2ZSVB

Crystal structure of h-2kb in complex with jhmv epitope s598
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Prevention of cytotoxic T cell escape using a heteroclitic subdominant viral T cell determinant.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zsvB00
2V7HA 1FIGL 4Z7UA 2VE6A 1A3QA 3U0TB 1KIUA 5DO2C 1G6RA 5FA4B 3WDJA 4RRPA 1WFTA 5EBWA 3IF1B 5IB5B 5J57B 2IPUG 5JMRA 5MP6L 2UY7A 2X4UB 2YBRA 2WIMA 4OB5L 3LHPH 3LN5A 1AY1L 5J9PA 5LCVH 4L9LB 5EU6E 1GOHA 5C9KA 3FB6A 4R96B 3O2WL 4R9HA 4YWGH 5DMGD 2AEQL 4PRIB 1CI5A 3RFZC 2ZCHL 2DD8L 1DCLA 5L2JB 2XY1A 1EGJL 4LPCA 2DLGA 1AGFA 2OSLB 4CL7A 1OAUL 4XHQA 1H3PH 3MUHL 5IGXL 5KTEH 2FEEI 1T0NB 3NOIA 1NMCB 2F5AL 2N56A 4U1IB 4OKVB 2G5BB 5EU6A 5IFHL 4GG6F 5IF0A 3TBYB 1MH5B 4BQCA 4Z77A 3GKWL 2R4RH 1VGKA 3AU1B 3F8UB 4IHOB 3WIFA 5ISZD 4MYWB 3DYPA 5HI3D 5F8QC 5L88L 2V7HB 1WAAE 4Z7UB 5GJTH 2B5IC 2VE6B 4QHUA 3B6SA 1G6RB 4N9OB 3GM8A 1MPAL 2DICA 3BYTA 3GJFK 1TMCB 4WHTB 5EBWB 2DQJH 5A2JH 3L95A 2FGWL 3LN5B 2P8PA 4IOFC 5J9PB 1NL0H 4LOUD 4O2FB 5EU6D 4DQOH 1CIUA 2E9BA 3LH2L 4YC2B 5A3ID 1VENA 4NQCE 4Y5VA 3RWCA 1AGFB 1WAAA 3HKFA 3QXUA 3F58H 2VXVL 4JKLA 5D2LF 4MJ4A 3DXAE 3CFIC 5EOCJ 1VFUA 1F58L 2YMXL 2ATKA 4TQEH 1A7QL 3VXSE 1PEZA 1J7VR 5EU6B 3V4UL 3TC9A 4HUKB 3L7FA 4ZAKD 5IF0B 3ZT7A 3IXTA 4LNVA 1EO8H 4Z77B 2VDQL 5HYJD 3D69A 1NUDA 2DQEH 5DD0H 1KELL 1VGKB 2B1AL 5TH2A 4HWUA 2BVUA 4NQCA 3WIFB 5AG8A 4XRCB 1JGUH 4PB9L 3DBXA 4OFKA 3TBVA 5E4EC 1FO0L 5D72H 3RA7H 3DXAA 3VFVA 1KIRB 1ZE3C 4QHUB 1IJ9A 3B6SB 1S9VA 2M1KA 3WIIH 3UTSD 2A6KB 3L95B 3QEGH 5FHAL 3VD4A 3O4LE 2XOTA 3H7LA 2A9NH 2P8PB 1LO3L 3D48R 1BJMA 3CCHB 1G7PA 3CXHK 2AQ3A 3S5LG 2A77L 5KJRL 1BPVA 2VNCA 2RQ8A 4NQCD 4Y5VB 3RWCB 4EVNA 4XGZA 4XP4H 4MGXA 4WWKC 3TT1H 1U0QA 1F3DH 2NY4D 2R29L 1DQMH 4ORZC 4GAJH 1NBVL 5HYQA 3O4LA 4HH8A 4PGEB 2ATKB 5KSBF 3S34L 2F8VA 3L7FB 3BDBA 4LSRH 2NX5D 3IXTB 4RSVA 1UM5H 4I3SH 3TA3A 2P4AB 2X40A 4JFDE 1OCWL 3D69B 5GS1C 5TH2B 3QULA 1T22B 3R1GL 2E27H 4NQCB 4N5UA 4ZDHA 1GH7A 3DBXB 3TBVB 3DXAB 3VFVB 2QKIA 1MAMH 1W0WA 4NZUH 1I4FA 5LGJB 1HH6A 1W8NA 4HJ0C 5GRJH 1BFVL 1YEIH 1G7PB 3TFKD 3L5XH 4JFDA 4UTBH 5M94B 3Q1SH 1P7HL 4Y5YA 1CE6A 3CVHA 2DQDH 4TRPL 1FQ9C 4P49A 5C0FA 4QY8B 1MCWM 2G60L 3CAFA 5ENWA 4XGZB 4EVNB 1X4YA 1AJ7L 1LP9F 5HYQB 3O4LB 1MCQA 3S36L 4D9RE 4JY6A 3EO0A 3GI8L 4V1DD 3BXNA 4OM1H 5CZKA 2WMPA 3TA3B 3GHBH 4HFWA 3SE9L 4JFDD 4YBQC 3P9WB 2OTWA 2WWKO 1ZT7A 3QULB 4ZDHB 2QHLA 1C5BH 5BZDA 2QKIB 5IBTH 3M07A 3E3QC 5JQ6L 4DGYL 4ELKA 3FQXA 1NDMA 5CILL 5GSRA 4M6NL 3U9UB 1HH6B 5HBBA 3QFJD 1A7PL 1T2XA 3TO4C 3HHRB 5JQHC 4CDGC 4JFDB 5TQ2L 3O2VH 3QIUC 2HVKB 1CR9H 2ICES 4NHUB 1J9CT 4OV6F 5E8NA 2FX8L 5D6DC 3TGXA 4KVCH 1O7SA 4GBXD 4Y5YB 1CE6B 1QQDB 3CVHB 4XAWH 4NQDD 5C0FB 5ENWB 1MREL 3ARUA 4PYHA 1RIUL 1KB5A 2KUTA 4X6FA 4OUUA 4G43A 4AEHL 4HMDA 2E7CA 2WP3O 4LCYA 4DN3H 4P5TC 2APTA 4D9RD 4JY6B 1I1AA 3EO0B 4N0FA 2MCPL 3BXNB 1WIUA 5KVFH 1OAQL 3T4AB 1UB5B 4XNYL 5KSAC 3V6OA 2P24A 3V0AC 1ZT7B 5INDA 3CXDL 1PEWA 4LASH 5EZIL 5I1IH 4BA8A 3UAJD 3LEYL 5BZDB 2OYPA 5DK0A 1Q9WA 1MCDA 4ELKB 2XICA 3FQXB 1NDMB 4TVPE 3MV8E 5GSRB 3MRDA 4M03A 1G1CA 1NCWL 4P4KC 1BBDH 3T77A 3ARFD 4KRPB 1JNNH 3FOLA 4NCC1 4YDKL 1SBSH 2VYRE 1Q38A 2FRGP 5E8NB 3RKPA 5E2UL 4DZ8A 4NZTL 4HX1A 5IT2H 1HKLL 2EEDA 4PJEE 4JY4A 1KB5B 3QUYD 4X6FB 1FN4A 2A38A 4KDTC 3RI5K 4OUUB 4YDIH 5DT1L 4G43B 4Z18A 3U79A 4OZIE 5I1GH 3MV8A 1LK3H 2PYEE 4KXZH 4LCYB 3UYPA 4ZXBC 3MCLH 3BGAA 3NIDF 1I1AB 2CK2A 4N0FB 4HXAH 1NC4A 4FQ2H 2ADIA 25C8H 5IJVA 5F9WC 1KB9J 5INDB 3PJSA 1ZS8A 4MLIA 4PJEA 4WFEE 3AVEA 2HT3D 4KY1H 4JCMA 3MO1B 4OZIA 5DK0B 5EU7E 2ENSA 2PYEA 3HE7A 3TNNB 1ZHLA 4TVPD 4H8WL 3V0WH 3L3IB 3MRDB 5CGYD 3DLQR 1JZ6A 3BE1L 3TJHC 2OI9C 4XC3L 1NC4D 1HE7A 2AQ2A 3D85A 3T77B 2ZUQC 4HS8H 1UJTA 3FOLB 1RI8A 3EDJA 3QXWA 4QXGH 3OKLA 4YUEH 1F90H 4IOSD 4DZ8B 3K80A 1ZHNA 1T21A 4HX1B 4UT9L 4XCYB 2AJUL 1EEYB 5F1OB 3WBDA 3C09C 4JY4B 1FN4B 4YFLF 1S8DA 2IPTH 4GRMA 3QCVH 3REVA 1MNUL 3BI9X 2P47B 3QDGA 4MCZA 3MV8B 4PJ9A 2DQFA 3SE8H 3SDCC 2B1HL 1P7QD 3HE7D 4OFVA 3OGOE 2FR4A 1QHPA 2R2BA 1NC4B 1JHKL 1IAIH 2ADIB 3EYSL 1SVZA 2CLVA 5IJVB 2BVOA 1TJHH 3MYZA 1QRNE 4IRSA 4PJIE 3PJSB 1ZS8B 4PJEB 2VAJA 4RBPH 4BM7A 3GB7A 1TJIL 1MWAH 1P7KA 5T3XL 4QHLA 5C0RH 4OZIB 1RIHH 3D6GA 4Q9BA 2PYEB 4P3DB 1KNOA 3QDGD 1ZHLB 4M9PA 1IGIL 4PJ9D 2OR8A 2GHWB 5I75B 1ZT1A 1RAMA 3ROOA 3D85B 2RJMA 3NCBB 3P40A 5IBLC 3OKLB 2M26A 4MAYA 5HHOE 1ZHNB 1T21B 5E6IA 3L3KA 1LK2B 2DTMH 3B9EA 3NCYP 1HYSC 4GRMB 1FNHA 4ZFFB 2FX9H 1YEFL 3REVB 1MCCA 1DBKL 3T65A 1WUNT 3QDGB 4MCZB 4PJ9B 5DEGB 3IDNA 2P5WE 1U95A 1HKFA 2RCSL 4OCRL 2ADJB 1OQXA 4MXQC 4HCRH 4X9GA 2GIYA 2R2BB 2YA0A 2NMSA 3LS5H 3VRIA 4JDZA 2CLVB 4JDVA 3SY0B 2PTTA 2BVOB 3NFSL 2EIZA 4IRSB 4U6XB 1FPTH 1RJZA 4MAYD 4L3EE 1GPOH 1K3IA 1IC7H 3GB7B 4OBRA 5E6ID 2GW5A 3SDXF 2NY3B 4OGYH 3BISA 4QHLB 4R97C 4CBPA 1U8MA 3VXME 1KNOB 2P5WA 5EC2A 4BSVA 3KYNB 1DN2A 3DURA 3MACH 2AK1L 4DGIH 5MENE 1S5IL 3OX8A 1CFNA 1ZT1B 1KYOJ 3ARTA 4KH2A 1GGCH 1N5YL 3P0GB 1DL7L 3SN6N 3FRUB 4IEFB 4OAWB 3BH9A 4PJIB 4L3EA 4JLRA 4MHHI 2Q87A 1CLZH 3L3KB 5GZOD 2YC1A 1K3ZA 1JRHI 3VXMA 1IZKA 1HCFX 3T65B 3GIZL 1D6VH 1QO3A 4XP1H 5FO7B 3IDNB 1U95B 2IADA 1U9KA 1XGRA 3KPLA 1B2WH 1Y6KR 5MENA 4I18C 3VXUA 4HT1H 4DK3A 1GZPA 1AGDA 4ZSOE 3VRIB 4JDZB 5IESH 1QPPA 4JDVB 1PFCA 2PTTB 3QYCA 4NNPH 3HPJA 2EIZB 5HHOB 1FC1A 1JZ7A 4GG6E 1EO7A 1T3FB 1E0OB 3BKYL 1RJZB 3MGAA 1CE1L 2O5YL 5ICYA 2Z4QA 4CRPA 3TT3H 3HR6A 2DF3A 3QQ9D 1MIEH 2IBBA 1U8MB 5IUSA 5CSBA 3W11C 2P5WB 4UIMA 1J1XL 4BFEA 5EC2B 4BSVB 3DURB 5CFHA 1OT1A 3DVGA 1T04A 3OX8B 1CFNB 2GJZA 3VXUD 4ZSOA 4P5KA 1H5BC 4I3RL 4KROB 4H0IA 4GG6A 3BH9B 4G6JL 2V2TA 5EN2A 1MY7A 2ZZUT 4L3EB 5F96H 5J13C 3E6FA 3T8XA 4S1RH 5CUSH 1TITA 1NBYA 2YC1B 3VXMB 3ZTNH 5I1DA 3BDYH 4UIKL 1R3LA 1QO3B 1F4YH 2MJWA 5D1QC 3BD3A 4L8SA 1FNSH 2IADB 1IKNA 1XGRB 3KPLB 5D2LE 1N6QL 2EC8A 5MENB 3OR6A 5LQBH 4KVNH 2O5ZH 1GZPB 4PB0H 4NQVA 1AGDB 4FZEH 5ITBH 3GI9L 3FHQA 1R3KA 2KBGA 2VDRH 1JYNA 1S7SA 5JNYA 2FECL 3HPJB 2R2HA 3GGWA 2VH5H 3QI9D 4PBWD 1U3HA 1I3UA 2X41A 1YUHA 2D3VA 5ICYB 1K6QL 2Z4QB 4ZUWB 4G8FA 2QADD 5ALCH 3C6LC 1B3JA 3O6KL 3ME0A 4OLXL 3NN8A 4XB7A 2N7AA 4HWEL 4UIMB 5D2LA 1ZHKA 2WLZA 3GBNL 5EO1A 4O5LH 2ZCKL 4JG1L 2KH2B 4ESKA 3DVGB 2X4TA 1T04B 1T6WA 4JZNA 2GJZB 3SKMA 1KCVH 4ODTL 4ZSOB 1ZA3B 4P5KB 8FABA 4U0QB 4F15C 3T1WA 4GG6B 4OF0A 2V2TB 4GO6B 5EN2B 5CJQL 4WEMB 3H3PL 4PJFF 1F13A 3E6FB 3T8XB 4F57H 3WJLA 1U3HD 2VZSA 1NBYB 4GS7C 1ZLUK 5B21A 5I1DB 3MUZ1 3T0BA 4BFGA 1KJ3H 3QPXH 4JFZL 4L8SB 2AJXL 4IBLT 4X6EA 5DC9B 4LIQH 2I27N 1RUPH 2W0FA 1ZVSA 1B6UA 5DUMH 2IC2A 3FAWA 3MA7A 5TF0A 5KSBE 4JQIL 1R3KB 4G6KH 3P73A 4FQPA 1QTYT 4RFEA 4UBDC 2FATL 2R2HB 3PL6C 3EJYD 1I9IL 1YUHB 5DUBB 2B2XL 1EJOL 4GUPA 4G8FB 3L3DA 4YHMH 5BV7C 3K4AA 1JK8A 3C60D 3M8OL 1AGEA 5E2VL 3ZDYF 3P0VH 5D2LB 1ZHKB 5EO1B 3PWUA 2FWOA 4JKPH 4JM4H 4LHJB 4NN5B 1IM3A 2X4TB 4E0RA 3FB5A 4JZNB 3SKMB 5KSBA 1YN6A 8FABB 3QNXA 3JVGA 3MODH 5I1AA 1B88A 4LSTL 2UUDK 2HKHH 1BM3H 3EDFA 3AS1A 4UILL 1AE6H 4OLYH 1YQVL 5D9SB 1FVCA 1OSPL 3P4NA 3MBEC 3LB6D 5FAAA 3RWDB 2R69L 1KIPA 35C8L 4NJ9L 5DLML 4X6EB 1LP9E 3AMLA 4JFPA 2W0FB 5IK3A 3ULUH 3MA7B 2VZ3A 1H8SA 3IGAB 3P73B 4RFEB 3JZ7A 1V7ML 4O58H 5GSVA 1ZWIA 2XZAH 3L3DB 1HOCA 1JK8B 4KDWA 4AIZA 4Z8FL 5FV2A 1OTSD 2A6IA 1LP9A 3K81A 3PWUB 2FWOB 3QUMH 1IM3B 2HLAB 3FB5B 5IR1A 4L8CA 3B2UD 4E0RB 3TVMC 5KSBB 2VMFA 1VB9A 5I0DA 1YN6B 2IGFL 4KJPC 3C5ZA 3QNXB 4XPTH 5I1AB 3SDAA 4O4YH 3VFWA 1BAFH 4Z9KB 5TFSH 2L0DA 4F8TA 4WV1A 1P1ZA 2VDNL 2PKDA 4L3AA 1D5ZA 1FVCB 1FIGH 3P4NB 1XF5B 3LN4A 3H8NA 4KKLC 3INUL 1RUAL 3CFCH 1KIPB 1QD0A 3VXRD 1MCKA 4ZODA 4JFPB 1K5NA 5IK3B 4OB5H 2HVJA 1AY1H 1U91A 1GJIA 5D93C 4R2GC 3O2WH 2C9AA 3DYOA 2AEQH 3ZHDA 2XQYG 2DD8H 3FN3A 3KYOA 1ZWIB 3MRKA 2VL5A 3C8HA 1HOCB 1OAUH 4NQEA 5IGXH 3HB3D 2EDLA 1TNMA 4AIZB 1BGXH 3WKNA 2A6IB 1LP9B 5BS0E 2F5AH 4H0GA 2IAMB 3OQ3B 4RDQF 1INQB 5GGVL 4L8CB 2FEDC 1CL7H 3ARGC 5IFHH 3C5ZB 3RKDD 3SDAB 5C6PB 3VFWB 5K59F 3GKWH 4Y0GA 4OZ4A 4N0CD 3PUCA 4WV1B 1P1ZB 3REWB 1XMWA 1PAMA 1D5ZB 2GUOA 2IFFL 5D96B 4ZYKB 5L88H 3VD9A 4N0RA 1QLRA 3LN4B 4LLDA 4NQED 1KTLA 2BHZA 1XAUA 1MPAH 4Y2DA 1KJMA 4UV4H 4UUJB 5T1LB 5BS0A 4JGUA 1K5NB 1U91B 3KHOA 5DJ2A 1KOAA 3RI5F 4HLZG 3ULUC 1ZLSL 2EXYD 3NIDE 5HGAA 4OD1L 4U6YA 3LH2H 5F8RC 4HS3A 3KDMA 2LAGB 1WC7A 3ZE0F 1JZ5A 3GSVB 4U1GB 3X12A 1LILA 1EERB 1XEDA 3KYOB 4KHTH 1K8IB 3MRKB 1YMHA 2VL5B 2EYRA 2VXVH 3MREA 2Y1VA 1B90A 4P2QE 4C83A 2W65A 4X7TB 1QR1A 3WNOA 4F7PB 1BVLA 1M1SA 4MQXD 1CZ8H 4Y2DD 1F58H 2YMXH 2XQBL 2GY5A 1A7QH 1ORSA 4F8QA 2HJKA 4FNLL 3WNKA 4G8EA 2VQTA 2V17L 2P43B 5I1EL 4XP5H 1IEAA 4O9HL 1KELH 2B1AH 4OZ4B 2KZWA 1CGYA 4J4PD 2GUOB 1DN0A 1CD9B 1FO0H 2IQAA 4KI5C 4LLDB 2R2CA 1JNJA 1KTLB 5E24E 3BIKA 4NKIL 4Y2DB 1KJMB 5BS0B 1FSKB 3GSUA 5FHAH 4MJ2A 5JXAL 5F9AC 4M5ZL 3CLEL 3IFLL 5JIPA 5HGAB 5I1LA 2Q7YB 4U6YB 1RHHA 3OXRA 5K9QI 3KDMB 1WC7B 4YXKH 2ID5A 5BJTA 2XKSA 4MX7A 5IVXE 3GSNH 3X13B 2A77H 5KJRH 3X12B 5DR5L 3KPQA 3MRMB 3MREB 5JW3L 1UZ6F 4C83B 1TLKA 3L3OA 1FYHB 2R29H 1QR1B 4KK9D 2CDGA 5A16A 4WHYH 2CGRH 4JN2A 4OCWL 3P4LA 3GSRA 1NCTA 4NJAH 2HJKB 2VZ1A 3KS0H 4IS6A 2X9XA 4GMSL 2J6EL 1IZJA 1OCWH 4OIAA 4BUHA 3R1GH 4A6YL 1DN0B 3JTTA 4P2QB 3BIKB 1DFBH 2VZUA 4FTVE 3ZSTA 3B4NA 3GSUB 1C1EL 2F15A 1TTFA 4MB4A 5KANG 3SE3C 1TVHB 1QLEL 1QFOA 4YDLB 5I1LB 1RHHB 2VQ1A 1ETZA 3OXRB 1FYTD 5BJTB 3QO1B 1YEEL 4MX7B 5DJCB 2B5IB 4WFGE 3D87B 2AXJA 3KPQB 4TRPH 1PG7L 4CADA 2G60H 4AG4L 2Q8AL 1AJ7H 5IQ9A 4FTVA 3L3OB 1LHZA 1J8HA 4K23L 2CDGB 3SDXE 4JFOA 3S36H 3SQOH 4HSQA 3TJEL 4N90E 4JN2B 1BX2B 2I26N 1NC2A 2DBLH 3GSRB 4JFYA 3GI8H 1YDPA 4IS6B 4LCCC 1KN2L 1RD6A 4U3HA 4XT1C 2M8XA 4PGDB 5IVXB 1U8KA 3SE9H 5C92A 4WWKA 5EUOE 5IG7B 4OCXL 3HPLA 3CFKA 1QFWM 3JTTB 3EZ8A 4CAGA 1VFAB 3E8UL 5FYLL 1NKOA 4DGYH 3SDXA 1JF1A 5E94A 1J8HD 5C8JA 5MI0B 5CILH 4FG6D 1V3LA 5CZVL 4M6NH 2EDXA 3QWRD 1A7PH 1NC2D 3HZKA 3PGDA 5IM7A 3I3BA 3MA9L 2OP4L 1CYGA 1ETZB 4ZO6A 1FL3A 3O3DA 5TQ2H 1TFHA 4JPVL 4O2EA 2FX8H 5E4EB 5EBMA 5D5MF 3W0WD 5EUOA 1LE5A 3BESR 4WWKD 1SEBA 5KOMC 4MNHA 4CADB 4J23A 2OXHA 1CXLA 1OB1B 5EZLB 3V52L 4FTVB 5L0QC 1T0MA 1X5FA 3VRLF 3UC0H 4AEHH 4WDIA 2NTSP 1NAMA 2BNRA 3AROA 3NABL 4JFOB 1MEXL 5IMLA 3WMSA 1YDPB 5ECJE 3TN0C 1T7ZA 4XNYH 1U8KB 2YD7A 5E6YA 3IRZA 5CJXC 4I48A 4R4BA 2X7LA 3CXDH 4WWKB 4JFEE 4PLKC 3E3QE 3CFKB 3HPLB 4EQ3A 2ADGA 1ZSDA 4M6OL 3LEYH 1QP1A 4K8RL 1UKQA 1FVDA 4DFHA 2DAVA 3PGFL 3SDXB 3QNZA 4J3VA 4HJ0D 3WJJA 2NY2D 4L9DA 4F58L 1BFOB 2Q76A 2BNRD 3RWIB 4LU5H 2EDKA 4M61A 3HZKB 5IM7B 1A4KA 1FL3B 3O3DB 3RBSA 3WFDL 2SEBA 5DRZA 1S9KC 4M1GL 4O2EB 4YDKH 5EUOB 4JFEA 5E2UH 1LE5B 3MJ7A 4NZTH 1RV6X 1HKLH 3OTTA 1Q9LA 4P23C 1SEBB 5EDXA 4S1SL 4MNHB 4TSAH 3FRPG 4CMMB 3MRJA 1T0MB 4ZNEE 1NBQA 4WDIB 3TO4A 3GMPA 1NAMB 2BNRB 2ZJSL 3BP5A 3OJVC 1VKXA 3LKNA 5FGRA 4ACPA 3PXJA 1WISA 1J1PL 1JNLH 4I48B 3VD5A 4R4BB 2X7LB 2JB5L 1CDBA 5JOFA 4JFED 4PGCB 4PJ8C 2ADGB 5C0JA 5J3HC 6CGTA 4PJFE 1Q0YL 1A9BA 1K4DA 4PG2C 4P5TA 3OF6A 3RIFF 3IAPA 4ZNEA 3ARSA 3QNZB 2Q76B 4KC3B 3T4YA 4H8WH 3SBWA 3ETBF 5KSAA 4M61B 1JF5A 2UZYB 3BE1H 3F12A 1A4KB 4U0RB 4XC3H 5D2NC 5JW5A 2SEBB 4NO0D 4XNQA 4KUCF 4Y4HA 5C6TL 3WEXA 4JFEB 3E1F1 5IEHA 3MJ7B 5GQBA 2QQKL 3R06A 4RDQG 4ZS7H 4U6TA 3MRFB 1A7OL 1A47A 1EV2E 3L1OL 1GZQA 2AJUH 2A73A 4PJFA 4NYLA 3DHJA 2E7HA 2VQUA 3PXHA 3IFOA 1MNUH 3MRJB 1ZTXL 4P5TD 5A40E 1MRDL 3QDJE 3TO4B 3GMPB 3PWJA 2B1HH 3BP5B 1VKXB 4OCYL 3ZDYE 3M17A 4H20L 1WWAX 2EH8L 3PWPE 4JEGB 1JHKH 3EYSH 2LTQC 4UT6L 4OLEA 3UEZA 1EAJA 4I0PA 4DZBA 4KDTA 4Y4HD 1MCWW 1JV5B 4M7LT 5JOFB 4F7MA 3O41A 5DK3A 5C0JB 3RZWA 3DIFA 1F8TL 4MD0A 5T3XH 1A9BB 4P5TB 5KVEL 3QDJA 4ONGL 2L7UA 3HZVA 2VRAA 1G7MA 1UKSA 4HC1L 1IGIH 3GJFH 3T4YB 3MLYH 3LS4L 2Z31A 5KSAB 3PWPA 2X4QA 2Z9TA 3DX9A 1KV3A 3SGJC 1ITCA 5CP3A 4LSUH 4KI5F 5JW5B 2KL6A 4XNQB 5H37H 5BCAA 2AEPL 1FL5A 3WEXB 4I0PD 5IEHB 3IJYA 1JPSL 3R06B 1CXFA 3ZDXE 1GZQB 2EKSA 2A73B 4PJFB 4BK5A 4NYLB 2UZXB 1PW3A 2CRYA 5T5NF 1RZ8A 1YEFH 1DBKH 3U4EA 4P4KB 3PWJB 1EIBA 2RCSH 2OMNA 3ECBA 3F7RA 2CIKA 3M17B 1G6VK 1KIQA 1JFQL 4NQTA 5KVDH 2Z31D 4HKZA 4K7PX 3PWPD 4GW1A 1F6FB 1VGEH 4FFYH 5DHYA 5GS3A 3WLWC 4NOFA 4LLYA 1CXKA 3GMQA 1GL4B 4PLNC 3CSBA 3NFSH 3WFEH 3LQZA 4I0PB 1ZGLM 3F7VA 4JVPA 1A22B 4QHNB 4DZBB 1NFIA 1CDCA 5T1KA 4F7MB 4PGZA 1KXTB 3O41B 1U42A 3FN0L 3DIFB 3SDCA 4ZXBB 4MD0B 5IP4A 4RIRA 1J1OH 3QDJB 4JPWH 3M45A 1QFWL 1G7MB 2DQUH 4FQ1L 5GGSA 3Q5OA 4CVZA 4JE4B 2ZG2A 4H8WC 2AK1H 3JWOH 1PKQE 3PWPB 5F9WB 2X4QB 3UPRA 3KPOA 1INDH 4XNUL 1JNHA 3FRPA 1N5YH 4G8GA 4E42A 3VW3L 1FL5B 2PTUA 4HEPG 1VFMA 4BJLA 3IJYB 4PJDF 5T1KD 3RX8A 3CSYA 4U7KA 3OJDA 3U4EB 4OD3L 3GIZH 2EIDA 3RIAF 1F3JB 3ECBB 1I7UB 1PKQA 2ZUQB 3O0RL 4O2CB 1KIQB 1JZ2A 4HKZB 4GW1B 5DHYB 3QXVA 5J6HA 3GMQB 4XAKD 5BQ7A 1QFPA 5DGQA 4G8GD 3C09B 1EEZA 2ED7A 3F7VB 3SKNA 4U1NB 4K94L 4MA3B 1NCUA 2X1XR 5K59E 5GRVL 2O5YH 4WFHE 2BCKB 3BMWA 3SDCB 2X4NA 3O6LL 4RIRB 3FHAA 5HTSA 4XCNA 4ZTOL 3MRGA 4R8WL 3DUSA 4F3FA 1LDSA 1J1XH 2G2RA 4JZOA 5GGSB 4CVZB 1U8JA 2HRLA 3HI1A 3UPRB 2W0PA 3KPOB 2C4XA 1JNHB 4G8GB 3MJ9H 3MX0A 4E42B 4EUPH 2HFGL 4XPFL 4G6JH 3VH8B 5EZJA 4G5ZH 4FRWA 3CPLA 4C56E 1HYSD 5L2KA 4YFEA 3ZE0E 2HFFA 4H0HB 3LIZL 1AKJA 3ARPA 2DOCA 3CSYB 3OJDB 1BD2D 1U8LA 2IBGA 2VABA 1T1WA 4Y4FC 5CKGA 1N6QH 2JIXD 1PKQB 4Z0BL 4XI5C 4DOHE 1AR1D 1CXEA 2I5YL 4OLUL 3V0VA 1WZLA 5J6HB 5BQ7B 1XIWC 1EEZB 3ALXA 2P49B 3SKNB 4C56A 1H8OA 1K2DB 1B0GA 3OR7A 4M7JH 2APXA 4WFHD 5L2KD 5EFIA 2X4NB 4KJWC 4KZEL 3ZYJA 3GNML 4OLXH 4I18A 4XCNB 2H2SD 2V5TA 3MRGB 4KWUA 4HWEH 3DUSB 1FZKA 4JZOB 2G2RB 3GBNH 2ZCKH 5I71C 1NQBA 4JG1H 4YXHL 3HI1B 1KB9K 3DRQA 3HE6C 3V8CA 1BQSA 1OLLA 5C0IA 3LMJL 4QXTA 5J56B 1N8ZA 5HXMA 3EJZC 4UINL 5CD5C 5CJQH 5EZJB 3CPLB 4TNVK 3H3PH 5DQDL 4IJ3C 1XH3A 2YUVA 5L2KB 3B9KD 2HFFB 3U9PH 5LAXA 4NM8L 1AKJB 3HR5B 1U8LB 1JE6A 1I3RA 2VABB 4OV5A 1UZ6E 2VL4A 1T1WB 2AJXH 1KTKE 2ESVE 6FABL 2ZCLL 2JKXA 3MLRL 5A1AA 1EVTC 1QBLL 1Z5LA 2J4WL 4KKAD 3V0VB 4HQQL 1FFPA 4GAYA 5SWSA 2XTJC 2FJFA 4X9BA 4C56B 2W9DL 1B0GB 3MC0A 1N7MH 3WS6A 1I9IH 3IDYC 5L9DH 1EJOH 5GGUA 2E7LC 1DBML 3MLXL 5EFIB 5FCUL 5D1QA 4APQA 1MAKA 3M8OH 4I18B 3DRTA 4HCRA 2JTDA 5E2VH 1FZKB 5JUEH 1HK6A 3SKJH 4DOHB 1H3UA 1CTNA 4GXVL 4ZFGL 5HHPA 4YHZL 4YPGA 1N8ZB 4LSTH 4QRPE 2OJZL 1B0RA 2D7MA 5SWSD 3NPZB 2Q86A 3C6LA 1XH3B 4R90L 4UILH 1JL8A 3UTQA 3DVIA 5LAXB 1OSPH 2QSQA 5D1QD 4APQD 4EDWL 1S9YA 2QSTA 3BQUD 2DN7A 3KLDA 1F00I 35C8H 4NJ9H 5AWNL 3EO1A 4M4PA 5DLMH 4X80L 4NC2B 2NY1C 1Z5LB 2XPGA 3MRLA 4RFOH 5J13B 3B5HA 1EO5A 2FYYA 3EDEA 4MD4A 4QRPA 1FFPB 4KXZI 4AEIL 4GAYB 4PJBF 2FJFB 2W59A 4X4YA 3QG6A 4D0CA 1V7MH 5BVJA 3KJ6L 3OMZA 3O6MH 3RNKA 3S35X 5CINL 3FFCE 5GGUB 5D1QB 4APQB 1E4JA 3EHBC 3MYJA 3VE0A 4QF1A 5GGRA 3DRTB 5DQ9A 4PG9A 2IBZY 1CFVL 4Z8FH 3QJFA 3WXWL 4P2RD 1F45A 1URLA 4Y2OA 4LCWD 3PL6A 5HHPB 2VLMD 3KYAA 4YPGB 1FFNA 1TZHA 4XX1G 3SGKA 4XCFL 2Q86B 3TH2T 1TTUA 3C6LB 1R3HA 3MTRA 1YMME 4XXDA 2VDNH 5I1CH 5B39G 4WIQA 3UTQB 4X6CF 1S9YB 1JWMA 1KYOK 1RUAH 1AXSB 5B22A 2GFBA 3EO1B 4F15B 3QO0A 1R24B 1LGVA 3QIWC 2XPGB 3MRLB 5ALBL 2IALB 1XF4A 2FYYB 4MD4B 4QRPB 3ZYZA 1U58A 5B4MC 4PJXF 4X4YB 3QG6B 1MVFA 1T83C 3LD8C 4D0CB 1YMMA 3C8KA 5BVJB 1L0YA 5C08D 3RNKB 5D5MA 1IAII 2F9BT 1ZA6A 4Q2ZA 3VE0B 4QF1B 1BIHA 5GGRB 1V3JA 2X4RA 5DQ9B 4PG9B 4OJFL 1INEL 5J12B 1PZUB 2NTFA 4Y5XC 1JMZA 1WIOA 3LQMA 5GGVH 3P2TA 3W39A 4NCDA 1CD1A 3PL6B 2HMIC 1JWSA 5T5NG 1FFNB 1TZHB 3BPOC 3QUZA 5BV7B 1R3HB 1EUTA 3FFCB 1DQJB 3ZLQC 3JV5A 4Y88A 2D7TL 4PS4L 3PIQA 3R8BB 4I2XE 3ZE1E 1JWMB 3QG7L 1JGEA 4HUXA 3TVMA 1AGCB 4XH2B 2R1WA 2GFBB 1KCLA 1BECA 5ACLA 3QO0B 3HRPA 3T2OA 4QO1A 4XCCL 3CVIL 1XF4B 1ZLSH 4LDEB 4FA8A 3RWFA 4OD1H 5GGTL 5TDPA 4H25A 1U58B 2EDYA 4WJ5A 3MZTA 1YMMB 3C8KB 3MR9A 3FO2A 3G6DL 3QUZD 4KTEL 1NGYA 4AY0A 1ZA6B 4LNRA 3DI2B 1FRGL 3NZ8A 1FFRA 2LFGA 2X4RB 4FQJL 2C3GA 2OZ4H 1TENA 3A6CL 2NTFB 3QT2A 3ES6A 1L4IA 2BSSA 2EDHA 1UKTA 1YEKL 3OB8A 1P2CB 4GRLD 3W39B 2AVGA 3D3VE 4FNLH 4ZFOA 1QFUL 1CD1B 3RWJA 3WDIA 1JWSB 1CQKA 2V17H 4KKCC 3T1FA 4PLJC 1HSBA 4O9HH 2YZ8A 3QUZB 2K1MA 3NPSC 5DJYA 5CGTA 3RPIB 4MJID 1A7RH 3VGEA 3PIQB 4XPBL 3GEWB 4LLVA 4PJ7F 4G6ML 5FA3B 1JGEB 3ARGA 3QIBA 4HUXB 3TVMB 4KHXL 3W2DL 1BF8A 1CN4A 2R1WB 4RMSA 3ULUE 4G9DA 1N6UA 4M5ZH 3CLEH 2WM0A 1U6AH 3IFLH 1N6VA 1S7TA 32C2A 4WHCA 3RWFB 1FAKT 4H25B 2WBWB 4WJ5B 2IWGA 2G75A 2CO7B 2Y06H 1ZVHA 3FO2B 3MR9B 4RA0C 3BPCA 2Y36H 4P3CL 4LNRB 4M7LH 4RFNC 4HWBH 5GS2D 5GJSL 2DQGL 3QIBD 1YEDA 3ES6B 4AMKL 2BSSB 3FL7A 1J0JA 4OCWH 5I19H 4PRHE 2CQVA 4GAFB 1KPUA 4OSUL 3RWJB 1PG7W 1UXWB 3BN9C 3K8KA 5B39A 1I75A 4GMSH 3T1FB 5FYLD 5JXEC 2C3WA 5CSGA 2H2PC 1K4CA 4KI5E 1I9JL 3KWWA 1MQ8A 4OCMC 4A6YH 4LPVA 5ELIA 5E2WL 4G9FE 5J89A 1H3WM 3OB0K 2R1XA 3ARGB 3MOBL 4YBHA 3NFNA 5DRWB 1C1EH 1XR9A 5F70A 4PRHA 3IFNL 4KPHL 3D3VB 4M4RA 1S7TB 4OLVH 32C2B 1EH9A 2CUMA 4QTIH 5JR1L 3C5JA 4DTGH 2G75B 1YEEH 1JZ8A 4PJ5E 3LQAC 5C0NC 3BPCB 4POUB 1FGNL 4FQCL 3H3KA 4N0UA 1GCFA 4EI6A 4G9FA 4AG4H 4MJ5A 3OKNA 2VLJE 2EO9A 4K23H 1YEDB 4ODWA 5KN5A 3OSKA 1A7NH 3TJEH 2ATPA 3RU8L 4ONOA 1F4HA 3NMEA 4BH7A 3PP4H 1KPUB 5FB8A 5B39B 1KN2H 5GS2H 5I6XC 1EGJA 3PQYE 3MXWL 4PJ5A 4W68A 4DKFL 4X9FA 1W72L 3KWWB 1E4KA 4FABL 1P5UA 4OCXH 2MSPA 1UFUA 3TH4T 1BJ8A 4J3TA 1RZFL 2VLJA 3I85A 3W9DA 2HWZL 4RCAA 2VSCA 3QUMB 3E8UH 5FYLH 3I75A 1UH2A 5HHQA 2R1XB 1MI5E 5LJYH 1HHIB 3NFNB 1MJ7L 3S8WA 3DOSA 4JM2F 5CZVH 1XR9B 1MFNA 2Q1EA 2R9HC 4PRHB 3ULVL 5IBUB 2RIKA 1P4BH 3DI3B 4MXVF 3MA9H 2OP4H 3N1PC 4MB3A 5TPWL 3C5JB 4M43H 4JPVH 4YJZL 3LN9A 5HGHA 4PJ5D 2EDEA 3QHZL 5C0AE 3JV4A 2R0KL 1IAOA 3EYQC 4WRLA 3RUGF 3TIEA 5CCKH 1QSFE 3AS2A 4JPKL 4G9FB 4Y8AA 1S7UB 4MJ5B 2VDKH 3OKNB 3V52H 1MI5A 2J88L 1ORQA 4ODWB 5KN5B 1MEXH 2BP3A 3B5TA 5FYJL 2ATPB 4BH7B 3IFPA 2YS4A 5FB8B 2R56L 4PJ5B 2FCBA 5INCA 4ZD3L 4D2NA 2UUDH 4PRPE 4YDJA 1QSFA 1U2HA 3BJLA 4M6OH 1C16A 2VLJB 3QFDA 3W9DB 5ESQA 4LRNL 4K8RH 1CQYA 3FFDB 3I75B 2NY0C 1BVZA 3PGFH 5HHQB 5E9DA 5LXGL 2DM3A 4HF5L 3O8XC 3PE9A 3OAYK 4LCCA 1GGBH 1GAFH 4KTYA 2YOCA 4HUNB 3WFDH 2VJXA 4M1GH 5HGHB 4K07A 1FO0A 5F88A 5E5MA 3JV4B 2XA3A 1MFEL 3H9SE 2YD9A 2OBGA 3UTPD 3W9EA 4OUOA 5I15L 5E2TL 1IGYB 5GGVY 3RX5A 1IILE 1MI5B 2NZ9C 1ORQB 1UEMA 4U33A 5TE4L 2Q8BH 5E9DD 4OGZA 2ZJSH 4UMGA 3IDXL 1K9TA 4M02A 2DQCL 1SHMA 1X5LA 1J1PH 1E6OL 4D0DB 4X99B 3VGBA 5INCB 5C0AB 2JB5H 3H9SA 4YDJB 1D5XA 1QSFB 1OARL 1AO7A 2IPUK 1JYWA 1A2YA 1J8KA 5GPRA 1C16B 3QFDB 1Q0YH 5ESQB 1IQDA 4NUGL 3ARZA 4KUZL 3TN0A 2X4PA 3HNVL 4LCCB 1C7TA 4WUKL 5CJXA 1O0VA 4HIXL 4X98B 3ROLA 1CFTA 4NP4L 2VC2L 4PRPB 1FO0B 5IIEB 5E5MB 1IGJA 2QQKH 3QUKA 1BFTA 5DFTA 5FKPA 3H9SD 3EYFA 3L1OH 2UV3A 3RWEA 1AO7D 4TNWF 1MLCA 5IMMA 4OGAC 2DJSA 3CH8A 1ZTXH 2CK0L 4S1DC 3QCTL 2EXWD 2R0ZL 3WKML 5GRXG 3D0VA 1U92A 4OCYH 4H20H 4J8RA 3SGDI 2EH8H 4UNVA 5HVGB 4P23A 2NXYC 4UT6H 3KLAA 1RK1B 4QRRD 2WWMD 5D7JC 1EK3A 1TETL 1CL7I 3H9SB 2W92A 4PREA 5L0QB 2MHAA 4NWUL 2F8OA 1A2YB 4S2SA 1IQDB 4K8RC 2EDRA 4ONGH 2DKSA 3TO2A 3TN0B 2DJ4A 4HC1H 2X4PB 3LS4H 5D2NE 3FT2B 5C0BA 4HPOH 4L4VE 3BFOA 4YAQB 1E6JH 3DETD 3ROLB 1RQ5A 4PJ8A 3ARDC 2FHFA 2AEPH 1J88A 4PG2A 1IGJB 1JPSH 4QXUL 5FKPB 4PJBE 5I1HH 3RWEB 4UNUA 3RVUC 1SQ2N 1N26A 5IMMB 5HGDA 3RHWF 1Z9MA 2Q7NA 3LKRA 3OHXA 5D2NA 3IAQA 4NQSB 1U92B 4L4VA 4XTRD 1JFQH 1EXUA 4J8RB 5C0BD 2VR5A 1V3MA 1ZK9A 4S0SD 4P23B 43CAA 5KTEL 3KLAB 2EH7H 4PJ8D 2IJ0C 1R5WA 2HTKD 2DTSA 4PJBA 4PREB 2MHAB 5C0CE 1D9KD 5K33A 3BH8A 3MRPB 4S2SB 3ARBA 2OR7A 3FN0H 5BRZD 4F7CB 1IM9D 1BHGA 1I1RA 4OF6A 4HS6A 1QFWH 3TO2B 4FQ1H 4X6CE 4NC1C 5J11C 4CMHB 5K9OA 1WZMA 5I9QC 4TTDD 1U8QA 3KPSE 4XNUH 5GJTL 2WBJC 4PJ8B 4DFIA 2NY6D 1KJ2A 3VMNA 3JWDL 3VW3H 3UCRA 5C0CA 1NCDL 4L5FL 5IFJA 3HA0A 4KI1A 2NYYD 4PJXE 3ARBD 2PN5A 4BSWA 2OCFD 4OD3H 4X6CA 4EN3C 3LKRB 3OHXB 5D2NB 3RDTC 3VFSA 4L4VB 4C58B 5BW7C 1NGPH 3BJ91 3KPSA 4D9LL 5HYSG 1CF8L 2NY6B 5ID1A 2DIJA 43CAB 4H1LG 1R5WB 5DS8B 4ZG1A 4PJBB 4L29A 4PJXA 4TQEL 5C0CD 5HGBA 3BH8B 1DSFH 1G9ML 3ARBB 3O6LH 4F9PC 2V7NA 3U30C 4ZTOH 1JIBA 1S9WA 5IOPA 4XVUC 2R2EA 2V5RA 2QQQA 3K1KC 2LTQB 5K9OB 2C26A 3VCLA 4HKJA 4QNPF 3TZVD 1I85A 1NUGA 3RA7L 4AZ8A 3F7YA 1KJ2B 2HFGH 4XPFH 1IE5A 5AD0A 5C0CB 5IFJB 5B8CA 5KG9A 3MMEB 1F2XK 3LIZH 2XZCL 4NGHL 3VFMA 2ED9A 1JHLL 4BSWB 4X6CB 1ES0A 4WO4C 5DD3L 1G7LA 1T1YA 2YEZA 2VIRB 2CRZA 5C6WH 3EGSA 3VFSB 4Z0BH 4X4ME 5IWLC 3KPSB 4OLUH 2I5YH 1XZ0A 5L8LB 3MUGA 5IB4A 4XP4L 5ID1B 3QEQD 2OS7A 3JWNC 4LHUG 5JOPE 1AC0A 3A0OA 4L29B 4PJXB 5HGBB 5T3XE 4E41E 1IAIM 2IH3B 5CLWA 1LEGA 3DUUA 4OGXH 3MV9E 3P9MA 4KZEH 2ICCA 4R3SA 2V7NB 1V8HA 5HHXL 3GNMH 5T3ZE 4EQ2A 4KRMB 2LQRA 4MCYA 1B4RA 1NGZA 1S9WB 4LARL 1UM5L 2ZG1A 1QA9A 4TSBH 5IOPB 2R2EB 3VXNB 4X4MA 3EOAA 1GYAA 3O6FD 4XB8A 4YXHH 4Y16C 4LQFH 3VCLB 4HKJB 2H41A 4IOIA 2WINA 4J3WA 2JK5A 2YPLA 3LMJH 3WFCL 1PZ5A 3FQRA 3HMWH 3T08A 3F7YB 1TXKA 4UINH 5AD0B 3P77A 4AT6A 3FZUC 5DQDH 5B8CB 2MFNA 5KG9B 4ZUUB 4YK4B 5H94A 1WCQA 3MV9A 4O00A 2PW2A 3VFMB 3WE6B 4XVSL 4UDUA 5T33L 1TQBB 5FIEA 1ES0B 2JJTC 4YHYC 4WI5A 1G7LB 1T1YB 2YEZB 1PY4A 4PJ7A 3RVWC 2VDML 2FHCA 4UTBL 3EGSB 2ZCLH 3MLRH 5SX5K 1QBLH 3VWJD 2J4WH 4PIRF 3MUGB 5HHMD 4HQQH 5IB4B 2IPKA 4YXLL 2V2XA 4JY5L 2YWYA 4FQXC 4OLWL 2YHGA 5DMYA 2YPLD 1XF1A 4OT1L 5TF1H 5JOPD 4ZS6C 4KFZC 4K94C 4DCQA 4E9LA 3IJHA 1DBMH 5FCUH 3DUUB 5FGSA 3PP3K 4Y4FA 3P9MB 4R3SB 3RVVD 4LGSB 5DJXA 2IFGA 1CICC 4ZOCA 5T3ZD 1NGZB 5HD8C 1QA9B 1FDLH 3EDDA 3GHBL 2YD3A 3EOAB 3FQWA 1XIWA 4IOIB 4ZFGH 3DJ9A 4Z7UF 1RPQA 1C5BL 1NANH 1FLTX 2JK5B 4YHZH 3G6AA 1PZ5B 3FQRB 2V9RA 1EJ6A 3QDME 3P77B 4AT6B 2DYPA 4E41B 4GT7A 5I17A 5H94B 4I5BA 3MV9B 3HN3A 1Y6MR 4EDWH 2EEAA 2ARJQ 4Y4FD 1X5JA 4UDUB 3HE6A 4NFDA 5FF6A 1L9NA 3FO9A 1CR9L 2B7DT 5AWNH 1BREA 4X80H 5DHVH 4PV8A 4XAWL 2XTJE 2X1QA 4FQHA 5E8OA 2IPKB 4NM4L 3ZKNC 3QDMA 2CO6B 1CGTA 3NH7H 1UWEH 3TBTA 4YHIA 1SBBA 4DCQB 3IJHB 1DEEA 5CINH 1A64A 1JGLH 4P46C 4LSSH 4Y4FB 5EOCH 4GXUM 1KTRL 5EB9A 3H9HA 5ID0A 3BUYA 3HE6D 1UC6A 2DL9A 2HYMA 4B0MM 1PD6A 4KJQC 3UYOD 3K2UL 3FQWB 4MMZC 1XIWB 1YA5A 2WIIA 2X9WA 4HAGA 4LASL 2YK1H 5EBGA 2J1KA 5I1IL 2R39A 1KPRA 3GHEL 3G6AB 1GGUA 3O2DA 4NUJA 4XCFH 2DYPB 4G6AD 4QOKD 1RVFL 5I17B 2P45B 5B38B 4I5BB 1NLBL 3CVHL 3RJQB 4CKVX 1R3IL 3OBAA 5TE6L 5I71B 3UYRL 1JYVA 3HE6B 5FF6B 1ODAA 2WNGA 3FO9B 1JNNL 5B3NA 3QEUA 4C57C 1GXEA 4PV8B 3N0PB 4JN1L 2XTJD 3QAZC 4JM2A 4FQHB 5ALBH 5E8OB 4IJ3B 1ZHBA 2O5XL 3QDMB 4YDIL 2JJWA 2F58L 3GBLA 3TBTB 4YHIB 3BZEA 1DEEB 1QG3A 5D8JL 5MERA 3PHOA 4HXAL 3RUGA 3H9HB 4Y4KD 4XP6L 4WTZG 1KXQE 5ID0B 3BUYB 3KPRE 3BPLC 2DI8A 4YGAB 2GJ6D 2WIIB 2XTJB 4LHUD 2J7LA 4PYGA 3JV0A 4JM2D 1KPRB 2EDQA 3IDYB 3VFUA 4OI8A 5ICZA 3VWKC 3DX6A 1T1ZA 3RWHA 4NUJB 2QJDA 4AL8L 2R15A 5TGBA 2X1PA 3GSXA 3HRZA 3BT2L 3QQ3A 1SEQL 3V0WL 4LSDA 1DDHA 2D7TH 2X6MA 2EYSA 1H9VA 4XZUA 1IAMA 4DUXA 3QG7H 2EC9T 1KB5L 2H1PL 1ND0A 2BHYA 3KPRA 3QEUB 3KPPA 4AH2B 3PABA 4YUEL 1F90L 1X5KA 5IHBA 2PXYD 4EUPB 4HIIA 4JM2B 3V4PL 4XCCH 3CVIH 1ZHBB 2VXUH 5GGTH 2IPTL 4KK6C 4LPYA 2WUBH 3QCVL 4CN1A 1FBIH 3N06B 4KTEH 3BZEB 2APFA 1BJ1H 5MERB 3MRCB 5BZWA 2NY1B 1NEZG 1IAIL 3KNBA 3QIWA 4G7YL 1DQDH 1S78C 5DQJA 4CNIA 1YEKH 4MWFA 3DMMA 5E99H 2F8XC 1DLHA 4X7DC 4UT7H 5C0RL 5ICZB 1RIHL 3DX6B 1T1ZB 3RWHB 1MRFL 5C0GB 3E0GA 5TGBB 5JOEA 1FL6A 3GSXB 3HRZB 2JCCF 1AQDA 4HWNA 5D71L 3QQ3B 4CU8A 1DDHB 4LGRB 4XPBH 4PTUA 4Y5XA 1G0DA 2EYSB 3K74B 3B8YA 4G6FD 3U6RB 2YN5A 4KK8C 1ND0B 4KHXH 3W2DH 3KPRB 3QIWD 3KPPB 3PABB 4TVPL 3ZTJG 4RGOL 3MRNB 3DMMD 1KCKA 3HAEG 2R1YB 4KTDL 1YEGH 3VD3A 3PF2A 2FX9L 3S37L 3RTQA 2W0KA 4ZQKA 1YJDL 3UJIL 5C71A 1Y18B 1MAJA 5BZWB 1SY6A 3P3YA 3LS5L 4FFWC 3LAFA 3QIWB 2DQGH 3D9AH 5GJSH 2GAZA 3P4OA 3NIFF 4LPTA 3LV3A 4DWHA 5DQJB 2BSRB 4CNIB 4LVHC 4CU6A 2E7BA 1MSPA 3DO7A 4AMKH 1FPTL 3TBSA 4MWFB 2PW1A 2NXZC 1GPOL 2XKUA 3U36A 3LD8B 4OSUH 1WK0A 1DLHB 3NA9H 4OGYL 4GAGL 1G7QA 4L3CB 1RUKL 4AEEA 3WUZA 1FL6B 4ZUVA 1AQDB 3RTQD 3MACL 5IROA 1YNLL 3IXAA 4GQ9L 4PTUB 4Y5XB 5I1JL 3O3EA 1PSKL 4UAOC 2AQ1A 4M1CC 4CN4A 4IRJC 3BPOB 4QKXB 2BVQA 5JR1H 4HWZA 4WTZA 5EUKA 3RTQB 4ZQKB 1AGBA 4LAQH 4FQCH 3R0MA 1B2WL 2BY3A 1MFBL 4HT1L 5JZ7D 5BOPA 5AAMA 3EFDL 2FECI 1CXHA 3WNLA 4XPHL 3IKCB 1HNFA 2GAZB 3P4OB 3NAAH 1LO4H 5FOBA 1DUZA 1ZKAA 3R0NA 5DJ8A 3IDJA 5L6YH 4KGJA 3DO7B 2N4IA 1NEUA 5T1MB 3RNQB 2PW1B 1XGYL 5E70A 3U36B 4J3UA 2ICWJ 4HKXA 1T20A 2IANE 4NT6A 1MIEL 3ESUF 1G7QB 4U2ZA 2ZUSA 5ICXA 1AR2A 4DKFH 1W72H 4ZUVB 1VSCA 2CUHA 4M6MH 4FABH 1PLGL 3IXAB 3R8QA 3V5DA 2PYFA 1RZFH 1OAKH 5J6GA 2W0LA 4NO5A 5DVMA 3TNMA 2HFTA 5F7NC 4GRWH 5DDHB 3MLPA 1MJ7H 3CDCA 4OZFH 1AH1A 1N5AA 3ULVH 1KG0A 5BXFA 5CUSL 5EIIA 1G7IA 3I9GH 3NPSB 2IANA 2EDOA 2BVQB 4HWZB 4Q6YA 3ZTNL 4U4BA 1GC1L 3BDYL 1F4YL 3QHZH 3V5HA 1AGBB 2EKJA 2R0KH 4CN6A 1IMHC 5BO1L 1JJUA 2V5MA 3PDGA 4JPKH 4CU7A 3MLWL 3ILQC 1SJHA 4O02L 3FONA 1YYLL 3SJVD 4RRPG 1CDYA 5D1ZC 2J88H 2VDRL 4N8VG 5F3BA 5FOBB 1DUZB 4PGJA 4BK4A 3IDJB 1CGWA 5FYJH 1AFVL 3RZCD 5ABDE 4P48A 5CZXD 1M7DA 1OF2A 2FD6L 3IJSA 4GSDL 2R56H 4TPRL 2W38A 3D2UD 4XWOC 2A0LD 4QNPE 1I9RL 2HT4C 4JGMA 4RFNB 4ZD3H 5ICXB 4GJTB 2EIBA 4NC0B 1NLDL 4Z5RA 3V7AE 1DTUA 4LVOC 4NZJA 1BWMA 4LRNH 5J6GB 4NO5B 3TNMB 5D1XD 3UDWC 5LXGH 3F6LA 3MV7D 5DFVC 3QCUL 4WI9A 4NWTH 1N5AB 1KG0B 1MIML 4F57L 4PP1C 5BXFB 5EIIB 1G7IB 2IANB 3VGAC 1ADQL 3VI3E 4TTGA 3T3ME 1GVIA 2BVPA 4HGMA 5GGQL 1IEHA 1V7NL 4ONFL 1I3GH 5GHWH 3V5HB 3QPXL 4QWWD 1YQ2A 1MFEH 2OL3H 3WNNA 4EDXA 5I15H 1CGSL 1D5IL 1T7VA 1SJHB 1VESA 3FONB 1FZOA 5I8OL 4NBXB 5F3BB 2PF6A 3ARWA 1LO2L 4NN6B 5DVNA 3IDUA 3IDXH 4EI5C 1HQ4A 3SPVA 2DQCH 3JBG7 1OF2B 5CGMA 5GS0C 3IJSB 3SKUD 4YHML 1E6OH 4B5EA 4MVBC 3U7WH 4MSWA 1LEKA 1OARH 4JKPL 4JM4L 4Z5RB 1U3YA 3QRGL 2PO6C 3C2AL 4M48L 2EDWA 5IHUH 4PJIF 4NUGH 1T89C 4KUZH 5EWIL 3HNVH 3UTOA 5I6XB 2XQYK 2J6EA 3QUXC 4WUKH 5I0ZA 4HIXH 1JI2A 4WFFE 3U1SL 2BVPB 4LFHG 3PHQA 2N1KA 4NP4H 3Q3GA 2WK2A 4NRXA 2WWKT 4F7EA 3GMLA 4EDXB 1UA6L 3GIVA 1I1YA 3O8XA 2NZIA 3PWVA 4HV8A 1FZOB 2CK0H 3OKYA 1X5HA 1TNNA 3QCTH 2AK4A 2R0ZH 4MMXC 1HQ4B 3WKMH 3SPVB 3RBGA 3CFEA 4NHCH 3MOAL 3UPAA 1TPXC 4H26A 1MQKL 4ZOEA 1NAKL 5DEFA 1PJ9A 3HAEH 3BUTA 4NSKB 1T0NA 4MSWB 3S36X 2RHEA 1LEKB 4NWUH 2FH6A 1I8IA 2G5BA 3O8XD 4AIOA 5C70A 4D8PA 4XPTL 1U36A 4LKCA 4BH8A 4O4YL 4LVNB 3VGGA 3ZKMD 1RY7B 5TFSL 4ORGA 2AK4D 2WP3T 4OZGF 2W07A 5ESVB 3QDAA 2PR4L 2XN9E 3CMGA 3WSQH 3PHQB 4A6YB 5F7DA 3Q3GB 1OTTC 2LV4A 3CFCL 2YKLL 4NRXB 4WHTA 3V6BR 4QXUH 4N8VA 1RJLA 2NY0B 3EO9L 4F7EB 2NZ9D 3GMLB 4KMQA 2XI9A 3O8XB 3GIVB 1I1YB 3PWVB 2HJFA 3B8SA 4XXCC 4HV8B 5IHLB 2QHRL 4O2FA 2D7QA 4BQBA 1MFCL 3FCTA 3CDGA 2AK4B 3LDBB 5J8OA 3CFEB 5EO9A 2XN9A 1FE8L 4H26B 4XVJL 5A2IH 5E08H 3CDYA 3DECA 2YD1A 5DEFB 2OQJA 4ENED 3NFPA 4U1HA 1BGXL 1O7VA 1DZBA 4EOWL 3X14A 4QYOA 4WW2F 1I8IB 4WU7A 1CL7L 1RZKL 2RBLA 4D8PB 2DM2A 2DLTA 4TUOA 4J2XA 4LKCB 4BH8B 1QBML 2Y6SC 2EDNA 3F5WA 2I9LA 4ORGB 1IAKA 2YA1A 5E2JA 5A2LH 4XRCA 4FHBD 5F7HA 5HSFA 1LO0L 4LRIC 4Q6IA 1T4KA 3M1BA 1KIRA 4HFUH 4RGNC 2ARJA 3LPFA 3JWDH 5F7DB 3GSOA 4UV4L 1LEIA 1NCDH 4L5FH 4N8VB 5TQ0L 1RJLB 2A6KA 1OP9A 4C55A 4TULH 2XWTA 5F9DC 2HJFB 4OTXH 3CCHA 2EC9U 3LEXA 5JDSB 3FCTB 3I02A 4HZLA 3CDGB 4WENB 5EO9B 4Z7NF 3ARDA 5ERWA 4KHTL 2XN9B 5ILTL 4D9LH 3GRWH 1CF8H 4L4TE 3QHFL 3MLUL 2OQJB 3NFPB 3AREC 4U1HB 2UWEF 4QEGA 1DQTA 1CZ8L 1RZJL 4NKOA 3X14B 4PGEA 4QYOB 2BOBA 5HVHC 1G9MH 1CT8A 4WU7B 2YA2A 5GZND 4TUOB 1CWVA 4XP5L 1G6RH 4HMEA 3F5WB 2I9LB 3OB0H 4K3HA 3KLHD 2NXYB 1IAKB 1T22A 5D7JB 4Q6IB 5EO0A 4FFZL 1Q9OB 1T4KB 3M1BB 2ARJB 2EDFA 3GSOB 5CD3A 5LGJA 1LEIB 1RUML 1B6DA 2Z35A 1LD9A 3VXSA 3TPKA 2FIRT 2XWTB 2XZCH 2P7TA 4NGHH 3ZZ1A 1JHLH 1OAXL 1T2JA 3LEXB 5DD3H 4YXKL 3I02B 4HZLB 2AJZA 3GSNL 1OQOA 2WBJA 5I76A 5M7QA 3ARDB 5ERWB 1OY3B 3KPMA 4X7CC 4QY8A 2YZ1A 4Z6AT 1NGWA 2QSCL 3NTCL 4OIIL 1IC4L 2ADFL 3DXAD 4UTAL 1KFAL 1CFSA 5HI5D 3EIFA 4NKOB 3RY4A 2E3VA 2MKLC 2WW8A 3IS0X 2CGRL 2BOBB 1OTUD 1GHFL 3UMTA 1CT8B 3VXSD 4R6UA 3RDTA 4NJAL 4HHAA 2JCCE 5F3HA 2CUIA 5HHXH 4MHHG 3HNTL 5HPOA 1BIIB 4LARH 5KW9L 3S96B 1WQVT 4AM0A 3FTGB 1B9ZA 3BOVA 1KGCE 4JHZA 4L4TB 5EO0B 3L9RB 3WFCH 3LVEA 4L9LC 1CFBA 1DFBL 3JWDC 4F9PA 5CD3B 1WWCA 2Z35B 1LD9B 3WO4C 3VXSB 5ACMA 3O4LD 4NQUA 3U9UA 4QHKJ 4Q7DA 5FKAA 2P7TB 2JCCA 3BDXA 2IBZX 4I3GA 4XVSH 5I9QB 5HYIA 5T33H 5C2BL 3LOWA 1L7IH 2HVKA 4NHUA 3TA3D 2AJZB 2VDMH 4AIXA 1NSNL 2WBJB 1A6TB 3QWOB 4PY7A 5I76B 5HHVH 1QQDA 3NIFE 3OV6A 3KPMB 2VKXA 4YXLH 1NGWB 1TDQA 2EZ0C 2VLRE 4JY5H 4LEXL 4L8DA 1FGVL 4OLWH 4JRYE 4OT1H 4XHJD 1BJ1J 5DMGC 1CFSB 4BFBD 2ZG3A 2XT1B 4RZCA 5CIPA 3SQOL 2D0HA 4WO4A 2DBLL 1G9MC 1CK0H 1MJJA 3RDTB 2H9GB 4HHAB 5F3HB 4MNQE 1WZ1L 5IWLA 4Z76A 3T4AA 1UB5A 4P0DA 4DKAA 3ZMRA 4AM0B 3F7PC 5DVLA 1MFDL 5EA0L 2X2YA 2VLRA 2B20A 4RWYH 5I74B 5DURD 4WTXA 3H2WA 4J3XA 3DYMA 5HI3C 5FKAB 2JCCB 4JAMA 4MNQA 3ZSSA 3L3HB 2F74A 1FIEA 3A67L 5CKAA 2J5LC 4Y16A 1T5WA 4PJGE 2B4CL 1WSST 1YEJL 2EYTA 4PY7B 3X3GL 4X5LA 3U82B 4M93C 4NM4H 4LOUC 5F6HI 1OP3K 4L8DB 1DQQA 43C9A 2VISA 5DURB 3RQ3A 5D7SL 5E5UB 3UC0L 4RZCB 5CIPB 5JTWA 3QP3A 1F4XH 5A3IC 2JJTA 4WO4B 3CH1B 1MJJB 1DJSA 1UH3A 1J5OL 3MJ6A 4Z76B 1TCRA 3MV01 3EUUA 3AY4A 4Y16D 1SJXA 4U3XA 4KRPD 1A6VL 3V6FA 3K2UH 2QLVB 4FQXA 5C1MB 1UYWL 1M6OA 2AP2A 4Y1AE 2VLRB 1FLRL 3GHEH 4ZAKC 4JRYB 5FK9A 1T80A 3MO1A 3N85L 1D5MB 5JO5A 5HJ3A 3WLBA 3TEUA 3TNNA 1RVFH 3RGHA 1NLBH 3L3IA 3CVHH 4LU5L 1OGAE 1R3IH 4JAMB 4MNQB 4U1MB 5TE6H 3ZKQD 1I1AD 5I8CA 5JPNA 3UYRH 2F74B 4Y16B 1AI1L 1T5WB 3ZKXC 1GIGL 4ODHL 4U1JA 4P9ML 3GMRA 2EYTB 1J0HA 1EHNA 4KAQL 4JN1H 3KG5A 4QRUA 5H2BA 4TSAL 1IC5L 4XCYA 1EEYA 1XGQA 43C9B 2C1PA 1DQQB 2O5XH 5TE7H 2VISB 4AJ0A 5MEPA 4PRNB 5F7KC 2YUZA 2F58H 1OLZA 3UBXB 4HIJA 2VZTA 5D8JH 2BNQE 1OGAA 4FQIL 4ZO8A 5FOJA 1EFXA 3Q6GL 1BOGA 3MRHA 4PJGB 4XP6H 4CW1A 1TCRB 4JRWA 2NY4C 4PBXA 1JNLL 3V6FB 4FQXB 4HUMB 1M6OB 5KSUA 1HIML 3MROA 4EIZC 2Y23A 3T2NH 5FK9B 4CGTA 4QTHA 5JO5B 5HJ3B 4XBPA 5CMAA 4P3DA 1EZVY 4AL8H 4K3GA 5DEZA 1MJUL 3WLBB 3CK0L 1I3VA 2BNQA 3BT2H 3MV8D 1SEQH 2CRIA 2BX5A 2VITB 1OGAD 5I8CB 5JPNB 1EFXD 2WBKA 1KB5H 2H1PH 4U1JB 2HT2C 3GMRB 4FMFA 2E9IA 1MCFA 4Q9RL 4Y1AB 5C07E 4ZS7L 3V4PH 1FG9C 4QRUB 5H2BB 2DI7A 1HEZB 1XGQB 2HLFD 1LK2A 5EU3B 2C1PB 2BXYA 2E9WA 3L3GA 4ZFZA 5MEPB 3TFKC 4ZFFA 5FHBL 3EYVA 3MPCA 1G0XA 4MA1B 3RVTD 3CUPA 4HIJB 2PYED 1KN4L 5DEGA 2FDBP 1OGAB 4JJHA 2ADJA 3FN9A 1EFXB 3SDYH 1BOGB 3MRHB 5E4IA 5IVXF 4HPYH 4CW1B 4G7YH 3D39E 4XNMA 4YEEA 3D85D 3SY0A 5T5FH 5L7XL 1S7QA 3E2HB 3HZMB 4U6XA 4URTB 2DM4A 3DUHA 3IS1X 4WFED 5KSUB 3MROB 5M95B 1QFWI 5HI4D 3HLAA 1S7XA 5AZ2L 4QTHB 1Z0NA 3CZJA 1MRFH 4P46B 4XBPB 5CMAB 2CSPA 2XG5A 1R5IA 5IV2A 5FYKE 2BNQB 5D71H 3KYNA 3MLYL 1U41A 3D39A 4LSUL 4OQ1A 1F97A 5IB1A 1I1FB 4TSCH 4WU5A 1QRNA 3FRUA 4HD9A 1BP3B 4OAWA 4PJIA 4TVPH 1ZEAH 4RGOH 4E5XA 5I16A 3VDCA 4IRSD 3VWKA 3UBXI 5JHDE 1A6UL 1JRHH 4KTDH 3L3GB 4ZFZB 3S37H 4JKKA 2NY3D 3EYVB 1VACA 5FM5O 3CUPB 3K3QA 2UYLB 1E28A 5FO7A 3WL9A 4GBXC 5T1DL 1YJDH 3H42L 4IDJL 3UJIH 2APVA 1J18A 5KVDL 2F54E 1VGEL 4FFYL 4HH9A 3D39D 4XNMB 5IB2B 2XFXA 3QAZB 5HHOA 1S7QB 2GJJA 3WFEL 1QRND 4IDLA 1T3FA 5JHDA 5C07B 1O5DT 5E8PA 3VWKD 4JPIA 3NCFB 4NRZA 4P5MA 3HLAB 4OZGE 1S7XB 2VLKE 2OK0L 1J1OL 4QCIA 4GAGH 1RULL 4JPWL 1ZGLA 1RUKH 4JFQB 1R5IB 2DQUL 5IV2B 2F53E 2F54A 1YNLH 3JWOL 4GQ9H 5I1JH 3UAJC 3BPLB 4B7IA 3D39B 1PSKH 1INDL 2XRAL 5IB1B 5F9OH 2QBWA 5EUOF 4D3CH 4WU5B 2EDDA 1QRNB 2F19L 2BVEA 4E5XB 5FGBC 5HHOD 5I16B 2Q6WA 3VWKB 3BKCH 4MDJA 5JHDD 1KBGL 1DBJL 4TVSa 2XTLA 1HWGB 3UPCA 4OZGA 2VLKA 4FXLA 2E6QA 5SWZE 1QBBA 3ARFC 3ZHKA 3UZEA 3AS0A 1VACB 2F53A 3V6OC 1E28B 3WL9B 2P5WD 5AEAA 1MFBH 4S10A 1S78D 1A8JH 1WTGT 2I07A 3EFDH 4MA7L 5JW4M 4HH9B 3QUYC 5HVWA 3LRGA 4K3JL 4XPHH 2XFXB 5FYKU 4KROD 3ZYIA 1QFHA 5JHDB 4L3ED 4PLOB 5E8PB 1XGTA 1XGYH 4JPIB 4ZUWA 3CFJA 4NRZB 2GI7A 4P5MB 5SWZA 3DARA 5KZCD 4RMVA 1EPFA 4QCIB 3KXFE 1ZGLB 3BVNA 3VXMD 1I9EA 1QHOA 4M8VA 2ZPKL 2YD2A 3WIHA 3L5WA 5K9QG 1PLGH 2F54B 2A83A 2UZIL 4P2OC 5MEND 2HT3C 5B3JF 1ZA3A 4WW2A 1UT9A 3V2AR 4LMQE 2E8YA 2P1YA 3MJ9L 4MLSA 2P42B 3HC4L 1T0PB 4G5ZL 2Q6WB 4MDJB 5CGYC 4OZGB 2VLKB 5KZCB 2AABL 4LLQA 4Z7NE 3KXFA 3EW3B 3KAAA 1WITA 4HJJL 1X5XA 1GC1H 2F53B 2KQNA 2L7JA 2C3XA 1D7FA 4J3SA 3B83A 5BO1H 2GTWA 1CDHA 2UWEE 3MLWH 1CDUA 1IRAY 4IRJA 2I07B 4O02H 1YYLH 2VTFA 3PP3H 4P2YA 2C7UA 3KJ4C 2R23B 2YPVL 3HE7C 1AFVH 1XGTB 4M7JL 3AM8C 3F65A 5DUBA 3CFJB 2E9JA 2FD6H 5SWZB 4GSDH 4TPRH 3BEVA 3VA2C 1F11A 1I9RH 2HG5B 3BVNB 4K3DL 1C5CH 1QLFA 1NANI 5JHLL 1NLDH 2UWEA 3L5WB 4WUUE 2A83B 2FJGA 4R4ND 4I8DA 4WW2B 4K2UL 3RIFK 2YD8A 4X7SL 3QCUH 2DM7A 4PJ9C 1MIMH 5E8DL 1A14H 2WUCL 3U9PL 3EYOA 1ADQH 4LLQB 5D9SA 2OTUA 3KXFB 3VFRA 4YZFF 5F7YC 4I77H 3RWDA 5IVNA 4Z78A 5GGQH 1V7NH 2AKRA 4ONFH 1JCKA 2ZUVA 4UAOB 3C2SA 4WUUA 2MQ3A 2GTWB 1CGSH 1D5IH 4IRJB 4N5EC 1MF2L 1HI6A 3FQNB 2BRRL 5I8OH 3IGAA 2C7UB 3OKMA 1DVFC 1LO2H 1MVUA 1N7ML 1CBVH 5L9DL 3K2MC 4KGLA 1EMTL 2VSDA 3BEVB 2F5BL 1F11B 1YPZE 1QLFB 4MAYC 5D1ZA 5D7KE 5JUEL 2FIKA 2UWEB 3SKJL 3NCMA 2FJGB 2HLAA 3QRGH 4YHNA 5MEOA 2J12B 5E6IC 1X6NA 3C2AH 4M48H 5EWIH 2D2OA 1CCZA 4GLRH 2EDBA 1JMXA 4U6VL 3EYOB 5FFLA 5CBAA 3U1SH 2OTUB 3QQ4A 2NW2A 3VFRB 2CR6A 3MBXL 1XF5A 4NZDA 1YPZA 1RK0A 3T2QA 4Z78B 1GC1C 2AKRB 1JYXA 2E5EA 5C3LD 5JLZB 3QEHB 4WUUB 3UDWA 4N8PA 1UA6H 4UOW1 5GZOC 4RFOL 1KCRL 1HI6B 1OW0C 1FAIH 1MCSA 2FO4A 2Y7QA 2ZNWA 3I84A 3OKMB 2DQHL 2D9QB 3O4OC 4W6XB 5CP7A 3ZDXF 1N3NA 1MVUB 2MTPA 5E1AA 3MOAH 1PG7X 3O6ML 3QNYA 4U1SA 2H32A 1MQKH 1E4WL 4JFXA 4JZJC 1NAKH 1PVHA 2ZP0T 4RGMB 4QXWA 4MAUL 1A1MA 5D1ZB 2FIKB 2IAMA 2X70A 5TDOA 1INQA 4YHNB 5MEOB 3U0PA 4HMCA 3NACL 4EI5A 5TDNB 3QQ9C 2BVYA 3U4BL 3UX9B 3P30L 3ARXA 4LP5A 4IMKC 3ILPA 1S7WA 3REWA 5I1CL 2PR4H 3TH3T 4G7VH 3BO8A 4ZYKA 5CBAB 3QQ4B 2NW2B 4HAFA 1YPZB 1RK0B 4LMQI 5DC4B 4OCLC 4LVOB 2PO6A 5HPMA 2YKLH 3Q2CA 4UUJA 5T1LA 5D4QA 3EO9H 3OGCA 1D5BA 1T89A 4TUKH 1SMOA 2IAMD 1WWBX 5CEXB 4HUVA 1EHLL 2Y7QB 2FO4B 2QHRH 4U1KA 3QUXA 1KXVC 5FYJE 3C5ZD 1MFCH 4V2CB 3SDAD 5CP7B 1OVZA 1X7QA 2OJEA 1N3NB 3VGAB 3RIAK 3GSVA 4HIHA 5E1AB 3QNYB 4U1SB 1K8IA 2H32B 4MA8L 1FE8H 2KQMA 1HH9A 4JFXB 4I9WE 4XVJH 4DW2L 1MHCA 3DVNA 4AYFA 4X7TA 1A1MB 4F7PA 5DSCA 4YIQA 3QI9C 1W0VA 3QPQD 4EOWH 5T1LD 4M6AA 2X70B 1KACB 5TDOB 5CEZE 3CZFA 5H8DA 1RZKH 3U0PB 3CFBA 3UO1L 2QADC 4EI5B 4PD4J 4ODUA 1TCMA 2XZQL 1QBMH 2Y4SA 1IT9H 2X10A 5EU5A 2EE3A 4PJHE 4L8SC 2P48B 3ZL4L 3ILPB 2K3TA 1S7WB 3V4VL 1A9EA 3SO3C 3AAZA 3HMXA 3BO8B 1LO0H 5GRUH 1KENH 1VFOA 3PV7A 3P0YL 4F7TA 2PO6B 1S7RA 5HPMB 2YN3A 5TQ0H 5IW1A 4ZPVA 1U3HC 3OGCB 1D5BB 1M7XA 2CMRL 1QNZH 4HUVB 5F7MC 4U1KB 1YECH 2Q7YA 3QUXB 4I4WB 3S35H 4WCYL 1X7QB 1PX4A 2OJEB 3MZGB 3X13A 4HIHB 3EJJX 2C1OA 5ILTH 2R0LL 5A43C 3MRMA 1HH9B 2HTLD 4YDVA 1MHCB 1WZKA 3DVNB 3QHFH 3MLUH 1QVOA 2OZ4L 5DSCB 4YIQB 1RZJH 5BV7L 1GGIL 1W0VB 5BS0D 3EJYC 1FFQA 4FS0A 5CEZD 1ZT4A 3CZFB 3CFBB 2FJHA 4JFHE 3V8OA 4JO4L 1Q72L 3C60C 4DKDC 1NBZA 4ODUB 3JSSA 4FFVD 1KCUL 1TPXB 5DZNA 2Z92A 5EU5B 1X5YA 4KKBC 3T0EC 2HH0L 1NGQL 1J86A 1A9EB 2VDLL 1A7RL 4JQVC 3AAZB 4RGNE 3BRFA 5F7FA 3ULSB 5DO2D 4FFZH 2UVEA 4P2QA 5I73C 1N0LA 3L7EA 4F7TB 1S7RB 2H45A 1RUMH 5DJZB 5IW1B 4ZPVB 4LPUA 3KYKH 4LSPL 1UADC 1U6AL 1TVHA 1KPVA 3LB6C 3H3BC 1OAXH 4RAUA 4LRIA 3QO1A 4PJHB 2UVFA 2Y06L 3MJ8A 5DJCA 2C1OB 2Y36L 5DUPL 1RURL 1WBYA 4M7LL 4YDVB 2QSCH 2XKNB 2BY2A 3NTCH 4OIIH 2GSIA 1IC4H 2ADFH 4CVXB 1AQKL 4P2QD 4HWBL 4UTAH 3F7QA 1KFAH 1QVOB 2ENYA 3CGTA 1I7ZB 1A3RH 1GHFH 1ZT4B 5I19L 1BX2A 5J1TC 2FJHB 1E4XL 3GKZA 3HNTH 1NBZB 5KW9H 3F6IA 4PGDA 2Z92B 5IVXA 1PYWA 1OTSC 2DKUA 5I66A 4OQTA 1XF2A 3UP1A 3BKML 5IG7A 1P5VA 3AMKA 3AREA 4MZ2A 5CS7A 5DHXB 4HGKC 1VFAA 1WVZA 3OKOA 1VEMA 3L7EB 4KJYA 4YHPB 4IOFD 5GISH 2R4SL 3D18A 4HG4J 4CJ1A 4R4FH 3BIBX 3OZ9L 2XA8L 3CU7A 1KPVB 4OLVL 1UACL 5EC1A 4JKWA 4QTIL 5C2BH 4RAUB 4DTGL 4YPJA 5EIVA 1U93A 3ALPA 3MJ8B 1NSNH 4RGNB 3P4MB 1WBYB 5EZLA 1OB1A 1JF6A 3HZYA 4LEXH 4ZFOL 1FGVH 2GSIB 4K55A 3KR3L 3SCMC 1WF5A 4PBVC 1UVQA 2E6PA 1RZJC 1A7NL 4DGVL 4LEOB 4WV1C 1MCOL 3RY6C 3PP4L 1WZ1H 3HB3C 15C8L 1UEYA 5FO9B 2ITDA 3TF7C 3TCXA 1PYWB 5I66B 2D9CA 1XF2B 3HC3H 3STLA 5C0DA 3T0AA 1MFDH 2W9EH 3AREB 4NBZB 5EA0H 2DQIL 1P4IL 2O61A 2C4FU 3RKDC 2X4OA 5HVHB 1GOFA 3OKOB 4KJYB 4FTVD 3TYGH 3CC5A 3IETA 4ZO7A 4YGVB 1BFOA 4N0CC 3D18B 3G9VA 2MPAL 2R8SH 3RWIA 3AXLA 4U1GC 4ZUSA 5GS1A 1GGYA 1VDGA 3K1DA 1P4BL 3STBA 3A67H 4HUUB 5EC1B 1QSZA 4M43L 2B4CH 3ORJA 1U93B 1YEJH 2P8LB 2HP4A 4WFGD 4V2BA 3X3GH 5CCKL 1P84J 2IEPA 4CMMA 4Q97A 3HZYB 1BOYA 4NKMB 2VDKL 4M62L 4ODVH 1NCNA 5D7SH 5ADPL 2HKFH 1UVQB 4R0LC 3BP4A 4N90D 3AC0A 3L3JA 1MLBA 5FUOL 3G08A 1EUUA 1J5OH 1UJ3C 4YH6A 3VXTB 2ITDB 5B3JE 1A6VH 4MQXC 4Y2DC 3STLB 5C0DB 1UYWH 4Y7MA 4M00A 4PGCA 1X5AA 3TCLA 1FLRH 3MLZL 1AXTH 2O61B 2X4OB 3N85H 1CVRA 5ISZE 4MD5A 3CC5B 3IETB 1IBGH 3UJJL 5CJ5A 2BNUB 2YRLA 5FUZL 3CD4A 5C2UB 1GGBL 3AXLB 3VGHA 4ZUSB 4J4PC 1GAFL 5GS1B 5LWYH 1AI1H 1GIGH 1Q1JL 3BHBA 1B4JL 4GG8A 4ODHH 4P9MH 4F37F 2A1WH 3W5MA 4KAQH 2EZ0D 3ZE1F 3CSGA 2MNUA 3MRFA 1IC5H 3UROR 3IDGB 2D7PA 2X44D 3WO4B 5ISZA 2E6JA 2OMBA 3VH8G 5GRWA 2Q8BL 1F6AB 5IJKC 1IGFL 3BP4B 4FQIH 3KLSA 3QIUA 1JZ4A 3WS3B 3Q6GH 3L3JB 1MLBB 2X4SA 3G08B 5D6DA 2AJVL 4LAJH 4PFEA 4YBQD 3VG9C 1N64L 3ZE2F 4ETQA 5HDQL 3DX8B 4XMPL 4YFDB 5CJBA 4HLZH 4KK9C 4YX2L 4M3KB 3MLVL 1JV5A 1I8LC 3QSKB 1HIMH 3TCLB 5HYJE 4UI2A 4YDLC 1II4E 4MD5B 1MJUH 2MMXA 3WUWA 3CK0H 3DPBA 3TO4D 4YZFE 2K7PA 4G3YL 4B50A 2AEWA 2FH8A 3QIUD 1IKFL 2N7BA 3UTSE 1FORL 2YBRB 3BHBB 4GG8B 2B4CC 4ZAKA 1UM4L 1BQHA 4POZC 2X42A 1OAZL 2Y25A 1NAMH 4Q9RH 3NVQA 2V5SA 3IT8D 3FB6B 5HYJA 1U2CA 1U8HA 1H3GA 5ISZB 5FHBH 1SYSA 5DJ0A 3ULUF 3OF6D 1KCSL 3LZFL 4P4KA 1KN4H 2J5LB 1X9QA 1JI1A 3BZFA 5SV4A 3QIUB 3UTSA 2X4SB 4ETQB 5IR1B 5KSAD 3AUVA 2YPKA 3O9WC 4QLRA 1A7BA 1VADA 4M93B 1M05A 5L7XH 4OBSA 4QHNA 3N1FC 3KGRA 5MI0C 2NX5E 1DEDA 4EKXA 1R6VA 4ZXBA 1V5JA 5AZ2H 4BZ2L 4YR6A 4ODSL 3WUWB 1WFNA 3IYLW 4P4KD 1FZMA 4J6RL 4HXBL 4JO2L 4HPOL 3CX2A 1QR4A 5SX4H 2YSSA 3TP4A 1KT2A 2FBJH 5JORA 1E6JL 1F2QA 4ZAKB 1BQHB 3OAUL 1PKOA 4EJ1C 2NX5A 4FG6C 5E03A 1I1CA 2FLBT 2X09A 4RISH 5HYJB 5I1HL 1A6UH 3G5ZA 3VFGL 1U8HB 4TN9A 1NFKA 4ERSL 4ZXBD 1SYSB 5DJ0B 5SV3A 3QDJD 4S0TD 4U1LA 1F3JA 4M3JA 5T1DH 4JDTL 3ZKXB 1BZ9A 1I7UA 2XYCA 3H42H 4IDJH 3BZFB 2J3SA 3HTLX 4O2CA 3UTSB 4WGVB 1WGOA 2G5RA 2WLYA 3O3BA 2YPKB 1VADB 5D70L 2EH7L 1M05B 4V1DE 1OPGH 4U1NA 1WBXA 4MA3A 2BCKA 1VPOL 4KMTL 4ZPTA 2OK0H 1L0XA 1RULH 1MCEA 4YR6B 3T0VA 2BFVH 4POYA 5A2KH 3TJHD 1FZMB 2NY4B 1KC5L 2YSSB 4LLWA 1S9VB 2HT2D 3VFPA 4KQ4L 1KT2B 2XIDA 5JORB 5E56A 2XRAH 1CU4H 4V1DA 2F19H 3QFJE 2NY2C 5KS9E 3VH8A 2NX5B 4M7ZC 4H88L 1I7RA 2XWJA 4OZHF 4WI7A 1KBGH 5I30H 1DBJH 3G5ZB 4C4KT 2Z0BA 4GKZA 2KDGA 3SDCD 1HHKA 4NQDE 4U1LB 4Z7VF 1Y6NR 2OI9B 1T2QH 2PCPA 1BZ9B 5HDBF 1NKRA 1NGPL 1KEMH 4JVWA 4MA7H 1A6PA 4K3JH 1MJ8H 3O3BB 3QFJA 5KS9A 3RAJL 1KLFA 3WJJC 1FJ1A 4GW4A 1K2DA 1WBXB 4Y8DC 3S98A 3LSOA 1DSFL 5FM5M 4GBXA 1QACA 2VZVA 5CP3H 4ZPTB 1FVEA 4PRBA 4U0RC 3AB0C 4NQDA 1KEGL 1F02I 3FQUA 2ERJC 5J06A 4QGTA 2ZPKH 3DO3A 1EBAA 1ZOXA 1W0WB 2UZIH 1HINL 4LLWB 4N1EA 3VFPB 1I4FB 3FMGH 5IBLD 1YNTA 5FM4A 4V1DB 3HC4H 2DDQL 1I7RB 4IMLA 2XWJB 4KRNA 2AABH 2BRQA 3V6OE 3ZDZF 4GKZB 3HR5A 4HJJH 4ALAL 4W6YB 1HHKB 3MGTA 4HKBA 4MXQD 5F97E 2PCPB 3TIDA 5KVGH 4OF5A 4PY8I 3J7HA 5FGBA 5CHNA 5ADOL 3OXSA 1OSZA 4PGBA 3QFJB 5KS9B 3L5HA 1HZHL 5IFAH 1UZ8A 1FJ1B 1U8PA 1X5IA 2YPVH 4GW4B 3ARFA 3LSOB 3SBWC 2ZKHL 4HFWB 4CVUA 4OGXL 4GBXB 1VEPA 2OTWB 3OPZL 1FVEB 4PRBB 4X6BA 4NQDB 2VO5A 1AKJD 4BELD 3K8LA 1BBJA 3FQUB 4TSBL 4K3DH 1KJ2L 3QUYA 3B3IA 4Y4HC 4D0BA 5JHLH 1NCAL 3JWOC 4LQFL 1RIVH 3WXVL 4MB5A 4K2UH 3WD5H 2EDTA 1YNTB 2XNAA 1YY9C 3S5LA 3HMWL 4X7SH 1MWAA 4R97B 4IMLB 4C56D 5E8DH 2WUCH 1JP5A 2QSVA 5CEYA 3T0DA 3B43A 4UOJA 4KV5F 1ZANH 5C09E 4P2OA 1OP3H 1TIUA 4OF7A 2CD0A 3MGTB 4HKBB 1AD0A 5C9JA 4I0PC 1H5BA 3TIDB 3LRSA 1ZAGA 3LEVL 5J1AA 3VFNA 1MF2H 4TNWK 5CHNB 3OXSB 2BRRH 1OSZB 4PGBB 2WSKA 5TF1L 1SMAA 1QRKA 1UZ8B 4ETYA 1U8PB 5DZOA 4RA3A 3ARFB 5LKNA 2Z31C 2P24B 3W11D 5DJ6A 5C09A 1EMTH 1QEWA 4X6BB 2F5BH 3LKPA 1BBJB 4NQXA 3F62A 1FDLL 3DSFL 2EEBA 4P2OD 3QUYB 3B3IB 2ESVA 4D0BB 3GBML 2R0WL 5J7CC 1UENA 5EH1A 1Q9WB 3MOQA 2GY7B 2B0SL 3MCKA 4IM8A 4MNGE 4PJCE 1P7QA 2Z91A 3QDGE 3QXAA 3U0WH 2XNAB 3AM8A 3S5LB 5AYQA 4P9HL 1OWWA 3JV6A 1MWAB 3D1MC 3ARRA 4K3EL 4U6VH 5CEYB 1R0AL 3MBXH 5C09D 2NQCA 3H9YA 4P2OB 3WFBL 1BEYL 1AD0B 1AXSA 5C9JB 1HN1A 1H5BB 1U3ZA 1SM3L 2ESVD 4YHKL 3LRSB 3DROA 1A4JA 1R24A 4P59H 4MNGA 4PJCA 5D7IF 3VFNB 5J1AB 4C59B 2ARWA 1KCRH 2IALA 5EORL 2DQHH 1GOGA 3RHWK 1F3RB 3NH7L 1LNUA 1UWEL 3C6LD 3BMVA 3O45A 4KK5C 3MFGB 1E4WH 1CDIA 1JGLL 4LSSL 4P99A 5DJ6B 5EOCL 1A1OA 5C09B 1QEWB 3LKPB 2LU4A 4MAUH 4NQXB 4CVWA 2W60A 2ESVB 1CLYH 2PETA 2ZUTA 1DVFA 4JREC 3KJ4B 1WEJH 2YK1L 2W1NA 3MCKB 3NACH 1P7QB 2Z91B 3HE7B 3QXAB 5T3ZL 3U4BH 4QRPD 3ARYA 3JV6B 3P30H 4JGJA 3N9GH 5EOTA 3FFCA 1DQJA 3LRHA 3GO1L 3I3DA 5DXWA 1ROWA 1VFBA 3BZDA 1JPTH 3G6JF 2FB4L 4WI8A 1AGCA 4XH2A 4N5ED 3RL1A 5EIQA 4HBCH