1XT5A

Crystal structure of vcbp3, domain 1, from branchiostoma floridae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
GQSIMTVRTTHTEVEVHAGGTVELPCSYQLANDTQPPVISWLKGASPDRSTKVFKGNYNWQGEGLGFVESDSYKESFGDFLGRASVANLAAPTLRLTHVHPQDGGRYWCQVAQWSIRTEFGLDAKSVVLKVTGHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ancient evolutionary origin of diversified variable regions demonstrated by crystal structures of an immune-type receptor in amphioxus.
pubmed doi rcsb
source organism Branchiostoma floridae
molecule tags Immune system
molecule keywords variable region-containing chitin-binding protein 3
total genus 31
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xt5A00
3VMPA 4MVBC 1T0NA 4NRYB 4P3CH 4XC1H 1YA5A 3G6JA 5HPOA 5T3XD 3RIAF 5EU4B 1ZWIB 3QXTA 3U2SA 1J87A 1F3JA 3WFHA 5CLWA 1RZGA 5GS1C 2I27N 1ADQA 1ITBB 1T89A 3FOLB 1DTUA 4S10A 4XC3H 3VFWB 2LAAA 5CIPB 1BFVL 1YYMH 1BBJB 5GGQL 5ICXB 4XWGL 4YXLH 3L9RA 1IM9D 1E4XH 4UILL 5KSAA 3ARBA 4MA8L 1YECH 1CBVL 3JWOH 3TBWB 2BZDA 1KGCD 5GRVL 4XVTL 2PTUA 1V3MA 3PGDB 1H8SA 5DS8B 3UTZB 4ERSL 1IGIH 4FNLH 2QQLH 2NY6C 1QKZL 5BVPL 3UPRB 4DOHE 5E8OB 3N1GC 1JJUA 4EIZC 3TIEB 1RK1B 2QHRL 2B1HH 2AABL 2IADB 2HTKD 5DRZB 3L3OB 4P2RA 3HRPA 1FZMA 4GRMB 5AD0B 4PJAB 3MRBA 3DX9B 5MEPB 3T4AB 1NSNL 1SJXA 2KQMA 4P5MB 3VJ6A 1AJ7H 3FRPG 4XCYA 1H9VA 1G9EA 3BEVA 3RKDC 3EYSL 1LDPH 4LLQA 5H35B 3L3IB 5CUSH 5EUOF 3V7AG 3Q6GH 4EI6A 3O8XA 5GRUL 5I8EA 3EJJX 3T04D 4HKBB 4WJ5B 1VPOH 4XH2A 1YMMD 5F7MC 5BRZA 3DVIA 1RVFH 5D93C 1JGLH 1NBVH 2BVQA 4K3EL 1NCAL 2WLZA 4P5TC 5HGHB 3S5LB 4S1QL 1PJ9A 5CHNB 2ZOKA 1AI1H 4K7PL 1FLTX 4LCWA 2YA0A 2XWBA 1HK6A 1MPAH 1Y6NR 2AJYL 2V5MA 1RZKC 1AD0B 4QRSA 4G8GE 5JDSB 3GMMA 2FEDC 2CKBB 5DJAB 1U2HA 1W72L 2ITDB 4M1GL 3QXDA 1QO3B 3ARDC 4N0UB 3DXAD 1EAJA 4G6KL 3VXRA 2GJ6E 2VH5H 1ORQA 2PTTB 1IGJB 3NIDF 1G0YR 4J3UA 4L29B 1MIEH 1DN0B 2E9JA 4XPFL 3EYQC 3DGCR 3KHQA 1JHLH 1Z5LB 2ZUQC 1KCSL 1KJ3L 1WBZA 4MA8H 3IDMA 4MAYC 4DKDC 3Q5OA 2IH3B 1MH5A 4H5SB 1NAKH 1U92B 4U0RB 3P4NA 4XBGB 1X7QB 4U0RC 1S7XB 3MUJA 4ZXBB 3CX2A 1AQKH 5JLZA 3MLUH 1KB5L 4HQQL 1C08A 4LLUA 4UQ3B 4HDIB 3TBYB 4Y4HA 3EO9L 4DQOH 3EYUH 5CKAA 3RZCA 1OTSC 4WHYG 5J12B 3NA9L 4M6NL 1A3LH 4ZDHA 1W72A 1QRKA 1D5IL 2NW3B 3HG1B 1MFBL 4GW4B 1EBPA 4ONOA 1NBZA 2NY1B 3MLWH 3GMNA 1G7IB 1F3DH 4GAJH 3BH8B 2FZ3A 4PJBE 5LKNA 4NN5C 1N8ZB 2W9LA 4C57C 3MYJA 3MCLL 1QKZH 5BVPH 5HHVH 1HDMB 3MLTB 5IV2B 1CL7I 1A7BA 3I9GL 2IBGA 3I3DA 4TSAH 2HJLA 5HI5D 4D0CB 2Z31C 2R23A 4KMQA 5C0RL 3KPNB 4KI5E 1UVQA 2RQ8A 5IV2A 4E41B 4PJFB 1UENA 1BJMA 3I6LD 2PO6A 4WI8A 5EOQH 3G5VB 2OMNA 2EDRA 4BK5A 2X40A 3BH8A 3MMEB 5C0IB 4AJ0A 4YH6A 2A74B 1NBZB 3WIFA 3Q6GL 3M07A 4P2YA 5F1KC 3WDIA 4GS7C 2Z92B 5FK9A 4ZDHB 4S1SL 5K59E 5T33L 4N90D 4NQCD 5E6IC 1FPTL 2VQUA 4OT1L 5M7QA 3MRJB 2VXVH 1UH3A 3HR5A 5D2NE 1D9KD 4EXKA 3RDTD 4MHHG 4R2GD 3ARDD 1U8MA 2NZ9D 3R1GH 5E2UH 2CLRB 1C08B 3QA3B 1BOGA 4ZXBA 1S7XA 5GSVA 3DGGA 3QDJA 3D39D 1ZT4A 3P4NB 5JHLH 2FR4B 4PJCB 5F72S 3D85D 4LHUB 3T65B 5MEQB 1CDCA 1CT8A 1WBZB 3UO1L 4DKEL 1G6RB 1B0GA 3T0VA 1GXEA 4NO2A 1GPOL 2FJHB 3UJIL 4XBEH 1DN0A 3FQRB 4UV4L 4XCNA 1R24A 3DI2B 1Z2KA 4L3EA 4ELMB 1F5WA 2VQTA 2EC9U 4EEEA 4KKNA 1IGJA 2DI9A 4FQJH 5DD6A 1KELL 3G5ZB 4NC2B 5D71H 5F9JB 3H0TB 1RIHH 2F58L 2NTFA 2DM3A 5HYIA 3B43A 3B8SA 4OCSH 1QO3A 1UT9A 2AJZA 4NPYA 1HH6B 4X6FA 5CILH 3MFFB 3Q0HA 3P9MA 5GGUB 3HMXA 2CKBA 5DJAA 2HLFC 1LEGA 4JM2B 2YHGA 1N7ML 2AAVA 3PHQB 5D9SB 3NN8A 2Z93B 3F7RA 3B9EA 1D5BB 1ZA3A 4MAYB 4PRPD 1HYRC 3WSQL 4IOIB 2DLHA 3D2UD 1AQKL 3WHE1 3S35H 3DRTB 5HGHA 1HHJA 1T1ZA 4YHOL 4X5LA 4KV5F 1AGBA 4FQ1L 1WV7T 5HDBE 2Z31A 3GHEL 4WRLA 3QT2A 1RZ7L 4OV6F 2ZSVA 2VDRL 4GRLA 3Q6FA 4QXTA 3QHFL 4EI6B 2GEEA 4ZPVB 1T66C 3ZHDA 4HS6A 4YBLC 2V2WA 3MLWL 4JM2D 5LGHH 3ZE2E 3CFJB 3LEVH 1QFWM 2ESVA 1ES0B 5ADOH 1MY7A 4NQDD 3CIQA 5DJ2A 3F7YA 3QIWC 4ZFGL 3L3OA 1RU9H 2VITA 4ZYKA 2AK4A 5GGSB 2WANA 3RDTC 2JTDA 3TIEA 1RK0A 4OQ1A 1WIPA 4Y8AA 4JRYB 5GS0C 1F90H 3ARDB 3KAAA 4J8RA 3T0EA 5EOQL 3BO8B 4LOUC 2BVPB 2XTJC 3IFOA 3MUGA 3E3QE 1PLGL 3GBML 3WO4C 5LBSH 2F5AH 4ONGH 5TE6H 1OPGH 3PL6A 3F6IA 4LQ1A 4P57B 5DGQA 1NBQA 4LDEB 1N0XL 4Q2ZB 1I1AB 1ROWA 4PRHA 2YPKB 2DL2A 2FX8H 3ARBB 3LQAH 1U0QA 1L4IA 3GSVB 3GKZA 5A2KH 3MLXL 2XYCA 5CSGA 3QXAB 5ICXA 5A16B 4YDIH 1ZT7B 5KVFL 1I8MA 5L7XH 1MCPH 3DROB 4XCCL 5B38B 2HJFB 2HFGH 4NHCL 3HLAA 4F7TB 1SYVA 3ARVA 1KTDA 3C9NB 1BQHG 2AXGA 5D7SH 1BBDL 3G04B 2HLFD 4Y1AA 3EHBD 4HKZB 3FQWA 2NY5L 4P4RB 3U7AA 1S8DA 5C92A 2BX5A 5I2IB 2KH2B 2Z91A 2ILLA 4ODWA 4RZCB 1XCQB 3LEXB 3CZFA 3MGOA 1NH6A 2BVUA 1KCVH 3TN0D 2P5EE 2DBLH 4G7VL 2VL4A 1KPVA 2F74B 3C09C 3O2VH 4JFZL 3KJ4C 3CDGB 1OT2A 2PXYD 3BHBB 5DJ0A 3BAEH 3QNZB 4MXWL 1TJIL 2FNBA 1BECA 3BFOA 3DUHA 1N64H 1QSFA 4MSWB 4UT7H 3KPMB 2NY5C 3SCMA 3CCHB 3WFDH 1CK0H 3ES6B 5C3LD 4R96B 1BWMA 4PGJA 4OLUL 3Q1SL 3DMMC 3SDAC 3LB6C 1C5BL 4GS7B 1IEHA 2BSED 2VLJA 1CIUA 2AGJH 3KYOA 2OJZH 4W4OC 2V7HA 2Y25A 1MPAL 1GZPB 4MMZC 5JNYA 1FNEA 3VRIA 4KKCD 1E6OL 5EU6B 5IM7A 5BMFH 2C4XA 35C8L 3O4LB 4L9LA 4WO4B 3HRZB 4RQQA 4NO5B 2COQA 5IFAH 3DV4B 1RD6A 3QDJD 4XB7A 4NZTH 1OM3L 5HDBF 1U8NB 2EDKA 3OX8B 5BO1H 2X42A 3DWTA 1CDBA 1YEFH 1ZS8B 3JVGC 2EDHA 2FWOB 2QHLA 1K2DA 3WJJA 2OP4L 5B8CC 5EN2B 1S7SA 3UPCA 3K1KC 2ZUYA 3W0WB 4JZNB 2EDLA 3TO4A 7FABH 2Q3ZA 3CXHJ 2LV4A 1PYWB 3K80A 3V79C 5FAAA 3S37X 4KRPB 2K3TA 4CMHB 1E6JH 1X5AA 2EH7L 4RGNB 4M6ML 4LDLB 2HT3C 1DANT 5HHQB 3FQNB 2R2BB 4P5TB 1BZ9A 1Y0LA 4XC3L 5D1QD 5EBMA 4R3SB 4PRIB 4P59H 5SX4I 1PEWA 4U1MB 1A22B 2E7MA 1QZ1A 4GG8A 4U0QB 5IF0A 1JPFA 3TP4A 2ATKB 5EOCJ 3TN0C 4PG2C 5ELIA 1EV2E 1A6AB 2DQIL 2X4TA 1DQDL 1AGEB 1AY1L 1MI5D 4NFCA 2AS5M 2OR7A 3DJ9A 1X9QA 1A02N 5I8KL 2EYTA 5C9KA 2OP4H 4XPAL 4ZOAA 3CLEH 3MA7B 3FB5B 5JW5B 1E28A 3TNMA 4PGCA 5C0FA 2NY5H 4ZNEE 1ETZB 3ORJA 3MO1B 3QEGH 2PYFB 2IH1B 4XNZB 5CS7A 1MFNA 3RNQA 2ZKHH 4OFPA 3KJ6L 3BD4A 1P6FA 3C6LC 3CLFH 2F54A 4LCCB 5I1LA 2DBLL 2H2SC 4OLYH 2BOCB 1P2CB 3QWOB 4I2XE 3UBXI 2HH0L 1PKQA 4UIMB 4WCYH 3SDDC 3O4LD 3L3DA 2GJ6A 5IMMA 4PJFE 4N0YL 4BQ8A 3L5WB 1G7PA 5DYOA 2HMIC 4OCMC 5D5MB 1FIEA 2UVEA 3EO1B 5IG7A 1MREL 4QHKJ 1KCKA 4PJAF 2FGWL 2A0LC 3OWEA 4GG6A 2WBJD 5DC9B 1DBBL 1JPGB 5IT2H 1U8OB 3DYOA 4PJCF 3O9WB 2GFBB 3LD8B 4GJTB 2H41A 4WWKC 1KN2H 1SEBA 1IEAA 3K2UH 1OD9A 5FA3A 3W82A 1CGSL 2ZKHL 3JTTA 3C5JB 3NACH 4NQEA 1X6LA 1PY4A 4H0IA 3GSRB 3U36B 2DQGL 4ZTPL 25C8H 4JRXE 5C0JA 4I0CC 1I7ZA 2QEJA 1CDHA 4JPVL 4N8VA 1UH2A 1AR1C 1K4CB 3CH8A 1NMAH 1MHEB 3RWDB 4MX7B 4NKQB 2G2RB 4JPIB 2B2XL 4X7SH 3SOBL 4QCIB 2W1NA 3VXMD 4R4FH 1LEKA 4P3DA 5JW3H 1KTKE 1XFPA 3IDGB 4LP5A 4PD4K 4PJHE 1BVLA 4Z7WB 4FG6D 3V0VB 1I7RB 5DWUL 4RMTA 4OI8A 5I1JL 3HA0A 3KDMA 3MRFA 2N4IA 3CGTA 3DMMA 4FN0A 4G6KH 2UUDK 2YWZA 3E3QC 2P45B 1CL7L 3EDEA 1KPUA 2IALB 3HE6C 5D6CB 3UJTH 5JUEH 4NQDE 3MV9A 3FO0H 4HHAA 3ROLB 4BUGA 1DLHA 4M4PA 4QYOA 3MQIA 5CLTA 4KU1A 3SKOA 2AEWA 4EDWL 3DX8B 5DUBB 4Z7OE 3RY4A 5DHVA 3ARED 2Z9TA 1TJHL 4A2MA 3T2NH 1MIEL 1MCNA 2WNGA 4FQLH 5IP4A 5IK3A 2GYSA 5I76A 5IK3B 4FQXA 4HWEL 1QNZL 1TVBB 5JQ6L 3L1OH 5ID1B 4NM4H 4JQXA 3QO1B 4OZFH 2LU4A 2E7CA 4U1IB 5F93C 4MS8D 1WWCA 2V2TA 1CXKA 3CJJA 1DQQB 3BZEB 4FZEH 1O7VA 2VLRD 2QSCH 3K2UL 5FUCE 1I75A 1II4E 4FQHA 5J13B 4JVWA 3KYNA 3SE9L 1KIQB 5D6CA 1BFSA 2ZSWA 3BKMH 3WDHA 4JKWA 1MFEL 4LEOB 4Z76A 1ZANH 5BVJA 4OT1H 3WN5B 3N50A 3RTQD 4KHTH 5T3XE 4LSSH 1TCMA 4FQHB 5D7IB 4PJ9D 1NGQL 3AU1A 1MVUA 4WV1A 4QXWA 2L7JA 3MCKA 1I7TB 3OG4B 5IVNA 4OKVA 1EZVY 1XEDA 1LEKB 2VC2H 4U1IA 3TT3L 5I1HH 2HT2C 4NM4L 3MRIA 4HSQA 5ID1A 4KRMB 4WVRA 4DOHB 3MOAL 4UB0L 4PBVC 3GZKA 4R90L 5AZ2H 4JO4H 3OKYA 2P4AB 1JIBA 4GKNA 2OR9H 1JF6A 4POUB 5I1KH 3ARGC 1RUPL 3FN0H 1U42A 5D1XD 4QRRE 3KYKL 5GZOC 4D8PB 3SKOB 3UO1H 4YWGH 4DKEH 1ZA6A 5IEKA 4X5XA 4XVUC 5IVOA 1XH3B 4I77H 1KSRA 1EHXA 3MLRL 4N5UA 3RGVC 2JB6A 1GIGL 3V52L 4TUOB 2E27L 1F4YH 5F7EL 3ESUF 2XNAB 3JUZA 2J6EA 1DQMH 1SEBB 5CSBA 3H9SB 2GFBA 3G6JF 4LPYA 1RZFL 1DJSA 1REIA 3ZDZE 2FO1A 1T2QL 2MFNA 2Y5TB 5EPMB 4GOSA 5HHME 1F4HA 2VXUL 1PW3A 1CDYA 1DUYB 4YK4B 1R6VA 4GBXC 4QGYA 3WFZA 3WE6A 4U33A 1EHLL 1C1EL 4IOSD 3HE6B 2ZNXA 2X7LB 1H15A 4LGSB 4AG4H 3FO0L 1MFDH 1R3KA 1I3GH 4J4PA 2X4PB 1JZ6A 4TPRH 4WEBL 5GJSH 5EC2A 4QNPF 4U1LA 4WHYH 5FYKU 4PV8A 1Y18A 3DMMD 1MQ8A 3BWAB 4GRWH 3DI3B 3MBXH 4U1SA 4EVNA 3OZ9L 4MNGB 1IAMA 5H2BB 5CBAA 1HH9A 4AMKL 3JTTB 4NN7C 3VWJC 1T2QH 4MAUH 3PHOB 1JI1A 3WKML 1AD9B 1F90L 1R5WA 5KSBB 1OL0A 1JI2A 2ATKA 5CMAA 1X5FA 3JBG7 3OGCB 4JFYB 5JHDE 3MV01 4NKMA 3QP3A 5J7CC 1P4IL 2X4RA 1JGVH 3KXFA 4F15C 5ADOL 1TTUA 5D5MA 2R2BA 4OCXL 4P5TA 3QEQB 4G6JL 1I9EA 5F6HI 1ZLVK 1OB1A 5IB2B 3DUUB 4UIMA 2R1YB 2BY0A 1X3DA 2EDDA 4ZAKA 1KTRL 3O6KL 2IC2A 2RCSL 1DQTA 1LP9F 2YD7A 5E8PA 3P0YH 5ISZD 1AFVH 1G1YA 1J1XH 1K2DB 1OWRM 2I9TB 2OMBA 3DYMA 3IFLL 2I24N 2K7PA 2FYYA 4XZUB 3TVMC 3PF2A 1G7JB 4OGAC 5T3XH 1AGEA 1P4IH 3O4LA 2E7BA 3FO2B 1FC2D 2KKQA 4OZFA 4AT6A 5IHZA 3EIFA 4KKAC 5F96L 1NCWH 2V7HB 5ACZA 1H3TA 2MSPA 1N6QL 3MJ8B 3O6FA 5KVFH 4F15B 3QG6A 3TPUB 4QTHA 2XN9D 1YEGH 5HHQA 3ZKMC 2CRZA 2R4SL 1NDGA 2PO6D 4IIQB 4R6UA 3BZ4B 1A7NH 1EGJH 3T09A 1G7HB 1MJJB 2XXCB 3KLAA 1OP3K 3ARZA 3BJ91 1S9WB 2Q6WB 4YHPA 1QBAA 4EBQH 1IGIL 2AK4E 3MR9B 3U4EA 3KXFD 5GS2D 1V7MH 3M1BB 4UAOC 2F74A 1ZS8A 2AJVH 4LCYA 5CZXC 3ZYIA 1NGYB 1VGEH 1MCFA 3NZ8A 5HVWA 3MGOB 1NL0L 4V1DB 4Z0BH 5FGCE 1NEZA 2WINA 4NRXB 5DZLA 1TDQA 1L6ZA 5K9OA 3GRWA 4WO4A 4PP1D 1MJ7L 1OAYH 1E6OH 1NDMB 3PWVB 1CFVL 1PSKH 3CSPA 5JNYB 3INUH 1OGTA 1TLKA 5D2LE 3KYOB 4ELKB 4K3GA 2J1KA 3QUZA 4U1NB 3QEUB 2AV1B 3LEYL 2H9GA 1OSPH 4YNYA 3HLAB 3L7FB 3N1QC 4I3SH 3T3ME 3ES6A 4G9FB 1ULVA 3CCHA 1YEFL 3SCMB 1A9BB 2DICA 1J10A 5GRVK 1SJHB 4YHIA 1AO7E 1JVKA 4ELME 4DGIH 3BPNB 1RZJC 4KQ3L 3QCTL 1WEJH 4MNQD 4M02A 4Z7VE 2YPLD 2GT9A 3TJHD 5JUEL 3SDAB 1QA9B 4PP2A 4LSQL 2OR8A 2VR5A 1EEUA 1XCQA 3FAWA 4MQTB 3E8UL 5BO1L 1DVFB 5I2IA 3PDGA 3V0AC 5HSFA 4NQCA 4UAOB 2AXFB 2UWEB 4AEEA 1FAIH 1FNGA 5IBUB 1I1AD 3SY0A 3ZT7A 4LNRB 1RZJL 2W0PA 5HHNB 5FOBB 4YFDB 4P4KB 5I1EH 4K8RC 3VH8B 5E9DE 1J8HE 4OD2A 2AEQL 3K81A 3BISA 3OKNB 3I2CL 2LVEA 4OFDA 3Q6FB 4GRLB 1EUUA 3KLSA 3WEXA 3V5KA 1K6QL 5A16A 4O4YL 3IAGC 4Y4KB 1B2WL 5DR5L 2HFGL 4I3GA 1IQDA 1HHHB 3SGKA 4Z7QE 5CIPH 4EQ3A 5JXAH 2YKLL 5IIEB 3B9DA 3QEGL 2ICWA 1ZA3B 2GQHA 4IIQC 4LSSL 4MAYA 2Z93A 2X4QA 3QUXD 3TBVB 1WC7A 2E6QA 5E9DA 4KQ4L 3RQ3A 4X4MA 1U6AL 2DS4A 2AJSH 2GY5A 2FJFA 2QADB 3O2DA 4JRYA 6FABL 4WW1A 3T2QA 5FM5M 4BA8A 3MFFA 4K7FA 1KXTB 1NFDA 1T1XA 3TBTB 1IGYA 5HPMB 2VITB 3QRGL 4HK3J 5SWSD 5SWZA 4K3EH 3UBXG 3EDJA 2XA8H 4X7FC 3NCBB 3ZT6A 3BQUA 5TGBB 1U8QA 2Q8AL 3DECA 4JKKA 3MUY1 3BUTA 1T89C 1KB9K 2H32B 1M05A 4OZ4A 2QQQA 1S5IH 5IW1A 3H8NA 1KCRH 3TA3A 4X4ME 4ZPVA 4NRZB 4NO2B 2G75A 3DARA 5F1IB 4R8WL 2X1WL 1CT8B 4P9HH 2G5RA 4JN1L 4KZDH 4LHUA 3T65A 1IGCH 5MEQA 1LP9A 4L3CB 5CGYD 4U7MA 5J89A 1RJCA 4MHHI 1D6EB 4HEME 3Q5TA 3TNNB 1CD0A 4E5XB 2NY4C 3PXHA 3PDDA 1NEZG 4Z7OF 3GJFA 4H26A 1LEGB 4JM2A 4X9IA 1T2XA 4HUVA 1VFAB 1MI5E 2B2XH 4X7SL 4QTIL 1HH6A 3R8BB 4YXKH 3T3MF 3G6AA 5F7NC 4MNQA 3TZVD 5JW4Q 2XZAH 3VG9B 1JZ4A 4HIEB 5C6PB 3LRSA 4K9EC 1K5NA 3VFNA 4E41A 5TDPB 3X11B 4PJHB 4BZ1L 5AZEL 3PV6A 3ZDXF 1NMAL 1T5WA 4JCMA 4OZGA 2OQJA 1EEQA 4XCNB 1KIPB 1FL5B 2H26B 1EEYB 4Q7DA 5B4MD 1B0GB 4Y2DC 5F3BA 5L6YL 1KGCE 1CN4A 1SEQH 4WWKA 5DRNB 2Q86B 2QADD 1FYTA 1F45A 5EBWB 1KCLA 4YJZL 1U91A 4D9LL 3HUJE 3EDKA 3SE3C 1B9ZA 2DYPD 3MC0A 4CJ1A 1WWWX 1U8MB 3OPZL 1A7RH 4D0BB 2J8HA 3EAKA 3CH1A 4OLWL 3BKML 4KUCF 3OXSA 5C08D 4IOFD 1WIUA 3BN9D 3HR6A 1C5CL 1H5BC 3IU4H 4L4TA 2CIIB 4ODTH 1VEMA 2EDOA 1U91B 4H5SA 4XPAH 3VFRB 4FXKB 4WWKB 5DRNA 4ODSL 2FGZA 2QSCL 1CF8H 4KHTL 2BVOB 4HWEH 4HZAA 1FFOA 5HYJA 5HTSA 2WMPA 5E6ID 1FV1A 4OZGB 4M1CD 3SDXB 4JCLA 2YUZA 3TIDB 1HHGA 2DQEH 4JO4L 5DZNA 1P84J 4G43B 2RBLA 4Y89A 3TJEL 3VFNB 1NSNH 2KZ1B 3RL2A 3CVHL 1YNLL 4AIZA 5DVOA 5JW4M 3WL9A 4JY5L 3F7PC 3D2UA 5F21B 4H20H 5I16A 1A7QL 3PWNB 2ZWLT 4N0YH 5AUMB 4ZUSA 3HG1A 3I75A 2NW3A 5JR1H 2H2PD 2JCCA 1VPOL 4TOYL 3BD5A 1LO3L 4HC1H 1AD0A 4JFDD 4QRSB 4MA7L 3RZCB 2AK1H 2JE8A 4LSUH 1Z9LA 1RIUH 4NOBA 2FEEL 4EUPA 4HDIA 5FYLH 3TBYA 4HPOL 4MLSA 3PGCA 4G8FA 4KRPC 1W0YT 5DQ9A 5HYEA 3X17A 3S5LA 1JGDB 4XMPH 3FB6B 1RJZA 1LE9B 1MH5B 4JQVA 1N5YH 4Z95H 3DHJA 1YMME 4KKLC 5C9JA 4MCZB 1KJ3H 3RNKA 5F1IA 5J12C 4D9RE 1S78C 4YR6B 4YBLB 3TA3B 4OZ4B 1I3GL 2WQ8A 1JMXA 2H6PA 4X9BA 4I9WD 3BEVB 1JWUB 3ARBD 3D85A 3UTSB 4Q9CA 1RUKL 4XCYB 3OV6A 3SKNA 4OJFH 1EVTC 2VNCA 4WUKL 3TT1H 4NC1C 1TCRA 1HKFA 4PJDE 4FQIL 5CJXC 4K7FB 3OAZK 2ITDA 1K85A 2OJEB 5CEXA 5IB5A 4PJDF 3GMMB 2R2EB 3RY6C 3NCYP 5C0DA 5E9DB 5KSBF 1N64L 1U3HA 4YGVA 4FFYL 4OZHE 1IQWL 1J0IA 1SVZA 3AS2A 4PTUA 3UZVB 4CMHC 2WIIA 5C0AB 5JO5A 1Q8MA 1FIGL 5KN5A 5SWZE 1HHHA 3ISWA 4HMCA 2LFGA 2W60A 2Y36H 5K9QI 3FT3A 3DSFL 3NCCB 3V5KB 3ULUF 1PGRB 2BRQA 4KVNL 4OM1H 3ULUC 3WEXB 3FOLA 1WIOA 4GLRI 4X80L 1YQ2A 4IDLA 5E95B 4XX1E 1RUAH 5HHOB 1T0NB 4NRYA 4WEUD 5C7XH 4TNWF 4GKSA 1ZLUK 4K71C 4N1HB 4PLKC 3DX9A 3T4AA 5MEPA 3MRBB 1LK3L 4HJ0D 3QFDA 2X9WA 2Q76A 1L7IL 1LO5A 5DJZB 1HWHB 2Q1EA 1J8HD 3HPJB 4WY7H 4X7TB 2UWEA 3WDJA 5D2LA 3VDBA 4MAUL 2GJZA 1RSFA 2C3HA 4DK3A 4RFNB 3U0WL 5EA0L 1WBYB 4XCCH 5AEAA 1OLLA 5BXFA 3U1SH 3B2UC 1BJ1H 1AHWA 4APQD 3VFPB 4FP8L 3P0YL 1JNHA 3U4AA 4C56B 5AWNL 3T0AA 3QPXL 2HG5B 4JM2F 5LVEA 3TBWA 5DMKA 3O2WL 3VXUE 1JHKH 5A3ID 4APQB 2CRYA 2RCSH 2DOCA 3WLBA 3L9RB 3WUWG 3SHSA 4UTBH 5CIPA 1CXFA 1SJHA 2UYLA 3HNSL 3V9FA 1J8HB 1JPST 4G9FA 1RZGB 2FSEA 4NUJB 3HC4H 3NFPA 3U2SB 4JY4B 3V95A 3RWGA 43C9A 4YHZL 5FHAH 3BUYA 2XTJB 1I8KA 2Z8VC 3QEUA 4O02H 4P46A 5E2TH 5L9DH 1JUFA 2VQ1B 4JFXA 4QHMB 3BDBA 3W11C 4HUMB 3DVNA 4IDJH 1HXMB 4GXUM 5A40E 4EDXB 4K2UH 3L95A 1MLCA 1RFDH 2GKIA 3PWVA 1XGUB 1WCQA 1KLUA 4F9LC 1KB9J 4YHNB 4FMFA 4QRUA 3W2DH 4WU5A 4HBCH 5I1AA 3CAFA 4M00A 1FSKB 1T5XB 4G9DB 1Q9OB 2B1AL 3SJVA 3ZKMD 3EOAA 4LARL 3AGVA 4J3OC 5HDQL 3QUMH 4YHOH 3ZMRA 2DMBA 1PZUB 3VXUB 2QQKH 4Z7VA 4CNIB 4RISH 1KBGL 4PUBH 2GK0A 2GSGA 4Q9QL 1J0ZA 3WBDA 4OBRA 1S9KC 2VJXA 1OTTC 2YC1B 4QOKA 4GQ9L 3TM6A 4UDTB 4WGWB 2GSIA 1CFVH 5FYKD 3U4EB 5HYFA 5DJ8B 2FIRT 3JWNC 5HYSA 4FMKA 1HQ4A 4KTEL 2DQDL 4O02L 4P46C 2HFFA 1FO0A 4PGDA 3BGMB 2X41A 3WO3B 4F57L 4PJ8A 5D1QA 4NT6A 1U8HB 4B7IA 3RIFF 4KJWC 4GH7B 4I0PC 4K7PH 3MJ8A 4U31A 4U1KA 1IFHL 3JTSA 4HIJA 2VDMH 1JHTB 1QOKA 1JPTH 1WITA 5IHZB 4S1RL 2VUOA 4DK6A 1XF2A 2O61B 3T1WA 1T2JA 1XF5A 3N1FC 4K23L 4Z0XB 1PQZB 5K9KB 2J8UF 3U7YL 3FO2A 5LGHL 5GS0D 5HGDA 4JGJA 1IBGH 4FTVE 4NNXA 1NC2D 5IBLC 4U3XA 4PB9L 5DJYB 1CLZL 2B4CC 2HFEB 1A4JA 1LDSA 1MLBB 4XZUA 3GNMH 1D6VL 1H8OA 3RIFK 1R5IB 3R06B 4Q0XL 5IBUG 1T22A 5FGRA 4ZG1A 1UM4H 5DMGD 2I9TA 5FKPB 3MACH 2IBZX 1AC6A 2CQVA 5F97E 3U0WH 2HLAA 1FZKB 4LVNB 3C5SB 5D96B 5DFTA 5DGRA 1WFUA 1U3YA 4WDIA 3D9AH 4YPJA 2DBJA 1BMGA 5D1ZC 4GKOA 4WENB 2K9UA 1V05A 4PJGE 4MA1B 5D7LE 5I1GH 4WW2C 5IB2A 3SGEH 4JZJB 4HGWB 3RWIB 4Z77B 2XV6B 3QEQA 3S3PA 3QIBB 5ESVB 2ATPA 1WEJL 1H3WM 4YQXH 4Z7UF 4Y4HD 3WXWL 5EZLB 4M3JA 1RPQA 1CLZH 1UM6H 2EEDA 2DJ4A 3OXRB 3WS3A 4HWBL 5D2NC 4MD5B 3O2VL 1KG0A 1R5WB 3O3BB 1BZQK 1BREA 5I19L 2PXYA 4F33B 2E8ZA 4LRIA 4K3DL 3MROA 4ERSH 1YY9C 4GAJL 4QO1A 5C0GB 5IVXB 2A6KA 5D7JA 3DPBA 3W2DL 4UOW0 4EIGB 2NTSP 4LLMA 2A9NL 2EO1A 1TITA 1BQHA 3L1OL 4KJPD 1GZQB 2BNRD 1X5LA 4Z18A 5J4MA 5C0RH 3NFSL 4F57H 5CJOL 3U9UB 2ORBL 4JFPA 2BSSB 2W0LA 4PJ5A 2QQKL 2WBJC 1W2KT 2YD9A 4PTTA 5CINL 1ZT1A 2XWJA 5AAWA 2VXQL 2QR0B 2I25N 3CVIL 5A2LH 4C59B 4ZFZB 1H15B 1T0PB 2VWEE 4JFHD 2EICA 3HZVB 1OAQH 1DL7L 3QZWG 5DF0A 4P2QE 5H37H 1E4KA 4TVPD 5CZVH 2PYEB 4XPBL 4XWOD 3CU1A 3LMJL 1K8DB 1SM3H 4OI7A 4JPVH 5EB9A 2FX9H 5FHBH 1W0VA 1INDL 4GW5A 2M1KA 3LKRB 4Y4KD 3OR7A 3LKRA 5I74C 1D5MA 5J3HC 2XNAA 5CWSB 1QSEB 2F54E 1LE5B 5T5FL 1NBVL 7FABL 2NY1C 4NQED 1PAMA 1XH3A 2XA8L 1OF2A 5HI4C 3QIUD 5J06A 1X5HA 3CFEB 5CINH 5I1GL 3V4UL 1RUPH 3FN0L 3HI1A 3N9GL 4PFEA 2AJYH 4M6MH 4XNYH 2NYYD 4LSVH 5D2LF 4YWGL 3ULVE 4LSPL 4AEIH 4OZIF 2F53D 4HS8H 2BSSA 2CK2A 4YQXL 1KYOK 5EC1B 2J8UE 2EDYA 1CD9B 3MSPA 5CILL 5HD8D 3SGEI 5I9QC 5IVZA 5I18L 4UDUB 4X99A 4LLMB 2H3NA 1BF8A 4XAWL 1G0XA 1F4XL 1YDPB 3AU1B 3E2HB 4WV1B 1INEH 4O2FA 2ADGB 1UG9A 4DEPC 4NQVA 4F33A 4N5EC 5J9PA 4M6OH 4LEOA 1ADQH 1TJGH 3U0PB 4BQBA 4F7CB 2ZSWB 1A2YB 3CXDL 5GSRB 4MZ3A 1T3FA 4U3CA 5FGCB 4NBZB 3KJ6H 4G8EB 3ECBB 3GSNB 4ZTOH 1OCWH 1EFXA 1VSCA 3NTCL 4OM0H 4LU5H 3IT8D 4DN4H 1A1NA 1U8LA 3QIBA 2YRLA 3LIZH 2A77L 5FB8B 3GSQA 1HNGA 4H1LB 2K1MA 4G3YH 1HILA 3PV7A 1DP0A 3VCLA 1G6VK 3GMPA 3KS0J 3P0GB 4EXPX 5F7UA 3FMGH 2VE6A 3BPOC 4OF8A 4QRTA 5EIIA 3B5TA 4WFGE 5BW7A 3HZMB 4PLJC 3BIBX 3L3HB 2UZYB 4S1QH 1E0OB 4JM4L 2FBJL 2DLEA 2X1OA 3KNBB 3SGJA 3LN4B 1BM3H 5TF1L 1R5IA 1ZXQA 2ADFH 5HI3D 5EBLA 3RI5F 2MOVA 3MRMB 4JRXA 5AWNH 4HHAB 3ROLA 4KMTH 3EYFB 3T4YB 2VZ3A 1RZIB 2A73B 1KPUB 2PCPB 3WUZA 2EYRA 3L5XL 3TV3H 2W0KA 4GXVH 3U83A 3DMMB 2IANB 3PIQB 1A6WH 1GIGH 3V52H 4ZXBD 3T3PF 2O61A 4TTDC 5I1CH 2V9TA 5I73C 2CGRH 1I7RA 5IJVB 5F3HB 4NUGH 4KRNA 4Z7WA 1C5DA 4LSPH 4U1KB 3RFZC 3OKKA 3TGXA 4JDTH 5HHVL 4EN3D 5IMLA 3UJJH 5JPMA 1YEHL 4PRBB 2G2RA 3G9VA 5BJTB 4Y5YB 1DSFL 2D31A 4FTVB 3V7MA 4YIQB 3QDMB 1HQ4B 5HYSB 3H2WA 3LDBB 4AG4L 4N8VB 4M1DH 4G7YH 1I7ZB 1UZ6E 5I1JH 4PJFF 5SV4A 2Y1VA 3HNTL 1S9VB 4S2SB 4U6XB 3GSRA 3U36A 3GRWL 3O3EB 5KZCD 5DHXB 3MLUL 4GRWB 2FRGP 4N5ED 4TVPE 5SV3A 1UKQA 3FB7B 4KROB 2ESVD 2QSTA 4N8VG 1T0MB 2EEBA 1IEAB 3EOAB 5JW3L 3CMOL 1N6QH 4JFZH 1I3RA 2ZNWA 3I3BA 4J6RH 2MHAA 3S37H 3O9WA 1RUQH 4RCAA 2X4UB 1JPGA 1VACB 4OCWH 1LO2H 4KDTA 3QJHB 2VDPH 1BFOB 4GW1B 4KKBD 5E5MB 4NQEE 1EJOL 4QF1B 2VO5A 4QHMA 1YN6A 4OLUH 1WFNA 2ZUQB 3VFTB 1I8KB 1AHWC 5TQ0L 1DSFH 1B4RA 1DBAL 2APWA 2FIKA 4PRPA 4DW2L 5DJDB 4NNYB 4C83B 4NDMB 3UAJD 3QEQE 1P2CA 4N8CH 4FFZH 2NNAA 2UYLB 1QFWH 1KJMB 4AZ8A 3KHOA 4LCCA 5I1LB 1FE8H 5MENA 2ADFL 3BWUC 5EH1A 1MCLA 1NC4D 4JHAL 1OLZA 4LCIH 5F1NA 3WLBB 3RNQB 4FFYH 3UYPA 3OKEB 4PRIE 1A7OL 3O6KH 4XP6L 1D9KB 1XZ0B 1IKNA 2XN9E 1M1SA 3MREB 1MF2H 5FUOL 5DC4B 3UC0H 4HH9B 5I71B 1VFBA 1E28B 1FNLA 3QHTC 2IGFL 4G8IB 1CFNB 1VENA 4C56A 2OZ4H 1QSEE 1WBXB 1N7MH 2EYTB 1A47A 5BXFB 4OD3H 4X9HA 4TN9A 5DUPL 5FO8B 2VDPL 4B53A 1T1WB 1A6AA 2WM0A 5CJQH 1V7NL 1JPFB 1MWAL 1MI5A 4BZYA 2C7UA 3RBSA 5F44A 4R3SA 4JFEE 5EBMB 4P2QB 4OM1L 3OQ3B 3FQNA 3QO0B 2HT2D 2VDRH 4JN2B 2P8MA 1EO8L 1D5ZB 3MXWL 2P5WE 1Q72L 4XHQA 4HLZH 2VB5A 5T3ZE 2P5EB 5HHOD 4I0KA 3IXTA 4I1NB 2X4NA 1AO7D 2ADIA 4J12A 3R8QA 4FQ2L 3OKOA 1NCBL 5H94B 4AIXA 4OIBA 3W0WA 5IB4B 3RVWD 1FNSH 2WIIB 5C0AA 3S6CA 4B5EA 4OLXL 4XVUD 3IF1A 2BHYA 2HWZL 5FA4A 6CGTA 2NY7H 3HFML 2W92A 3MV7B 5C2BH 5J11C 1AE6L 4Y19A 3MZTA 5D7LD 5C07E 5CP3A 5KVDH 5B3JF 3D0VB 2H32H 2C3VB 2R2EA 5D96C 4DN3H 2C4FT 3FFCD 4KK5C 2VDQL 4U05A 5D2NB 2B4CL 4Y4FA 4JQIH 2BC4A 4Y2DA 1TCRB 1HHIA 4P23B 5DD3L 3V4VL 4KK8D 4JFEB 3VRIB 2A83B 2HRPL 4ZUUB 1GZPA 1WTLA 3KYMB 4L4VD 4UINL 1DUZA 3KLHC 3KPOA 1DQML 2GUOA 5D8JL 5IW3A 1JL8A 1X5JA 3QIBD 4GAYA 4KJPC 1FNAA 4L8SA 4CVWA 2RFXB 3QUML 3KPQB 4I5BA 5E7BA 4KAQH 1ORSA 4DVBB 2NXYB 4PUBL 4IJ3B 2I60H 3IKCA 2V9RA 3HTLX 4CU6A 2JKXA 4MCZA 5F9DC 1SM3L 3P9LA 4MQ7B 3C5ZC 2WWKT 2NR6C 2OTUA 3W0WE 3SCMD 2AERT 3PL6D 3D69A 4XP1L 3V5DA 2PR4H 3WIHA 3O2DL 4EUPB 5FF6B 4JFFA 3VG9C 1BD2E 5F6HJ 5FGSA 4OFVA 5EULV 4JVPA 1C5BH 4PRHE 4JRYD 3GO1L 4QRQB 2IQ9H 3GI9H 4Q58C 2N56A 3WNMA 2J3SA 2FBOJ 2JCCB 3O3UN 4DJMA 4NGHL 3VFGH 5DA4A 5DI8A 3QUXA 5I16B 1CTNA 2DIJA 2I07B 4S1RH 4KJWD 4ENEC 1G7QB 2ERJB 3WL9B 5K93A 5IB1B 1EVUA 5BMFL 1WSST 2ICWI 2AXGB 4HFWA 4Z8FL 3BT2L 4WI4A 2BSTA 3VXUD 1HEZB 1MQKL 3PQYD 3IETA 4OFKA 4JVUA 3STZA 5HY9B 3U9PL 2BVOA 3DV6A 3JWDC 1GCFA 5F8QC 5B8CB 1NC4B 3MXVL 1MCEA 2BHZA 1F4XH 3PWJA 5DVNA 4W4OA 1QLRA 1ZOXA 2CKBL 1IMHC 5KS9E 2ZG1A 1CXIA 5CGMA 4F7PA 4MJ5B 4MJ6A 1CL7H 1G7LA 2GAZB 4HXBL 4ZFOA 1JV5A 5GGQH 1QFUL 3EZ8A 3PL6B 3PABB 4KK5D 4FA8A 4J3TA 3H42H 1P53A 1WZLA 3A67H 4F7EB 2I9LA 2J88H 4KVCH 2HA1A 5IKCA 3BO8A 5HHXH 4HWBH 4D0BA 4FNLL 1M7XA 4G7VH 1FN4B 4KK8C 5CEYA 1I8IB 4EDWH 4OZHA 4ZFOL 3DURB 1QRNB 3P9WB 3CFDA 1GAFL 3CDCA 5EIQA 5EOTA 2AK4B 5EA0H 3MACL 3QI9C 5LCVL 5EBWA 2EDQA 2CMRL 3BKYL 3ZTJH 4XNUH 3IDIB 1FGVH 1SEQL 1T1YB 4V2BA 2R29H 1U8IB 1XCTA 4F37F 2CUHA 4XCEB 3VE0B 4HK0A 5D72H 4KDWA 3D87B 4WIQA 2IBZY 1T03H 3C5ZD 4PJEB 4L5FH 2OQJB 4U1JB 4QXTB 3RBGA 3KPSB 2C4FU 3TF7C 5TDPA 3X11A 4LLWB 3BVNA 3HNSH 1BVKB 4UINH 3C09B 1WT5C 1YY9D 2Z31B 4JFFD 5A1AA 3LKNB 4P59L 2YMXH 1DBMH 1NC2B 3MJ9L 2IPUG 3RWFA 1HHJB 1UQSB 1T6WA 2XG4A 3PHSA 2I60L 3E6FA 4WFFD 3NN8B 1D5XA 1XIWA 5FM8A 4J1UB 2DTML 1ACYL 1OAQL 3BPLC 5GGUA 5J11B 3RKDD 3IJYA 2L7UA 1FGVL 3GBLA 4R8WH 4BFIB 4ODHL 3MUZ1 4OZIE 3O9WD 1CE1L 3HAEH 1JNNL 4NYLB 2EH8L 2NTFB 1P7KA 4X6DE 3MRHB 5F9JA 5IT2L 4RISL 2NZ9C 2AKRA 3DXAB 4XRCA 3QUMA 2MJWA 1FC1A 3DETD 3FQRA 1AR2A 4HIXL 1A6PA 4PJXA 4OGXH 3FO1B 4IS6B 4KUCD 2LU3A 4OI9A 2IF7A 1VGKA 1VKXA 1BWWA 3BQUB 5TGBA 3MRHA 1OD7A 1P7KB 4PJCA 2QLVB 2VZOA 5SWZB 3SE8L 4HT1H 5HI4D 1A21A 3F5WA 2MQ3A 3O8XD 1DBBH 1DQDH 3DURA 1I1FB 3CFKB 5CEZL 2CLRA 1U8PA 2Q20A 4KY1H 4EN3A 2VLJE 4NCC1 5DLML 5HVHC 4X0KB 3HR5B 4LRNH 3BESR 2RHEA 2X4QB 5GS0L 1JV5B 5E6IA 2FLRT 1I4FB 3WIHL 5IROC 2Y4SA 5E8DL 3RVVC 3MLVL 1J12A 2XICA 4JKPL 1IQDB 1UQSA 5LXGL 3MMEA 1JYWA 4X7DC 1GGUA 2Z8SA 3U7WL 3GNML 4YHLL 2A77H 2CSPA 4FFZL 4LLWA 4GLRH 3BH9A 2MTPA 3MRGA 4XAWH 1UVQB 1PVHA 1B90A 4LHQB 4PJ7F 4XNXH 5CP3H 2VISA 4OD2B 5KOMC 2EIEA 3MJ7B 4OLVL 4UUJA 1HDMA 3MLTA 4P4KA 1MF2L 1TJGL 1F02I 1T1YA 3IDIA 4JG0H 2FZ3B 4NSKA 4UV7H 3ZYJA 4ELMF 2PTVA 1FNGB 3J7HA 3GMNB 3N06B 4XC1L 2DYPA 4M8QB 4XCFH 1FCGA 4XPTL 2AXFA 4PJXF 3MFGB 3VXRE 3LIZL 3HE7C 3ZE2F 3L5JA 4JFDA 4MNQE 2BSRA 1A0QL 1FG2A 4WWKD 3TH3T 5IKCB 2I5YL 5IESL 1M7IB 3SDAA 3L7EA 1KPRB 1ZANL 3V5DB 1EFXD 1EUTA 1QHPA 4UQ3A 2GAZA 3BP5A 4OFYD 1DBJH 4WHCA 5C0BD 5HI5C 1DANU 3S96B 3DVFA 1KENL 5C86A 1X7QA 4MJ5A 4F7PB 1NGZA 5C7XL 4JM4H 2IH3A 2D7PA 3P9LB 4MQ7A 4J3XA 3WUWA 1QSED 3PWJB 1IC1A 2WAHA 1U8KA 4XXDB 3CZJA 5ESQA 1B4JH 4Y19D 5F7HA 4GXVL 2UZXB 4ODHH 1X5XA 1IILE 2VLLB 3IJSB 3KPQA 4W70A 3PWPB 2C26A 2ZJSL 1Z9SA 1FNSL 1WUNT 4EOWL 4HK3N 3D5OF 1PX3A 2YD6A 1LGVA 1YNKH 4ELKA 1E27A 1FL3B 1KOAA 2CD0A 5C09D 2EIZA 1JWMA 2LQRA 4W68A 4KTDL 1G7QA 1MWAA 2ED9A 5I1CL 1HHIB 1MVFA 2I07A 4P23A 5JHLL 1OARL 3SKUD 3MLPA 5KAQG 3VD5A 5IESH 2VDQH 1YQVH 2C3WA 1KEGL 4L1DA 2X09A 3CDYA 1GGIH 4NRXA 4O9HL 2GTWA 2D2OA 3D0VA 3VRLF 4O5LL 4Y19B 2BMKB 4M7ZC 4PBWD 5FF6A 5FA4B 1J1PH 4MYWB 5EU7E 5I9QB 1LEIB 3KPSE 2X70B 3ARBC 5E99L 5ERWA 3D69B 3BOVA 1H5BA 3MLSL 3MR9A 2LAGB 2OTUB 2BVQB 3U0TB 4HLJA 4X4XB 3T77A 4OLVH 4MB5A 1A6UH 2JB5L 5BRZB 3OAZH 2YPVL 4QXGH 3WIHH 2M8XA 2AQ1A 5TQ0H 1TIUA 1N2RB 4M1GH 3PP3K 4YC2B 1DBKL 1NDGB 2VDOH 2PXYC 4LVEA 4Q9RH 1OSZB 1T4KB 1JYVA 3KPOB 3O2DH 5EZIL 3VXMB 5TE7H 5E5UB 3HE7D 4ZUUA 3D0LA 3FHAA 2C7UB 4JFEA 4LCIL 4OZFB 1FZMB 1X5GA 1LP9E 2BNUA 2H2SD 5C09B 4AH2A 1RK1A 1IGMH 5FUOH 3UC0L 4QHNA 3V7AE 3QPQC 4U6HA 1W8NA 2GTZB 1WBXA 3EGSA 4MNHB 5IQ9A 1DEDA 5I8OH 4ZQKA 1ZLVH 3UTZA 1Q9KA 1MELA 4OZIB 3VXSB 1I9JL 4U1GB 4GMTL 3ROOB 3ULVL 4YBHA 5LBSL 1CFQB 1FFQA 5L2KB 2IMNA 4O2CA 2EDJA 2ADIB 1TMCB 4ZAKB 5AYUH 2C3XA 4HMDA 2P5EA 3B5GA 2FHFA 5SX5K 1ZLSL 2FIKB 4PRPB 3QDAA 4KZEL 1QR1B 4ZS6D 1J0KA 3VFTA 4QF1A 2P7TB 3IXAA 2CDEA 4LEXL 1JGVL 5SWSA 4GW1A 4AL8H 3S34L 4QT5B 2RR3A 2ZG3A 4K8RL 2DQCL 1QLFB 3LQZB 5E1AA 4CN1A 1NGXB 1NFKA 4RAHA 3D39E 1JNLH 5C3TA 3I6KB 1T1WA 5INDA 4LBEB 2F53A 4RFEB 5TF1H 5L88H 5AAMA 1Q72H 4RWYH 3I3EA 1X5KA 1QEWB 2P24A 4JY5H 5DD5H 5F9WC 5F7WC 3KR3L 2IMMA 3KS0H 3MREA 15C8H 4U1SB 5HYJD 4M48H 1U41A 3O3EA 1L7TH 1AXSB 4S2SA 1Y18B 3HN3A 4OAWA 4GUPB 3ZDYE 2OL3A 5D6DA 2R2CA 5J57B 1BGXH 4U1LB 5EC2B 1FVEA 1YYLL 1QPPA 4OQTL 4TPRL 2ZCLL 5E9DD 4ZAKC 4NNYA 4C83A 5CJ8A 2B4CH 2NY0B 5D7IF 4DUXA 4Z5RB 3TWCL 1EGJL 3MV7E 5DJCB 3V2AR 4U6YA 3U6RB 4FQ2H 1T21B 4HLZG 3FN3A 4DN3L 1KBGH 1N5YL 3BPNC 2BCKB 3BE1H 4X6BA 2DF3A 3IJHB 5E5MA 3Q1SH 4G80A 2NY7L 3HFMH 1LVEA 3RKPA 3BGFB 5EFIB 4UV4H 4MJID 3TESA 3PIQA 4KK9D 3TVMA 2X4UA 5DD1H 5JORB 5EO9A 4HUWB 3H9SA 4MD4B 4GMTH 3CX5K 5CJ5A 4KK6D 5T3XL 3ZO0A 2VZVA 4TUOA 4L4TE 4JO2H 4FQXC 4O00A 4NWTL 3DX7A 3MYZA 4BYHA 2NX5B 3IRZA 5B22A 2R0LH 3RPIB 3LN4A 2XI9A 4D8PA 1NANH 4TUKL 3O6FC 3LQMA 3CPLB 3QI9A 2ZUUA 1XGTB 4PY7B 4F9PC 1AO7B 4ETQA 1JZ5A 4Q0XH 2KZWA 2N7BA 5KG9A 2V17L 5FKAA 5FYLE 3AM8C 4PB9H 3OGOE 1A9EA 3MRRB 3SE8H 4LPVA 4PRBA 4YLQT 3C6LA 2VZUA 4P2QD 4UQ2A 3WS6A 1FRGL 5A2IH 5I15L 1EMTL 5FB8A 4RMQA 1V8HA 3MCKB 5DK3A 5F6IC 5IJVA 5D7IA 5F6IB 3VRJA 1A14L 2BVEA 3QQNA 2SEBA 5KTEH 5GSRA 4GAGH 4MNGE 3ULSA 2WLYA 1YEDB 2BHUA 4F7CA 3U0PA 4Z76B 4NQTA 1JHKL 1WT5A 4PRAA 1QSVA 5BRZE 5J0BA 1RZIA 1VERA 3S97C 1WICA 2NXZB 2LE9A 3MLZH 3FONB 4LSTH 4KQ3H 5GIRA 3MBEC 3EJYC 4PJBF 4UDUA 3KNBA 1T7WA 4HGMA 1GGCL 5B3JE 1FAIL 3NABL 1G9ML 2EC8A 1DQLH 4HJGA 4PB0H 1U58B 4X6EB 5MHSD 3SQOL 3LKOB 1TVBA 5EIIB 3MGTB 5D1QC 4LASH 5IBTH 3CC5B 2F5AL 2RGSA 5TE6L 1LNUB 4MJIB 5F7FA 1TXKA 2AEQH 3ILPA 2KQNA 4I3RL 1GAFH 3GMPB 1CQKA 3WXVL 1S7UB 2QQNH 1HILB 5HHPA 3GSQB 5DUBA 2ZOLB 2W65B 3RVUD 1NLBL 1A1NB 1U8LB 2AJ3B 4N68A 3S88H 3O3DA 2AVGA 3HAEG 4QYOB 4QEGA 2EXWD 3LS5L 3ECBA 3GSNA 3QUYD 3TA3C 3A67L 1QSEA 3BKYH 2ORBH 4C56E 2IALA 1A2YA 5INCA 1DBJL 4OV5A 5FEBA 4X6DF 5C6TL 4Q9BA 2BNQB 2VYRE 2P8LA 4NQVB 3QRFM 2XN9A 1GGCH 5C2BL 1FL6A 3GMQA 5I75B 4J4PC 3HG1D 1B2WH 4GRLC 5DR5H 1NFDE 4PB0L 1QFOA 3L6FA 1YDPA 1M6OB 1OTTD 5LCVH 3K7UA 2H3NB 1BVLB 1UZ8B 5M95B 3AY4C 2PYEA 1HI6B 1P1ZA 5CSZA 5D7IE 2R1WB 43CAA 2H1PH 4RIRB 4G6FD 2DLTA 5HGBA 5GGRA 2CLZB 3QNYA 1CGSH 1IAOB 3KYAA 4ZOBA 4MD0A 2Q8AH 2DQEL 2X1QA 2VTFA 4MX7A 3ARFC 2NY0D 1ND0B 2VKWA 3P2TA 1ND0A 4HAFA 3FT2A 4PTTB 5DFVC 1K4CA 2A0LD 1V3LA 1CCZA 5EU7C 1MIML 3VGEA 4KH2A 4MXWH 5T5NF 4NJ9L 5HGBB 5L0QC 4NHUB 4HBQA 4TOYH 3EOTL 2D7QA 2FEDD 4UIKL 3P11L 3U4BH 5C0NC 4O58H 3L6FB 4HCRL 1MAKA 4JAMA 4RAVB 1A4KB 3NAAL 4NKIL 2P8LB 4OGXL 1YMHB 4AEIL 2FO4B 1MRCL 1KEML 3JWOC 3WS3B 1ZGLB 1RVFL 1W0VB 1SBBA 3H9SE 1CE6B 4LRIC 1S3KH 3EW3B 5ITBH 4OF5A 5IG7B 1JBJA 2W65A 4YXKL 5DYOB 1MHHA 4P49A 4GAFB 2APFA 2VDOL 1J7VR 5FFLA 1EHNA 3O8XC 3L3DB 1UA6L 4YHLH 3WV0A 4LU5L 4MGXA 2QQLL 1PKQB 5DTFB 2QKIA 1KELH 4WI7A 3MOBH 5E00B 4RMSA 2F54B 4JFPB 3CXDH 3FT4A 3L3JB 3U9UA 4B0MM 1YMMB 1JFQH 4Z7VF 1MCWW 4LCWE 1R3JB 3UTTB 2JIXA 5C8JA 3UTQA 2P46B 4IJ3C 4F8QA 2J8UB 3GMRB 4OCWL 3QISA 4NIKB 5CEZH 1FP5A 3MA7A 1TJHH 4I0PB 1EXUB 4HUUB 1S9YA 1KG0B 4RDQG 5F89A 5ICZA 2EKSA 3AREC 4KXZH 2OYPA 1K8IB 4KUZL 4OLWH 3IAQA 5E2WL 1GGYA 3LS5H 3QQ3B 2D7MA 4KJYA 3AMLA 4U1MA 3RVTD 2ATPB 5KOVC 3O41A 4CU7A 2NY0C 4OIAA 1UB6B 4FZEL 3SDXF 4NT6B 4Z77A 2MKWA 2YXFA 1A6VH 4CVZB 5LQBH 1FH5H 2MCG1 1HZHL 3VD9A 1DL7H 3MV8E 1T83C 3UZQA 1B4JL 2MPAL 4PRNB 2DMCA 2A2QT 4KZDL 1PYWA 4WNQB 5C0ND 1PG7X 1F4WL 1MOEA 3CPLA 3QI9B 4UDTA 2G9HB 5TJWK 4BELD 1S7SB 5EIVA 2VL5B 5IVXE 4H25B 2C3GA 3DUSB 1WWAX 4J3SA 2NX5A 4XMLH 4NOFA 5DD5L 1MLBA 5GGSY 3C8KB 3GDBA 3SKMA 2CXGA 4X8JA 3GJFK 3RY5A 2HFEA 5MERA 3DV4A 3NACL 1U3HD 1Q9OA 1CFBA 4RQQB 1IARB 4YO0A 3TVMB 4QRUB 4DGYL 1XF5B 3IYLW 3BEWB 4H0GA 3H9SD 5JOFB 1B3JA 3ARUA 5EZJB 4HIJB 3JTSB 3HC0A 4K7PX 2Y06L 3CUPB 4WTWA 4JO1H 1HKLL 4APQC 3BUYB 4WUUE 3G5YB 3RRQA 5DJCA 1BLNB 4Z5RA 4JY4A 5IHUL 4AQ1B 1FO0B 4NUJA 4YFLI 2D3VA 5GGTA 1WZMA 4G6ML 1KIRA 2NQCA 4MSWA 1EHLH 1QSFB 3UTTD 4JANA 5I1IL 3MLSH 5D6DC 4JR9L 1AGDA 2JCCF 3QNZA 2J2ZA 1AXSA 2VXUH 4K8RD 4NBYB 4LMQE 5K9JH 4NO0B 3OKMB 1XIWD 1KPVB 1RJYA 1EDQA 1QQDB 1CLOH 2YPVH 3I85A 5DMKB 2B0SL 2GK0B 3QEHA 3RUGF 4FFWD 1FFRA 1AH1A 4Z7VB 3VXUA 4NWTH 3CFCL 3KPRD 1AHWB 3V6BR 4NO0D 1LO4L 4P99A 1A7OH 2F8VA 3BGAA 4LBEA 1N26A 3OZ9H 1S8DB 1CLYH 4P4RA 5HYSG 1NGXA 5D2LB 1UZ6F 3CK0H 2JK5A 3HPJA 4X7TA 1BIIA 1CXEA 5E1AB 1KLUB 2W0FA 3NPSC 3QFDB 3L95B 3SJVE 4EDXA 1QYGH 3FN9A 4X98B 1Q0XL 1ZSDA 2CDEB 4KDVA 4GKSB 2DLIA 4K55A 1KTDB 1QNZH 1ZHKB 1SYVB 1ZHBA 4YHYB 4U2ZA 5F7KC 2ZG2A 5EWIH 4F7TA 1EEZB 1EAPB 1FBIH 2R56L 4M5YH 5HHOA 3SO3B 2YD4A 2CDFA 3QPQD 2FSEB 1KFAL 3DXAE 5KSUA 4CL7A 3QUZD 4O2CB 3QXAA 5GGRY 3OKLB 4K23H 5DRWA 1CFQA 1MFCL 3RL1A 1A3RL 2E7HA 1KCUH 4PRHB 1NAML 4Q2ZA 3A6BH 5F9OH 3L5XH 3TV3L 2O5YH 4HF5H 1PBYA 3F12A 5I17A 2HG5A 2QJDA 5CP7B 2MPAH 1U3HB 1CD1A 3VXSA 1Q9KB 3BQUC 3VFPA 1R3HA 3MRDB 2X44D 1MCHA 3D6GA 3EGSB 4MNHA 4A6YA 5C0DB 3T0EB 5IQ9B 4J8RB 3PWLA 4NUGL 3VW3H 4U6HB 3ILQD 4XCFL 3JWDH 5AYUL 3H3KA 2OJEA 4QHNB 5CEXB 1F8TH 3UTPD 1EPFA 4RMUA 4S1DD 4L8CB 3RX8A 4AH2B 5C09A 3MA9L 5JMOC 4MQXC 4XMPL 1LO5B 2JLLA 4XPGL 2FATL 3F7YB 1JGEB 4YZFE 1DN2A 2VN4A 2R56H 4KMTL 3I02A 3HMXH 4IRJA 2CKBH 2HP4A 4R0LC 1JPSH 5T1LB 3B2VH 4CADA 2V2WB 3M8OL 4YR6A 3VA6A 1KXQE 3O2WH 4AENB 5BCAA 1HN1A 4QRRA 3H42L 4J23A 4RNRB 5IHLB 4EBQL 5L88L 2B7DT 3AUVA 4OFYA 1A7NL 1AGBB 1PD6A 3FT3B 1PG7L 1JGDA 4QWWD 4PS4L 1V7ML 3DYPA 1LEIA 3PQYE 1RFDL 3JV4B 1G0DA 1CDIA 4YGVB 1RZKL 2BMKA 4YHML 4PRPE 2GTWB 1CR9L 2XXMB 3RWJB 3TA3D 3QFJD 3QPXH 4KHXH 2DIAA 4X6FB 2VDNL 2B0SH 3SGJC 1NL0H 1UJ3B 2UVFA 3QEQD 4L3ED 4AIZB 4XGZB 3SKNB 5IGXH 5BW7C 3RL2B 3BE1L 3WNKA 2W91A 3FHQA 4C56D 4NN7B 1HHGB 4JO3L 1FE8L 4P0DA 1WWBX 3SDXA 2XIDA 1BEYL 1YJDC 3H3PL 3GGWA 3IJSA 1FFOB 1F6AA 4MCYA 2FJHA 4I3SL 3FQXA 1SMOA 2YUWA 3EOTH 3BT2H 1AGCB 1J05B 4HV8A 4KC3B 5EU3B 3RNKB 4PV9B 4EI5A 4O58L 4YDVA 3VFRA 2DQTL 4PLKD 2DRUA 4JFHE 4CUCA 3FB6A 5JOPD 5ENWA 2IAMD 2OZ4L 3ARTA 2FR4A 4ZS7H 2CIIA 3QCTH 4YDIL 5DQ9B 1MCIA 3S96A 1BOGB 4JB9H 1KPRA 3G9AB 12E8H 4OTXL 3IGAA 3C2SA 2EH8H 3OHXA 5DO2C 4LSQH 2A1WL 3BPLB 1FZJB 2OSLB 2RAMA 4NO3B 3LN9A 3I75B 3BP7B 5J6HB 1ZEAL 2E9WA 3WIFB 4R26L 2OK0L 3BDXA 4MJ2A 2VLKE 4M8QA 3O45B 5C0IA 3IFPA 1U3ZA 4KJQC 1B6DA 2NY4D 4CVXB 3ZHKA 4A6YL 1VEOA 1XGRA 4G43A 2A6DA 3NZHH 3MJ7A 2AI0H 3TIDA 4D94A 1TVHA 3GSWB 3BYTA 4URTB 4NZTL 1OM3H 1T5WB 4XNUL 1YEKL 4N0CC 3MYJB 1K5NB 4FXKA 1P9MA 3D48R 5T1KD 4HIEA 1TJIH 5L2KE 1F6LL 3VXOA 3HI5H 3EJYD 4ZUTB 4TRPL 4XMKH 2R39A 5KTEL 1MRFH 3N1MC 2DWDA 1I4FA 3OXSB 4KUZH 1DQLL 4Y2DD 3KPTA 3LKQA 2NXYD 4GT7A 4NP4H 4XHJD 3CH1B 3EYQD 4X0KA 5JQHC 3GKWL 3PWPE 1T20B 3OR6B 3MLZL 1KIUA 5MEOA 1BX2B 1OHQA 2IFFH 3UTSE 2J5LB 3B3IA 1CLCA 1MRDH 1VB9A 3L3GB 1ZGLP 4LPCA 1BEYH 1BQLH 4JFOB 5CFHA 1FG9C 3CU7A 1FYTB 3W9DB 3QQ4B 1N0LA 4GO6B 3UZEA 3WFEH 1XT5A 4JHWH 4YPGA 1P5UA 2AW2A 1ACZA 1Z5LA 1LDPL 2YK1H 3FO1A 4IS6A 1EEYA 3V0WL 1FL5A 2H26A 2ADJA 3B9VA 3BN9C 3LOWA 1DVFD 5IW1B 3QUMB 4K9EL 1R5VA 2FBJH 3DXAA 3PV6B 5AG9A 1HIML 3GUTB 1VFUA 1Z9MA 4HIIB 3ARSA 3AS1A 1BP3B 4JB9L 2NR6D 2IANE 4JKLA 1U8QB 4IMKA 3VXRB 2Y9RT 4MXVF 4Y16A 5KVEH 4M6AA 2WW8A 1KLGA 1NCAH 4MNQB 2OCFD 4N8PA 3TO2A 3QRGH 3REWB 1VFMA 4E41E 5HPMA 3TBTA 2IQ9L 4EUPG 3VFMA 3TFKC 2LTQB 4MA3A 3DNKA 5JDSA 4H26B 1FQ9C 4ZOCA 4XPHL 1HYSD 1D5XB 1GGBL 3ZKND 1PDKA 4E5XA 5DVLA 4X5WA 5L2JA 1LHZA 4Z8FH 2ICWB 2ZOKB 3QFJE 3WFEL 1UGNA 2XZQH 4K94H 1AIFA 4LRNL 1A5FL 3HS0B 4L3CA 4TNVK 3LKSB 4WI5A 3GMLB 2Q8BL 1BVKA 4WFEE 3ARFA 1AQDB 1TZIA 3HI6L 5D1ZD 2G75B 3V4PH 3A0OA 2XZAL 4N0FB 4ODUA 3QR2A 1AP2A 3CVHB 4HK0B 4XCEA 4KI5D 1CLOL 5FOBA 4ZOEA 5HHNA 5L6YH 1HINH 2BJMH 5CD5C 3OAYH 3PGFL 3SDCC 5E2VH 4K3JL 1NUNB 1X4YA 1JCKA 2XZCH 2CO7B 5KANG 4QRRD 4D9LH 4P2RB 5T5NG 3LEYH 4HCRH 3WJLA 1IGYB 3CFDB 3VGDA 2FX9L 4UT9H 5FHBL 5ISZA 5EUOA 2IFFL 4OZHB 3DVGB 2MCPL 2CPCA 1MRDL 5FM5O 1JTOA 4NZDA 2IPKA 3FQTA 1ZHLB 3W11D 1NBYA 3ZZ1A 1JF1A 1KN4L 3D3VD 3LN5A 4BSVB 4NWUL 2R29L 1SY6L 3H9HA 2Q8BH 5IIEA 2YK1L 3ARGB 5BZWB 1IJ9A 3ARWA 3QAZC 2J7LA 4TSBH 4NP4L 3GHBH 4Y4KA 3V4UH 2APTA 3CD4A 3LPGA 4KGLA 5A2JH 3EFDH 2ZCHH 1U93A 4OQTA 3A6OA 2O5ZH 4F3FA 3DV6B 5ITFA 3MRLA 1A6VL 4I8DA 5LQBL 2VR4A 3G6JB 1KJVB 5LWYH 4CGTA 4RGMB 1HEZA 1A3LL 2A6JA 3BN3B 4W6WB 3F58L 3FJTA 3SY0B 1F97A 1NDMA 4R97B 3Q3GB 4KQ4H 3QUZC 1T03L 4PLNC 5DUPH 4RA3A 3LKPB 3OJVC 5KANI 4P2RD 1DVFA 2X89D 1KTLA 3AREA 1NEZB 2WINB 1YY8A 5D1XB 2Z0BA 4QRQA 2EO9A 2HN7B 3NZ8B 1QA9A 1S7VA 5MI0B 1NGYA 1IAIM 2HJKA 4PJEE 2NY1D 3VD4A 2WBWB 5FDWA 4OF6A 4HGKC 4QHKI 1I7UB 4XBPA 4GSDL 4ZTPH 4M1CC 4C54A 4BK4A 4YHPB 1NKRA 2XACC 2Q6WA 1KJ2A 1YQVL 2VAJA 3IKKA 5GZOD 1UEYA 3MLYH 4PJ9B 3M17B 2CR6A 3BZ4A 4I5BB 5GZND 5C08B 4YNYB 2H9GB 4GAYB 1A6UL 2JB5H 2AV1A 4HWBA 1X6NA 3BMWA 3DO7B 1F4WH 3QG6B 3TPUA 3MRPA 2X6MA 4X6CF 3ULVD 4AM0A 2EEAA 2GHWB 3HG1E 1HCFX 4QOKD 5DHVH 4TSCH 4JR9H 1VDGA 3DIFB 4WGVB 4QLRA 1JGUH 5GRJL 4FQIH 3G08B 2Y06H 3IB4A 1ADQL 3H9YA 2VDNH 5IB3B 4K3HA 1GOFA 2C1OB 8CGTA 5AYQA 4G7YL 2F19L 5L8KB 3SDDA 5DQJA 3P30L 4XNQB 4RDQF 3HE6D 1RUQL 2WP3T 3IF1B 3ME0A 1KV3A 1TETL 5E6YA 4ZUWA 1N4XH 2E9BA 4OGYL 1DLFH 1BIHA 4IM8A 2X4OB 3N85H 3UJJL 4OUUB 3VFVA 1S9WA 1KCSH 2CO6B 2UWEE 4G8GA 2R1YA 5F71A 1NGPH 3BXNB 2F5BH 3VH8G 4IIQA 4R4NC 4JG1L 4X6DA 4YAQA 3QO0A 3KPLB 3LEVL 3RHWF 4QTHB 3DBXB 2Y6SC 3TLRA 5GRWA 3BKCH 1A0QH 4WTZG 3AY4A 4AT6B 1MFCH 1MNUL 2VERN 3OGCA 3U82B 1LO0H 2VLRB 5FGBC 1IGFL 2J4WL 3C8DA 3CMOH 3C5ZA 1AD9A 4L4TD 1KENH 5I1KL 1I9RH 3HZKA 4G8IA 2R69L 2FYYB 3DHMA 3KYKH 1HH9B 1KLFA 3G6DH 4UT6L 1EZVX 2X9XA 2W07A 2B20A 3A6BL 3SPVA 3BWAA 3K1DA 4M5ZL 4AL8L 1YEJH 2EDXA 3K46A 2FECL 4KROC 5E8PB 4K8RH 5F7EH 5T1LD 2HYMA 3THML 2NNAB 4KJQD 3FRUA 1OQXA 4WO4C 2NPLX 1VEPA 2X4PA 4NDMA 4E42A 3DUUA 3BPOB 2OL3L 2X7LA 4ODTL 5C07B 3VW3L 3TZVC 5I73B 3WE6B 3MRNA 1H0DA 4PGBB 1F11B 3KXFB 2X4RB 1QVOB 4XP6H 2YUXA 1DUYA 1MCJA 4JFYA 1HQRB 5GRZA 2BNRA 2DM7A 1V5JA 3HAEA 3MLRH 5EPMA 2FHBA 5CMAB 3HC3L 4DUVA 4UTBL 5ANMB 4EKXA 7CGTA 1CGTA 3VGAC 2MHAB 3WFCL 5ADPH 4K2UL 3T0BA 3PQYA 4OGYH 3OKDA 3PHOA 1WZ1L 2XQYK 3SN6N 5TDNB 3M8OH 5GISL 5HYQB 4TQEH 5MP6L 5GGTL 4NJAH 1A1MA 5CBAB 4PLOB 5IFHL 1WTGT 4MNGA 5F9WB 4EVNB 3VXPA 1A6ZB 4OD1L 1A7PL 3J8F7 5H8DA 5JW4R 1S9VA 2FDBP 5JZ7D 3V4VH 4K9EH 1KT2A 1DBAH 3BPCA 2RJMA 3QDMA 2V2XB 2P5WB 4HS3A 1KJ2L 5BJTA 2OTWA 5KVEL 5EUKA 5E5RB 8FABB 2Y6SD 5E99H 4DTGL 3MRIB 2IBBA 5FO7B 2HTKC 4NKDB 2YKLH 4OKVB 5IHUH 1CK0L 1YEEL 1XGYL 5FYJE 3MBXL 5ICYB 3VXNB 5JTWA 2VDML 4B7LA 5F3HA 3UYRL 2XKNB 1CG9B 5E8EB 2PETA 4L4JA 3RPKA 4OCYH 5EBGA 5GS1A 2EXYD 4WV1C 2PCPA 4OB5H 3T4YA 5TFSL 2YA2A 5EG6C 5EBLB 3NIFE 4X5XB 5E08H 1OOAA 2Y07H 5E4EB 5HGAB 2Y5EA 2V2TB 3IDJB 4G6JH 5DD0L 2OTPA 2OZ4A 2VLKA 3HUJB 3FFCA 4GKNB 4A6YH 1NCDH 4AEHL 3GI9L 4KAQL 4XP5H 5BS0A 1G9NC 1IM3B 1EH9A 3KPRE 3SQOH 4EI5D 2JELH 2RIKA 4YHKH 4P9MH 4M61B 5DDHB 4MJ4A 4H1LA 2F54D 4UT9L 3DX8A 5KJRH 3MNZB 1E4WL 5HBBA 4WTZA 4OLXH 4D9QD 3W39B 2WIMA 2EE2A 3RUGA 3LVEA 1UWEH 4G8EA 4NN6C 1CFTB 4K7PY 3V6ZB 5JIKA 1CICC 2Y07L 3CXHK 2AI0L 1KIQA 2NX5D 5JXEC 1JF5A 3B9KD 3HPLB 1UA6H 4N1EA 3SDXE 4IRSB 5JZ7C 1S7RB 5C0CA 1UFUA 5BV7L 3BZDA 3BZEA 3W39A 2R0WH 3BDYH 4DZBB 3A6CH 1UWGL 1FYTD 4MQSB 3WJJC 3EBAA 4PYHA 1RULH 4KKAD 3SKJH 3QO1A 3WFBL 5F1SA 3WXWH 2KL6A 1I85A 3PNWA 5E4IA 2X9YA 3U9PH 4NC0B 1FJ1B 3VD7A 4KGJA 5SWQB 3D3VE 1KACB 2VLKB 3HUJA 3SDAD 5C0JB 3BP4B 4LSRH 1YJDH 5EOCH 1XF1A 3EKCA 4NQEB 3OPZH 4OZFG 1TQCC 3EYVA 4IRJD 3MV9B 5GHWH 2KDGA 3OB8A 3I2CH 5CWSA 3S3JA 1MREH 3LQAC 3OR7B 2NY6B 3IU4L 1QFPA 3V0WH 1BHGA 3KDMB 3MRFB 3L5IA 2P8PB 2XKNA 1RULL 4JRYE 3NCYS 3VI4E 3EO1A 2DM4A 1OGAD 2LU7A 2O5XL 5FYJH 1KC5H 5EO1B 5IUSA 3DO3A 4UIKH 4P3DB 1OSPL 5D1ZB 1QLEL 4QCIA 5HDOA 5LGJB 5ITBL 4JPIA 2JJVA 5EZOH 4ZXBC 3RA7H 3T3PE 5KVGL 2DTMH 3QIWA 4G6AC 1IRAY 4IRZL 5EOCL 5E4EC 3MRCB 2YZ1A 4HIXH 4QY8A 1KT2B 3BPCB 5ILTL 5FCSH 4HPYL 4LSVL 1AKJA 2DIBA 2IH1A 2IG2H 3QDGE 2GW5A 4LPTA 1RV6X 4HFUL 1CIDA 1ETZA 2X1XR 2Z35B 2EE9A 4DGYH 5DK2B 3C5JA 1CICB 2A6KB 1DZBA 1JFQL 3PXJA 1JNJA 4L8SC 3PQYB 1S7TB 3TJHC 5KJRL 4Z7NE 5ANMA 1BFVH 3CX5J 3VXSE 1MJ8L 2YS4A 3PWUB 4BFEA 4OIIL 5EORL 5EZLA 1YNTA 3RVWC 2BNRB 4Q6IA 3O4OB 1FGNH 4GKZB 4PGBA 1H0DB 1Y6MR 4JKPH 5L8JB 3RGVA 3EHBC 5E2VL 5IW6B 4Y19E 5C07A 4R7DA 1PY9A 5IMMB 2Y7QA 4HGWA 4LFHG 2QQNL 2GJ6B 3UMTA 3X3FH 4Y5YC 2BOCA 4ETYA 4NNPL 4W6YB 3K8LA 2OS7A 4FZ8H 2DL9A 1Q0YL 5D93B 4JQVC 1A3QA 4Y5VA 2LTQC 2UV3A 1SVCP 5JXAL 1IEBB 1SY6H 4L9DA 4XB8A 3QCUL 5LAXA 1RJLB 4UV7L 3R06A 4PJIB 4IOFC 5JW5A 3ZKXC 5HVGB 4HJJL 4CU8A 3IVKB 3JSSA 3WIIL 2DQUL 1T66D 1HZHH 3BP6A 2MQ0A 4P9HL 2A9NH 4NNXB 6FABH 4Z78A 4L9LB 4ZSOA 5T33H 4UTAL 2NLJB 4P2CG 4Z0XA 5IF0B 1H3VA 1MCOL 1XF2B 5EU6A 4E0RA 4GG8B 1FNEB 1N6VA 2W9EH 1JHTA 2HFTA 2IAND 3HNVH 1AGFB 5C1MB 3RZCD 3WYRA 1A6WL 5CCKH 5FUCC 2YA1A 3KPLA 5IBLD 4E41D 1QBLL 1QBML 1MIMH 1HSBA 5JPNA 3ZE0F 4LOUD 3AXLB 4R96A 5GRUH 4JJ5B 1W72H 2HVKA 1PFCA 3QUYA 2VC2L 1X4ZA 3P11H 3U4BL 5FYJL 4CDHA 5DJ8A 1I9IH 2YSSA 3TO4B 3MV8B 2GSIB 3BHBA 5DHYB 1P4BL 4HT1L 3CDGA 4ZUWB 4QOKB 5ADPL 3WLWD 5AG8A 2FWOA 5I71C 3X12A 1YPZF 1RZ8A 1HKLH 3OB0K 5DQJB 4CNIA 4TQEL 4MA1C 5IMKA 1PKQE 3EOBA 4LCUB 3CZFB 4PPTA 5K33A 4NO5A 4OZGF 1K3ZA 3QWRD 4F8TA 3B2VL 1YN7A 3QNXA 2D0HA 2V5RA 3FQWB 1XGUA 1MCKA 4YX2H 3UP1A 2QL1A 3HNTH 1ZVHA 3I6GA 2JF1A 3C9NA 3DVNB 2VLJB 2J6EL 4S0SD 1JUFB 3UPAA 5DVKA 4BJLA 5GQBA 2G5BB 1UKSA 4RAUB 4M4RA 3WHXB 2HJFA 4HZLA 2VLMD 4PJHF 1M71A 1WF5A 2D9CA 3GJEA 1KJ2B 2BFVH 1FGNL 5KSAC 1ZT7A 1I8MB 4ZD3L 3O6LL 2EC9T 4JG0L 3KLHD 4JZOA 4BKLB 3GSVA 4ONHA 2DTSA 1CGYA 1J88A 4WEBH 2B1AH 5FDWB 5GJSL 3VI3F 2GIYA 4LK4A 4HG4J 5T1KA 4UNTA 4P2OD 3MTRA 4GMSH 1Z3GH 1LO0L 5LJYH 4DZ8B 2I5YH 3IFOB 3MUGB 2BVPA 3LEXA 1YY8B 3LB6D 3ARDA 4P2OB 4R4BB 3SDDD 2GJZB 1HHKA 3TBSB 4LAQH 4ZYKB 4HKZA 4JRWA 4M7JH 4HCRA 5DJ2B 2N7AA 4NZUH 4DAGH 2DQDH 3G04A 3RAJL 5ACMA 5HGGS 1MEXH 3OJDB 3REVB 4H1LG 1TQBC 1UJ3C 3BIKB 3CFJA 3TCXA 1ZHNA 4KWUA 2NX5E 4HS6B 2VSCA 5E2JA 3FFCE 1P4BH 3MV9E 5B38A 4F3FB 2ZSVB 1MCCA 3TJEH 4F9PA 5BQ7A 3IU3B 1YNLH 4WHTA 4XVSH 4ZO8A 3ARGA 5BZWA 5JO5B 1C16B 2FCBA 2YPKA 4O2EB 5F7YC 2DQFA 5HVFB 3H9HB 3GK8L 4IOIA 1CD8A 3CFBB 4P57A 1IGML 3LN5B 3SBWC 4BSVA 1D5BA 1GPOH 1MCRA 1NMCB 4J3WA 3UJIH 4S1SH 3EJZC 2JJWA 1OAXL 4G42B 5DJ6A 3PHQA 5D9SA 3TYGH 1U3HC 1OTUC 3HB3D 4X6CE 3VA2C 5BV7H 1C8PA 5HHMB 4TVSa 4LLDA 4TNWK 3A6CL 1FHGA 5IB5B 1NCTA 3LDBC 5EUOB 3P9MB 1I9JH 2DJUA 5GGSA 2WP3O 4H8WL 1S7QB 5JIHA 3LPWA 5IFHH 1JWSA 3DRQB 4PS4H 1J1XL 2DLFH 5DD6B 1ES0A 2DWEA 1TFHA 1QFHA 1I1YB 3K4ZA 5J56B 1YEGL 2H6PB 4L3EB 1R24B 4KTYA 5F70A 4YHMH 3K74B 3QAZB 1OTSD 1MUJA 4O51A 2ZCLH 5FUZL 3OF6D 1G6RA 4POZD 3GMLA 2DD8H 4RSVA 3QFJB 2VRAA 3VRLE 3OG6B 1LE9A 3GKWH 2FX7L 2UWEF 1ZT4B 3MZGB 3C87A 1L9NA 3DGGB 3IDUA 4G8FB 3PGCB 3S5LG 4D0DA 4PJ8D 2I26N 3T0XA 3KPRB 2L0DA 4X5WB 4YHZH 1OP5K 5I1IH 3ZE0E 4I18C 1OWWA 2D03H 1X5ZA 2Q87A 3CMGA 2HMID 4ONFL 5KSVB 2A74A 3FQUB 5DRXA 1MFAH 5HI3C 4MS8C 3PDOB 3H0TA 4OCYL 1UCTA 5FV2A 2PO6B 1P7QB 5C0CE 1INQA 1JYXA 3GBMH 1ZLSH 3VMOA 2GI7A 5HYJB 1LO2L 4XXCA 2HJLB 4RX4A 1D9KC 4LIQL 3IS0X 3FO9B 2YD2A 5F9OL 1YUHA 4GBXB 1N8ZA 3QQ4A 3SBWA 3ZE1E 3S34H 2WK2A 4GQPH 4D9RD 1G7IA 1MHPL 2ARJB 3PG2A 4E9LA 1N59A 4POYA 4JPWL 3QDJB 3B3IB 4K07A 2AQ3A 3UDWC 3RIAK 1W72B 2D03L 2YBRB 5DD0H 1T20A 3OR6A 5CJQL 3SE4A 5GRYA 3MRJA 2E7LC 4OLZH 4AEHH 1MCBA 2YBRA 2DWDB 2Z92A 5FK9B 4MQXD 2R0LL 5C71A 1CXLA 4JEGB 1B88A 3T8XA 5HHXL 1MCQA 3ARRA 2Q86A 2YD3A 4CBPA 3BD3A 2BJML 4JPKL 4PJFA 3JWDL 1GH7A 3E0GA 4NFBA 3OAUL 4BH7A 1IL1B 4PR5B 2R23B 2WUBH 1IL1A 3WS6C 4BH7B 3GSWA 1NANI 3LH2L 3QDHA 1INQB 4BZ2H 4PJHA 2DQJH 4HUNB 1ORQB 5JHDD 3L3KB 4ZPTB 4O4YH 4Y5XC 3FTGA 3D1MC 3G6AB 2OL3H 3TC9A 1CTOA 3O45A 1YJDL 4GBXD 3QXDB 2PN5A 1CR9H 4YEFA 4LGPB 1TQCB 3BP7A 3WN5C 4WI2A 5FUZH 4Y4FD 3IS1X 3AB0B 2IFGA 2ZCKL 4PGZA 4L3AA 4OM0L 2BVTA 5B4MC 1DVFC 2XWBB 3TNNA 3HC3H 4V2CB 4Y4HB 4X7CC 1D6EA 3RWCB 3WCYA 4R0LB 5JLZB 1GC1H 3QDME 2QHRH 1U92A 2W9DL 3RP1A 1JNNH 3GSNL 1CQYA 1BD2D 1LP9B 4LVNC 2AXJA 5MP6H 5FV1L 3IDMB 3GI8L 3F58H 3MJGX 4YBQC 5I1DA 5EU3A 4HV8B 1AGCA 1J05A 4HIHA 4KHXL 3TN0B 4F58H 1DQJB 4K94L 4NRZA 2B5IC 5T1DH 3VWJD 3O8XB 1FAKT 1SBSL 4OCLC 5I8EB 2EZ0C 1WFOA 3RU8L 1N5AB 1M05B 4LLQB 5H35A 1YC7A 1P7QA 1I1YA 4LF3B 4DKAA 3V6OE 2PTTA 3T0WA 5E94B 3PDOA 4PJAA 4GRMA 4B50A 4WU7B 5FYJU 4YHYC 3PUCA 5DRXB 5JHDB 1I1RA 3FQUA 4OGZA 1T1XB 4P4KC 3B9KB 2E9IA 4UBDD 4LFHD 1HINL 4PJAE 3UPRA 2ITCA 3RWJA 4LLDB 5JIIA 3OJ2C 3ULVF 1UC6A 2MNUA 4LLYB 1TZHB 1WC7B 4G42A 5DJ6B 1E4XI 3INUL 3UBXB 3WMSA 3CDFA 2EDBA 1P69B 4LCWB 3CFBA 1EO7A 3GI8H 4QNPE 3UJTL 5KSAB 4OB5L 2O5XH 3BW9B 1EJ6A 1A8JH 2HRLA 4WHTB 1U3JA 3VXRD 1KN4H 4DKFL 3U46A 4BM7A 5BQ7B 3VFWA 4QRRB 4HULB 1URLA 4HKBA 4WJ5A 4TSCL 4K3DH 1MUJB 1F3JB 3WFHB 4I3RH 1NUGA 3OKNA 1ZEAH 4LDOB 4WFGD 1R3LB 3VH8A 1LD9B 1NCDL 4IRJB 2NXZD 3I02B 4L8DA 4XP5L 3OJDA 1FVDA 5GGVL 5AD0A 1S7QA 2F19H 4JGMA 1LO4H 4AIOA 5CJOH 2VABB 2EKJA 2WUCL 5DRZA 2IADA 3I50L 3MODH 2YXMA 5E8OA 5D7KD 1KB5H 4HQQH 3GIVA 1QBBA 4HS8L 4JFFE 3MRDA 3PGDA 5DS8A 1FVCA 4HWUA 4DZ8A 3ET9F 1CD1B 3SE9H 4HKXA 4JHWL 1Q9WB 1C16A 2HH0H 1QFUH 4LSDA 1J5OH 5DRWB 5FXCH 2NY6D 4G6FB 1KNOB 2DQUH 4YHIB 1A9BA 2EDTA 3TYFA 4BQCA 3P73B 4WCYL 1ZWIA 5I30H 4HJJH 5EU4A 4U4BA 1Q0YH 1GOHA 4ODSH 3OTTA 1EFQA 2W9EL 4U1NA 1N2RA 1WZKA 2XFXA 1IC5H 4HKJB 3REVA 1MJUH 1D7FA 3WNPA 1OAXH 3AROA 2W0FB 3NH7H 5GGVY 5JW4N 1QBMH 1QBLH 1NUDA 1BIIB 2ICES 4H0HB 3S36H 1ZAGA 3DX6A 5KW9L 1YN7B 1HWGB 1F8TL 1KEGH 2OI9C 3OSKA 3ZKXB 1YEJL 1HYSC 4LKXB 1NEUA 1X5YA 4V1DA 2J12B 1EO5A 3EOBB 2ED7A 2BY1A 4QGTA 1RUML 4Y4KC 5J3HD 3PWPD 3T0EC 3HMXL 1G6RH 2BNRE 4CW1A 4JRXD 3M1BA 3VWJA 1RZFH 2Q7YA 2AK1L 5ETUA 1NAKL 1NLDL 4M9PA 4U7KA 1WLHA 3VG0H 1A1OA 1P9MC 3HCVA 2OM5A 3MNWB 2DAVA 3TVMD 3KGRA 1UJTA 4PJ7A 3ESVF 5JR1L 3RDTB 2NXZC 1G7HA 1M71B 5TH2B 1QUNA 4YUEL 3BYYA 1PG7H 3WD5H 3D3VA 2UZIL 3G5YA 3Q2CA 2G5BA 2AEIT 2R1XA 3ULUL 3MNVA 4YFLF 3K0WA 5ALCH 5IMOB 4HPOH 5I18H 3HUJF 4JZJC 4OJFL 3BX7C 1DLFL 2C1PB 4NKOB 4M7KL 5E24E 4Z95L 4DGVH 3AS3A