4A6YB

Crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
214
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTAYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGGSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY BBE6.12H3 LIGHT CHAIN
publication title Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yB02
1AGDA 3D25A 1LEIA 3RWGB 3KPLB 2IPTL 3EYSH 1G6VK 2A9NL 2KBGA 2VDPL 3JV4B 5L2KE 5C0DB 1LP9A 1FCCA 2QR0B 1A14L 4OGYL 2HFEB 1TTUA 4POYA 4M48L 3Q6FA 3LKRA 1ZHBA 4X7SL 3L3KA 4EUPA 3GSOB 1LNUA 3MV8D 1YEJH 3GEWB 3EJYC 4Z76A 3PXJA 4X6DE 2ENSA 4L9LA 4N8CL 2R4RL 1R3HB 1LGVA 1S7QA 2WP3O 4XVTH 2MOVA 2VISB 2WBJD 3DROA 1SJEB 5GZNC 4HFUH 4LPVA 4OZHF 3GJEA 3MFFA 4NBXB 1D5MB 5B39G 1BOGA 1R3KB 5JW5B 3CUPB 5AD0B 3FRUA 4FXGB 2VDQH 4RIRB 5JMOC 3TO4C 2RCSL 1S5IL 1A2YB 5IBLC 2DJUA 1YMHB 3G5YA 4G43A 1FH5L 5DEGA 5F6HJ 4Q6IA 3PABA 1T83C 1WBZA 4PLKC 3RVWC 3DRTB 3TYGH 4BH8A 2VXTL 2DYPB 5GSRB 2ZCLH 3MCLL 3X14A 1JUFA 4JM2B 5DJDB 4M1GL 1FFOB 2UUDH 2BP3A 4O58H 3U0WL 2OTWA 4Y89A 3NCCB 4KI5E 1DL7L 2GITB 3CVHB 3H9SB 4RISL 3N1GC 3SKMA 2QSTA 4JO1H 2Z92B 1PSKL 2J4WL 4M61A 1CDIA 4ZUSB 1HI6A 2XZZA 2YC1A 5FGBA 2X89A 2J8UE 4IOFC 1OAZH 5ABDE 1BF2A 5ANME 4EN3A 4X99B 4ZOBA 1ORSB 5DFVC 4EDWH 1NCWL 1UM6L 4YX2L 3SDAD 1K8DB 3BISA 4L3AA 2WIMA 3TCLA 4HHAB 2AK4A 4PB9H 4EBQH 2X4PB 5DD6A 1U8LB 4K9EL 5MENA 1ZHLB 1NGQH 1FZJB 1SM3H 1VB9A 1LWRA 5FDWB 2IJ0C 3BH9B 1D5ZA 1OW0A 3HMWH 3LPFA 3KPRE 2Z0BA 3MRPA 1ODAA 1MUJB 4URTB 2EDRA 3MUGB 4JFOB 5JOPD 4RQQB 2AV1A 1OAKL 5D2NB 3FT4B 1UZ8A 4U7KA 3C5JB 2AJYH 2P1YA 1VHPA 5DEFA 3QQNA 1DE4A 3QXDB 4NQSB 4UQ2B 1I7ZB 2DMKA 1KCUL 1WTLA 2PETA 1A64A 4GG8B 3U4EB 1CIUA 4U1LB 3LS5L 3BDYH 1WZKA 5IWLA 4OKVB 5IVXE 3U9UB 3HE6A 2BCKA 4IJ3B 4FQJL 4QXGL 3S5LG 4KHTH 3QUXC 1P7KA 3Q2CA 1IILE 5DWUL 1J1XL 3EFDH 3T2NH 3BPNB 5D6DA 1MFNA 5I16B 5ITFB 4AQOA 1CFTB 2VQTA 3QCUH 4M3KB 2EEAA 5IQ9B 1EEZA 2RIKA 3RL1A 1YMMB 3U36A 3S35H 1VKXA 4CADB 3SE8L 1YEEL 4UNUA 2VDLH 4NRZB 3KPMA 1F42A 5E8EA 4Y2OA 4U6VH 2GSIA 2R0LH 2WLYA 4PJEE 1FO0H 1UJTA 3BGMA 4NN7C 1Z5LB 1FNSH 1A1NA 3ELAT 3MYJA 1NGPL 4HD9A 5T3XH 5I76A 4MCYB 4Q9QH 2BRQA 3O0RH 3RUGF 2YKLH 1KIPA 1MFBL 2IMMA 3BZEA 3I2CL 3I9GH 5I75B 5C0BD 4WTWA 5DRZB 1JWSB 4FXLA 3ZSSA 3GIVB 4NRXA 3N0PB 2AEIT 1NAMH 3SCMC 2PW1B 1BMGA 1P5UA 1V7MH 3DNKA 3HE7A 5CFHA 5H94B 3EIFA 2DLHA 2DQDL 4IS6B 5HGDB 2X1OA 1KV3A 3G9AB 3SDXB 4ZO9A 3ULVF 1EXUA 3MO1A 1AO7B 3QDAA 4BYHA 1TPXB 2VLLA 3BZFA 4U1JB 1LO0H 2VABA 5E08L 4PTTA 2OJEB 1LO5A 5MEND 5F71A 3FFCA 4PG2C 1IKNC 2N56A 1QRNA 1GH7A 4V1DA 5IM7B 5T1MB 1SJXA 4ENEC 5C0FB 1J05B 1T2QH 4CVZA 1GC1H 4HK0B 2B2XL 3ZLQC 2VR5A 1CFNA 1CZ8L 2EDOA 2X4TA 4HKBB 5A16B 4R2GD 3P0YH 3MLUL 3WIIH 4ERSH 4NM4H 1WEJH 3QZWA 4NQTA 5E1HB 3ZKQD 1HYSD 2QADC 1FAKT 3V7AG 1C5DB 2HAZA 2FO1A 4E9LA 1JGDA 4HFWA 4YDVA 4IOIA 4MXVE 5FYKH 2QQNH 1VADB 3N9GL 2IFFH 5FKPA 5BOZG 3WBDA 5KS9B 5CMAB 1IGML 5TPWL 2V17L 3AS1A 5E4IA 3VW3L 4GUPA 4LPCA 3CCHA 4NQCE 1G9MC 5INDA 1G0YR 3VXUB 3ES6A 3MV9D 3NFPA 4EEEA 2VIRA 2HMID 2XA8H 3MLSL 1GIGL 1IGIL 1DP0A 1ZANL 2QV2A 1EA9C 3U7YH 4NCC2 1P4LA 4G9FA 3QIBC 3EO1B 3PP3K 1S9KC 3VXQB 4X4ME 4IRSC 1Q9WA 1CR9L 5EOTA 4ZD3H 3AFLA 5E8OA 1CBVL 3LKQB 3GI8L 1KIQA 4HUXB 4MX7B 2LU3A 3N1PC 2VQ1A 1S7WB 3G5VA 5AZEH 3MRFB 2DLGA 2VN7A 2HKHH 4MA1C 5CLTA 4PJDB 4JFDB 4HWBH 3D0LA 1TZGH 4MNGE 4ELMF 4K94C 2ATPA 3WE6A 3WO4C 1VEMA 3DI2B 5AUMB 3SDCD 1KN4H 5C7XH 5T1LD 4LLDA 1FGNL 5IR1A 5EC1A 4X7CC 4AT6A 3BIKB 4CU6A 2SEBB 3TBWA 3UJJL 5FGRA 1GGCL 5C0AA 1TZIB 5E94A 2E6QA 1UWGL 32C2B 4Y1AD 1A6TA 3T3PF 1F5WA 2XTJB 4PJAE 2Q7NA 1DZBA 1GHFL 3BWAA 1UB6B 3W0WD 1K3IA 1A7OL 5L7XH 3C5SB 5IG7B 4JKWA 3RP1A 4MD5B 2PUQT 1HQ4A 5AWNH 1KJMA 4FQXB 1CE1L 5GZOD 2H32H 5I2IB 2MQ3A 1DBMH 4JFYA 4MQSB 1UJ3A 5KN5B 4XAWL 2OJZH 5EU4B 4TN9A 5IMMB 1F4XH 3QI9D 2V6HA 4JVWA 4FN0A 1CDJA 1QBML 2R2BA 1UC6A 4PRAA 1OARL 3EBAA 3RAJL 4B53A 1MPAL 2Y07H 2IPKB 3EGSB 4XPHH 4IRZH 4V2BA 4GBXB 3WNLA 3MGOA 1E27B 4JO2L 3C8DA 5F7KC 4DCQA 2W0KA 5TGBB 1CDGA 4EQ3A 3C9NA 1XGQB 1ZVYA 4RFOH 5DC9B 4DUWA 2FZ3B 3CPLA 3FO2B 3OJ2C 3L1OH 3B9AA 1TJHL 3VCLB 4QXUH 3P11H 4JQVC 4G9FD 2X9YA 2WUBL 3ORJA 4OLZH 2HRPH 5BS0A 1K2DA 4PPTA 2I9TB 2V2TB 5A1AA 5KVDH 3O8XB 4G8GB 4KK9D 3ZDZF 4LVOB 1FORL 1FO0A 2EYTB 1NC4B 4MA3A 4IIQB 5F70A 4ZTOL 3SDYH 4X9FA 1KTDB 1N5YH 2JELL 2VH5L 1BIIA 4NN5C 4HLZG 4I3SL 4OFYD 4PGJA 2V5SA 2EE9A 2EICA 2VDOL 4LLMA 4F7PA 3BD5A 5JQ6L 3STLB 1J1OL 2WINB 3C2AL 1AXTL 1B6DA 3CFBB 2HTKD 4PBWD 4Y5VA 3THMH 3S35X 3EFFB 2RAMA 5JIHA 2EIZA 1M7IA 4JKPH 4LQFH 2GK0A 1T5WB 4ZUUA 5EN2A 1WIOA 1D6VL 2RBLA 1D5XA 3KPOA 4PGCA 1IGJA 1XEDA 2VDKH 4TVPH 3WEXB 3BDXA 3AB0C 3QJFB 4YR6A 3LN4B 1ZHKB 4H0HB 2F54D 3ECBB 3D0VA 4PJFB 4UT9L 3GSRA 5HHVH 3MJ9L 5BO1H 5MEPA 3PWPA 2BY1A 3VXMB 5HHNA 4B7IA 4UTBL 4OZGB 5K9OA 5L88H 2ZSWB 4P2QA 1HSAB 4WTZA 3B9VA 4R4ND 5CJXC 4QRRA 1Y0LB 1F11B 1SEBB 3CFKA 1NCDH 3H42H 2VE6B 1MCJA 5EO0B 1HHJB 4K3DL 3QUMB 4KKBD 2GAZB 4MJIB 5C0BE 1H3TA 3EYVB 3GSVB 4MNQD 4W6YB 5EA0H 4WFED 3ZL4H 4N68A 3ARDA 3HZKA 1AD9A 4JKLA 3O6FD 4MHHG 1WBXA 3ULUL 3RIAF 1I7TA 3PHQA 2VZSA 1X5IA 4QGYA 2IH3B 3S98A 1YJDC 1KCSL 3QG7H 3VXRB 5JXED 3QUYC 1NEZB 1OSPL 3OAUH 5IBUB 1JGVL 4MDJA 4U7MA 4KZDL 4YPGA 2FB4H 4DKFH 2CK2A 4F7EB 5HI3C 1QYGH 3MCKB 2LE9A 4PJ5E 1T2JA 2IG2L 4M5YH 3P0GB 1OAXL 1T22A 4N0YH 4PRNB 2XXMB 1CD0A 3DOSA 3IFPA 5IHLB 4JLRB 2NW2B 5F1SA 2PTTB 5I18L 3HAEB 1V3KA 1MNUH 1S9XA 4YFDB 5JORA 3H9HA 4G6FB 2F8OA 3FTGA 4MA8H 1F4AA 2A6JA 4X5WA 1FAIH 1G9NL 3UAJD 2DQGH 3T08A 3RNQA 3IKCB 3E8UH 1ZT1B 3W81A 5JIIA 2DI8A 3HR6A 3IJSB 1IE5A 1RU9H 2W65A 5GS2D 1KJ2B 2BNQD 3DARA 4QHNB 2R8SH 5I1KL 4F58L 4LLUB 4CNIA 3O2WL 5I1GH 3FQTA 4LVNC 3REVB 2YD9A 5A43C 4O02H 5I6XC 4YAQB 5I1HH 3RVUD 1S9YB 3G9VA 3MV9E 2H45A 5C71A 3KWWA 3BVNA 4GQ9L 4XWOD 2CJUH 4PRHB 3FOLB 4PJ7E 5F9WB 1RUQL 3L5WA 4EIGB 2OZ4H 1OT2A 2YBRA 4YNYB 4L4TD 4ZAKB 5C0EB 1EHLH 3ZTNH 1Y6MR 3PWPD 2A0LC 4BZ2L 4X4XA 3MSPA 4HX1A 2H32A 3LEVL 3FQRA 2AK1L 3S7GA 4AH2B 3WFZA 1N0LA 2ORBH 1K3ZA 3O45A 4BSWA 4NUGH 1E4WH 5DMGC 1OSZB 2A2QT 4AEHH 1LEGB 1AQDB 5FF6A 5DK2B 4J23A 4L29B 1PKQB 1MRFH 3P4NA 5FHBH 4Z8FL 5EBLA 2BVOB 1TTGA 5L2KB 3CZJA 4M6OL 1SY6L 1FIGH 1IJ9A 3DRQA 4OM0L 5E2WL 5FIEA 5FYLL 5CINH 3CH1B 4U1KA 5C8JA 4A2LA 5MEQA 2HN7B 3C09C 1MLCB 1BM3H 3QCVH 5K59E 2V7NB 4LSTL 5INCB 1FVDB 4Y1AE 3T4YB 2CRYA 3HG1A 3MNWA 4ZUTB 2MQCA 3W0WE 5DSCA 4JY6B 1OLLA 2IEPA 2PN5A 3M8OH 4PLOB 2F5AL 3G08B 4X4YB 5D96B 5C07D 1VEPA 3JUYA 5DUBB 1GOHA 1NJ9B 5KANG 4RMWA 3IFLL 5IB5A 1ZGLA 5EH1A 4NPYA 3U0PA 2AXJA 4XHJC 5ADPH 1MCOH 4L4VB 3F7QA 2DIAA 3GKWH 1C8PA 4YXKL 2FHCA 3IDMA 4E42A 1EO8H 1KLGA 1FV1B 3MROB 5E9DA 1H9VA 1EMTH 3OGCB 4OIBA 4MAYB 4M7KH 4JCMA 3TCXA 5BVJA 1D6EB 3EYQC 3C2SA 4Q9BA 4ODWA 3NGBB 3BKML 4OD3L 3HC0B 1YYMH 3QHZL 2AEQL 2V2XA 1DVFA 5FECA 3V4UH 2VXVL 5ADOL 1AP2B 1KSRA 4UB0L 5BV7C 2X40A 5GGVL 5I75C 3TYFA 3KGRA 5EIVA 1T80A 2H9GA 4N0FA 1ZLUH 3RVTC 3QRGH 4QRQA 1Q0YL 3CU1A 5FB8B 4IBLT 4CU7A 4F33B 2J8UB 3OKDA 4PY8J 2RR3A 5ANMB 4M1DH 2ZCKL 3O6ML 1MLBA 2QSQA 3UTTA 4R26H 3OZ9L 5CZVH 3U6RA 4LU5H 2E27L 1CGSH 4ELKB 1HN1A 4NZTL 3VRLE 2XQYK 3TT1L 4X6CA 3VE0A 1N3NB 3OXSA 4JY4B 3C8KB 1BEYL 1OAUH 4UNTA 1I8MB 3BP5A 2JJWA 4HUVB 3WUZA 3ILQC 4LKXA 4X83A 4EJ1C 1CT8B 4UDUA 4FABL 4JRXB 3WNKA 1A6WH 1OB1B 4XC1L 2Z91B 2FBJH 4YHPB 2CKBH 3MGTB 3C5ZA 1MCPH 4GKNB 5ITBL 4HMDA 3TC9A 2F54E 2DQJH 4OD1L 2VWEE 1IAIM 1MAML 4H8WC 3LMJL 2C3WA 5IVXB 2HJFA 2EDLA 2R2CA 5DLML 5GS1C 1I3RB 3BP4B 2AKRB 5TDOB 2R69L 4IMLA 1S8DA 5FHAL 3QEQD 1KENH 5LQBH 3EJZD 1K85A 4WW2C 3TZVB 1WT5C 4LVEA 3PQYA 3PWNB 4KZEH 4KDTA 4KRPB 3VG0H 4RAUB 3B8SA 4OLEA 4CN1A 1VFAB 3AXLA 4RMUA 3SDDA 1I85A 4POUB 3EDEA 3U0TA 1DN0B 2AABH 1HKLL 1IKFH 4MNQE 5E9DD 1GAFL 5FO8B 4WFEE 5E6IB 2W59A 5BZWA 4HDIA 5JR1L 4KTDL 3RA7H 1DBAH 3L3OA 4YK4B 1ZS8A 4FNLH 5EU6B 4F7TA 4LRNL 4PJEB 2BNRB 1DEEB 3BZ4B 1Q9OB 3JTSA 3UPRA 4ALAL 4KUZH 3K3QA 5IB2B 1OQOA 1NANH 3MQIA 4KKAC 1UM5L 1M7DA 1YNLH 5HHQA 5D5MF 5FEBA 1Z0MA 3V0AC 2FJGB 5IUSA 2VDML 4XBGB 3UTTD 3DETD 1HXMB 1WISA 2Z31B 3ARFC 1E4KC 1JZ6A 1QD0A 2VOTA 4MJ4A 3HI6L 2Q7YB 3BESR 4PS4L 5FXCH 2R4SL 4J3XA 3NH7H 1AGCA 1N7MH 5F7FA 4NGHH 4NQDD 2XTJC 5D8JL 3TJEH 4H0GA 3IU4H 5DRWB 1KACB 1C7TA 5EUOA 1QTYT 3TH2T 1BLNA 5C9JA 1NUNB 4OGAD 5EOQL 1EV2E 4QY8A 3F12B 1EVTC 3MA7B 1XCTB 4Z7VB 5BRZA 1K6QL 5JPNB 5JUEH 5DD1H 3K80A 4GKOA 5MERA 2BNQE 1TZHB 2O5YH 4P5KB 3DX6B 3RZCB 4Q0XH 1CL7H 3T4AB 4G8FA 5GGTL 4KJQC 4DZ8A 2IWGA 3GRWA 1QFWH 2GEEA 1R5VA 3P9MB 5CBEA 2R0WH 3TV3H 4HZAA 2VTFA 5HY9A 1QSFA 2J1KA 3D39B 4O9HL 1NLDL 4L4TE 3P30H 4L1HA 4JPKL 2NXZD 3PWPE 2B1HL 3T8XA 4U2ZA 2FO4A 5E2TL 3ARBB 4U3CA 2Q8BH 3DVIA 3BKYH 4HUUA 4LSUH 1RHHB 4HMEA 4HWZB 2EYRB 2B8OT 4GBXC 3VFTB 3WSQH 5C0JB 5JDSB 1VGKB 2HFGL 4ZXBC 5FK9B 3I84A 3PQYD 5C2BL 1DBBL 1JTTA 4WNQA 4XNZB 3SDDD 1RUMH 1Q9KB 1C1EH 5E8NB 4OZHA 1CFVH 1U36A 5F88A 3VFRB 4TUOA 1EUUA 3DPBA 3MTRA 2PXYC 4FFZH 2XTLA 2F53E 4H25A 4DTGH 4OT1H 2QKIA 4M6ML 4XNUH 2IAMA 3RPIB 1RK0B 1ZE3C 3HZMA 1Z3GH 2DL9A 5HHPB 5ESVA 3IF1A 2C26A 2ED8A 2QSCH 4NNYB 4G6AD 4NWTH 1PD6A 2HFFB 4WV1C 3MV8B 4NKIL 4P9HC 1A6UH 5E99L 1RJLA 2IFGA 2YD1A 3D18A 4QRUA 2V5RA 3TWCH 3WLBA 1T0NA 4NWUH 3HLAA 3DUUA 5JLZA 3UZQA 1QEWA 1YNKH 2FJFB 2P24A 2WBJB 5C07E 1VFUA 4WW1B 3TBSB 4FQQB 4Z78A 2P8LB 1JPTH 2XG5A 4YHOL 3I6KA 1I7RA 1T7ZA 1W72A 4S1SL 4XWGH 1QBBA 5C70A 2JB6B 4UBDC 3V5DA 1OAYH 3JWOC 1ETZA 3CZFA 5J9PB 2FECI 1RJZA 3EYFB 5BRZD 1MHCA 4G6ML 1JHLL 3U46A 3CDCA 1BF8A 1PG7H 5L9DL 3IGAA 4P4KD 5F6IB 4JPWL 2DKSA 5KVFH 2CKBA 1K4DA 2X70A 2VB5A 1XCQB 1QSFD 2CIIA 3LV3A 5AYQA 5AZ2L 1F3DH 1OY3B 1V7NH 1A02N 4OCSH 3KPSD 1WFNA 5A3IC 1F3DJ 2GKIA 4L8BA 5TQ0H 1RZ7L 1C08B 4UU9A 2FJHB 3RZWA 1FZKA 3BI9X 5B8CA 1Q9LB 3LQZB 3SDAB 3W11C 4XNXH 3QXAA 3O9WC 3ZE0F 5FYLD 1FYTE 1IGCL 3X12A 1NAKH 3LSOB 1FJ1A 5DK3A 2OI9C 4NKOB 2DLEA 4RNRB 5LXGH 4R8WH 2VDRH 2F15A 2IQAA 5DJZA 4JGJA 1AGDB 4LPXA 4HGWA 3D25B 4XBPA 1LEIB 1IEBA 2XY1A 3VFPB 3CSYB 1LP9B 4AQ1B 5HVWA 1OM3H 5F1KC 5B4MD 1FVCA 2Y7QA 1F13A 2UYLA 3Q6FB 1RIUH 3LKRB 3I6LD 1ZHBB 4EUPB 3BRFA 2F8VA 4RWHA 5T33H 5CBAB 5MP6H 4Z76B 5BCAA 2VZTA 4NRYA 4L9LB 1FZOA 4Z0BH 5FCUH 3DROB 1FRGH 1QBAA 3CNKA 2B4CH 3GJEB 3QEQE 1Q1JH 1BOGB 4NKDA 5J3HC 2IH1A 5J1TC 3NIDE 5KVEL 3FRUB 1QPXA 2YD5A 4LSSL 3KJ6L 4LCIH 3AMLA 1LK2A 1WJ3A 3QNXA 3CLEL 3TNNA 4XMLH 5IIEA 1S7SA 2FDBP 3GBLA 4YGAB 5E9DE 3G5YB 4UI2A 5K9KA 4G43B 4GAGL 4KGLA 5DEGB 4Q6IB 3PABB 4MD4A 4BH8B 1CF8H 1JFQH 3X14B 4OF5A 1JUFB 1AH1A 2XKUA 3JV6A 1EO7A 4HCRL 1CLYL 2OM5A 2P7TA 4P3CL 1RZGA 1NCAH 2OTWB 4LLVA 3SKMB 3PV7A 4RX4A 1YEJL 3TIEA 2AP2A 4MVBD 3P4MA 2FATH 4FQ1H 4I8DA 5TF1L 4YO0A 4M61B 3TBTA 1HI6B 2FEEL 2YC1B 3EOAA 4XVTL 4YWGL 4HFUL 3C60A 4PP1D 4EN3B 5DXWA 4P9MH 1ZLUK 1CXIA 5IHBA 4LLYB 3GDBA 2CXKA 2VDQL 4KUCF 1U3HA 3TCLB 1JWMA 3QNYA 3X3GH 1U8HA 4MQXC 1I1CA 5DD6B 3OSKA 3JV0A 4NQDE 5MENB 3IU3A 3E6FA 3QYCA 1WIPA 4YHKH 3UTZB 1CLCA 4PR5A 4JDTH 3MBEA 1D5ZB 3RDTA 2UWEA 4A6YL 2NY6C 4MCZA 4O58L 3MRPB 3G5XA 2OSLA 4JO1L 3OF6D 4R2GB 1UZ8B 2HFTA 2K7QA 5DEZA 1X9QA 1M05A 5DEFB 3P9LA 4LASL 1DE4B 1MAJA 5CP7A 4HC1H 4BQ8A 2DDQH 1P4IH 4MAYC 1YUHA 3HE6B 3RWJA 1T66D 3NGBC 4GT7A 3ULUE 2NR6D 4HIEA 1P7KB 3WS3B 2LU4A 1UADC 3SKUD 1U8KA 4EI6A 4KI5C 3I85A 4ZSOA 1NGQL 1SM3L 2XRAH 3PQYE 3WDIA 1PZ5A 3QQ3A 3GIZL 5JHDD 1EEZB 4KKLD 3U36B 2UVEA 1VKXB 3ME0A 3KPMB 3ULVD 2Y5TB 2BJMH 4JCLA 1FBIH 4U4BA 1DCLA 2GSIB 3M17A 1CG9A 3GSNH 1KCVH 4P2OA 2NTSP 4WW2F 2HT3D 3BGMB 2AJYL 4Q9CA 1CDYA 5IMKA 1IGYA 1A1NB 3MYJB 5ELIA 5I76B 4JQIH 3LKPB 4LARH 1KIPB 5BMFL 4K23H 2J12B 3BZEB 5D70H 1UXWA 3MV01 5DD0L 3DIFA 1SEQH 4ZNEE 4NRXB 2H8PA 5D2LE 3GKZA 4BKLA 3GMRB 4OZFG 1DFBH 1KB9K 3FFDB 4G8EA 3HE7B 3KNBA 3T2NL 4PLJC 5FUOL 1J10A 1EXUB 3MO1B 4J6RH 5EBWA 5LGHH 2R56L 1MHHA 2VLLB 4K7PX 3U7WL 5IW6A 3S35L 2VABB 4LSQL 4PTTB 4PRIA 3TBYA 1XGTA 1LO5B 5HDLA 5DHYA 2N7BA 5IOPA 4U6VL 2KUTA 3VFVA 2R0LL 2GTZA 1QRNB 5F96L 1I1AA 4V1DB 1XFPA 4LDLB 3QISA 3RDTD 1I75A 2CGRH 1MRDH 1FNSL 2BVEA 4CVZB 5T3XL 2NCMA 4YFLI 4Q9QL 1CFNB 3O0RL 4F9PC 2YKLL 4LP5A 2VXSH 4RMTA 2X4TB 1RI8A 4XCYA 5F7MC 1FCGA 1JPGA 3QZWB 5L6YH 5DI8A 4YHZL 4GRLD 2RHEA 1NAML 4PJBF 1EEUA 35C8L 1H3VA 4Y4KA 1I9IH 1YNTA 1DSFL 1OTSC 2QSVA 1QKZL 1JGDB 2FGWL 4XC3H 3KPSE 4HFWB 3WFEH 4IOIB 5IB1A 4BZ1H 5FKPB 2A73A 3CVIL 4QXWA 3SKNA 4GUPB 3CCHB 4XGZB 3ZKSD 5GS0D 2M8XA 5FYLE 5INDB 4HJ0D 3ES6B 3NFPB 2ZOKA 3T0ED 3VFNA 4OLVH 1IL1A 2NZ9C 1HK6A 1SVCP 2Z8RA 1CLOH 3BJLA 2Z4QA 2A1WH 1T2QL 2X9WA 1P4LB 2VMFA 4G9FB 4ONOA 4OZHE 1UFUA 1MHPH 3MXWH 2VAAB 2O26U 3Q6GH 4CMMA 1DBKL 5EOTB 3P0YL 1GGBH 1Z9OA 4NM4L 4PBXA 5D1ZD 3UBXA 3P0VH 3VD4A 1B9ZA 3RNKA 1F6LL 5KOMC 1KIQB 1SJHA 3OKLA 5IGXH 2YUVA 2VQ1B 2ICEA 3LS4H 3G5VB 4QRPA 1F6FB 3I6LE 1EK3A 2QQNL 3ALXA 3D0LB 2G2RA 4WY7H 4WUKL 4AIXA 4L8DA 4OZFA 1G9MH 2ATPB 3WE6B 1GVIA 2W92A 4WCYL 5C0NC 4KDVA 1TMCB 1WAAF 3QAZB 3TO4A 1D9KC 5I1IH 1DQDL 4NDMA 5DQ9A 5EC1B 4HULB 3TBWB 2X4SA 3A6CH 5C0AB 1T83A 3U7YL 3WDJA 5HI5D 4LSDA 3JBG7 5I1EH 4KVCH 1A6TB 2DIBA 3ARED 4LF3A 2QTEA 3BWAB 3D87B 1MI5A 1RMFH 3DYOA 1R3JB 3MLXH 3MOBL 1HOCA 5ISZA 3QQ9D 4I5BB 3JWDC 1HQ4B 1KJMB 1ZK9A 5DK0A 5AZEL 4JFYB 1UJ3B 4HS3A 1H5BC 2P8MA 4K94H 3OKOA 3K81A 4NC1E 4M43H 4HWBL 4I9WE 1JF5A 1JNNH 3RJDA 3S88H 4NN6B 2DF3A 2VC2H 5FA3A 1L7IL 4Y4KD 3TA3D 4HC1A 2R2BB 4PRAB 4MNQB 2BOBA 3DX7A 1KN4L 5FYJH 4MXQD 1YC7A 1EH9A 2X09A 3SJVA 4X7TA 1NBQA 3MGOB 4Z9KB 4CJ0A 4DCQB 4U6XA 1R0AH 2BC4A 3P4OA 4Q6YA 2I27N 1R5IB 3GHEL 2BSED 4HW6A 4L8SC 5L7XL 3MNVA 5TE7H 4W68A 1KELH 5BS0B 1K2DB 3L6FA 5AWNL 4J7RA 3GSNA 1DBML 2WBJC 1FO0B 4MA3B 1YPZA 2OJZL 1JPST 1KGCD 1ZEAH 1DUYA 2FX9L 4KJYA 5GRJH 4QTIH 1BIIB 5K9JH 2Q76A 2OK0H 1W2KT 2ZZUT 4LLMB 5F1OB 4F7PB 3I6GA 1IGFL 5D7IF 3EHBD 2Y07L 1G6RH 3L3DA 1KTLB 3QUXA 3CIQA 5JW4M 4TTGA 1NGXA 4Y5VB 5FKAA 4RGND 4XPHL 3TO4D 3RUGE 2EIZB 1M7IB 2BNQB 4ZUUB 3VG9B 5EN2B 5IMLA 1YY9D 1WF5A 2DQFA 4JZNA 1D5XB 1GZQA 3HTLX 4PGCB 4P5MA 1IGJB 5IBLD 4J3WA 4RFOL 4YBLB 4KK8C 2V2WA 4YXHH 4PLKD 4QXUL 4U6TA 4YR6B 1K4CA 4KMLB 1IBGH 2HRPL 4Z95H 4R6UA 5JHDE 1H8OA 3D0VB 4IEFB 3GSRB 2D4FA 5MEPB 3PWPB 3ULVE 3SDYL 3BKCL 5ISZD 5DFTA 5K9OB 3SDAC 3S4SA 3P4LA 5D7JA 2FLRT 2J7LA 5CEYA 4ZFOL 3SGEI 3DVGB 4ODHH 4QRRB 3ET9F 4TUKL 3SCMA 3CFKB 3ZTJG 1VESA 3C6LD 4WU7B 2IADB 1JPSH 5BJTA 4JY5L 2CH8A 5IJKC 3FCTA 1MCHA 4NYLA 3K7UA 4ZG1A 5CWSA 5MI0C 2FCBA 1WGOA 3ARDB 3HNVH 1AD9B 4WHYG 2COQA 2OQJB 3MRKA 5IQ7H 5GRZA 1FPTL 1WBXB 1I7TB 2NPLX 5CJBA 4UZGA 3PHQB 43C9A 3T0XA 3M1BA 1IFHL 4HWEL 1IKNA 4QGTA 2W60A 2FD6H 4MDJB 3VFMA 4YPGB 2LAAA 4YEEA 4RAVA 2F74B 5L88L 1T22B 5E2VL 5EORL 3NZHH 3IFPB 1MCWW 3IDJA 1QUNA 3V0WH 2QQLL 1FNAA 3MODL 2JJTC 1S9XB 5JORB 3H9HB 5HHOA 3GMNA 3FTGB 2IALA 5EA0L 3ZL4L 2JJSC 4X5WB 5E7FA 1Y6KR 1YJDH 3QUXD 3RNQB 4LCUB 1YYLH 1BQHG 2F58H 4OF3A 4LNRA 3V7MA 3ARVA 3QG7L 2W65B 3TPUA 3OAUL 5IB4A 4WU5A 3KXFA 4CNIB 1H3PH 4YE4L 1RJYB 3FQTB 4JFEA 1DEDA 1J0ZA 4DKFL 3QIBA 3D85A 1MSPA 4ELME 4IRSA 4I13B 1B0WA 3T0EE 2Y1VA 4PJIF 3BVNB 3BAEH 4O4YH 1INQA 1XF5A 5F8QC 3MLZH 2YBRB 2G75A 3MREA 3V4VH 3E2HC 1WWAX 2NY4D 4CJ1A 2QHLA 3VD7A 2JE8A 4N0CD 4UOW1 4X4XB 5D7JD 4HX1B 4APQC 2J6EH 2DQIH 3FQRB 2JIXA 3ZE1E 5DHVA 3HPJB 3T3PE 2D7QA 4U1HA 1NUDA 5EULV 3B9EA 3O45B 4BSWB 3VH8A 4UUJA 4Y5XB 4Z7NF 4IHOA 5T5NF 1RU9L 1RUKH 1ZT7A 3KPQA 5FF6B 2R8SL 5M95B 2JCCA 4KROC 2FEDD 4IM8A 5I1GL 4HIJB 2OTUA 4MB5A 4O02L 1B4RA 3DRQB 5EOCH 2E6PA 4U1KB 4F7CA 5MEQB 1XGUA 2R2HA 4G9DA 2OZ4L 4HWNA 1HYSC 5I30L 9CGTA 4Q7DA 3ZTNL 5EIQA 1SHMA 3DX9A 3FMGH 2C1PA 1HHKA 3MNWB 3HG1B 3BPCA 3CFEB 1Q0XH 5DSCB 2BSRB 3IXAA 5CEZL 5CD3A 3I3BA 3BE1L 4UOW0 4WI7A 5H37G 2ORBL 1U0QA 5IB5B 1ZGLB 4EI5A 4JO3H 4N8PA 3BXNA 5HHOD 4NUGL 1E4WL 4ZYKA 4NPYB 3U0PB 4AEHL 3HA0A 4F80A 3PGFL 4EXPX 2HMIC 4X9BA 5KVGL 4DVRH 2YK1H 5IK3A 3HC4H 1CLZL 3IDMB 3M45A 1G6RA 4E42B 4P23D 2A74A 4I18C 3ZDZE 1KLGB 1MRFL 5C6TH 5KOVC 1PEWA 5E9DB 2GT9A 4YXLH 1FIGL 2CO6B 2XZCH 2CMRH 4LAJH 5DVOA 5BVJB 2PO6D 3UYRL 1XF3A 1XGRA 4GQPH 3KXFD 4M00A 4N5UA 4ODWB 1BM3L 3ZT6A 2V2XB 4JQVA 3CJJA 3LRSA 1DVFB 3QIBD 5ALCL 1M6OA 3O3EA 4HPYL 5FECB 5HGHA 5DJCA 1RZKC 1FN4A 1AQKH 2WM0A 3ALPA 1QFUH 4CVXB 4ZS7L 3TYFB 4M6NH 1MAKA 5JDJA 2H9GB 1DQLL 3K2UH 4N0FB 4QRQB 3M8OL 3OKDB 1X44A 3BX7C 3VGAB 3JUZA 4JRYE 1FDLL 2ZJSH 4GJTB 2EKSA 3SDCC 3UTTB 3KAAA 3QBTB 2NY7H 3QO0A 4WWKD 1ES0A 3TGXA 1KGCE 2DAVA 2WIIA 2VZOA 3U6RB 3HZYA 4NKQB 3GKWL 2NNAA 1KG0A 1G9EA 1L6XA 3DUSA 1EO8L 4HMCA 1XIWD 2EO1A 5SV4A 1EMTL 5LWYH 4DN3H 5EC2A 4H20H 3N50A 4TYUA 1F2XK 4X6CB 3VE0B 3OXSB 4N8VG 4RGNE 3WO3B 1XT5A 5BV7H 3V4UL 4BZYA 4XVJH 5F72S 3BP5B 4XP9H 1G7MA 4DGYH 3GUTA 1T3FA 3QWOB 4U1SA 5GZOC 4U1MA 4XB7A 5SWQA 3WLWD 4HLJA 4LKXB 1BWMA 5CCKL 3PGCA 3QRGL 3QI9C 3P3YA 4PJCA 5EU7E 1JF1A 3VXOB 4P46C 4PG9A 3OAYH 5CJXA 4MJ6A 3SE9L 4R26L 2L4OA 3Q5TA 2NXZB 3BRDA 3LQAC 5CZVL 1H8SA 2HJFB 2CRZA 5ERWA 4Y16D 4IMLB 1S8DB 2NY0D 2X4NA 2R23A 3DWTA 3ZDYF 3DX8A 4EI5D 5TDPA 2DKMA 5F7LB 4EDXB 5I19H 3KJ4B 4MD0A 4AMKL 1A6VH 3PQYB 1A7QH 4WO4D 2UZXB 1ZVSA 1PFCA 5J7CC 2G5BA 4XI5D 3SDDB 1URLA 2GJJA 3U0TB 1OAUL 3QUYA 4JHAH 2HFEA 1NFDF 2MHAA 3VXTA 1S78C 5BZWB 4HDIB 4GS7C 2BX5A 4KK9C 3L3OB 5F93C 1ZS8B 3ETBF 4G8IA 4F7TB 4PJ9D 5C6PB 5F89A 1A6WL 3JTSB 3UPRB 1MCPL 2YPKA 4H8WH 1BBDH 1XZ0B 4DGIH 3CFCH 3DV6A 2VISA 3W9DB 4Y19A 5DR5L 3QWRA 4X8JA 2EKJA 1M7DB 4DKDC 1J8HD 5HHQB 3BSZH 4M62H 5JW5A 3CUPA 4XNYH 3VWKC 4MB4A 3DV4A 4MAUL 4HK3N 5LQBL 1WSST 2APBA 1O0VA 2D9QB 3NPSC 5KSUA 3VG0L 4LGSB 3RVXD 1HKFA 1OP9A 5CILH 5E5MA 4P2CG 2I25N 1AGCB 4ZUWA 3FT2A 5I8EA 1N6UA 2GYSA 2OXGA 2Q86A 5F1IA 1U42A 2VWEC 1BLNB 1DBAL 5C9JB 4OF8A 5I17A 2EDHA 3FAWA 4ZQKA 4N8VA 4S10A 5BRZB 3FQWA 4OM1L 4TSBH 2Z92A 3EO9H 5MERB 4S1RH 3G6JA 4C56A 4XVSH 1GYAA 3LKNA 1WZ1L 4G8FB 2DBLL 1HCVA 3BKJH 4KUZL 4FQLH 2O61B 1GCFA 1CXLA 3P9WB 4DZ8B 3IDNA 4P4KB 2VXUH 1C7SA 3BPLC 5CBEB 2FH6A 1EHNA 5HY9B 3L9RA 3O3UN 4KKBC 5HPOA 5JHLH 1WUNT 1QSFB 1H3UA 1TETH 4K9EC 3BIAX 1HH6B 4GLRI 5C09D 4RRPA 3O6FC 3T8XB 4HUUB 2YPVH 4R7DA 5JXEC 1T21A 3NH7L 2HKFL 4DKEL 4I0PD 3TJEL 4FZEH 1I3GH 2I07A 4OQTL 4YH6A 5CSBA 1CYGA 4WNQB 5DA0B 3T0AA 4I77H 3G04A 4BJLA 4P5TC 3WNMA 3BGFB 3QUYD 5JUEL 1H0DA 4QHKI 4I4WA 4YUEH 4OZHB 2O5YL 5F88B 1CL7L 4TUOB 2NY1D 4UQ2A 4NQSA 4ONFL 3WN5C 5HI3D 4H25B 5C3LD 4U1LA 1I9EA 2QKIB 2IAMB 1QFWL 5T3XE 1QSEA 2R0WL 3B8YA 3HZMB 4OKVA 4CN4A 4NJAH 5C08A 1UACL 5ESVB 3IF1B 3I75A 4Y19D 3QWRD 1BGXH 1ND0A 4XXDA 1B2WL 1FNGA 4LDOB 5C0CE 4HGMA 1A3LL 1I1FB 4P57A 1RJLB 3BKYL 3K2MC 4LSUL 3WLBB 4QRUB 3D18B 3WSQL 1T0NB 3GI9H 3HLAB 5IQ9A 2ICWA 3DUUB 5JLZB 4ZOEA 3FRPA 1QEWB 4JJ5A 4OSUL 2P24B 4P4RA 3L5XH 5GJSH 4Z78B 3OL2A 3I6KB 2VLJA 4TTDD 5HHOE 1I7RB 1W72B 1T7XA 4BQCA 4G80A 1C1EL 1EAPA 3HUJA 4E41E 4XWOC 1CFVL 1GZPA 3X3FH 3V5DB 4HBQA 4G7VL 4X0KA 4Y4FA 1ETZB 3CZFB 4FFZL 1RJZB 4XP6H 1T1WA 5DJYA 3QNZA 4OT1L 3WNOA 1MHCB 4PJHE 4FTVA 2DQTH 1KEMH 3U46B 1Z3GL 4NZRL 3KXFE 3GIVA 3HRZA 5J6HA 1I3VA 1WC7A 3B5TA 1NBYA 2AV7B 2H1PH 3OJMB 3IGAB 4P9HH 5CS7A 4WGVB 4CVUA 1OT1A 3F7YA 1BD2A 2CKBB 1K4DB 3OQ3B 1YEKH 2CIIB 1N4XH 3SO3C 3TWCL 2ZUXA 1AO7A 4GKSA 1YNKL 4JZJA 4L8BB 1NEUA 1OD7A 3MLYH 1VFBA 3UC0H 4UU9B 4PJGE 1J0JA 3ARXA 1P5VA 1CU4H 5B8CB 3FO1B 2APXA 5FFLA 3QXAB 3JWOH 4WHTA 1U6AH 3NFNA 1J05A 3X12B 4RDQF 3ARSA 3VMPA 2FR4A 1FJ1B 1QHOA 1L9NA 5SX5H 3N06B 5LCVH 1UZ6F 1EEYA 4N5ED 4HKJA 3CMGA 1E4JA 2IQAB 1N2RA 3CK0H 5DJZB 3WHE1 2E5EA 4CN6A 1PG7L 4HGWB 5HGGS 4XBPB 3L5HA 3QUMH 4GXVH 4PGBA 5D72L 1IEBB 4R97C 4F9LC 5CEZD 2NY2D 1KB5H 2FHBA 1FNEA 4FP8H 1FVCB 2RB8A 2Y7QB 2UYLB 4F37K 1V7NL 5GS1A 1ADQA 2X41A 2XYCA 4LKCA 1MF2H 4WW2A 1WT5A 4NKMA 3VA2C 3BJ91 4XNXL 3VXSA 4NRYB 4CUCA 1FZOB 2DLIA 3ARYA 3O81A 4MHHI 3BUYA 1H8NA 4EOWH 4NKDB 2IH1B 5D5ME 5E4EB 1DQJB 1PVHA 5I1AA 3QG6A 5LXGL 4R8WL 5HD8D 1ZLWH 4XCCH 1LK2B 3QNXB 4MA7L 4Y8DC 3TNNB 3S37X 5I8CA 5IIEB 4Y4FD 1S7SB 4LVHB 4POZD 3D3VA 4KUCD 2QEJA 1S7WA 3WHE0 5K9KB 3AMKA 4OV5A 5HYFA 4JM2F 3FB7A 2WBWB 1I8LC 4MD4B 2Y72A 5TE6H 2BMKA 3MV11 1I1YB 3ROLA 4OD2A 2AS5M 3JV6B 2P7TB 1RZGB 1A6PA 5AYUH 4F37F 1UGNA 3IAGC 4IRJD 4LLVB 1KJ2H 1CCZA 4XPGH 5T33L 1YN7A 3GFUA 4Y5XC 3ARFA 3P4MB 4LFHG 5MP6L 1AFVH 1E4KA 2APWA 5SWZA 2Y6SD 4YO0B 3IFOA 1J8HE 4UV4H 4KXZI 3TBTB 2H6PB 4HJJH 3QO1A 4TUJA 3EOAB 4F57H 1BBJA 1FRGL 2EDBA 5J89A 3C60B 2B4CL 4UINL 1Q1JL 2Z9TA 32C2A 1V3LA 1UB6A 3BYTA 4UT6H 4JPIA 3V5HB 4NM8H 1U3HB 4LCIL 1JWMB 1RVFH 3QNYB 4OCRL 1U8HB 4XX1G 3FAXA 3O4LE 3GBMH 3IU3B 3E6FB 5GGQL 2X05A 4PR5B 1JFQL 2EH8H 3MBEB 1U8QA 2UWEB 3NCJL 3PE9A 5EUKA 3RDTB 4MCZB 5I1JH 3RWHA 4ZOAA 4G6JH 3ZDXF 4PIRF 3EJZC 3G5XB 2W0LA 2OSLB 4NO3B 1N0XL 3LHPH 1M05B 3P9LB 3QCTH 1REIA 3TJHD 3HMXL 2LAGB 2P8PA 4GBXA 4JFFA 5CP7B 4P9ML 4ZXBA 5C09E 1T03L 4KQ3L 4TNVK 1T4KA 3RWJB 3OAYK 2FIKA 1FHGA 3DMMA 4PY7B 3DI3B 3WFDL 4NQED 4HIEB 4U6HB 5C0RH 1BQSA 1MCKA 1U8KB 4EI6B 2JJVA 4YPJA 3T77A 4ZSOB 4WFGD 2E7MA 1PZ5B 2PXYA 5JZ7C 4JDTL 4ODUA 4GMSH 1ZV5A 1LO2H 3GBNH 1W0YT 4ONHA 4AG4H 4LAQL 2ILLA 3QUZD 3DETC 4Y5YC 2YPLA 1CICC 4KKAD 5EZIH 1CG9B 3CFBA 4P2OB 3F5WA 5KSAD 1RAMA 1G1YA 2MMXA 4WV1A 5IMKB 1IGYB 3BGAA 4X5LA 1OGAD 1T20A 1RZJH 1WITA 1CD1A 4Y19E 3ARFD 1UXWB 5H2BB 4P0DA 5SWZD 2EIBA 5I1DA 3DIFB 2H8PB 4OGAC 4HXAH 1NMBL 1UH4A 4BKLB 3FN0L 4TNVF 5HYIA 4QOKA 3GNML 2P42B 3HHRB 4JM4H 4G8EB 3SDXF 3KNBB 3L3IA 5GGUA 3MR9A 2XT1B 3WD5L 1BVKA 4AENA 3AS0A 1OP3H 2G60L 5EBWB 1F2QA 3FOMA 1MHHB 5HVHC 5IW6B 1N8ZB 3E6HA 1I9RH 1EGJH 2BVQA 4PRIB 3TBYB 1XGTB 1IM9D 2BJML 5DHYB 1P4BH 3MBXH 4BSJA 5IOPB 3N1FC 2B7DT 3VFVB 4GAJL 2E8YA 4NO5A 1I1AB 1HHIA 4OB5H 3GSXA 3ZE0E 1J5OH 1Y18A 3OGOE 3QUMA 4UAOB 3S34H 2GAZA 2EDTA 4GRWB 3ULUC 1AKJD 3H8NA 7FABH 5ESAB 4JREB 1KB5A 4DN4H 4YC2B 4XCYB 4RFEA 1OP5H 3FT3A 1JPGB 3D9AH 2P5ED 5DI8B 5DGRA 1FL3A 4M7LH 1FL5A 1QO3A 3SDDC 1JHTA 4Y4KB 2H2SD 3O9WA 1P9MC 3KDMA 4ZXBD 5CUSL 5KS9F 1BREA 1UXSA 3QWQB 3RX7A 5IW3A 1KPVA 5IVZA 3PV6A 3O2DL 5IROC 2WP3T 4J6RL 1YN6A 3DMMD 5ICZA 3NACH 3SKNB 1OVZA 3MRMA 4MMZC 2DTML 3KHOA 3OV6A 2ADIA 2D7PA 3DURA 3CXDL 2ZOKB 3WDHA 2PXYD 4D9LL 1IL1B 4G6AC 5DT1L 1OWWA 2FYYA 1XH3B 2BSTB 2Z4QB 1G9NC 1EEQA 3T1WA 1FFQA 1ZA3A 3NAAH 2D0GA 2VXSL 1CGVA 1KOAA 1MJ8H 2YPLD 3R4DA 5IFJA 4CMMB 1GGIH 4FQ2L 2ZPKL 2CSPA 3UDWA 1RIVL 4WUUA 2EDDA 1UWXH 3UBXB 3IDXH 4LGRB 5CEZE 2BRRL 2D7TH 3RNKB 1MFEH 1NKRA 2VYRE 1IZJA 1SJHB 3OKLB 4PJDF 4KMQA 1KJ2A 1U2HA 1DTUA 2ICEB 2EYSA 4LFHD 4XC3L 5CJOH 4GG6F 3VMOA 4BZ1L 1HIMH 2G2RB 4JFXB 2UZYB 2NY5C 4L8DB 2GJZA 4OZFB 3S36H 1S9YA 4QOKD 5E5RB 4RGNB 1VA9A 4PRHA 3TO4B 4R4FL 1MQKH 5CKGA 5IHZA 4NDMB 1FQ9C 3LEYH 4RBPH 5DQ9B 3SE3A 3WUWG 2KQMA 4P4KC 5T5NG 1XGYH 2V5MA 4R4BA 2X4SB 3NTCL 2P5WE 4F2MA 3IAPA 1KLUA 4PYHA 1NFKA 5HDQH 1J1PH 1MHPL 4FFWD 4LF3B 4J4PD 1MI5B 2ESVD 2YMXH 2R15A 1F4WH 1KC5H 1HOCB 5ISZB 4JO4H 3MLPA 1F4YH 4AIOA 3MV7D 3RGHA 1HHHA 4XPFL 2OTPA 5DK0B 4HS3B 2P8MB 4G3YL 5DTFA 2GSGB 5FA3B 3O9WD 3ZSTA 4WI4A 2BOBB 5C92A 3DX7B 5B38A 3ZKMD 3SJVB 4OI7A 4X7TB 4OTXH 4XP5H 1HE7A 3K8LA 2LFGA 3A6CL 4X6DA 5B4MC 3FO0H 4U6XB 5DYOB 4GXUN 2BC4B 3P4OB 2WMPA 1CDUA 3Q5YA 1A5FL 1RMFL 3J8F7 4UV7H 3JWDH 3MNVB 4K3EH 3ARQA 1HCFX 3L6FB 1JNLH 5TQ2H 5SX5K 3RBSA 5E8DH 3GSNB 3QHFL 2E9BA 4WUUD 1YPZB 4LCWE 4JDZA 1FV1A 4M43L 2BHUA 1DUYB 3MROA 2K7PA 1JNNL 3OGCA 4KJYB 2W0PA 3A0OA 3G5ZA 4S2SA 2Q76B 5EZLA 1N26A 2FBOJ 2UVFA 4B0MM 3GSUA 5I73C 3LEXA 3LKSA 3HNTH 8FABA 1UM4H 3I6GB 5FYJL 1JZ7A 2DQCH 2QL1A 3L3DB 3DLQR 3QUXB 1IRAY 3MXVH 4LBEA 1NGXB 4OFIA 2C3HA 3MLWL 4HUKB 1X7QA 3ZKND 1R0AL 5IMLB 2DQFB 5DRNB 4JZNB 3JTTA 1GZQB 4P5MB 2J8UA 3ZKXC 4NQEE 4XCFH 5ANMA 5IBTH 4NC1C 3ARGA 2CLZA 2V2WB 5JNYA 3VGFA 1EGJA 4MVBC 4WFGE 1K4CB 3QEGL 3MC0A 1QFOA 5JXAH 3LKOA 4NN7B 2I26N 4JFPA 3SE4C 4OZGF 1BJ1J 4PP1C 1ZLWK 3RIFK 4Q97A 1I8KA 4GMTH 2GTWB 3S4SB 4NC2B 5D7JB 5CEYB 3L5JA 3SY0A 3H7BA 4OZIE 3MX0A 1OGTA 4FHBD 4JY4A 4H1LG 1G7HA 2R2EB 3UTSD 1PW3A 1OGAE 3KPRA 3NA9L 5JO5A 1RURH 5SWZE 1BZ7A 3FCTB 3MRGA 3B5HA 1TCRA 4HUVA 4NYLB 4D0CA 5CWSB 4FQCL 2W0FA 1G0DA 1QZ1A 4Z7WF 1J0YA 3MRKB 2R0ZL 5A2KH 4GKNA 4XPBL 43C9B 1IC5H 1DLHB 3CLFH 3M1BB 3IDYB 3PWJA 1KN2L 4PJBE 4R90H 5IVXA 1NPUA 4Z95L 2W60B 4Z7UF 4ZUVA 1CFQA 2NY6D 3VFMB 3BP4A 5ILTL 4F9PA 3QPQD 3MLRH 4RAVB 1RJCA 1RIHL 1EFQA 1C5CL 1P53A 2XPGA 2OL3A 1J0IA 2QADB 3IDJB 3OKEA 2NR6C 5F7UA 3L3JA 5E4EC 4GSDL 5HHOB 3GMNB 5J12B 2XZQH 2P5EE 2IALB 4PJEA 5E00A 3X13A 5T1KA 5D1QC 3IT8D 1MFAH 4N0UE 1QR1B 4P23B 5IQ7L 4S1QL 2NX5D 5DUPH 3QFJD 1W8NA 3ULVC 3OKNA 4LNRB 4ZPTA 2OBGA 2EDNA 4ZFZA 5MEOB 3TPUB 5IB4B 3QP3A 4WU5B 2HT3C 3L7FA 3WIHL 3SBWA 3KXFB 1LO4L 2FD6L 4EUPH 5JW4R 2BVPA 1KNOA 2VZ3A 1NL0H 4JFEB 3QIBB 3ARGD 1FL6A 2XACC 3SGEH 3MJ6A 3PL6A 4IRSB 4TRPH 1MIML 3PWLB 1HQRA 1XF5B 1WAAE 1HINH 2G75B 2O5XH 2IANE 3MREB 3NZHL 3SEPA 2XZAH 5F7EH 4HS8H 1A7NH 4QRTA 5DFWH 4CVWA 3FN3A 2CRIA 3UJIH 3C87A 5BQ7B 4G6KH 5IFAL 1T7YA 2BVYA 1UH3A 2JIXB 4H1LA 5DHVB 2D4DA 4HQQH 5F9AC 5E6ZA 3WO4B 4P5KA 4Y4HD 1D9KA 2F58L 3VH8B 4KTYA 4UUJB 2Q3ZA 4PLJD 1J11A 5FGCB 5KTEL 4OIIH 4IHOB 4N9GA 1ZT7B 3KPQB 4HAGA 2FRGP 1OL0A 5KJRH 1YEIL 2JCCB 4MB3A 3RDTC 1H3PL 4L3EA 5D1XC 3B9KA 3RTQD 1JHKH 2OTUB 3DXAD 5FAAA 5FDYA 4J3VA 3ZT5A 5M7QA 1GL4B 4F7CB 3BAEL 1XGUB 2R2HB 4GRLC 4WDIA 3V4VL 1F58H 1RHHA 1KCLA 4NQCA 1SVZA 2C1PB 1HHKB 3B2VL 3BPCB 2VO5A 5GRVL 1H5BA 4TPRH 2J6EL 2ESVE 5BXFA 2MPAL 3IXAB 5CHNB 5CD3B 2VLME 2NY0B 3MV7E 5H8DA 3WFBH 4LCCB 12E8H 4EI5B 5EBMA 1FNFA 3BXNB 3MNZA 4UOJA 4ZYKB 1Q8MA 5TE4L 4HJ0C 4RZCA 4X4MA 5HI4D 3T0EC 3GMLA 4S1DD 3MUY1 5D6CA 5IK3B 5T1KD 1G6RB 3MJGX 1OP5K 2A74B 3CVHL 3VD5A 4XP4L 1A0QH 1BQHB 3GO1H 5IMOB 3JV5A 5E0QA 3ULUF 5FUCE 2XWTA 3N1MC 1FZMA 1XF3B 3QH3A 1XGRB 4L8SA 5D1ZC 4M7ZC 4MNGA 1EO5A 3P40A 4OGXL 3ARPA 3LRSB 5D7IE 5HJ3A 2N1KA 3NOIA 1M6OB 3BQUA 3O3EB 2R29H 4I2XE 5HGHB 4DZBA 5DJCB 1AE6H 3PL6D 1FN4B 3VXNA 4JG0L 4MSWA 2FJFA 2WBJA 1OAQL 3UP1A 3IFNL 5DO2C 3HNSL 4ODBD 2A6IA 4BFEA 1DQQA 2YD7A 2PF6A 5EFIB 2JB6A 2EKSB 3D6GA 1E4XI 4PJAA 3QO0B 1ES0B 4NJ9H 2WIIB 5J9PA 1Z9MA 3HZYB 2IBGA 3HC4L 2NNAB 1LE5A 1HDMA 1QHPA 1UWXK 2EC8A 5D2LF 4X7DC 1MFCL 4YXLL 2BDNL 3AREC 5EC2B 4KMTL 3QA3A 4QEGA 3DHMA 1C12B 2I5YL 4BA8A 1DANU 2L0DA 3CX2A 4L3ED 3B9KD 4UAOC 3QQ9C 4RDQG 4Y2DD 1AQKL 1G7MB 4YC2C 3GUTB 4U1SB 5D7SH 4M6NL 4NO0D 5HBBA 1TQBC 3BH8A 1ED3A 3PGCB 3BT2H 2HH0H 2B1AH 4PJCB 4RBPK 3LQZA 3IYLW 3TA3C 3IB4A 2ZJSL 3FONA 4MXQC 1QSZA 1AY1H 5CGMA 3KYKL 5ERWB 1KEGH 1EX0A 2MKLC 2H3NA 2XN9D 3DVFA 4OLUH 2UZIH 2X4NB 2AXFB 5IJKA 2R23B 1MJ7L 3CDFA 3OX8A 3DX8B 5TDPB 1P69B 1RZIA 4MD0B 4KJWD 5LKNA 4H0IA 2X4UB 5I71C 4DN3L 3UTSE 4ODSH 1ZVSB 4TSCH 3QUKB 2G5BB 3VFPA 3CSYA 3SGDI 4XPAL 3QUYB 4PGDA 4ONGH 2MHAB 4YDLC 1YEGH 3VXTB 1PQZA 4XP9L 1XMWA 3DO7B 3R1GH 1U9KA 1MY7A 3VGDA 5AAMA 3NABH 4G8IB 4KY1H 4F15C 4OLYH 2FEEI 2X7LB 3GK8L 5F89B 5CBAA 3T0BA 3BQUD 5T3ZL 4KKCD 2AJUH 2YPKB 3F7VA 1RZFH 3DV6B 5SWSD 4L1DA 4Y19B 4JDVA 2HYMA 4X8JB 3EHBC 1JYNA 3LB6D 1UWEL 2IPTH 2FX7H 5EPMA 2JJTA 5B3NA 3DV4B 1MJJA 3EW3B 3LPWA 4RGNC 1A14H 1T6WA 4OGYH 5J57B 4MXWL 4W4NA 5I19L 2JJSA 1CVSC 1YY9C 4PJIE 1A6VL 2H26A 1A7QL 1ZA6A 5KSUB 3O4OC 3AS3A 3PJSA 5D7LD 5HSFA 4ZPVA 4TOYH 1HWHB 5E5MB 5EU7C 5EZJA 4ZUWB 3FT2B 2E9JA 5I8EB 1RUAL 5F1IB 2Q86B 4Z7VF 4N8CH 2EC9U 2R4RH 5J11C 1CFSA 1IQDA 4LVNB 2NX5E 3QFJE 5I17B 4KK8D 5I6XB 4PRPA 4ZQKB 3NVQA 4N8VB 3FQWB 1T1YA 5C0BA 4C56B 3G6JB 4HZLA 4H8WL 1CN4A 1BBDL 4DGIL 3LKNB 3OG6B 3CFCL 3S37L 3SPVA 1EPFA 2RCSH 4Z7NE 2ADJA 4JN2A 4RGOH 2HJKA 3IDNB 3RU8L 3C6LC 4M62L 3RX8A 1E6OL 1IC1A 1BX2A 4LLYA 3L9RB 1FH5H 5HYJD 1LO3H 4APQA 5AAWA 2LABA 1SMOA 4M1GH 4DKAA 5L0QB 1YDPA 2XWBB 4TSAL 1NCCL 1DL7H 4PJ5A 4R7DB 4ZTPL 1T21B 5CILL 5HGBA 3UTZA 2AQ2A 2J4WH 1CIDA 4GW4A 3V8CA 2I07B 4LP4A 5JW3L 1NMAH 3CD4A 3G04B 2WW8A 4PV9A 1NCWH 1H0DB 4I4WB 4HEPG 5T5FL 3REWA 2RQ8A 4C59B 3C09B 4ZOCA 4FFVD 1JP5A 3BKJL 1LHZA 5J0BA 3DXAE 1WCQA 4JGMA 1FGVL 2EDEA 4RFNC 1MREL 4K9EH 1QSEB 5JHLL 5C08B 1PLGH 5KSBE 1Y6NR 1TETL 3I75B 3RGVC 3TFKD 3DHJA 1ND0B 4XXDB 5B39A 1WBYA 4OFPA 1FNGB 3WS3A 4GH7B 5FM5M 1TJIL 2W9EL 4XZUA 4P57B 1YEDA 3MV9A 4WI9A 1OAKH 2EEDA 2ICWB 1QBLH 4CBPA 4PJ7A 4JJ5B 1I3GL 4I18A 1MWAA 4P4RB 1MVUA 1X5JA 1KCUH 3PNWA 3WS6C 2Y5TA 1ZSDA 2VLJB 4I77L 2P47B 3LS5H 2BFVL 2VSCA 2WK2A 4G80B 1EAPB 3HUJB 4YUEL 1GZPB 3OPZL 3AGVA 8CGTA 2ZCHH 2WAHA 3ZHKA 4FQJH 4X0KB 5FM8A 4Y4FB 4QXGH 3LKPA 2NY4C 4PRPD 1T1WB 5DJYB 3QNZB 2DQUL 4FTVB 4N0CC 4GLRH 5BV7B 4HUNB 3KPNA 1AR1D 4NJAL 5D7JC 4HV8A 3HRZB 5J6HB 3GMRA 1BGXL 1WC7B 3QULA 1NBYB 4GAFB 3BN9D 3VGHA 3MMEA 3FFDA 3SE8H 5H35A 2WZPD 3KHQA 3F7YB 4IRJB 1BD2B 5CZKA 5EU5A 3SDCA 5GS2H 5T1LA 4YQXL 6FABL 4APQD 4GKSB 5HHMB 1XAUA 5D93C 3AM8A 4JZJB 1AJ7H 4HBCL 2FEDC 1VFBB 3L5XL 1DBJL 1G7JA 4Y1AA 4PJ5D 1R3LA 1MFBH 3IDYC 1S7RA 4XP1H 2OS7A 2OCFD 3K4AA 4WHTB 3NFNB 3W0WA 5I15L 2R0KL 4DOHB 3X3FL 4KROD 3D48R 4LSVH 2FR4B 5C2UB 1NCUA 4BUHA 1EEYB 4PV8A 4CW1A 2DQDH 2WNGA 4HKJB 4OCLC 3TT3L 1KEML 15C8H 4MGXA 1N2RB 3ZDYE 4CGTA 4L3EE 3QI9A 4PGBB 4P9HL 4P46A 5E08H 3PDDA 1Q94A 1FNEB 5JQHC 1YEKL 1JYVA 5J12C 1NFDE 2DYPD 5GS1B 3HZVA 2VLRE 3S5LA 1EAJA 4P23C 3MLYL 4LKCB 3UC0L 2EEBA 4XGZA 2B2XH 4WW2B 1R5WA 2DN7A 1CZ8H 3IS0X 2CUHA 3H9SD 4NKMB 1CU4L 1LD9A 2VSDA 3V6OE 3VXSB 1U6AL 3MLUH 2PO6C 1F97A 1QLEH 4I3RH 1IC7L 1UKTA 2XN9E 3PHOA 2JK5B 4NQEB 3BUYB 3N85L 3UCRA 4RMVA 3OMZA 2YD4A 3FZUC 4WWID 5I1AB 2VAAA 4G5ZL 3QG6B 1GPOH 2EZ0D 4FG6D 4UTAL 2F5BL 3GMMA 2Y25A 3N9GH 4OCYL 4XCEB 3CK0L 4CL7A 4JKKA 1IGMH 5TPWH 2V17H 5I8CB 1MCRA 1P6AB 3VW3H 4OFYA 4HLZH 3D3VB 4QHMA 1VSCA 1NDGA 1QFHA 4OV5B 3FB7B 1QLRA 4FP8L 2BMKB 4WWKC 5EWIH 1CTNA 2A83A 1GIGH 3G6DH 2EH7L 3ROLB 4OD2B 2H2PD 4ZDHA 3VWKA 1ZANH 1O5DT 1XF2A 1XIWC 3FO9B 4WFFD 1MF2L 5SWSE 1NH6A 1YN7B 5DRXA 3U4AA 3VD9A 3ARFB 3TVMD 5SWZB 1JJUA 3IFOB 4LCYA 4WI3A 5FYJE 1T0MA 4TUJB 3QO1B 1BBJB 4D0DA 3W9EA 1S7XA 3OWEA 1NGZA 4R3SA 3ZE1F 2C3VA 2F54A 1BECA 4YZFF 3RWEA 1YC8A 4O51A 4AJ0A 4PJBB 1S3KL 1R3JA 4P2RE 1JPFA 3WLWC 4JPIB 5D7LE 1QFWM 4HKZA 4QRSA 4I5BA 4KQ4L 2C9AA 3WNNA 3OKMA 4B50A 2ZNXA 2IC2A 5DJ8A 1AGEA 1ITCA 3O3BA 3B43A 3V0VA 3UYOD 5I9QC 4JG1L 4Y16C 1U8QB 1NGYA 5EUKB 1A9EA 1YMMD 5DJXA 1LDPH 3RWHB 43CAA 4P46D 2B39A 2NY0C 1GGCH 4NQUA 5AYUL 4MNQA 1UWGH 4LCCC 4EI5C 5IHUH 4J3OC 1EJOL 2B5IC 1AFVL 5IEHA 3O6FA 4WO4C 1BIHA 2P5EB 1A7OH 3QHTC 4XI5C 2P8PB 5HYJE 2CKNA 4JFFB 5JXEA 4ZXBB 3DGGA 2YUXA 4XCNA 1R5IA 2IBBA 1T4KB 4WEMB 5F7YC 2GJ6E 1F45A 4XAWH 4UT6L 4NM8L 2FIKB 3DMMB 4PJ9C 1RVFL 3SO5A 4P5TA 2YUZA 2NY3C 4XRCA 2AI0L 4UT7L 4U31A 4GG6A 1S78D 3GBML 1OARH 3T77B 2BZDA 2UV3A 5T3ZD 2FL5A 1IQWH 2PXYB 3WN5A 5BW7A 4HWUA 1MPAH 4Z77B 4YHYB 2EH8L 3U79A 4ODUB 3ARWA 1UH2A 2AXHA 5ACZA 4G6JL 3MJ7A 4ONHB 4JO2H 4WENB 4KXZH 4JVPA 1TLKA 2YPLB 4AEIH 3NCEB 3F5WB 3LHPL 1KTLA 1TVHA 4X9GA 3VGGA 4JFZL 4U6YA 3EYUH 3VWKD 4WV1B 3QCTL 3RVXC 4UIKH 3X11A 3VWJD 3S9DB 3TIDA 3EOYG 2J2ZA 1T20B 1MEXH 4DEPC 4DW2H 2BNQA 2YN3A 1CD1B 3CDGA 5I1DB 1A7PH 1WCBA 3T1FA 1TNMA 1EJ6A 4ZTOH 1G7QA 1CK0L 2J8HA 1A7RH 2JF1A 4QOKB 3ZMRA 1KTRL 2JELH 2VH5H 5C0RL 2DI7A 5ESQA 3L3IB 5GGUB 3MR9B 4JB9L 3T04D 3UYPA 1BVKB 4AENB 1L4IA 4L4TA 4ZO6A 5JQ6H 1J1OH 5DC4B 2V9RA 3FOMB 2DLTA 4GMSL 1AXIB 3E6HB 1I3UA 3HI5H 3DBXA 2BVQB 3AY4C 3MA9L 3DVGA 4AG4L 3F58L 2AJ3A 4KDWA 3STZA 5IBUG 3VXUD 4NO5B 1HHIB 3GSXB 4PRPE 4WU7A 2IADA 5I1LA 2X1PA 1Y18B 2UUDK 3H7LA 2BY2A 4LHJB 1GGUA 1JBJA 1OQXA 1KB5B 1RZJL 4I0PC 1UZ6E 4RFEB 4EQ2A 2OQJA 3LQMA 3FT3B 4UT9H 4NP4L 2F53A 1FL3B 4RA3A 1FL5B 1QO3B 4UTBH 1JHTB 3HAEG 4JFQA 3O9WB 3KDMB 1U8IA 1UXSB 1KPVB 3VD3A 3O6KH 5IVZB 2NY1C 4K7FA 3PV6B 1NMCB 1MCEA 3BDBA 1YN6B 5ICZB 3WMSA 4YIQA 2OI9B 3MRMB 4P5TD 2HLFD 1F4HA 2F74A 2ADIB 3DURB 1P4BL 4D3CH 5EIIA 2Z8VC 1G1CA 5L2JA 5C07A 4W6XB 2FYYB 4F9LA 1J5OL 1U3YA 5FUZH 4NNPH 2WSKA 3S34L 1ZA3B 3NCMA 1KCSH 7FABL 3TH3T 2ARJA 2NZIA 3IDGA 4O00A 4QLRA 5IFJB 3WXVL 1JGVH 1OTTD 4NCC1 1WZLA 4WUUB 4KZDH 3D9AL 4LCUA 1DLFL 1S7VA 2WBKA 2DM2A 4ISVA 4M7LL 4TTDC 4Z18A 3BPOC 5IJVB 3SKJL 1T1ZA 1OAXH 2EYSB 4FQXD 3KS0H 1RJYA 5CP3H 5EG6C 1JE6A 2GJZB 2VXQL 3NACL 3H9SE 2E9IA 2DD8H 2XQBH 3RL2A 3MRIA 1HNFA 4YHNA 3GB7A 5IHZB 3RWIA 1INEL 5TF0A 4NSKA 5A2LH 4BFGA 4QHUA 2ZUUA 4R4BB 3TH4T 2ZKHL 1I8LA 4F2MB 2OLDA 4JRWA 1CWVA 1KLUB 2HVJB 3NAAL 4U3HA 3U4BL 3HPJA 1MJ8L 3WJJC 2G9HA 5I1KH 1FYTA 4QTHB 1U95B 3O2WH 5L0QC 1JZ5A 2D7TL 1MFEL 1AHWC 4KPHH 4Y5XA 2YXFA 5E5UB 4QCIB 4OBSA 1HHHB 1M71A 2ICWI 4QNPF 2NY5H 4NO2A 3BP7A 1ZVHA 3O8XD 4G8GD 4HIJA 1NC4D 2F53D 2A9ML 5DTFB 5F3BA 4WFFE 3S36L 5IW1A 2R39A 4JN1L 5D2NE 4N5EC 5F7NC 1JNJA 1CDHA 4U2YA 1X5LA 1MQKL 4OGZA 3ZDXE 5B38B 3LEVH 2AK1H 2FIRT 3GRWH 1LVEA 5E1AA 3QDHA 1NKOA 5J6GB 1AGBA 2NY2C 3CFEA 4R7NA 4X6DB 2BSRA 2L7JA 3ZYZA 2WWKO 4P99A 2NY6B 5HYQA 4I3GA 3K74B 3QEQA 5JW4Q 1F4WL 1KC5L 4M6OH 4JO4L 1SY6H 2KQNA 5E2WH 2AAVA 5DUML 1F4YL 5GGRA 1VPOL 3MZTA 3LZFL 4GAYA 4LOUD 1YMME 4JDZB 4RMQA 4QXTA 1VACA 2WQ8A 2HWZL 1A47A 3V95A 3G5ZB 3FL7A 4S2SB 5EZLB 1A3QA 4XVUD 5GHWH 3GSUB 1NCBL 3LEXB 5HD8C 3LKSB 8FABB 4EXKA 4Y4FC 4POZC 4OTXL 2NX5B 1F6AA 4XP5L 4ZFGH 4LBEB 3UPCA 4CVXA 1B90A 1X7QB 1CTOA 3FO0L 3ILPA 3JTTB 3ALWA 4YXKH 2F19L 5DF0A 3ARGB 4UILH 4UV7L 2ARJQ 2CLZB 2ERJC 4IRJC 5JNYB 4Y5YA 1CICA 5T3ZE 1LK3L 3VXRD 2Y6SC 3SDXE 5TQ2L 3LKOB 4M8QA 2RFXA 4JFPB 1FYTD 4PJHF 4JZJC 3VRJB 3K1KC 3NIFF 4OD3H 1W72H 4PP2A 2DWEA 3UPAA 1NUFA 1FFRA 1I8KB 5DD5H 4C4KT 4NQDA 3V4PL 4UB0H 5GGVH 3SY0B 3H7BB 4RWYL 1OGTB 4HF5H 2Q8AL 5JOFA 3HNTL 1FC2D 4DK3A 1UM4L 1G7HB 2DQCL 3MJ9A 3KPRB 1UA6L 3JVGC 4Y4HB 5D7KD 1X5FA 5JO5B 4OV6F 3GM0A 3QWOA 1BZ7B 3MRGB 2Z35B 3OZ9H 1TCRB 4D0CB 4PJGF 4Z7OF 2W0FB 5A2IH 3NZ8A 3QDJA 3D2UD 3RWCA 4DFHA 4AEFA 1FFNA 3VXOA 2ZUYA 3DXAB 4U1GC 5F1NA 1KLFA 3PWJB 5KS9E 4ZUVB 2P44B 1CFQB 3HCVA 1HZHH 2QHRL 3TJHC 1AGFA 4EDXA 1TQCB 4HKXA 3UTPD 3VXUE 4LSPH 1MCBA 3OJVC 4LHUG 1FFPB 1MELA 2XPGB 4LL9A 2OL3B 4FABH 3BP6A 3OKEB 4XC1H 3VFGL 1P9MA 3L3JB 4BFIA 5ITBH 1LE9A 1YEHH 1RURL 1D5IH 1JIBA 4OD1H 2CQVA 1MAMH 5TFSH 5IROA 1U8NA 3LMJH 3DYMA 5E00B 4G42B 3X13B 5T1KB 5DLMH 1NGWA 4Q9RL 5CP3A 1QVOA 2R69H 1BFSA 1IC5L 1XZ0A 3OKNB 4ZPTB 3W9DA 4ZFZB 3QUZC 2X4RA 5JZ7D 2BHYA 4PJDE 2WWMD 5KSAC 3VFWA 3L7FB 4ZNEA 2IF7A 5LBSL 4OIAA 1KB9J 2BVPB 5D2LA 1KNOB 4AIZA 3TM6A 3L7EB 2XY2A 4GG6E 2X4OA 2YWZA 1FL6B 3PL6B 1CICD 3MLRL 3P77A 3M07A 1JGUL 1HQRB 4LRNH 1CD8A 5CEXA 1TDQA 2OP4H 4QRTB 3CH8A 4YHML 2VZ1A 2Q3AA 4ALAH 1J9CT 3DO3A 2XZQL 2HLAA 4H1LB 4OCNC 3FHAA 3ULVH 2BXYA 4ETQA 2ZUQC 3RWDA 5DUPL 1D9KB 4DQOL 1V3MA 1RZ8A 2VDMH 4N9GB 2O61A 4YHLL 3BO8A 4ESKA 4P4KA 1A4JA 4L4VD 3HI6H 3QDJD 4L3EB 2APTA 3B9KB 4PS4H 2R4SH 3OXRA 2AXGB 2VL4A 1UEMA 1ZWIA 1HH6A 3KPSA 3RI5K 4LSRH 4ZFFA 4PUBH 2J3SA 5CJ5A 2HP4A 4KK5D 1R6VA 1JWUA 1HINL 4WDIB 1VCAA 4M7JH 2C1OA 3ULUD 1JCKA 4KV5F 2H2SC 4NQCB 1SY6A 1EBPA 5GSVA 1JZ4A 1H5BB 5GGTH 4J8RA 3C08L 3UJIL 2R9HD 2CIKA 3DMMC 4TULH 5BXFB 3PGDA 4HQQL 2YRZA 1IAMA 5GISL 4BSVB 1KXQE 1P7QA 5EBMB 3E3QE 3MNZB 4WI5A 5KVMC 3QDMD 3H3PL 4RZCB 3EUUA 2V9QA 1MCIA 4G8GE 4O9HH 3GMLB 4JPKH 5D6CB 1IZKA 2B1HH 4YHYC 2FLBT 1JTOA 5E2TH 1JHKL 2HFGH 3QEHA 2XWTB 1FZMB 3QH3B 4L8SB 5C2BH 4NFCA 4MNGB 3RI5F 1P2CA 5BOPA 1I1FA 5DJ2A 5IVOA 2OMNA 5HJ3B 1F58L 1QLFA 3BQUB 4U49A 4DZBB 1TNNA 3ISWA 2Z8SA 3VXNB 4MSWB 3LVEA 3B3IA 1KIUA 3UJTL 1QR4A 4JRXD 2A6IB 5GS0H 1DQQB 2NYYD 1MHEA 1IVLA 4X5XA 3WFBL 12E8L 4QHLA 4PJAB 4K8RL 5DJAA 4DFIA 1FSKB 2VDNL 3INUH 1LE5B 1HDMB 3VXME 4NKIH 4OZGE 3WKMH 2VUYA 4X6CF 1W8OA 1DANT 1T2XA 4O5LL 3TZVD 1F90H 2AV7A 4FFWC 2MJWA 1IEHA 3QA3B 4J4PC 1BQUA 4KRPD 4YHOH 2YEZA 2ZG2A 4HT1H 4S1SH 2YUWA 4U3XA 1U58A 4N90D 5E6ID 5JIKA 3TPKA 3T09A 3SE4A 1U92A 1S7TA 2CDFA 1WZMA 1ED3B 3BH8B 4KHXL 4Z7WE 2WUCH 2BNRD 3FO1A 1BAFL 5E03A 1L0XA 3VXRE 2E7CA 3MYZA 4FOMA 4MJ2A 1V05A 3FONB 4LHUD 3ZKMC 1NMCC 5FUCC 3QIUC 4Z7UE 2H3NB 4JPWH 4FZ8H 4HG4J 2X1QA 5DDHA 3W39B 3OX8B 1P7QD 2FWOB 2HVKA 1X6NA 4NFDA 4NZUH 1IAOA 1RZIB 5MI0B 1HYRC 2Z31D 5F7HA 3KLDA 4GRWH 1RZ7H 5D7KE 4M03A 5DMIH 4PGDB 3OF6A 1PBYA 3NIGF 2VITA 4PTUA 3RY6C 1PQZB 4O2FB 1IGCH 3UDWC 5D7SL 1T6VN 4R0LC 1S9VA 2HH0L 3QJHA 4XMPL 4CMHB 1E4XH 2YWYA 3F7VB 3RUGA 4HJGA 3RZCD 3GMOA 1J0KA 3BN3B 1QP1A 4JDVB 3T0VA 3L3HA 5FM4A 4OCXH 3FQXA 1AY1L 1UYWH 5HHXH 3ZYJA 1F8TL 3G6AA 4BFBD 1F3RB 5EPMB 2PYED 1DQJA 5F9OH 3UTPE 4EKXA 2F9BT 1MJJB 3HC3L 4OLUL 1YECH 4LEOA 4P3WA 5HGAB 5E8PA 5GGSA 1HXYA 5JHDA 3ZKNC 3D39D 1ZLSH 5D1QA 5JPMA 1X4XA 1PYWA 2XOTA 3SE3C 2H26B 2R1WA 1ZA6B 3EYSL 1AXSA 2IGFH 4ODSL 4PJXF 5BZDA 3PJSB 2C4FU 1OTUD 2EC9T 3GSQA 4OZ4A 3OB8A 3ARBD 5EUOF 4ZPVB 1JYXA 5EZJB 2JJUA 4JANA 4PBVC 4Q2ZA 1I1YA 1YEGL 1CFSB 1IQDB 3R1GL 4WHCA 4I9WD 4KY1L 3PHSA 4PRPB 4OI8A 1PEZA 2B4CC 2FH8A 1T1YB 2ADFH 5C0BB 4XNQA 2AJUL 4HZLB 2AEPH 2H6PA 4DGVH 1CDCA 3SPVB 1J88A 5GPRA 3U30B 4OZFH 2ADJB 2CLRA 3QT2A 3CLEH 1PKQE 3E2HB 2HJKB 4JN2B 4TQEH 2X6MA 3VU2A 3WFHA 4JQXC 2FX7L 4KVNH 2NTFB 3NCYS 3S3PA 1BX2B 1CE6A 2MKWA 3LIZH 4GAGH 4APQB 3QXTA 3DTXA 3V5HA 1ZKAA 3L95B 2G5RA 5GGTA 4FA8A 3BYYA 3SGDH 4HCRH 1CLYH 1T1XA 2CXGA 4P3CH 1YDPB 2GIYA 5HVFB 4PJ5B 1X5HA 3TYGL 4TOYL 5HGBB 1T89C 2GW5A 2ZCLL 2VQUA 3B6SA 5TF1H 4EVNB 2VLKD 2YOCA 4GW4B 4BK4A 4KROB 5D1XA 4YWGH 5F9JA 3W5MA 2YA2A 4HK3J 3L3GA 1V3JA 5F3HA 4BM7A 3QPQC 4PV9B 4W70A 4L9DA 4NO3A 5DD3H 3REWB 1X6LA 1MFDH 4L4VE 4NQVA 4WJ5A 2EDWA 3PWVA 3QDJE 4GRLA 1OAZL 4LDEB 3OAZH 5IFHH 4RGOL 1G84A 3AU1A 4EDWL 4OLWH 2J88H 1QA9A 3IJYA 1LO3L 1GXEA 4PY7A 2E3VA 3AROA 5B39B 4A6YH 4U6HA 1WBYB 4PB9L 4EBQL 3LH2H 4XZUB 4JR9H 4ELMA 3UXFA 1YEDB 2EXYD 3MV9B 3T0EA 4C83A 4PJ7B 5D1QD 4LASH 4I18B 4RGMC 1MWAB 1MVUB 2DMBA 3HMWL 5HDBF 1BZ9A 3PNWB 5B3JF 3ARGC 3IDIA 3NN8A 1ZSDB 4NNXB 4HEME 1NMAL 1KT2A 3QDME 1QRKA 3LDBC 4J2XA 5D1ZA 1IAKA 4M93B 5TJWK 1JI1A 1RK1B 3BIBX 4I0CC 3BDYL 4YBHA 5H2BA 2YD6A 3KPNB 4X6FA 1PLGL 2ZG3A 4LRIC 2GFBA 3OR7A 4HV8B 4C55A 3H3BC 3GIZH 3TLRA 3QULB 3GJFB 3MMEB 4JFHD 4KHTL 3W82A 5H35B 4GXUM 4Y4HC 5EU5B 3EFDL 3SDCB 4C57C 5T1LB 7CGTA 1VENA 4OKDA 4CRPA 3TVMB 1NDMA 1E28B 3QCUL 3H0TA 3UO1H 1QBLL 4ZS6D 2B0SH 4JRXE 3TP4A 1PG7X 3ARZA 3QZWG 1O7VA 3TESA 1N8ZA 3LCYA 3RTQC 4OZIF 1B0GA 2VDLL 1G7JB 4Y1AB 1R3LB 2OR8A 5BMFH 2WQRA 4ODTH 3AREA 1S7RB 3L5IA 4WI6A 3W0WB 3U2SA 1FO0L 3QFDA 5DD0H 2ZCHL 5D1XD 3MACH 4C4KO 1IAII 1KXTB 5ESAA 5K9QG 1TQCC 1JN6A 4CW1B 4PV8B 4XT1C 3I9GL 2YXMA 5FUOH 4HH9B 2X4QA 2R56H 3OR6A 3QI9B 3FHQA 1S7UB 3U7WH 4LPTA 3TA3A 4LSQH 4P46B 1VERA 1V7ML 4N90E 5ACLA 1JNHB 2DICA 5B22A 1Q94B 3MGAA 5HI4C 2FSEA 4S1DC 4U1IB 5F96H 4S0TD 4YDJA 5EU6E 2D31A 3HZVB 2V7HA 3S5LB 3V52H 1N6VA 2BNRE 1AJ7L 1LO0L 2BNUA 4RMSA 4X9IA 2Z93A 4K3JH 1R5WB 1LD9B 5DZLA 2DOCA 1GOGA 5EO9A 4XP1L 3RJQB 3MOAH 3SBWC 4N1HB 1XH3A 2BSTA 4YHZH 3PHOB 2X89D 1GC1L 4LSVL 1U3JA 35C8H 4EN3D 1N59A 4XTRD 4JRYA 1X5YA 2A6DB 3OBAA 4LIQH 4GS7B 1DSFH 3PL6C 1QKZH 2FGWH 1ORQA 3WIIL 2ATKA 4ERSL 15C8L 2DQEH 3SGKC 3GMMB 1WEJL 3CVIH 4I1NB 1AC6A 5IB3A 3VDCA 4QWWD 2AK4D 4QHMB 1GGYA 1NDGB 3QIWA 5FYKL 1QLRB 2VL5A 2DLFH 2IFFL 2A83B 4JFXA 1OHQA 4QYOA 5DO2D 5F44A 4K8RD 4ZDHB 5SX4I 3VWKB 3GHBH 5C6WH 4Z7VE 3HI1A 3VWJB 2HJLA 5C0GA 1LILA 1XF2B 4JZOA 4AM0A 3I3DA 1Q38A 5DRXB 2XA8L 1DBKH 4OUUA 4LCYB 3NPSB 1QLEL 1T0MB 4I3RL 2PYEE 5EO1A 4D0DB 4HCRA 3W9EB 1S7XB 3B9KC 1NGZB 2PTVA 3MRDB 4R3SB 3VGBA 4Y2DC 1BQLH 2C3VB 2F54B 3D39E 3RWEB 4C54A 1GPOL 4O51B 4ZD3L 1FVEB 1JPFB 4OFVA 3D5OF 2D0HA 3HE6D 5F7DA 4L5FH 4WUKH 4HKZB 4QRSB 5LAXB 3VI4E 1SBBA 4KWUA 4WCYH 2Q6WA 3OKMB 3VFOA 4KU1A 5DJ8B 4NT6A 1AGEB 2UWEF 5DHVH 3R06A 1DQDH 2HKHL 3ZTJH 3O3BB 4J3TA 3V0VB 3V6OC 2Y36H 5EWIL 1TZGL 4U33A 3G6DL 3C6LA 1QPPA 2GSGA 4O2EA 3BPLB 1NGYB 1A9EB 4Y8AA 5DJXB 43CAB 1K5NA 5C7XL 5HYSG 2OX5A 4KJWC 4WHYH 5IEHB 3O6FB 4OF7A 5LG1A 4M6AA 2HTLD 4A6YA 3MOBH 4OCWH 1ROWA 1JGLH 5F7WC 2E8ZA 3DGGB 5DYOA 4XCNB 5AG8A 2C7UA 5CJQH 5FYJU 4BQ6A 4P5TB 3MV8E 4XRCB 1RQ5A 1L7IH 3BQUC 4GG6B 4JRYD 4HG4K 1I4FB 3BMWA 3R0NA 4KKCC 3HE7D 2VN4A 3O6LH 2VLKE 5GJTH 4PFEA 2XICA 2FL5B 2GY5A 3WN5B 3LB6C 3ESUF 2D3VA 1A3RH 1F4XL 4PJ8C 1A6AA 2PR4H 1LDPL 1RY7B 5ACZB 3MJ7B 3QIWD 3PUCA 3VXPA 5IHUL 1HHGA 3RGVA 3FFCD 4KJPD 3NCYP 3WXWH 1U91A 1TVHB 1QRND 2C3GA 4V1DD 1FSKC 4U6YB 3GHEH 2VAJA 3X11B 2GI7A 3TIDB 1O7SA 4IRZL 4DJMA 3T2PA 2EDYA 4L3CA 4HH8A 3CDGB 5DRNA 4WTZG 1WCBB 3T1FB 3WS6A 3KYMA 1G7QB 3L1OL 1UQSB 4LEXH 3P11L 4PGZA 1WLHA 2FX9H 3SGJA 4OLZL 5ESQB 1JRHI 2FHFA 4YBQD 1N6QH 5KVDL 4ORGA 5EB9A 2IPUK 1CVRA 4L4TB 1IQWL 1IGFH 2W9LA 3V6BR 4H88H 3ULSA 3MCG1 2VZUA 2VKXA 1N5YL 2GTWA 4JGUA 3DBXB 4ZO8A 4KRNA 2AJ3B 3STZB 1CGTA 4P2YA 4AEIL 2R2EA 4GRWF 3CC5A 5I1LB 3EYUL 3JWNC 4UIKL 3DVNA 3THML 3SO3B 1MEXL 4DW2L 4LQFL 4JKPL 4XH2A 5HYSA 4U1NA 4NC0B 4JFHE 5F21B 3DSFH 1A7PL 2VDKL 4TVPL 2F53B 1DLHA 4JHWH 3BKCH 1A7RL 2XQYG 1VEOA 3VFUA 1LP9E 5JOPE 3QB7C 4JFQB 4E0RA 1U8IB 1S5HA 5D9SB 1DR9A 4FFVC 4GW1A 4TUKH 4K7FB 4W4OC 5HHVL 1E6JH 5BO1L 3V6ZA 2AJZA 3RPKA 3TO2A 5C0CA 4YIQB 1NAMA 4JY5H 4CMHC 3HI5L 3GMPA 1QOKA 2VR9A 4UQ3A 2YD8A 5GRUH 3LRGA 3RIAK 1D5BA 5EIIB 3TFKC 5L2JB 1NCDL 5C07B 2BSSA 3H42L 4R97B 5H37H 1FPTH 1T5XB 3R0MA 2FGZA 3CFJA 1IFHH 4P48A 4HWEH 4XMKH 5C0AD 2ARJB 3IDGB 3RGVD 4E41A 1QR1A 4P23A 1EVUA 5DA4A 1S7VB 2I9LA 4NOBA 3CU7A 4ISVB 2Z8WC 4XNMA 1TVBA 5LVEA 3RRQA 3OAZK 4PJHA 1QG3A 5MEOA 1T1ZB 3EOBA <