2ZSVB

Crystal structure of h-2kb in complex with jhmv epitope s598
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Prevention of cytotoxic T cell escape using a heteroclitic subdominant viral T cell determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zsvB00
2XQYK 4ERSL 2NXYB 3LKRA 4LOUC 5DFWH 1Y6NR 2GT9A 1AQDA 3ARZA 3UPRA 2W0FA 3K3QA 2D7NA 4P2QD 5EBMA 4ELME 3O2WH 1HHIA 4UOW1 3MFFA 3VH8A 5IKCB 3PHOA 1AQKH 5ALCH 5EO0A 2BOCA 1RJYA 1W0VB 4PRHB 4POUB 1G1YA 2F5AL 3TIDA 5JZ7C 1Y0LB 5GRYA 5EZLB 1A3QA 1I1YA 4G5ZH 3NCEB 1I7TA 3DXAA 4HV8A 4LPTA 3EYOA 4H5SA 4K71C 4NUJA 4HQQH 4HPYL 1CFTA 2DIAA 4TQEL 1F3RB 3MC0A 1CLZH 1FG2A 5DQ9A 5I9QB 5IMKB 2J12B 4FNLL 4FP8L 5CBAA 3SHSA 2OTUA 4L8BB 3G5XA 1J5OH 3K2UL 2YWZA 2V2WA 5IBTH 2Q87A 1O5DT 1T1ZB 3MRBB 1II4E 5E94A 4ODXB 2C4FU 4OM0L 4R26H 3ZL4H 5HYQA 3VXTB 4NP4L 4ZSOB 3T0XA 5HHOA 2G60L 4GKSB 1IEBA 5IHZA 1F13A 2XTLA 3Q5TA 3DRQA 3AAZB 2E9IA 3LKQA 1CD8A 1XR9B 1KLUA 1B6UA 3RL2A 3U82B 1CFQA 4PJ5D 4Y19E 3SGJC 1X5FA 4X5WB 3BP4B 4XNMB 5I73B 4ODHL 2VITB 4QTIL 2EDOA 1FC1A 3MJ9L 4HS3B 5DS8A 3GHBL 3L7FA 1GGCH 3T09A 2E6PA 4QRUA 5IFHL 4NRYB 2A1WL 4H8WL 2AJXL 5FUZH 1NQBA 2DQTL 4LCCB 3QBTB 4HUWA 4OGXH 3ILQD 5EPMB 2XXMB 4UT7H 4MD0A 2NXZB 3TFKD 1HE7A 4LLDB 4Q2ZB 1UM6H 1CQYA 1U8PA 3O3UN 1UA6L 3PABB 3BPCB 5C0AE 4RDQF 2NR6D 5C6WH 1YDPA 3C2AH 3L5IA 5FGBC 4PJEE 4XNUH 4G9DB 2KL6A 2Y7QA 1AP2A 3OAYK 3TO2B 3IRZA 3F58H 3IDIB 3LZFL 2I5YH 2IGFH 5HDQL 2NY4D 1JIBA 1PDKA 1BJ1J 4X4ZA 4YBLB 4XAKE 3ILQC 5C0RL 5DJ8B 1OCWH 4YX2H 3FTGB 5LCVH 4Q6IC 4WU5B 3TFKC 2L4OA 3GJFH 3S36X 1FO0L 4M61A 3SJVB 1T1WA 3PIQB 2NR6C 3I6KB 1RZ8A 2XNAB 4XCFL 2PW1B 3HRPA 1JVKA 3F7VB 1J7VR 3MCLL 1HWGB 1E4KC 2NY4C 5C92A 1Q8MA 5C0CB 1A7PL 2QQLH 5D7SL 1X6NA 3LH2H 4TNWK 4BKLB 2AK1L 3B2VL 1NFDB 5CKAA 1MVUB 2W91A 4OZFG 3QNXA 5HHXH 4F7PA 1JN6A 2OL3B 3QIUA 1AD9B 2XICA 1LD9B 1WSST 4M7KH 1DVFD 3NIGE 5BO1L 4HGMA 1GGYA 2ZOLA 1NEUA 3LQMA 1YY9D 4JG1H 4E9LA 4AH2B 5GGRA 3F65A 4LCUA 3VWJD 1CZ8L 3TNNB 4P23B 3PWNA 4FQXD 1J1XH 1DBKH 3KPOA 4OZIE 3DVGB 2R56H 1G1CA 1DVFC 2AKRB 1J10A 1YY9C 3FO9B 1ZE3C 5IKCA 1XF4A 3E1F1 5M94B 1PY4A 2IALB 4HUUB 3LB6D 5ERWB 1Y0LA 3VWJC 1O7SA 5EZLA 4EUPB 4FQXC 5B39G 2G2RB 4LU5H 3GRWH 4X7DC 1X9QA 4XI5D 1GYAA 5I8KL 2HJLB 2BRRL 4TNWF 1JTTA 2VERN 3ULVL 5IMKA 3TH2T 2M2DA 4WUUB 5MEPB 1R0AH 4L8BA 5FOJA 3S9DB 1JGLH 4S1SL 1TVDA 3IETB 2VUYA 3UDWC 1T1ZA 2DQEH 3MRBA 1KENL 4ODXA 5C3TA 3LB6C 1C16B 1V7ML 1TITA 2DTSA 3MV8E 3VXTA 4ZSOA 2VQ1B 5D2LF 4G3YL 4GKSA 1WIUA 4XI5C 3SKNB 4YDLC 1M7DB 1MCLA 4F7EB 1N0LA 4DN3H 4PJGF 3FHAA 1LEIB 4YXLL 3ZTNL 1HOCB 1XR9A 3EO9H 4XVTH 3MRRB 2YPLE 2AJVL 3N85L 5E9DD 4XNMA 2VITA 2FX7H 4HS3A 4YXKH 2F8VA 3GIVB 1WFTA 1WFOA 1PLGL 3BWAB 2WP3O 3G08B 4PBXA 1BLNB 2VDQH 3PP3K 3VFGH 3MREA 3SQOH 2Q6WA 3ZDZE 1YQVH 4LCCA 5L6YL 1MJUL 2EE9A 5EPMA 3LDBB 2A9MH 1AIFB 4LLDA 4Q2ZA 4YQXH 3BPCA 2APXA 3TH4T 2V9TA 1A02N 3NTCL 5F71A 2A0LD 5DEFB 2OI9C 2ICEB 4G9DA 1IM3B 2W65B 1FL6B 4AG4H 3SKJH 3IDIA 4RIRB 4LLUA 1MIMH 4XWGL 2CLVB 4CU6A 1X6LA 3MZTA 1OSPH 3GUTB 1IKFL 1RI8A 3MXVH 1JZ2A 4KFZC 5DJ8A 3UBXG 5GS2H 1IBGL 4WU5A 1RURH 4J6RL 3NBNA 4ZTOL 3RKPA 1KB5L 4IRZL 3OXSB 3SJVA 3PIQA 4NC1E 3MR9B 3I6KA 1BQHB 2A0LC 2GIYA 4TULH 2PW1A 4KI5D 4JKWA 2GTZB 1YUHB 3F7VA 1YEGH 4Z7QF 4CMHB 1DN2A 5KVGH 1D9KB 1Z0NA 4NRZB 1G9MH 4L4VE 1IJ9A 5TE6L 5DUPH 1VFUA 3WKML 3I50H 4YHKH 5IB1B 4O00A 4QRRE 3QRGL 2D7QA 1TTGA 1AD9A 4QTHB 2BVPB 1KCRL 1RY7B 4GMTL 2MMXA 3DJ9A 1LD9A 3P3YA 1J8HE 4AIXA 3WDJA 4P99A 3D3VE 2YD6A 4KI5C 4WI6A 3S35H 2E6JA 1RHHB 2F58L 3V8CA 5FB8A 1VGKB 3MV11 3T1WA 1EFXD 4Y4FD 3RJQB 4AH2A 4UV4L 1W8NA 4N0CC 1Y18B 2P8MB 4TSAH 3TNNA 4P23A 2Y72A 1WAAA 2GEEA 1KIQA 3HC4H 1EUUA 4RAUB 1K3IA 4JO1H 5FO8B 1GPOH 2V2TB 5CMAB 1N6VA 4WI3A 3DVGA 5D7JD 4NQCD 1A7QL 4LASH 2AKRA 2JK5A 1RMFH 3DTXA 5E2WL 4YHZL 3EYUH 1QRND 3FO9A 4Y4FC 4ZNCD 3F7YB 2Z35B 5J13B 2BJML 2F19H 4Z7NE 1HILB 3NIFF 1KB9J 3QXWA 2IALA 3QZWB 4JQVC 5ERWA 3TLRA 4N0RA 4EUPA 4NN6B 4HEPG 3CDFA 2G2RA 5TE4H 1J0KA 4NWUH 5IW3A 2DM4A 3LD8C 4MA8H 5D7JC 2HJLA 5BCAA 4NN7B 4HJ0D 2APTA 3MXWL 5MEPA 2PR4L 3WEXA 5E2VH 1EFQA 3IETA 2O5XL 2R23B 1YNLL 5SX4H 1C16A 4JFDE 1JFQH 2Q3AA 1CXHA 3KPMB 1OARH 4CN1A 1HI6B 4HJGB 2VQ1A 4JR9H 3VXMB 5KSUB 2G9HA 3B5TA 3ULVE 3SKNA 1D5ZB 3U0TA 4PREB 4RFNC 4F7EA 1WJ3A 3B5HA 3FO0L 4XPFH 4HJ0C 2PKDA 3MRRA 4RWYH 3MJGX 4ODBD 3C8KB 4DGYH 4L3EB 1MAMH 3SDAB 1A4JB 3B9EA 2X9XA 5E7BA 1DBAL 4MLIA 4KK8C 2D7OA 2IBZY 3GIVA 2W9EH 5E03A 2CKBL 3JV4B 5HVHC 4UQ3B 4PIRF 3BWAA 3G08A 1BLNA 3EFDL 1QEWB 1ZANH 4ONFH 5K9QG 4MD5B 5J12C 3O6MH 5EA0L 3R8QA 3VFUA 5K9OB 5FYLL 1AIFA 4OF5A 4YC2B 3L95A 5HHPB 5JPMB 4POYA 3ROOB 2ENSA 5JDJA 4KV5F 1CFVH 3P0VH 5AAMA 5DVNA 3VXNB 4HC1H 1QFWI 1IM3A 2W65A 1FL6A 1OLLA 4DKEL 4YHYB 4RIRA 1R5VB 2Y36L 2R69L 1U8HB 1QR1A 2CLVA 4K3JH 3FAWA 3MRHA 4P2QE 3HI6L 1QNZH 5F9WC 5GRXG 4Y2DA 5FIEA 3OKLB 2ZG2A 4YFEA 4WV1B 3UYRL 4O5LL 1SMAA 4RFEB 3QXVA 2PETA 3MR9A 1G0XA 1BQHA 4X8JB 3SE8H 4LAQH 2GTZA 1NCCH 1ZA3B 3DX7A 1XCTB 2XTJD 4K94H 2CO7B 3JTSB 4EN3D 1D9KA 4NRZA 1EBAA 4O02H 1EJOL 3QCUH 4X83A 4ELMB 2BNRD 5J9PB 5IB1A 2HA1A 5I1EL 3WV0A 1QKZH 3SKMB 1TLKA 3NPSC 4KROB 4QTHA 4GAGH 2BVPA 3STLB 4ELMF 2DDQL 9CGTA 3IJHB 5IW6B 3BH9B 1RHHA 3X12B 3GI9L 4JZJC 1VGKA 4U3XA 4G6JL 2XTJC 2VQUA 3WIHA 4EN3C 3OV6A 5HDOA 4GBXB 4HG4J 4UILL 1QBAA 3RWEB 1Y18A 2P8MA 3MROB 1TQCC 4UI2A 3ZE2F 3S37H 4PJ5E 4RAUA 1OGTA 4PD4J 5I6XC 5FO8A 4YWGL 2QSCL 4ODTL 2V2TA 3BDYL 4JGJA 4ALAH 1V3JA 4HK0B 2UWEB 4J12A 3WMSA 4EKXA 3QXUA 4RAVB 4PJXB 5E08L 4OLXH 1OOAA 2XZAL 4OLUH 4FQLH 3VFPB 4JKKA 3MBEB 4GRWH 4GG6E 1F3JB 2Z35A 3ALXA 1HILA 3QZWA 4OF0A 1TVHB 3JUYA 5M95B 1IE5A 1P7QD 1VFBB 1UZ6E 3DUUB 5EBGA 2F15A 1A14H 5GS0L 3HNSL 4M1DL 1WZLA 3VD3A 4H1LG 1NGPH 1AGEB 3V5KB 4BH8A 4J3TA 1RJLB 5E8EB 4N8CH 3Q6FA 4Z7OF 1K2DB 3SQBA 2LTQB 4JKPL 2R23A 4YFDB 3PL6C 2DL2A 2P45B 1OD9A 3KPMA 1PD6A 4FABH 4LVEA 1MJJB 4HJGA 3F7PC 5CGYD 1YN6B 1OAKL 1UM5H 4OTXL 2DLHA 2N7AA 1D5ZA 3UTZA 4M7LL 4PREA 4PJEB 4JO4H 4L29B 4Q0XH 5CFHA 1TIUA 3K1DA 1DL7H 3C8KA 4L3EA 2FBOJ 3SDAA 1YEHH 1A4JA 4XBEH 2DQDH 4HZAA 3GSNH 2MQCA 1CFBA 3R4DA 1QUNA 3JV4A 3KS0J 4ZUWB 1P4IL 3U7WH 4UQ3A 3VG9B 1YEIL 2Y25A 5CGYC 2H6PA 5C09D 1QEWA 2YD8A 4WO4D 3FFCE 1DLFH 4P48A 4WVRA 1NEZG 1IAII 4MD5A 1U3HD 5EDXA 1CICB 35C8H 3PJSB 3FQNB 5D8JL 3WIFB 1YJDH 4HKZA 5DK3A 4U1KB 5HHPA 5JPMA 1DR9A 3CLEL 3ROOA 5EU7C 3VXNA 1LO4H 3EUUA 4NRXB 3GO1L 3EDKA 1C12B 3I9GH 4WO4C 1U8HA 2OK0L 5D1QD 3H42H 1GGIL 4LSVL 3MJ7B 5EORH 1U3HC 2V5TA 5J0BA 5FYLE 2IBBA 3OKLA 4OLZL 3Q1SL 4WV1A 4LSTL 1HKLL 2X9YA 4JN1H 4RFEA 3NIGF 3QISA 1NPUA 1WISA 1AR1D 2DYPA 1FQ9C 1F4HA 2W0KA 5HPMB 3PUCA 5TF0A 2VJXA 4P2CG 1INEL 4JFEB 4DK6A 5JPNB 3FCTB 2VL5B 3PV7A 3F8UB 3B9KA 5D1QC 5EU3B 4LHUD 4A2MA 4ELMA 3LKSB 4OZIF 4PJHE 3QDHA 1X5YA 3ARBB 3SKMA 4ZODA 3VRIB 1NUFA 5I1HL 3STLA 3LRGA 3MLSL 4Y4KB 5IESH 4O9HH 3IJHA 3RWFA 2X5PA 1AR1C 3A6OA 4M6MH 3SE3C 5IW6A 3BH9A 2NY7H 2EC8A 4OD1H 3MRFB 2P24B 3X12A 3LQAH 5J06A 4XP1L 2PTTB 4GBXA 3SE4A 1W0YT 3W39A 1MF2L 2HG5B 4KQ4L 1KIRB 2YRLA 1FP5A 2NY3B 2Q8AH 3MROA 1QFWM 1WBYB 3ULSB 5GS1B 2CGRH 2ZNXA 5CS7A 2ICWB 2X40A 2HKFL 4U31A 2UWEA 1DQTA 4PJXA 2N4IA 3VFPA 3MBEA 2X09A 1IM9B 3V5DB 1F3JA 3P77B 3O9WB 4I0PB 3HFMH 4ESKA 1TVHA 2BDNH 4PTTB 1J1PH 3BD3A 5GGSY 1VFBA 2FEEI 3DUUA 3TIEB 3T2QA 2YPLB 1SBBA 5T5FL 4NKIL 4GXVH 2YN3A 4KVCL 4L1DA 1EZVY 4X6CB 4ZFFB 3SO3C 1MUJB 3OB0K 3MLRL 3V5KA 1NCAL 5E8EA 2D0HA 3D85D 4DZ8B 4UV7H 4L4TB 1K2DA 1MELA 3QB7C 3MFGB 3K1KC 5EU4B 1EGJH 2VZTA 3MCKB 5CP3H 3SOBL 1MHPH 1MJJA 1NAMB 2A77L 3GFUA 2IEPA 2IMNA 4M5ZH 1KIPB 5C0AA 1T4KB 4UINH 2J8HA 4PJEA 2F8XC 3MODH 5IVOA 3Q5YA 5CLTA 4KI5E 3MRJB 3FN0H 1LP9F 1BBDH 2ITDB 5AZ2H 3MLZH 4ZUWA 2X10A 4JM2F 5T1LD 4ZXBD 4M7LT 3QXDA 1KSRA 2FJGB 1S9XB 4FZ8L 1JGVL 4FXGA 5IWLA 1CICA 3PJSA 3QDMB 3FQNA 3WIFA 5DMIH 4CMMB 1VFOA 4U1KA 3NCYS 1JMZA 4L4VB 4UDTB 1MREL 1RZFL 3H3PH 4NRXA 4G7YL 1QFHA 4ZXBC 5TF1L 3X13B 1RUPH 4NQCE 2IAMD 2X70B 1AFVH 4LQFL 1XGYH 3UJJL 4GW4B 2OR9L 4HLZG 3RGVD 1EERB 2RIKA 1QRNE 5F89A 1CU4H 4PRPE 5HPMA 4XP6L 3WNNA 4JFEA 3IDUA 3QYCA 1CGSH 3FCTA 1JWUB 2VL5A 3Q0HA 2ZKHL 3JUZA 4KRMB 5IROC 3A6BL 2XOTA 1KTDB 5HHVL 4C54A 2IAMC 4OV5B 3RY6C 2IPUG 3LKSA 1NC4D 5EZJB 3RGVC 3ARBA 4IDLA 5I8OH 1T0MB 4Y4KA 4Y4HB 1PZ5A 5EBWB 4M4RA 1QFPA 4CDHA 1IAIM 3MRFA 2P24A 2PO6B 1IGIH 4DGIH 3C08H 5MI0C 4KZDH 1VGEH 4Z7NF 3P11H 3UTSE 1CE6B 3BN9C 5C07D 3DV4B 1Q1JH 4LEOB 1T6WA 3GSWB 2HG5A 2CRMA 4XP5L 4JVPA 4OLWL 1V7NH 1EDQA 5KJRH 3FONB 1WBYA 3ULSA 5GS1A 5MHSD 2VR5A 4NCC1 1BD2E 2Z91B 1V3LA 3JXAA 5E8DL 3QDGD 3J7HA 5T3ZL 4K7PH 4M93B 4PJBB 3W9EA 1OTTD 4XVJL 4JFDB 3AS1A 5EH1A 4N1EA 1IM9A 1ONQB 2JJTC 4O2EB 3V5DA 5SWQB 3OB8A 4Z77B 3TO4D 3P77A 1KCUH 3O9WA 4I0PA 3V4UL 3P30L 5TGBA 4MAYB 3QUXD 5CJ8A 1Q0YH 4PTTA 2HAZA 2IQAB 2YPLA 3ULVF 2YN5A 2VC2H 4R7DB 4HFWB 1FFPB 4ZFFA 2NY5H 4O58H 3K2MC 4F2MB 3CFCL 5A2KH 1OTTC 1A1MB 4IDJH 4DZ8A 4WEBH 4JFQB 4X0KB 4L4TA 3TO4C 4LIQL 2CJUL 3RKDD 5EU4A 3QUXC 3MCKA 1RFDL 4I2XE 1H0DB 4GMSH 4S1QL 3KPRB 4GFTB 4BZ1H 1OF2B 1RHFA 2RGSA 2SEBB 1NAMA 4OCRL 1KIPA 4PJDE 4AL8H 3MJ9A 3KPSE 1T4KA 4WFEE 2DBLH 3NFNB 4K9EC 5JA9A 3GMNB 3WJJA 2ZUXA 3MRJA 1PG7L 5I74B 3DSNA 2ITDA 2XTJE 3WIIH 5HGDB 4K71B 5GQBA 3KYNB 3LVEA 3EZ8A 2DQJL 3RKDC 1OP9A 5D1XB 2IMMA 5A16B 3NABH 1ZVYA 2BNRE 5JXAL 2AJSL 4KY1L 1FIGL 3ZTJG 4G8GD 1BZ7A 1S9XA 2QHRH 4GS7B 1BFSA 1RD6A 3QXTA 3QDMA 7FABH 1A6WL 1GHFL 2Q8BL 2RCSH 4L5FH 3WFCH 4LGPB 4CMMA 2CSPA 2BOBA 5ISZE 2ADFH 3GIZH 4L4VA 5AUMB 1FSKC 3NOIA 4UDTA 3NCJL 1FFOB 4OBSA 4U49A 4NCC2 3QULB 1KB5B 2WW8A 2Z31D 4CBPA 1UXSB 1H3PL 3X13A 2NYYD 3D18B 5DVKA 4LEXH 2X70A 1FE8H 1J8HA 3DPBA 4XP9L 3D3VA 3FB5B 4U1IB 4ZUVB 3FRPG 2R0LH 4NQTA 4LLQB 2BVYA 4G6KH 2XZCL 2EXYD 1YECL 3RI5K 1HIML 3WUZA 1ZT4B 3W82A 3ALWA 1K5NB 4UOJA 3CLFL 1OGAD 2Z31C 1JWUA 1A1NB 3UMTA 1N5YL 1SM3H 1TZHB 3ARED 4KMTH 1KTDA 2NYYC 4D9LH 4OV5A 4PP1C 1CK0L 1PJ9A 2CMRH 5EZJA 2J3SA 1PW3A 3R1GH 4GG6B 3QQ4A 1TQBC 2BSTB 2EXYC 3EO0B 4PJ8D 1T0MA 2X41A 1L0QA 3BKJH 5IHLB 2FECI 5EBWA 4HMEA 5C0JA 3I85A 4GG6F 1HKFA 2PO6A 1FNEB 1JP5A 5ETUB 1ZHNB 4Q6IB 1AY1H 4GH7B 1KJ3H 5DHVB 3PWLB 1M7IB 1CE6A 3DV4A 3AREC 1KLGA 2Q86B 4CVZA 4OCWL 1UZ6F 1XZ0B 3GSWA 5DMKB 1U8IB 5B8CB 2B4CC 4R4FH 1W2KT 4Z7UE 1TETH 3ULUH 5FO7B 2Z91A 1DLHB 2NY4B 3K0WA 3HPJB 3W0WD 4PJBA 5FO9A 1G6RL 5HI5D 4OCXH 1I4FB 5FA3B 3HHRB 4YPJA 5B38B 4N0YH 3SDDA 4JFDA 1FGVL 1JWSB 2EH8H 3CH1B 1S5IH 3EFFB 4JY5H 5C09E 4YDKH 1ONQA 4O2EA 3RI5F 5CILL 3AROA 4Z77A 4G8EB 1A7OH 5LWYH 1MQ8A 4MAYA 1X3DA 2HWZH 3V4PH 5CCKL 4M6OL 5F7YC 2HTLD 4OB5H 2IQAA 1ZEAH 5IG7B 5EU5B 3Q6GL 4R7DA 5JO5B 5JW4Q 4HFWA 1FFPA 2OL3H 2VWEC 2VLMD 3MRKB 4F2MA 5HI5C 3BZEB 7CGTA 2XFXB 2QADD 4KVNH 5HI3D 4JFQA 4X0KA 3LEVH 2NNAB 3OAYH 5L8LB 3B8YA 5ALBH 2EEDA 1Q9KA 2DTML 4QF1A 1B4JL 1OSZB 4C4KT 2ZZUT 1A6PA 3KPRA 3KWWA 2HTLC 4Q7DA 1OF2A 2SEBA 1J18A 4PYHA 4HULB 1P7HL 3TVMD 3HAEB 1SVZA 3RJDA 1YYLL 3LN9A 1OAXH 5C6TH 3TBTB 3NFNA 3GMNA 3VWJB 3BRDA 3PWPB 1IAMA 3V52L 2QADC 4FQXB 5HI3C 2FL5B 1ZLSH 4LIQE 3KLDA 4DN4H 3EAKA 1C1EH 2QSQA 5DO2D 5HGDA 5AG8A 3KYNA 1HWHB 1A7NL 4Y1AD 4PLJC 1KCVH 5GJTL 5A16A 4P2QA 5EULV 4LHQB 5AYUL 4EUPH 3MOBH 1GOGA 3L3IB 1UCBL 2CRIA 2XA8H 5EIIB 3TVMC 5FHBH 4DTGH 4HIJB 5TQ2L 4LSRH 1U8NB 3D39D 5I75C 3C2SA 1D7FA 4U1SA 1JGUL 2IH1B 3OG6B 2Y07L 5DO2C 5AUMA 1UZ8B 4JG0H 1MEXH 1QR4A 4YDLB 1FFOA 1U6AL 1GGTA 2FBJL 4NHCH 3QULA 1KB5A 5K9QI 3O6LH 2XWTB 4FFYL 3Q2CA 3SGJA 1UXSA 1IQDA 1T0PB 4D2NA 1E0OB 2YD4A 3AMKA 3D18A 5LGHL 2V5MA 5K93A 1YC8A 4NZTL 4PJHF 3FB5A 4U1IA 4ZUVA 1U9KA 3FFDB 4K9EL 5F96L 5D7IE 2VXSL 4JHZA 4JY4B 1JYVA 1HHJB 2Y4SA 3DSFH 1ZT4A 3TYFA 1CIUA 3UJIL 1BEYL 1M05B 4OCMC 2VR4A 3L5XH 4HK3J 5GRZA 4WTXA 1KFAH 4PJ5A 3H9YA 3LN5B 1A1NA 3ORJA 4UTBL 3RTQD 5GSVB 4E42A 1TZHA 5E9DB 1WIOA 1MFBL 1YMMD 3CIQA 3H9SD 4LVHC 3BZ4B 4LSQL 3RPKA 5DYOB 4JHAL 3WNMA 1OPGL 1J0IA 4EI5D 3GKZA 3V8OA 4GG6A 5FCSH 1K9TA 3EO0A 4NHUB 2COQA 2ITCB 4OUUB 3W11D 5GRWA 4KAQH 5IEHB 4R8WL 4DWHA 1A64A 5ETUA 1ZHNA 2YD7A 4Q6IA 5IVXE 5DHVA 3PWLA 1M7IA 2Q86A 5DMKA 1U8IA 2YD5A 3C09C 5B8CA 1A3RL 1QFWH 4MAUH 5K9JH 3KLHD 2QHLA 5B4MD 5IQ7L 1A6VL 1MIEH 5DD5H 2VXVH 3QG7L 1DLHA 2P8PB 2ZCLH 1TJGL 3HPJA 2CO6B 3W11C 1JPSL 4ZOAA 1GCFA 2E8ZA 1MAKA 3DMMD 5DJAB 5FA3A 1F90H 1JWSA 3CH1A 5CEZD 4R96B 3X17A 1BECA 2EYSB 4G8EA 4U3HA 3EOTH 3CFIC 5DJDB 3ZDYE 2RB8A 4Y88A 2FO1A 4XPBH 1BOYA 1KCLA 1HCVA 3KLHC 2O26U 5B4MC 2DQHH 1YEDB 1OL0A 1BQLH 1UJTA 5IG7A 5EU5A 5JO5A 1NGQL 5F7WC 3MLUL 4FQCH 3W9DB 4KI5F 3MRKA 4CNIB 4QT5B 3BZEA 2XFXA 4K3HA 5DRZA 3HTLX 4D9RD 1QRKA 2NNAA 5BW7C 3V7MA 4XPHL 3WIHH 1GJIA 1LWRA 1M6OB 3QWRD 5IVZB 1OSZA 1MI5E 1DVFA 5JLZB 3PGFH 3VGDA 2B1HL 2B4CL 4PYGA 1NLBL 4OV6F 2VDMH 4Y4FB 1VHPA 3HAEA 2E8YA 4PJIB 4JDZB 3VRJA 3TBTA 5GGVY 4Z78B 2CKBA 4LRIC 3VWJA 2YUVA 4ZO8A 4DKFL 3PWPA 3UAJD 4FQXA 32C2B 2FL5A 3CSBA 4X80L 3CJJA 4P5TD 1DEEB 3EDJA 3LD8B 3VXSD 4B41A 2QEJA 5D7JB 5A3IC 4NQCB 4OGAD 1LO0H 4B5EA 4KKBD 4OGYH 3L3IA 4IOFD 5D5MB 1OLZA 3U7YL 1WZ1H 5CJBA 2VZ1A 4PRAB 5EIIA 1QRNB 4CL7A 2NQCA 3UDWA 3L3OB 4HIJA 3UTTB 1U8NA 4ZPVB 3VGBA 3T4YA 3NA9L 4HK3N 4MQXD 3UAJC 4AEIH 4WEUD 4NIKB 1MHCB 2IH1A 3I6LD 1DQJB 1KJVB 5C07E 1UZ8A 2VNCA 5F9DC 4D3CL 4RFNB 1UYWL 4OGAC 3H0TA 5I18L 4FZEL 1ES0B 1OAUH 4IOFC 2XWTA 4R4ND 4RAHA 5IMLA 1IGCH 1FGNL 3BUTA 2OP4H 2UYLB 4FQ2L 5DR5L 3DNKA 3QHZL 1ZKAA 4MQXC 3WXVH 5HVHB 2IPUK 4PBVC 1DJSA 4ZO7A 2VDRH 4JY4A 3CC5B 2CUIA 1HHJA 3U4BL 5IHUL 4DUWA 1AI1L 1M05A 5IV2B 5J12B 1V3MA 1FV1B 2ZJSL 4JRXD 3GBML 3BI9X 5I76B 3LN5A 5GSVA 4XAWL 3JV6B 4N90D 2NY2D 1BFVH 3O2VH 5E9DA 4EI6B 1DSFL 1GZQB 3BGFC 1K4DB 3BZ4A 5DYOA 1OT1A 4BH7B 1JI2A 3MJ8B 3TWCH 3RX8A 1NMCC 2B1AL 4NUGL 4FTVE 4K2UH 2CLZB 2ITCA 2HLAB 4OUUA 5L88H 1IAIH 5IEHA 3PHSA 4N0FB 5F9WB 4D0CA 5EO1B 5F7EL 4LCIH 2DMKA 3DIFB 4WRLA 5D2NC 3IF1B 2NY2C 1XMWA 3JZ7A 1UM4L 5E70A 4R97C 2D7TL 3KJ6L 4MHHG 4X6FB 3GBLA 3HZVB 2W0LA 4V2BA 2IAND 2P8PA 4KKAD 4PV9B 4FG6C 3C6LD 5DJAA 3QNZB 4I2XB 1UXWB 2X4SA 5E8OB 3GHEL 3L3JB 3MLTA 4U1JB 1RUMH 4KK6D 3LIZL 1RK0B 2VLKD 2EYSA 4PRDA 1NMBL 4PJDB 4G8GE 5DJDA 1FBIL 1ZHBA 1KC5L 5M7QA 1YEDA 4JZJB 1I9IH 4WGVB 2W60B 1NSNH 4GG8B 4OZGE 4Y5YC 1EHLL 2XTJB 4KKAC 4EN3B 1JPST 3VW3H 1XIWD 4NO3B 3C6LC 1GRWA 5I1JH 3VFNB 3BSZL 4CNIA 4QT5A 4BFIB 1TQCB 5D71H 2BNRB 1QSZA 5DVLA 2NPLX 4KK6C 5I6XB 4C59B 3MBXL 2I60L 4RMRA 3AM8C 5DC4B 5T33L 4ZQKB 4U6HA 5JLZA 2HFEB 3MCG1 2JLLA 4AJ0A 4YPGB 4NBYB 1EFXA 1IFHH 4Y4FA 3IKKA 1F2QA 4PJIA 4JDZA 3DO3A 1XIWC 2QR0B 2DIBA 4R4BB 4JQVA 1V05A 4I3RL 1HYSD 1I9EA 3IFLL 1JHLL 1NDGA 1KCKA 1ZT1B 5E99H 3L9RB 2MCPL 1DEEA 4TVPL 1TZGL 5HYJD 2XACC 1PG7W 5D7JA 4NQCA 1E6JL 4UQ2A 5GRUH 4YZFE 5LQBL 5MP6L 3TT3L 1QRNA 4ODSL 3KPTA 3N1QC 3L3OA 3BW9B 4ZPVA 1AHWC 4Z8FL 2I07B 1P7QB 3AS3A 3W81A 1HYSC 3IU4H 1CCZA 3WLWD 4NQEE 5JQ6H 3KPQA 4LVOC 3SGEI 1KJVA 5CEZL 5EZOH 2IFFH 4OCYH 2VH5L 1A21A 15C8H 3OAUH 2PYEE 1ES0A 3VFWB 2CRYA 2VSCA 3GMLA 4PB9L 2UYLA 4MQTB 2E27H 4I3SL 4P59L 1DANU 4UT9L 5DZOA 3W0WE 1KEML 1CE1H 3WFBL 1BAFL 3HUJE 4YFLF 2BC4B 2P4AB 4OIIH 4OLVH 3PXJA 5DC0A 4IRJD 4U1HB 3WLWC 5TDOB 3VDAA 1KPRB 2B39A 3CC5A 4DKDC 4EDXB 4GKZB 5F7UA 1FDLL 4WI8A 3O45B 4AMKH 5IV2A 4JLRA 1FN4B 1AC6A 5MEND 5I76A 4EOWH 5DUML 1UWXH 1TCMA 3V6BR 4EI6A 5HYSB 4Z7UF 1QYGL 1GZQA 2VLME 3ZT5A 1DQMH 4I1NB 1VENA 1K4DA 4BH7A 1YEEL 3WN5C 2DQGL 5F88B 4IRJC 3MJ8A 4KHTH 1S9KC 4P3CL 5C09B 1OHQA 2CLZA 4WO4B 2HLAA 4XPGL 5BVPH 3DYMA 1EJ6A 1U3HB 2MNUA 4BFBD 2UVEA 5EO1A 2O61B 3DRTB 4IRSC 3DIFA 4DUVA 1ND0B 3IF1A 4K23H 4U6XB 3V6FB 3U46B 1CFNA 1IC5L 5FM5M 4KQ3H 1UG9A 1TNNA 3HZVA 4IMLB 3MGTB 3ZKSD 5FGCB 2F9BT 4PV9A 4TRPH 5DWUH 4Y1AE 3RL1B 3ZZ1A 3CFJB 3QNZA 4I2XA 1UXWA 4P2RD 5E8OA 4DW2L 4KTDH 3L3JA 4U1JA 1QLEL 3ELAT 3WHXB 1E4WH 1RK0A 2JELL 1T03L 4PJDA 3VXUD 2DM2A 1SEQH 3RWJB 1T3FB 5CHNB 5IB3B 2GI7A 3RWGB 5C0FB 1J0ZA 3F5WB 2VZUA 3MNVB 1QBMH 1K6QL 1UACL 4JZJA 4BZ2H 3Q5OA 2W60A 4GG8A 4EVNB 2VAJA 2J8UE 4EN3A 2VDOH 2P5WD 4WNQB 3X3FH 4NO3A 4K07A 3O6KH 3U1SH 2AVGA 3VFNA 4YHLH 2XT1B 5DJYA 2CIKA 4LHUB 1KN2L 2FIRT 4HIHB 1ETZB 2BNRA 2FGWL 1W72L 3LKPB 3UO1H 3L3KB 4XMLL 2H1PL 4ZQKA 3D6GA 1RUQL 4BSWA 4D9QD 4Q9QL 4WFGD 4F9LC 4YPGA 3K4AA 5JMOC 4XP4H 1X4YA 5CP7B 43CAB 1MJ7H 3WSQL 4LSPH 3E0GA 1XFPA 2O5ZL 2F5AH 3LOWA 5EU6D 2QR0A 4R4BA 3ZYJA 1T1XB 4L4JA 1A7BA 4HWEL 4WEMB 3L9RA 1RIHL 3SDYL 3OQ3B 4HPYH 5SX5K 4NSKB 5L7XL 1D5IH 1GOFA 1NCUA 2BERA 4PS4L 3QG6B 5KANI 5B3JF 2VN7A 2ADGB 3H9SE 4FNLH 4FP8H 4S10A 4UMGA 2XQBH 2XRAL 3SKOB 1E4JA 1IGYB 5LBSL 4LLVB 5CZXD 1D6VL 1JV5A 4OM0H 1WWBX 2DLFH 1CVSC 3BW9A 5KW9H 5D7IF 2I07A 3ZHKA 1P7QA 4NP4H 2G60H 1CGVA 4TVPE 3MRIB 1BF2A 3TH3T 1QFUL 2YKLL 1KIUA 2BHUA 1LGVA 2CXKA 1RZJH 5DURD 5HXMA 4OQTL 3VFWA 5FK9B 1YNKL 3D85B 1NAMH 4NM8L 1GGBL 2RR3A 4JDTH 5CZXC 3RZWA 4HXAL 3MJ9H 1C5BL 3GHBH 4LLMB 4LPXA 2BC4A 4LRNL 4U1HA 2A1WH 5CEZE 1UQSB 3HC0B 1KPRA 2Q3ZA 5JUEH 4EDXA 4GKZA 1WTGT 2BSRA 1H8NA 4CGTA 3NAAL 1BX2B 3O45A 5IVXF 4Z7UA 2IG2L 1G7JA 3JV5A 1UA6H 3FB6B 2YXFA 2ZUQC 3W2DH 3C5SB 3HKFA 2WBWB 2A9NH 4NZUL 3WNKA 4XCNB 1I8IB 4QHNB 5KSVB 4XH2A 5C09A 5T1LB 1XF3B 2EDFA 4D9RE 2IPTH 4ZXBB 4WO4A 4HJJL 3FRPA 2E9WA 2VZOA 3M8OH 2XN9E 5C0RH 1ZS8A 3EDFA 3K8LA 1F4XH 1U3HA 4LFHG 1Q0XH 3IDGB 2O61A 3DRTA 3UC0H 1T83A 3IDYC 3PDGA 5I30H 1ND0A 2OXHA 1JZ8A 1RZ7H 4P3WA 4U6XA 3KYMB 3LMJH 5DLMH 3V6FA 3U46A 3GM0A 4MMXC 4XCFH 4HBCL 2ZOKB 4DVRH 3BE1L 3MCLH 4IMLA 4JFFD 3SDCD 1B2WL 1ITCA 5D1QA 3VXSE 4D8PB 5AG9A 4Q97A 3RL1A 2IAMB 3CFJA 3JWNC 2MCG1 4J3SA 1TTUA 3DUSB 1SHMA 3BP7B 1RU9L 1TENA 3D9AL 3RGVB 3RWJA 4RNRB 1T3FA 1CL7I 5CHNA 2ADIB 5IB3A 5C0FA 4M48L 4P9HH 3F5WA 4PB0H 3MNVA 3RVUD 3SDCC 4JVUA 4EVNA 3I6LE 4HAFA 4WNQA 4WFHD 1MHEB 3SCMD 2Z8WC 3IT8D 1ORSB 4NN5C 2VLJD 4LHUA 1NC4B 1RULL 2BCKB 5F6IC 2R0KH 3LKPA 5KVEL 3CVIH 3L3KA 2AEQL 3QDJD 2NZIA 4ETQB 3MGOB 1SBSL 5EIVA 3RVUC 3AC0A 5CP7A 43CAA 2VSDA 4RISL 4WWID 3KXFD 5F44A 3SCMC 2APBA 3WDIA 4PGDB 4FQJL 1NCDH 3IJYB 1T1XA 4U2YA 1L7IL 1MFDH 3B3IB 3BKYL 4LCYB 5D2NE 1ZVHA 4NSKA 5I8KH 4N90E 4ONOA 3QG6A 3QDGB 2ADGA 1A9BB 1FNSH 3OKKB 1JF6A 4K55A 3QPXL 3AUVA 1IGYA 1D5XB 2XZQL 3SGKA 3VG0L 3MLPA 1NGZB 2CDEB 1JNLL 2FATH 2AERT 2MWCA 1V7MH 2P5ED 3AU1B 3QUXB 4NZRL 3T0EC 4YHNB 5JXED 1P6AB 2VDLL 2DJ4A 4G3YH 1OAZH 3MRIA 4R90L 2DWDB 5JHDD 3N1MC 5TQ0H 1AKJD 4IEFB 1XGRB 2AJVH 3N85H 2WP3T 2MOVA 5FK9A 3D85A 4F58L 4P0DA 5IB5B 4IS6B 1RK1B 2X1XR 4GAYB 2Z9TA 4LLMA 4TOYH 5HGHB 3DX9B 1RJZB 2P48B 4RX4D 1H15B 5JXEC 1PGRB 5DGQA 1HEZA 1UQSA 3HC0A 1NLDL 2VLKE 2EE6A 4BK4A 4JO3L 1YMHA 3QHFL 1JGDB 1YEFL 4G6AD 1BX2A 2PF6A 3CX5J 4JRYD 1ZV5A 4FQHB 4ZD3L 1AE6L 4NKMB 1IARB 5I1IH 1G7HB 1OAQH 2BNUB 4LGRB 3NTCH 5DJCB 3C5SA 5KSAD 1CT8B 1FSKB 4XWOC 5GGUB 3QFJD 1T0NB 5C7XH 1IGMH 4XCNA 1T2QH 5DC9B 1I8IA 3BKML 1T7XA 4XWGH 5KSVA 1QLFA 2FX9L 1XF3A 2VDPH 5T1LA 4ZXBA 1HH6B 3NCCB 2VIRB 2FB4L 3LQZB 4G8GB 4KZEL 4LSUH 4P2OD 3FT4B 1IBGH 2FO4B 3CVHB 3IDGA 4QRPE 5DFTA 4PJFB 5CINL 5DT1H 1S9WB 5E5MB 3KYMA 5KSAC 4U6VL 1SQ2N 3BRFA 3DV6B 2IADB 1FL5A 4LNRB 4OZGF 3VD5A 4QXGL 2Z31B 3TBVB 3QIWC 1RZGB 2HP4A 3DVIA 1J1OL 4MB3A 5IROA 5HYJE 1ROWA 4D8PA 1WK0A 4P2OC 2GK2A 2IAMA 3WKMH 3RY6A 4FQIL 3MUGB 3BP7A 4I77L 3RGVA 3QRGH 2ZPKH 4WCYL 1Q72L 1T7VA 1TQBB 5L0QC 4CN6A 4RNRA 1X5LA 2ADIA 1W8OA 4NDMB 2F58H 5ECJE 1RZKC 3GSQB 3LV3B 4TPRH 1OGAB 1G7QB 5BZWB 4OFPA 4UV4H 1JNHB 1MHEA 3AREB 3ARFB 3HB3D 4HD9A 4NQVB 1ORSA 1CLYL 4DFHA 2YPVL 3LEYH 1NC4A 4APQD 1AGCB 4Y0GA 2R8SH 3IXAB 1INDL 3WXWL 1EIBA 5DHVH 1C8PA 2YD2A 3ESUF 1A7QH 4ETQA 1ODAA 4PJ8B 4YZFF 4MCYB 1WBZB 3UZQA 5EC1B 2CKNA 5E2WH 3LY6A 1P5UA 1V5JA 1BF8A 2JJTA 2BJMH 5BQ7B 5C07A 1AQKL 5ALCL 2XKNB 4Y16D 4PGDA 3QUYD 3IJYA 3INUL 3B3IA 1XF5B 4LCYA 4APQC 5MENE 3GDBA 4G5ZL 1AXTH 4RWHA 4Y5XC 2V5YA 2QQNH 5F7DB 3QDGA 4HQQL 5HJ3B 3W0WB 5FHAH 1A9BA 3HUJB 3MXWH 4Z7VE 1CLZL 3T4AB 1MWAB 3OKKA 4HKXB 2PR4H 3UEZA 3S4SG 2AGJL 2O5XH 1D5XA 4JQIL 1U93A 1NGZA 3HUJF 3TO4A 1QD0A 5IBTL 4Y16C 3QUYC 3QUXA 4HWZB 4YHNA 4R26L 5F1OB 3RZCD 5BOPA 4M8VA 5SWSE 4NJAH 3SY0B 2E6QA 2OTWB 3NGBB 3T77A 3ME0A 1BPVA 1J0HA 3ABZA 1CLOL 2FD6L 3OL2A 1YYMH 1XGRA 1KF9B 2KZWA 5D7LB 4BQ9A 1UJ3B 1U3JA 2QADB 4OM1H 5E8PB 1S7WB 1P1ZB 4PJAE 4OT1H 3HAEH 2DMCA 3RWCB 3QEQD 5IB5A 1RK1A 2ERJC 4MGXA 4FXLA 4GAYA 4Y89A 3JWOC 3ZE0E 5A2JH 5HGHA 3DX9A 1RJZA 3RZCC 4P2RE 3EFDH 1GGCL 2WQRA 5EUOE 4KK9D 1IEAA 1JGDA 5FUOH 4JGMA 2KQNA 1MCWW 4NQUA 2EKJA 4QHMB 2APFA 4FQHA 4OGXL 4PGZA 4UT7L 3IU3B 5FYKD 2AQ2A 1G7HA 3GNMH 2BNUA 1GAFH 1EEUA 3I6GB 5DJCA 2P5WE 3CXHJ 5J57B 1CT8A 2FWOB 3BGMB 4Y1AB 5GGUA 1T0NA 4DKEH 4XNUL 4G6ML 1CG9B 4C56D 2R69H 2GK0B 3F58L 4KK9C 1HH6A 2I5YL 2VIRA 4ZAKD 3RWDB 3LQZA 4G8GA 3T2NL 3E3QC 4MS8D 2FO4A 3D39B 4WFGE 3UYRH 1OCWL 4O5LH 4YX2L 3RIAK 4PJFA 3ARDD 5LCVL 2BRQA 4I0KA 3P9MA 1S9WA 4OZGA 2ILLA 5E5MA 4OFVA 4YDVB 1NGWB 2DJUA 2WSKA 1FH5H 3QT2A 3N50A 3NMEA 3DV6A 1OB1B 2IADA 3ZE1E 4LNRA 2J8UF 4F80A 4QEGA 2Z31A 4MVBD 3TBVA 5J11C 4G8IB 1RZGA 4BUGA 2AQ1A 4ZAKC 1DBJL 2WBKA 4JANB 4CKVX 1O0VA 2X2YA 2BVTA 2QQLL 4MS8C 5D93C 3GMMB 1EZVX 4HLJA 3MUGA 5C0DB 1G7IB 5TH2A 1KTLB 1G0YR 2OZ4H 1OP3K 5HHXL 5CEYA 3ZDXE 4MXQC 2D7MA 2DL9A 4NDMA 4DGVL 4QGYA 4F15C 3GSQA 3LV3A 4LF3A 1OGAA 1G7QA 4MVBC 5BZWA 2YRPA 3RTQB 2EICA 4JG1L 1JNHA 1KPUB 3AREA 4NZJA 4NQVA 3C09B 1EHXA 1YMMB 2Y5EA 2QKIB 1AGCA 4AT6B 3WCYA 4EI5B 1J1XL 2ZUVA 3IXAA 1UGNA 3MLWL 4MWFB 4PJ8A 4MCYA 1WBZA 1KCSH 2R56L 5C1MB 5DJXB 2WM0A 5EC1A 4CADB 3FZUC 5DHXB 3RIAF 1N4XH 1KNOB 3EJJX 4KPHH 4NM4H 1BVZA 3UP1A 2IFGA 2VXQL 1PSKH 2Z0BA 3F6IA 5BQ7A 2XKNA 3MLYH 1HZHH 3VFTB 5DSCB 1CGWA 4CN4A 4PBWD 1X5HA 3P73B 1XF5A 3HNSH 4M1DH 2HLFD 3FMGH 3GRWL 2XI9A 5F7DA 5T1MB 2VXTL 4NC0B 3W0WA 1G0DA 1VB9A 2X9WA 3WS6C 3DMMB 3HUJA 1Q9OB 1MWAA 4HKXA 3T4AA 3QUMH 3U9PH 1MVFA 3BP6B 1RZIB 1RZKL 3CSGA 1L9NA 1JGLL 4M6AA 4K7FA 4X6EB 1KJ2L 2DQEL 2WQ8A 4UT6H 4HWZA 5ESVB 5EOQH 4OSUH 3GSRA 2VAAA 3SY0A 3BD5A 4N0UB 3BJ91 4OTXH 1F2XK 2HLFC 1I3GL 2FX8L 4GUPB 2BMKB 2DKUA 2NZ9C 1IQWL 2JCCE 4YHML 1BP3B 2G75B 4DN3L 1I7RA 2BVEA 1UJ3A 4NOBA 2HJFA 4JFFE 4XVTL 5E8PA 1P1ZA 3E6FB 5IFJB 3VXRD 3HE7D 25C8H 3RWCA 1HHGB 3EYFA 3TNMB 2J6EL 5IBLD 3TT1H 2FX7L 1SVCP 1AXIB 4F7CB 1JRHI 4PG9B 4MJID 4F7MB 1DQLL 3AFLA 2VDQL 3G5YB 3SQOL 4IJ3C 1JZ6A 4KJWD 1JJUA 4QHMA 2QV2A 5H8DA 3IU3A 2A9ML 2GJ6D 4P5TB 3HE7C 3I6GA 4WWKD 4YQXL 3ZHLA 2FWOA 4WFHE 3VXSB 3MRNB 4Y1AA 5DRNB 4LDEB 4C58B 3GO1H 4J4PD 3R0MA 1IC1A 2D7PA 4AG4L 2GK0A 3IAQA 3SKJL 4F33A 4P5MB 4XMKH 1MIML 3QDJE 4F8QA 3RWDA 1ZLVK 1OSPL 4JRWA 3MXVL 5IP4A 4NKDB 4KJWC 3D39A 1AO7D 3MOAH 1WEJH 2Y5TB 2AJ3B 1Z0MA 4ZPTA 3BYTA 3WO4C 1JPTL 3SGEH 2J8UA 4YDVA 1NGWA 3L1OL 4WWKC 3KXFE 2AEPL 4ZO9A 1OB1A 1INEH 1TJIL 4TULL 4J4PC 3T0EE 1MQKH 1N0XH 4WW2C 1UKTA 1YEGL 2FGZA 4G8IA 3EGSB 3U6RB 1U8MB 4JANA 5C8JA 3DETD 1FRGH 3BN3B 1G9ML 1X5IA 1P5VA 3GMMA 4MQSB 5C0DA 2J4WH 3UYOD 3I50L 4YHKL 1KTLA 2HKHL 1NMCB 4OQ1A 1VPOH 2H26B 2D0GA 1H3XA 3CXDH 1U42A 2P5EE 5SWZE 4HZLB 2LVCA 4JRXB 3S35L 2GHWB 4PGEB 3JSSA 4MZ2A 1N8ZB 2QTEA 3DHJA 3RTQA 2BY3A 4QRTB 1KPUA 2NY2B 3KPPB 3DETC 3HCVB 5JHDE 4MNHB 3IYLW 4R97B 1YMMA 3H9SA 4YUEH 4ZFOB 4TSAL 2QKIA 1UWEL 4S1RL 4AT6A 1BVKB 3ARGD 4EI5A 1P6FA 4XCCH 3HC4L 2L7UA 1ZMYA 5KSBE 1AGFB 1GPOL 5EZIL 5DJXA 4CADA 3P0GB 1KNOA 1RMFL 4KXZI 5D6DC 1F4YH 1P2CB 3EYUL 4WI5A 1E4XH 5DSCA 3VFTA 3MV8D 4YIQB 1S7XB 4JRYE 4RA0C 3P73A 4RGOH 1XH3B 4NKIH 2IANB 3ARGC 2EO1A 5FM8A 3QHTC 4HT1H 4Y5YB 1S78C 3LN4B 5T1MA 1FNGB 4K3GA 1DUZB 4MA8L 3C6LB 3DMMA 4YHIB 3QFJE 1NCAH 1D5MB 1Q9OA 1I3UA 1YJDC 4NOFA 2B0SH 1RZIA 3TA3B 5E2VL 5BW7A 2DKSA 4X6EA 4J3WA 2EH7H 1WCQA 4KJYA 5FECB 4Q6YA 1JFQL 3N9GH 4H88L 1HYRC 1BIIA 4N0UA 1OARL 1AGBB 4JR9L 4KUZL 4GUPA 4JQXC 2BMKA 4LP5A 1XIWB 2VDNH 4LRIA 1OT2A 3VA2C 1X5AA 3L3DB 4YGVB 3OG4B 5J6GB 4RWYL 3E6FA 5IFJA 4DGYL 5CJ5A 1HHGA 5IR1B 1MAML 3TNMA 3QWRA 1QACA 1LO3H 2D4DA 2PUQT 4F7CA 5D7KD 4PG9A 5EO9B 4F7MA 4JM2D 1P4LB 1AQDB 1U91B 3G5YA 3UPRB 1WFUA 1ZANL 4ONFL 3ZYZA 1KYOK 1AHWB 4I0CC 4UIKL 2FR4B 3PHOB 4PJ7B 5EO0B 3P4LA 1RJYB 4P5TA 1FPTH 5ENWA 3M1BB 3CMOL 5JW3H 5HYJB 3VXSA 3MRNA 1RZFH 1CFVL 4G7YH 4HCRH 3LQAC 1P53A 1I7TB 4CDGC 3VXOB 2WINA 4JM2C 3NCFB 1CFTB 4P5MA 4NKQB 4P5KA 2Q20A 4FQPA 4LQFH 1UC6A 2CUMA 4K3JL 4NKDA 5CBAB 5KS9B 5C6PB 4GJTB 1UFUA 2Y5TA 1QNZL 2AJ3A 4QRRD 2IQ9L 8FABB 5I0DA 3EYSL 5FCUL 5EWIH 1GC1H 4DCQB 4J1UB 3NIFE 4X7EC 4LAQL 5HYQB 2GUOB 4ODVH 3ZTJH 1U8JB 1NCCL 1T20B 4OZHB 3WFDL 1IEBB 3EGSA 3U6RA 3OXRB 4X6DE 1KXTB 1U8MA 1MY5A 2G5BB 4XCYB 3CX5K 3THMH 2HVKB 1S5HB 4GKNB 3TBWA 2LV4A 3LKQB 3N1GC 1CXLA 4M03A 2F5BH 1CFQB 3VD7A 3QCUL 3UTPD 5IB2B 4KRNA 4IRJB 4MA1C 4EDWH 2VZSA 4HKBB 2H26A 4ZNEE 1XCQA 5BJTB 4HZLA 1W72A 4NGHH 5D72L 3NACH 4JRXA 4PGEA 5MENB 1UWGH 4UUJA 1N8ZA 3PQYE 5KTEL 4LSDA 2PCPB 4QRTA 3KPPA 3HCVA 5ADOH 3DVFA 4MNHA 4PP2B 4WHYH 4MB5A 4ZFOA 1WT5C 4JZNB 2HN7B 2C4FT 1BVKA 3MYJB 2JB5L 5DA4A 4ZO6A 4A6YL 4E41E 3QEQE 3UZVB 4Z7VF 4ALAL 4XVJH 4QRSB 4NYLB 4UBDD 3OSKA 4OLUL 4FQLL 4YE4L 1P2CA 5E00B 3OGCA 3E3QE 3IDJB 3SDXB 4YIQA 1S7XA 1XH3A 4LDLB 1X4XA 1Q9WB 2IANA 3ULVD 2VLLB 1A14L 2YUXA 4Y5YA 1LNUB 2YOCA 3LN4A 3CFEB 3ZLQC 4YHIA 4KV5E 3C6LA 2VTFA 4JFHE 1D5MA 1FC2D 2VZ3A 1U36A 2FH8A 4PJAF 4R7NB 4P2RB 4UBDC 4ZS7H 3MA7B 5E8NB 5CWSB 4C56E 3VD4A 4N8CL 3ZE0F 3VXUB 1OAYH 1CL7H 3AM8A 1XT5A 1A0QL 4OQTA 4ZS6D 1IC7H 3CK0H 5EUOF 4OCRH 2FSEA 4F7PB 2OQJB 1AGBA 1BFOB 3QIUB 2DI7A 4LOUD 3ULVC 5TPWL 3T0BA 1DE4B 1UM5L 2P5WB 4YK4C 1XIWA 2ED9A 2EYTB 3S7GA 1AJ7H 3HZMB 3L3DA 5C0ND 4YGVA 4MA7H 4JO4L 4Q0XL 5T1KD 3VMPA 5TE7L 5J6GA 1QQDB 1DL7L 4PUBH 5IR1A 4LCUB 3X14B 2DQDL 3ETBF 1OP5K 4L1HA 2C3VB 4N9OB 1TJHH 4ZS6C 3U7AA 3U7WL 4MJ2A 5EO9A 1FIGH 5EC2A 1P4LA 1U91A 1DLFL 4HUXA 3UZEA 3ARUA 5EU6B 5LGJB 5E7FA 1AHWA 2Q8BH 5C0NC 1ZLWK 2R0WL 35C8L 2FR4A 2CQVA 3BDBA 1XF4B 1YJDL 4PJ7A 3ECBA 3HLAB 3M1BA 4PLOB 5HYJA 1KXQE 3ZE1F 3U9UB 3WUWG 1G9EA 1LO4L 1KV3A 2CDGB 4OKVB 4ENED 3VXOA 4MCZB 1OWWA 3ZE2E 2K1MA 1BJMA 2IJ0C 3JTTA 3I9GL 1P4BL 1SYVA 3H42L 2HRLA 5KS9A 5EORL 3O8XD 3NFPB 4K3EH 8FABA 4WTZG 4D0DB 5L2KD 3ZDXF 1IAKB 4J3OC 4Z7WE 1K8IB 1MCWM 2V9RA 3VU2A 3BIAX 4JN1L 4DCQA 4JJ5B 4J1UA 1LVEA 2C1OB 2GUOA 4V1DD 4LSSH 4ENEC 1U8JA 3RDTD 4X7SL 1T20A 4OZHA 1ACYH 1S8DB 4G9FD 2V17H 3OXRA 1FNHA 2G5BA 2ZUQB 4XCYA 3MUJA 3WJLC 1QOKA 4I3GA 2HVKA 1S5HA 1CK0H 4GKNA 1NCWL 5ID0B 1LK3H 2X4PB 1TDQA 3O8XC 5IB2A 5ESAA 1MCOH 4IRJA 4R0LC 2P1YA 3O3EB 3CXHK 4Z7OE 2NXYD 4HKBA 2CXGA 1JF1B 2NY5C 2I27N 3BOVA 5BJTA 5IESL 4O9HL 4EBQL 4M6ML 4HSQA 2NY7L 3RDTC 1PKOA 4YR6B 1QHOA 5GS3A 5MENA 3LQAL 1KG0A 2ZNWA 5EOCH 3MREB 2P7TB 2Q6WB 2MKWA 2PCPA 4PRHD 5FYJU 5C2UB 3MA9L 4HH9B 4PP2A 4Z7VA 4JZNA 3BAEL 2Q8AL 2HN7A 2K7PA 4YHOH 5DJ2B 2ID5A 3MYJA 2APVA 2NXYC 3VXRE 5AZEH 3BEWB 5E6ZA 1CTOA 4UOW0 1S7VA 1FGVH 5FDWB 4QRSA 4NYLA 4RMSA 3PDOA 4LLUB 5GGVL 4MJIE 5E00A 2OMBA 2Z4QA 3UX9B 3R06B 3IDJA 3SDXA 2BDNL 1J1PL 3EJYD 5JOEA 1DCLA 3VFVB 5C0BD 3Q6GH 1Q9WA 4KH2A 1QA9B 3SDCB 2GJ6E 3K7UA 2VLLA 1LNUA 3HZYB 4LKXA 2JCCF 3EYVB 4GXVL 3CFEA 3FQXB 5GPRA 4TNVF 4NN5B 5I9QC 4AIZB 2X89D 4R7NA 4P2RA 1EEQA 4GRWE 3MA7A 5E8NA 4MJ6B 5CWSA 5F6IB 1CF8H 4JFPB 4UV7L 3BGAA 4LBEB 1FNFA 3RP1A 3VXUA 2OMNA 4J8RB 1RUAH 5D70H 2QBWA 1MFAH 4AM0B 3GJFK 3EJYC 1AO7E 5JOPD 1PKQB 4F9LA 3FFCD 1MHPL 2OQJA 1BFOA 3G04A 3S5LG 4HGKC 3RGHA 4M5ZL 1QSEE 1DE4A 4HPOH 2P5WA 4FRWA 3SCMB 2EYTA 4UINL 3HZMA 2GITB 2VLJB 1NC2D 2L7JA 5FB8B 3MODL 4K8RD 3D48R 1QQDA 5IJKC 12E8L 3NCMA 5GRVL 3ROLB 5AZ2L 1BBDL 3MLZL 1U8KB 1TNMA 3QDJB 3X14A 4EEEA 5IBUG 3A6CL 2C3VA 4M5YH 4P9MH 4OKDA 5IMOB 3IFNH 1EV2E 5HVGB 4O51A 1KIQB 3BKCH 5C08E 3NZ8B 4MXWH 3C6SB 5K59E 1A6AB 4TUJB 4U6YB 4XC3H 5FYLD 1QSVA 5EU6A 5ABDE 2JK5B 4QOKD 5LGJA 5F9JB 4K8RC 3DTXB 3HE6D 3CZFB 1DQDL 2Y07H 5DMIL 1NJ9B 3HLAA 4S2SB 3G6JE 3HG1E 4X4ME 3U9UA 1YPZE 2AXHA 1YQ2A 4B0MM 2CDGA 1D3CA 4OKVA 1NH6A 3GJFB 4MCZA 2C1PB 4M9OA 5T1DL 5LGHH 2ZUYA 5C0CD 1JE6A 4YBLC 4PR5A 2P5EB 2BVUA 4K9EH 4XNZC 4UU9B 3NFPA 1AFVL 3ULUC 1K3ZA 3FOMB 3WEXB 1F8TH 4D0DA 3HE6C 2D31B 1IAKA 1K8IA 3NN8B 5D2LB 4BFEA 3F12B 5F1SA 5JHDB 4JJ5A 2C1OA 2LE9A 4HHAB 5DD6B 1CU4L 1AKJB 2CK0H 4PJGB 2GY7B 2DIJA 2G9HB 2WLZA 4UTBH 3GK8H 2VLRD 5GGSB 1S8DA 2DQCL 2CIIB 1KACB 3U0TB 4MDIB 2ZCHH 1DBML 1MFBH 3DBXB 2OCFD 5ID0A 2JE8A 2X4PA 2OR8A 3BT2H 2GAZB 5KSBF 3OMZA 1LDPL 4TSBL 3O3EA 5I8OL 1MJ8H 1JF1A 3ZKXC 1FHGA 4PRBB 3TC9A 4JRYB 1A6UH 1B0GB 1GH7A 4YR6A 4EQ2A 4DGIL 3C08L 2P7TA 3H2WA 1VGEL 4ODWB 3P11L 3V7AG 2BY1A 3NZHH 5KSAB 1P84K 4W4OC 1CDHA 4HH9A 4N68A 4P23C 2H45A 2MJWA 3VFUB 3QFJB 3CVHH 1V7NL 2C9AA 5DJ2A 3QG7H 5KJRL 3L95B 5E24E 4R2GD 3QEGL 3KYAA 1R24B 1MRDH 5JOFB 1LP9E 1AD0A 1JPSH 4NT6B 3BEWA 1UB6B 4P2OB 2DS4A 1FYTD 4K7PL 5LAXA 5FDWA 5I1GL 4WUUD 2E7BA 5D7KE 5FXCH 1H8OA 5EB9A 1QR1B 4LPYA 4HAGA 3BH8A 4UTAH 2VRAA 3R06A 2EYRB 4M1CD 4NO5B 5L0QB 1KCUL 3MRHB 4JAMB 3RAJH 2JCCA 3VH8G 5GS0D 3QXAB 1Q0YL 4Y2DB 1ZA6A 3VFVA 1U58A 2DQIH 2UV3A 4LHJB 4JFFA 1QA9A 4R2GC 4KK5D 3SDCA 2VXUH 1KJ2B 2VC2L 3HZYA 3EYVA 3FQXA 3N1FC 3B8SA 5JTWA 2NY5L 4AIZA 3TYGL 3DX7B 2IWGA 5ICXB 1F58L 4CVXB 3NCYP 4MJ6A 2DI9A 4JFPA 4IDJL 5EN2B 1MHHB 4LBEA 4J8RA 1VEPA 3QDAA 4M1CC 4N0CD 5ANME 5CKGA 1U8LA 4WU7B 4AM0A 5GS0C 5BS0E 3IFOB 4G80B 5DJZB 1PKQA 1NLBH 4GMSL 5DHYB 4Z76B 4KK5C 3PGDB 3QFDB 1BWWA 4ZDHA 5JDSA 1LQSR 3SCMA 1QSFE 1TXKA 3HI5L 2DRUA 3TEUA 2DBLL 2GITA 2VLJA 3V7AE 2YK1L 4APQB 4Y5XB 3ROLA 5SV3A 3WIIL 3QDJA 1U8KA 4MD4B 5KVDH 2WK2A 5IMOA 3GGWB 3UTPE 4ELKB 1HSBB 1OGTB 1A2YB 3NABL 3PNWB 3NZ8A 1R3JB 3C6SA 5TFSH 1A6AA 1OM3L 3KXFA 4TUJA 3BXNB 4U6YA 1Z9SA 4Y16B 4J23A 5FYJH 3QUYB 2QHRL 5F9JA 4M9PA 1MWAH 2X6MA 1I3RB 7FABL 3CZFA 4L5FL 4GQ9L 3WFCL 1NJ9A 4LPCA 1XGQB 4X6DB 2VN4A 4S2SA 2ADFL 4PRPD 3GIZL 1NFIB 5DQDH 2ARJQ 1R3LB 3CMGA 4X6DF 3GJFA 3DXAE 1G6VK 1IVLA 5JR1L 2C1PA 5JW4R 1N6QH 3AMLA 2ERJB 1I75A 1VADA 5CAYB 3MX0A 3QHZH 2P5EA 4BH8B 1FE8L 2AJZB 4UU9A 1HQ4B 4DEPC 2WWMD 3Q6FB 4IOSD 3FOMA 5JXEA 2D31A 2R0LL 3NN8A 5D2LA 4OFYD 5F6HJ 3F12A 4KK8D 5F7NC 5IHUH 4LDOB 5JHDA 1AI1H 4HHAA 1H3UA 2YZ8A 5DD6A 4CW1B 2R9HD 3GEWB 4M43H 1AKJA 4PJGA 5BV7C 4XAWH 1L7TL 5GGSA 3UTSD 1D9KC 3T2OA 1NFKA 2CIIA 1DSFH 2CPCA 4HXBL 3UTZB 4MDIA 1SM3L 5C71A 3DBXA 1A3LH 4KMTL 2C5DC 5H37H 4IMKA 3L3GB 4KHXH 5H35B 2GAZA 1ERNA 2WWMC 4RX4A 2J5LB 1EXUB 1JRHH 1BD2D 2B1AH 4NUGH 4WUKH 4K8RL 2WIIB 3KHQA 4RRPA 1AGDB 4HFUH 4PRBA 1DFBH 4GRMB 4BA8A 5F7EH 2R9HC 4JRYA 1B0GA 2H6PB 1MCRA 3KR3H 3S88H 2WBJD 3DOSA 4YEFA 2VQTA 5J1TC 5I0ZA 4ZOBA 1AY1L 4EXKA 1KJ3L 4ODWA 1HINH 1VSCA 2X4UA 2D7TH 5KSAA 5J1AB 3ALPA 5IW1B 1TCRB 3QFJA 3O41B 5FKPB 4HKZB 1TETL 5GISH 3F62A 4C56B 3ULUL 1R24A 5J11B 4KGLA 4XVUD 5B22A 5JOFA 4NT6A 4ZAKB 1UB6A 4P2OA 3X3GL 2EC9U 4DVBB 2ESVD 3GHEH 5D93B 5I8CA 1FVDB 2C4XA 4N0YL 4QXUH 2WBJC 3LIZH 2EH8L 3ARDB 3AY4C 4YDKL 2DQUH 5CIPB 2N7BA 1FAIH 2NY0D 3K4DA 4NO5A 2EYRA 1A7OL 4JAMA 4Y5VB 3HZKB 3QXAA 2HWZL 4LPWA 3V4PL 1SY6H 4F15B 3VXMD 4JDVB 4OB5L 3CDCA 1ZEAL 3KPSD 4XVUC 4WFED 1KJ2A 5C3LD 1JNJA 2OL3L 2DYPB 4XGZB 2ARJB 4I18C 5ICXA 3H8NA 4CVXA 1O7VA 1F4WL 2OJZH 3KLAB 2DD8H 4KVNL 5EN2A 3TCXA 4CJ0A 3B9KB 5A43C 1MHHA 1T5XB 2NY0C 3OAZH 1PEZA 1URLA 4QHKJ 5ALBL 2EDXA 4WU7A 1A6TB 3IFOA 4G80A 5DJZA 5DHYA 4Z76A 5L2KE 2J6EA 1BQUA 4BM7A 3PGDA 3H3BC 3QFDA 3RWFB 5IT2H 3RA7H 3ARQA 1OAXL 3O3BB 3IFLH 2HMID 4V1DE 3GBNL 5ISZD 4APQA 3M17B 3IDXH 3P40A 4G9FE 4Y5XA 5HVFB 3W39B 4WY7L 1CDIA 4DN4L 1C1EL 5JNYB 4MD4A 3T0WA 1CD9B 5F9AC 2E7CA 3OPZH 3GGWA 5LQBH 4ELKA 1HSBA 2R2EB 5JW5B 4R6UA 1A2YA 3PNWA 4KXZH 2OR7A 3MOBL 5FEBA 1R3JA 1N2RB 1RSFA 4QKXB 4OCSH 5FHBL 3BXNA 4Y16A 1L6ZA 3QUYA 4LSRL 2ZG1A 2HMIC 4Z7WF 1JZ7A 3QCTH 1B0WA 4WI4A 1I3RA 4JO2H 3DYOA 5CEZH 1UB5B 2HT2D 3PGCB 5DD1L 3K81A 1XGQA 4P57B 3PL6D 4X6DA 4PRHE 4JE4B 4JG0L 5FGRA 1BFTA 1NFIA 5C2BL 4Y19B 2KUTA 4NHCL 1R3LA 2XKUA 4YHYC 3O6LL 4N8VB 1V8HA 2KKQA 3WFBH 1UKSA 2NLJB 4NO0D 2AJZA 4NKOA 1HQ4A 4JFOB 3RZCA 3V0VB 1EO8L 3T04D 2HT2C 3RU8H 5BOZG 4CW1A 2YHGA 4NQXA 4C57C 3TF7C 4ZSOE 4NO2B 5C0BE 1JYWA 1FZJA 3DWTA 1KFAL 4U7SA 5C0AB 3VXRB 1QYGH 3HE7B 3QEQA 3L3GA 5D96B 5H35A 1JK8B 1EXUA 3L6FB 4MJIB 4E0RB 2B7DT 2WIIA 4GSDH 2EDBA 1AGDA 1Z5LB 4GRMA 1CDUA 2BSSB 4KAQL 3P2TA 5JOPE 2VOTA 5IF0B 2KBGA 4KC3B 1CR9H 4A6YB 3QXDB 2HH0L 4WWKB 1ED3B 4JM4H 2FH6A 4FXGB 5J1AA 1IC5H 5IW1A 1TCRA 2ZSVB 3O41A 1QFWL 4MAUL 5FKPA 5T3ZD 1BVLB 4C56A 1MIEL 1F6LL 3MUHL 2PW2B 5DD5L 2VXVL 3QEUB 4ZAKA 2ZCLL 3LPWA 4JPWH 4GRWF 4RBPH 4DVBA 3HR5B 4WW2F 2UZIL 1FVDA 1QLEH 1YEKH 1AO7B 4BUHA 2A6IB 2JELH 3ARDA 4NWTL 4QWWD 5BV7L 1CGTA 3S3PA 5CIPA 1Y6KR 5GGQH 5TDPB 4HUNB 3EOTL 2B5IC 1L0YA 4TSCH 1FFNB 2YSSB 4QOKE 3HZKA 4Y5VA 3IJSB 4XPBL 1K6QH 3ULUE 3K8MA 2YS4A 1S7TA 3CFKB 1KBGH 4JDVA 3ZKQD 5CD3B 1BQLL 4EUPG 2JF1A 5I1AB 1U8OA 3TBYA 4NQSB 5F89B 4XGZA 4R9HA 3HI1B 4FQCL 2ATPB 5IK3B 2UUDH 2ARJA 2FGWH 5E5UB 1MCNA 3V5HB 3F7RA 4OZIB 4QWWC 4KTEH 2LTQC 3KLAA 4XMLH 1T5XA 5C0CE 5L2JB 3OF6D 4HIXH 5I16B 1JI1A 1RUQH 4Q9QH 5F70A 3PHQB 1A6TA 4X9FA 1NFDE 3PGFL 1A6ZB 3WSQH 5K59F 4Z95L 2O5ZH 2FYYB 4U1MB 1CDCA 1PZ5B 3O2DL 3G6JB 3RUGF 3W5NA 1YPZB 3PP4L 1WQVT 3O3BA 4HWEH 5JW4N 2WUBH 1WC7B 3SDYH 3M17A 2VLRE 3G6JF 3S3SA 3ARGB 4PS4H 1E27A 1YPZF 1ZHLB 5JNYA 2HFFB 1XF2B 3VRLE 3WS6A 3WNLA 1LO0L 5KOMC 2R2EA 1WAAE 5JW5A 3IAPA 1N2RA 1WZ1L 4I9WD 5D1ZD 1CDYA 4OZFB 4XNXL 3W9EB 3QJHB 3LRSB 1CICC 2CD0A 3SBWA 3MV8B 1YC7A 3LRHA 4K3DL 4ISVB 3BX7C 1QFUH 1MFCL 1UB5A 3FL7A 3TPUB 3PGCA 5LKNA 4P57A 5F9OH 5TGBB 3GM8A 3F7QA 4D94A 1TMCB 1YA5A 4L3CB 4MNQD 1JNNL 2DICA 3VDCA 4OQTH 5E6ID 4Y19A 1YNKH 1OAUL 2NY6D 2GYSA 4N8VA 3BQUD 1C5BH 5D1ZC 1IGCL 2JB6B 2NLJA 4Q58C 3ARVA 1FYTE 4WUUE 4JFOA 3V0VA 5EG6C 3DX8B 4XPTH 4HH8A 3C5JB 3C9NB 2GQHA 4XNYH 4YDJA 2WLYA 3NAAH 1SJHB 3P4MB 3O4LD 4HWBH 2ORBL 5E6IC 1MRFH 4NO2A 1BQHG 2NY6C 3BQUC 2QL1A 3VXRA 3HE7A 1LP9B 3RHWK 5B39B 3U4EB 1BFVL 3O2VL 1FORL 2E7LA 4QXWA 1JK8A 3L6FA 5IVNA 1J8KA 3AVEA 4MJIA 4E0RA 3R8BB 4JM2B 3TWCL 3IKCB 4K2UL 1Z5LA 1FL3B 3G5ZB 4PY7B 1IL1B 2GKIA 5L88L 2BSSA 2BX5A 4NFCA 3RX7A 3CGTA 2VKXA 5IF0A 1HH9A 3MRPA 4A6YA 4LCIL 5L9DH 2GJ6A 1RIUH 1BZ7B 1OQXA 1OTSD 3ILPB 4WWKA 4XBGB 1ED3A 2BVQA 4FQ1L 4HBCH 1IMHC 4Z9KB 1KN4L 2NY3C 3BE1H 2ZSVA 5GRVK 3PWVA 2H32B 4J4PA 2BOBB 4NQDD 1BVLA 3BPLB 2PW2A 1I8LC 1G7MB 4BQ6A 4ONHA 3LS4L 2HRPH 3QEUA 3WD5H 2A2QT 3HR5A 4FFWC 1NCNA 4NBXB 4YBQD 2ZUTA 1AO7A 1FO0B 2A6IA 2VUOA 4QRRB 4MA1B 5J4MA 1OTSC 4PJ9D 2YPKA 3O9WC 5TDPA 2VE6A 4M8QB 1J8HB 1VFMA 1MI5D 1FFNA 3D3VB 2YSSA 4JKMA 4M48H 5HHQB 3N0PB 3IJSA 4UDUB 4JZOB 1R5IB 3ARTA 4GT7A 3QZWG 3CFKA 5CD3A 1I9IL 3RHWF 4NJ9H 1NSNL 5I1AA 4NQSA 4RZCA 5BRZD 3HI1A 2UY6A 2AQ3A 2F74B 2ATPA 5IK3A 1RULH 2GSIA 1LHZA 4YBQC 5I1JL 1RIVH 2WWKT 1XGUA 5D71L 3V5HA 3CD4A 2DMBA 4OZIA 2AEQH 3BN9D 3O6FD 4LKCB 1T21B 4HF5H 4PJ9C 5H2BB 1Q9LB 5L2JA 1DBBH 5I16A 1MNUH 2OTPA 3LPGA 1ZLUH 5C70A 1S7QB 5IOPB 4HBQA 5IJVB 3PHQA 1LE9B 1IKNC 2E5EA 1ZK9A 1A6ZA 4X7TB 3QQ4B 3UBXB 5D6DA 1R3IH 3DYPA 2LU4A 1IFHL 2X1WL 2VDKH 2FYYA 4U1MA 2YMXH 3G6JA 3HNTH 2G5RA 5C0JB 1YPZA 1L7IH 3KNBB 4JPIA 1WC7A 5I71C 1L4IA 3ARGA 3O6FC 5E99L 1KLGB 4CVZB 1ZHLA 2E3VA 5B3NA 2HFFA 4RSVA 1WWWX 5I1CH 1XF2A 1U3ZA 1CXFA 3ZYIA 3QRFM 1CXIA 5GRUL 1KEGH 3FJTA 3VG0H 1QG3A 1U92B 5FO9B 4OZFA 3QQ9D 3QJHA 2HFGH 3LRSA 3SDDB 1XGTB 2KPNA 4JFZH 1V3KA 3MV8A 5GHWH 4ISVA 2FEEL 5DD3L 1ACZA 3S34L 1NCTA 3IU4L 3TPUA 3Q48A 1CGXA 5JQ6L 1F00I 4JQXA 1BZQK 2WUCH 4TUKH 4L3CA 2EDHA 4OCYL 5AD0B 1FFQA 15C8L 3OAUL 4AIOA 5JIHA 4AEHH 3CFBB 4GW5B 2JB6A 3QQ9C 2E27L 1S3KH 4DZBB 1I1CA 2ESVE 1F3DJ 5GGTL 1LO2L 4M00A 2GFBB 4OIIL 4OLVL 4XHJD 4DOHE 4LP4A 5KVMC 3HN3A 3DX8A 4FTVD 1NLDH 3VI3E 4FHBD 3C5JA 3C9NA 4N5EC 3QHFH 4KRPD 1SJHA 1Q9KB 3P4MA 4QF1B 1YEFH 4Y4HD 1UH4A 4BK5A 1PG7X 4B7LA 2M8XA 4ZD3H 3KWWB 3S98A 2H2PD 5KVFL 4F3FB 3VXME 5T1KB 4UAOC 4N9GB 4EOWL 4N5UA 5B39A 1LP9A 5E56A 3JWDH 3U4EA 1JHKH 4MDJB 1DDHB 2H8PB 3OR7B 5DXWA 4DJMA 4P9HC 1DQML 3QO0B 2HT3D 4XHJC 1D5BA 4YNYB 1JPGB 4KHTL 4GXUN 4JM2A 3IKCA 2FB4H 3B9VA 3QUZD 4KRPC 1FL3A 3G5ZA 1A5FL 4PY7A 4Y4HC 1IL1A 2AP2A 3GMQB 5BVPL 3WBDA 4P2QB 2H2PC 3OJDB 1NKRA 4UB0H 3MLVH 4QYOB 3OZ9H 2B2XH 3ILPA 4U6VH 4XBGA 1QO3B 2AJYL 4B53A 1DTUA 4PGCB 4U1SB 2H32A 2HT3C 4QXGH 1F11A 4KQ3L 3TESA 1J1OH 1G7MA 4ORGB 3QUZC 2HJKB 4M93C 3MTRA 3O81A 5HYIA 4TRPL 2YD1A 5DWUL 4FQIH 1E6OH 2V5SA 4M3JA 3O8XB 3SE9H 1FO0A 5I2IB 4WCYH 4KTDL 1YNTB 4QRRA 5L2KB 4G7VH 1IQDB 2W9DH 2NTFB 4R0LB 1E4WL 5FV2A 4M8QA 4PP1D 1NDMB 1SEQL 4TYUA 5HHQA 2R29L 4UDUA 5LXGH 4JZOA 1R5IA 4WHCA 1GOHA 1QBML 1IT9H 4G9FB 1JZ5A 5FFLA 3TYFB 1CLYH 3X3FL 4P3DB 3T08A 2DKMA 2F74A 3IGAA 3O6KL 3U1SL 4YHLL 4PJ5B 3UJTH 3NIDE 2DB8A 2W92A 1INDH 4E42B 1FCGA 3UBXI 4LKCA 1T21A 3UO1L 5F7FA 5H2BA 1Q9LA 5JA8B 3LS5L 3HC3H 1S7QA 5GSRB 5IJVA 5IOPA 5D1XD 4NFBA 1LE9A 1WGOA 2EDKA 4J3UA 4MNGE 3PG2A 3HNVH 3MO1B 4X7TA 3UBXA 4XP4L 1MJ7L 4LSPL 2VR9A 3INUH 5J1SC 4FS0A 3WFZA 3KNBA 3K74B 4BQ8A 4YXHL 3V0AC 3V79C 4NQED 5I74C 4Q9CA 5BZDB 4F57L 2AXGB 1QFOA 2XY1A 1D5IL 3G6DH 2PYED 5D1XC 2AGJH 2MHAB 2XQBL 3NFSH 4JQIH 2ADJB 3R0NA 1NCBL 5JIKA 1U92A 4KI1A 2UWEE 3MJ6A 4GS7C 2RFXB 1XGTA 4I13B 2DLFL 2AXFB 4PJXE 5KW9L 3GI8H 2KDGA 3ZHDA 2EE3A 2P43B 5C0BB 1GZPB 1CQKA 1WICA 5F72S 2DLTA 2Y6SD 1DUYB 1CLOH 2FD6H 4M7ZC 5AD0A 3V2AR 1RZJL 2EDDA 2Z93B 5T3ZE 1L0XA 1BWMA 1NAML 2ICWJ 2AABL 3CFBA 4GW5A 4JDTL 4DZBA 2JJSC 1DN0B 2X4RB 5DRZB 1S7SB 2GFBA 5FYKU 5KZCD 3FFCB 1SYSB 2X42A 4NBZB 5I1KH 3HMXL 5JUEL 4PLJD 2Y6SC 5AWNH 1DVFB 5F1NB 4GAFB 1MCEA 1NC2B 4F3FA 3CSPA 3U0WH 2PTUA 5T1KA 2A6KB 4N9GA 2BXYA 4XB8A 5GJSH 3VRJB 1KPVB 2X4OA 2CKBB 1EBPA 4WHDA 4OLYL 4MDJA 5DQJB 3W2DL 1DDHA 2H8PA 1P7KA 3OR7A 2CDFB 3DO7B 4OJFH 4GOSA 4MA3B 3QO0A 4BELD 4H1LB 1CTNA 3KGRA 4G6MH 2A9NL 1KGCD 4IM8A 4S1DD 4YNYA 4M62H 4MLSA 4JB9H 1JPGA 4WFFE 4LVNC 3MRDB 1EAJA 3T2NH 3UTOA 2IPTL 3GMQA 5CUSL 2H9GB 3M8OL 4OF6A 1CXKA 4QOKB 4XNZB 1F4XL 3MYZA 3OJDA 1WZKA 4S11A 5DMYA 1Q0XL 4QYOA 1HSAA 3HE6B 2F53D 3UC0L 5I30L 2W07A 1LEKA 1QO3A 1RZ7L 5B8CC 1EK3A 3T4YB 3ULUF 3LMJL 5DLML 3L7EA 4PGCA 3MV7D 2EDEA 1Z3GH 3VFSB 4S1DC 4DVRL 1LO5B 1DBJH 4ORGA 1I9RH 3ZYOA 3TBSB 2HJKA 3WJLA 1ADQL 3S36L 3H0TB 1BM3H 2DBJA 5B3JE 3WE6B 4PJHB 3O8XA 1LILA 1K85A 5I2IA 5ADPH 1YNTA 5IMLB 5L2KA 5B21A 2NTFA 4R0LA 5IQ9B 1G84A 4I9WE 3ZKXB 1NDMA 1EH9A 1NFDF 4DGVH 4GKOA 3DGGA 3FQWB 1NEZB 4V1DA 1OW0C 4P9HL 3RDTA 4PB0L 5GZOD 2VLRB 3CAFA 4G9FA 2D3VA 1GSMA 4HS8H 4P3DA 1IAOB 4MNQE 1PEWA 2XG5A 3PWPD 5TJWK 2VISB 4LLAA 3A67H 4JFEE 3GKWL 1IGTB 1FVEB 3MLWH 4H26B 3TN0D 1HN1A 2R0KL 4EJ1C 3VRLF 5F6HI 3CVIL 5FGBA 5I15H 4J2XA 1WAAF 5GSRA 2OI9B 2FECL 4BSVB 4U7MA 4MB4A 3MACH 3MO1A 2VXQH 5GZOC 2HFTA 1BMGA 2BNQD 4QLRA 1W0VA 4PRHA 1ITBB 4OIAA 3D87B 2F8OA 2Q7NA 3O4LE 4D0CB 2RHEA 1NCDL 3P0YH 4TVPD 4JVWA 3AGVA 5BZDA 1MFDL 2WMPA 3QEHB 2AXGA 2E9JA 4R2GB 1PZUB 1G9NH 4PJCE 3BPOC 2VXTH 5HGAB 3TN0C 4AEEA 3TJEH 2MPAL 2RJMA 4ZUTB 1FYTB 1FNSL 1NKOA 2R1XB 2MHAA 1RZKH 2ADJA 1ZGLB 1C7SA 1E4KA 4AYFA 2NY1D 4JHWH 1KJ2H 3L3HB 1CLCA 4KKCD 2FATL 2RFXA 4YAQB 2X4SB 2AXFA 3U4AA 3U0PB 3MLTB 1NMAH 1CVRA 5ILTH 1T1YB 1NAKL 5C0BA 3OTTA 1GZPA 1I3GH 2FX8H 4PRDB 1X5JA 1OAZL 2J2ZA 3PP3H 5HSFA 1DUYA 5DK0B 1IQWH 4YHMH 2OYPA 2YD9A 1ZHBB 3AAZA 5E2TH 1T04B 2C3XA 2EDJA 5TQ0L 2X89A 2Z93A 4H0IA 5CGMA 2J88H 4NQDE 4AEFA 3GB7B 4X5WA 3BP4A 2NY1C 5IJKA 4D0BB 2J6EH 4X6CE 2X7LB 4KKCC 5H94B 5CJXC 1DN0A 2X4RA 4TOYL 1S7SA 2CR6A 5DZLA 5DD0H 1DQLH 4NRYA 2Y06H 5JMRA 4L4TE 3FFCA 4S0SD 1SYSA 3SO5A 3E8UL 1H3VA 2XN9D 5A3ID 2R0ZL 4U6HB 5F1NA 2ZSWB 1NC2A 1IEHA 3V4VH 2GTWB 3OGOE 3QA3B 1EFXB 1MRCH 4I8DA 3S8WA 2A6KA 3D1MC 3PABA 1KPVA 5I1IL 1Z2KA 1OAQL 5BXFB 3QQ3B 5DQJA 1DQQB 5BRZE 5D6CB 3RVVD 3DO7A 2CDFA 3SPVB 1FNAA 3U83A 1CI5A 4QHKI 4MA3A 5SV4A 1NDGB 4H1LA 5C7XL 3TO2A 1IGML 1T2QL 5BMFH 4RFOL 3MRDA 2VDPL 3DARA 4XC1H 4UQ2B 2UZYB 2H9GA 1NL0H 1L6XA 4LSUL 4QOKA 4KWUA 3FTGA 1KUMA 3BISA 4DEPB 1JPTH 3HE6A 1N7MH 3L1OH 2QLVB 5DT1L 2AEPH 3WHE1 3BMVA 1C08B 4PRPB 3RVVC 1TJIH 2XNAA 3JWOH 4LARL 3QDME 5CJQH 3VFSA 5BV7B 3KPQB 1LO5A 5DEZA 4MXVE 3V6OC 3KDMB 2I24N 5C0CA 3TBSA 4PV8B 1EX0A 4BKLA 3WE6A 4PJHA 1NFDA 1JMXA 3QCVH 1MVUA 2HKHH 1JZ3A 3GMLB 2OL3A 1YEJL 2ZPKL 4IHOB 5IQ9A 3S6CA 2ED8A 2QQKH 3FQWA 1NEZA 2FNBA 2OJEB 3C87A 4LFHD 4NNPH 5E5RB 3BIBX 3AS0A 2VLRA 4TPRL 3OJVC 3UTSB 4W4OA 4JLRB 1IAOA 1F5WA 5IHBA 4JPKH 4P49A 2VISA 1I3VA 1UWEH 4S1RH 3VGFA 1IGTA 3IDMB 1BD2B 2ICES 3LEYL 1FVEA 4H26A 4B7IA 5FYKH 3DECA 2YA2A 5I19H 2R8SL 1N6UA 5EZIH 3X11B 1I1RA 1QTYT 1OTUD 3BD4A 4BSVA 1JWMB 1MFEH 4WENB 2WBJB 3FHQA 3B9DA 4HUKB 2LU3A 5F97E 4F8TA 4FG6D 2DOCA 5HDBE 2HTKD 1N64L 2JKXA 3UTTD 4HUUA 2XIDA 4XVSL 1DANT 2L0DA 3P4OB 5MERB 1RVFL 1C5CL 1J87A 3QEHA 3T8XB 3KVQA 5GRJH 4XXCC 5HGAA 1AXTL 3GMOB 3TP4A 5CIPH 1MCFA 1CFNB 1IGJB 2QQNL 5C0GB 4ZUTA 5FHAL 1FYTA 1OTUC 2ESVB 4WUUA 2R1XA 4DOHB 4I18B 1ZGLA 3WHE0 2Y23A 1ZVSB 5K33A 4LNVA 3L3HA 2NY0B 2HTKC 4PJBE 1X5KA 2EKSB 4Y7MA 4YAQA 1I7ZB 3U0PA 3VI3F 4H88H 4CUCA 2H3NB 1BGXH 4HMDA 1T1YA 1PX4A 3WFEH 4KUZH 2M26A 3CNKA 4NJAL 4W6XB 5LG1A 3NPSB 3KPSB 1S9VB 1BQSA 2R4SH 4WHTB 5DK0A 1M7DA 1PQZB 1R3KB 4YDIH 3VE0B 1LEIA 1HOCA