2ZSVB

Crystal structure of h-2kb in complex with jhmv epitope s598
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Prevention of cytotoxic T cell escape using a heteroclitic subdominant viral T cell determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zsvB00
3P4NA 4QY8B 4TNWF 1UCBH 1ES0B 4NYLB 5IMOB 4OT1H 1VEPA 3C5JB 3BRDA 1V05A 2AQ2A 1FYTE 4TOYH 5HVHB 5FCUL 1U3HB 3IRPX 4YWGL 4K8RL 4L3CA 2Q6WB 5EZIL 4AMKH 4PLJD 2AW2A 5D71L 4PJ9D 1UH4A 4YX2H 4B41A 1RZKC 3IFPB 2Q76A 2GEEA 1GOHA 4C56E 1EMTH 2VZUA 5HI3D 4LCCB 1TZIA 2HWZL 3ARYA 1CL7I 2FECL 3ORJA 3VXUE 4NO3A 1ZLWK 5TDNB 5DD3L 4PTTB 1KJ3H 5TE7L 3MRKB 5MEND 5FA3A 1S7RB 3Q3GA 3WNKA 1JE6A 1FFRA 3TZVB 1ZE3C 4XAWH 1ZLUK 5I8OH 1RURL 2J5LB 2VH5H 3IGAB 2QSCH 1LNUA 4DOHE 1DL7L 3O8XA 1DBMH 3U2SA 2Y23A 1LO2L 5FUOH 2V5MA 4HGWA 3CK0H 5HGDB 5JQHC 4XWGL 1OTTC 1WZ1H 3D0LA 4M3KB 5IJVA 4QRQB 1WIPA 1Y6NR 5D9SA 5B4MD 5DJZB 4U1IB 1VGKB 4XAKE 5TDOB 4Q0XH 3BZ4A 5IMMB 1NSNL 4QRUA 1BZ7A 3U0PA 1IQWL 1TTGA 3AVEA 5I73B 1QEWA 5DA4A 4ZUTA 3FOLB 2J88H 4D0CA 3S5LG 5L8LB 5EC2B 2J7LA 12E8H 3FQWA 3UJTH 2VZ3A 4P4RB 1ZT7B 4ETQA 1S78C 3GM8A 5E8PA 3QCVL 4XNYL 5IEHB 1IZKA 1UB5A 5F9DC 4EI5B 4D0BA 1X4ZA 2YOCA 1I8LC 1TQCC 5EO9A 1BFSA 2YPLA 4FQCH 1RJYB 2A9NH 4QT5B 5DURD 2QQQA 5C6PB 4IRJB 3RVVD 4GQ9L 1BVKB 2H1PL 4Y19E 1BJ1H 4H1LB 1IMHC 2ESVD 3H0TA 1JNJA 3CMGA 3AS2A 3D3VB 4ODXB 4ZXBA 1DR9A 5HDOA 5KVEH 4LEXH 1IBGL 4XGZB 1LO4L 3MA9L 4PGCA 43C9A 3ULUC 4GLRH 1JGVH 1FYTA 4WUUD 2ADFH 4KJYB 3I6GB 1OM3H 2UWEF 3VD4A 1HH6A 1FNGB 4R90L 5F1KC 3RWJB 4PFEA 1MIML 5IHUL 2F5BL 5F88A 4WU5B 2BVQB 5JXAH 1MJJA 3MJ9A 3SKJH 4NC1C 1NC2A 3HN3A 5KW9H 2OCFD 3DBXA 4OGZA 4LU5L 3KAAA 1D5IL 1RZ7H 5C0AB 3ULVH 1MAKA 4I3RH 2I9LA 2EDBA 3PQYD 1E28B 3KR3H 3VXUA 3JV4B 1T1ZB 4QTHB 1J05B 1KBGL 2A9MH 2ZCHL 2OXGA 3OL2A 5E2WH 2PO6A 3BYTA 3H9HA 2ADIA 3S3SA 5C7XH 2EDEA 1QUNA 3GJFH 5KVFH 1AGEA 2WP3T 3KYKL 3LQZA 5JZ7D 4QOKE 1FV1A 1HKFA 2XYCA 5C9JA 1H3WM 1OSPH 3PHOB 4L3CB 1HXYB 4LASH 3BPLB 5KTEH 3D39E 4JJ5A 5FKAB 4F7PA 2Z35B 2G5BA 3LPGA 4CN6A 5DGQA 1FVEA 4RA3A 2Q76B 4PLKC 5D72L 1JWMA 4NQVA 4L4TD 1JNNH 5T3XD 3LVEA 1H3GA 2HLAA 1TZIB 5ESVA 4PREA 1MFAH 3IETB 3WKML 1GCFA 5ALCL 2B5IC 3MGOB 5H94A 4OQTH 3WBDA 1BJMA 4XBPA 5FO8B 4HGMA 3Q3GB 5C0DA 4XC3H 1BIHA 4PLOB 3NFSH 2ZG1A 2DQIH 3HUJA 2ADJA 2XZAH 1LNUB 1U95A 2GTWA 1IAOA 5T33H 4YE4L 5TE6L 1PEZA 4H8WH 4HGWB 2C26A 1IAIH 2VDRH 3NZHH 4U6XA 4LAJH 3D0LB 1DUZB 4RA0C 3RI5K 4KHXL 5D9SB 3N1PC 4M62L 1I8IB 4PJAA 4MD0B 4FZEL 1EO8L 4XCEB 4Y19A 4MHHG 1A6AA 1U92B 1OP3H 4NP4L 1NLBL 4QRUB 3ARGA 1BZ7B 5CZXC 4NIKB 4G8EA 3FHAA 4JM4L 2J1KA 1CQYA 4HJJH 1PSKL 4LVEA 1E6JH 2V5SA 4D0CB 3V9FA 3LRHA 1W0WA 2KH2B 1I8MB 3T8XA 1KB9K 2YPKB 5EB9A 4PGJA 3NBNA 4G8GE 2CPCA 4KGLA 5J12B 1RZKL 5GGQH 2HTKD 2DLTA 4M6NL 4D0BB 4JVPA 2JB6A 3MRCA 3MLSH 2Z92B 1UZ6E 4HFUH 4ZUWA 5GS2H 5JMOC 3JV5A 2HJKB 4WUKH 5H37G 5HYJD 4R97C 4QOKA 4JREB 2Q8BH 4PGCB 1FYTB 2B1HH 4RMUA 1INDL 2VDPL 4JKLA 5EWIH 4Z6AT 4RISL 5C0BA 1M6OB 3T3PE 2Z31A 3PWJA 3HAEH 5TDPA 1HH6B 5IQ9B 5DUPH 3QQNA 4G6AD 3OJDA 1IC7H 3D39A 4UAOB 5ISZB 4WV1C 3RWFB 2P8PB 1II4E 3VE0A 1D5XA 3QPXL 4KKBC 2NW2A 4UTBL 4F57H 2DJSA 4C56B 2IG2L 3I6LD 1F42A 1RIHL 1YYLH 4KMLB 2I9LB 4ODHL 1L7TL 4ONFH 4OCYL 1F6AA 2VC2L 2PO6B 2O26U 3ZYIA 4MQXD 1AGEB 5GGSY 3SGDI 5BZDA 4DW2H 1RZIB 3U48A 1RUAH 1HHHB 3X3GL 1Z0NA 3FMGL 1PGRB 2N4IA 3EJZC 5I16A 5J06A 5FM5M 4LDOB 2PYED 4IOFC 4B7LA 3GSWB 4JJ5B 5D7KE 5IBUG 3B2VL 2Z91B 3WD5L 5IW6B 1FVEB 2F5AH 3TVMB 4BUHA 1JWMB 4NQVB 4QCIA 4EDWH 4PREB 4I0PC 5KZCD 1M7DB 2DQHH 1RUKL 3ULUL 2A38A 3PG2A 3CIQA 2V7HA 5ERWB 5E08L 4F8TA 1ZLWH 3SDXB 5H94B 2BK8A 5FGBC 1WV7T 3HNSH 5I8CB 4HWEH 4HC1A 4NO5B 1Z9OA 3MLUH 4FXGA 2QV2A 3GSNB 1BREA 1CLYL 2Z4QA 4JFHE 4G8GA 1V7NH 1ZLUH 1IAOB 2F58H 2KZWA 1AGFA 2X4UA 4N0CD 3FB7A 1XGYL 4EBQH 1ORSB 5C86A 4POYA 1A7RH 4Y19B 3WIHA 1WICA 4K23L 7FABL 3ARBA 3Q48A 4LLVB 4X9IA 2E7HA 4P3WA 3HZMB 2CGRL 4NWTL 5EU6E 4RX4D 5EBLB 4D8PA 5DT1L 3SCMC 1T21B 1KN2H 1W0WB 3OKNA 5GGTH 2W60B 3QXAB 4MMZC 2WWKT 3MV7A 5KN5A 5DEGB 1UYWH 4KTDH 2LU3A 2FHCA 5FKPB 3BP5B 3BW9A 3MRCB 1A9BB 5M95B 1TTFA 2IAMC 3ULVE 1YYMH 5FYLH 2UZYB 2AJSH 2VUOA 2BNUA 1UT9A 3AY4C 3PHQB 3S34H 3CVHL 3A6BH 3QDGE 3MBEA 32C2A 1NKRA 1UB6A 3SE9L 2EDTA 3PWJB 5GPRA 4JGUA 1CD0A 3UBXI 3G6JE 4ZUUA 1OW0C 3AGVA 2NLJA 1F2QA 4RFEA 1UXSA 3OR6A 4PRBA 5DVNA 1FZJA 1T04B 3AB0C 3EGSB 1D5XB 1P7KA 1J88A 2HKFH 3CFCH 1CT8A 1A3RH 3SDCD 5FUZH 4XZUA 3O9WD 3PWLA 1I9RH 2H32B 4XX1G 3GMQA 4XNXL 5F9WB 5F7YC 5A2IH 3CC5B 4XVUC 2OJEB 3CCHA 1BQHG 2AGJL 4RWHA 3JTSA 5JDJA 5BZDB 3CFBA 5D93B 2W59A 3DI2B 4J6RL 1K4CB 1IGMH 2YRZA 2XKUA 5CJ8A 5FXCH 3UPRA 4NRYA 1UM5L 3VW3L 5IOPB 4P2OA 2B0SH 4FFVC 4PJ5E 2CDEA 5DQ9A 3HC3H 4Z5RA 4ZTPH 4X80L 3FO0L 3F6LA 4QGTA 2AI0H 3CLFH 2V9TA 5F3HB 4PV8A 3DX8B 2C5DC 3FN3A 4FXLA 1KPVA 5I1IH 2JJSA 3CVIL 3G04B 1BGXL 3PWVA 4KXZH 4NCC1 4NKQB 1U8LA 4LGPB 3UCRA 5IEKA 2FWOA 4M7LT 4DK6A 1MHCA 1B4JH 5EU6A 1ZHBA 3RVUC 4HXAH 4OCXH 4KJWC 5I1EL 1MCIA 4YDLC 1CK0H 5GRXG 3OMZA 4EDXB 4TVPD 3ARRA 2AABH 1MFDH 3MR9A 4MD5A 3Q6GH 3RWHB 4XVTL 1AGFB 3ECBB 2X4UB 4KPHL 4KZEL 5IW1A 3MLTA 4HWNA 1B4RA 5FCUH 4YWGH 3ARBB 3AU1A 4K8RH 3GJFA 3QDGA 3GSOB 5EZIH 1NAML 1P1ZA 2EDYA 1NDMA 4ORGA 4L3EA 5D71H 5IESL 2GJZA 4D8PB 4PJBF 3ULSA 3D2UD 5E24E 3KS0J 3RWEA 3FB8B 1JK8B 4KRPB 2DYPB 5F7EL 3WEXB 3F7VA 4WWKC 4F7TA 5IHZA 2I9TA 3VXNB 5DD3H 4PJFE 1ZHKB 3IJHA 4AM0B 1XCTA 5E8OA 5TE7H 5I1LA 3CXDL 4HAGA 4KKLD 1HYSD 1MWAB 2P45B 2AQ1A 1MY5A 2BNUB 4UIMA 3N1FC 3O3EA 5FYJD 2C3GA 4MCYB 1RURH 4OQTA 1N64L 1JYNA 3QPQD 1DL7H 4XBGA 4OCLC 4YR6B 4Y8AA 3EHBC 1LO2H 1GOFA 4MNGE 2H2PD 2E5EA 4EIGB 4NUGL 4XWGH 3E8UL 5L2JB 1W72L 4P5KA 4WEBL 4Z0XA 3TPUA 1UG9A 3QIWD 5CJOL 3OR6B 1C5DA 1FZJB 3KLSA 4G5ZH 1BZQK 2NXYB 4PJ5A 1NSNH 3LKPA 5H2BB 1CT8B 2ITDB 3IYLW 3NFNA 1IQWH 3S37L 3WFHA 3C6SA 3QFJD 4OZGE 3ZE1F 4F2MA 1ONQA 1YN7B 3TNMA 4JZOA 1OTSC 2EIZB 5L2KE 2BC4A 1KB5L 3MV8E 5T1LD 2PW1A 5DHXB 3EIFA 3JTSB 3QCVH 4XNYH 4PRPE 2WBJC 3WFZA 4JANA 4Q2ZB 2YUVA 3IAPA 3IXTB 2I27N 3FT2B 3T0BA 5ADOL 3IFLL 1VA9A 3DRTA 3RTQC 4NRYB 5E6YA 3WYRA 5E2UL 1G84A 3SJVE 4NQXB 4GQ9H 2H1PH 1GPOL 5ICXA 3WLBA 1AIFA 2OR7A 5DQ9B 2CDEB 1G1YA 3JWOL 4MJID 1IBGH 1LO4H 2NTSP 3BZFA 3MA9H 5CGTA 5T5NG 4PV8B 4JB9L 3I9GL 5HYFA 4E41D 5MP6L 3OKDB 4FQIL 1NFKA 1VB9A 2JIXA 4K7PY 1RQ5A 1U8LB 4R90H 3QEQE 2MNUA 1MIMH 5IHUH 2F5BH 1PG7W 1OLLA 2W07A 1G0DA 1MHCB 4PJXB 5EU6B 2APVA 3HAEA 4PJGA 3IDXL 3U0WL 3UC0L 4GRWH 4LU5H 1TQBC 3U1SL 5C08D 1D5IH 5INDB 5JOPE 1ZLVH 1YEKL 5HHMD 3MR9B 3BISA 4MD5B 5EZJB 3RGVC 2H3NA 4TNVF 2KUTA 5GS0C 2ZCHH 1KBGH 1NMCB 4U1JB 4PJFA 2D0GA 4JPVL 4O2EB 5HGHA 5C0ND 3L3HA 3KYKH 4UQ2A 1Q38A 1NLDL 5FYLE 1SJHA 2PF6A 4F7EA 3VWJA 4J3SA 3KLAA 3WNPA 2IPKA 1K2DB 3P40A 3QDGB 3BIAX 4LMQI 3ZL4L 3D25B 4ORGB 3RIFF 2YN5A 3FQTB 5AAMA 4MNGA 1I1AD 1WWCA 4NN6C 5KG9A 4F7MA 1J1PL 4PLJC 1KELL 4PJ9C 2IADA 3G6JB 5D1QA 5D72H 5CEYA 3RWEB 5DD6B 2JELL 2JJVA 5MHSE 1FL3A 1CVRA 3BH8A 3E2HC 3S37X 3WKMH 2QTEA 1SMOA 4ERSL 5IM7A 3UTSB 3QR2A 1HHGA 3SHSA 4OZGA 1H8SA 2BSTA 4U1MA 1OHQA 2ZUTA 5FO9B 2D7MA 2W65B 2XZQL 1J87A 1V8HA 2DQEL 2CR6A 5TPWL 4F9LA 3MV8A 1CL7L 3T4YA 2BMKB 3MJGX 2BHYA 4J3XA 4QHMA 4PRPA 5GGRB 3RKPA 4JZJA 4HUWB 4YE4H 5TE6H 4ELME 3QULB 1JV5A 5DFWH 3KPNA 3TPUB 3UTPE 4KHXH 1OAQL 2PW2A 4M62H 3DURA 4WFHD 3SJVA 4FZEH 1EO8H 2WUCL 3MFFB 4K71B 5T1MA 4RMSA 3FFCD 3VFUB 5B4MC 4NKMA 4NP4H 1NLBH 5I74C 4N0UE 4LF3B 2OL3L 1U91A 3NFNB 3C6SB 4JM4H 1KTLA 1EBPA 1PSKH 2WLYA 4EN3A 4F2MB 1ONQB 3MSPA 3KYOA 4XI5D 3BPCA 4KC3B 5IGXL 1K3ZA 1RZKH 4DKFL 5DJYA 2V9QA 1RUPL 2R2HA 2D7PA 3VI4E 4M6NH 1FNFA 2CK2A 5GGTA 3K46A 4EJ1C 4NN7B 1EHLL 2XQYG 1DP0A 2AK4E 1F6LL 4WEMB 4U6HA 2OXHA 5ICXB 2E7MA 3WLBB 5EIIA 1I9IL 1AIFB 3RVVC 4QRSA 3TA3A 4WO4A 4WW2F 4MQSB 4LVHC 3BQUD 5JW4Q 3SDAA 1INDH 4U0RB 2VDPH 2QSTA 3MRNB 1J0IA 4RISH 3LRSA 3VXTB 3O0RL 1FLTX 2ZUUA 4M7ZC 2X70B 4L9LB 2GSIB 3LPFA 1ZMYA 3O6LH 3AS1A 2KQMA 4D9QD 1FFNA 4RNRA 5J0BA 3HUJF 3QPXH 3MRGB 2DB8A 4UTBH 2IG2H 1RIHH 4ODHH 2MCPL 3GUTB 1L7TH 3UTTD 2VE6A 4LRIA 4OCYH 1JGLL 1S5HB 2VC2H 4OZ4B 2VAAB 5KANG 2KBGA 1H5BC 4PJAF 3O3DB 3T65B 2EZ0D 4GG8A 3LQMA 4F7EB 3O3BA 2FX7L 3VWJB 5JZ7C 3STZA 5DJDA 3SPVA 3X3GH 4FABL 3FMGH 1UCTA 2AXFA 2ZUVA 2X6MA 3OKOB 1MFNA 4LL9A 4M7JL 2R23B 1JTTA 2Y6SD 4OFYD 1GGUA 3TC9A 4ELMA 2MJWA 1G0YR 4G42A 1KEGL 2A0LD 3B2VH 3WD5H 3X13A 3D48R 4F7MB 2WNGA 4IJ3C 3RVWD 4PJIF 4R4FL 4G6FB 2MMXA 2ADGB 5IVXE 1FL3B 4PJ8D 2KZ1B 2K1MA 5E6ID 1KN4L 1UJ3C 1RUKH 3ULUH 5B3JE 3HG1E 2IH1A 4N0UA 1IM3A 5D1XA 4L8BB 5AG8A 5E08H 2FZ3A 5IM7B 2ATKA 3FO9A 4OZGB 3OJMB 1INEL 3O4LB 5E56A 1WT5C 3RNKA 4U1MB 1G7IA 5HXMA 5L2KB 5DA0B 4F7CA 1JIBA 2ED8A 4JFEB 1WBZA 1CLYH 3T4YB 4YZFE 2XRAL 4XPGL 4PRPB 5T3ZD 2HJFA 4Y5VC 3HI1A 1GH7A 5DUBB 5BW7C 1EAPB 3MJ8A 4PJEB 2AK4A 1XGYH 2GSGB 3VG9B 5CS7A 3T3MF 3DURB 5EBWA 5A3IC 3SJVB 2ERJB 4F37K 3W2DL 1XIWA 5IB4B 3CSBA 5T1MB 1MLBB 4K23H 7FABH 4NKMB 4WTXA 2VL5B 5C09E 4JQVA 1U91B 2CGRH 4NWTH 5I1KL 3MPCA 3O41A 1KTLB 4WTZG 5BXFB 2VABB 4LHJB 2Z93B 2A83A 4P2QB 4EN3B 5DT1H 4UBDC 3ZDZE 3KYOB 3QEQB 3T04D 3BPCB 1AXSB 5KSAA 2VYRE 4HS8L 1ZOXA 2HN7A 2XI9A 5DJYB 1FH5L 1YEEL 4GRWE 2RAMA 3MFGB 3CU7A 1S7UA 2HTKC 4ZSOE 4CVXA 4U6HB 4KKNA 5CKAA 1NGXA 4JQXA 1GJIA 4U1HB 1A6ZB 3QEUA 4JQIL 2V9RA 3VCLA 4S1RL 3DLQR 2DL2A 5JDSA 1T1YA 5BS0B 3NA4A 1YY8B 3CVHH 1I85A 5F6HI 4ZNCD 4X99A 4WHDA 4Z7WE 3SE9H 3LRSB 1SYVA 3V8OA 3O8XD 4LCWA 5HHOE 5DK2A 4ZODA 2BXYA 3S36X 4LHUB 2ED7A 3RHWF 4YPGB 2VDOL 1XCQA 3LN4B 1DQJB 4H5SA 1FFNB 1QG3A 4CMMB 3VRJB 4AEHL 3C8HA 3UTZA 5IB2B 4DQOL 3W11D 4P46A 4YK4B 2P46B 3GMRB 5IVXA 1BQLL 3PV7A 2YD3A 4UT7L 3SDYL 1SHMA 2WIMA 2VXQL 4IOIA 5DVKA 4FP8L 4ELKA 4XNXH 4KDTA 1QD0A 3LEYL 1RZ8A 3WS6C 5I1CL 1UVQA 3GNML 1U8QB 4JRYA 3EFFA 1LD9B 2AGJH 4FZ8L 4NQED 4ZMAT 1TVDA 2GUOB 1C08B 1T0NA 3OAZK 3F62A 4NQUA 4J6RH 4HWZA 4UDTA 3K0WA 5ANMA 4XRCB 1A1OA 4CL7A 2CLZB 2XN9E 1E0OB 1UM5H 3LKRB 3VW3H 1YMME 4KVNL 4ELMB 3EYUL 5JHLL 2R4SL 1S7WA 5E5RB 5C0CE 1IGYA 3JVGC 1H0DB 4X80H 3FO0H 1UZ8B 2AVGA 1ZWIA 1PLGL 5DTFB 4ZXBD 4GKNA 4LLYA 5I1HL 5GJTL 2ICWB 5HY9A 5K9OB 3BESR 3CVIH 4LLWA 1BGXH 4XXCC 2Y7QA 3A6OA 5FYKD 5C09A 1MJUL 3GSUA 1QFWI 2WANA 3TF7C 2ATKB 1IC5L 2D3VA 1MQ8A 2FO4A 2GJ6A 3G5XB 4AY0A 3GEWB 1QLRB 5I1EH 3RIAK 3RNKB 3FT4A 5HGAB 4LLMA 1CG9B 4JR9L 1NC2D 1D5ZA 4KV5F 2BX5A 1CBVL 2HJFB 3T0AA 3DX9B 4LLQB 4XVTH 3TBYA 5F7DA 5KVGL 4D9LL 1FN4B 4KPHH 5F97E 4ZSOA 4KZEH 4PG9B 5FGSA 3FB5A 5DXWA 4N0CC 5EBWB 5HDLA 4JFZL 4JFOA 2DWDA 5EUOA 3IS0X 5JUEL 3G5VA 4Z7UB 2ZUQB 1Q8MA 4KFZC 1TJGL 1IAMA 2IALA 3B83A 3FAXA 1KCKA 4P4KA 1NAMH 2NY6D 4Z7WA 3ETBF 3NN8B 3O41B 4LPXA 5IESH 1FG2A 4F3FA 4GRLB 5HHOA 5DD0L 4BQCA 5I66B 5K59E 1R3KB 5KSAB 4HIXL 5I9QB 5F7EH 2HN7B 2FEEI 4H1LG 4LLDA 2P8MB 4NUJB 5KS9F 3QRGL 3HMXA 3CXDH 1T1WB 2Y1VA 1AGDB 1TNMA 3L3JA 1P7QB 1EEYA 2JE8A 3OXRB 3T09A 3QEUB 4Y2OA 4P23B 2EDXA 3W9EA 2GKIA 2K9UA 5JDSB 1I7UA 4GKOA 1T1YB 1X5KA 1AP2A 1N64H 2Z0BA 4NBYB 5FGRA 4TRPL 4U31A 4WHYH 2WBWB 3O45A 1DANU 3HRPA 1AR1D 2YN3A 3BI9X 4WNQA 1SYVB 4NUGH 4JDZA 3E8UH 3N1MC 1W72H 1JI2A 1A8JH 4WEBH 5DK2B 5FM8A 5EZLA 1NUNB 2XN9A 2SEBA 1X3DA 2HVKA 1YMMA 2DTSA 4J8RA 5CJOH 3BP7B 3TN0B 3HPLB 3IDJA 3QI9D 5EO1A 5C0CA 5GS1A 1CTOA 1S8DB 1A6WL 5DJCA 3S37H 1YQVL 4HUUB 1WIUA 4XNUL 3ESUF 3P9WB 3ULUE 3BVNA 3HG1B 4WW1B 1KB5H 4Z0BL 5DC9B 2HT3D 4PGZA 5T5FL 4OUOA 5JIKA 3P4MA 4U3CA 1T0NB 1FORL 4HWZB 3MUZ1 3GIVB 4MCZA 5ADOH 3IFLH 4J23A 3VMOA 5E2UH 2VQUA 4X0KA 5FF6A 1FFPB 2VUYA 3DTXA 1GPOH 3DWTA 3VWKD 3F7PC 1A7PL 5GSRB 3BWAB 3JWOH 3OV6A 3DECA 3I9GH 2UV3A 5MP6H 4FQIH 4LLYB 4E5XA 5BMFL 1HINL 3GB7B 5H35A 1IILE 1T6WA 3RKDC 5J7CC 3P73B 1NFDF 1A4KB 4S1DD 5C0BD 3GSUB 1VENA 1GGBL 2A74A 4ENED 1INQA 4U2YA 4PGBB 5IK3A 4P3DA 4ZO6A 1G7JB 1BQUA 2LV4A 3UC0H 5JORA 3U0WH 5FB8B 3U1SH 1QBAA 2RFXA 1YEKH 43CAA 4OZFH 1D5ZB 9CGTA 1CDGA 3SKNB 1UC6A 3FQNB 3IFNL 1MH5A 5F7DB 5J6HB 4GRWB 4JPVH 1ULVA 3D18A 4U6YA 1XGTB 4J3OC 4QRRE 4JGJA 4ZSOB 1Z0MA 1MCQA 5EULV 1K5NA 1NLDH 4PJCF 5ID0B 4APQA 4M8VA 1WFTA 4OD1L 3G5VB 5IR1A 2XY2A 4OIAA 4XBEL 3FB6A 3ZL4H 3H9SB 2F74B 1MNUL 4C55A 3BO8A 1VFUA 1J1PH 1KELH 5DMKA 3D85D 5E4EB 2JELH 1JRHI 1I8LA 3OSKA 3GJEA 2BRQA 2NZIA 4LLUA 4W70A 5DJ2A 3MMEA 5T1KB 4ERSH 3W39B 4U1GC 1QFOA 3QUXA 3BGMB 3PL6B 1DBJL 2NR6D 2CUHA 4KKLC 1ORQB 2UUDH 2XZQH 3EFDL 3W9EB 1QSFA 2DQEH 5TPWH 1I7UB 4MZ3A 3CUPA 1SBBA 1CL7H 1AP2B 1D7FA 4HQQL 4M93B 1U8NA 2AJZA 1HE7A 3MRRB 3O45B 4L8SB 4CADA 3QPQC 8FABB 2IBZX 4JDZB 5B8CC 4XVJL 5AEAA 5EZLB 2H2PC 2SEBB 1OAQH 4Y5XC 2HVKB 3T0VA 3MNVA 2WUCH 4PJGF 3QIWC 2E27L 3ZE0E 1LP9E 1VCAA 4MHHI 2OL3H 2QSQA 1VACA 4G9FD 1TVHA 1IKNC 1WZMA 3LV3B 1SEQH 5E99L 4LAQL 3DX6B 5IIEA 1YEDA 2EYSB 3BVNB 3KS0H 2BVOA 3V5HB 1U2CA 2HTLC 1T5XB 1QA9A 1GGIL 4PS4L 1NDGB 1SQ2N 2A2QT 5IGXH 4X5LA 4DKFH 2OS7A 3GMLB 1EK3A 1RUPH 4Y4KC 2OSLB 1EHLH 1N2RA 3MV7D 3OAZH 4MCZB 4HFWA 1X6NA 4DKEL 4N1EA 3VFOA 4NKOA 3P0YL 1XGPA 5FF6B 1S5IL 1H3UA 3CXHJ 3DUUA 1OGAB 1I9IH 1BF8A 1KENL 4QRRA 2IAND 3MGTB 3F5WB 1B90A 4Z7VE 4M7KL 4CW1B 3GIZL 1H9VA 2OZ4A 1AKJA 3L3GA 3MBED 3O0RH 2X10A 4Q9BA 3CVHA 2GQHA 3OGOE 2ZSWA 2VITA 1INQB 5K9QG 5E1HB 1CD8A 4P3DB 2P48B 5JORB 3B9KD 3NGBC 1WC7A 4I77L 3PHSA 1U8KA 5GSVB 1CDIA 3LOWA 1MPAL 2MCPH 1JZ2A 2P7TA 3KXFB 1CGUA 1JGLH 5BRZB 1ED3A 2K7QA 1ITBB 1NCDL 4V2CB 1JF1B 2ZOKA 3CFDB 3ARTA 4RRPG 3GSXB 2EH8L 5C0NC 3VFWB 2FX7H 4BFIB 1HI6B 4FABH 2MQCA 3UMTA 3TBWA 3P9LA 4ODWB 1MY7A 5CD3A 4M7JH 3RAJL 1FFQA 1F97A 5ICYB 1KEGH 5IMKB 4QXWA 4LP5A 3U36B 3EJYD 4P2OD 5F7WC 2X09A 3EAKA 1I1AC 3CSGA 4R4FH 3CFIC 2VXSL 3T08A 4OKVB 1TQCB 4GAYA 1KN4H 1CFSB 1LP9A 1BBDL 3MMEB 5AZ2L 2F53A 5ETUA 2DI9A 1CDHA 1YC8A 1INEH 2RBLA 2KPNA 4YO0B 2AK1L 1CDUA 3S97C 3VXOB 4I8DA 2BSRB 3SO3C 3K4DA 4ZUVB 2XRAH 3RJQB 1U8NB 4XPGH 4PGEA 1T2JA 4IRSC 1F4HA 4CADB 1F4XL 4L5FL 3CDGA 4WV1A 5D1ZA 4TVPL 5D6CA 3EOAA 5D5ME 3MNVB 1Q9OA 3MUGA 3W2DH 5CSBA 5D2NC 3TYGL 4NO2A 4WRLA 4GBXD 1ZHLB 4ONGL 3HS0A 2VLLA 5D7JA 4U05A 3WJJA 5I1KH 5D7LE 1F3RB 4NKDA 4Z7VA 3FN9A 4U1NA 2ITCA 1F11B 3IDYC 2GJJA 1EFXA 4YDVB 4L3ED 4X4XA 4OV5A 3I84A 3QNZA 1ACZA 3MJ7B 1NAMA 1RIUL 2F9BT 2E7BA 4HS8H 4UT6L 4XI5C 4X4ME 3QYCA 1FH5H 3EW3B 3FRPA 1YEEH 4OD3L 4C58B 2NY0B 3IJSA 5E00A 3DRQA 3VFOB 1Z3GL 1AO7E 3FQRA 2YUXA 4JQIH 1XGPB 4S1RH 4OFDA 4I0PA 4MA8L 4QRRB 2RCSL 1WBXA 3ARFC 3MJ6A 3CX2A 3H2WA 2B5IB 2R2EA 3FKUS 3UP1A 1KTDA 4YHLL 1AKJB 1LE9A 1TVBA 3BQUC 5FYJL 1MCCA 1U41A 4NQDE 3CVHB 4OCMC 3L7FB 1QLFB 1B6DA 2VITB 2CH8A 2VDOH 3QB7C 4Y4FC 2XXMB 1WISA 4F58L 4AEHH 1BAFL 1NC4D 1W72A 3BUYA 4DQOH 1BQLH 1U8KB 4UT7H 3SDYH 5C0JA 4A2LA 2A1WL 3JWDL 1T03L 4FQ2L 2VXQH 1QR1B 3MRMB 3NFPA 4FP8H 3D9AL 2DLIA 2YD8A 5CJXC 3LEYH 5I1CH 5DI8A 4LOUD 5LWYL 5DJ6A 3GNMH 4FZ8H 3MLPA 1XF5A 2FYYA 3MREA 1DDHB 5JW5B 4FQ1L 5HVFB 1KB5A 1BIIB 2EZ0C 3F12B 4JHZA 1MHHB 3PGCB 2AKRA 4KK6D 3BD3A 4ETYA 4KVNH 3VFSA 3OPZL 2X4TA 3EYUH 5JHLH 2R4SH 3EJJX 2Y6SC 3SGDH 4QEGA 2I26N 1RK0B 4PR5B 4OGAD 2A0LC 3TO2A 1EEZA 1PDKA 5D5MA 1PLGH 2IAMA 4OZIE 4KHTH 5I1HH 1E4KC 5GJTH 2V7NA 3MOQA 1LP9B 4S2SB 3F7QA 4PJ8C 1JWUB 1TPXC 1Y0LA 1MJUH 1FO0B 5D7LA 3MYJA 5ETUB 1IC5H 1IM9D 1S7SA 5CEZD 4N8VB 4K7PL 1IAIM 4R97B 4X98A 2YMXL 5C0EB 3BGFC 3KDMB 3GMOB 4L8DB 4JR9H 3SGEI 5JIIA 4X7SL 2Y9RT 3TCXA 1CBVH 1NUDA 1OW0A 4X4MA 1UEMA 4PJ7E 5DFVD 5KVGH 3HKFA 4D9LH 3CDGB 4WV1B 5JHDE 1UWGL 5IB3A 4OZFA 1P2CA 2EKJA 1AO7A 4CJ1A 1N5YL 3IAQA 4JFZH 2AXGB 1Q9OB 1YNLL 5JUEH 4NO2B 3T0EE 3IRZA 1CTNA 4DTGL 2VR9A 2VLLB 1TJGH 4OLXL 1WWAX 4NKDB 3GDBA 1FJ1A 3VRLE 2FH6A 2ITCB 1FIEA 3T0WA 4NQDA 1MI5B 3QNZB 5DD0H 1NAMB 3QUMB 5MEQB 3FO2A 1Q0XL 4LCIH 1OP5H 4A2MA 5A2FA 4HIXH 5D1QD 3WFCL 4ODBD 4XWOD 4LRNL 3QRGH 3K8MA 3IJSB 2ZCLL 1T7YA 1TLKA 2ARWA 2PXYD 3WDHA 4ZQKB 4LSSL 4I0PB 4Q9CA 1MUJA 1S9VA 4NGHL 5I1DA 2YD7A 3ARDD 3EO1A 3WL9A 4TRPH 3MV8D 2R2EB 4P49A 1R3LA 4Y4HD 2OYPA 3LEXA 3X3FL 2VZ1A 3AS3A 2DQUL 4ZFGL 5SWSD 1JYVA 3G5YA 1KYOJ 3MRPB 3O8XC 4UNTA 3D69A 5MERA 5F9JA 3T2QA 2R1YB 1A1NB 2ZSVA 1W72B 5I17A 4NFBA 3WFBL 4BSJA 1A6WH 1YQVH 1LILA 2DM7A 2DQFA 4OZIA 4XNUH 1JWSB 1KOAA 3O11A 4JO4L 3NFPB 4X6FB 2IF7A 2M26A 1MCPL 1JZ6A 4YIQB 4H0IA 4BSWA 2OL3A 3TH3T 4K7PX 4Z0BH 2EKSB 3WIIL 3VA2C 5AWNL 4JLRA 1D9KD 3QIUA 5T5FH 2XA8L 1L4IA 1W8NA 2B20A 1AGCB 5EUOF 1FORH 2IJ0C 4PUBL 5DMIL 1R3HB 4OLVL 1KB5B 4IBLT 3RL2B 3SCMB 5F1IA 5IP4A 2NY4D 4LNVA 1EJOL 4GUPA 3VFSB 1FNLA 1NMAL 2X4TB 2H2SD 4PJ7A 1JN6B 1AQDB 3QWRA 1T20A 1A7PH 5JHDA 2DKSA 3RDTA 3TO2B 1EEZB 2IAMB 3FFDB 4NNPL 4WO4D 4ZFZA 3TA3D 5BMFH 3T0EA 5BCAA 4ZXBC 5EU7E 1I7ZB 1GGBH 4R96B 1K3IA 1AGBB 5LCVL 2V5RA 1RHHB 3X14B 3TWCL 2CIIB 1ZA3B 3S6CA 4X9HA 5D6DA 5EOQL 1S7QA 4GFTB 3VFRA 3UYRL 1ROWA 3VGBA 3B5GA 2W0PA 1QFWL 3SOBL 5D70L 1B0GA 1KF9B 4J4PD 3AB0B 1BBJA 4NQSA 5IB3B 1OP9A 2D7OA 1ND0B 2YC1B 5KBNC 4WI9A 3DX7A 1KJ2L 2C4FT 3KPQA 3CDYA 2PYFA 3WE6B 1U58B 4P2YA 4OD1H 3H9YA 2X7LB 2VERN 7CGTA 3DVNB 3CXHK 4XBEH 3NCJL 4XT1C 3G6AA 4WJ5B 2VKXA 3QNYA 1KPUA 1FJ1B 1MNUH 1IFHL 3QO1A 2NY6C 1OSZA 3MOBL 3D87B 3BEWA 1GGTA 3C5SA 4ZFOL 4MGXA 3C5ZD 4JPKL 1BQSA 2R39A 1NANI 4QXTA 4Z76B 4L4VD 3WHXB 2OM5A 1H15B 4IRZL 5D1XD 1G7PA 2HFGL 3LKSA 1WAAF 4HULB 1DBJH 3HB3D 2DLFL 2X9WA 3EFDH 5CBEA 1CS6A 3QUZD 2F19L 4AJ0A 2DL9A 2FEEL 4HQQH 3TBSA 4FQHA 1WBYA 3L3DA 3VMPA 5KSBE 2Q20A 1LEIA 3LEXB 4TYUA 5DS8B 2WIIA 4Y16D 1JP5A 4PIRF 5DK0B 3BXNA 1AR1C 4XVJH 5CLTA 3SO5A 3IDUA 3SDDA 5DDHB 4YDLB 4JY4A 2IH3B 4TULL 5T3ZL 2EH7L 1AJ7L 1G7QB 4KVCL 5MERB 4AIZA 4R2GD 5F9JB 15C8L 3Q6FB 3KPOA 2E27H 5EU5A 2ZSVB 4A6YL 2FRGP 1YNTA 3K80A 4GQPH 3QI9C 1SJVA 1O0VA 2DQFB 5E99H 4OZIB 3CJJA 3NZ8B 4LAQH 4Z7QE 3O11B 2ZPKL 4LBEB 2ESVE 3ARGC 2X05A 2XWTB 5DK3A 5CBAA 2BDNL 3AUVA 4PS4H 1GGIH 4WUUE 2FDBP 1I1FB 4GW5A 4O2CA 2HT3C 2VIRA 3S5LB 2CO7B 4DKEH 1AY1L 4LVNC 3QXDA 4YGAB 1EXUB 3OHXA 3QUKA 3P0YH 1S5IH 1NBYA 4PJ7B 2A6JB 4MQ7B 1BLNA 1KENH 2GK2A 4WWKB 3WKNA 4NO0D 2NX5B 1CQKA 4C83A 3PQYE 4M7KH 4O02L 3GIZH 2ZKHL 5TE4L 1ZVHA 4OIBA 4ZFZB 4RAVB 3N50A 1OT1A 3DJ9A 4LNRB 4G80A 3SE8L 1TFHA 4JZNB 1NJ9B 4W6WB 2IQAB 1MHPL 3V4PL 3J8F7 4LCWD 3VFPB 5EOTB 2FGWL 4P9ML 3OKLA 1FL6A 4S1DC 1LK3L 2Z31C 4AEFA 1U8MA 2ZOLB 4ENEC 1CD9B 3TZVD 1DN0A 4X6DE 4OD2B 4I77H 1GZQA 1KCSL 1M71A 3X11A 2D31B 4CAGA 4P46D 1MPAH 5C07E 3SDXF 3B2UD 5DJXA 3KWWA 2P5WE 4I48A 4N1HB 1NCDH 4UDUB 1UWEL 4NQSB 2QKIA 3DHMA 1J8HB 4JRYD 4TUJA 5KANI 3PF2A 2PYFB 3PDDA 2QR0B 4KI1A 1KJMA 1NEZA 5LVEA 2D03L 3E6FA 3NIDF 3PUCA 4HKXB 5CKGA 5KSBA 1A7NL 3AREA 3SEPA 5I8EA 3RAJH 5LXGL 1LEGB 4GKSA 1KGCD 3QO1B 5AYUL 3D0VA 3O4OC 2WBJB 5ACLA 1OSZB 1SMAA 2D0FA 3INUL 4QLRA 5DRWB 3HCVA 2VXSH 2P1YA 4FTVA 3RTQB 3MUY1 1BBDH 1VFAB 4QXTB 2PTUA 5AZ2H 3W0WB 4QF1A 3VI3E 4Y5YA 4DN4L 4KU1A 5C09D 4HS6A 3LKSB 5IFJB 3L5JA 1P53A 3REVB 2AK1H 4BZYA 1WSST 2ESVA 1XR8A 1JRHL 2GJ6D 2X9YA 5FYKL 3E3QE 5CBEB 3D3VD 1IEBB 2NR6C 3V7MA 3ZYOA 1N8ZB 4Y2DD 4LHUG 1F02I 3B43A 1LE5A 4WUUA 2VJXA 4FQHB 4PJDE 2CQVA 1WGOA 4Q6IC 4CN1A 4N9OB 5C8JA 5LGJB 1TIUA 1F4XH 4L5FH 1J0KA 4XPHL 4TVPH 1K8IB 5CINL 4HJ0D 1TQBB 2APFA 4LLAA 4K07A 2Q8AL 4DN3L 1A5FH 3TYGH 3CH1B 3QO0A 3PNWB 3RGVB 5EC1B 5EU5B 4P59L 2G2RA 4ONGH 4HUXA 4XPBL 2R8SL 1DUYB 3PQYA 1MCWW 2JJTC 2Y5TB 1FNAA 1Y18A 4P4KD 1H5BA 4CNIA 2GK0B 3ZHLA 4J7RA 3OQ3B 3QWOA 1NGYB 3MRFA 4DVBA 4P5MB 3EYSL 3I3EA 1RIUH 4UT6H 3M07A 1HHKB 3RVXD 2VISA 2EYRA 2UYLA 1JGDB 1G9NC 4OD3H 4GG6B 3TH4T 1R3IL 2OQJB 4FQPA 4NN6B 4LPYA 3LEVH 4YBHA 4CVZB 4U1SA 1Z3GH 3QXDB 4PJ9B 5C07A 3OHXB 2X4OB 4LGSB 3CNKA 1NBYB 2P5WA 5GGVY 4MWFB 3CU1A 4CVUA 4KQ4L 1OWRM 5CP7B 4MA8H 4X5XA 3E2HB 3NCBB 4Z7NF 3I6LE 2RCSH 3QXVA 4DVRL 4C83B 3GBML 3MBXL 1CD1A 3KPMB 4YHLH 5F3BA 3VJ6A 4RGMC 4ZUSB 5FYJH 3VRIA 2R56L 3JV6B 3BX7C 5MENB 4KK8D 4XNMB 1QO3A 3MBEC 2AJYL 5B3NA 1U0QA 2QEJA 3S8WA 3DV4B 4F58H 4HMCA 1X4XA 1BAFH 3N1QC 1WCBB 1DN0B 2YD1A 4KMTL 1I9JL 5C0CD 1GZQB 2P5EB 3X11B 2A1WH 3JWDH 4C4KT 1T03H 4FQ2H 3B9KC 3IKCB 3D9AH 3V6ZA 5DJXB 4AEEA 3FCTB 4IS6B 2NXZD 5LWYH 5I74B 4LPTA 4TQEL 3UBXA 2NTFB 3BDXA 3Q5OA 3NCFB 4FQ1H 1KJMB 3E6FB 2JB5L 4XTRD 4PV9B 2BCKA 4PJDA 4X9FA 3V4UL 5IHBA 5DMYA 1WTLA 3DUHA 3S88L 3OPZH 1KG0A 3X12A 3B6SB 3BD5A 1H3TA 4GKSB 2H6PA 1D6VL 3D0VB 4XXDA 4P48A 1DQML 2X89D 3BGAA 2GTZA 1MCFA 1PZ5A 3C8KA 3VFVB 2DIJA 4P2OC 4FG6C 1NUFA 3IDIA 4N9GA 4NT6B 5IBUB 4XCYA 3O2VL 5I0DA 3FT3B 4FN0A 2CUMA 1EJ6A 4ZAKA 4K7PH 2JJSC 1A1MB 2ZNXA 4QHNA 3OKKB 4LVHB 4TNVK 2OTUB 1LGVA 2YMXH 1HQRB 5F1SA 1IQDA 2BVEA 2Q1EA 2X4RA 2YSSB 1BJ1J 1D5BB 4WI5A 1FE8L 4X7SH 4MB4A 4O51A 2XWBA 4M7ZB 1ZHNB 5HJ3B 2OLDA 4HW6A 5IBLD 4HAFA 1PJ9A 5ITFA 3FRUA 1MCWM 3GSQA 5LAXA 3T1FA 1PYWA 5ISZD 1N5YH 3VXPA 3RIFK 1YNLH 3BT2L 1BM3L 3QDME 5IJKA 4WHTB 3QO0B 5IWLA 3B3IA 4DTGH 4HUXB 3U4BL 2Z8WC 4K55A 2UWEE 4OLXH 1I3UA 5JPNA 4S1SL 5ACZA 4GBXC 1O7SA 3G08B 1C12B 4CUCA 1H5BB 1WZLA 3R1GL 4RAUA 5E8DL 1VADB 5A16B 3QWOB 2MCG1 3BKYL 4K3HA 4M03A 4S11A 1HILA 1Q0XH 3QQ3A 4RGOL 3WFCH 2WLZA 1AXTL 1GL4B 2VISB 2UYLB 4X6DB 1GIGL 2VXTL 4LRNH 1PKQA 2ZCLH 4ZFFB 4JN2A 2M8XA 2A6DB 4HX1A 4CDGC 3JVGA 2FSEA 4IJ3B 1JZ7A 4M4PA 3RPKA 1CXEA 4LSSH 3ROLB 3VGAC 1L7IL 3LSOA 4KKAD 3ZKMD 1E4XI 3BP4B 1UJ3B 4X5XB 1DLFL 4L4TB 4XXCA 4NGHH 4WFGD 1QSFD 4MDJB 1BOYA 2O5ZL 2AJ3A 3ZZ1A 1CD1B 1KT2A 3X3FH 1QBML 2DQUH 4ZFGH 4HS3B 2CK0L 5HVGB 3VRIB 2X41A 5J3HD 1MCKA 1HIML 3NIFF 2YD2A 1QO3B 2DBJA 4YAQB 1IARB 1FL5A 4Y5VB 3WFBH 4MAUL 4UINL 5ESAA 4M6AA 4H8WC 4ZOBA 4HLJA 4PY7A 5CLWA 4JO4H 5IG7A 1L9MA 4LMQE 4PJXF 1MCPH 5A43C 3LIZL 5F7HA 3HPJB 2YUZA 3WIIH 5AWNH 3P9MB 1SEBA 4LOUC 2XA8H 3RRQA 3EYFB 4UT9L 2OK0L 4Q7DA 4PUBH 5DMIH 3L9RA 3S98A 5DQDL 3H8NA 2X4SA 3MRBA 4NNXA 4H0HB 2XNAA 3TIEA 1M7XA 1EV2E 1G9NL 2GY7B 1EJOH 4MAYA 4RX4A 1KLUB 5HI4D 1NMAH 4KK6C 1MRFL 1KJVB 5DEFB 1PX4A 3QA3A 4XXDB 2UY6A 4PD4J 2CRZA 5HHNA 4TVPE 2B2XL 4YHOL 5BV7C 1PZ5B 3VFNA 3HMWL 4NNPH 5EIQA 3IDIB 3QDMA 4FA8A 4FQJL 2UWEA 3C08L 1DQQB 5LCVH 3TWCH 2A6IA 2V2WB 5BVPL 3MNWB 5HYJB 1HK6A 3L7EB 3C9NA 5EOQH 1IQDB 4ZG1A 5FDYA 5ID1A 2DQDL 2DJUA 3GMNA 3UYRH 3FQXA 3Q0HA 4BH8B 5AD0A 2XWBB 5CUSL 4Z8FL 1QFWH 3SOBH 5D70H 4NKIL 5FOBA 3T1WA 3IU4L 4M5ZL 3QH3A 1OQOA 1MVUA 3QIBA 3FQUA 4N8PA 5DFVC 4N5ED 3T1FB 1KJ2H 1QSEE 3U6RA 1NMBL 1RFDL 3MRIB 1B0WA 5F9AC 4X9BA 1R24B 4P3CL 1T5WB 3SDCA 1Q9WA 5LGKA 4HZAA 3NCJH 3O9WA 4KRNA 5ACZB 3QCTL 3RZCB 5HYQB 1IFHH 4RAUB 3FTGA 5FYJE 5GGSB 4MJ2A 4TTDD 3MOBH 1AD9A 3QJFB 4WTWA 2NZ9D 4MD4B 2HFFB 2FATL 4JPKH 1A4JA 1R6VA 1LHZA 4D94A 3WXVL 4ONHB 1KIRB 3DO7A 3I75B 5D1QC 5J8OA 1RY7B 2PYEB 4KTEL 4IRZH 2HFGH 1DEEB 5E5MA 4XWOC 2F53D 3LKQA 4IM8A 2DLFH 5TFSL 3C8DA 3H3KA 2Y25A 1UENA 2PXYC 4I13B 5E7BA 4LSVL 2DWEA 1IZJA 2F19H 3SY0B 3TYFB 2MWCA 3QFJE 5J6GA 3LAFA 4LEXL 5KZCB 3BN9D 3IFOA 2NY3B 1F3JA 4J3WA 2ENYA 3E6HB 3M1BA 3ARDC 4F9LC 4AH2A 4Y4HC 3STLA 3PWPE 4MS8D 3BKCL 2NYYD 3LS5L 2BVPA 4TULH 4JZJC 5T3ZH 2EH7H 5D1ZD 1AJ7H 1J0JA 4KVCH 1RJLA 5JTWA 1FL5B 4ODUA 15C8H 3VXQA 4A6YH 3MRJA 5D2LB 3RY5A 5ESAB 5D7JD 1A6TA 3LKOB 4JFPB 1CF8L 1MCOL 3ILQD 5F96L 2ZPKH 4L29A 5GZNC 1UWXK 2EE2A 3P30L 4B53A 4M48L 3N9GL 2BDNH 4UQ3A 4DUXA 4E41E 4HMEA 4RBPK 3PE9A 4NPYB 3EZ8A 4I5BA 3T4AA 2BNRB 3FZUD 4G8IB 3KPPA 3MROB 1G9EA 1RMFL 1AY1H 3RPIB 4ZS6D 1UKTA 3G5ZA 3UZEA 5SX4I 1KIPB 4R0LA 3IT8D 2FBJL 2NY4C 3PWNB 4PBVC 4JFXA 4HK3J 3L3KA 2H2SC 2MHAA 4XNZC 2CDGA 3RHWK 1QSEA 4O02H 2ZKHH 5TE4H 1BOGA 4U1LA 4LDLB 1MFAL 4PG2A 3WV0A 2FIKB 3TJHD 3SE8H 2VKWA 4RAHA 3TA3C 4PRID 4WO4C 5JOFA 2J4WL 3H42L 1MHPH 3V4PH 2FGWH 3SDAC 4DCQA 1I7TA 3QFDA 5IF0A 4P9MH 3JSSA 1LK3H 1D5MB 4P0DA 3GRWL 1WZKA 4ZD3L 5ID1B 5E6ZA 1KCSH 1ZSDB 4JPIA 4ZPTA 1N5AA 5AD0B 1A9EA 1NAKL 4W81A 3RVTD 4GSDL 3CH8A 1KCLA 4N0FA 2DQTL 5DHVB 4NC2B 1Q94A 4OBRA 1B0RB 4W4OC 4HJGA 1CE6A 1UWEH 2ED9A 1AXIB 3VFTB 4QGYA 4ZPVA 5JPMA 4Q9RL 5EUKB 4HDIA 4J4PC 4LRIC 2COQA 5EOCL 2D03H 3MRDA 3QFJA 4PJEF 3KPRD 1A7NH 1HHIA 2WV3A 5LXGH 5EO0A 5FFLA 4KTYA 4BKLA 5AYUH 4I3GA 3T2OA 3PWPA 3BHBB 3P2TA 3INUH 3OB0K 4NCDA 2RQ8A 3ESVF 3QEHB 4WU7B 5BV7L 4ODSL 1KEML 2B1AL 4OI7A 3CZFB 3QDJB 1S7XA 4WFHE 4DN4H 5E5MB 2QQLL 5J4MA 4P5TA 3I02A 3FFCE 5D1XC 1JRHH 1OB1B 5FYKH 1G9ML 4MDIA 3LN5B 3HB3C 4K2UH 1L0QA 4QHKI 4E41A 5CEZL 3QUZC 5EN2B 2Q8BL 1GGCL 1F3JB 1MCJA 3GKWL 3WS3B 2OR9L 2XFXA 4AH2B 3K3QA 4XPHH 3BMWA 1W2KT 1NGPL 2MKLC 2BZDA 5CINH 2BVPB 2LVEA 3HRZA 3PDOA 2UZXB 4X6CF 4IDJL 1ZKAA 1RJLB 4DUWA 2Q8AH 4UOJA 4DN3H 4HIJB 1C16B 1QFPA 4P59H 4XPBH 4R2GC 2R8SH 1CFQB 2YR3A 1OD7A 1XIWC 4BQ9A 1T7WA 4FQXA 2YKLL 4L29B 3CFKB 3L95A 2I24N 3ZT5A 4JQVC 4AIXA 5FOJA 5HHPA 3N1GC 1BX2A 1N4XL 4NQDD 3UPCA 2CKBL 2EEBA 3EYSH 1NGZA 2BP3A 1A14L 3X17A 3T4AB 1NKOA 1R3IH 4TSBH 4D9QE 4HIEA 3G5ZB 2OTWA 5F89B 1I1AA 1CXFA 1IKFL 3D2UB 3S96A 4JFXB 1I3RA 4JVWA 4KQ4H 3JZ7A 3JTTA 4LKCB 4G3YL 4JQXC 4HPOL 4WGWB 4TUKL 2I5YL 5ILTL 5E9DB 4DVRH 1A7QL 2CDGB 1T0MA 4MSWB 3GBMH 3MBXH 3UTTE 1BOGB 2CDFA 1XZ0A 4U1GB 5CSZA 2DQHL 1KB9J 2R56H 2NW3B 4PJBE 5I8KL 5KSVA 2AJYH 1T3FA 1I7TB 1J1XL 5IF0B 5LBSL 4KUZL 4NRXB 4KMTH 1I9JH 3QHFL 5B8CB 1N5AB 3U46A 4R8WL 4PRDA 4XCCL 5FGCE 4C54A 4CU7A 2J5LC 4Y5XB 1J7VR 2A6KA 2BOCB 2H41A 1HH9A 3GJFK 4P46C 4U6TA 4U7SA 3B2UC 3PDGA 3QIWB 1CE6B 4NJAL 1A6VL 3U0TB 1JZ3A 3OKYA 1GC1L 2GFBB 4TQEH 3FFCA 3UDWA 4HDIB 5DF0A 1PQZA 1XR9A 3EKCA 3QIUD 3KYNB 2FJGA 1CXIA 3ZYZA 1NL0L 1FQ9C 2XTJE 2JB5H 3MRDB 4KDVA 3V4UH 5CAYB 4JE4B 4RCAA 1GZPB 1FVDB 3S88H 1OF2A 4LKXB 4NRZA 3RUGA 1HZHL 2AJUL 2LVCA 1D6VH 2YWZA 1UACL 2WM0A 5T1LB 4Z78A 1A6UL 4TSAL 1CDJA 1DQMH 1X4YA 4Y4KB 4Z7UF 2YXMA 1R5IA 1X5ZA 1FZKA 2OJZH 5T3ZE 3RDTD 4X4YB 4YHZL 3CX5J 4BQ8A 1HDMA 1KPRB 3ZE1E 3RWIB 2LU4A 2WQRA 3O2VH 1S7XB 3WNMA 4XH2A 2EECA 5JNYB 3U4EA 5I1JL 4EXPX 4S0TD 4M9PA 5KAQF 3STBA 4MJIB 2P8LA 5F1NA 1T1XB 2NY5L 2I07A 3BQUA 1FE8H 3U4AA 5FDWA 1U6AL 4Y2DC 4DGYL 4IHOB 5GIRA 3CDCA 3RA7L 4JY6B 4IOSD 2F54E 3HRZB 2AP2A 1IGFL 4BFBD 4TTGA 5AG9A 3NGBB 5D7IB 1CR9L 4UNVA 1OP3K 3BT2H 1BM3H 4D0DA 4HJ0C 4LSQL 3DVGA 5C08B 3QG6A 3U4BH 4YBQC 4M1DL 4KGJA 5B38B 5HHMB 4PD4K 2P4AB 4S1SH 1KJ2A 1X7QA 3UTTA 4OLUL 3MQIA 3R1GH 4KK5C 4W4NA 5HYSA 2H26B 5MEPB 4P4KC 2AJVL 3BKYH 1UWXH 4PJBA 2DMCA 4LARL 3ZDYF 3HE7D 2VLMD 1NGZB 4RGOH 3AMKA 1VEMA 1AXTH 2NPLX 4MXQD 5L7XL 1GIGH 2VXTH 4QWWD 4RBPH 1CFTA 1TCRA 2QADD 3BJ91 1RUQL 1SM3L 4GJTB 4OFYA 4ZFOA 4O58L 3OZ9L 4OKDA 3KHQA 4HIEB 4JKMA 1HYRC 1I1AB 3O6ML 1B3JA 1P6AB 1JMZA 1NBZB 4RFOL 1L7IH 5TGBB 2R1XA 2VDKL 1KCUL 5EIVA 4YDIL 1DLFH 4G6FD 1IAKA 2DLEA 4PJ8A 3GK8L 3HNVL 2C3WA 5E6IA 2O5ZH 1KNOA 2QQKL 5ADPL 5B39B 2CK0H 3TBTA 4XMKL 2N1KA 4HIIB 1HIMH 1IGTB 1EERB 4NQEE 3SO3B 3O4LD 5IW3A 3SDDD 3ZSTA 3EO0B 1ZVSA 2ZUXA 4JFED 4IRSB 4WI2A 5C9KA 4MAUH 1MREL 4UINH 5E03A 1MJ7L 2VOTA 3RX8A 3TCLA 5KJRL 2AABL 1P4LB 3AAZB 4LCUB 2ATPB 1X5JA 1G7HA 5GS1C 1H8OA 1HH9B 3LIZH 4N68A 4UU9A 1TZHB 5D2NB 3QCUL 1BD2B 2NXZC 5GXBB 2WQ8A 3OKMB 5FAAA 3V5DB 1D3CA 4KMQA 3FFCB 5EPMB 1NGWB 4UT9H 3S4SA 2OK0H 4PY8J 5DQDH 5FYKE 3REWB 3IDYB 3KNBB 1G9NH 4P2QD 4NRZB 4XTRC 1MRFH 2YEZA 3WJLA 1M05B 2PTTA 3MNZB 2BNQE 2O61B 4R4ND 2B2XH 2F54A 4YHOH 2R9HC 2IMMA 1CFVL 4L8CA 3HMWH 2XQYK 3OB0H 3LRGA 4U4BA 5FO7B 2GAZB 5BVJB 1OTUD 4FQJH 1LK2B 5TH2A 2BHUA 3C08H 1UXWA 3DV6A 2ARJQ 3DUSA 2VLKE 5BVPH 3ARFB 2AEIT 4ISVA 1S9XB 4UMGA 5BS0D 5HDQL 2DQDH 2P8LB 5GQBA 3BQUB 1WQVT 4DKDC 3SN6N 4X4ZA 1JTOA 5CUSH 2Q86A 2E6QA 1EAJA 4Z8FH 5IB1B 3VH8B 3MGAA 4NKIH 4UUJA 4Y4FB 3IU4H 3K2MC 3GI8L 2C9AA 2X4QA 4M5ZH 1HSBB 5IBLC 2FHBA 3LKNA 4LPVA 2N7AA 3BZEA 3MV01 1NMBH 1RFDH 3R8BB 1CLOL 2BY0A 2R2BB 3SGEH 5BOZG 4G5ZL 4P3CH 3WHE1 4DZ8A 5HGBA 3DGGA 4GW1B 4HUVA 1RD6A 4APQC 4LEOA 3QCTH 1CCZA 3C6LD 4OGYL 1G7LA 3P4OB 3ARED 4KKCC 3HR5A 4EUPB 2HJLA 1X6LA 4PJBB 4NQEA 3T0XA 3HUJE 4XCNA 1G7MB 2FATH 3KYMA 3BEVB 3RY6A 4P2RB 3RBGA 3WXVH 4FTVD 4X8JA 1CFTB 1TCRB 4LFHG 4KTEH 4M6MH 2V2TA 5FGCB 5TFSH 4PJAE 1MLCA 4QRTA 1FC2D 4LIQL 2R1XB 3MV9E 4HGKC 2APWA 4LSVH 3S3PA 2G9HA 4PJ8B 5ENWA 3QUXC 1I7RB 4I0CC 1TPXB 4KKAC 4YFEA 1R5WA 5IQ7L 1W0VA 4M1CD 3RWCA 5FK9A 1KNOB 3KJ4C 4I1NB 1WK0A 3WUZA 3TBTB 1UJTA 2EIBA 3BKCH 3LS5H 4AYFA 4CVWA 2GI7A 3L5WB 3BGFB 4I4WB 5EU3A 1E4XL 5J3HC 4PJIE 3T77A 1LO3L 1EVTC 4AZ8A 1CDBA 3ROOA 2BNQA 4QKXB 4K9EC 4XCFL 4PTUB 3GFUA 1IGJA 4OI9A 5IVZB 5DJAA 3IDMA 4KJPD 3TCLB 2XXCB 1CF8H 1MCOH 5F96H 4HKJA 2LAAA 3P30H 4A6YB 1ETZA 5AUMB 3P4NB 5EU4A 1C7SA 4HV8A 1CYGA 1QOKA 2RJMA 4M48H 2D2OA 5HHQA 3N9GH 3SE4A 1JGEA 2VLKA 2R0KL 3S4SB 4S1QL 1QVOA 2FBOJ 2GITA 2WP3O 3KGRA 4JFDE 5C0BE 2ICEA 1EBAA 1RMFH 5C07D 2FBJH 3T3ME 2YEZB 4WEUD 1XF2A 5HI4C 3BIBX 2P5WD 5BOPA 3HMXL 2PETA 3P77A 5GGVL 1RV6X 4WW2A 5DR5L 1S7VA 2X44D 4NO3B 3K1KC 3ZO0A 5DSCA 3TIDA 2J4WH 3H42H 2VLJD 2D4FA 1UXWB 3ELAT 4V1DE 3TT3L 5FECA 2VMFA 1FRGL 5FA3B 3DUSB 2G75A 3N06B 1LO5A 3EYVA 1MCEA 3CSYA 1EHXA 3PABA 1RU9L 5GJSL 3GRWH 4ZD3H 2UVEA 1I3GL 3MLZL 1NAKH 5B21A 3RX5A 5K9JL 4GSDH 2DQTH 5C1MB 3O8XB 1CGXA 3U2SB 4HLZG 4UUJB 4O9HH 1LQSR 1HOCA 1X5LA 5EBMA 5IJVB 3MUHL 2ZZUT 2XWJA 4RMWA 3BZEB 3TN0D 4Q9RH 3QI9A 1Q9KA 3AXLA 1YZZA 2NY2D 1TJHL 4N5EC 3MV9A 5EOCH 2FX8L 5SWQA 4JRXD 3GKZA 5JO5A 5K9KA 3BZ4B 5C3LD 1V3KA 3U0PB 4L1DA 4NZTL 4LEOB 1QEWB 2R1WA 4Y89A 4ZUTB 3KPLA 2IPTL 2HJLB 4G43A 4NQCA 2FX9L 3FQWB 5DEZA 2Z8RA 5ITBL 5C0IA 4NQEB 4ETQB 4S0SD 4XCNB 4TTDC 5E8PB 4PJIA 4HWBL 2FL5A 5BV7H 3KYMB 1UB5B 1KEMH 2B1AH 4ODSH 2IBZY 4QO1A 1M1SA 3O3UN 3BD4A 1QRKA 3V6BR 2CRYA 2V2TB 1GGYA 5EO9B 2QQLH 2YPLB 3VWKA 1I4FA 1CZ8L 4ZAKD 2A73A 1G9MH 4G9FE 3H0TB 2G9HB 4ZXBB 5CEZH 4RDQG 1NANH 1W0VB 1PW3A 3Q5YA 1GGCH 43C9B 3JUZA 3GKWH 1J10A 1JHTA 2OR9H 5ACMA 4JFDA 4BFEA 3BN9C 4KROD 4O4YL 1NGPH 3DMMA 1J18A 4IDJH 5F88B 2XICA 3O6LL 1MJJB 2NYYC 4TN9A 4XX1E 1FDLL 3GHEL 5JXED 3ROOB 3GZKA 3GM0A 3MV7E 1XGQA 5D1ZC 3DETD 3EDJA 1NC2B 1BZ9A 3DBXB 1OAYL 4ZDHA 1R0AL 2YKLH 1K9TA 4HKJB 3VXUB 5D7JC 2IANE 2MPAL 3WJJC 3CX5K 1JUFA 2WINA 2X4PA 3H9HB 3ILQC 2ADIB 4V1DA 3K2UL 1N4XH 2CKBH 4U49A 4O5LL 3ZKXC 3LQZB 1FV1B 1A14H 1QVOB 5C9JB 4KV5E 2GITB 1DVFD 2C4XA 2V2XA 3WHE0 4NC0B 2NY6B 3VFMA 4HHAA 2EDDA 5C6TL 4DOHB 1KLFA 4QTIL 1PY4A 1JZ5A 1IKFH 2WSKA 5J1AA 4F7PB 2GYSA 4ZS6C 2ICWI 1UA6L 2G5BB 3D85A 4MA1C 1DE4A 4G3YH 4HPOH 1HEZA 4TUKH 2FLBT 2I5YH 5ILTH 1A7QH 2HP4A 4AT6A 1K8DA 4OF6A 3P77B 2HLAB 3OJVC 1JPSL 5ESVB 3SGJA 1CN4A 4KXZI 2B8OT 2FJFA 5I8KH 3TJHC 2D7QA 1J1XH 2P42B 4XBPB 5LBSH 1LO5B 5C0DB 3EYVB 4KUZH 4Q6IA 2RHEA 1ZLVK 3BP6A 3QHFH 3HUJB 2ADJB 4R8WH 4K9EL 4XCCH 3V95A 5KS9E 1OAKL 1U95B 2GTWB 1SY6L 1HHJA 5F7KC 4QRPD 3RVTC 3GSNL 1KIQA 4OLEA 4U6XB 5E94A 1RZGA 2EC9U 3FOMA 4NJAH 1A6VH 4MXVF 5M94B 4H20L 2E9JA 2XWJB 3QQ9D 1GC1H 2PR4L 3QI9B 2N7BA 2JJTA 4PJAB 3QNXA 5J56B 4YGVA 1A6AB 1NL0H 2AEWA 4G9FA 4I9WD 1AR2A 4NNYA 5KVDL 3ARGB 5F71A 4G8EB 4ZYKA 1FNHA 1A0QL 1HZHH 3KPLB 2AJUH 3LQAC 1UACH 4MAYD 3ZT7A 3G9AB 5JA9A 1A6UH 2VZTA 4TSAH 3U7YL 3QSKB 3BPOC 4NN5C 5TQ0L 4W6XB 3T8XB 4PJIB 3KHOA 4YHZH 5MEOA 3Q5TA 1RULL 4LVNB 2J8OA 1WLHA 3QDMD 2JB6B 2WWKO 4GRMA 2AEQL 5LKNA 2XPGA 1SBSL 5JW4M 1CGSL 4ZUWB 1KTRL 1S7TA 2CUIA 1OGAD 3QP3A 5I1JH 2OZ4L 4J3VA 2JLLA 2IANA 4Q6YA 3JWOC 4H0GA 2X42A 3WXWL 2NY5H 5IMLA 4JO2L 4XC1L 3LN9A 1U6AH 1U93A 4QOKB 3MCKA 2W9LA 1U8PA 4DGYH 3F58L 4L3EE 5C0BB 2Z31B 3RA7H 4EIZC 5TDPB 5F7UA 3NTCL 3BYYA 3MCLL 1IGFH 3OJDB 1CR9H 2VWEC 3DGCR 2WWMC 3QIBD 3D39B 3NA9L 4B5EA 3F7RA 4OFKA 3B9KA 4LSQH 1EPFA 3VE0B 5HD8D 4M1DH 1OTTD 2NW2B 4XP5L 3KJ6L 1NFDE 4OLUH 3QAZC 1LO0L 4I18A 4PP2A 1F6AB 4MVBD 2BY3A 4XP1L 2AJVH 4JFFD 4CU6A 2HA1A 4LARH 1JPGA 5E95B 3LB6C 4LPCA 3V7AE 4XB8A 5L7XH 1RUQH 1SM3H 3O4OB 4O58H 3OZ9H 4JAMA 4HHAB 5I16B 5KS9A 3CFJA 3RUGF 1CIUA 2YZ1A 3O6MH 1PFCA 3RY4A 5DJ0A 4RFOH 4H88L 4PJCE 1OGTA 2VZVA 2VDKH 1YEIL 1KCUH 4YDIH 5TF0A 1DE4B 1HEZB 3GK8H 3HNVH 1MFBL 4AT6B 4QCIB 4YFLF 2QQKH 4LQFL 2C3VA 5ADPH 2DLHA 4XMKH 4OCNC 2V7HB 2FJFB 4J12A 4YXKL 1P84J 4GXVL 4Q6IB 1P69B 2BVTA 4IIQC 1MREH 3ES6A 2W92A 4FXGB 1NCNA 3MRQA 4ZO7A 2YZ8A 2Z4QB 1MJ7H 4G8GB 5KJRH 35C8L 1KIQB 2HVJA 2IMNA 3PV6A 3R06A 5E94B 1L0XA 3FOMB 2XACC 3QCUH 2LTQC 5E8NA 3FB7B 3MX0A 1A7OH 3BAEL 5FHBL 4ODVL 4GBXA 3KPSD 3OX8A 4G9FB 4NNYB 3BIKA 3QIUC 2H8PA 5CEZE 1RAMA 4ZYKB 3O3AA 4D3CL 1EGJL 1NH6A 2YD9A 4P57A 2DI7A 1EZVX 5HHXL 5SX5K 1YDPA 1WFOA 4PJGE 3OKNB 1YMHA 1FZOA 2R0ZL 2BY1A 1QLEL 1CFVH 4LSUL 2YXFA 2IPUG 3MA7A 1QSED 2MQ0A 2NY0D 3MV7B 3RDTC 5DC0A 5KN5B 1S9KC 1RI8A 4UI2A 3CSPA 3GMPA 3BW9B 4F37F 4LVOC 3H9ZA 4M61A 1NFDA 5DFTA 4HKZA 2XPGB 3T0EC 1HWGB 1EO5A 4X7EC 1U36A 5HDQH 4RGMB 4JCLA 1IEAA 5C0RL 1A64A 3MCKB 5D6DC 3MBEB 32C2B 1UB6B 3DO3A 3GRWA 3F7YA 1OAUL 3GI8H 5I2IA 1A3QA 1P4BL 3VU2A 2X4NA 4ZUUB 1CGVA 2PKDA 5F6IC 5DMGD 4JO1L 2NLJB 2UVFA 1UXSB 1CLOH 4RFEB 1NC4A 4PRBB 4PJCA 3B9KB 4WFFD 2E6JA 1P7KB 2CSPA 5DRNA 1MVFA 4M02A 2DIAA 4OGYH 4XZUB 3PWLB 2CRIA 3GMQB 4PP2B 3FONA 5DYOA 4YPJA 3CCHB 1UM4L 3LQAL 3PWPD 5CZXD 3IDGA 2JK5A 3CFBB 1KLGA 2ICCA 5SWSE 3HE7C 1HQ4A 3P0VL 1C1EH 2EIEA 4MJ5A 3CFJB 3UPRB 2QADC 1MIEL 1ZTXL 3QZWA 4K3GA 5DGRA 4LIQH 4P2OB 4P5TD 3TBVA 4Z5RB 4Y1AA 1A47A 5IQ7H 2X1PA 2PNDA 1ZGLA 3OF6D 1KPVB 4LSRL 4L3AA 3PWVB 3MZTA 5KOMC 5IEKB 1IM9A 2FWOB 4JG0L 1MCBA 2FJHA 3QRFM 1E4XH 5EZOL 3OG4B 1NUGA 1LO3H 1ZHBB 3HZYA 3HC0A 1N3NA 4XCFH 3SDDC 5IROC 3G6DL 1W8OA 3WLWD 3MRQB 1SJXA 1BFVL 2BSED 4FQXD 1P9MA 1CGWA 1T7XA 5IW1B 3KLHD 2KQNA 3MLTB 5D4QA 2R0KH 4S1QH 3RWDA 1Z2KA 5EU7C 4GBXB 2OX5A 3L6FA 3OX8B 5ECJE 1XF1A 3AU1B 2CKBA 3GJFB 4UTAL 1P1ZB 4JM2F 1NDMB 3DROA 2L4OA 5SWZD 4L3EB 4P57B 3IS1X 1MI5D 2GJZB 3L3IA 1ZS8A 3ULSB 5LGHL 2UZIL 4JG1L 2XT1B 3MTRA 1MAML 5FUCE 3HMXH 5GGVH 4IOFD 3CGTA 4R4NC 5CWSA 5DR5H 2IC2A 3F7VB 4G8FA 5HI3C 4F7TB 1U8HA 5IHZB 2I9TB 3VGAB 2PXYA 3V0AC 3VG0L 4F9PC 2EEDA 3TT3H 3IJHB 3M45A 1XCTB 1VESA 4CBPA 4M61B 5E8OB 5I1LB 1NFDB 3IU3A 1OTUC 1FRGH 4HKZB 2YRLA 3GGWA 3SGKA 1HXMA 1RU9H 4UIMB 5GJSH 4UV7L 3O3EB 4HK0A 1N6QL 1I3GH 3ARDA 1F3DJ 1FNSL 1IEAB 4Y4HA 1GYAA 3MLZH 5CHNA 4NDMA 5K9JH 5ICZA 2E8YA 3QWQB 4XBGB 4PP1D 1BHGA 4JDVA 4WI6A 5SWSA 2APXA 1U8IA 2GCYA 4CMHC 1F13A 1KTKE 4P5KB 4Z0XB 2WZPD 2J6EL 2X4NB 3K74B 3LHPL 1TJHH 1JZ8A 1T66D 2FX8H 1C5DB 4L4VE 3WUWA 4PJ5B 4BH7A 2RGSA 4MA3A 3TEUA 2HFEA 3LKPB 3E1F1 3WFHB 4NZTH 4YC2C 1HSAA 1SEQL 2IPTH 3VXSD 3QXWA 2RIKA 5IV2A 3C6LC 2FX9H 3TNMB 2QQNL 1CGTA 1S9WA 2VDQL 4JZOB 3AREC 2CJUL 5ITBH 1D9KA 2BC4B 2C4FU 2PW1B 3ZYJA 1Q0YL 4HWBH 1Q72L 4E42A 1RJCA 3HI5L 5SV4A 3DARA 4JANB 1HQ4B 3T0DA 3DRTB 2E7LA 5BV7B 1FCCA 3QZWB 1CZ8H 3V0WL 2NY1D 3TBVB 4Y5YC 2EYTA 3VGHA 1KCVL 4GG6F 3BZFB 5IFAL 3GSVA 2JIXB 1SVCP 4O4YH 5IB5A 5J11C 4YUEL 4DZBA 5BJTA 1FDLH 4NHUA 3GHEH 4DFHA 5CZKA 1N3NB 4BSVA 3HAEB 4PJGB 2EDOA 4W4OA 1OAYH 3D5OF 4NBXB 4N8CL 1R0AH 2H3NB 4J4PA 4KJPC 2MPAH 4ESKA 4PJFB 1FZMA 3K2UH 5HGHB 1X44A 4O5LH 3L3HB 5I15L 4UQ2B 1UQSA 4R3SA 1D6EA 1SJHB 1WEJL 2ZG3A 4TPRL 3KLAB 2BSSA 5C0GA 4NZRL 4LCWE 5EG6C 4XVUD 2E8ZA 2AJXL 5C6TH 2IPKB 4QTIH 1QP1A 1JNHA 4PB9L 3S36L 1UA6H 4MNGB 1EEQA 2O5YL 5KG9B 5F21B 4WTZA 3C5ZA 3G9VA 5GRYA 4JO3L 5SX5H 2IADB 5CEYB 5D1QB 3IAGC 4X7TA 5CWSB 1JPSH 3D1MC 4GAFB 5L88L 4L4VA 4OCRL 4BQ6A 3BH8B 5SX4H 2PXYB 4FFVD 2XTJD 4JRYE 1QFWM 3DYOA 5F93C 1HHGB 3HLAA 4R7NA 4WIQA 3QUZA 2BSTB 3UX9B 1AC6A 5I76A 1AE6L 1E4JA 5IHLB 3ARDB 5CSGA 3MV8B 5ANME 4Y4HB 3LDBC 3BRGC 1KULA 4K9EH 4NDMB 1OAKH 1XFPA 2J8UF 2XIDA 4QHMB 1IVLA 1KGCE 4Y16A 1SY6H 4JZJB 5SWSB 3GSNH 1C7TA 1JV5B 2AEPL 4K7FA 4HG4J 5B38G 2YWYA 3AM8A 3KPNB 4H20H 4PRHA 2VR5A 1VEOA 2PW2B 2PR4H 3BZDA 3ZDXF 4LIQE 3TN0C 5JIHA 3WUWB 5KVDH 1BVLA 2NY2C 1DBKH 2EDHA 1I1YA 1A0QH 3E3QC 1ES0A 2GJ6E 5IMOA 2EDRA 3D3VE 3BFOA 3C5JA 1RSFA 3U7YH 1J11A 3VD3A 2BXZA 5TQ0H 1QQDA 4MXWL 3C2SA 3LZFL 2F54D 2HMID 1RULH 2IBGA 2Q6WA 4YHNA 2FD6L 1TITA 2R2HB 1P84K 4NM4L 2NY4B 2IGFL 2AEQH 4U7KA 1U2HA 1SBSH 2UUDK 5DD1H 3UJJL 1CGSH 3WIFA 4WI8A 4XNZB 5B39G 3IFPA 2OZ4H 4NO0A 4WWKD 5EIIB 5EUOE 4JN1L 4HH9A 3WXWH 2EYTB 4JO2H 4XC1H 4ZAKC 4F33A 4QRSB 3TA3B 4WO4B 2CXGA 1EUUA 5TDNA 4PTTA 1HCFX 3SDAB 3F58H 3VMNA 4PJHF 3MRKA 1S7RA 3NTCH 2YUWA 1OD9A 3MCLH 3ZTJH 1CXHA 2IFGA 1F8TL 4KROC 3NA9H 3TZVA 4NHUB 4G6AC 3EHBD 3IGAA 3ZMRA 4BSVB 4RNRB 4J3UA 3QDAA 4XP5H 3DETC 3KJ6H 5HDBF 5HGDA 5IJKC 4KI5F 1NCUA 3F6IA 5IWLC 1EH9A 2VAJA 1LO0H 2VE6B 5DWUL 4LDEB 5DJZA 4XP1H 1WITA 3OGCA 4JM2D 1VGKA 3NACL 5TDOA 2DQJL 4YFLI 4R3SB 5IMMA 3F65A 2NY7L 4GG8B 4MQXC 3O3BB 3STZB 5DJDB 3SPVB 4M00A 2BSSB 4XPFL 1J0ZA 4POZD 1OTSD 3FOLA 2AXFB 2BJML 1HKLL 5EC2A 1DVFC 3K7UA 4N1CA 3BOVA 5IUSA 2WBJD 1ZT7A 4G42B 1NCWL 4H88H 4NWUL 2EE9A 4JHAL 5TQ2L 1YEIH 3X13B 4KZDL 5IEHA 1ZLSL 1E6OL 1T89A 1MFBH 3ILPA 3EO9L 1YA5A 4X7TB 4KHTL 2ICES 4LQFH 2DKUA 2DBLL 4YDKL 3W0WD 1RJYA 2IH1B 4N0UB 1IM3B 5D1XB 4UIKL 3HE6D 4IRJA 1BVKA 2FZ3B 1FHGA 5J1SC 5C2BL 3UYOD 3VH8G 3FO9B 3D3VA 3QUZB 4ODXA 2C1PA 4YXKH 4GXVH 5L6YL 3BMVA 4Y2DA 3C60D 5I76B 4XGZA 1G7IB 3ZKND 4F7CB 2BNQD 3I6GA 1WBZB 4FS0A 2G60L 35C8H 1FNGA 3RWJA 4Z18A 3HI1B 1GAFL 2BVQA 1WAAE 3MJ8B 2PUQT 4HT1L 2CMRL 2AK4B 1YPZF 2ZG2A 4MQTB 4R2GB 2Q3AA 4EUPG 2AV1A 3BAEH 5FHBH 4ODVH 1QSZA 1XIWB 2YK1L 2VLKD 4KQ3L 4CKVX 5GS0D 1N0XL 1QFHA 2XOTA 1E28A 3NAAL 1T1ZA 2E9IA 1J05A 4RFNC 1RZFL 3K81A 4D3CH 1EGJH 5HHXH 2A83B 4U2ZA 1CE1L 4IMKC 3TPKA 2R0ZH 1QQDB 1FFOA 4MAYC 3PHOA 1QLEH 2X2YA 4LSUH 1CWVA 1EEUA 4LCIL 3M17A 1HXYA 4YHNB 2OI9C 4JFQA 1Z9SA 5ISZE 5FKAA 2RB8A 1S7UB 2Z35A 4JDTL 4CVXB 1NGXB 3V6OE 3WIFB 4LPUA 1QBBA 2RR3A 3VCLB 3DXAD 4NO0B 2EO1A 4HH9B 2VDNL 3M8OL 1MWAH 3IETA 5C0RH 4F33B 4K3JL 4X99B 1EVUA 3QHTC 4JRWA 1X5GA 3MGOA 2QJDA 4YBLC 4LCYA 1OAUH 3NIGF 3VDAA 5FO8A 4LCWB 2F8XC 1P4BH 3ALWA 5TF1L 4JO1H 4F8QA 1XCQB 4H5SB 3LD8C 4YHYB 2FH8A 2MSPA 3QIBC 1K6QL 3UTZB 1CFBA 2P5ED 3MV9D 4P46B 3L5XL 5IVXB 3S4SG 1JTPA 5HD8C 3BUTA 4WI7A 4IOIB 3U7AA 1DUZA 4ELKB 3SDCC 4W6YB 1I8IA 1RZ8B 3O9WC 3OGCB 4WFGE 1QSFE 4MD0A 1UVQB 4NQCD 1UM4H 3LQAH 4XCEA 5D2LF 2YA1A 4JRYB 3EFFB 1MQKL 1U92A 2GY5A 3B9EA 1FCGA 4MVBC 2ILLA 5I75C 1FSKC 3SDXE 3P0VH 4UDTB 2VLRD 2K3TA 4JCMA 4M5YL 4O2FA 5ANMB 3S9DB 1A1OB 4HWBA 4IDLA 4Y7MA 2X1XR 1I8MA 4OQ1A 3A6CL 1ZK9A 2YD6A 1MIEH 4Y8DC 1ZTXH 2YPKA 2X89A 4OZHF 1WAAA 1JF6A 1S7WB 4YXLL 4BK5A 5I1GL 2CD0A 1IGYB 3ZE2F 4OV6F 1QSVA 1MELA 3ILPB 1MHEA 1ZWIB 3NIDE 2Z92A 3K4ZA 4GKNB 3F8UB 5HY9B 4LSRH 3UAJD 4LLWB 5IVNA 2Y7QB 5C09B 4JG0H 4JFDD 4YLQT 1G1CA 5EZOH 2HJKA 3DMMD 2FO4B 2GJ6B 2C1PB 3FT4B 4Y2DB 5CIPH 2OBGA 3G6DH 4LLMB 3B5TA 2FR4A 1M6OA 4NBZB 3O6FD 5IQ9A 2M2DA 1BFVH 5C3TA 3TBYB 1Z6JT 5T5NF 4TVSa 4U6VL 5ISZA 3TLRA 5BZWA 3RWFA 2P8PA 2XG5A 4L4JA 3V6OA 3FB5B 4V1DD 2AV1B 4JFOB 4C56A 2DWDB 1YY9D 5EUOB 3IDNA 2YHGA 4UTAH 2IALB 4P4KB 4Z7WB 3GHBL 1FG2B 4F3FB 3DPBA 5HHOB 5LGHH 1RZIA 2UZIH 4JG1H 1FFOB 1MAMH 1HHHA 4R0LC 5DJ8A 2DLGA 3M17B 2HT4D 4LLDB 4JFQB 1YNKL 3EOBA 3VG0H 1ZA6A 1QPXA 3GSWA 2NY0C 5J13C 2XTLA 2Z91A 4QXGL 3TT1L 4HF5L 3L3JB 5IW6A 4PG2C 1EEYB 1GXEA 1MSPA 3TVMA 1FP5A 1HYSC 4UV7H 1N6QH 4WCYL 3BE1L 1MEXL 4FOMA 1FNSH 1M7DA 5A40E 1REIA 3RNQA 1QKZL 5ERWA 3SDXA 4LCYB 4WNQB 2EDKA 4JHBA 2LU7A 1CDCA 4KI5D 5I8CA 4IMLA 4PYHA 2J6EH 2XN9B 4Z7NE 1SY6A 4HPYL 1YMMB 3FN0L 4J8RB 4NO5A 3TNNA 4HUKB 4WY7L 3LHPH 3GSNA 3IDJB 5EO1B 5C0CB 5DMGC 3JWDC 4OI8A 5GS1B 5DJCB 2F53E 5F8RC 5KSUA 4GAJH 1YJDL 5A3ID 2NXZB 3EUUA 2DS4A 4F15C 4HH8A 2QQNH 2VDQH 1ORSA 2CJUH 1OP5K 2W38A 4GKZA 1Q0YH 1JNLL 5FEBA 1Q72H 4LLVA 3P4MB 1YN6A 3HI5H 3HZMA 2DM2A 1FGVL 1OCWL 5E2TL 4UBDD 4O2FB 4RRPA 5EBLA 4P2CG 1T21A 3B5HA 2JCCF 4YHIA 4GO6B 4X0KB 3V0WH 3DTXB 1PD6A 2W60A 3QXAA 1KCVH 5DMJB 1KACB 4P5TC 4HG4K 5DEGA 4RWYL 1DBBL 1MHEB 4OCSL 5IFAH 5FKPA 3BP5A 1A9BA 2EDQA 4E5XB 1JGUL 3R8QA 1QHOA 5H35B 1UH2A 4YUEH 2A74B 3B8YA 1NQBA 2DDQL 5J9PA 2DI8A 2CLRA 3PHQA 1QACA 5IK3B 2DN7A 4OFIA 1QNZL 3LH2L 5I6XC 2FR4B 4N8CH 5CZVL 1JYWA 2RFXB 4LSDA 3WLWC 1X5YA 43CAB 4JY5L 1MH5B 1GVIA 4OM1L 2E6PA 2WW8A 5D7SH 3D18B 4U6YB 2VXVL 2PTVA 1IGIL 5BZWB 5I15H 1T04A 4FQXC 3EGSA 1K5NB 4APQB 1WEJH 1JCKA 3KLHC 4TPRH 4PRIE 1TNNA 3CPLA 3IDNB 2W9DL 2QL1A 4NZRH 5IR1B 2AJXH 2H32A 3MO1A 3FB6B 3RZCD 3ZHDA 1BWMA 3CC5A 3OTTA 2D0HA 2OJEA 4PB9H 3S36H 3U9PL 3T2PA 2O5YH 4XHQA 1QRND 3BO8B 3B9AA 4Q97A 2Z8VC 5DMKB 4JO3H 1K4CA 1MJ8L 5DJ8B 3IKKA 5L88H 1DZBA 3GJEB 4OCRH 3NCYS 2NQCA 4NM8L 4LLUB 4R6UA 5DJ2B 3UTOA 3EOBB 5IOPA 1ZA6B 4L9DA 3K8KA 3MLWL 3I85A 3O81A 3ARXA 3QUXB 2W0FA 2W9EL 2X1QA 1IGCL 1FC1A 1AE6H 5F3HA 3KPRE 1QSFB 3DX8A 3KJ4B 1JHLL 4TNWK 3CUPB 4UNUA 3MOAL 2NY3D 3G04A 4OLZL 3RNQB 4AK1A 2AJZB 2ARJA 1WFUA 2AEPH 2Y36L 4PP1C 4IMLB 4DUVA 3TNNB 2W0LA 4XHJD 4EDXA 1A5FL 2JKXA 2OTPA 1N0LA 1T66C 1VACB 5F6HJ 4WFED 3RWHA 4G9DA 1TVHB 4OSUH 3UDWC 5KSUB 3ECBA 1HWHB 3H3BC 3NIFE 5D7IF 1EHNA 2FHFA 5IIEB 1YEDB 1YEJL 2BVOB 1P5VA 2XY1A 2EDFA 4GKZB 4MXWH 3LZFH 1EGJA 1QA9B 4ZOCA 2BNRD 2AAVA 1YN6B 2FD6H 3H3PL 2VWEE 3GSOA 4MNQD 3HNTL 3H6JA 4N0YL 4NM4H 4OBSA 1N2RB 1OAZL 2IGFH 4PJXE 4AIOA 4HFWB 3LEVL 4OLWL 3UJJH 4NKOB 4N0RA 4YHIB 1A2YA 3FB8A 1F3DH 3DUUB 1JK8A 4JN1H 2DQGL 1SJEA 2DYPA 3WEXA 2NY1C 4JGMA 1T4KA 4HWUA 3VXNA 1ZHKA 3L3OA 4AM0A 4HSQA 4PRIA 3L3GB 1MWAA 4QNPF 2ZSWB 1DQTA 1F8TH 5J9PB 2CLRB 4MCYA 1JPST 4GT7A 2KDGA 4YR6A 4N90E 1WC7B 4OUUA 2LFGA 3SBWA 2Y06L 4NFDA 5L2JA 2P7TB 3W81A 2YD5A 5DWUH 1ED3B 2K7PA 4GW4A 1F5WA