L 1UEMA 5I1KL 1IL1A 1F90H 5CP3H 2VR5A 3T0XA 4MXVE 1M7DA 2OSLA 2F54D 1MI5A 3IDJA 5SWZD 1UJ3A 1ZT7A 3FT3A 5DJCB 1R0AH 4U1IA 1RZIA 5BV7L 1LO0H 3B8YA 2WINB 4XH2A 1B90A 2FYYB 4PJ9C 4P57B 4GG6E 4TRPL 3QUML 3C6SB 1J7VR 2IANE 5HPMA 3KPRE 3Q1SH 1MJJA 2JB6B 4PP2A 2A74B 2XWJA 3S97C 2R2HB 1J0IA 5D7JA 1BLNB 2QR0A 3F7VA 2ICWI 1DQDL 3OR6B 2HVKA 2AJUL 4ZAKA 2APTA 2P44B 1KFAL 2F5AL 3QCUH 2GHWB 4HK3N 4K2UL 4CVUA 4MD5B 2GJZB 2IBZY 1N0XL 3IT8D 4G7YL 4NJ9H 5HDBF 4P3CL 2BRRH 4PJXE 4DCQA 3GI9H 3IYLW 3QDJB 4HLZH 3S4SA 1NGXA 4KJQD 4YXLH 5EOCJ 4M5YL 4IOFD 1IAMA 5C0DB 2R56L 4AEHL 3JWDH 4M62L 4GKNB 3BO8A 4KQ3L 1RUPL 5CEYA 4OCXL 3WHE0 5LCVH 5K9KA 5HHQA 2DQUL 1T6WA 3BJ91 1A6UL 5AG9A 4XXDA 2VLJA 2B1AL 3TVMC 4TVSa 1FVCB 1YN6A 3SQOL 3ULUD 4OTXH 3IJHA 5FUOH 4CAGA 2WSKA 4ETQA 4Q97A 2Q6WA 2XA8H 4LVEA 4N8VG 3MRPB 4GKSA 4XVUD 4ZS7L 3VH8B 4ONGH 1FNFA 2PTTB 1A8JH 4JHZA 3VE0B 5FDWA 3LY6A 4YBQC 1TQBC 3OKDB 1F4XH 1RZJL 1QSFD 3IXTB 1UYWL 1NAMH 4ZSOA 4KY1L 3RIAK 3D5OF 1UM4L 5GZOD 5I1LA 3BZFB 4PJCE 3RWFB 5F7WC 5EOTA 3LS4H 4RIRB 1DR9A 2BZDA 5EN2A 2DM7A 1OL0A 1MFAL 4H20H 5A2KH 4I9WE 2X1WL 4DOHB 1UADC 4F57L 1UXWB 5GS1C 1Z3GL 3KLHC 4CVXA 5DTFA 2PXYA 4I5BA 5F71A 1AGDB 3GNMH 2HFEA 3QDMB 5HY9A 4PJ9B 3DX6A 4PREB 2Q6WB 1IAIL 1T1XA 5ICXA 1L6ZA 1CGSH 4JDZB 4C56A 3VXOA 4HXBH 1KJMB 4K3EH 4ZUUA 1BBDL 1LP9F 1O7VA 4BZ1H 1QFUL 4RBPH 5H2BB 3LS5H 3UJIH 3IXTA 4XPFL 3CFKB 4OCLC 2VLJD 3MRMA 1I8LC 1MREH 5CGYC 4Z7OE 1QNZL 1ZMYA 8FABA 3QFJD 4WTXA 3MR9A 3N50A 3QHFL 2ZCKL 1AD0B 1DVFB 1ZKAA 5KS9B 5C0FB 4XPAH 1ZHKA 4MNQB 1N3NB 5E5UB 5IQ7L 4U3CA 5E0QA 3RL2A 4EBQL 4IRZL 4NCC2 4PJ5B 2XZQL 1T6VN 4DKEH 4B5EA 3UPRB 4XMKH 2IPTH 2DJSA 1DE4A 3SDCC 2VXUH 1A9EA 5ID1B 4KHXL 1AR1C 3DETC 4HAFA 3MV9E 4N0UB 4WUUE 2R69L 5BS0E 1QSEA 3VD7A 2P49B 3I50L 1KPUB 2P8LB 3V6OA 1CTOA 1TXKA 1U95A 2ZG3A 3I3DA 2EDBA 3CFKA 4KI5C 3ARWA 5TF1H 5DJ2A 2EDWA 2JB5H 2VLKD 2XPGA 5D1XB 5DJAA 5KSAD 3QG6B 2EECA 2AW2A 5E08H 1YMME 3BKYH 5E56A 3KPRA 1GZQB 2YMXH 1I7ZB 5CBAA 2W07A 2A0LC 4LGRB 5AYUH 2A6KA 4X80H 4OLXH 4HKJB 3IU3A 4LVHC 1Y0LB 2B0SL 2X70B 3DGCR 4AH2A 5BRZE 1O7SA 3I6KA 3WDIA 1DLHB 3C2SA 4X4YB 4R96A 2EDFA 3IFPA 3O4LD 2YS4A 3TN0B 1MQ8A 5GRJH 3DRQB 1G7MA 2DQGH 4JQXA 2F53D 3MFFB 2XWBA 1EA9C 4YQXH 3MNVB 5DMIH 4LQFH 4S0TD 1LE5A 3C2AL 2D2OA 3QG6A 3RZWA 3SGDI 5D72L 3T0DA 5EOQL 4WHTB 4CDGC 2WBJD 3WBDA 3FO9B 1XAUA 2MMXA 5E94B 2ESVE 2IADB 2YSSA 3D0LB 3MUGB 4CL7A 2E7LA 5K9OA 5FYLH 2NY6D 1M6OB 3DOSA 5KG9A 2JJWA 43C9B 5TDPA 2EDKA 5CUSL 2Q86A 3ARBA 3SE9L 3VCLA 4CNIA 2EYRA 2JCCB 4U0RB 3HZVB 1BX2B 1OGAD 4PLNC 1RULL 4U6HB 1G7MB 4JM2A 3DX9B 1JPFB 3U0PB 5IUSA 2VDPH 1TZGL 3K4AA 4KRMB 3P0VL 4QEGA 2HLFD 2AQ2A 3QWRA 5EWIH 5FA4A 3RAJH 5TE6H 3AROA 4EN3C 3QEGL 4ODWB 3VXUB 2Y6SC 4RGNB 2ZOLB 1C5BL 3NIDE 1EJOL 1RZIB 1WAAF 3DMMB 2GJZA 5ESVA 2P24B 4JEGB 3KJ6H 2R8SL 4GSDL 2XTJC 3GBLA 5J11B 3SDAB 1OB1B 3D3VA 1NGWA 2PYED 4O2CB 1KJ2H 4NRZB 4PRIA 4Z7NE 5F1KC 3AY4C 5DI8A 4HJGB 5ECJE 3MLRH 1LO4H 2OZ4H 1TCRB 4CMHB 4PJAA 4LLWB 5FYJD 1YN7B 4ZFOA 3F62A 1CLOH 3SOBL 4XP5L 4M43L 1TCMA 3OXRA 3W0WE 5J1TC 5CEZL 5HPOA 3MUY1 1IGYA 4PJ8A 4A6YL 4JPVL 2BDNL 1MFCH 2AQ1A 5SWZE 5CIPB 5FYKD 5INCA 5C0BB 7FABL 4WHCA 4GAJL 5KSBE 4OGAC 2OK0L 1X5FA 4NN6C 2OR8A 3BEVB 1NBZA 4FXGB 5ANMB 4UU9A 1HEZB 1JYXA 5D7IE 1CFQA 4HCRA 1S3KL 2YOCA 5BZDB 2R4RL 1FNHA 3RX5A 3QO1A 2V6HA 4JFYB 1KBGL 5J0BA 4PRAB 3QUXD 5FKPB 5C0JB 2CR6A 3NABH 2W9EL 4PY8I 3DGGB 3B9DA 3HUJA 5HDQH 5JR1L 3ES6A 3GSVB 1EXUB 5A40E 1LE9A 4DVRL 3QEQD 2ZCLH 4LCIL 4HSQA 3GUTB 1I3GL 3DUHA 2X9YA 4QTHB 5FO7B 3ZKQD 4M6NL 2AI0L 2XTJD 1A7NH 3UTZA 5T5FL 2OJEB 3CH8A 4HWEL 5KVMC 1B0RA 4NC1C 4K3GA 2VLRA 3VFUB 3RL1A 1Q72H 1KCLA 4HGKC 2I9LB 1PAMA 3HC0A 4PJIE 4IDJH 1J0KA 4KI1A 4NQSA 3S96A 3RWJB 3GDBA 3FO1A 3GMLA 4PR5A 5F70A 3BI9X 1E6JL 4MAYB 4K71B 3QXTA 4N0FA 1NAMB 5IEHA 1A6AB 1FVEA 2NW3A 4X5XB 1JHTB 2BOCB 3LB6D 1RMFH 3CX2A 4LASH 4OFYA 1ZLUK 3B6SA 3U9UA 1I8KB 3KPPB 3DHMA 1FJ1B 1IKFL 1FZOA 2FIKB 4YE4H 4BH8B 5T3ZL 4FFYH 2APVA 4L8DA 5MENA 1G7IA 3BP4A 4KK6D 5EORL 4N8PA 3QUZA 4HHAA 1S7TB 2IBGA 5BRZD 3QPQC 1F58H 3F7YA 2V17L 3RUGB 5FYKU 1HZHL 1K8DB 3CIQA 3SJVE 4DUVA 4JB9H 4K3EL 3VRIA 5JPNA 3LQAH 3T0EE 3LS4L 4LLYB 3TJHC 1MQKL 1RZFL 1YEEL 4MWFB 2BNQA 3WSQL 2VLMD 4WDIA 1WWCA 5FFLA 1Q94A 4JFDA 2Y5TB 2DAVA 4DKFL 1J88A 3A6BL 2NY0B 3TGXA 4QTIL 3BDYL 1VFAA 5CP7A 2D03L 3HC3H 3H9SB 2UVEA 3U1SL 5IHLB 3I75B 4KJPC 3EBAA 4JFFE 4RSVA 2ATPA 2NXZB 3O41B 5EUKB 25C8L 1P4BL 1LEKA 1ERNA 3BKMH 4HKJA 2D7OA 3OB0K 1FE8L 1NFDE 1XGTA 2X6MA 1NCAL 2E9WA 4LLUA 4G9FB 5GZND 2FCBA 4H1LA 1LO3L 3MREB 4PV9B 4IEFB 3PHSA 4JG0L 1XIWC 4P4KA 3MRGA 1QR1A 1OAYL 5TE7L 4Q7DA 4BM7A 3PHQA 3IAGC 1EMTL 1T0NB 3P9MA 1N2RA 2ICEB 1E4WH 4AENB 2NY2C 3MJ8A 2Y72A 4QHNA 1YNKH 4YHZL 2WQRA 2BDNH 2E7CA 3VFWA 3QWOA 5MHSD 1GIGH 4KROC 3BIKA 4EIZC 4JM2F 4JFDD 1T4KA 1IM3A 5SV3A 2OTUB 2QQLL 2WIIB 1SEQH 2AABL 2YA2A 1BGXL 5HBBA 5E6IB 3KPMB 1JWMA 3D18A 3I50H 1DQTA 3LD8B 1SEBA 1M6OA 4Y16D 5INDB 4AIXA 4U1MA 3P77A 1WCBA 3S9DB 1TJHH 4LSUH 1KCUL 3MV9A 4C57C 1RUML 1N0XH 1HXMB 4MXWL 3KNBA 3PJSB 4KRPD 4HDIB 1YEJL 3NOIA 1BZQK 3MOAL 4FMKA 1PSKL 3MO1A 3WLWD 1QLEL 4PG9A 3MRQB 1B4JL 1ZEAL 3ZKXC 2YK1L 4XZUA 3JWDL 4RGND 3ZL4L 1NMBL 2J8UE 3DNKA 5LQBL 4KRNA 3FQUB 3IS0X 3OMZA 2ADIA 3EOTH 1G6RB 4N9OB 3WFHB 4OBRA 4M7JH 1C5CH 3EUUA 1EERB 2I26N 4W4OA 2ADJB 1S7SA 5JHDE 3V7AG 1RZKC 1UH3A 4OLZH 3SE9H 1YQVH 2BNUA 2OMNA 1R24A 4ZNEA 1L0XA 1EAPA 2FD6H 1P5VA 1XZ0B 4GXVH 1JN6B 5B38B 2GFBB 3MFFA 4OJFH 1RZKH 3MRBA 4ZUVB 4YAQA 2NZIA 1UWEH 1FFNB 4PG9B 1A1NA 2V5TA 1OOAA 4ZDHB 3DSFL 1IAKB 2V2TB 2AJ3A 4HV8A 5CMAA 4UT6H 3T08A 5L88H 1ZE3C 1DSFH 5J9PA 5JW4M 1XF5B 1MCEA 3JUZA 3O3DB 4XPGL 3QB7C 5BO1H 4MGXA 3EW3B 3FMGL 1ZLVH 3QUXA 3KDMB 5IW3A 1IJ9A 1BQHB 5DVMA 1G7LA 2OX5A 1KPRB 1CU4L 2BX5A 3SCMA 3RHWK 4MJ4A 2BNUB 1JWSB 2V17H 4JY6A 2FGWH 3EJYD 3HZVA 1EAPB 4M43H 2P8MB 1N6VA 3JZ7A 4XMLL 1I7UA 2J7LA 4FRWA 2GK0B 4U1HA 1F4WH 2ED8A 2F19L 1MHPL 4UINL 3HUJB 2GSIA 1YY8B 1AXTH 3QBTB 3I84A 4WFEE 5I1HL 3UTSA 2R0KH 1C1EH 4LEXH 3FB5A 5KVFL 4JRXE 5IEKA 1UWGH 5IOPB 2MPAL 4XCYB 1A1MB 5FOJA 1MAJA 1MHEB 4HH9A 3D0VA 4RFNC 4WTZG 4ZFGH 2NY3C 3MFGB 2VDLH 4PJ8D 4JZOA 1K8IA 2C1OA 5JLZB 5E2UH 4WW1A 1NBVL 4OFYD 2UUDH 4UUJA 2VE6B 1TETH 5L2JB 4HUUB 3ZT5A 1R0AL 4AIZA 1G6RH 2V5MA 4JFPB 4M5ZL 1JI2A 4LPWA 3QIWC 1WTLA 4L8SC 2VH5H 1AIFA 1VEOA 4HK3J 3PHOB 1TVBB 3E6FA 5HI3D 3ROLA 5SWSD 3C60A 3QQ4A 1UJ3B 1CLOL 4XP9L 4XNZC 1UKSA 4FFZL 5ETUB 1T21A 3L6FA 1NCUA 4OUUB 4PRNA 1HINH 4D94A 1NFIA 3OX8A 4OV6F 1FSKB 3MV8A 3GKZA 2Z92A 4GMSL 1MNUH 1U8LB 2I60H 2GCYB 3CH1B 3DYMA 3S5LG 2J12B 3GJEA 4JAMA 1S7XA 1M71B 4Y1AB 4GMTL 5F7KC 1YDPA 3SGKA 3C5JB 3KJ4C 2HP4A 1WJ3A 3S36H 5FHAL 4XCFL 5DHXB 3WLBA 1R5WA 1VGKA 2P5WA 2QSCL 3FQXA 3VXRE 4PJXA 4KJWD 1ZT1A 1JGDA 3IFOA 4TSBH 4S10A 3A6CH 4MWFA 4K7PY 2L4OA 2FJFB 3D69B 1KCRL 1H5BA 1Z5LA 2X42A 1E27A 3CFEB 2UZIL 3Q0HA 1AQDB 3GM0A 3QXAB 5D7LE 1KTLA 4M7KL 4F7EA 4OUUA 4PRNB 2PYEB 1G9NC 4JM4L 4NRXA 1Y18A 4ONGL 5JQ6H 3OKEB 4Y7MA 1FLRH 1YNTB 4M4RA 1KGCD 1QRND 4LIQE 4DVBB 5KG9B 3UZVB 3TZVA 5DLML 4WW2A 3U0WL 1MFDH 3Q5OA 1BJMA 2WP3T 1NEZG 3AS3A 4WFHE 4OLVH 4YHOL 4HXAL 3VXMB 3U48A 3X3FL 3C8KA 2BY2A 5FUOL 4NUJB 4UTAH 1ZA6B 1G7HA 3NZHH 2NY5H 4YIQB 5C0ND 1U91B 3X11B 3HC4L 4JRYD 4V2CB 1QA9A 3C09B 1PZ5A 4NGHH 5A16A 1DN0B 2ZCKH 4X4ZA 1LD9B 1EJOH 2NY5C 2XFXB 3HMWH 2FIKA 2HRPH 5EUOB 4DEPC 3T3PF 1VFBA 1IEHA 4UDUB 5FGSA 1HIMH 4BSWB 2BCKB 4MDJB 4UMGA 2R9HC 3MZTA 3O2DA 3PE9A 4NQVA 3MJ9H 5D7SH 1G9EA 3RUGA 3ZKNC 3BPNC 1IAOB 1QNZH 4PY7A 5F89A 1I1FB 2V5RA 3ARDD 3GNML 5GGSA 3W0WA 3T0EA 3AGVA 2A9MH 4LSTL 4YXHH 2CDFB 4HXBL 1W8NA 2M8XA 3O3AA 3RU8H 3ARXA 4ZG1A 5GGVL 5AD0A 4Y4FD 3KGRA 5HHVL 3PGCA 4MQSB 4PRPE 1A1NB 4M00A 4KKBC 2HJFB 5J7CC 3AUVA 3AU1B 4F2MA 3FT2B 5I1CL 1MWAB 5AWNL 5CFHA 1EEQA 3WHE1 2X1OA 3LRSA 1FO0L 5I18H 3SDAA 3VJ6B 3V0WL 4XB8A 2QKIB 1DLFH 1CS6A 4XNMB 4HUKB 3VG0L 3ILQC 3F65A 3SDYL 5GRXG 3GMNB 1SEQL 1QLFA 1OAYH 1MCBA 1X4YA 1TCRA 2X1PA 1S7WB 2F54E 4XTRD 4P5MB 3ILPB 1J1XH 3ZDXE 2AI0H 1JUFA 3L9RB 3UTTE 1S7RB 3LN5B 2FEEI 4RAUA 2UWEA 2GQHA 1BWWA 4QRTA 2D7TH 3WCYA 2W0KA 2EC9T 5I74B 4FQ1L 4KAQH 1KENH 4BSJA 1L7TL 2YPLE 4KUZH 5F3HB 1A7RH 5IVZB 1Z9LA 4ZOBA 1E4JA 1WCQA 4WW2C 3V8CA 5C71A 3SGJA 4D9RD 3RDTD 3GSXB 3BW9B 4UQ2A 1BAFL 2AEIT 2X4RA 5SX4H 4F15B 3WNMA 1RZJC 4MB3A 4LASL 1HOCA 2PTVA 5JO5A 2GAZA 4IMLA 4PJEE 3SDCD 3CSYB 1RULH 2CD0A 1V5JA 4Z7WB 2Z93A 3LN4B 1BVKB 1GC1C 3RWGB 3QFJA 4O2FA 3VXQA 4EQ3A 1CWVA 4S2SA 1HZHH 1KXQE 1ZXQA 1QBBA 4KK5C 4XHQA 2VL5B 4HUVA 1U2CA 4N0YL 1D3CA 4KU1A 4XVJH 4OT1L 3JWOC 3S7GA 4TUKH 4L4TA 5IROC 4JQVC 1ZGLB 1C08A 2OYPA 3EFFA 5GS2D 3TH2T 4J2XA 3I75A 1DQLH 1TFHA 3WFBL 1JI1A 3HUJF 2A1WH 4CKVX 2G9HA 1VFMA 1UM4H 3P0YH 3K8LA 4P5KB 3VXTB 4AYFA 4YHYB 3VFVB 4JO3H 2FR4A 5E2UL 5JORB 2EH7L 1U3JA 1BEYL 4LLUB 2JKXA 3OHXA 3MRNA 3RRQA 4P5TC 4N8CH 5D8JH 3RA7H 2AKRB 4YFLI 1T0NA 1RQ5A 4OKDA 5AEAA 4UNTA 5I74C 3MRDB 1FYTD 4L9LC 1GZPA 4P49A 4AQ1B 1FFPB 3TH3T 1Q9KB 3QIUC 3X17A 2AS5M 3CDYA 3PABA 4XRCB 4ZUUB 1S3KH 4JPVH 4LLYA 3ZE0E 4UT7H 4Q6IC 2HT4C 3PWJA 4F9PC 1INQA 1HHKB 1XF3A 3L3JA 5KVFH 1JPSH 1T1WA 4WGVB 4X7SH 1IRAY 3TEUA 4BH7A 5CP7B 3TO4D 2VE6A 4G6KH 1M7XA 2OK0H 2X89D 5C6PB 4PB0L 5AG8A 1EUUA 5D1ZC 4X6BB 4OAWA 2H9GA 3NTCH 4V1DA 3W0WD 3ARDA 1L0YA 4RDQF 2VXSL 3DYOA 1B6DA 2FX9H 1FL3A 4QHMB 4F33B 3UC0L 4DGYL 1S5HB 3DMMD 2PKDA 3S6CA 2YZ1A 4GAYB 5D71L 5DRNB 4MQTB 1OTSC 2E27L 1TVHB 4NNXA 4LRIA 5CEZE 3GMOB 1U95B 1UM5L 4BSWA 4GRLB 2GW5A 3KHOA 1VADB 2HTLD 3TO4B 3U0WH 2N7AA 5GGTH 1LWRA 4NYLA 3QYCA 3V6OE 1FG2B 3OXSA 1ZLSL 4KPHL 1SJXA 3SDXE 4NN6B 4JRYA 3KG5A 3OGCA 4XXDB 1DUYB 5F1NB 2AJYL 1AC0A 3BESR 4I8DA 2CGRL 3SKNB 3ARDB 5CZXD 2DTML 3HMXH 4RFEB 2IGFH 3ZTNL 1QFHA 4ERSL 4OQTL 4R8WH 4XXCA 3SQBA 2CK0H 2MHAA 5ISZD 1RUKH 3I6KB 4KI5F 5L7XH 4PJ7F 3HMWL 4EUPG 4FQCL 5E99L 3SCMC 3PXJA 1HKLH 4J23A 4OI9A 3K2UL 1IQWH 3O9WD 4HLJA 1NANI 1BFSA 5FYKH 4BFIA 5D5MB 1PKQE 1RZGB 2OL3A 4R0LB 2EDXA 1B6UA 2IANA 5MP6L 3QUYD 5IHZA 5BXFB 3EOAB 1K8DA 4KJWC 4AG4L 1BMGA 4KKAC 4PLOB 2CO7B 4XI5D 1YUHA 4L8SA 1UXWA 4ESKA 4E42A 1AKJD 1Q9LB 2J8UA 1KXTB 2XA3A 5SWQA 3NAAH 1JGVL 1RI8A 1X5KA 1ZT7B 3FT3B 5DQJA 3HG1B 5IOPA 2G75A 4JDZA 3I85A 2NTFB 4G3YH 4LPXA 5BOPA 4P4RA 3TT1H 3K4ZA 2ZUSA 4N5EC 3TBWB 4WCYH 1AD9A 1KTKE 3HTLX 1I7TA 3RVVD 3MR9B 1AR2A 4LPTA 1A02N 4MCYB 4GAFB 1NUNB 3VXRD 5C0EA 1D5BA 3PGDB 3MLTB 1D6VH 1F2XK 3GIZH 4MCZB 3BRGC 3PNWB 2QJDA 3RX7A 4X7CC 3WFEH 2F15A 2WUBH 3FO2B 1A7PL 2EH8H 4HUNB 4OV5A 4TUJA 2H2SD 4KH2A 4O4YL 5E2TL 4X6CE 4XP1H 4X5WB 1NEZA 4WGWB 2A77H 4E5XA 2ZG1A 5A2LH 4ELKA 5JXEA 2GITA 4QGTA 4GS7B 4PP1C 2VWEC 5FM4A 1G0DA 3DUSB 9CGTA 1QOKA 2B7DT 3HRZB 3WUZA 1I9RL 1FZMB 4PJHA 3SE8L 1LO0L 2GY7B 3PQYD 2BRRL 2EO9A 3QJHB 5CJOH 3OZ9L 1KOAA 3MJ7B 5IEKB 5HHVH 5EH1A 1YNLL 2DI8A 3S36L 5FDWB 1CDYA 5KZCD 4P5KA 4HGWB 3FKUS 5HPMB 1IC7L 2JJSC 3BT2L 3TO2B 4MMXC 5AYQA 2IH1A 2D9CA 2VN7A 2W0LA 1FVDB 3VFOA 5CJXA 1TITA 1NC4B 4X83A 4WI6A 2HKFL 5FM5M 3U82B 1F3JB 1LO2L 1M7IA 1OTTD 5C08E 1KJVA 4I2XA 4YDLC 1TJGH 5DQDL 4HIXL 3HPLA 5HGBA 3RFZC 5B38G 3RJDA 5D2LE 1YY9C 3KJ4B 3OKEA 3AB0B 3DWTA 4TULH 3BWAA 3STBA 4M93B 4PTTA 1L7TH 3AM8A 3K74B 3L3KA 3JV4B 3UBXB 1H3VA 4CU8A 1A22B 4JZNA 2W1NA 4U3HA 4RGNC 1XGYL 4QTHA 4U1GC 3DXAA 5GRUH 3KPQB 1BAFH 5CLTA 2AJXH 1P69B 4XCCH 4NO2A 2CKBB 1JIBA 3S36X 1GC1H 4APQC 2MKLC 2NPLX 4F9LA 2D4FA 4JPIB 4MNHA 1HWHB 2JK5A 2Y5TA 3LEVH 4JREB 2MTPA 5E4IA 2JE8A 3RPIA 1IAII 5C09D 1F4XL 1OHQA 1HXYA 2NR6D 3G6JA 5T3XL 3LEYH 1WFNA 3GSQA 3K2UH 1DANU 4NC0B 1VEPA 4UZGA 5IK3B 5F9WB 4XPBL 2A73A 2HVJA 4CUCA 5HHOB 1KB5A 4QOKE 1Z9MA 4FP8H 4I48B 5HYJA 2IH3B 3HNTL 4HKBA 5GHWH 4JY6B 2FZ3B 3BUYA 4JFQB 3O45A 4PJAE 3MRCA 4LBEB 1QHPA 2N56A 4TTDC 2H26B 1IVLA 3RWHA 3NFPB 1H3WM 2HT3D 2NXYD 1JTTA 3X12B 3HR5A 4K94H 3TA3C 5DSCB 3CVHA 3QIUB 2VQ1A 1VKXA 4I0KA 5EU6E 4XBGA 3D0VB 1TETL 1HQ4A 2ADGA 1JWMB 4NHUA 5H35B 1UWXK 2QHRL 3B9KD 4MLIA 2W0FB 2BVYA 3D39E 3DSNA 4EDWH 2X4OA 5CD5D 3FT2A 4I0PA 3DJ9A 4HGMA 1FH5L 1OT2A 2XNAA 4WWKD 3SKJH 32C2B 4EBQH 2W38A 5BQ7A 1KACB 2VLKB 1CICB 1X5IA 3MXVL 1XIWD 4HH8A 4JRWA 3ULUF 1NBVH 3IJYB 3EDDA 5FA3B 3TFKD 1T83A 4KVCL 3MV8D 5HVWA 1MFNA 4EI5B 2KDGA 3U0TA 2PO6D 4XP1L 4GQ9L 1I7RB 4IJ3B 1DQML 4M7ZC 3MA7B 4U1SA 2YC1B 3RKPA 2VZ3A 1KN2H 4P5MA 5TDOB 4I18C 5TDNA 3C60D 3BQUC 4AQOA 1HQ4B 2ADGB 5AAWA 4LLDB 2G2RB 3BQUB 5CHNA 3VW3L 4YWGH 4JQIH 4EN3A 4C4KT 5CD3B 3N85H 5IMKB 1FZJA 2ZOKA 4P23C 1MCFA 4Q9CA 3U36B 5DDHB 3O3AB 1CGYA 1V8HA 3D3VE 5J12C 3UYOD 1XZ0A 2VLJB 3WFCH 3WXVH 5EU4B 3FN3A 3FQXB 1FL6A 3VI3F 3V5DA 3M8OH 3CU7A 4EI5A 3HE6D 1KLGB 3PGCB 4FQXD 2E9JA 4HIHB 1XF4A 5E99H 4R97C 4GKSB 3LKRB 1J1PH 3OL2A 4LLVB 5F6IC 1P2CB 2P5EA 3A6CL 3CSYA 3IAPA 4Z7VE 5MEOB 3HPJB 3KPSB 3ULUE 4FS0A 2Y9RT 4RDQG 2WP3O 2DWEA 3MACL 3T1FA 3I2CH 3ARFC 4TSAH 2R0LL 5D6DC 4H0IA 1FZOB 4ZD3L 1IZKA 4X9FA 1CG9A 4AEEA 3GO1L 1FPTH 2ITCA 4FQCH 2R2HA 3H3PH 1RZ7H 2DQGL 1CE1L 1F6AB 5I1IH 5JPMB 3MUGA 3DO7A 3DX8A 2YBRA 1AO7B 4ONOA 5DJCA 1G9MC 5INCB 1KV3A 3U6RA 1LEGA 1EJ6A 2JCCA 3O11A 1PFCA 4M7LH 3A67L 1RUKL 2FRGP 5CBEB 1JF1B 2DQTH 3GSNH 4JHWH 4WDIB 5DK2B 2AXFB 3QI9A 3JV6A 1KELL 2PR4H 2EKJA 1NKRA 2ZUQB 3P30H 2RFXB 1M7IB 1YC7A 5D1QB 5FHBH 3OV6A 4G6FD 4FP8L 2VXTH 4YDIL 1EHNA 4S1SH 2RR3A 1C12B 1JE6A 2JLLA 2PO6C 1CU4H 4TPRL 4GKOA 3P4OA 1JZ3A 3EZJB 1U8NA 3SE4A 2QBWA 3L3KB 4LPVA 3O6FD 3DRTA 3AMKA 4YXKH 3C60B 3QQ4B 1CXFA 3VDBA 1S9YA 2NY7L 4H1LB 4O58H 4LF3A 1F3JA 1TMCB 5T5NF 2ICES 1UEYA 4RA3A 3UMTA 2F19H 1QSEE 1INEH 3MGTB 3MV8B 5LBSL 4P2RD 1NGYA 3QQ9C 5JW4N 3SPVB 4DN4H 3MCLL 3KPLB 4UILL 5JOEA 2X4PA 3P4MA 4ONHB 1UKQA 2O5ZH 5C0BA 4FQ1H 3NGBC 4TSCH 1OSZA 4NOBA 3UCRA 2HT3C 2NXYC 4P2OA 3RZCC 4DQOH 2XQBL 2W9LA 4OV5B 3P4OB 1UZ8A 1GGCL 3MV7D 2FSEB 4GQ9H 1DLHA 3T04D 1J86A 5C9JA 3ZO0A 2Y23A 1MRCH 5K59F 3TT3L 1SVZA 2NZ9C 5EN2B 4Z8FH 1HYSC 4XP9H 1U8JB 1H3UA 2BVQA 3V9FA 3ILQD 3PHOA 1K5NA 3X14A 1U93A 5C6TH 4Y16B 3OAYH 3DBXB 5ERWB 4OZFH 3SBWA 1ED3A 2MQCA 1NAML 5ICXB 4ODUB 3UPCA 5IMOB 4QHLA 1WT5C 2XIDA 4V1DD 1YYLH 1BF2A 4PJCB 4YC2B 4M6OH 3O6FC 4EJ1C 3WE6A 3NFPA 3JWOL 2RJMA 4KK9C 5FYLD 2DBLH 1DQQA 3QNZB 4D3CL 4P48A 4PJGA 4KTDL 2EYRB 4HUMB 4Q6IA 2WWKO 3MODH 3S3JA 4DOHE 5GSRA 4WI4A 4K7PX 4P59H 4P3WA 2BC4A 3MRBB 5D93B 3V6OC 4DN3H 1CGSL 4KVNL 1NJ9A 1BQLH 1BFOB 5FO8A 4OLYL 2QLVB 4J3XA 3WFDL 4MJ2A 1R5IA 3QDGE 1QFUH 1T66C 2DQFB 3BXNB 5KSBF 1CD1A 1NLDH 4H8WL 1FLRL 2JJSA 2XNAB 4PRHB 1TVHA 4NNXB 2H6PB 4M1CC 4QGYA 1PX3A 4J7RA 1UACH 1UFUA 5E7FA 2J88L 4Y4HA 5GISL 1BD2A 4K94L 1Q8MA 1I4FB 3IDNA 4KMTL 1G9NL 5DHVA 2R8SH 4JRYE 3FB8A 3GEWB 3QZWA 4OIBA 4BJLA 4NOFA 5EC1B 3LKOB 3SDXA 4G6ML 2ZUWA 3MNWB 1CL7I 4YFEA 1IGIL 4Y4KB 4ZO8A 3JV5A 3OAZK 4UBDD 3HNSH 4S1RH 5BS0B 2VSDA 4H88L 4LOUD 1KIQB 4HKBB 1XR8A 4NO3A 3BIAX 2VLRD 4NZTL 1S5IL 3MRIB 2X4QA 2ZUYA 1I8IB 5I8OL 4UUJB 3TN0C 4NO0D 1T03L 3R1GH 1LGVA 4NQEB 5GGUB 5IVXA 3HS0B 4GAJH 1ZHNA 4WHTA 2EXWC 5B4MD 1ADQL 3ZSSA 4PRAA 2IBBA 1R3KA 3QXUA 3PHQB 4HCRL 2VWEE 1JVKA 4J8RA 5DJZA 1KFAH 1LHZA 2F5AH 2UV3A 3DVGB 4LSSL 4XNXL 3LEXB 4OZHE 2A0LD 4GKNA 4X6EB 2GI7A 2YD8A 4XAWH 3RVTC 5C8JB 4CU6A 4BH7B 2VXUL 4G7VH 4H25B 2Z35A 4JO1H 1TZHB 1RIHH 4NBXB 2D0HA 1E28A 2VLRE 2X4UA 2E7HA 1QSFB 4R8WL 3O4LB 3O8XA 3DO7B 4UV7L 2DRUA 4ZS6C 1FL3B 4I13B 3NH7L 2KL6A 4LPUA 4Y2OA 3HC0B 5JW5A 2VDQL 4JO4L 2ESVB 4MXWH 3S37H 3AS1A 4O51B 5FYJL 3D9AH 5E08L 4UI2A 4PJEA 1VB9A 3SO5A 2DQHL 3HE7B 4Z18A 1S9XB 3GSRB 5HHXH 2B4CH 1B0GA 4JKPL 2WLZA 5MENE 1KLUA 4BK5A 1TNMA 2R0LH 2JCCE 1NMBH 2XA8L 4U1IB 1KJ2A 4JVUA 5GSVB 4WENB 5T5NG 5EOTB 2XXMB 2C1PB 4KROD 4Y4HD 5DHVH 3MPCA 5GRUL 1A14H 4WWID 2QR0B 3PWPE 4RGNE 2R2EB 5HDBE 2WANA 1S9WA 4O02L 1L7IL 4BQ8A 3B4NA 2DIJA 4K3JH 2QTEA 1WK0A 1CICC 5F3BB 2R1XB 5AZ2H 1T2XA 4LFHG 2FX7H 4GRWB 1P2CA 4OFDA 1P6AB 2ENYA 1CIUA 5E4EC 1E4XL 1CE6A 5DRZB 4HS3A 5KN5B 3O6KH 2C9AA 2XACC 1EVTC 4ISVB 3BW9A 4UQ2B 1JNNH 3BVNA 2P5EE 1N7MH 1DEEB 3QUKB 1WZ1H 5EBMA 3RTQC 4X6DF 1WBXB 3T0ED 5SWZB 1B0RB 4UOW0 3B9AA 2YWYA 1GYAA 3LH2L 3C09C 5C0BE 3D6GA 4HZAA 3VWKA 4QTIH 2CRZA 4MYWB 1G7PA 4NQDA 5KSBB 4AT6B 2ICWB 4S2SB 2ID5A 2NTFA 5CINL 1KEML 4UT6L 3KXFA 5D7JD 1MCCA 2YPVH 5E8NA 1R3LB 4GW1B 1I75A 2YPKA 4M9PA 2MSPA 3AFLA 4ZSOB 1QRNE 3GJEB 4JAMB 4Y1AA 3WNOA 2BFVH 4G6JH 4NKMB 3WN5C 4RGOL 3ZHDA 1UQSB 4OCYH 1HCVA 4HWZA 1DBML 5IFHH 1BVZA 4OD2B 4L8CA 4NQSB 2P8PA 1CZ8L 5JIHA 1QVOA 2A6DA 2UY6A 1I7ZA 5CBAB 1S7UA 2JELH 3BP5A 3GMQA 4OCWL 4TUJB 3QA3B 1DZBA 4GW5A 1MREL 3RVVC 4HWEH 3INUL 3FCTB 3SKMB 3QNZA 4YK4C 3U4EB 1DDHB 3CFDA 1QRNA 5KSAA 4UILH 4F7EB 1AP2B 3BQUA 4OCSL 5CHNB 4XNMA 5FGBA 3EO0A 1ORQA 1LK2A 5CD3A 2WQ8A 3GMNA 1OWRM 5ESAB 3CUPB 5GGSY 3IDNB 2ZUTA 3P73A 1A1OB 3QO0B 3N1QC 1X6NA 3EYOB 1XT5A 4ZFFA 3QIBA 4R4FL 1SBBA 1P53A 1ORSA 1QQDA 2IFFH 4FFWC 2J8UF 1S9VA 2ADJA 1YPZE 2HKHH 7CGTA 1VACB 4PD4K 4KTEH 5HGGS 1CLYH 5EU3A 1G7JB 1EK3A 3P40A 2H8PA 3SGEI 5D2LA 2PCPB 5HI3C 2G5BB 4NO0A 3O81A 1LO5A 4WJ5A 2HG5B 5C0AB 3TO4C 2OJZL 3H7LA 3TWCH 2NY1B 3RNQB 3RWIB 1EUTA 1VFBB 1F11A 2NY6B 3L3DA 4N1CA 1NGZB 4XVUC 3ARZA 3RUGE 1NUDA 3UDWA 4WWKC 4G8IA 3PWUB 2R0ZH 2VQUA 2YN5A 3G9AB 1N5AA 2ZOLA 4PRIE 2BY0A 4XHJC 3BAEL 3ULUC 3RZCA 4A6YB 2I5YH 5HHPB 1XF5A 1FIGH 4FABH 3ARFB 5FUZL 3BZEB 3DXAB 3KPQA 1UACL 4QHLB 1TTGA 3PWPA 1HCFX 1T22B 3D85D 4OLWH 4QHKJ 4J6RL 2Q7YB 5BOZG 3DX8B 3D18B 1MHHB 3V52H 2IAMC 3BYTA 3I6LE 3H9SE 4YFLF 3BN3B 2WK2A 4YX2H 1RJYA 2IPUK 3FQTA 2JK5B 4JFFB 3JVGA 2OLDA 3EOYG 1KCRH 3TN0D 4WU5B 2AAVA 4QRQA 1Q0YL 1BJ1J 1BQUA 2J6EL 4OM0H 3FRUA 5AAMA 1IGMH 4LU5H 4PP2B 3RNQA 1NFDB 2CLVA 3WNNA 3ALXA 4LCCB 3H0TB 1QSFA 5GHWL 1JP5A 1QSVA 4RA0C 1PGRB 3L1OL 1T89C 1A7OL 3IJSB 1NGPL 2GSIB 3GSNL 4JHWL 1DBJL 4JFHE 2LQRA 3EDKA 2KKQA 2HRPL 4B0MM 1MVUA 1NCWH 1FC1A 5DHYA 2UZXB 4ZMAT 1HILA 3REVA 4LIQH 4QOKA 4U1NA 1MIML 3QAZB 3RWDA 2C3WA 1N7ML 4UV4L 3O3EB 5DFTA 2KBGA 2VLLA 3SO3C 2GSGA 1U8KB 4M3JA 1QBLH 3ECBB 1PG7H 1JGLL 3OKNB 4X4XA 3MJ9L 1WWAX 4R0LA 4KHTH 2FH6A 2BHZA 2C4FT 5L8KB 5DVNA 1CICD 4FQQB 1KJ2B 5GSVA 4RNRB 1TPXB 3G6DH 1IGIH 3Q2CA 4PD4J 1N59B 4APQD 1S9XA 3GSRA 1NLBH 3OJDB 4MD0B 5SV4A 1EZVX 5GRZA 5ILTH 4PB9L 4HUWA 1JRHH 3OF6A 2IJ0C 1N8ZB 1FFPA 3VG0H 4KJYA 1NCAH 3GSWA 4WFHD 5H94A 3DUUB 3MLWL 5FO9B 1A3QA 2KZ1B 2Z92B 3QQ3A 2EDRA 4J4PC 1M71A 3IVKA 3GHBL 4ZODA 1I7TB 1ETZB 2JJVA 3K2MC 1TQCB 4IHOB 5J13B 3NFNA 4JQIL 3D9AL 1QO3B 1T1ZA 5FGRA 5F7MC 4UQ3B 1OSPL 3WL9B 2P5WB 1J05A 1JWUA 1DCLA 1T5WB 4OZHA 1R3KB 1Q0XL 4YHKL 4G8GD 2HFGL 5CJ8A 1BJ8A 4X5XA 4QHUA 4NJAH 4OKVB 4MA1C 5IROA 5DDHA 1ZA3A 1EFXD 3AM8C 4L4VB 4LLQB 3REWB 4YQXL 3CDCA 1UGNA 1XIWB 3MGTA 1NBZB 2VKXA 1MWAH 1X44A 3GI9L 3CXHJ 5JW3L 3MV9D 1EO8L 1JUFB 4OCMC 2H3NB 1YNLH 5F8QC 4ELMA 5HYJD 5JHDA 4WI2A 1L9MA 4GG6A 3MV7B 4KQ3H 1ZHKB 4MNQA 5TF1L 4JPWH 3WL9A 4UDTB 4JFPA 5LQBH 5DMYA 1LEIA 1KB5H 2IAMA 1ZVYA 5D7JC 4DGIH 2VDQH 4JFEE 3G08B 4PRDB 5E5RB 5KTEL 1PKQA 1BQLL 4ZFZB 1G9MH 3IDYC 2NY6C 5C9JB 3LV3B 1CFVL 1H8SA 2X4RB 1JNHB 4PGEA 1P1ZB 2MNUA 3AY4A 3QG7L 1EEYA 2DM4A 2M26A 5DRWA 1N3NA 3QI9D 1RZGA 2OL3B 5DT1H 3RGVA 5IB2A 3K7UA 2HRLA 3S5LB 2R0WH 4JRXB 4NGHL 5DVOA 5J1AB 1X9QA 2C4XA 2AXGB 3CCHB 5CGMA 2MWCA 3EOAA 5E95B 1UC6A 2E9IA 1OTTC 1Z9OA 4GSDH 3MMEA 3KPTA 1DDHA 4ZS6D 5SWSA 4JY4A 1J10A 5F97E 4OSUL 2NXZC 3JWDC 5D72H 2DIBA 5SX5K 5FYJU 4JFEA 1INQB 3KYMA 5AZEH 3DROB 3RKDC 1ND0A 2OR9H 3FQNB 1U8HA 3QRGH 5T1MA 4PJGB 4X9HA 5KVDL 1MFBL 1MPAL 2M1KA 2AK1H 4DFHA 1QLRA 2BNQD 1KNOB 4FQJL 5IJVB 2X10A 4H88H 4XB7A 5C0CE 1J0HA 1T4KB 5C07B 1EZVY 4MAYD 5CUSH 4FQLH 4I0PC 1BBDH 5K9JH 4A6YH 3ARFD 1A6ZA 1E4KC 4P23A 3EJJX 3ULVL 3MRKA 4RX4A 3CXHK 5EO9A 4CVWA 1MNUL 5IG7B 2AJZB 2EIDA 5IT2H 3CVHL 1NCTA 3PIQB 4Z7NF 3OHXB 3V4PL 5GGVH 1QACA 4QXWA 5JUEH 4UIMB 1WZLA 3HE6A 3WUWA 5DEGA 3W9DA 5F1OB 3TA3A 2XWBB 1MHHA 5KW9H 3STLB 5IR1A 1NGYB 4GBXA 3MV01 4N0RA 1OAQH 4UNVA 2IQAB 1F5WA 5JXED 3FB7B 5I16A 4WV1A 1INEL 4LSRL 5GZNC 5D6DA 4NBZB 1FO0H 2LAAA 5D7KE 1KNOA 1JPFA 4GRWH 3U0PA 2ATPB 4LCCA 2XRAH 2R1WB 3L9RA 1AGBB 2DD8H 4MSWA 3PV6B 1AGEA 4PG2A 5J12B 5L6YH 4G9FA 3MBED 1J8HD 3RNKA 3I9GL 3O3EA 1CFSA 3CPLB 2CKBL 3W11C 3TNNB 3TO2A 3F58L 1KPUA 1NFDA 3N1MC 5DA4A 1BGXH 3VFOB 3MJ8B 4QHNB 4FQQA 1XMWA 2DKMA 5DJ6B 1YYLL 3VXME 3X14B 4NM4H 5EO0B 3S98A 4G9FD 4QRUA 1BZ9A 1OGTA 1FNGB 1U92A 5FAAA 3ARGC 1W8OA 5D7KD 4L3ED 1IM3B 5E00A 2ADFL 3B9KA 2DDQH 1A47A 1WZMA 4DJMA 1A7QH 3JUYA 2PETA 4Y5XB 4X98B 2DLFL 2ZOKB 3H9SD 2AERT 2L7JA 4XWGH 1FDLH 3EOBB 4AH2B 1A4JB 5BZWA 2EE9A 1HIML 3QFJE 3U36A 4OLYH 3TZVC 4GOSA 5FUCC 3VRLF 3BPLB 1CQKA 3SJVA 4GQPH 4X0KB 5BW7C 4RMVA 1YPZA 3BUTA 1P7KA 2Q1EA 4W4NA 2O61B 1HH9B 1NGPH 1S78C 4MD0A 4F58L 1MFEH 1YMHB 3FHQA 2OL3H 3BDXA 1INDH 4NC1E 4F9LC 4Z7OF 3EFFB 4I77H 4KKCD 3RQ3A 1IGCL 1F8TH 4LLVA 4OTXL 4J3SA 3WS6C 3ARFA 1BWMA 4OLVL 4YHOH 5F8RC 1PG7X 1ODAA 1MLCB 2CIIB 2VRAA 4R4NC 4ZD3H 2UWEB 2YXMA 4QRTB 1CR9H 4ODBD 2NZ9D 4X99B 4X8JB 1IM9A 1JGEB 4WNQB 4OUOA 4U7MA 4HIJB 5C09A 5KVEL 3QO1B 3UTZB 3UTTA 4YC2C 4FMFA 4MMZC 5IW6A 3LQZA 3ZYIA 5GGTA 1L0QA 5D1ZB 2WLYA 1JPTH 2DI9A 4ZPVA 8FABB 3ES6B 4J3WA 4RAUB 1A2YB 2OR9L 4P4KC 3FRPA 4YDJB 1HNGA 5D7SL 3G5ZA 1KIQA 4POYA 1YEGL 3UROR 3O11B 4RWHA 4ODSH 2GEEA 5ICYA 3TBTB 4LCWB 3QUXB 1B2WH 1URLA 3ARBC 2X9XA 1KJ3L 3RL1B 3FFCA 2H3NA 5HJ3B 1ACYL 3QI9C 2DLIA 1HHHB 5EZOH 2EYTA 3QULB 1YEHH 1H15B 4KHTL 3OZ9H 1HOCB 3UTTB 1CICA 1FLTX 4TQEH 4L8BB 2EICA 2IEPA 5I0DA 1QG3A 3CSPA 3S5LA 3I6GB 5EU5B 5C2UB 4O9HL 4UOJA 1V7ML 3RI5K 2D0FA 5KSBA 2Q87A 2V2WB 1DBKL 3E3QC 4UV7H 1JNHA 3FFDB 4WI9A 5IB1B 1JHLH 4RFOL 1J1OH 1QP1A 2WZPD 5HD8D 2BNRE 4FXGA 1A0QH 4GRLA 2NXZD 4Y2DD 4NZUL 4BFGA 4NKMA 1M05B 5HJ3A 3MLSH 4NKQB 1NDGA 2RCSL 5HHNA 5HYJE 4YHKH 2FB4L 3CLFH 5CCKL 5I66B 4JPWL 2ESVA 5J11C 3HG1D 4G8GA 3CMOL 4Z7WE 1JK8A 1FRGH 1QBAA 5EA0L 4L8BA 5EPMA 3ZHKA 3SDXF 2R4SH 5HVFB 1QSZA 3DVFA 3QDJA 5IGXH 4Y5VB 3IRZA 3H9YA 3EHBD 5EB9A 1KC5L 3MA9L 5IB1A 4CMMA 4FZEH 1OLLA 2FZ3A 3CD4A 3WUWB 4U1KA 2FWOA 2IPKB 1D7FA 3L3JB 1MY7A 2QADC 4ENEC 4X6FB 3BE1H 5TDPB 3ZDZE 2EE2A 4R6UA 3TH4T 1GZPB 1Y6KR 3O6ML 4AM0B 1LO2H 3NCFB 5TQ2H 1U8PB 5IG7A 3QIUA 5DYOB 5EZIH 4M7KH 3BDBA 4HIXH 2Z8SA 4HQQL 4I2XE 1FO0A 4J3TA 1KJ2L 3OAYK 1AKJA 3HZMB 4IIQB 2FEEL 4APQA 5AZEL 1NSNH 1X5YA 3P9MB 1N2RB 4PPTA 3BX7C 4MNHB 4X6DB 1YEDB 1NMCC 1Y6MR 5EC2A 3VA6A 1F58L 4ISVA 1RJLA 4KKAD 2YEZB 1B88A 4NZRL 3MZGB 2P46B 3QUYA 2HWZL 3FAXA 2AJXL 3FB6B 3P4NA 4S1QL 4XCCL 5C09E 4ZUWB 4WEBL 5DK0B 5F6HJ 4OD1H 1XR9A 5BVJB 3INUH 4ZAKC 4FTVB 3DO3A 3IFLL 4NQDE 4A6YA 2ZCHH 4YH6A 3F8UB 4WHDA 1RFDL 3UTSE 1CFSB 3SKNA 4EI6B 3CC5A 4POUB 1F90L 3O2VH 1BZ7B 3TPUA 4JQXC 5IBTL 1E6OL 5C0CA 5J1SC 1V3LA 4JKLA 5IMMA 1OCWL 5E8DH 4LMQI 1GHFL 2FX9L 4FQIH 4BUHA 1DVFA 3UO1L 4KKBD 2EH8L 4H25A 3VXNA 1OAZL 4ZUTB 3NCYP 4PRID 4QKXB 1TZHA 5E5MA 5FXCH 1P4IL 5I8CA 4P9ML 4L5FL 4U6XB 1OVZA 5DK0A 2YWZA 1T04A 1UXSA 2HT2C 3F7PC 4KDTA 4MJ6B 5E8EB 2XTJB 1S7VB 3KXFD 4DVRH 5HVHC 1EFXB 4L4VD 5IFHL 3MJ7A 5BS0A 1DE4B 3IKKA 4B41A 1OW0A 2PO6B 3HAEB 5ADOL 4PJDA 4WFED 5GGTL 3RWEA 4U33A 4GRLC 1YYMH 3VGFA 1KEGL 1C1EL 2P8LA 3KDMA 3KPSA 1EO5A 4YLQT 4LSQH 2ZUQC 1MCOL 4LCYB 3WXVL 2B2XL 1I8IA 3G5VA 4ZDHA 4KKNA 3CFCL 4OQTH 4EXPX 5JNYB 2A6JB 1H3GA 3RI5F 5TDNB 2ITCB 4J6RH 1IGFL 3X13A 1U0QA 3WN5B 4P2CG 5E6IA 1FV1B 1NDMB 5LAXA 1BVKA 3B83A 4XCEA 2DQIL 5F1IA 3NN8B 3FB5B 1KCVH 1HE7A 3ULSA 2N7BA 2OR7A 1SYVB 3OKDA 4OB5L 2VDKL 4U2YA 3L95A 5DD5L 3MJ9A 3THMH 3BKJL 2P7TB 2C1OB 4PTUA 4YHPB 4F58H 1JNLL 3O2DH 1INDL 1D9KB 1LE5B 3T4YB 3U46A 1ZTXH 1DUZB 2HTKD 2X7LA 3U9UB 2R2BB 3VGEA 4G8FA 3MGAA 1OGTB 2ENSA 5GRVK 4AIZB 3LQAL 1AJ7L 4UQ3A 5GS0D 1MCDA 3RBSA 1KG0A 4HUXA 5F7YC 4EVNB 3C08H 4WHYG 4F7CA 4JRXA 3RY6A 1TNNA 4FFYL 2HFEB 3QDMA 3QR2A 2IGFL 2WBKA 3ZTNH 4ZTOH 5L0QB 3RVXD 5EORH 1W0VB 4FQHA 2AEQL 3TZVD 3H9HA 3ULSB 5C3LD 4C56B 4IOIA 1C5DA 2DL2A 1DBBH 5IB4B 4XNUL 1CDBA 4CMHC 4YHMH 2X44D 4X6CF 5F9JA 3W5MA 4FG6D 2C5DC 5BJTB 2D31B 4ZXBA 4ELMB 4OM0L 1OGAB 3MACH 4KK6C 1JGLH 1KT2B 2JF1A 1EX0A 3UJIL 4IMKC 4GKZA 5HYIA 3VWKD 3LZFH 5DSCA 5F3BA 1HILB 1XFPA 4PGZA 4YBLC 1ZANL 3KLSA 4HC1L 4Q9QH 2I9TA 1LEIB 4CN1A 4S1QH 3CFIC 1UZ8B 4XVJL 4YHZH 4QXGH 3L5IA 1I1AC 4F8QA 5I19H 5DD0L 1HHGA 1A6PA 3NZHL 3BGMA 3TCLA 1AGCA 1FJ1A 2ZUUA 4V2BA 3MCLH 3KPSD 3T2OA 4M48L 3VFNA 3BRFA 2GK0A 3CSBA 5DUPH 4Z0XB 1JF5A 3JTSB 1PD6A 1R3IL 2DICA 2X41A 3L3HA 1CN4A