4A6YB

Crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
214
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTAYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGGSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY BBE6.12H3 LIGHT CHAIN
publication title Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
pubmed doi rcsb
total genus 44
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yB02
4DK6A 1OSZA 4ONOA 3EYQC 1ZHKB 3JTSB 2QQNL 1LILA 4NN5B 5TF0A 4JAMB 4PJHF 4AK1A 4F7CA 3OF6D 4HC1A 1BFOB 5ENWA 4APQC 3WIFB 1JPTL 2W65A 4JFED 4S1SL 4Y4HB 4RAUA 1KB9J 3GMLB 1A2YA 1HQRB 3QULA 4XWOC 3SDDA 1PZUB 1JWMB 4LRNL 2I5YH 3NBNA 3ROOB 1A1NB 5JORA 5EU7E 2R4SL 3GIVA 4X6DB 5C07D 4DN3H 3FQUA 3LD8C 3DLQR 1AXTH 5INCB 4O5LL 5HY9B 4Z7UB 1S5HB 4CVZB 2OMBA 4Z7QE 3MR9B 3RVUD 1BF2A 3OAZH 3QNZB 1E27A 2ZUWA 3KXFA 3OKEB 4BZYA 1E4JA 3QAZB 2E7HA 3GDBA 3VD9A 2EEDA 2ICWJ 2VLJA 4FQLL 5D7JB 2DI9A 5GS1A 1I1AD 4KVCH 5GISH 5K9OA 4WUKL 3V0VB 4J3VA 2OJEB 2VISB 4G6FD 1GC1L 4R96B 4QHNA 3C5SB 5DK3A 5DYOA 4HXAH 4RWYL 5FV2A 1ADQA 2H41A 1WCBB 1F90H 3FB5A 2F15A 4X6DE 4MHHI 5HHMB 4LVNB 5CILH 1U58B 4Y2DC 1MFAH 3DI2B 4HWBA 3MJ8B 5ISZD 1XT5A 5IG7A 3FT2A 5BMFH 5FO8A 5AWNL 2NY0C 1J0IA 8CGTA 2JIXA 1CGSH 1ZE3C 4LLAA 1OWWA 2ED7A 2F54A 2ESVA 1VFAA 3RA7H 2R0LL 5GS3A 1FN4B 4KZDL 2Y06H 3B2UD 4WFGD 5DRXA 4WO4A 4UOJA 5LWYL 3GGWB 5DTFB 5BZDA 2R2HA 1NCNA 4LCWD 3TPKA 4KC3B 4PR5B 2DBLH 5CIPB 1FPTL 3QH3B 2OR8A 3C8DA 5C86A 1ZGLM 5HVHC 1ZA3A 1U2HA 1GZQA 2X9XA 4EEEA 2E6JA 2PO6B 4OZFG 3IDMA 3QO0A 4NZDA 3S34H 4PJFF 1AI1H 1YNLL 3ZKQD 4UIKH 1IGTA 1JYWA 4NP4L 2BNQD 3TO4D 5MHSD 2V5RA 4KHTH 2EIZA 1BLNB 1B2WL 1QLFA 5IMMB 2VL5A 1CL7H 3BP5A 5KSAB 4X4YA 5ITBH 4YX2L 4G7VH 1H15A 1QSED 4FQXB 2FJGB 3OMZA 1IM9B 1RJZB 4X6CA 4NIKB 3SE8L 3H3PH 4RGND 4L3CA 1KENL 2QSCH 4DN4L 4F80A 2J8UE 4U1KB 2JB6A 2IANB 4PJIE 3HAEG 2J4WH 4OD2A 1NJ9B 1OP5K 4Q9BA 1KTKE 3I6KB 1SYVB 3EYSL 4G8GB 4UT6L 4QF1A 4QRUB 1Q38A 4F2MB 1JFQL 1FNEA 2HA1A 2PW2B 2VLRA 3OL2A 5EBGA 5E8PA 5LBSH 1MEXH 2D4FA 3N1QC 1J8HB 4JFOA 2NTFB 3ZDXF 1ZGLB 1CD9B 5T1LD 4NRXA 2Q3AA 4O02L 1NC4A 1MUJA 1KN4L 4X80L 4F9LC 3S36X 1GGYA 2X42A 2BFVH 1WUNT 3QO1A 1FSKB 4EZMA 3EYUL 1FBIL 4UOW0 2XV6B 3F5WA 1KPUA 1EEZB 5IEHA 3ZYJA 2EDLA 4KXZI 4ETQB 2IANE 1Q9WA 4K7PX 4PJ9B 3QG6A 1ACYH 4G8GE 4OM1H 1S7SB 1IGYA 1D5IH 3BZ4B 1IC7L 5D4QA 3RWIB 4XH2A 3KLAB 1ZHNA 1M7DA 1UG9A 1J8HE 5L8LB 5CD5D 5I1HL 4RNRB 5I16B 5AYUH 3CZFB 5DK0B 3O6KH 3SCMD 1ND0B 2R29H 4UIMA 1MRCH 1KN2L 2R9HC 1R3IL 3MACH 4JQXC 1G7HA 3QIBB 2DD8H 1KB5A 5E2VL 1OM3L 1PYWA 3B3IA 5CGMA 4TUJA 1NBVL 3AXLA 1B0GA 4JB9H 4WFED 2EDBA 3D25A 2AJXL 2D7QA 2XKSA 4X98B 5CP3A 5IM7A 4ZUTA 5HJ3B 2ZP0T 4PJHA 4OLVH 5E5RB 3CFIC 3KVQA 4HUVB 2ATKB 2EC9T 4JEGB 1YUHA 3ZE1F 4JO1L 2ICWB 3UJJL 4AIXA 4HV8B 3I85A 4P0DA 1FLRH 3MLSL 1UT9A 1DFBL 3GBML 4IMLB 3VG0H 1D5XB 3QNXA 3I84A 2DTMH 3SGJA 1EHNA 5JHLH 1WAAF 3WFCL 4ODVL 4KMLB 3QPQC 1C5CH 2BY2A 1I9EA 1W0WB 1PX3A 3DYPA 5GGUB 2OL3H 1XGPA 1YDPB 4NWUH 1C1EH 3VXNA 3ES6A 2ICEB 1NKRA 4M1GL 5IROA 5JNYB 4XC3H 4GAFB 1NFIB 5MEOB 3HUJB 2A6IB 1F8TH 3OAYH 1MRFH 5T3ZH 2EDEA 4X4ZA 3GMRB 3HE6A 1DCLA 4ZQKB 4QNPE 3PIQB 1AQKH 2NY1C 2ZUSA 1JUFB 4X8XA 4RFOH 2VNCA 1AD0A 3K74B 4K07A 3B5GA 5C0FB 1N0LA 1YEKH 2BX5A 3WJLA 3AS3A 5EUOB 3MGOB 3O6FC 3TFKD 2X05A 1N6VA 1AR1C 3G6DL 2C1OB 4L5FL 4FFZH 5HGBA 4FHBD 4P57A 25C8L 4L9LC 4XNZC 3WCYA 5D2LF 5T5NG 3Q0HA 1J88A 1PKQB 5MEQA 1T6VN 3MTRA 4N1EA 3A0OA 3GSOB 3IDIB 3VXQA 1HNFA 3ULUL 4LIQL 5FF6B 5EA0H 5FM5M 4OZIE 5DRWB 3MRHA 3UTSD 1FYTB 5LJYH 4HGMA 2NNAB 3W2DL 1RMFH 4MA8H 1S9XB 3P73A 4OZFH 4I0PB 1G1CA 4YXLH 4JJ5B 3NH7H 4M5ZH 3GMOB 3T0EC 2V2TB 4PGZA 5KSVA 4M6OL 1WT5A 2G75A 1JCKA 5F1IB 1TZIA 4OCRL 2ARWA 4R4BA 2YD2A 4DGYL 3SGEI 4KKCC 4LF3A 1N2RA 1HSBA 3HA0A 3QWRA 3IJHB 3KJ4C 3BAEL 3LS5H 1IAIH 2IMMA 1UKTA 3NFNA 4PJFA 2VLJE 2FZ3A 4JZOB 4XX1E 5GHWH 3OQ3B 1AR2A 4RMRA 1T5XA 2M1KA 3L6FA 1BX2B 1MRDH 2B8OT 5FYKD 5C0ND 1TZGH 3L3GB 1LDPH 2VXSH 3OZ9H 3LV3B 4L3AA 4N0FB 4O58H 1FYTE 4M7KL 4NPYA 1FCCA 3NA4A 2X40A 1ZEAH 3HAEH 3LKPA 1IBGH 2X4SA 5GGRY 1HINH 1A1OA 1HN1A 5IJVA 3D85A 3QUXD 3RWJB 4L3EA 4YHNA 3IGAB 3BXNB 1PZ5A 4PP2A 1CZ8H 3MRFA 2IPTL 3WFEL 4Y5YC 3Q3GB 1A6VL 32C2B 1V7MH 2LTQB 2GSGA 2FX7L 5GGVY 3MRPB 4U1IB 4KUCD 3V4PL 3T3PF 3V4UH 3EGSB 1MAJA 4LLUA 3O4OC 1B6DA 1CICA 2X89A 5ADOH 3M1BA 3FRUB 1RZKL 4JLRA 3OTTA 2QLVB 4NHUB 1HXYB 1LO3H 5EB9A 2Q7YB 4E5XA 4LSQH 3ARBA 5F3HA 5I1IL 1VDGA 4I1NB 3MLWH 3Q6FB 2FJFA 1U8KB 5D5MF 4XXCC 2IADB 2H3NA 4ELMF 5JIKA 2NY3B 2CIKB 5FUOL 5ILTL 5I17B 4RGOH 2EDYA 4MZ2A 2FGWH 5B8CB 2QQQA 3GRWA 1MJUH 2UVEA 3RPIA 5CCKH 3GI9L 4NFDA 3QHZH 3W11C 3QZWB 4K3HA 1NC2D 1IE5A 4UILL 5DA0B 1RJYA 4IDLA 1I7RA 3MREB 4LLVB 2I07A 3WNMA 5C0IA 2SEBB 3U46B 4PJDB 5FCSH 5DD1L 4WWKA 5HGAA 1IVLA 2E9BA 4RGMC 5CUSH 2BHYA 5DQJB 5IHBA 3RWHB 3CGTA 3IF1A 1XZ0B 5BRZA 4GRMB 1KTDA 2Z8SA 3O2DH 2FH8A 4BQ9A 4JQIL 1J0KA 4GG8A 4CJ0A 1E28A 4Z8FH 3H3BC 1YN6A 3B5TA 1GPOH 4IRZL 5CS7A 3JWDC 1EUUA 4NKDA 4NQCD 4HMDA 5D93B 4P23C 4OF6A 1K4CB 1XGRB 2BSED 4AIZB 4QRPD 3D2UD 1NQBA 3EYVA 1KTLB 3RIFK 3DIFA 4D0DB 4JFFB 1A6UH 4ZFGH 4KWUA 4YAQB 3EO0B 1OTTD 2ADIA 2NY2B 2IAMB 4WI8A 4M62L 2XWBB 3VFGL 1INEH 3E0GA 3GSRA 3T08A 4PJDE 2A9NL 3E6HB 3ZL4H 4Y16A 1I1YA 4ERSL 3MLYL 2DQTH 1Y6MR 4M6ML 3NCJL 1HEZA 2BOBA 1KCUH 4P2RD 1A5FL 5HI5D 4QRRB 1W0YT 4LSPH 3AC0A 2YK1L 3B9AA 2A0LD 4JQVA 3W82A 2HFTA 5JZ7C 3MRQB 1ZTXL 4GW5B 4NHCL 2V2WB 1OP5H 3MUY1 5BZWA 4M1DL 1Z6JT 5J12C 5E94A 3MROA 4KJQD 4GFTB 3SY0A 2ZNWA 4JO3L 1NGXA 5FGBA 4TVPD 1RUPH 3ULSA 2DQIL 3CPLA 4RSVA 5IF0A 3MJ9H 4HW6A 4XPGH 3U4BH 3CDGB 4Y4KD 2Q76A 3MBEB 5DJ8A 5HI4D 4OFVA 3DETC 4QRRE 2Z4QB 1JWSB 5CSZB 5IW1A 2EH7H 4G8FA 3TZVA 3DURB 3QFDA 4R3SB 1W72H 3LKSA 3KWWB 5J0BA 2Z92B 3CFCH 2VZ1A 3BWAB 3EO9L 1NAML 4NRZB 1DN2A 5C0AD 4YDIL 3TH3T 5C0RL 5C07A 4XPBH 1KC5L 5IHZA 1NCAH 4KI1A 1PKOA 3UTPD 4EBQH 5F21B 1KJ2A 3HNTL 3DMMD 5D2LA 1G6RH 2J5LC 4LL9A 3ZDYE 1FVEA 3HKFA 1U8LA 3BVNB 3MLTA 3MA7A 4RMSA 1NGQL 3INUL 3BPLC 1V05A 4EUPG 1IKNA 4G8EB 2KBGA 2X5PA 1ITBB 5FHBL 2C26A 1YEIL 5E6IA 1NEZB 4RFNB 3MJ7B 4NO0A 4FQHA 4WCYH 1IEAB 2CKBA 4HWEL 4JVWA 4MAYB 2PYFB 5K9QI 4Z0BL 2Z35B 4LDEB 3ZDZF 5L7XH 3LEVL 4G6KL 4G6ML 3RRQA 2XTJB 2KKQA 3RKDC 1F4XH 3FO2A 3DUSB 4P3DB 5SX5K 2ZKHL 3EOAA 3V52H 1FO0A 3X13B 1IARB 5HVGB 4OZGF 1DQQA 1Q9LB 4JANB 4P5TD 4ODSL 3ZT7A 1H3PL 5EN2B 3MV8B 5D2NA 3NCYP 2P42B 4DAGL 4OV5B 1CLYL 3H9HA 3LQAH 1MHEA 1ORQB 5J4MA 1BZ7A 3AS1A 1UVQB 3OG4B 1HSAB 5T5FL 1LP9A 1WEJH 3O2WL 1JYNA 4EN3B 2XN9D 2WUCL 2XTJE 4PJCB 1JN6B 4A6YH 4NOBA 3VH8B 3DECA 5JR1L 2DB8A 5AZ2L 1PDKA 5L8JB 4G9FA 4XHJD 5KANG 4R4NC 2Y07H 3SOBH 3PQYB 1IGIL 4OI7A 2EECA 4KKNA 3K2UH 1UH3A 3UXFA 4OQTA 2JJTC 2I26N 2GJZB 5CHNA 3DTXA 2K3TA 4PJBB 5F89A 5HHVH 4EDXB 3O3UN 3ILQD 5ACZA 3T8XB 4OLWL 2ADGB 4YHKL 3N06B 1ZT7A 4PJEB 5D5MA 5HGHB 4Z7OF 1J1PL 2W91A 5FYKH 4P3CH 3H42L 1B0WA 1H8SA 1OCWH 3PHOB 5C9KA 1REIA 5GS1C 4KQ3L 4Y7MA 1RK1A 1RZ7H 1B0RA 1A22B 5DFVD 3T2PA 2QEJA 4PJCE 1HXMA 5DHXB 3LD8B 3MNZB 5FYJD 4KUCF 1UB6A 3Q48A 4OLYL 2A73A 1E4KA 3PQYE 4MDJB 2IF7A 1GGUA 4NJ9L 1U6AH 4YDLC 2BSSA 3SKNB 3K1KC 4GUPB 4MNQD 4L3EE 4OFPA 4WGVB 3F7VA 1D6EA 3QJHA 2P5WD 3ULUE 3VW3H 1R5VA 2OK0H 4XP1H 3OJ2C 4KK9C 5HYJD 3RWDA 4MMZC 4L8CA 2B2XH 1P7QB 1NGWA 1U3JA 4ZPTB 3BI9X 2VTFA 3T4AB 2AEPL 2NPLX 4PJEE 5EIVA 1XF5B 4PJAA 3CH1A 1BQHB 3VWJB 1KJ3H 4P4KC 5C8JA 2HJLA 4PJ8D 2VJXA 2A74A 1ZT4B 3MRNA 2IC2A 4WFHD 4NNYB 1NMBL 2B39A 2AW2A 2APBA 3IDXL 2R15A 4Y2DB 4CKVX 3LQZA 4MA3B 3FO0H 3CFDB 4QXUL 1CDIA 4Z6AT 1U41A 4OF5A 1MLCA 2VR5A 4JG1L 2BDNH 2BNRD 2NY0B 1DBMH 5IB5B 3MRDA 3ZKMC 4B41A 5IVNA 4PGCB 1RPQA 4YXHH 3DV4A 1XIWD 4JREC 3OSKA 1CFVH 1OD9A 4N0UB 5D7LA 5T3XD 2NXYD 3BQUA 3HZVA 3LEYL 1ZVSA 1EFXB 5B3JF 3S5LG 3X3FH 3QQ4B 4LMQI 2ADFH 1CBVL 1KJMB 4IHOA 2DQUL 5ACMA 3WFDH 4F57H 15C8L 4IM8A 1OAZH 3DX7A 3HLAA 4R97B 1FLTX 2FD6H 1DBKL 4TSCH 3NA9H 2EYTA 3CCHA 4D9LL 5HVHB 4NT6B 4U6HB 4DW2H 3HG1B 4D0CA 1I1CA 4QOKD 1Z9SA 1IRAY 3MV9A 3QUMH 4JFDE 4WUUB 3RNKA 3O9WA 4HS3B 4JDZA 3DWTA 1F97A 1JNHB 2VDLH 2Z8WC 3EJZD 3GSNA 3WLWD 5GGTL 3EDEA 5IT2H 1TMCB 1WWAX 4UQ2B 4C4KT 3LSOB 3QEGH 5ICZB 2YBRA 1MCQA 4QCIB 4OD1L 1S78D 5CEZL 3PL6D 4U1GC 2YKLH 1M71B 3QXAA 2OZ4L 3GBLA 2IG2H 1EEYA 2EIBA 4WWID 2EH8H 3O4LA 2FX8L 3VRJB 1E4XL 3JWDL 3U0WH 1T20A 2BVTA 3ETBF 1K3ZA 4MJ2A 1SJEA 2F5AL 2WWKT 5H2BA 5TE6H 2HLAA 2YPLB 3W9EA 5GGSY 3HG1E 2DYPD 3G6AA 1VGEL 3RIFF 4E41D 1XAUA 1UM4L 2Q6WA 4Z7VA 35C8H 4S1QH 3WSQH 4S0SD 4GG6B 4PYGA 1NUDA 1UXSA 1OPGH 4PJ7F 2GJ6A 2E6PA 5KVDL 4LCIL 1FORL 2GK2A 2IEPA 5IFJA 4JM2A 1FVDB 3V0WL 1XFPA 5T1KB 1DQJB 4CN1A 1JI2A 4H88L 2FH6A 2EKJA 2CJUH 4TVPH 3BSZL 4LU5H 4ZS7H 3SKMB 1WLHA 3D18A 4FG6C 1BM3H 4GRWB 4PJ5D 5L2JA 1T83A 2QHRH 1BIIB 3FOMB 3OB0K 1FH5H 5JW4Q 4MJ5A 3B8SA 1BD2B 4I2XB 2BJMH 1F6LL 1XR9B 4X0KB 4YHOH 1FL5A 1R3KA 2UWEF 3LKRB 2CRZA 1IC4L 1FVCA 1QFWL 3GNMH 2G5RA 2X70B 1Y6NR 3HE7D 4WHCA 4P2QA 3MNWA 5CBEB 1QRNB 2NX5B 4X6FA 3QDGB 4GG6E 2Q86B 1DR9A 4POZD 1I4FA 1K5NA 2H32B 4FFWC 3NIGE 5E1AA 1UWEL 3BGMB 4FOMA 4LOUD 1A0QL 3UTSA 1HYRC 4Y1AB 1NCBH 1ONQA 1J18A 1LD9B 2BNUA 4LLMA 4MCZA 1DQLH 1HZHL 3FN0L 1U93B 4C83A 3VI3E 1KCLA 5DD5H 5IVZB 3WS6C 2PTVA 3ARGD 2D4DA 5HHXH 3FT3B 1NAMB 3TT1L 2DLGA 4M03A 3B43A 3W0WA 1RUAL 3E6FB 3S96A 5GRZA 1ITCA 2NMSA 3NZ8B 5JTWA 2BCKB 4ESKA 3LB6D 2R0KH 1PG7H 2FX9L 1QRNE 3OKNA 5CJ8A 1TCRB 3QDGE 3P4OA 1RHFA 5J11C 4BH7B 1NGZA 3TLRA 5KTEH 2QJDA 3I6LD 4KRNA 5TPWL 4Y5VA 3RI5K 5TDPB 3QG7H 4Y1AE 2CDFB 4N0YL 3QJFB 1N4XH 5JHDE 3WHXB 4K7PY 4RA0C 4HKBB 4HBCH 1QR1B 3F7YB 2IPKA 4Y19A 5DEFA 3MRCB 1ZAGA 1H3VA 2L7JA 3AREA 2RCSL 5EO9B 3QQ3A 2AJ3B 2LVCA 1ZLVK 4NZTL 2RFXA 5ANMA 1XGUA 5D2NE 1A7QH 1MPAH 4M6NH 1A4KA 1AD9A 4HJGB 4JPIA 3DX9B 2AEQH 4C56B 4WNQB 6FABH 5ESVB 2BOCA 1DUZA 1LP9E 5HHOD 1KULA 2OS7A 1SM3H 2I9TB 4X9GA 4L4VB 4PFEA 5LGKA 2BHZA 4NDMA 2VDMH 5TQ2L 2NY1B 2JJSA 2K7PA 4CN6A 4BZ1H 4X7SH 4MQXD 1X4ZA 3CFEB 4GW4B 1GGTA 3KS0H 1E4WL 1BGXL 4U6XB 4Z95L 3PHQB 5DZLA 1CFSA 5TQ0L 4F7TA 3VFWA 3O6FB 5SWQA 2RHEA 1CE6B 1INDL 5IFAL 1N59B 1B4JL 1U8QA 1DL7H 3RPKA 4L9LB 1TETL 2P5EA 4XNZB 1WT5C 2VLKA 5SWZA 1T2JA 4TSBL 4LPYA 1UEYA 1J05B 3NABH 5E8OA 1S9KC 4M8QA 2FEEI 4HCRL 4OGXH 3AMKA 2DIAA 4V1DA 3AB0B 5E9DA 2CXKA 2NQCA 4JFYA 5IQ9B 4XCCH 1S7UB 3BW9B 5EBWA 5JXAL 2C3XA 4L4VE 3TF7C 3GUTA 1YQVH 3BD5A 1KJVB 5FKAA 5E99H 3MSPA 1C12A 2A83A 4UT9H 4HIXL 3FN9A 7FABL 3CX5K 3V4VL 3DGCR 4BSWA 2B7DT 5AAMA 1G7PA 1FIGL 5DI8A 2OR9H 3T0EB 1SBSL 2F58H 5HPMB 3HFMH 5ESQB 5BW7C 1A7NL 2LVEA 3ZE0E 5IKCB 4HFWB 4NYLA 3KJ4B 1Y18A 5MERB 4EI5A 4TQEH 1OAXH 1KPVB 3JZ7A 1NANI 5ESAB 3VFVA 4TTGA 1E6OL 4JDTL 4FS0A 3BEWB 3T1FA 3DJ9A 1DQDL 1D9KC 3X11B 4LDLB 4TRPH 3X3GL 1SQ2N 4HT1H 3VFRB 4WW1B 3H9SB 3QNYA 1ORSA 2APFA 5KN5A 3S37X 3O2VH 3BP4B 1NCCH 3MZTA 5H35B 3VXRB 2CQVA 1QYGH 4JFZL 1WF5A 3P4NB 4LHUD 4LLYB 3BKYH 3DPBA 3U7YH 4HH9B 3V6ZA 4F7EA 5T3XH 1L7IH 4GBXA 3VMNA 5BQ7A 2PTTB 2AVGA 4Y5YB 3I9GL 1T03L 1P2CB 2AJYL 4L9DA 3WO3B 5D7LE 1P84J 1CLZL 3VXPB 1J8KA 2EDJA 4JVUA 2O61A 2GY7B 2VIRB 2XRAL 1CU4L 3WE6A 5DD3L 1UZ8B 4PY8I 3O4OB 1I8LA 5I1CL 3GHEL 4U0RB 1KEGH 3EYFA 4FXKB 4KKAD 3H9SE 1GZPA 5J6HB 4AM0A 4JKPH 5GGQH 1PEZA 1V7NH 3ZT5A 2EXWD 2RIKA 5JDJA 1MFEL 4L4TD 4YBLC 1NL0H 3U9UA 2AXHA 2OYPA 3VXRE 1A6TB 1FNLA 2APTA 4GAJH 1S7VB 1XH3B 4XNMB 2P8PA 4JFHE 5BO1L 2VLMD 5FHAL 4MDIB 3QFJD 8FABA 5L2KD 2D9QB 4QKXB 3G5YB 1KGCD 2GT9B 4HJ0C 2UWEA 5BS0B 3IDYC 1FGVL 3MLRL 5I18L 3RY4A 1XF2B 5F88B 3GK8H 2VN7A 3P9LB 4MA1C 1ZHLA 3O4LE 1MCFA 3DXAD 3AMLA 5CEXA 2WBJA 1S7TA 4ONGH 4EDWL 5EBMA 4PRPD 3T1WA 5INDB 3IS0X 4HLJA 1QFPA 4YC2C 4XBPA 3UPRA 4F8QA 1WIUA 4OCWH 3ZLQC 1VFOA 2Y5EA 4NNXB 1FZMA 4WEUD 5F70A 3PV7A 4QRSA 5EU5A 3LN4B 4LHUG 4PGEB 5I15L 4IDJH 5D1XA 1KFAH 2VRAA 4Z7VE 1SY6L 2AJUL 2R69L 3QSKB 4P23B 5DJ2B 2MFNA 5HHNB 3HTLX 3KNBA 4YPJA 2BVPA 5DQ9B 3O8XD 1HOCB 2AV7A 4FQ2H 5BS0E 4HGWB 3B4NA 4HIEA 4Z18A 1WITA 1U8MB 1SMAA 1MCPH 4TUKL 2BHUA 2DJSA 3AAZB 1CQYA 1UJ3B 3U4EB 5EIIA 4KKLD 1JRHI 1OLLA 5FGBC 3VFPA 1VCAA 4GKNA 3D3VB 1FZOB 4EVNA 4YR6A 5JXED 1KCRH 1I85C 4UB0L 5CEZE 2YMXL 2G9HB 5D7IF 2Q7NA 3C5ZD 1MWAH 4NZUL 4JRXB 3CLEH 1URLA 1ES0A 1OGAB 4M7LL 3UPAA 5JO5A 4OFIA 2HTLD 4NO3B 5J12B 4DGVH 2BC4A 4I48B 5C0BE 1U8HB 2NY6D 3CFBB 1J12A 1IL1B 5IB3A 3QUYD 4XNQB 1R5WA 3HZKB 4LPVA 4UINH 3AROA 3IJSB 3PWJB 4GMTH 4XP9H 5BJTA 4U1LA 1EJ6A 3PWNA 3BDXA 3NIDF 1UWXH 3VE0B 3D3VE 4AMKH 1AXSB 3RVUC 4F58H 3BHBB 4WY7H 4P2OA 3OB0H 2I5YL 2IGFL 3GIZH 5D96B 3W0WE 2APXA 4UUJA 3EO1B 1YEDA 5JPMA 4JVPA 4DVBA 1IKNC 1UXWB 4PBXA 4JRXE 4LGPB 1WBXA 5GPRA 3B9KA 3CLFH 4NQED 5EOTB 1I1AC 1OGAE 1HHHB 2C4XA 3KPSB 5H37G 5E6IC 4LKXA 5FGSA 3V95A 3RU8H 3WYRA 3SGDH 1P1ZA 1A3RH 1UACH 1Z3GH 4OAWA 4N8VG 4RMQA 1VFUA 4E0RA 1QRKA 1RV6X 43CAB 3B6SB 4PS4H 2J5LB 5GRYA 3SO3C 4BYHA 3PF2A 4LQ1A 3BPLB 1NDGA 4Y19E 2EXYD 4KVCL 5GISL 2D7TH 3MV7A 5I8OL 2G5BB 3MYJB 1C08B 2ZSWB 3L7EA 4KTDL 3RI5F 3U9PH 4IJ3C 1NAKH 1A6WH 5ITFA 1CDBA 2FIRT 3QEHA 5CILL 1T04B 1MFAL 4QT5B 1O7SA 1EEUA 3KPSE 1T2XA 4JFXB 3QDMD 4LSDA 4Z78A 1R3LA 2F53E 4J3TA 5FAAA 1CGSL 1KIUA 1SBBA 2XNAA 2GTWB 2VSCA 3RA7L 2AXFB 2CLVB 4PBVC 3VRIA 1BBJB 4HIHA 4QYOB 4HWUA 2CRMA 5TFSH 1Q9OB 3HCVA 4CW1B 2H9GB 1WBZA 4PTTA 2ADJB 4HX1B 1DDHA 2DBLL 4HS8H 1DBBH 4JDVA 1H0DA 1K8IB 5IV2B 3SHSA 4AEHH 2Z31A 3S8WA 2J2ZA 1CLCA 2VWEC 5JW4N 4H5SA 1HHJA 1AI1L 4JN2A 1AXIB 2R2CA 4V1DE 4FTVD 4X5WB 3KYKH 5I2IB 1U8PA 4S2SB 4UTBL 4RGNC 2X4PB 4DKEH 4KHTL 5C0EA 3VXUD 3TEUA 1QSFA 2D31B 3GIVB 4YNYA 3SKUD 1LMKA 3TN0B 2UZIH 3GSUA 1VADB 2X4RA 4G7VL 1H3UA 4WHYG 1A14H 1KSRA 3H3PL 1KCSL 4M7ZC 1DBJL 3TNMB 1UM5H 1I1FB 5CEYB 2WLYA 2Z9TA 1WZMA 5I1GH 1HCFX 2MCG1 1U95A 2G2RA 5FDWB 3IU3B 3EOYG 4K94H 1WZ1L 5K9OB 1CD1B 4ZXBD 3O3DA 4LNVA 5E8EA 3GSVA 1FDLH 1R6VA 1JPFB 2L4OA 4G42B 5LBSL 1I1RA 1MEXL 1QO3B 5JOPE 3BN3B 3FB5B 1JL8A 4RCAA 1LEKB 2Z93B 2P8MB 3PP3H 2JK5A 3QEQA 4UMGA 5FO8B 5CP7B 1JMZA 3SPVA 4WI9A 5I71C 4XGZA 5E4IA 5LQBH 2NLJA 1X5FA 4AG4L 5CD5C 1ERNA 1RUQH 3W39B 3G5ZA 1WSST 1KXVC 1J5OH 1U3ZA 2VUYA 4P4KB 1ED3A 4RDQG 4DKFL 4HDIA 1Z2KA 4Z9KB 4OM1L 5TDNB 3SCMC 2Y72A 3V6OC 4MS8D 1TVHB 3MRRA 2R2HB 3ARFD 5C0CD 1RHHA 2HMID 2OMNA 5GS0C 3P77A 2MKLC 4ODUA 3SDXB 2XZCH 4Z7WB 2ENYA 4P59L 1MLBB 3SEPA 3HI5L 3O6KL 4HWZA 2R29L 3RKPA 3FOLB 3FFCD 1MRCL 2ZUUA 4LCUA 3V7MA 3MACL 1P5UA 3C60D 2DD8L 3WO4B 3EYQD 1F3JA 5D7IA 4BA8A 4HKJB 1RIVH 3WIHA 4LCCB 4JB9L 3TYFB 5FUCC 5SWSB 3MNVA 2R4SH 4APQD 2E3VA 4MMXC 2FRGP 1EUTA 1JMXA 1NEZG 1EHLH 5DMYA 4HAFA 4NO2A 4OLVL 3FZUD 4O5LH 2AK4B 2GCYB 3BJLA 2IALA 3ECBB 3QIUA 4K55A 1S8DA 1PGRB 2FEDC 1N5YL 4Z7WE 2GITA 4X6BB 5H37H 1FLRL 3E2HC 4IMKC 3N85L 4U1GB 4YK4C 4FQLH 4DUXA 3ELAT 3QIWD 5DHVA 1S7QA 3V5KA 3VG0L 3W9DB 2BSTA 4GRLA 4P49A 4WUKH 2DTML 3S36H 4JFOB 3DNKA 1SVZA 1OL0A 3MV11 5JHLL 2DRUA 4NRXB 5GSRA 3PGCB 5DJCB 1J10A 4KRPD 5CZKA 5SWSE 2X41A 2L0DA 2OL3L 2WBWB 3O41A 4Q9CA 4NWUL 1C1EL 5GRJH 3RAJL 4XAKD 1L9NA 3ABZA 1QNZH 4XC3L 3TFKC 4D9QD 1F8TL 5JDSB 4WU5B 2AK4E 1MRFL 5T3ZL 2MTPA 3MUGB 3VG9C 3D39A 1HWGB 1FFPA 2XZQH 3ARUA 2ZUXA 2IJ0C 1JPGB 1Q9WB 3MLZL 3WFHA 1D5BB 2M8XA 5MENA 3HC4H 1DQMH 4RFOL 5ICYA 4KZDH 1MH5A 2X4NA 3P40A 1U3HA 3ARDB 1YEKL 4FXGA 4GLRH 3C6SA 4K3DL 4XPHL 1CDGA 5CJOL 2MCPL 1Q9KB 4YPGA 4YHIB 4U7MA 4FFZL 1R3JB 4Y8AA 1AO7D 1BQSA 3WJJA 2PXYD 4RISH 1TVDA 1FPTH 5I1JL 4PJXF 3DVFA 1QR4A 1LWRA 1QBAA 4OT1H 4X99B 3KPOA 5F7EL 3FO1B 4ORZC 1YNLH 5C08B 3CUPB 3S3PA 4NP4H 2QKIA 4WEMB 3H3KA 3KDMA 3F7RA 1G7LA 1RMFL 5GRWA 5KG9A 4MA8L 5GIRA 1JHKH 1WWWX 5HD8C 4YXLL 4M5ZL 3NH7L 1S9VB 1NCTA 3P4MA 5C0NC 3BKJH 4ZUTB 4EI6A 3IRZA 3O3EB 5FUZH 4Y5VC 1EHAA 3TO2B 1A9EA 3VXOA 5KOVC 1KXQE 1YYMH 4PRHD 5GZND 1XGQB 2AXGB 2HVJA 3LS5L 1IAIL 1QLRA 2GAZB 4Z76A 2C1PB 3UTZA 4ZO6A 1KENH 4PJGA 4DN4H 1Z5LB 4DKDC 5A2JH 2FLBT 3BZFA 5IB2B 5GHWL 1F6AA 4WDIA 4WHYH 2R39A 5B38G 3MV7E 4UV4H 5D8JH 3G9VA 1L7TH 1MRDL 1JYVA 4LVHC 1G7IA 4N90D 3HZMA 1J1OL 4UT7H 5DJ0A 1RK0B 1LDPL 2VXSL 3OZ9L 3PWVB 2WANA 4ZUUA 4NZRH 4D94A 4WU7B 3T4YA 1SVCP 4NQDA 4R6UA 1ZEAL 4HD9A 2DWDB 1IBGL 5DFWH 3F58H 5BVPH 1HINL 3T0WA 2QQLH 4P48A 2MMXA 4ZFZA 4ZOEA 4GH7B 5I19H 1TQCC 1YZZA 1I8MB 1CZ8L 1JGEA 2IBZX 1LVEA 5DEGB 2JB5L 3O81A 4JFPA 3PJSA 4NKOB 4RDQF 5EU6D 1JE6A 4ZSOA 1DE4A 5E7BA 3V4UL 2W07A 2P45B 5KVFH 3WFBL 5DWUL 4YH6A 5L8KB 1T22A 4FQQB 5JIHA 5ADOL 3GMMA 2BY1A 4IIQC 3DRTA 1LO3L 4KV5F 4LSQL 5HGBB 4LRIC 2X9YA 3BE1H 2EDNA 1NFKA 4I9WD 2V7HB 3MLWL 3LRSA 1XR8B 4P46A 4CMMB 4MNHB 4RGOL 5I1HH 2FGWL 1PW3A 1NGYA 4OQTL 1AGEB 4NQSB 2WBKA 1MJUL 1MCJA 3MUZ1 3GKZA 5EPMB 1BVKA 5CCKL 2X10A 5EO0A 3VD4A 1G1YA 4NSKB 3MRMA 3N0PB 5DJAA 4U3XA 3KPRD 3HAEA 1KN2H 3QFJA 5KW9L 2EDHA 3QYCA 4NUJB 3MUHL 5CUSL 4ZS6D 3ZHKA 3MO1A 2AJXH 2LAGB 3X17A 1UENA 5FKPB 4JE4B 1CFBA 3MLXH 1JBJA 2DL2A 3BDBA 1DLFL 3O2DL 4YLQT 2MJWA 4LF3B 4OLEA 4UQ3A 4MQ7A 4NCDA 1CE1H 4EI5C 2O5ZH 4Z8FL 2R9HD 3FT4B 1AGFA 1YMHB 4PJFB 2CDGA 3BIBX 1FIEA 1GRWA 5IWLC 5KSUA 4KZEL 4OLXL 3DO7B 1M05B 2LABA 3PWPA 3R8BB 5FGRA 3UJJH 5DUMH 4KGLA 4NC0B 4S1RH 1A6UL 4ZFGL 4AT6A 4LPWA 1DFBH 4DZBA 3AUVA 3VXSA 1QSVA 1G7QB 4Q9QH 4XC1H 2VAJA 5C09B 1INEL 4MAUL 2X1OA 4BQCA 3ZL4L 3EIFA 3R06A 1JV5A 4X5LA 4RMWA 2DQTL 2O5XH 5I1EL 2V6HA 4JRYD 4U6VH 3TBYA 4FA8A 2CSPA 1KCUL 4M1GH 4AH2B 2K7QA 2XA8L 4LSPL 1D9KB 1U92B 3CC5B 3KYOB 3QXDB 3PUCA 2YS4A 3U7WL 3RDTD 4M9OA 4XB8A 3AS0A 4I3RH 2N7BA 4WTZG 4YZFE 4Y4KC 3DVGB 4LLUB 1DVFA 5HI4C 4LPTA 4Q58C 3SKOB 1I8LC 4YHZH 4E42A 1EO5A 5GJSL 5B39B 2VDRH 5F3HB 2ZOLA 1F00I 3G6DH 5C09E 3WNNA 1RUPL 4I18C 4C59B 4ZUWB 5EWIH 2XXMB 1ZWIA 3MJ9L 4XPGL 1TJHH 1FJ1B 3U4BL 3UP1A 5H94A 4W68A 2AJVL 3TCLB 2I60L 1O0VA 3OV6A 3DMMC 3IDGB 2VYRE 3U36A 2YD9A 2EH7L 2HTKD 4JHBA 4ONHB 5L9DH 1GGBL 1W72L 4LIQH 5HYQB 1AKJA 1AGCA 1AR1D 4RBPH 1NBZB 1OGTB 3CFCL 1FZKB 4F7MA 4XNUH 4NBYB 3VFMB 3G04A 3UTQA 3VD7A 5C6TH 5I76B 4YBLB 4XPBL 3RJQB 1VGKB 1NCAL 3IVKB 4JG0H 4M6OH 4YJZL 5IESH 4N5EC 4OCRH 2XY2A 1G6RL 1I3RA 3D69A 2FR4B 1UZ6F 1R5IB 2ARJA 5F7MC 1HH9A 4MCYB 2VXUL 3IDYB 5D1QD 4F3FA 2PYED 4XVTH 4JZJA 2RBLA 4MA1B 2XWJA 4WEBH 3GJFK 5ABDE 2EE2A 3UTTA 5F7YC 3BUTA 4OKVB 4YC2B 2VZTA 3ZE2E 3MRKB 3DSNA 2BSRB 5J7CC 1D7FA 3L7FA 4NQXA 4BH8A 5L7XL 1ETZA 3KPNB 3GSWA 4K7FA 1U8OA 1ZSDB 1F4XL 1QEWA 2D9CA 4PTUB 1I3GL 2OL3B 3FO9A 5JMRA 1YEHH 2HFEB 2VKXA 3V52L 4KGJA 3WDHA 1BP3B 5FOBA 5HYSA 4QHUB 4G43A 1UKQA 4RAVA 3BZEB 2F74B 4KK8D 3S35L 4XPAH 2LU3A 4XHJC 3SY0B 1IAIM 3LQAL 5CBAB 5DJDA 1FCGA 3RWGA 4I0CC 4Y4FA 2OLDA 1VFBB 3ULSB 5A16A 3IFOB 1K4DA 2Q87A 4N1HB 3H7BB 1DEEB 1G0DA 1CGUA 1UQSB 3ILQC 5FUOH 4JFEB 3ZSSA 3LVEA 4L8SA 1KIQA 4A6YL 1JWUB 5EC1B 4PREA 1WBYB 1BAFL 1TZHA 4MX7B 3UBXI 4PGBA 3SOBL 2P7TA 1R0AH 3CDFA 3VGFA 5CMAB 3QCUH 4NM4L 3VXUA 1P4LB 3B9KC 3VJ6A 1L6ZA 4CJ1A 4G8IB 2DL9A 4HJJL 5DFVC 1EGJA 4L29A 5C07B 5HHVL 5T3ZE 1UA6H 4NKQB 5DD1H 3ARPA 1DSFH 1OF2B 1NCWH 4HLZG 5JPNB 5I9QC 3S88L 3FMGH 4NOFA 1EH9A 4OZFB 4PJGE 4RQQB 5FYKL 1U9KA 2VDOH 2X09A 5F9OH 3E3QC 4KTEH 5BV7C 1PLGH 1IEBB 4M5YH 5HI3D 4XVUD 1A6AA 4WW2A 1TENA 5E8NA 4Y0GA 4AL8H 1OB1A 2P8LA 4JFEE 5I1DB 2W60B 1LNUA 2P24A 2XTLA 1I1AB 5ICXA 3HC3H 1KT2B 4I5BA 4ORGA 4G6FB 4MJIA 1T5WA 5LGHH 5HXMA 3TBSA 2YC1A 5EFIB 4FQHB 1TVBA 4R7NB 1ZHBA 4AQ1B 1FNSH 2AGJH 3MJ6A 3F65A 2D03L 4XWGL 3L3JA 4BSVB 2BY0A 5DK2B 3VW3L 2OK0L 4XP1L 4XVSL 3SO3B 2A9NH 5ISZB 1U2CA 3O3BB 3BD3A 4M61A 2B2XL 5HSFA 3BRFA 4ERSH 5TGBA 5HDQH 4M6MH 1XEDA 3NCJH 4KI5F 1A5FH 5F1NB 3UCRA 1XIWC 2YK1H 3PXHA 4ZSOE 2MHAB 3IJYB 1KJ3L 3L5HA 3MXWH 3UBXA 4J4PA 4GRWH 3ILPA 2YPKA 1DQQB 4LQFH 4BFGA 4PRID 2I9LB 2EYSB 1T0NB 3TBWB 5T33H 2KQNA 3ME0A 1AP2B 3FO0L 3SDAD 3TBTA 1M6OB 3H9HB 3BH8A 3IKCA 2BDNL 4LCWB 1LK2A 3H0TB 1PJ9A 2L7UA 4U1SA 1RZFH 4YXHL 5BOZG 1AHWC 3FB6A 4KJYB 2H26B 3VXMA 2DQHH 2R1YA 1JK8A 1CFVL 3KPMA 4IRJD 5I30H 5AYQA 5JZ7D 5BVJA 2WWMD 5ISZE 3EOTL 5B22A 5TH2B 4CDGC 1K6QL 4IEFB 3IT8D 2WIIB 1QSZA 3RZCA 1CDJA 2ZCHL 2BNQB 4Y5XC 3OKOA 3X3FL 3TO4B 2V5SA 3EJZC 3WLWC 3WFDL 1TPXC 4F57L 3FQRA 4ZAKA 4DCQA 1OAZL 1FFNA 1KB9K 2YD4A 2CMRH 3NA9L 4WFGE 2VITA 3PL6C 4GW1B 1DTUA 1IGFH 1QSEB 1B88A 3QUML 4P2YA 1ZT7B 4QXWA 3LRGA 3TBVB 4RGNB 4ELMB 2VDLL 5IT2L 3KYMA 4X5XA 3DETD 4LARL 3QEGL 3S4SG 5ID1B 4PIRF 3QXWA 1YMMA 1V3KA 4U1HA 4HUKB 4HKZA 4I4WA 1MHCA 1NGQH 2YKLL 5IBLD 3WUWA 2HLFC 2IG2L 3QR2A 5I8KH 2BNQE 4J8RB 5MHSE 4QXTA 1IFHL 4U31A 2V5YA 3R8QA 4M7ZB 1C5BL 3BIKB 5T1LB 4QY8A 4D8PA 3ULVF 3A6BH 4HWEH 5TE6L 1R5VB 5ERWA 4MXWH 3RWDB 3ZO0A 2BY3A 5F3BB 1QSEE 3OHXA 4G6MH 5KS9A 35C8L 4J1UB 4YBQC 4S1QL 3SDCA 3WSQL 5JOEA 3MRLB 3RTQD 2QR0A 3BDYL 5C8JB 4GMSL 3GZKA 1Q94B 3WLBA 2FEEL 2JTDA 3DRQB 3A6OA 5J13C 1RZGB 3HE7C 5AD0A 4TVPL 5LKNA 4LU5L 1AGDA 2DTSA 2GFBB 1BM3L 4POZC 4K2UL 2QHRL 4H20H 1S7WA 1FH5L 1CLYH 1NLDL 3RKDD 4LSTH 2BJML 1XCTA 2DN7A 2Q8AH 2X7LA 4QRTA 1KNOB 3GNML 4PD4K 2KZ1B 4X7EC 4KJPD 5D9SB 1A6PA 4I3SH 3SCMB 3JTTB 4OGAD 3KPPA 4X4XA 1T1XB 3PP4H 3O11B 2VAAA 5AZ2H 5I1LB 2RQ8A 4X7CC 1IGIH 3IDNB 3CCHB 4K3JH 1DQLL 1OD7A 5A2FA 3OX8A 4Z7QF 3TM6A 3QXTA 5DS8A 3VFOB 1K2DA 1W72B 5E0QA 2XYCA 4FQ1L 3SDDD 1QP1A 2AV1A 1KLGB 1W8NA 2VDPH 5HHXL 4QHKI 5DMIH 4UDTB 4YHKH 4IOIA 5ETUA 1IGMH 5EOCH 4XCYB 2HJFA 2NTSP 4R4ND 1Z9OA 3F7PC 3VI4E 1JF1A 2V9RA 3UZEA 1ZA6A 1FV1A 3O45A 1MCKA 3HI1B 4LKCA 4GRLC 4P3WA 3V6OE 1G6RB 5I6XC 4NKMA 4HLZH 3FRPA 3UTTE 3VCLB 4PG9A 1ZANH 1KBGL 2XQBL 4X6DF 1FC1A 5E4EC 2BZDA 3QG7L 1XMWA 4LNRA 1BJMA 3KXFD 5IBUG 4OCLC 2W0PA 4WFEE 1N4XL 2HLAB 1YYLH 1SEBB 1A7PL 3FCTB 2E9IA 1F3DH 5IW6B 3UC0L 2VLJD 4MD4A 1CCZA 5C0DA 1BVLB 3WEXB 5M7QA 3DVNA 3E2HB 3QUKA 4YK4B 3I75A 3QUZA 2EC9U 3VFNA 2PCPB 4MQXC 4DOHE 5KAQG 1A47A 3QI9A 3RUGA 1MPAL 4IS6A 4M6NL 3PABA 1P53A 2XG5A 43C9A 3CSYB 1IQDB 3Q6GH 2AEQL 2OQJB 3GJFH 4L8BB 2JIXD 4KK9D 3UPCA 4QHMA 4HKXB 2F54D 4XCEB 2ESVD 1SM3L 4G3YH 4JG1H 3MRJA 5DGQA 3VG9B 1FL5B 4YFDB 4A2MA 4BZ1L 4X7SL 4YUEL 4WO4D 5GGVL 2P49B 2ZJSL 3LIZH 4OCXL 5GS2D 5I8EA 1RSFA 3EOBB 1NFDF 3SE3A 1I75A 4RIRA 3CFJA 4WGWB 4RMTA 4FXLA 3LKOB 3QDJA 2B1AL 1EZVY 3TH4T 3UTSB 3B8YA 4OZGB 2EDXA 1CBVH 4GKSB 15C8H 1C16A 4G5ZH 1DL7L 3ZKMD 4A6YB 4L4JA 1T3FB 2CLZB 2YOCA 3TVMD 3OPZH 4LLQA 1MI5A 4KTYA 3UZVB 3NABL 3REVA 2J8UF 2D2OA 4P4RB 3EFFA 4PJIF 3PDOA 2E9JA 5IVXF 1HILB 3VD3A 1Y6KR 1I3UA 3ZDZE 4G6AD 1AFVL 5E99L 4HUUA 2ZSVA 1JRHL 4UT9L 3NVQA 4LSVH 1JZ6A 3GEWB 4OD1H 4RZCA 2OR9L 5GQBA 4MJIE 1TFHA 5BV7L 1N6QH 3M17A 4ZUVA 4KDTA 2OZ4H 5F6HI 5IEKB 5MEPA 4X7TA 3HFML 5L0QC 1CFNB 4Y5VB 3BPOC 4NUGH 1JGLL 3KYNA 4K94C 4OZGE 5EZJB 2P44B 3MRGA 1OAXL 3FQNB 2GTZA 5BXFA 4R26H 5FO7B 1LE9B 1DN0B 2CUHA 3QUXB 2DS4A 1MIEH 2A6KA 3BN9D 2IPKB 4HZAA 1VGEH 4LVHB 5F9JB 5DMKA 2AJZA 4HK0A 1UM4H 1BQUA 3CK0H 2VLRD 3NFPB 4DZ8B 4HT1L 4I0KA 1A4JB 4WV1C 1KPRA 1HDMA 1P7KB 1QVOB 1NC4D 3BO8A 4LCIH 3D0LB 2YD3A 1JHTB 3O2VL 1XGUB 1NCCL 2IH1A 3L95B 2RJMA 2BVQA 1QYGL 5C0GA 5FYKE 5ALBH 3BSZH 1TQCB 5HHQA 2C5DC 3BKYL 1K8DB 3CVIH 1QHPA 4KKAC 3NN8A 3R4DA 4O9HH 1L7IL 4P46C 5T3XL 3VXME 4X9FA 2EXWC 4ONFH 4PRNB 3QHFL 4J3UA 3HMXH 5DLMH 2ITCA 5IUSA 1MJ8H 1U8JB 3BH9B 4OZHA 4LEXL 1HHKB 4NGHL 1CFSB 4X8JB 3VFWB 5IFHH 3BD4A 1TTFA 2OTUB 1KEGL 4IIQB 5EUKB 1INQA 1NC2B 2VDQH 4MHHG 4JKPL 5GGQL 5IB1A 4K8RC 1V7NL 2YEZA 5CJQH 3OAUH 3HR5A 3KS0J 1A0QH 4HUXA 1NL0L 4YDVA 1CG9B 5IP4A 2H6PB 3BP7A 4MJ6B 4ELKA 4HUWA 4HS6B 4ZDHA 3GSQB 3VWKA 3MXVH 4Q6IB 1PD6A 1YMME 3QA3B 5FKAB 3TT1H 5EU3A 3GK8L 4BSWB 4NQCB 3QUMB 1RUAH 1MJ7L 5F9WC 3JWNC 1U36A 3DBXA 1AIFB 4U2ZA 4QRPB 3D2UB 3IYLW 4ONGL 1PY4A 5FCUH 1G7MA 5ADPH 2EDQA 2IBZY 4DUWA 1ZHKA 4OCWL 1DJSA 3JTSA 3JSSA 4MGXA 5KZCD 1DBAH 1N64H 2YD6A 4JAMA 3LRHA 4IDJL 3LPFA 4DEPC 2P4AB 1PBYA 3QWOA 1KFAL 4N0YH 3WIFA 5KS9E 5J89A 4MD5A 3CAFA 1YEFH 3BPCB 3S37H 3BKCH 4OZ4B 2ID5A 4P2RB 4LP5A 3VD5A 5F6HJ 2LE9A 4Y4HA 4POYA 4EUPB 5E6YA 3GMLA 1HQRA 4MLIA 3TNNB 2RCSH 3C5ZC 1JWMA 4XTRD 2XKNB 1MCPL 5B3JE 3ROOA 1A1NA 2VLLB 2AK1L 1MY5A 2HTLC 4X6DA 1GIGL 1L0QA 5HHPB 1AGBB 5INCA 3HE6D 2VUOA 5J1TC 2CK2A 5HY9A 3CX2A 1KCRL 3QUYC 4JGJA 2R2EB 1S5HA 4PV8B 3TGXA 4CVZA 3MR9A 5IIEB 1WC7A 1JPSL 1MWAL 3QNZA 1JGDB 3CLEL 3GMPB 4P9ML 4M00A 1MVFA 4ZOBA 3C08L 4NC1C 4OZIF 2XIDA 1NBQA 3OKEA 4Y4KB 1MIMH 4PJ7B 2HJKB 4FZEL 4P2RE 4DGVL 3RIAK 5D7JA 5L6YH 1GZPB 5DC0A 3V0VA 2OJEA 4LASL 2YA1A 3QDHA 4R96A 3C5SA 5F71A 1HWHB 5I0ZA 5IFAH 5FA3B 1WCBA 4I18B 3WIHL 2YHGA 5C0AB 1TETH 4MYWB 1F13A 5GRVK 4GXVH 1U58A 4C4KO 4NQVB 5JW4R 2NZIA 4AMKL 1D5MB 3NOIA 4W70A 4M7JL 1BEYH 1WIPA 1FL3B 3DMMB 3QEUB 3KPLA 4TVPE 3BISA 5F7DB 3TIEB 4JZJC 3HNSH 1QPPA 2GK0B 2VDKL 1FN4A 2EXYC 4HIXH 1CWVA 1OAYH 4BFBD 1W0VB 5AG9A 1FIGH 1FAKT 1A3RL 3T0XA 1UACL 4U7SA 1Z3GL 3GGWA 2WWKO 5DTFA 2EICA 3QWRD 4ZTOH 4NFBA 5KSBB 4Q74A 1OVZA 1NDMB 3L3DA 3P0YL 4GOSA 4PS4L 4PR5A 1YEEH 5CIPA 5DC4B 1WISA 1ADQH 3QH3A 3VGDA 3RL2B 3EUUA 4FQPA 4JDTH 1QTYT 5DUBB 2PO6A 2HKHH 1DQDH 4LPXA 4W6XB 2AV7B 4HWBH 3SJVE 4TOYH 1CGVA 4XVJL 3X3GH 4PUBH 2GQHA 3RUGE 1BLNA 4O2CA 3D85D 3JV4B 4BQ6A 4OM0H 2J7LA 1L0XA 4L3ED 1KIPB 3SN6N 5IMMA 4P5TB 3P0VH 4JFZH 2YXFA 2FJGA 1A9BB 1IM9A 1RJZA 4JJHA 5KSBE 2X44D 1NLBH 2R23A 3SO5A 2YR3A 5GGRB 2DQEH 5C3TA 2XN9B 4ODXB 2HT4D 2PKDA 3HMWH 3I9GH 2R2BB 4L8SC 2GIYA 5CWSB 1PQZB 2WV3A 3OB8A 1ES0B 3JVGC 4U1KA 1HH6A 5TFSL 1CLZH 2IANA 2WINB 3B5HA 3Q2CA 3L1OH 1CICD 2W0FB 2X89D 3UYOD 1YEGH 1NJ9A 3I6KA 1CU4H 1SYVA 5E2WL 4G8GA 1DBBL 4HS8L 4PGDB 3MCG1 3ARBD 4QRUA 3VDBA 4X6CF 1RZJH 4F2MA 4K3EH 2PW2A 3CXHJ 4PLOB 1J8HA 3H7LA 2NTFA 4AEHL 1JZ2A 1ZGLA 3ZTNH 3ARVA 4HIJB 1FFOB 1X5KA 1YC8A 3KYKL 3AY4C 4F15C 2JJWA 4DKEL 5BO1H 4R7DB 4JHWL 3QWQB 2JLLA 4RFEB 5JPMB 5FECB 1G7MB 2UUDK 3GJEB 2XN9E 1MREH 2O93L 3S5LB 1P9MC 2UZIL 4MXQD 1EEZA 2EDOA 4WWKD 2IQAB 2ICWI 4ZXBC 3BFOA 1KYOJ 4LKXB 3NGBC 1A14L 2DQJH 1MHHB 1IZKA 2DJUA 4J12A 4PJ9A 1MFBL 5BRZD 4IRSD 4PJDF 3PDGA 3BZ4A 1UM5L 3FHAA 4NN7C 3RWIA 1HI6B 5I9QB 4ZNCD 4JFDD 3KLAA 2Q8BH 5I1GL 4EIGB 1JP5A 1FNGB 4GT7A 5BV7B 4MNQB 1I8KB 4LLDB 3I3BA 1ZMYA 1BHGA 2P5WB 1YA5A 2EE6A 4K94L 2F9BT 4RNRA 5HYJB 5I16A 3AU1B 1FDLL 2C3GA 3CZFA 5DK0A 4N0CD 2DKUA 1ND0A 3PE9A 4J4PC 3G08B 5FYJU 3LHPH 3RVTD 4AEEA 3FHQA 5DJ6B 1IGCH 4PJ8B 3QIBA 4DWHA 4UV7H 2APWA 1QBMH 3WHE1 1LQSR 4Y16D 2DAVA 4XB7A 5JLZB 3UO1L 4KMQA 5LQBL 4M3KB 4X98A 2HMIC 4A2LA 2BNRB 2FWOB 5HJ3A 1J5OL 4GXUM 5CJXC 2OSLB 4Q7DA 1XIWB 4UB0H 3E3QE 4HUVA 2ATKA 1Q1JL 1T0MB 4OZHE 4BFIB 4JY4B 4GKZB 4YHLH 3RZCC 4CADB 3S97C 1RJCA 2W9EL 2NXYB 4S1DD 4ZAKC 2ICWA 4M7LH 3C60C 4CVXB 4HV8A 1L0YA 1A1MB 4KROD 4IMLA 4HIIA 4LVOB 4OSUH 1D5XA 2XACC 1OP3H 1TNMA 4O00A 3QCTL 3ESUF 1H5BA 1AHWB 2XZCL 4WFHE 1KB5H 3O0RH 1YJDC 4IOFD 4B0MM 4JY6B 4OLZL 1W0WA 3OKDB 4TN9A 3FZUC 5GGUA 3ZDYF 3T09A 1YDPA 3GBNH 3VGBA 4QOKB 3TYGH 2BNRE 2ICEA 3TZVD 5JNYA 2EZ0D 4Y5XB 5MEOA 3HUJA 2A6IA 1OT2A 4OGZA 4ODHH 1RIVL 4XRCB 1TPXB 4D3CL 1LGVA 2IGFH 3M07A 5DO2C 3GMRA 1MVUB 4OZIA 5C9JB 4ZQKA 3PIQA 4YEFA 1OTUD 5T3XE 3PL6B 3QIWC 1EHLL 1DUYB 4H8WH 1C5DB 3E8UL 5FXCH 4KXZH 4KJWD 5C0FA 2C4FU 2QADD 3DV6A 3EZ8A 5EUOA 5GRUL 4KRPC 4F33B 2G2RB 2VZVA 2CDEA 4I13B 3RP1A 5JA9A 3ZTJG 3PV6B 3FQWB 2KUTA 3BJ91 1F4WH 3O3DB 1IILE 2DYPB 3PGDB 4E41B 1PKQA 1ZLUH 1DLHB 1B6UA 4KPHH 4RX4D 4JFQB 5E6ID 3S36L 5I8OH 3GSOA 2VO5A 3HRPA 2FHCA 3IDIA 4NO0D 4KTDH 2OJZH 1JNLH 5FF6A 3ARSA 3LN5B 5DRWA 1FYTA 1VKXB 1WZKA 2NNAA 3SQOL 2R0ZH 4LFHD 1V8HA 2E7CA 5GRJL 2F5BH 2F19L 1S9XA 3EW3B 1I7ZA 1QNZL 5JHDD 4I0PA 4JJ5A 2C3VB 4K7PL 4KK6D 3GMOA 4Z7UE 3RL1B 4PJ5B 2V2TA 4K23L 2PXYC 3G5ZB 2QSTA 2XZQL 3LKQB 2WK2A 3F8UB 2PF6A 3HC4L 4HG4J 1DQML 1G84A 4R0LC 3IJHA 12E8H 3V6BR 2X1PA 4OCSL 4HF5H 3MLUL 5J13B 1U8IB 3HE7B 4E41E 4JZOA 1PVHA 2HRLA 4J7RA 2R1XB 1VSCA 1T1YA 1BX2A 4XCNB 1MWAB 5A3ID 1MAMH 4RISL 3LV3A 4N0FA 5I0DA 3EAKA 3VA2C 5HHME 1T1WB 2IQ9H 4OT1L 3KG5A 2EDFA 3V7AG 4W4OA 3TVMA 1GOHA 3D6GA 5IR1A 4U2YA 3RIAF 3RWJA 3MMEB 3MODH 5GZNC 1XF4B 3ARGB 4UTBH 4OFKA 1HQ4B 4G9FD 3IGAA 3BXNA 3MCKB 1CTNA 4PJCF 1G9MC 1JHKL 4ZD3L 5EZIH 3P9WB 3NIFE 2KH2B 5MI0C 1T7WA 5ELIA 3BKJL 4NO2B 5FUZL 1DEDA 3STZB 1YYML 3EGSA 1TCMA 1KCSH 4LFHG 3ULUF 1DBJH 3FRUA 4NHUA 1HXYA 2Q7YA 3MPCA 2GITB 1BJ1J 3Q6FA 4PJEF 1U8KA 4UV4L 5D8JL 1L7TL 2IADA 2E5EA 1QFOA 4UT7L 5I17A 1EV2E 1WZ1H 5B8CA 2F8VA 4JZNB 5I6XB 2VE6B 4NZRL 1K85A 5F1SA 2X1XR 2DQGH 1CK0L 5GSRB 5H8DA 1UC6A 3QI9C 3F58L 1IQWH 5E4EB 5BVPL 1NMCC 3D0VA 3NCCB 2QQLL 3QZWA 3L5WB 4YO0B 1GAFH 2Q3ZA 3MREA 4LLVA 4ODWB 5IMOB 5I19L 2AABH 3RWCB 5KVEH 1KTRL 1MCOL 2SEBA 4LLWB 4X9BA 3U46A 4PJDA 4U05A 1JF5A 5DQJA 3UJIL 2ARJQ 3I6LE 5HHOB 3RWHA 5IMKB 4MQSB 2WQ8A 1LEIB 4AG4H 3WFHB 4GRMA 1GH7A 4TVSa 1FZJB 4KI5C 3SGEH 4DKFH 4K9EH 4WHTB 3SE3C 5KVFL 4M48H 1K4CA 3K0WA 1XGRA 4AIZA 2AKRB 2Z91B 1ZS8B 3GRWH 1FG9C 3BE1L 2B4CH 2FB4H 4D0DA 4JFFA 1HHGB 5K9QG 1K9TA 1BMGA 4GXUN 1JHLH 4YAQA 3EO0A 3OR7B 3QXUA 4QTIH 3V6FB 2IAMA 2V5MA 4ZS6C 2XWBA 4FMFA 2NR6D 1WVZA 5D7LD 4XAWL 3BQUD 4P59H 1OQOA 1EGJL 1MCEA 3HI5H 3E6HA 1H9VA 1EXUB 1F4HA 3H9YA 3KDMB 1T21B 5HHOE 4DTGH 1J87A 3TCXA 1XGTB 3WV0A 4QRRA 1Z0NA 5DD0H 3AM8A 4M43H 5GS0D 5D71H 3C2SA 2NCMA 3P9MB 1GOGA 3MRQA 3MLXL 4GW5A 1A9EB 3PWUB 4H25B 4P5MA 3MV9D 5J9PB 3O9WD 1CE1L 1LO5B 2DQDL 4KHXH 1U8NB 5C1MB 1JI1A 2O5ZL 4J23A 3Q5YA 2ZUQB 4HK3N 4O51B 3ROLB 3CVHL 3VFTA 4WDIB 1N5YH 4NCC1 2LFGA 5DUML 4S1RL 3O4LD 3G5XB 5C6PB 3N85H 5IW3A 2W92A 3CDGA 2A38A 3OXRB 4Q9QL 3MBEA 4XC1L 2V17H 3RDTC 4O2EB 5SX4I 1OARL 5L0QB 2Z4QA 1JWSA 3BPOB 5CSZA 3ZTJH 5IOPB 3DURA 1TJGH 3EDKA 4R3SA 1LDSA 1H8OA 3KWWA 2XPGB 1VHPA 2Z92A 2FEDD 2O5XL 3BWAA 4NRZA 4U6VL 4TUOB 3RAJH 3ULVC 1YY8B 1RJLB 4LHUB 1YECL 3OKYA 4GQ9H 2GJ6D 5F96L 4OBSA 2V7NA 4I3RL 4WV1B 4JM2D 1EA9C 4ENED 2VC2H 3MLZH 4GG6F 4JCMA 5GGSB 4JR9L 3BVNA 3NIGF 4YHZL 4HPYH 2QSVA 2HTKC 4EQ3A 1MCLA 3GHBH 2VDRL 4K3DH 4XPHH 5CJOH 2MCPH 3OJDB 1I9JH 2R56H 3VI3F 4GAGH 5EWIL 1CD0A 1NEZA 3UYRH 3MJ7A 1ZLWK 4L4TB 5B3NA 5I1JH 3VRLE 1TJHL 4MAYA 2PYFA 2X6MA 4P2QD 2RGSA 2Z35A 5F7EH 3HUJE 4G7YH 1GYAA 5L9DL 5D6DC 3QFJB 5L2KB 1YJDL 4G80B 5DDHB 5C0BD 5EC2B 3DUSA 5J3HD 4XNUL 5D1QC 1EPFA 1KJ2H 5EU7C 4N8CH 4P3DA 5C6TL 4PB0L 3DXAB 2UY6A 3X13A 5CINH 3CDCA 1NH6A 4JG0L 4KK5C 4WIQA 3L3KB 5EUOE 1Q9LA 4PRPB 5IESL 3BYYA 4S11A 4JANA 3FQXB 4NNPH 5EN2A 3MV8A 1EVTC 2XY1A 4OV5A 5I75C 2UYLB 3W0WD 4L4TE 1ORQA 5DR5H 1HHIB 4ISVA 1HSAA 4XVTL 1PKQE 1QG3A 3WBDA 4EN3A 1M7IA 2CKBH 5E5MB 5F9WB 2DLTA 5HD8D 4Y4HC 2YWZA 5LG1A 4WEBL 2IPUK 3WN5C 2VLME 1J1OH 5E70A 3OR6B 3T0VA 4PJCA 1JN6A 1OHQA 3O8XB 3VH8A 3V5HB 3K4ZA 3ORJA 3MA9H 4LSUH 3PQYA 1A6ZB 1AY1L 2D7MA 1VENA 4KK8C 1LP9F 4N8VB 3DXAE 2GJZA 1LO0H 5DHYB 4BQ8A 1FO0H 4PJBA 4EDXA 4Y19D 3UX9B 4CVUA 1SEQH 3RVWD 5LAXB 3ARED 3T8XA 1YEHL 2ADGA 3D9AH 3WKNA 4PJEA 2JB5H 4YGVB 5HGHA 3TIDB 3C5ZB 3PGFL 4ODTH 3PHOA 4QEGA 3A67H 3OXSB 4Z5RA 4XPAL 3WFBH 5DWUH 4Z0XB 2CIIB 1P84K 2F53D 3MNZA 2NY6B 2PNDA 3MV01 2JJVA 4OTXH 3QUYB 1G7JB 4MDJA 2X4OA 2CK0L 5DURD 3MLVH 5DD6A 1AQDB 5H94B 3SKNA 4GUPA 3VGHA 4OQTH 1T4KA 2G60H 4L8DB 4XP6H 4XMPH 5FB8A 3IXTB 2NYYD 1R0AL 4JGMA 4UNTA 5HI3C 3QCUL 4ZPTA 1HIMH 4ACPA 4XVUC 3T4AA 1ZVHA 5KW9H 1HNGA 1XF5A 2LQRA 3FAWA 4N9GB 2VZOA 1BQHA 2P5ED 4UOW1 3VWJA 2VLKD 2XFXB 5SWZD 3IRPX 1AJ7H 1IAKB 1UA6L 4NQEB 3AS2A 3CMGA 1ZT4A 1KLUA 1DSFL 1MCWW 4F7PB 1G9ML 3ZE0F 4NNYA 1NCWL 4V1DD 5E9DD 3FMGL 4ZFFB 4D0BB 4Y2DA 1DLFH 1RD6A 4MA3A 4PJXB 5EO1A 5TDOB 2VDOL 3CFDA 3DX8A 4IRSA 4ZFOL 5F9OL 4KTEL 4F9PA 1HH9B 1PLGL 4M5YL 4JFDA 3B2VH 5IB5A 4PJAF 4F8TA 3AGVA 5IBTH 4PGCA 3U79A 4AL8L 3L3IB 4KZEH 4OLXH 3S98A 4X9IA 3DROB 3GMNB 3HC3L 5CGTA 4N0UA 5FM8A 4LPCA 1YNTA 2HYMA 5JA8B 5LGHL 2E7LA 1EFXA 3NMEA 4JO4L 3WFZA 1FNSL 3QQ4A 4DFIA 2AGJL 1KJMA 4EI5D 3RNQB 3MRIB 4MAUH 1R24B 2DLIA 1F4AA 2YA0A 3SDAC 4H26B 3QDMB 1N5AB 5HDQL 4NT6A 5I1EH 4U6HA 2GSIB 2DMKA 3HG1A 2XA8H 1Q0XL 5HDBE 2HT3D 5TF1L 3MGTB 1H3TA 5HPOA 4MLSA 4WUUA 3MXWL 3X14B 3RQ3A 4HS3A 3U7WH 1MF2H 4IRJC 5JOPD 1JNHA 2A77H 4OF8A 3F12B 4LQFL 2WWMC 4XI5D 4UQ2A 1IGJB 3LSOA 3EYOA 5T33L 1YN7B 4QCIA 1EIBA 4OJFH 5I1KH 3SKJH 2H8PA 2X4UB 2DBJA 2DM7A 4JFFE 4TYUA 1M71A 1LE5A 4O2FB 1MAKA 5GJSH 4XBEH 4GBXD 4JO2L 1L6XA 3VRJA 4X4ME 1RZFL 1GGIH 2XI9A 1CLOL 2DQHL 3VXTB 3U30B 5I30L 4J3WA 3VGAC 1QKZH 1HCVA 4FTVB 3QDME 2AJVH 5GS0H 2I60H 2YPLA 2ZOKB 4S0TD 3I6GB 3VXUB 4BK4A 1S7RA 1GGBH 4GG6A 2CMRL 5AZEL 5IBLC 1EO8H 1IGFL 1FVDA 4HEME 4U33A 5T1KA 3BWUC 1J86A 5DRZB 4YHMH 4F15B 3SKMA 2WIMA 1SHMA 3B9VA 4Z7VF 1P4IH 1IKFL 1BIIA 2H2PD 3FOMA 4J3SA 1TQBC 2P24B 2VXUH 5M94B 3RWFB 1XR9A 4X0KA 3SE4C 4JM2F 2WBJD 3BOVA 5I8KL 3LKRA 4ZXBB 4ORGB 5DZNA 1UADC 2X70A 3RTQC 3L9RB 3CVHB 2N4IA 4RX4A 5CBEA 5E08H 1QRNA 3K8MA 3QDGA 2Q86A 4N5ED 1GGCL 2ZUTA 3A6BL 2H32A 4H0GA 2C7UB 4PP1C 1Y0LB 5HTSA 5D1XD 4MXWL 4Y1AA 4KV5E 3QBTB 1LD9A 3CXDH 1JNJA 5TGBB 5JHDA 5BCAA 1U93A 5JW5B 3FB7A 5IVZA 3A6CL 4OFYA 1I3GH 3D5OF 4LGSB 1MNUL 4HZLB 4MB3A 4LVEA 3TV3H 3FT3A 1NAMA 1RZ8B 1V5JA 4KJPC 4JN1H 1ULVA 4XCFH 4OGAC 2D7OA 3E6FA 1YPZB 3ARFB 5C0CB 3NZ8A 3S35H 2BCKA 5CZXD 2IH3B 4H20L 2HH0L 1BOYA 1H5BC 2DIJA 1HKFA 1TCRA 1ZT1B 4LSTL 4BH7A 1H3XA 3VFSB 2H1PH 2Q8AL 1PG7X 3IDJB 5TDPA 2YUWA 3NCFB 1CDYA 1I7TB 1AE6H 2CDFA 4I3SL 3SDDC 3QJFA 5CSBA 2FHFA 4UDUB 4RAHA 1FG2B 2JELL 3PP4L 3FFCB 4EOWH 3C60B 1BAFH 4HKBA 3NACH 1QR1A 3F7YA 1MJJB 3MRCA 1DP0A 4NM4H 4K3JL 1DANU 2V9TA 5EO9A 1J7VR 1E0OB 4KY1L 4HJJH 4APQB 2YD5A 3UAJD 1YPZE 2AJ3A 5C0CE 3DUUB 1CTOA 3MV8E 2VDPL 1UB5B 2PETA 5DMIL 4P2OD 5DZOA 4HJGA 3FQTA 5AUMB 1IGML 3S88H 5EOCL 3DX9A 4C56A 4WNQA 5HYEA 5ESVA 3HPJB 2I9TA 4I4WB 3SDYL 5EOQH 4L4VA 3B9KD 2DWEB 4Z77B 1X44A 4M7LT 1ZANL 2YD8A 3CFEA 3QIWB 4GW4A 5FK9B 4MNGB 1T0PB 1G9NC 3DSFH 4U6XA 3PHQA 3T0DA 1BZ9B 4KRPB 3O6FA 3OAZK 1TTUA 1FRGH 1CE6A 1YYLL 4NFCA 4I0PC 3FJTA 3QRFM 1KIRB 1N59A 2D03H 4XWGH 2RB8A 4PJBE 5EZLB 2E7MA 4LIQE 4XVSH 4L9LA 2MPAH 3MV7D 1X6NA 2HFGH 2I27N 2J6EL 4ALAH 2X4TB 5B38B 1JYXA 1J05A 1S5IH 2FECI 3DUHA 2GEEA 2ICCA 2OX5A 2HN7A 2X2YA 4OF3A 5IQ9A 1S7UA 3BW9A 1N3NB 3EBAA 4WO4C 3QPXH 1I9RH 1CFQA 1MFDH 4U7KA 1MELA 1KJVA 2ZUVA 4WI2A 3Q6GL 1KV3A 4AENB 4R4FH 3WL9B 4JKLA 4G3YL 1AO7B 1JVKA 2PXYB 3QXVA 5ESQA 1VEMA 1LEGB 1S7XB 5EULV 1OSPL 3U6RB 1ZOXA 3TVMC 1XF1A 2E8ZA 4HFWA 5IKCA 3LIZL 4QTHB 1IT9L 4R0LB 1RZJC 5MERA 4X4XB 1KPVA 3RX5A 5FO9B 2YZ8A 3EOTH 5ESAA 2Y23A 1K6QH 3BEWA 2ZCHH 3U2SB 4G6AC 1NBYB 2QV2A 4G5ZL 2Y6SD 5I66B 3VFRA 4H0HB 4WW1A 2Z31D 3H9SA 3OX8B 1ZXQA 4JRWA 3VGEA 2Y7QB 4HPOL 3OPZL 4PRAB 3FFDB 1CT8A 3BP4A 1JNNH 4FQCH 2EIEA 3T3MF 5H35A 3VXRA 4PRHB 1AO7E 3P4NA 2YSSB 4LLYA 1QSFD 3DHJA 4HH9A 5TE4H 3RBGA 4LARH 1BIHA 2PTTA 4LSVL 5B8CC 3BN9C 4WJ5B 5IJKA 1E4XI 3NFSH 1P2CA 3IETB 4N0UE 2ZCLL 5MI0B 5HVFB 1N6QL 3VXPA 4ZFOB 2ZWLT 3CSGA 5EOCJ 2QBWA 4NO5B 2VIRA 4CDHA 3K2MC 4NUGL 5F72S 4HULB 1UZ8A 1QBBA 1IFHH 4LBEB 3QRGH 5HGDB 1NCDL 3WIIH 1C5BH 3C9NB 2EYRB 4FXKA 2BVOB 4R26L 4YQXH 3B9DA 5J6HA 4EUPH 2ITDB 1MIEL 4Y88A 4YFEA 5JIIA 3QDAA 2NXZC 2NY7H 4MJ4A 3CK0L 2HLFD 1S7VA 1XH3A 4WUUE 5GXBB 1MCBA 2LAAA 4XNMA 4CL7A 2CLRB 2Q20A 1F3DJ 3BDYH 3GFUA 4MDIA 5EU6B 1I9IH 2A9MH 4GMSH 3G5YA 2GT9A 5BS0A 2GUOB 4R8WH 5HDOA 4JCLA 3QEQD 5ALBL 3EDFA 4N90E 1XF2A 5GZOD 1KXTB 3CVIL 3LEXB 4O9HL 5JUEH 4K2UH 2K9UA 3HC0B 3RWEB 2NY2C 2FLRT 5GGTA 4YBQD 4ONFL 5DT1H 5INDA 5E95B 1QFWI 3RX8A 1NLDH 2HKFH 3HMXL 5DLML 4PRBA 1MJ8L 1RULH 4YIQB 4YDKH 1IM3B 2IBBA 4NNXA 2OZ4A 2YPLE 4MA7H 3LN4A 4PGEA 3O3AB 3JV0A 3JWOC 4RIRB 3EDJA 5IFHL 2MSPA 3KJ6L 3P4LA 4P23A 5DJ2A 4M8VA 5HHNA 3KPRB 2VDQL 1NANH 2AJSL 5E24E 1H8NA 2XWTB 3HNVH 5DJXB 5EU6E 1SJXA 5DQ9A 5CJQL 3OAUL 5C0BA 4URTB 1HOCA 4B7IA 4XZUB 1RIUH 4HGWA 1U8MA 5GRXG 3IXAB 3EFFB 5DSCA 3AAZA 4MSWB 3WMSA 1UJ3A 4GRWE 4FQ1H 3U4EA 4Z7WF 3T2QA 4W81A 3MXVL 1FP5A 4U6YB 3OGCA 4I9WE 2DQFB 4H8WC 2ZSVB 1BD2E 4I2XE 3D3VA 5J1AB 1FZOA 3IFNH 2G9HA 4RZCB 4U3HA 5EG6C 3FB8B 3TWCH 4JRXA 3L3HB 5FCUL 1U91A 3EFDH 3SGJC 2NX5E 5D70L 1OGAA 3UJTH 5ADPL 4LHJB 3KPRE 4QXGH 1KBGH 4KAQH 2XQBH 3K8LA 3QIUD 3GI8H 4NO3A 4H1LA 4XTRC 3MRGB 1N8ZB 4I48A 1DBAL 1U8HA 1N64L 3CFBA 4KVNH 3LPWA 3UTOA 1IL1A 2VXVL 3EJYD 2PW1B 5IROC 4YWGL 4XNQA 1A7PH 3HZKA 1YEFL 3P30H 3UC0H 1EAPB 4JRYB 3BKCL 3OKMB 3S37L 9CGTA 3HE6C 3IJSA 3PWJA 4FQJH 4GRLD 1BFVH 3RDTB 3T65B 1AXSA 1OT1A 4OD3H 3ZHDA 3BEVB 3EO1A 3HZYB 3WJLC 1UXWA 2HP4A 4R2GD 5EOTA 3HS0B 1QA9B 1HHHA 3D39D 3RGHA 3KPSA 3G5VB 2F53A 3MBXH 5DEZA 5MEND 4YDJB 3VFUB 4WI6A 1N6UA 4HC1L 43CAA 4LEOB 1U3HD 3B6SA 4YUEH 5GGVH 4NRYB 2R4RH 3OWEA 1MIML 2ZJSH 2FATH 5CD3B 3PWLB 1F6FB 4OCXH 4JY5L 4CBPA 2E8YA 5L6YL 1R3HA 3U0PB 2B1AH 3MYJA 4CMHC 1C08A 3LAFA 5D7SL 2ZSWA 5SX5H 5CKGA 3PNWB 2CR3A 1DZBA 1VERA 4HUWB 4GXVL 3I3EA 1LO4H 2FGZA 4TTDC 3I02B 1T04A 4QT5A 2IWGA 4C56E 4JFXA 1BEYL 2X4QB 3MCLH 1J0YA 4NWTH 4YHPB 3JUZA 5HVWA 5FYJH 3TT3H 1AFVH 3HNSL 5JQ6L 2GHWB 5D1QB 3LPGA 1JRHH 2PYEB 2AXFA 2CLVA 1OAYL 1T1ZB 2ZG2A 1BBJA 2WMPA 3OKKB 3FAXA 2XG4A 2OXHA 2XQYK 5BV7H 4F37K 1Q9OA 4JKMA 2CPCA 4ZTOL 4CW1A 2H9GA 1JGLH 2ADJA 4HX1A 4MQTB 3UDWA 1BOGA 1YEEL 2YWYA 2FSEB 1ADQL 1QFUL 3QWOB 5ID0B 5I75B 4KDVA 4MD5B 1G9NL 4W4NA 1K8IA 2HAZA 3ULUC 5IV2A 4CNIB 1LK3H 4UBDD 1S9WB 2HKHL 3BMVA 1T7VA 5GSVB 4HWBL 4X5WA 1X5GA 4TOYL 3WN5B 3SE9L 1BBDH 3V9FA 4S2SA 5I2IA 4NQDD 4HGKC 4PUBL 4XXDB 4ETYA 1T6WA 2XXCB 2X4PA 3CIQA 2HT4C 1WICA 4P5KA 1CD8A 2AI0L 2PYEE 4OM0L 2D31A 5K9JH 1CICC 3TN0A 1X5AA 1M7XA 4FRWA 4HCRA 2JJTA 1CDCA 3P0VL 3T0EE 4J6RH 3ARBC 1VADA 4K9EC 4UU9B 2ZCKH 1NLBL 2FDBP 5KVGL 1WC7B 2DQEL 3WXWL 3TNMA 4P2CG 3HMWL 1I1FA 1XF3B 5I74C 3QHFH 5CEYA 3GJFB 3FN3A 2B4CC 2VMFA 3BUYB 5JW4M 1N0XH 2D7NA 3LY6A 1F2QA 3L1OL 2J12B 1YEGL 4LEXH 4TULL 7CGTA 5FDWA 1JIBA 3IU3A 3MFFB 5CLWA 4NGHH 4MD0B 2VQ1B 1CD1A 4LGRB 2Y25A 1RZJL 1JPFA 2VXTH 5EZOH 3VWJC 4G42A 4K3EL 4MXQC 4P46D 1MCIA 2AXJA 1CVRA 4WWKC 1QO3A 1UM6H 1QPXA 1T89A 2YRPA 2HVKB 3ZTNL 3WNLA 2QQKH 2C9AA 3NAAL 2Z93A 1LEKA 2P8MA 4JPKL 4KQ4L 4X7DC 2NW2A 4L1DA 4PY7B 3V8OA 1EK3A 4IRSC 3KPQB 4Q2ZB 4F9PC 5CP7A 2WUBH 3KPLB 3BPNC 4WFFD 3G6JB 4LCYB 3BP6B 1HE7A 1MREL 1T80A 2FO4B 3SGKA 3W39A 2JCCB 2VDNL 4K8RD 3EZJB 4GO6B 1N7ML 5CLTA 1NFDB 1RZKC 2DQJL 4TNVK 1MJ7H 4KUZH 4P4KA 4N0CC 2E7LC 1FGNL 1P5VA 4RGMB 3TA3D 2D0GA 5TDNA 3IU4L 1TVHA 3DX6A 2V2XB 3RVTC 2Q8BL 1W2KT 3L3DB 4PD4J 4CU7A 4PRDA 4R97C 4FFYL 4WI3A 4WHDA 1NGPH 4Y16C 2FIKA 2J8UB 3C8KB 4EJ1C 2O5YH 3PWPD 4PJIB 4ZYKB 3M45A 2ENSA 3SDXA 3S4SB 5K9KB 5IVXB 1QQDB 4Z7WA 3ZKND 4PB9H 1MLBA 3VXSD 4BKLB 5F7FA 2XQYG 4JQVC 3G6JE 3FOLA 4YZFF 5FIEA 4U1JB 3LHPL 4CVWA 3S3JA 5DJYA 2HG5B 1IGCL 4O2CB 2JCCE 1CR9H 4UV7L 4XBGA 3IFPB 1QBML 4HKJA 1NFDE 4PRIB 4PV9B 5HGGS 4S1DC 4LCCA 2AK1H 3TYFA 3V5DB 3GB7B 5SWSA 4KDWA 3SDAB 2ATPA 2DLFH 1GIGH 4JHAL 5IMLB 5EORH 5DVNA 4KROC 3KYAA 2BRQA 2OTWB 3CFKB 3U0TB 2R23B 1SJHB 2AK4A 2GCYA 1X7QB 2OM5A 4UZGA 3ECBA 5K33A 3GSXB 4IOFC 1HH6B 4YHLL 4IRJB 1JPSH 5I73C 1DVFD 4P9MH 5IVXE 5J6GB 3C08H 3WDJA 1CVSC 4X6BA 3CD4A 3TZVC 5DRNB 3MQIA 2EZ0C 4FZEH 4N68A 5FM5O 3ARRA 3OG6B 2M2DA 3DGGB 1SYSB 3W9DA 4OSUL 5FM4A 4LSRL 4FNLH 1QZ1A 3RGVA 1CF8H 3JWOL 4LASH 1P7HL 4GAYB 1OTUC 1KB5L 4PRIE 3O0RL 3PGCA 3LKNB 5DJCA 1SY6A 3WIHH 2FJHB 4X6EA 3IB4A 4KJWC 3VGAB 3GBNL 4ZPVB 3TYGL 2QADC 5EBLB 4NBXB 1IAOB 2LU4A 5C0JB 1F45A 4ODHL 1RUKL 5JDSA 4WU5A 1AKJD 4M7JH 5I8CB 1L9MA 3MUGA 3MRBB 5E7FA 3T77B 2NZ9C 2BMKA 4HFUH 2F8XC 1JPGA 3LMJH 2A6JB 5FA4B 4G9DB 1D5BA 1MFCL 4OB5L 2VDKH 1J0ZA 5FYLD 4H8WL 3ZE2F 3ARDA 4HWNA 4M1CD 2VR4A 3K80A 5DHVH 3JV6A 1Q9KA 4YHIA 1R3JA 3RX7A 3P0YH 4HHAB 1A3QA 4PLNC 1F4WL 5I1AB 5D6CB 1TQBB 5JW3H 4KK6C 3HRZA 4ZUSB 4KPHL 2Y1VA 4X99A 3UTTD 3FO1A 1UJTA 2NW3B 3RTQB 5C08A 3HPLB 3CUPA 4PLJC 2OJZL 1JNLL 3REWB 4XVJH 4LPUA 4XPTL 4N1CA 5T1DH 1OQXA 2R0ZL 2F5BL 5D2NC 5IBUB 3STLB 1S9VA 5D7KD 1KCVL 5A3IC 3GMQB 1F4YH 1VACA 1S9YB 1ZK9A 3GKWL 4XP4H 3O3EA 3IFLL 3TO2A 1A7BA 3WS6A 1JGVH 3ARQA 4HSQA 4EIZC 1I7UB 4U1MB 1XGQA 2AXGA 1CFTB 12E8L 3KLSA 2FL5B 2GAZA 5HBBA 1TITA 2C1PA 4HF5L 2DIBA 1FL6B 1Z5LA 3OKLB 1PX4A 2P43B 5IB2A 1OSZB 1WWCA 5FGCB 1MAML 5E2WH 1RK0A 2ED8A 1OAUH 4HIIB 4Y4FD 3PWVA 4F7CB 5ENWB 1H5BB 4OF0A 1MCSA 4WU7A 1J9CT 4G6JH 2W65B 2DWDA 2IQ9L 1ZLVH 1WFUA 4PJGF 4RAUB 2M26A 1A2YB 3QULB 3MODL 1WTGT 2IMNA 3SDDB 3WKML 1CL7I 3T0BA 3U7AA 1I8MA 4JHWH 5JORB 4PG2A 5HDLA 4OZIB 5EZIL 3RJDA 2E27H 4R90H 5DEGA 4NKOA 3FQUB 1RVFH 4KRLB 2RAMA 4WVRA 4TNWK 4PBWD 1E4KC 1MFBH 3DV6B 5FGCE 4FQQA 5BOPA 5K59E 1E27B 2CDEB 2VQTA 1E6JL 3KXFB 1PY9A 1VEPA 5HYIA 2V7HA 1ZKAA 2XZZA 1XR8A 3BX7C 4U6TA 5F1OB 4NJAH 4CMMA 3PDDA 2VLJB 3U4AA 5GRVL 3Q1SH 4MNHA 5GS1B 1YC7A 4X9HA 4F37F 4LSSH 1AGEA 3AB0C 4MJID 4NQSA 1FNAA 2QHLA 2XZAH 4QHNB 5DYOB 3B9EA 2PTUA 5HYSG 2DQGL 5EPMA 3V8CA 2Q1EA 4NSKA 1IQWL 1OTSC 1Z0MA 1GAFL 1MCCA 3VDAA 4PGJA 2X9WA 1I7ZB 2AABL 4I3GA 4YDLB 5KVEL 4NUJA 1MOEA 5IG7B 3FT2B 1UWGH 1UKSA 3UO1H 3IDUA 2JIXB 5FKPA 1GHFH 2F54B 2ESVB 1VFAB 1TTGA 2NY5C 3KXFE 1CXLA 5KOMC 4J4PD 1F11A 3N1PC 2NR6C 2A1WH 3WNOA 5DRXB 1Q1JH 3FT4A 3PG2A 4WO4B 1YMHA 2ORBL 3BQUC 2AEIT 4K9EL 4BM7A 4V2BA 3K46A 4M48L 3DHMA 2W9EH 3QQ9C 5BZDB 1FYHB 1T1YB 3DO7A 1M05A 3BIAX 3GRWL 2B4CL 3NPZB 2FB4L 1JHLL 1NUFA 4PLKD 4QTIL 1G7QA 3VXMD 3CMOH 1ZA3B 1GZQB 5IB4A 3QCTH 5C09A 5BW7A 5MP6H 4ZODA 3IDMB 3QO0B 4JREB 3TVMB 4JGUA 5IR1B 1IGTB 3RZCD 3O9WC 4OLZH 4RRPA 3H2WA 4K8RH 4CAGA 4DTGL 2YUVA 2F54E 2ESVE 4ZAKD 2EIZB 1UCBH 1B3JA 1QLFB 4AH2A 1D9KA 1WWBX 5DD0L 1U92A 1BF8A 5IJKC 2VL5B