1XT5A

Crystal structure of vcbp3, domain 1, from branchiostoma floridae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
GQSIMTVRTTHTEVEVHAGGTVELPCSYQLANDTQPPVISWLKGASPDRSTKVFKGNYNWQGEGLGFVESDSYKESFGDFLGRASVANLAAPTLRLTHVHPQDGGRYWCQVAQWSIRTEFGLDAKSVVLKVTGHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords variable region-containing chitin-binding protein 3
publication title Ancient evolutionary origin of diversified variable regions demonstrated by crystal structures of an immune-type receptor in amphioxus.
pubmed doi rcsb
source organism Branchiostoma floridae
molecule tags Immune system
total genus 31
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xt5A00
4M4PA 1X7QB 5I74C 1I1FB 3CH1B 3T1FA 43CAB 2YOCA 4JFFB 2NXYD 4JPKH 4N5ED 5SV3A 3S4SG 1DUYA 2YPLB 3GI8L 4LSSH 2OP4L 5EWIH 4KK9D 3FN0L 3MRKB 1J05A 5BRZD 3HMXA 2P8MB 3KJ4C 1UXWA 3HNVL 1LO0L 3HZKA 4NJAH 4MDIA 4EUPG 3LS4L 3O6FB 3RPIA 1U8KA 3DURB 2HVKA 3MMEA 3FCTB 5M94B 3GSNL 4YHPA 4OFIA 1K3ZA 3UTSA 5TQ0H 3WE6B 2WBJB 1CFTB 1P7HL 1H0DA 3MLWH 4AEEA 1GCFA 3CVIH 3TT3L 1F4YL 1HCVA 4P46D 1QPPA 1T5WB 3I02B 3UAJC 5I8OH 2OJZH 2XG4A 2UUDK 2QQKL 4P3WA 4QHKJ 4S11A 1OP3K 1IGYB 2Z31C 3T1WA 1IVLA 1LK2A 1IL1B 2F54E 1BFTA 1GZQB 2O5XL 1J5OH 2PO6B 2VE6A 4HUWB 1F3JB 3O3BB 5F89A 2UWEE 3GEWB 5E5UB 3T4YB 5F7LB 3WXVH 3TZVD 4O9HL 3AUVA 3LKNB 3KPRD 3BYTA 3EIFA 1KN4L 3RVXD 4XPGL 2D3VA 2FCBA 2PYEA 5DJYA 2BY2A 4TRPH 3SKNB 2YPKB 3OKLB 4F9PA 2FR4B 4OLYL 3VXPB 4L4TB 4FABH 3O41A 4Y5YA 5I6XC 4KHXH 1WAAF 1U8HA 3QHTC 4PJ5A 5SX4I 1JNNL 4XZUB 4NO3B 1LD9A 1R3LA 4UV7H 1UZ6F 3QUZC 4ZPTB 1F8TH 1S9YB 1EUTA 3KJ6H 4JR9H 4IS6B 2A83A 3HZYA 4HAGA 5K33A 1PKOA 3X3FL 1N4XH 3SGDI 2MPAH 1I1CA 2NY0B 2HWZL 5MEOA 5FF6A 2W0PA 4GRWE 3PP4L 2HFGH 4JM2D 4LSQL 4XVSL 5F1IA 1A1MB 3EOBB 5D2NB 1AGFB 2CJUL 2VABB 1DLFL 4IIQC 4HK3N 3VFSA 4YFDB 2NY6D 4PJ7F 4DQOH 5HHMB 4G5ZL 4Y5XB 5FUCC 3VI4F 1N5AB 5DD6A 3GHEL 2VDKL 2P24B 3MV7A 4JDTH 1I3RB 1VFBB 4OF6A 3QDMB 5GPRA 1HILB 3L3DB 4YX2L 1K4DB 3HC4H 1IQWL 3MLZL 2P49B 5KAQF 4XP9L 3HR5A 3QIBD 3IB4A 4TUJA 1CFQB 2HG5A 4NC2B 4DKFH 5DD5L 3W2DL 2EH7L 5ACMA 4PJAB 4PJEA 1RK0B 1MH5B 1XIWA 4HJJH 2DI9A 4R2GD 4ACPA 4P2RE 1VENA 1ZHBA 4JY4A 3WIHA 1T6VN 3HUJF 1YNKH 4RBPH 2PETA 5EBGA 4M3KB 4LLDB 1AKJD 5D1QB 4PS4L 5HI4D 1J1XL 5D96B 2R8SH 3C8KA 2IAMC 1YY8A 1NCUA 4RDQF 2VL5A 1A3LL 5GRWA 4YHIB 1QLRA 1U8NA 5EORH 5T5NG 1KJ3H 2WZPD 2VWEC 3FN9A 4Q9BA 5CS7A 2VR9A 3I6LE 1UKQA 4MJID 3G5YA 4APQB 2MHAB 1OSPH 4ZTOH 4N8CH 5TE6L 4ELMB 4PRIA 1DLHA 3TNNA 1T03L 3VD4A 1CTNA 2ESVA 1XGRA 3NZHL 4Y4KB 4BM7A 4FFYH 5KSAA 1YEGH 5FM5O 3P0VH 1QBBA 3MFGB 3X11A 1MRFH 2Y36H 2DQGH 2FJGA 5C0EA 5DJZB 5HHNA 5D7JA 4NP4H 2A74A 1GGIH 1CZ8L 3QYCA 3DGCR 3STZB 3RVTC 4YHNB 3I2CH 4XAWH 4NOBA 3FQWB 2R69L 4UT9H 3QAZB 1EERB 1MREL 2NY4B 3A67H 5F1NA 1MI5E 4E9LA 1PSKL 2VXQH 3S7GA 5EBLB 1CF8L 2ZCHL 2XWTB 1QYGH 5E2VL 2AP2A 4HXAL 1RUPL 3FQNB 35C8L 1JWMB 3CLFL 4G6ML 4MJ4A 1JZ5A 3VA6A 4Q6IA 4KK8C 3RL2B 3IAQA 4HGWB 1R3IH 2X4TA 3NN8B 3AREB 1RK1A 2CK0H 4WW2F 3GBNH 3CSYA 3F7QA 4R4BA 5D1ZA 1U92B 3WKML 2ARJQ 4LCUA 3B2VH 2EYRB 1DQMH 3W9DA 3BWUC 1RZJH 4M6MH 4ODXA 4Z7UE 2EDXA 5HYSA 4S1DC 1YYLL 3D5OF 4V2CB 3W82A 5E6IB 3JTSB 4G6FD 4JM2B 2OSLB 2YD5A 1C16B 2BVTA 5ACLA 2OL3A 4W6YB 4LFHG 4ZAKD 2BDNL 2EDEA 3D69A 3DMMC 3NABL 4FQJH 3RWJB 5IESH 3UO1L 2ATKB 4M8QA 5D9SA 5FOBB 4Y2DA 4HF5H 3UTOA 5C0CB 4LPXA 1KYOJ 1A47A 1PQZA 4OD2B 3BW9A 1HI6A 1P2CA 5T5FH 4QYOB 4URTB 3RJDA 1JZ3A 1SMAA 2P47B 5DEGB 5B8CB 2EIBA 3LH2H 1MOEA 3CMOL 1KJ2B 1YEKL 3UTQA 4OLXL 4NKOA 4R96A 2AJZA 1JTOA 5CUSL 4F15C 3HI1A 4HPYH 5JO5B 4O2FB 4GG6F 2GY7B 4U31A 2X4UA 2A6KA 3CDGB 1OGAD 3C6SB 3CVHH 4FQLH 4OCNC 1I8LA 4FXGB 2BX5A 2FH6A 4F37K 3FZUC 3PWJA 1K4CA 5FYJL 1HYRC 1SEBB 1CICA 5KSBB 4OGYH 1T0PB 4WTZA 3V52H 1S78D 4PRDB 1ZLSL 2DL9A 1BOGB 3BEWA 4QRRA 5EZIH 2HH0L 5BJTB 4PV9A 1GAFL 2BVYA 4YDLB 4U33A 1NL0L 4JY6B 4PGDB 3QI9A 3GSVA 4G9DB 2DJ4A 5JPMA 2KBGA 3VFVA 4E42B 1RHHA 1YMME 3AM8A 3IRZA 4PRHE 3DO3A 4Y4FA 2F74A 5BRZE 4HK0A 5DC0A 4IRJC 5FKPA 5GGTA 4JPWL 4MA7L 4UAOC 1IKFL 1JWSB 4UIKL 3Q6FB 1WQVT 2P42B 1FNAA 2GW5A 5E8NB 4LPUA 2K9UA 3JV0A 1JNJA 1A4KA 4RISH 1Z9OA 3QEHA 3JV6A 2P5WA 3BIAX 4HCRL 3MNZB 4L1HA 4P5TD 1S9VB 4PREA 8FABB 5GGVL 1A2YB 3P0YL 2HJFB 4CMHB 5C6PB 1PJ9A 2AXGA 3S96A 3HG1A 4PGJA 2YZ8A 1LEGA 3JV4B 3F62A 5KVEL 3OKNA 5GZND 4K8RH 1S7UA 2XYCA 3G04B 4JE4B 5TE7L 5FEBA 4J1UB 1NMAL 3LN4A 1M05A 4D3CL 1UWGH 4BH8A 1BF8A 3KPRE 4PJ9B 1KPUA 1UEMA 2OTWA 3GSOA 4MNGB 4ZFZA 5TPWH 3SDDC 1JZ4A 4H0GA 5CINH 3VWKC 4NQXB 4N0CD 1FBIL 2AJSL 3OPZH 4NKMA 4Z7VF 3ROOA 1E6OL 1U36A 1V7NH 4C4KO 3TO4A 3VWJA 1FFOB 4CUCA 3STLA 3MROB 1FO0B 3BP7B 1H8SA 4NIKB 4PGBB 5EUOE 1W2KT 4J3SA 2QV2A 3DX8B 3T77A 1JIBA 3FQXA 1XF2A 4BFIA 3ARYA 1ZHLB 3F12A 1KXQE 3MNWB 3QNXA 4PLJD 3UJTL 1A6UL 1HN1A 2JCCE 4GG8A 2CXGA 2EXYC 2PW2B 4G6FB 3AFLA 2VQUA 1IC4L 1INQB 5IWLA 2PYFA 5T1MA 4O2CB 1UWXK 3TYFA 4Q7DA 1MPAH 1OARH 3EKCA 4NN5C 5D1XA 3LKPB 3QQ4A 4YEFA 1I7TB 1JE6A 2AGJL 1WBYB 3ILQC 4XMLH 3CZJA 4LSTH 3PHQA 1EMTL 1JPFA 1CN4A 3DXAD 4KRPB 4JVWA 1G9MH 3H3PL 3DYMA 5CZXD 3O0RL 3VFGH 2D0HA 4X6CB 3MLRH 4UQ3A 1VPOH 4I0PA 1KCLA 2VXTL 3JUZA 4U6YB 3OV6A 3IDUA 3M1BA 4K7PL 3K3QA 4OZIF 5C2BH 4OZGE 1VKXB 1OCWL 4QLRA 4ISVB 5MEQB 1IGCL 3QCTH 1BFVL 3MRBB 1KPRB 2N7BA 2C4XA 2IH1A 5J1AB 5I1HH 1R3JB 3NTCH 4EVNB 3RP1A 2EECA 3MRRB 4JKKA 5CKAA 2GSGA 2MFNA 5MENE 5H35A 4Z78A 4P3CL 3I3DA 4ZS6D 4WO4D 4XC1H 3WDIA 4JFOA 3CC5A 4FQIL 5GRXG 4F7MA 2FL5A 3ULUL 3KPOA 2V7HA 3QA3B 4YO0B 1EO8H 3RGVA 1AQKH 5KJRH 4UI2A 5JHLL 2XA8H 3BDBA 3LV3B 4ZSOA 4OKVB 1W72A 1X6NA 3DX7B 3LQAL 1XF4A 4MJIE 2D2OA 1HHJB 2PXYB 5DFTA 3HMWL 4NYLB 4OUUA 1T83A 3T8XB 4MJ6B 4ZFFB 2ORBH 4ZMAT 5DR5H 1QFUH 3W11D 4GSDH 2NY2B 5TDOB 2VDLH 1EV2E 4FP8L 2EICA 3WDHA 3M07A 4Y19E 1P7KB 4D0BB 3BXNB 4GRMA 5F7HA 1KTRL 2C3VA 4Z7QF 1N0XL 4JLRA 4P5TB 4XCFH 4F7EA 1A6AA 5E2JA 3MRGB 4LK4A 5B4MD 1A7QH 1UWEL 2V2TA 4C83A 3VFUB 2YEZB 5GGQL 1LO4H 2R2EB 3T0XA 2EZ0D 2XKNA 4FS0A 3TYGL 1JPST 3O3DA 3TVMB 3EYVA 2F8XC 1R0AL 2FIKA 4FTVA 3B9KA 4NDMB 3V7AE 2AERT 2XWBB 2LTQC 4EXKA 4Q2ZB 4QOKE 2HTLD 3CZFA 3O3EB 5EOCJ 4MXVE 3MLVH 4KAQH 3DVNB 4JHAL 4OF8A 3EO9H 4QXGH 5HI3C 5ID0B 4PV8A 3GKWH 2O5YL 1FYTA 4P2QD 2YRZA 1YNLH 3ZLQC 2DQUL 1BFSA 5IBLC 2QR0A 4OV5B 3O45A 1C1EH 3QUYA 4OSUH 4LSRH 4IRSB 5DO2C 5ETUA 3QFJA 2YWYA 4MVBD 1AO7A 5L0QC 1MY5A 2COQA 6FABH 3BRGC 4GAJH 4D8PB 2IADA 4JZNB 3BISA 3WHXB 1TQCB 4ZXBD 1T0MB 1LQSR 3K80A 3BPCB 1LO2L 3VH8A 3CMGA 4NC0B 3D2UD 2G75B 3UTSE 4PJCF 1JZ2A 2ERJB 2WANA 4XCYB 1MHCB 1CS6A 2UZYB 3Q6GH 1A7OL 3WHE1 3DV6B 3JWOC 1AH1A 1VADA 1RY7B 4L8DA 4WV1C 5JXAH 4NHUB 2W38A 1SHMA 3C2AH 2LU7A 4X9GA 2NX5B 2B5IC 1OD7A 3ULUF 1OHQA 1KJVB 1MCBA 1I7RA 4YXLH 1XFPA 5TDNA 1J1OH 3CK0L 3MFFA 1U8LB 3LRSA 4OJFH 3OR6B 3J7HA 4CU8A 4TULH 2N4IA 1NGQH 4WEUD 4I48B 3P3YA 5GSRA 5IEHA 1OGAE 2ED8A 3S4SB 1FHGA 3V6FA 3K7UA 2J8UA 1ZEAH 3QUML 4JANA 4N68A 3WS3B 3O6KH 5SX5K 2HTKD 3I75A 1V3LA 4JRYB 2VKWA 1NSNH 2R2CA 3BQUB 1CE6A 2OZ4A 3OXRA 4PJ5E 3FT2B 3UBXI 1BZ7A 3G5XA 4WY7H 4XNXH 4WU7B 4CVXB 3DYPA 4W4OC 3I6KA 1E28A 4X80L 2CR6A 5DZLA 4HUXB 3UBXA 3RKDC 4DVRL 4UIMA 2NR6D 1CBVL 2CMRL 3O6FC 4AENB 1SVZA 1A1NA 3FQTA 3UTTB 2OI9C 1HOCB 2IAND 2H2SC 2WBJC 1HSAA 4R3SB 3TT1H 1SJEB 4GBXA 4IMLB 2ITDB 1T1XB 1K8DA 4YNYB 3ZDZF 1FNGA 1U58B 2C7UB 3N0PB 2VL4A 3SGKC 1M1SA 5HDLA 1MJ8H 5SWZA 5E94A 4AL8H 1E27A 3EGSB 3BVNB 1LO3L 4UDUB 3UX9B 1PAMA 1A9EA 3MV7E 4UTBL 5FKAB 2QSQA 1MUJB 1J10A 2BVEA 3OGOE 4GFTB 5B22A 1MELA 3QDJD 3HPJB 3RAJL 3AVEA 5EH1A 5SX4H 4I0PD 2FX7L 3MUGB 2HKHH 2R1YA 4PJXB 4NNPL 4OQTA 1VDGA 5D7IE 5I17A 3ARSA 1O7VA 4A6YA 3P4MA 4OFYA 2CQVA 4JFEA 4LAQL 5CD5C 2Y6SD 5DI8A 1UFUA 5E8EB 3SGDH 2A0LD 4AG4H 3ULVD 4F58H 1H3WM 2G5RA 3OZ9L 4PLOB 1KEML 3SE4A 5B39A 5D7LB 3EDDA 3Q1SH 1ADQH 2RHEA 3TJEL 1MRCL 4OZ4A 4RRPA 5DD1L 3PV6A 3LS5L 2E7MA 4WCYL 4JM4L 1L0QA 2FEDD 1QR1B 4BH7B 1WAAA 4K3HA 3VGBA 1VEOA 2VDOL 3N85H 3MYJA 4U1MB 5GSVB 1ORSB 2F5BL 3QRGH 4QXTA 2B7DT 4IMKA 4ZPVA 2Y5EA 4IM8A 4I0KA 2EKJA 5ENWA 4C55A 2UYLB 1FNSH 1CGUA 2KPNA 2EDQA 5HJ3A 1P6FA 1CXFA 3QIWA 5J0BA 3NFSH 2ZSWA 1IKNC 1T7WA 2X89D 2BOBB 1NAML 1IBGH 1TXKA 3O6MH 1EBPA 2X10A 3RGHA 1S5HA 2DLFL 3PJSA 1RUML 3REWB 5JXED 2F53D 3WIHH 4NWUL 3RQ3A 4UDTA 4ZOAA 2NMSA 5IG7A 2Z92A 2AJ3A 4F2MA 3H42L 4HKZA 5E5MA 3DXAE 1AFVL 5EBMB 3SQBA 3DROA 3W81A 3ARWA 4EI6A 4Z9KB 5ANMB 4LARH 5FUOH 1NLDL 1MFCL 5FGRA 4OFDA 3O4OC 1CXEA 5HDOA 5D1QC 2ZPKH 4WW1B 3KHQA 2GCYB 2L4OA 1T4KA 1XGTB 4DTGL 1S7QB 5C1MB 4MWFB 2CDEB 5ACZA 2CIKA 1I8IA 1QRKA 1PGRB 4LP4A 3D9AL 4JREB 4OCWL 3BPLC 3O8XB 1CL7L 1A14L 4N0UE 4U1LA 1NH6A 2NXYC 3HUJA 4N5EC 3FOMA 1NMBL 5C09D 2EDHA 4WHCA 3GSNA 2DQDH 2WWMD 4KK9C 2D7MA 4GOSA 3SE8L 4MA1B 3DUUB 5ID1B 1EEUA 5D5MA 4M6NH 4QRPA 4Y4KC 2C4FT 1NGZB 3EYQD 2VUYA 4KMQA 4WU5B 3B2UD 3O9WD 2ZUQB 2IANB 4MD4B 5HYQB 4TSAH 5ICXA 3TA3A 1HXMB 1MIEL 3RPKA 3ZTJH 4CKVX 3GMRB 4CJ0A 5CJQL 3G6AB 2OQJA 3C60B 1MQ8A 1FE8L 3P9WB 1KCRL 1NJ9A 4P46C 4U1IB 4Y16D 1REIA 1A6ZA 5FO8B 4CU7A 3ZKQD 3GO1H 1LILA 3MGOB 4HKJB 1BBJB 2BSRA 4NRZA 5TH2A 3VDAA 1INEL 4Z7NF 3QBTB 1H3PH 4EN3D 3HA0A 1L9NA 4K7PX 4WEMB 3T2NL 5KSVA 5IB2B 3HKFA 4XC3L 3BHBB 1LO5A 3EYFA 1D9KD 3TZVC 2HFTA 4HKXB 5L2JA 3NZ8A 2AEPH 4PD4J 1ITCA 1N59B 3KPPA 2YA2A 3ORJA 3RVXC 4I77L 3PWLA 4W81A 1G7MA 3VRIA 5AYUH 4JQXC 2NPLX 5GGSB 3MBXH 5I18H 3UZEA 1MCFA 2MKWA 4MA3B 5EOCH 4MHHI 1LP9F 1AHWB 4P2QE 2CPCA 5DRXB 4DVBB 4LAJH 2VDQL 3HNSH 5HVFB 4LF3B 3ZHLA 3IXTA 2EYSA 4QRRE 4EDWH 5DJ8B 4JM2C 3LN9A 5IR1B 4WW2A 2A9NL 5HGBA 4NM8L 5MP6L 1E4WH 3K74B 1NFDA 1FFPA 1ES0B 5TJWK 4AIXA 4XPTH 4KV5E 3B6SB 3WFBH 4Y7MA 4ODTL 3ZDXF 3LIZL 2IMMA 5GIRA 2X9XA 4O2EA 4MCYA 1HKLL 1NUFA 1A22B 3IJYB 2G9HB 3BZFB 1T2QL 3ARFA 4QY8B 2DYPD 2GFBA 4GXUM 4YFLI 5JZ7D 1LHZA 3IT8D 4CADB 4HGMA 1ONQB 3V6ZB 2OM5A 2F53B 3QIBC 5DJDB 1EGJL 4L4VD 3NCBB 3DGGA 3QEQA 3L3OB 4M7KL 3HRZA 3S34H 3WFCL 3KGRA 4R2GC 3QFDA 2ZUSA 3TJHD 5HHOD 32C2B 3U83A 3MLYL 3VCLA 3P4LA 3CFBB 4TSBH 4FQCH 5EO1A 1ED3B 4XNQA 5C0AA 4WTWA 5HI4C 2VLKD 4KK5D 4HIHB 5DUBA 1CDJA 5F6IB 1ZGLP 4LIQH 1PLGH 1X3DA 2RB8A 2Y23A 4M93C 4MAYD 1HH6A 2IQAB 4HWEL 4NBZB 2VMFA 2BVPB 2X05A 3MRLB 3PL6A 1YN6A 4OT1H 3OF6D 1JRHI 3W5MA 3KLAB 2E7LA 4X8JA 3K0WA 4LEXL 1WZLA 3BD4A 3DTXA 2GSIA 1YC8A 4K94C 2QQQA 3RL1B 5GS0H 2FWOB 1XGPA 5DUML 3O9WB 3FT4B 1FVDB 1WCQA 4U7MA 4GH7B 4PP2A 3X3GL 1KN2L 4NRYB 4KROB 4IBLT 4ZUTA 3UDWA 2DM4A 4Y16B 5F7DB 2Z93A 3GBLA 1VFAA 4OM0H 5CEZH 1NGWA 5EU6D 3RVVD 3GJEA 2CLZA 4Q0XL 4GUPB 2FECL 1G7JA 4G43B 5IHUH 3FMGL 3T2QA 5HHVH 1F2XK 2G2RB 2FB4L 3U30C 2CKBL 4PIRF 4Z0BH 1KF9B 3X14B 4ZYKB 2VIRB 3QDJE 4W4NA 5D8JL 5CJ5A 2GT9A 5JOFB 4U1JA 2WWKO 4PJ9C 4M7JH 1NKRA 3EYOA 3MRFB 1D9KB 2R1WA 4JB9H 4UT7L 4XXCC 1NBVL 3RUGA 3QZWB 3EFFA 5DT1H 5JLZB 3WL9B 4X7SH 4WUKH 2A9ML 3MRMA 2DQHH 3GB7A 4DAGL 3ULVE 3L9RA 3QWQB 4F7PA 4ZD3L 4ZDHA 2XNAA 2BNRB 3B9AA 3MCG1 3R8BB 2X4QB 1TJIL 5GHWH 1VSCA 5AZEL 2R15A 1CIDA 1BVZA 5DJ0A 5LQBL 3ZTJG 4JQIL 5E7BA 4K8RD 4ZSOE 5FXCH 4D0CB 2P7TA 5DQJA 4JAMA 3MV8A 3BX7C 4E0RA 3NFPB 1YQVH 5DFWH 5J12C 4RZCB 1L9MA 4OCRL 1MCOH 2BCKB 4LP5A 4ZAKC 1Q9LB 5HVHC 3VFWA 1X5FA 2BVUA 3MCKA 1HEZA 1AXSA 2FJHB 4RMWA 1JF1B 3I6GA 5EIVA 4JJ5B 4NO5A 4C4KT 5IW6A 1FNFA 3BPNC 3CFDB 5C0BB 3OB0H 5HGHA 2FBJL 1RIHH 3JVGA 4FQ2L 3BP4A 3K1DA 2HA1A 4AIZA 2V17L 5EU3B 2E6PA 5D72H 4L4VB 2C1PA 5HYSG 2F58H 3BT2H 1FH5L 4FQ1H 4NO0A 4O5LH 1UC6A 3P11L 2YHGA 2OTUA 4HJGA 2VZOA 1W72H 3LMJH 4FMKA 4M9PA 5HHOB 1CGXA 2EDBA 8CGTA 2L7JA 1MEXL 1N8ZA 3MOAL 2V9TA 3FTGB 2VLJD 2R2BB 3SDXB 5EOQH 5HXMA 1S3KL 2BRQA 1S78C 1K6QH 4OZIA 3FFCD 4RIRA 3WXWH 4S0SD 1WSST 2EO9A 2DLTA 1K9TA 1A7PL 3LKSA 4J4PA 4N0FA 4NZTH 4LMQI 1FYTE 4M48L 4WHYH 2VISA 4ALAH 1IC7L 2XZCH 4PJGE 5GJSL 1FVCA 1QNZH 5DJAA 3SO3B 5C09E 1DE4A 3S37H 3G6JB 4EDXB 5CBAA 5AWNL 5EIIB 3RVWD 4MQTB 1RJZB 3WN5A 2EDDA 4WUUA 4HCRA 3RWCA 3SBWC 4MD0A 4NHCH 3V5HA 2BVQA 4NQTA 4AM0A 3VXRD 3QWOA 4XRCA 2DRUA 1RZ7L 3CVHB 2H6PB 4G8EB 3GNMH 5KN5A 4JFDD 4P5TC 4ZFOL 4XHJD 4CU6A 1IARB 4LCCA 5FIEA 5DLMH 4F8QA 2ZOLB 4NCC1 5I15H 3H0TB 4KUCF 1GC1C 3QDGD 2MWCA 2E9IA 1P4BL 5EG6C 3U7AA 2XRAL 2W1NA 4P5KB 4U3XA 5GZNC 1KB9K 1CQKA 3ZZ1A 5LWYH 1X5GA 1ZWIA 1Z3GL 2VKXA 1KJMA 4D9LL 2HKFL 4HJ0D 1FZMB 3CD4A 3WLWD 3B3IB 2BVOA 3I3EA 4ETQB 3T04D 1CU4L 3KYNA 4QCIA 2ZJSH 4U1HB 3V4VL 5I8KH 3HZMA 2D7QA 1FLRL 3RWFB 1AGCA 4FQHB 2VXVH 3TGXA 1OGTB 4KJYB 2NTFA 4N0CC 1PVHA 1UB6B 4PR5A 2BSSB 2FLRT 4ZODA 3VXQB 5EULV 1AGBA 4Q9QH 1J8HA 2KDGA 5E8DL 1D5ZA 3D3VA 4R26H 3QUKB 3ARBD 4X4XB 3EO1A 1RV6X 5E4EB 3KPQB 1S8DA 4PLJC 5IMLB 5JA8B 5DDHA 1RZKC 5A16B 4ORGB 1J0ZA 4U6HA 3QNYA 3FQUA 4PJ8B 1B0RA 1JHKH 5KZCB 3L95B 5D6DC 2ERJC 5C07A 3MRCB 1T1YA 3QXDB 5I1LB 5EZJB 5ITFB 2WBKA 5ICYB 1NC2A 3HR6A 4PJFB 1CD0A 1U8PB 1SVCP 3MREB 4HV8A 4LCWD 2PTTB 5JW5B 2L0DA 3UJJH 5I19H 3RZCB 1OAYL 2I9LB 4LSVL 1ZT4B 1FAIH 1AY1H 3GSRB 3WFEL 1QFWM 4PJCA 1PD6A 1J1PH 4DN4L 1YUHB 5T3ZL 1JV5A 4S1SL 5T3XH 3OXSB 4FZ8L 5FDWA 4MX7A 4KRNA 4X6FB 5IMMA 3LEYL 3ET9F 5HD8C 4PTUA 2A6DB 4R90L 3MRHB 2UY6A 2FX8H 4ORZC 3BQUC 3IAPA 2W9EL 4JHBA 2LAGB 1R5VA 2VLKE 3SQOH 3ZKXB 1DN0A 4YHZL 4ZS6C 4WO4C 1J86A 1U6AL 4N8PA 4S1RL 5L8JB 4XBGB 1MAJA 3BO8A 1KTDB 5DSCB 3IU4H 5IMKB 1J88A 4U1NB 1GGBL 4F33A 3GMMB 3HE7A 2CKNA 4O02H 1KT2A 1I7UA 1UGNA 4JRWA 3SDYL 2XN9D 1T2XA 3SKJL 4X4YA 1WAAE 1DQLH 4WVRA 1HNFA 1C5BH 5INDA 3FO0H 5IF0B 4QXUH 3W11C 4I3RH 43C9A 5CJ8A 1UZ6E 4P3DA 1S7SB 4M1GH 2J3SA 3BIBX 5DRWA 4GW4B 3RZWA 4FHBD 3HNTH 3N1MC 4XP1H 5EC2A 4NNXB 3H9ZA 5ALCH 1TJGH 2JJSC 1T22A 3S3SA 4A6YH 3VD9A 3C6LB 3ISWA 4LLAA 5IP4A 5B4MC 3ARXA 3OJMB 1SM3L 5EU6E 3PHOB 4ONOA 2FRGP 3SOBH 4D2NA 5H8DA 4JJHA 3C5SA 3U6RB 4L3CB 2EZ0C 4PJ7E 4JKPH 5E4IA 3RHWF 4LGSB 5I75C 5E9DD 3ZYIA 3BSZH 5FYJD 3VI4E 5FYLH 4FZEL 5EU5A 5DVLA 3SKMA 3KYOB 1NDMB 1JGLL 2NLJB 2HTLC 1V5JA 4I3SL 3KWWB 1RVFH 1UJ3A 4WHYG 4PBVC 2IPTH 3OTTA 1N6VA 4MA8H 1C5DA 2RFXB 1UJTA 4WI7A 1ZOXA 1RIUH 5ISZA 3GMNA 4ZQKB 3K1KC 2PTUA 3LEVL 1RSFA 3IFOA 2ICWJ 2V9QA 2I60H 4NZUH 1L6XA 5DD0H 5I8CB 4WNQA 2P8PB 5E08L 4HFWA 5DRZA 4MVBC 5I16A 1T2JA 2AXFB 3WLBB 2NY7L 3QH3A 1S7RB 1K3IA 1BM3H 3NPZB 4XI5D 2JIXD 4ZXBC 4QRPE 3QIUD 3WSQL 5IB4B 1ND0B 1PG7X 1IGML 2I9TB 3SJVD 2ZCKL 5DMJB 4ZUUB 4U0RB 3AXLA 1NDGB 3IDMA 4G3YH 4NQUA 1JPGB 5JR1L 4DGIL 4HX1B 3MXWH 3QJHB 3SGEI 5J1TC 4HIEA 3TCLA 2R4SH 2J88H 1I1RA 3FO2A 2D7PA 4UQ2B 3BKYL 5HTSA 4ONFL 3DECA 3QUMA 1KXVC 2ZUVA 3LS4H 4YDKL 3BKJL 4GJTB 2XA3A 4YHKL 3QRFM 1S5IH 4LRIC 3AS3A 4NQVA 3OKKA 1R24B 1U8OB 3VH8G 4GRLA 1HWHB 1AP2B 1TETL 4K3DH 2RCSL 2DWEB 4JREC 2HTKC 4X6BB 5BOPA 4C56A 1DBBH 2VLJE 4NPYA 2A38A 3IETA 4I2XB 2ARJB 4M5ZL 5JIHA 3FFCE 3MV9A 4V2BA 2DTML 2FEEI 5T1LD 3JWOL 3GIZL 4ZUSB 1G0XA 3T2OA 2NR6C 2FATH 4XCNA 1X6LA 3QO0B 1I1AA 1YECL 3KNBA 5CILL 5IVZB 4O9HH 1D6VH 1RZ8B 4UILH 3GSWA 2XN9B 3BP6A 3QXVA 2CR3A 1RU9H 4CMMB 1BX2B 2Q76A 2BJMH 1EUUA 5FK9A 2L7UA 4XPGH 5HVGB 3T1FB 4G6AD 2WUBH 1DUYB 3N06B 3VXRE 3U4AA 1J05B 1AJ7L 1E4KA 1Y6MR 3T2PA 5CGMA 3B83A 5KW9L 2J5LB 2DICA 4X4ZA 1UXWB 4PY7B 5HPOA 3U2SA 4JFDE 5CSZA 2XOTA 1UCTA 3RPIB 1BIIA 1U8KB 2GIYA 3L6FA 1EVUA 2LABA 4L1DA 3X3FH 3UBXG 2B2XH 3QDGE 2HWZH 1D7FA 4YR6A 1MQKH 5C9JA 2O5ZH 3PP4H 2CUMA 4Y5VB 1HK6A 1GPOL 2XQYK 1X5YA 2NZIA 5DWUH 3BEVA 2XQBH 2CJUH 1P4IH 1VEPA 5E95B 1DLFH 4C57C 2Y6SC 1LK2B 4E41D 2A0LC 4G5ZH 5CBEA 5KANI 2VE6B 3NVQA 3ULVC 4HLJA 2AK1H 3GHEH 2VDKH 1AHWC 2R1XB 2JJTA 5CHNA 4YEEA 1AE6L 2ZUXA 5MHSD 3JWDH 2FEDC 1E4XL 2PYEB 3MLZH 4GG6E 1BOYA 2DQTL 4UU9A 4RCAA 3WHE0 3O41B 4Y5YB 4Y4HA 5KTEL 1G0DA 1U8HB 5KVDH 1XAUA 1S7VA 2EH7H 3W2DH 1EHXA 1CGWA 1Y18A 2GJ6A 4FFZL 2GJZA 1DFBL 1LD9B 1LP9A 1MCWM 4MAUL 4ONGL 5E1AB 4PJHA 4OD3L 2A83B 3HZYB 2JIXB 3RU8H 4CDHA 1KCSH 1N6QL 3QIUB 4PS4H 5B39G 2VYRE 1I9IL 2H26B 5FF6B 3MCLL 1I1YA 3QR2A 4ODUA 4QRUA 3FB5B 5JXEC 3SJVB 1GRWA 4RRPG 4TUOB 1DBKH 5F1IB 5TDPA 2DQEL 4KHTH 3QCUH 4LCWE 1X5JA 2YA0A 4JFXB 2WSKA 2B1HL 1NEZA 3TV3L 1T89A 1DQTA 2QQLL 4BJLA 5DUPL 2R39A 5DD6B 5IQ7L 4MSWB 1I3GH 1KTKE 5KOMC 1BECA 3HI5H 2Q8AH 1KC5L 2VQ1B 3GUTA 3QQ9D 2X9YA 1RUKL 1TVBA 1PY4A 1JRHH 4JN2A 3MODL 2YMXL 4PJEB 3FRUB 2DDQL 1XIWB 3V0VB 4ONHB 5I1KL 3L3HB 5EIQA 1UM5L 5DZOA 3CJJA 2WWMC 5DS8A 3X13B 5EZLA 4KFZC 3LKQA 3G5VA 2X41A 4XPBH 1MCDA 3EYQC 3FO1A 1U8NB 3MRPA 1TCMA 1B4JL 1RUPH 5LXGL 1X4ZA 3O9WC 4HXBL 4G6MH 4XWGH 4Z7VE 4LSUH 1NCDL 3GGWA 3VDBA 1HHIA 3KPMB 1HZHL 1CDUA 5CJBA 3K4ZA 1QLFB 3G5YB 4J12A 5DVOA 4YHYB 4KQ3H 3NH7H 2CLRA 4Y16C 1NAKL 5BS0D 4J6RL 4JVPA 2YXMA 4YAQB 4CW1B 2KKQA 4PRIB 1DLHB 1CXHA 5T1KD 2X40A 2PR4H 4FRWA 3GBML 3CUPA 1X5ZA 1XGRB 2ESVB 2WLZA 5KVGL 4EN3C 1IAMA 3WKMH 1RZIB 5HHPA 2F9BT 5H94A 5F8RC 1SEQL 1JCKA 4K7PY 4RDQG 5J13B 5JHDA 2FJGB 1IC5H 1XF1A 3RWEA 5HHNB 5C0EB 1PYWB 5K9JH 1EHNA 1D9KC 5MERA 4HS8H 5C0JB 4BQBA 4HD9A 2B4CH 4YBHA 5E9DE 3IFLL 2P45B 3AB0C 1HIMH 5FYJE 4X6DB 4M9OA 1LE9A 4BZ1L 1ZS8A 4GAGH 1QBLL 1RAMA 3NABH 3QULB 2W65A 5F1NB 2J12B 4E41B 3ES6A 3T3MF 3UO1H 1L0XA 2ILLA 1RUAL 4FQQA 2Z31A 4FOMA 2EIZA 5E2UH 4AZ8A 1VACB 1C5CH 4XPFH 3F7YA 2HN7A 4OZIE 1OP5K 5I71B 5C08A 3PQYA 4HH8A 1P4LA 2WWKT 2J6EL 2BSED 2J4WL 4YPGB 5C0RH 3GJFH 2WIMA 4P2OD 3CMOH 3QISA 2FIRT 1RK1B 1YEKH 4JY5L 1F00I 1T5XA 5ABDE 4QRSB 4XCCL 4G8GD 1ITBB 1TITA 3VFTA 1I8MA 4LCUB 5TFSL 3QHFL 4RNRB 2A77L 3W9DB 5HPMA 2MKLC 3QUZA 4V1DA 3THML 3MUY1 3PWPA 1U3HD 5JZ7C 3PGFH 4S1QH 3H2WA 1ZLSH 1FDLH 1A4JA 2C1OB 2HH0H 2XXCB 1MSPA 1GAFH 5GZOD 1MHHB 4ODBD 1XF3A 4LGPB 1YJDH 1MFAL 1AXTH 1RZJC 3D69B 3C5ZD 3DPBA 1DEDA 5CGYD 5EZOL 1FP5A 5HY9A 2C26A 4HEPG 3IXAA 4PRBA 5BQ7B 5HYJA 4M8QB 5D9SB 1ZV5A 2XXMB 3TJHC 4KVCH 4IIQA 3ROLA 5BCAA 2FBOJ 5KS9A 4Z7QE 3QHZH 4QT5B 5BO1L 1PQZB 2AS5M 4X0KB 1P2CB 3IDJA 4TUKH 2ZWLT 1JYWA 4LPVA 3ARUA 4OD1H 5SWQA 4KK5C 4BA8A 5E99L 4O4YL 4MAYC 5ADPH 4HCRH 3V6OE 3QG6A 4R96B 2AJZB 4XBPA 5DC4B 1H3GA 1OQXA 3P0YH 3NIDF 3VXSA 3U9PL 3L7FA 2A6KB 4P59L 3E6HA 3PWJB 1J8HE 1T1ZA 1N5YL 1Q1JH 4LU5L 5TE7H 4JZJC 4R4FH 5IV2B 1NMAH 4JKWA 5FECA 3BEWB 3RWIB 1YN7A 3IFPA 3D39A 1GHFL 1M7DA 1IM3A 4PV9B 4J3VA 3BKCH 1A7BA 5GS1C 2IAMA 3QI9B 3GSVB 5JPMB 2CK2A 5CZVL 2DMCA 4HH9A 4UINL 2Y25A 3VFVB 1RHHB 4PGEB 5C0IA 3TBVA 2F74B 1FBIH 2AJSH 4HK0B 2CKBA 4YHOH 5BS0B 2FSEA 4HWBL 3RVVC 3N50A 2DM2A 3FB8A 1L7IL 4GAYB 4CJ1A 3U7YL 2VNCA 3U1SL 2YPVH 1IC1A 4NN6B 5DRNB 1OVZA 3EW3B 2W0LA 2P5WB 4S0TD 1WWCA 4HC1H 5LCVL 1KB5L 5E6YA 4PREB 1QFOA 4PJCE 1KCUL 5CJXC 2VH5L 4H0IA 3B5HA 1FNEB 3HG1B 1IC4H 4K94L 1LEGB 2VZ1A 4ZO8A 4DZBA 5L88L 2QADD 3MACH 3OKNB 1M6OA 3PUCA 2NNAB 4RMRA 4GKZA 3O2VL 5IVXA 4OBRA 2AGJH 4NSKB 4WFED 3LN4B 1J12A 2XI9A 2X4SA 1EMTH 4BH8B 4HBQA 1KPUB 2Q86A 4EBQL 4OCYL 3H3PH 3U4BH 1I8KA 5ITBL 4KKNA 3O0RH 1RURL 1BLNA 1CFVL 2OTWB 3VD3A 4K8RC 4RFOL 4ODSL 2VXTH 5E56A 4A2LA 1W0VA 2VDPL 4LEOA 3U7WL 3ROOB 2EDTA 1OCWH 5GS2H 1KCVH 3TO4B 3VWJB 12E8L 3KXFD 1AI1L 1BFVH 4G8GB 4U1GC 3STLB 4JM2F 5FO9A 2FO1A 1S9WA 5F96H 1F4HA 3C9NB 3VW3H 2QL1A 4Z76A 1CD1A 1BBDH 1CLZH 1Z5LB 4KTDH 5FHAH 3FQXB 1XF2B 4BFIB 3HC3L 3F12B 3QNXB 4YXKL 3ULUH 1U3HB 4GG8B 2K1MA 3BJ91 4XP5H 3LQAH 1OSZB 1TZGL 3U48A 2PYFB 4HT1H 4HS3A 3EYSL 4M7LT 3LHPL 5T1MB 1FO0L 4P57A 4I1NB 3VXUA 4MNQA 3MOBH 3DUHA 4HGKC 1B2WH 4Y1AA 3BH8A 3F8UB 5BVPL 3R1GH 4GW5A 3R0NA 1MVUA 3DMMA 3P77A 5AAMA 2DQCH 5IW1A 5CWSB 3WEXB 2F5AL 3PHSA 4FP8H 1F90L 3HPLA 5JOPE 4HUVB 3BD3A 4YFEA 2QHRL 4UQ3B 4LDEB 3ABZA 4OI7A 1N0XH 2Q8BH 5CJOL 3IDIB 2GUOA 3GK8L 4K23L 5KSBF 1KIQA 3L3IB 3WJLC 2BK8A 2HP4A 4KQ4H 1G9MC 2SEBB 1T20B 1JHTA 4LVNB 2IH1B 1F6LL 1ZXQA 2RGSA 5HHXH 2X1QA 3TYGH 3RVWC 3U0PB 2GSGB 4XMKL 5I66A 4Z78B 4ZFOA 3GRWL 4M3JA 4RFEB 4LVHB 2HJLA 3BI9X 3CC5B 3KYKL 3EYUL 4YLQT 2FL5B 3PDOB 5JIKA 3BP5A 4G6KL 5L7XL 3PDGA 3RGVB 4YHMH 3AMLA 3A6BH 1W72B 3U46A 3S9DB 1XF4B 4JFPA 2CRZA 4XHJC 2KQMA 3E8UL 2NY5C 5DVNA 3ZE2F 1UH4A 1WJ3A 3IDNB 3SPVA 1K85A 2VDMH 1RPQA 3ARGD 5L2KA 2D9QB 5I1AA 3OWEA 1LWRA 1QSED 1R3HB 4PP1D 4IRJA 3RX5A 4HW6A 4OZHB 4G9FD 1G84A 1WK0A 4HJ0C 4JRXA 5CFHA 4GRMB 1HXYB 3WLWC 3T65A 1H8NA 3RNQB 4KU1A 1HNGA 5JOEA 4JLRB 1N0LA 1OWWA 2VLRD 4F7EB 3NA4A 1A6AB 5JPNA 4M5YL 5EC1A 4C83B 3MTRA 3QXWA 4POZD 1LO2H 4DN3L 4RQQA 4I18C 5C6WH 4U2ZA 4CL7A 1F3DH 4NO2A 3KPTA 3ZT7A 2QADB 3VD7A 3H3BC 2AABH 3RIFF 3O3DB 3ZE0F 4H8WH 3EYVB 1A7OH 3Q5OA 2FIKB 1X4YA 4FTVB 3B9KB 5HDQH 4ERSL 1DZBA 3G6DL 3V4PH 3ARBC 3CZFB 3A6CH 4Z7WA 5K9QG 1GC1L 3GMQA 1A6TA 1YPZE 3LRGA 4P0DA 4X9HA 3V5DA 5TF1L 5EBWA 5D2LB 4PV8B 3TLRA 5CGTA 4ENED 5I1GL 1FFNA 2WIIA 3ZKND 5FV1L 2ID5A 1UACH 3SDDA 3VWKA 1CE1H 4J3UA 2I27N 4U0RC 4XP6H 4RMUA 3SGEH 1SYSA 3QCVL 5FCUH 1W8OA 2CDFA 5ETUB 3QFJB 3LKRA 1AO7B 3GSUA 3T0DA 2DKMA 4FXKB 3SDCD 2FJFB 3CPLA 4XPHL 3L3JA 3E6FA 4OLWL 3RA7L 4DVRH 1K8IB 1EHLH 3VH8B 1CBVH 4IJ3B 1XCQB 2AJXH 1L4IA 2IC2A 2H41A 2JELH 1HHHB 3MRQA 3S98A 4YQXH 4X6CF 2DD8L 1JPSH 2GAZB 2CO7B 4KUCD 4Z7NE 3QPXL 4RFNB 4DOHE 4PUBL 1QRND 4NQDD 3VE0B 1RZKL 4OM1H 3IFNL 4LPCA 5TDNB 2APXA 1WIPA 4ZUWA 1FLTX 4DGVL 3MFFB 2DMKA 4JFHD 4XTRD 3LRSB 4DKAA 4P4KD 4M4RA 4BSJA 2YD1A 4NC1E 1XZ0A 2CIIA 2IG2H 5IEHB 4N0YH 1OPGH 2J8UB 3WUWG 1GOFA 5T1DL 3RAJH 5JTWA 3I75B 4PYGA 1YQ2A 3VXMD 3DX6A 1CE6B 25C8L 2PKDA 1IFHL 5JNYB 1BZ7B 1O5DT 3G5XB 4QTHA 3UYOD 4DEPB 4YK4B 1LP9E 1J9CT 3UPAA 3I6KB 3KPLB 4KVNL 2JB5H 3UBXB 4UIMB 2CH8A 3OBAA 5B3NA 2ZG3A 4MDJA 3DVGA 3NCYS 4XMPL 1AGEA 2P46B 1A1NB 1MFEL 3TJEH 1MRCH 1E6JL 4XPAL 1LK3L 5DURB 5BMFL 1U2CA 1HE7A 4WCYH 1CDGA 1HSAB 4JM4H 3DX9A 2HLAB 4OKDA 1WC7A 2MQ0A 3H9SD 3H3KA 4GBXB 3KPSA 1ORQA 1CWVA 2R4RL 1K8DB 3PIQA 4Y5VC 1RIVL 5CLWA 4S1DD 3ZDXE 1IAIL 1FZOA 2LU3A 1IZJA 2P5EA 2F5BH 4H20L 2WUCH 2ADJA 4KZEH 4G9FB 4KGLA 4ZNCD 3EOTL 5SWZB 5E94B 4DKEH 4NQCD 1N2RA 4OAWA 1ZANL 5I30H 5EDXA 5F1KC 2VLRB 1MAMH 2JE8A 3F58H 4NZRH 3FB6A 3OL2A 4G42B 4KKCD 5JW4Q 2F54A 5IHZA 3ESVF 4WEBL 1MCPL 2R1YB 2XY2A 3OB8A 5I17B 2AKRA 3L5WB 4WFEE 5LBSL 4A6YB 2HRPL 1WVZA 2PW1B 4JFEB 4UNVA 5D6CB 1JWUB 3CU7A 1QSZA 4O51B 2NZ9D 5B39B 4C54A 1EEZB 4JFZL 5FO7A 2R0KL 1NLDH 2BOCA 1FSKB 2B8OT 4JO2L 5FFLA 4XI5C 5JQ6H 4OZ4B 4U1SA 4IRZH 1DJSA 2P8LA 4P4RA 3PV6B 3QIUC 3S8WA 1OAZL 3I50L 4XNUH 3WMSA 1EJOL 5DMKB 1EAPA 4JFYA 3KXFE 5HGGS 1FFQA 2NW2A 3TBTB 3MYJB 4OCSH 4TSCL 1QFWI 4QXTB 4JHWL 1V05A 4ZPVB 3D9AH 1RULL 5ENWB 4LKXA 2WW8A 3MRDA 1MNUH 2YRPA 1NMBH 1U42A 2BC4B 1YEJL 4JDZA 5HJ3B 3QIWB 1Y0LB 1UQSA 3LD8B 2MOVA 2BXZA 3ZHDA 4NFCA 2BFVL 2DLGA 1D5XB 2A73A 2KUTA 1S5HB 4TOYL 3PJSB 5JHDE 3D25A 2FH8A 5HGAA 5HYFA 1BFOA 5IB5A 4UDTB 2Z92B 5HGDA 3L1OL 4F2MB 3I3BA 1WFUA 5E5MB 1N7ML 2V6HA 3V6OC 5CJQH 5EUKA 1KCRH 1QRNB 4NQDB 4EI6B 4WV1A 3GHBH 2H9GA 4ODHL 4YUEL 1INEH 1CDBA 4X7TB 3AY4C 1CLYH 5E00B 3P0GB 4N9GB 5IBTL 3M17A 1U8QA 4JDVA 4LHUA 1CT8A 2AEIT 4DGYH 4NQED 1T4KB 1XCTA 5F9JA 1JJUA 2AQ2A 4XC3H 4YDIL 1I9JL 5C08E 3PGDA 1I8IB 4HIJA 2R2HA 1Q0XH 1CLOH 1UYWL 3UC0H 1QEWA 1YDPA 3VXMB 4G6AC 3HUJB 1JNLH 4YHYC 1X7QA 1Q0YL 3MLPA 1I3UA 4NGHH 4RWYH 4JFFA 1G9EA 3DI2B 2Z35B 2DJUA 2LE9A 1ZTXH 3A6OA 1S7WA 5D5MB 3MRKA 1S7TA 3VFOA 4W4OA 4ODWA 2E6QA 5CP7A 2VDQH 5J13C 4P9ML 5ICXB 1MLCA 3O6FA 3TA3B 4JG0L 2X1PA 3FCTA 4PTTB 4EEEA 4OI9A 5INCA 1URLA 1QSEE 1MHPL 3AS0A 1PEWA 2WBJA 4M6OH 4YIQA 3DUSB 4NRZB 1T5WA 2BNQD 3ALWA 3SGKA 1OTUD 3LIZH 4IOFD 4FG6D 1ETZA 3SDAD 1IGIH 1IGYA 4Q9CA 2YK1L 1LO5B 1GZQA 2KZWA 1P84J 4HUWA 3O3BA 2VXUL 5DJCA 2AVGA 3IDGB 4WWKD 5K9OB 3VRIB 1JGUH 1HQRB 2EE6A 1P7QD 4K2UH 2XWJB 1TQBC 4JPKL 3OKLA 4RAUA 1FZKB 2ATPB 2BRRH 3WFCH 4LSSL 5EWIL 1TTFA 5JW4N 4G80B 2W9DL 4WI3A 4NO3A 4NJAL 2DBJA 2NY1D 1S9YA 2EYSB 1IM9D 4KV5F 5TQ0L 4H1LH 1I4FB 1KIUA 4WW2B 2GJJA 5HGBB 3MLWL 3CVIL 4Z7UA 1JPTH 4HWEH 2VWEE 3GMPA 1NFDB 5I8OL 3LN5B 2OJZL 1A1MA 3D0LA 5C86A 1QA9B 1DBJH 2R0WH 4MCYB 1KPVA 4LEXH 3GMLA 3ARFB 1HHGB 5JORA 1IKNA 4H26A 2P24A 3WXVL 3QDAA 4L5FH 1I3RA 3QDMA 4JPIB 3QQ9C 2VSCA 2BSTA 2ZOKA 2WMPA 1HILA 3L3DA 4N90D 3WNKA 1K4DA 4JO4H 3QEQB 3X3GH 1TZHA 3B8SA 4WI6A 1CFQA 4FABL 3TBSA 4BUGA 3V95A 3L7EB 4KHXL 1OP9A 5IFHH 3VCLB 4Q0XH 4JFHE 1M7XA 1UKSA 3RDTD 2DQIL 3FMGH 1NEZG 4BFEA 4XNQB 5C0AB 1D6EA 3KJ6L 2JJWA 4QHNB 5DUBB 2CKBH 4LASH 1N4XL 4X7EC 3OG6B 2KL6A 3DBXA 5FV2A 1F4WL 1NBVH 1TNNA 3HCVB 2HFGL 4YHIA 1JGEA 2FGWL 1KFAH 1PY9A 2MJWA 2A6JB 4X8JB 1MCKA 3O11B 1HSBA 4DQOL 2GSIB 4H88L 1ZHKA 5HHQA 3HZVB 2MHAA 4ZD3H 1BD2D 5BRZA 1B9ZA 4JDTL 1XGPB 1PKQE 1TJIH 2Z8VC 1CG9B 1MLBB 5J8OA 3H9SE 1AIFA 5LQBH 4PP2B 3HC4L 4M1CD 4LLMB 3TBWA 4ZUTB 1DP0A 1XR8B 3RTQD 3T09A 3C09C 4DKFL 3GKZA 2Z93B 1VFAB 1KACB 3VXUE 4OCRH 1NGWB 2JB6A 3UPCA 4Y1AE 3ZDYF 1V3MA 5CLTA 3H8NA 4NQCE 1G7JB 4P46A 3S36H 2VRAA 1YC7A 3CX5K 3LVEA 3RHWK 4Y8AA 5DHXB 3STZA 4HWUA 4YHNA 2BNQB 3QUXD 4EUPH 2YC1A 3UTZA 2QLVB 1YNKL 2J6EA 3SDAB 4CDGC 4I0CC 2FHBA 2V9RA 2D31B 2R1WB 5EBLA 3OKMA 3HE6D 5FYKH 3TZVA 3FQNA 1KJ3L 4NUGH 2V17H 4LL9A 3RUGB 3TN0D 4CRPA 3KPRA 3NGBB 5IGXH 4P2OC 4QXWA 1TVHA 1PBYA 3OX8B 4MLSA 3VWJC 3L9RB 4JQXA 5EO9A 1OSPL 4ZTOL 4N8CL 4ZDHB 1MF2H 3WIFB 3IS1X 4KTEH 5IVOA 4TVPH 2ARWA 5GRVL 2H32A 1U92A 1B0WA 5HBBA 5DJ0B 2NY1B 4KUZL 3MOAH 2HRLA 4FFYL 1YEGL 3P0VL 5DGQA 1FL5A 1U3HC 3MV8B 4HQQH 2YPLD 1JTTA 2Y36L 2DQGL 4NP4L 5GZOC 1G9NC 1OAXL 3IF1A 1I85C 1GGIL 4JM2A 2VZUA 3TWCL 2JCCA 3C5ZC 3MCKB 1C16A 1HEZB 1AXSB 1K5NB 1MCWW 2Y72A 3I2CL 4XAWL 5CGYC 3GMOA 1MRDL 1RI8A 3I6GB 4B5EA 1BZ9B 4NO5B 5EO0B 3GJFB 4W6XB 4KDTC 3RWJA 4H0HB 2WBJD 3U4EB 4XAKD 1OM3L 2VXQL 4JRXE 1NGXB 3BP4B 1QYGL 1U95B 4AIZB 2C1PB 3C08L 5F9DC 1ZGLB 3KDMA 1WIOA 2ZUUA 4NO0B 1R3IL 1MIMH 3WJJC 3QIBA 1LEKB 2PO6D 2OTUB 2PCPA 1TMCB 4HJGB 3L5JA 3GBNL 1J8KA 4ZFGL 2XRAH 3X12B 3RDTB 2CO6B 3CDGA 1N8ZB 1Z3GH 3GFUA 3VGEA 3B2VL 4LVHC 3EO0A 2OR9H 3BDXA 1DQML 3QO1A 4NQEE 5GXBB 1RZJL 2C3HA 4H1LG 4PJGF 4L4TD 4M6ML 5FB8A 3BZ4B 2ZZUT 5KSBA 4XNMB 1AKJA 5C8JB 4HWBA 1YA5A 3LKSB 3K46A 4N0FB 4G7VH 3L3KA 2VISB 4U3HA 4GMSH 4P23D 4UUJA 1QLEH 3JXAA 3R06A 4JY6A 1T83C 3ELAT 5CBAB 2H1PH 3D85B 4FQJL 5IESL 2NY0D 3WN5B 4E42A 4MJIA 4WUUB 4F3FA 3AS2A 1KB5A 1F6AB 2EXWD 4O00A 4MD0B 3V5HB 2BVQB 4AM0B 5E8DH 5T3ZE 1BD2B 4HF5L 2F15A 2ADGB 4XRCB 5T5FL 1RUQL 3VDCA 3WD5L 5E8NA 1A1OA 5HHMD 4R7DA 4RMSA 4F57L 1DCLA 5CP3H 5BVJA 1QQDB 4I9WE 8FABA 4HPYL 1ULVA 3IKKA 2QADC 1TVDA 4FQLL 1ZWIB 3CVHL 5DQ9A 3OKEB 5GRUH 1KJMB 3JV4A 1OW0C 2DBLH 3PWVB 4MNHB 4QCIB 3V52L 3HZMB 5E70A 5EZIL 4PJ9A 3HE6B 5IKCA 3WFEH 1NMCC 2OMBA 3DJ9A 3SO5A 4DN4H 1MFBL 4LPWA 2NTFB 4OFKA 4XXCA 3TN0B 4HPOH 4MNGA 4ZOBA 3QXAA 5D1QD 4FZ8H 1T0NA 5A2JH 2YBRB 2ADFH 3H7BB 1X44A 3CDFA 5FUZH 3MA9H 1D5ZB 1A3RH 3D3VB 2IGFH 1NFIA 3INUL 5CEXA 2NQCA 3EO1B 4Z95H 4HAFA 2W92A 3JUYA 2RJMA 3MLXH 5ESAB 2W9EH 1WFNA 4G7YH 1LE5A 1BVKA 4YHZH 4PGBA 1CGSH 1U6AH 1H3XA 4U7KA 4APQD 4RISL 5DDHB 4UB0H 2HJKA 2D7NA 1ZHLA 3MNWA 4IJ3C 4U6HB 3EDJA 3QNYB 1TZIA 3FQUB 1F6FB 1B0RB 1WEJH 2C4FU 1QFPA 3EZJB 5C07B 4Y4KD 4HS6B 3KPSE 2ZSVB 4ZAKA 3BE1H 4K8RL 5EPMB 2NYYD 4RFNC 3O2WL 4KI5D 2P5EE 3NA9H 1WBYA 3VMPA 3CFKB 4TN9A 3N9GL 5ICZA 5H2BB 2C9AA 2EO1A 3DHMA 3G5ZA 3BH9A 3WUWB 4OLVH 1JV5B 5TPWL 2PF6A 1DL7H 5D93C 3B9VA 5CINL 2NY4D 4QHLA 4MX7B 5IUSA 1DQDH 2DIJA 3GRWA 3OPZL 4PTUB 1HYSD 4KY1H 1V7NL 1FPTL 2Q7YB 1FORL 3IDXH 5MEQA 4WDIA 3MRBA 1KPRA 1Z9SA 1R5VB 1OGAA 1DN0B 5F3HA 3MYZA 1ZVSB 5J6HA 3ARED 3G6JF 4F7TA 2F19H 4JN1H 3Q5YA 3ARDD 5I1JL 1KT2B 1I7UB 3WNNA 2VZ3A 4P23B 5SWSD 4XVUD 4X4YB 5ESVA 5INDB 3CDCA 3LEVH 4GBXC 4GO6B 1MPAL 1P1ZA 3WO3B 43C9B 3ARGC 4NYLA 3TH2T 2CUHA 5HI5D 4CVZB 4E5XB 4XMLL 5E6ID 4LSTL 2EKSA 1KEGH 4PP1C 4FFWD 5TDOA 5TQ2L 2J1KA 4K55A 2CRYA 1G9ML 3QEGL 3SBWA 4OIBA 2NY7H 3VFGL 4LLQB 1VPOL 4TTDD 5C70A 4J3OC 3WSQH 5A3ID 1VFOA 1EXUA 5DTFB 4P5TA 2YR3A 5C2BL 4POZC 3C5SB 5IJVB 5C0CD 4OUOA 2APWA 3VGFA 1OLZA 3QCTL 2ZCKH 2D9CA 5E24E 3TFKD 1NC4D 3VFUA 2IWGA 2YEZA 2R2EA 2WP3O 5I1HL 4NJ9H 3NTCL 5EU5B 3BJLA 4YHLL 3PDDA 2NY5L 1WFOA 3SKMB 5JR1H 4DGIH 2HT2D 4XC1L 5D7IA 2AEQL 2GTZB 5C0FA 1EO8L 3LSOA 3TIEA 1AQKL 3TCXA 5KJRL 1A6VL 1WCBB 1FSKC 4ENEC 3M8OL 1C5DB 3O3EA 4GRWH 4ONFH 4KGJA 5ESQA 5ISZB 1QFWH 3ZKNC 1U91A 3GMNB 4YDKH 1L7TH 1H3VA 3B5GA 3ULSB 3PWUA 5ID0A 4DW2L 1VHPA 3KPNA 2A2QT 3KAAA 3IFOB 3CGTA 1NLBH 1QFUL 4GSDL 2OJEA 5F8QC 4OV5A 2VN4A 2AJVL 3BGFC 5DRZB 1UXSA 5FYKU 5I16B 3V0WH 4JFFE 3K4AA 5I8EB 4X98B 3SDCC 4GS7C 2YPLE 1FIEA 4BFGA 2DTMH 3LQMA 2V7NA 4PJFF 4R9HA 4JZNA 5ADOH 4RGNB 1QKZL 1T0MA 1A7QL 2UUDH 5BZWB 1YECH 2Q6WB 5CILH 1OP3H 3AXLB 4Z8FH 1LO4L 4ZTPL 1QFHA 2EDWA 5L9DH 2EDYA 3OKOA 5D6DA 4XAKE 3STBA 3DV6A 3DI3B 4RA3A 4NHUA 4HIEB 1R3KB 5I9QB 3DXAA 1ZLUK 1YY9D 2E8YA 1T3FB 3MLVL 4XTRC 2XZAL 4P4KC 5IVNA 3AROA 3VRLE 1SY6L 3GKWL 3W0WD 4NQVB 3OKKB 4D9QD 1YNLL 2HVJA 4GRLB 1OTSD 1WWBX 2EC9U 4PJ9D 2MQ3A 3BRDA 1C1EL 4OSUL 1GPOH 3T3ME 4C56B 1OAQL 4NPYB 4LSRL 4U0QB 1CD8A 4M62H 3WS3A 1U2HA 4L4TE 3MV9B 2J2ZA 3L5XH 6FABL 5I0DA 3BQUA 4QHUA 4N0UA 5DXWA 4J8RB 4WO4A 4LLWA 4HMDA 4XCNB 5I73B 3ARDB 1A6WL 4KXZH 1I1AB 3KNBB 3OHXA 4GLRI 2OTPA 5DF0A 3U0TA 3Q3GB 3GSWB 2OX5A 5SWSB 1IGJA 3VFMB 4AENA 2Q76B 3MRIB 1FL6B 1Y6KR 3Q6GL 3V4UH 1FV1A 1TDQA 5JXAL 5KTEH 3V9FA 3C2AL 1SJEA 4QKXB 4IMLA 2XTJB 2ITDA 5D2NE 1JGVL 2FGZA 4YNYA 3U2SB 1DFBH 4YXLL 1UCBH 2C7UA 1G6RA 5CSZB 1J1OL 1BIIB 1KLFA 5HHME 3L6FB 4OD3H 1U41A 3BVNA 4KKCC 3O4LD 1NGQL 3MC0A 3QDME 1MUJA 4KRPD 4MCZA 4LQFH 2AV1A 4RX4D 1DN2A 1NC4B 1S9XB 1ZEAL 3MXVH 3O6KL 5ALBH 4NN7B 5D7SL 1NSNL 5EA0H 3PE9A 4PJAE 4GXVH 5CBEB 4WY7L 4XNXL 2NZ9C 2I5YH 2AK4D 2MQCA 5IQ7H 1Q9KA 3MJ7B 5CHNB 4LDOB 2KZ1B 4OI8A 5LGJA 2JLLA 4HBCH 2VZSA 1J0JA 1AD0A 2X4PB 3NIDE 4UU9B 4EKXA 4P2QA 1MCIA 2YSSB 2HMID 3TT1L 1Y18B 1ZA3A 2H8PA 4RGOL 2GJ6B 3VG0H 4XGZA 3SY0B 4U1MA 2Z8RA 4NQSA 1ORSA 3JWDC 4B41A 5I1KH 1IEBB 4PJHB 2PXYD 1MJ8L 4YZFF 1ZK9A 4AL8L 2J7LA 1HQ4A 2UYLA 4ELME 4PFEA 2BHZA 4U6XA 2NY2D 4R8WH 3TNMA 3H6JA 4YXHH 1Q94B 4ODUB 4QRUB 4ZXBA 2FO4A 4MXWH 4PG2C 5K9KA 1B4JH 5JIPA 1UH3A 4HXBH 1G6VK 3D2UA 3REWA 1NCDH 2HKHL 5J11B 2GK0A 1NEZB 1TENA 2EDOA 3HLAA 1BQLH 5LGKA 5EBMA 4AG4L 5E8OA 3GBMH 5ANMA 4F58L 5KVGH 3Q1SL 1ADQL 3LEXB 3OSKA 3TVMD 3GUTB 5BW7C 3W0WB 1SEQH 3U9UB 1V3KA 1TVBB 3P30L 4JN2B 1FN4B 1XGTA 1C7TA 4LRIA 5B3JF 3N85L 3IFLH 1JNHA 2VDNH 4RSVA 2ITCA 1VEMA 4BZ1H 5DS8B 5SV4A 3BN3B 4GW1A 1R6VA 1FNSL 4YPJA 5IB3A 1NCCH 1FCGA 4QF1A 3LKQB 3NFSL 3G5VB 2UY7A 4RGMC 3DUUA 3FO1B 4F80A 5ID1A 1IBGL 3O6ML 4IRSD 4LHUG 4NM4L 1WZ1H 4NKIH 1NKOA 1HHIB 3WIHL 1D5BB 1DBMH 2J6EH 4NKDB 4MMXC 2IANA 4MD4A 5HYQA 1RMFH 2XACC 5I74B 3GMRA 3UJIL 3G6AA 4U1IA 3NCJH 2BNUA 3CUPB 4XCCH 3RVUD 4LARL 5FUOL 5FO8A 3DIFA 3LPGA 4GQPH 1OTUC 4HKJA 1BBJA 3KJ4B 4IOFC 2FYYB 4FG6C 2A77H 5H94B 3SDAC 1S9KC 1DVFD 2DQJL 5HVWA 2ZPKL 3RWEB 5C0CE 1Z2KA 2NX5D 4XVTH 3O4LB 4PJBB 1A21A 1NCNA 3P4NB 2CXKA 4CN1A 3QDJA 4HKXA 2AQ3A 1WFTA 2H32H 3KHOA 4WWKC 1LE9B 2EE9A 3SCMD 3RIFK 4AIOA 4DK3A 3TH4T 1MCLA 3BZEA 5F3BA 2DQDL 5T33H 2AK4B 4FQQB 2EIZB 4XNYH 5HD8D 1N3NA 4M6NL 5BO1H 3P9LA 1D5MA 3F7YB 2NY1C 2D03H 2APBA 4JRYD 5KSBE 3PQYB 1AHWA 4L3ED 2QKIB 3BQUD 4LVOB 4UNTA 4IHOA 2X2YA 2BXYA 4TSAL 3UPRB 5IMOB 4LF3A 1T5XB 5DGRA 1BVLA 5I6XB 5LGHL 1I8MB 3UTTD 5FYKD 5HPMB 1BQHB 1EIBA 1ES0A 1H3PL 2B20A 3QUZB 1N5YH 3KYAA 4V1DB 3PWPB 1TJHL 3LAFA 4ELKA 2BZDA 2RQ8A 3ZE2E 5FA3B 2G9HA 2X89A 4QY8A 1QR4A 4BSWA 2AEPL 1XF3B 5CIPA 1JN6B 5JXEA 3C8DA 2F53A 3MJ9L 5DJDA 1BMGA 5AYUL 4PRBB 3IXAB 4K3JH 5HYJB 2F8OA 4IIQB 3ROLB 1FGNL 4H1LB 5KS9B 2J8HA 3T0ED 3S3JA 3RDTC 4PJEF 3U7YH 5MEPA 32C2A 5EOCL 1YJDC 3GSQB 5DD3H 5SWQB 5MI0B 4X6EA 4D9QE 4TNWF 1WBZA 1UVQA 2YD7A 4LHJB 1KB5H 4UT6H 4EDWL 1GOGA 3CLEL 2VH5H 5D7KD 3ZE0E 4MNGE 1TPXC 3IYLW 3VXSB 3L7FB 5D7LD 4K94H 3MLSH 2BVPA 2WINA 1P69B 2AJUH 5K93A 4XPTL 2WV3A 1T1ZB 3WFBL 5AEAA 3VGAB 4CN6A 1HINL 4O58H 4PJGA 3O2VH 3K8KA 5C09A 5DJ6A 4P2CG 3F7RA 4UOJA 5EU4A 5FECB 4BQ8A 5F7KC 3IFPB 3D39B 1M7DB 3EDEA 1UWXH 1D5IH 4EBQH 2OK0H 4IOIB 2IAMB 4BFBD 4JQVC 1R5IB 4M1CC 4RFOH 3LRHA 4ODSH 2Z4QA 1UADC 5TF0A 3RTQC 3O9WA 5C0IB 1FVDA 4M02A 3TBVB 1T21B 1I9RH 2DM3A 4B7IA 2CKBB 2FHCA 3KG5A 1JMZA 4XB7A 1EVTC 4Y16A 1MJ7H 5F7DA 2I25N 1JUFA 4YDJA 2FX9H 1LDPH 2HT4D 5AUMA 1DQJB 4X83A 3QUXC 5FAAA 4KWUA 4TSBL 4X6DF 4FQCL 4G43A 4WRLA 1DEEB 5FOJA 2AJYH 4EN3A 1DVFB 2G2RA 3WBDA 2YN3A 4LIQL 4YXKH 3X14A 5DEFA 3I9GL 3HE6C 1BZQK 3MRFA 4X6CE 1D9KA 3TN0C 1TZGH 4DZBB 1BQUA 3BDYH 3LHPH 4Z7OF 4PRPD 3T0WA 3SCMB 3PWNA 3QZWA 3MLUH 3WL9A 5EFIA 5IVXB 4PLNC 4JFQA 5C0GA 3HMXH 2X4SB 3K4DA 4FQXD 1DTUA 2Q86B 1X5AA 2G5BB 1G7QA 1I8KB 1SJHB 5GS0L 3O8XD 1FVEB 4L3EB 3DSNA 2W60A 4AEHH 1HHKB 1W0VB 2CLVB 4EUPB 5E2WL 1NANI 4PJDB 4F9LC 5CJOH 2LVEA 3JSSA 4D0CA 1RJLA 3ARRA 3P4OA 1A9BA 1WUNT 2VAJA 4RZCA 4RA0C 4DCQB 4OM0L 5CEZL 4BSVA 3WFDL 1NPUA 2BMKA 2BCKA 5KOVC 1Q9LA 3MV01 4Z76B 4R7NA 5IHUL 1CD1B 1F11A 1QSFD 1VCAA 4XMKH 5HHVL 5TE4H 3GRWH 3VMNA 4CN4A 2ZKHH 4Z0BL 3EYUH 5A2KH 3C60D 4G6KH 4LQ1A 2GHWB 4M7JL 3MJ6A 4JB9L 1YEDA 2DYPA 2VJXA 4P57B 1C08B 1CGVA 4MNQB 4NRXB 4K3EH 1ZLWK 3TIDB 4WJ5B 5DT1L 4L4VA 2PO6C 1X5XA 4X7SL 4WUKL 4FMFA 1MJUL 1MVUB 2AXJA 3P77B 5IW1B 3CSGA 4LCYA 3T0EB 4XCEA 3DLQR 1HDMA 5HHOA 1G9NL 2Y07H 5GHWL 4HKBB 3RX8A 4X5XA 4XVJH 3U0WL 2R2BA 4AMKH 2VLKA 4WFFD 5IM7B 4KDWA 4PJIB 1YQVL 5C7XL 4P23C 4MAYA 4S10A 4MQXD 5I1DA 3JZ7A 5KSUA 1AD9A 1RZFL 2GQHA 2NY0C 2ENYA 3OF6A 4LFHD 2EXWC 4OV6F 3U36A 3ARTA 3BP5B 1RJZA 1U93A 3EJJX 4Z18A 3BGMA 3RWDA 1JFQH 4JZJA 3B43A 1RIHL 2X1OA 4JFPB 5D2NC 4D9RD 3HTLX 4TPRL 1VESA 4M7LH 3CVHA 2H6PA 4PRNA 4G8EA 5D72L 1IJ9A 4Y5XC 5GS1A 2Y06L 3BT2L 2AI0H 3IGAA 3MZGB 1QBAA 3SPVB 1YYML 5GGRB 2Z91A 5GGRY 3K8LA 5L2KB 4OTXL 4Z0XA 2E7HA 5DFVD 1W72L 3LMJL 4IRJB 5EU6A 4EOWH 3HI6H 5I1IH 4UAOB 5J1SC 4P5KA 2EIDA 1AQDB 3T65B 1F58H 4PG9B 2NX5E 3G9VA 4PJ7A 4G8IB 4ZO9A 1YNTA 5JPNB 1K6QL 3B3IA 5EC1B 4ETQA 3WXWL 1X5KA 5SX5H 1WTLA 3VGDA 4NZTL 1GGTA 5CJXA 4NO2B 4PRPB 4ALAL 3HFMH 1JP5A 3VD5A 1KIRB 4AH2B 3S37L 5D96C 2YD3A 3VXNB 1UB6A 1YPZF 1H5BB 3G9AB 1XEDA 3MA7A 4OFVA 4LNRB 2DL2A 1RJYA 4FQXB 1RZKH 4JRYE 2WP3T 4KK6D 4NHCL 5LAXB 4Z7WB 3IFNH 4OF7A 4NZDA 3GMQB 1A6TB 2YUVA 3MO1A 3V5DB 1JYNA 3F6LA 5EBWB 4H8WC 2IPUK 1GZPA 4BQCA 4NZJA 2WIIB 4PGCB 4APQC 3GNML 1JMXA 3KPQA 1YEHH 4KJPC 5FGSA 1KNOA 3SDDB 1UZ8B 5DLML 5FGCB 1QVOA 3VWKB 4JVUA 3V7AG 1BEYH 5I2IA 4F8TA 5I15L 5A16A 3FOLA 2D4DA 3K2UL 5DHVA 3UTTE 2ICCA 5JDSA 1SYSB 1Q72H 2PN5A 5T1DH 1CYGA 4C59B 2CDFB 5J06A 3LKRB 1I9EA 5D70H 2DIBA 1XGUA 5KVMC 2V5RA 2HFEB 1FRGH 1QSFB 2NYYC 3HN3A 5EZJA 5ITFA 5ICYA 4KI5C 1IFHH 3O2DL 4PJFA 5J89A 4KROD 1OAKH 3IJHA 3PNWB 3S35H 2PTTA 3E6FB 4J3XA 3MBED 2ZJSL 5I8KL 2VLLB 5FM4A 1BAFH 4PB9H 3QAZC 3W5NA 3GSRA 2VXVL 1UM4H 2NY4C 4R97B 1M71B 5GJTH 1W0YT 5F6HI 1YUHA 3S97C 1BGXH 1PX3A 1C12B 1ODAA 3OXSA 1HYSC 4NN5B 2X70A 3BZDA 3VFPA 5IQ9A 3UXFA 1RIVH 4HUUA 4PJXE 4KZDH 2FD6L 2ZG2A 4ZUWB 3MRHA 3O6LH 3QWRD 4H20H 5D4QA 5GISL 2X4NA 4HDIA 4GLRH 5AD0A 4X5WA 3EOTH 4ZUVA 4P5MB 3AREC 4ODVH 3TPUA 2EH8L 3PF2A 1BIHA 3MR9A 4P2RD 2VLJA 5IFAH 5GGSY 5D7KE 4K9EH 2M1KA 4BK4A 3ARDC 3FFCA 1I1AC 1XZ0B 2CIIB 2OXHA 3DARA 4XBGA 5D7LE 4DZ8B 1XH3A 4UTAH 1KTDA 5IMKA 4XVUC 2BNRD 3OJ2C 1MVFA 2OL3H 3GMMA 1G6RH 3GIVB 1MCPH 1QHPA 2X6MA 3WJLA 1JHKL 4ZS7H 5CCKH 3ZKMD 3ZSTA 5DMIH 1GOHA 5E5RB 4OB5L 5CKGA 5BV7H 5HI5C 2GEEA 5CZKA 2HRPH 2DQFA 2APTA 5E6IC 3TM6A 4YC2B 4FFWC 3UJJL 4EZMA 5HYEA 4MDJB 2H3NA 3DVGB 4GW4A 4JFZH 1FAIL 1V7MH 1AY1L 1XMWA 4JEGB 3VXRA 1LEIA 2X4RA 4TTDC 1J1PL 4OZHF 1OD9A 1H15A 1OAZH 1XF5B 5A3IC 4JFDA 3DX9B 3UTPD 1OY3B 4WHTB 1WC7B 5F7MC 5C0BD 1ORQB 2I07A 3P9MA 1V3JA 5AZ2H 3PHOA 3TESA 3TFKC 1FZOB 1EPFA 4FXLA 3QDGA 4TSCH 3D0VB 3U6RA 4NN7C 4XWOD 2ADJB 5B8CC 1YEFH 2R56H 3SQOL 3VFNB 5E2TH 1RZGB 2HT2C 5ANME 2AV7A 1NDMA 5A40E 3FB6B 5JW4M 1MCQA 1DSFH 3IU4L 1MI5D 2F54B 5IHZB 3J8F7 3IVKA 3UP1A 4TOYH 2X1XR 4O02L 1ZSDA 1DQQA 3KLDA 2OR8A 1BHGA 2UWEB 4U49A 2AKRB 5DQDH 1DQLL 4I18A 1C5BL 5D2LF 4ZQKA 5JDJA 3FO0L 1P9MC 4QXUL 4OLUL 5GGTH 1N7MH 2N1KA 4KKAD 1JGDB 3QNZA 3AS1A 2IBBA 2DMBA 4GG6A 4M1GL 4YDLC 1UM6L 5I8CA 2V2XA 3H9HA 5F9OH 3ARBA 2ADIB 2ZNXA 4XP1L 5ALCL 1TJGL 2P8LB 4P4RB 5GRJH 1JF5A 1S7RA 5JMRA 1NGPL 2CRMA 2P43B 3BN9D 1EAPB 4JFYB 5IB4A 2WK2A 3SOBL 3RBGA 3OAUL 1EH9A 4R4ND 2IANE 4EI5D 2I9TA 4POUB 4WI8A 5J11C 1LMKA 4GRWB 4JKPL 1CFSB 1FZJB 2JK5A 2XZQL 5JUEH 3TF7C 5FYLL 3ECBB 1PG7L 1SY6A 5L6YH 4CMHC 5L0QB 3CIQA 4LCWA 2AAVA 3RWHA 4LKCB 4HX1A 4I4WA 1YY9C 3MBEB 5JW3H 2ZCLH 1OF2A 1OB1A 2YS4A 4L4JA 1IT9L 2A1WH 1JK8B 3D25B 4ETYA 2RIKA 4MA8L 5HGAB 1BFOB 5IB5B 4FA8A 4Q9RH 2IH3A 1RIUL 3NACL 3CXDH 2BHUA 3NIFF 3BIKB 3FB7B 3KR3L 3HAEA 1OTSC 3ZDYE 3FHAA 3PABB 4GKNB 3GSXA 3BOVA 3WO4B 1C7SA 2I60L 3UROR 4NZUL 4BZ2H 1IE5A 2EC9T 1WZKA 1R24A 1U8OA 3MRJA 5DD0L 3AU1A 5EUKB 3TBYA 1K2DA 3IAGC 5AG9A 2H9GB 5DHYB 2W0FB 4X6BA 3DSFH 4UV4L 5CEYA 5ELIA 3FRPA 4WFFE 1EBAA 3M17B 1U8QB 1BM3L 4P2RB 4JDVB 4LHUB 1FJ1A 1CT8B 5F9JB 2LAAA 3NIGE 2YK1H 3FFDA 3HB3D 5IFJB 4ZUSA 2R2HB 3GI9L 2MCPH 3OJDB 3LZFH 2GI7A 1F4XH 3QO0A 3ZE1F 2VAAB 2YXFA 5IVZA 1QEWB 1YDPB 1RZ8A 4G3YL 2XN9A 4XP4H 5F7NC 4CMMA 1BX2A 2DWDB 1ROWA 2OXGA 5C0DA 4OF3A 4Z7VA 4HULB 4D9RE 4RBPK 1YMMD 1S7WB 3MXWL 4PRHD 4PJ8D 1S7TB 3VFOB 1FGVL 2R4SL 2J88L 3O3AA 5KZCD 4ODWB 2W9DH 4Y89A 4PY7A 2X44D 3RX7A 3FKUS 5CP7B 1UA6H 3HC0A 1MLCB 4HIIB 5J6GA 2HLFD 2Y7QB 3FQRA 2OI9B 1S5IL 3RZCD 4KRPC 5INCB 2R0LH 5EU7E 3RWGA 1MCEA 2F53E 4YIQB 4K3DL 1VFUA 3ULVH 3MJ8A 1UH2A 5DYOA 3QQ3B 4Y5VA 1DBBL 5J4MA 3RY5A 3DO7A 7CGTA 5E9DA 7FABH 2NW3B 2W07A 4JO1H 5GRVK 1ETZB 3EOAA 3FONB 5EOTA 4BKLA 2FATL 1MI5B 4R0LA 5L8KB 2R1XA 1TIUA 5DJCB 4LVOC 1D6VL 3ARVA 4NNYA 4UILL 4QWWD 1RU9L 3CXHK 2BJML 1JTPA 2QEJA 2HMIC 2WUBL 2XPGA 4RAUB 5ILTL 1KIPA 1DBAH 3MLTA 4PGZA 1KBGH 3AAZA 1T7VA 4FNLH 1IGFH 1SBSL 3CCHB 2YD8A 1SJXA 2PXYC 5CIPH 2DQIH 1X9QA 4W70A 2VDRL 1MHEA 5E1AA 3E2HB 2NY2C 1FNHA 4Q97A 2JIXA 5F6HJ 1QUNA 4U6VH 1ERNA 1XGQA 2B2XL 3QIUA 3MUJA 1MQKL 4U1KB 1F4WH 2H26A 3ZT5A 4RWHA 4Z7UB 2O5ZL 4U3CA 3OKDB 2UV3A 3GMPB 2LFGA 1N64H 3FB5A 4EI5B 3K81A 3SJVA 4TUOA 5CAYB 2FGWH 4KH2A 4WTZG 1ADQA 3C6LD 4L9DA 3D0LB 5DWUL 3WFHA 2XQBL 1P4IL 4JKLA 1KPVB 2YKLH 3GMLB 1WF5A 4JFXA 4M1DH 4H88H 2IPUG 3D18A 4OIIL 2XZZA 3N1FC 5JORB 4MSWA 1VGEH 1NCBH 2AK1L 5K9QI 4H26B 5MI0C 3TVMC 2BSTB 1CK0L 2QBWA 2ZOKB 2CGRH 4PYHA 3JWDL 1S7XA 2VQ1A 3S37X 5LVEA 1TZHB 4IDJH 2VXSH 3TBSB 3ZMRA 5KVDL 1GIGL 1QBMH 3ZL4L 5E8PA 3W39A 3V6OA 3FRUA 5IOPA 1T04A 3V0VA 3T0AA 4ONHA 3VGAC 1EDQA 4OGXH 4HHAA 1D6EB 1P53A 1ZGLM 3L3HA 2R23A 4JZOB 3NBNA 3O4OB 4LDLB 3RU8L 3X13A 3AY4A 2FNBA 4Z77A 1KCSL 2LVCA 4FN0A 5T1LA 2BNRE 4OGAD 4RMQA 3DBXB 5MEND 4L8CB 3S6CA 4IOSD 4IRSC 1JL8A 5D5MF 3RY6C 4BELD 1JGEB 1DBKL 1QOKA 4JGJA 1EFXD 3OJVC 4KHTL 3QCUL 1TQCC 3BPLB 4LCIL 1VGKB 4Y88A 3KPMA 3SKUD 2NXZD 4M43H 1HSBB 2NXYB 1NBYB 1QLFA 1ZHKB 5HHQB 1YMMB 3RVUC 4PRHB 4CW1A 4YAQA 2X4OA 1A7RH 3T4AA 5BRZB 1I3GL 1TTGA 1B0GA 2RBLA 4MJ5B 2OYPA 3HI5L 1DVFC 3UTPE 1RZIA 4KUZH 1AIFB 4LSPH 2Q8AL 5C0BE 1EEQA 5DA0B 3TBWB 4Y19D 1MJJA 4M03A 1JRHL 1PYWA 3WYRA 4B53A 3DV4A 2JB6B 3L3GB 1OAXH 5C0JA 3CFCH 3LKOB 4L4VE 4P46B 4X7FC 3SCMC 4KJQD 3TWCH 1CR9L 5D71H 4X6DA 2OZ4H 1MWAL 3TO2B 1MRDH 2YC1B 3KS0J 4XBEH 3UTZB 4LRNL 1OLLA 3QULA 5HHOE 4HG4J 4E41A 4OF0A 1NANH 2IPKA 1OM3H 3QEUB 4AQOA 4KMTL 3OKMB 4OGZA 4XPBL 3OR7A 4QOKD 4EJ1C 4WENB 5IJKC 3SDXE 1VACA 3TZVB 4XWGL 3ZT6A 3KPRB 1N26A 1EEYB 3C08H 4LSUL 5BZDA 1JHLH 1TVHB 4OCXL 3VXTA 2R29H 3LQZA 1KCKA 4YPGA 4N1CA 5F93C 5KG9A 4KQ3L 2HAZA 3NH7L 1QG3A 5F71A 4IEFB 5EO9B 5C9KA 2PR4L 4QRSA 4ZFGH 3G6JE 2H32B 2QQNH 2N7AA 1NFDF 1DANU 4RNRA 3MJ9A 5F70A 1FL5B 3NCFB 5EUOB 1IC5L 5K9JL 4HZLB 15C8H 1FIGL 4HS8L 4GMTH 1YEEL 2FZ3B 3IF1B 4YWGH 4MD5B 1NBZB 2B4CL 4P9HH 2C1OA 2JCCB 2GYSA 1HIML 1ZA6B 4OQTH 1MHHA 3HS0A 3GMOB 4GAGL 1AGDA 4YFLF 3DRTA 3UTSD 3FHQA 2NY6B 3VGGA 5I1CH 3T0EC 3EDKA 5BQ7A 4DJMA 4L8BA 3UZQA 3ZTNH 3TEUA 1RQ5A 5E2UL 4KC3B 4QT5A 1C5CL 4XPFL 4X0KA 3DVFA 1RUQH 3WD5H 4TQEH 1ZT1B 3KDMB 5J9PA 5C0RL 1GVIA 3QIBB 2V5YA 2QSVA 3M45A 1IAOB 4F57H 2PCPB 4NFDA 4TYUA 3BWAB 1TCRA 3SE9H 4UBDD 2D7TL 3EJYD 4PRAB 2O61A 4OZGB 2IFFH 3NPSB 4R2GB 4X4MA 1KENH 2E7CA 4L8SB 2PYED 3EO0B 3P73B 3OMZA 3QO1B 3BUYA 5I1EH 3REVA 2UZIH 5FB8B 4HFUL 4L9LB 1EJ6A 1AKJB 3UYRH 4N1EA 1RFDH 2QTEA 4PJ5D 1XGYL 5CMAA 5MENB 5IV2A 3PGFL 3L3KB 4I3GA 4S1QL 1FDLL 3QG7H 4JGUA 2CDGB 2G60H 3RWIA 4K07A 4M93B 4UUJB 3WS6C 3OAZH 2R9HD 3R06B 1MFBH 1OL0A 1EFXB 1PZ5B 1KELH 3JWNC 4GQ9H 1YJDL 1AXTL 5IT2H 4HIXH 4Y8DC 5DVKA 3WV0A 2NXZB 4MJIB 4PGEA 2EDLA 4F3FB 2Y5TA 1Z9LA 1KB5B 2R0ZH 1R5WA 5ERWA 5BS0A 2GITB 4KVCL 1G7LB 3WIIL 2HT4C 3NFNA 2XFXA 3NAAH 4I5BB 3INUH 2VZTA 5T1KA 4PJFE 3QHZL 4GAYA 3V5KB 1M4KA 4TUKL 4LBEB 4OD1L 2E3VA 4KPHL 1A1OB 5DRNA 4Y19B 4R7DB 3LDBB 1W0WA 4AY0A 5ADPL 3GI8H 2CSPA 2OP4H 5GRYA 3FN0H 5IK3A 5BVJB 2D4FA 3MV7D 3HNVH 1LO0H 3B9EA 1FNEA 3FT3A 5DQ9B 4X9FA 5GS3A 4LPYA 2YUXA 1H5BC 3GSNH 3RUGF 5FA4A 1QHOA 4KMLB 2NNAA 3MRNA 1WIUA 1Q1JL 3O2WH 4FQXC 5DK0A 3U30B 3RY4A 4R4FL 4NSKA 4K7FA 5DHVH 1KG0A 3TT3H 1F4YH 1IAKA 1XIWD 3N9GH 3O8XC 2D0GA 5IKCB 3QDHA 4QOKB 3BKCL 4XNZB 3MNVB 2QQKH 4G8FB 3UYPA 2CD0A 4L29A 3QXAB 4MA1C 1YPZA 3E3QC 1MFNA 1T0NB 2O5XH 5J7CC 4P2OA 4YHOL 1CGTA 1NFIB 4U05A 5CEXB 1FPTH 4MB5A 3Q5TA 1FORH 2ZUQC 3QZWG 4G8GA 1KN4H 1LE5B 1BVKB 2YPVL 3C9NA 1CDCA 1Z5LA 4OLYH 3C60C 2VERN 2HJKB 4HC1L 1OOAA 4PRID 1JNNH 3EHBD 1TZIB 3T0BA 1U3HA 5I1JH 3HZKB 2ESVD 5J12B 5F9WB 4H25A 4N8VA 4RMTA 4R97C 4MDIB 1OSZA 5KSAD 1I85A 4XH2A 2HVKB 3MMEB 3MACL 4WI9A 4YHPB 4ZAKB 5HVHB 3RIAK 3C5ZA 1H8OA 3VFRA 3UTSB 5D7JD 5HYIA 3QB7C 1H0DB 2XKUA 4U6TA 1FAKT 5DK2A 3BPNB 5ICZB 4KDTA 3HRPA 5CWSA 5TQ2H 3WEXA 4LSQH 4RAVA 1YEIL 4XVSH