1Y6MR

Crystal structure of epstein-barr virus il-10 complexed with the soluble il-10r1 chain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
204
Chain Sequence
b'TELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Viral interleukin-10 homolog
molecule tags Immune system
source organism Human herpesvirus 4
publication title Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain.
pubmed doi rcsb
total genus 34
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y6mR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y6mR01
2ZCKH 1OGAA 1J0ZA 1ES0A 3EYSH 4H1LB 1P4BH 3LH2H 1JIBA 1M7DA 3ARDA 4D9RE 2V5MA 2FZ3B 2DLIA 2J5LC 1P5VA 2G75A 2Q87A 3WFDL 5D5ME 1I3UA 4XXCA 4C56B 2VDLH 4U1SB 5JOPE 3RKDC 1EEYB 3L3JB 3RNKB 5T5NF 5CMAB 5C0CE 4UDTB 3QEHA 5TE4H 4R96B 2GUOA 3LQZA 3I85A 5DFVC 2PETA 4KJYA 1J0JA 1FCGA 2HLAB 2X4UA 1JPSL 1S9XA 2G60L 1R5WB 5GZNC 4P2RB 3DX9B 1PJ9A 3U4BL 2FL5A 3P4LA 2LQRA 2ZSWA 3FCTA 1ZHLA 1ZTXL 4OD2B 2AK4B 4XHJD 5D1XC 3VXME 5I1EL 5D7SH 5B4MD 1HDMA 1I7RB 1B4RA 5EA0H 4OM0H 3KDMB 5DDHA 4P59L 3Q3GA 4XCCH 2Y7QB 4K7PL 1Q1JL 3GSUA 5J56B 4CN4A 1XIWD 3HZMB 3NIDE 5TDPB 2G9HB 4KUZH 2EEDA 3DPBA 3O4LA 1A5FH 4XBEL 2ARJB 4IRZH 4G6AD 3CLFH 3VD5A 3O45B 5EU6B 3BAEL 5DA0B 1IILE 5KW9H 2A83B 4GOSA 3GMPA 4OZ4B 3GIVB 4FXKA 5DVKA 3D87B 5E8OA 1EDQA 4LLYA 1I9IH 1S8DB 2DM2A 1RZJH 4FQCL 4W6XB 4J8RB 4K55A 1JI1A 1T1YA 2V7NA 4JFQB 4PRBB 5JW4R 1YEEH 3MUZ1 1JHKH 1MCLA 4NN6C 3HG1D 5FHAH 3FB8A 1G7QB 3NACL 3HCVB 1IQDB 4AQOA 4JO4L 5KOVC 3KYOB 4JFDB 2VDKL 3H3BC 3V4VH 1P7KA 5C0BA 3GIZL 2DIBA 4M1DH 1OSZA 1LEGA 4HBQA 4ZOAA 5ALCL 3SGDI 1NBVL 1W72L 3DMMC 4KI1A 3WD5H 1F8TL 4YDJB 2E9BA 4P2OB 1XGUA 5DYOB 3ULVH 1ADQH 5EIIB 1IZKA 5C0GA 2I9TA 3WLBB 4QOKE 3PGCA 1ORSA 3Q6GH 1ED3A 2VB5A 1KJ2A 4HAGA 3HCVA 2F54E 1HSAB 4HMCA 3TBYA 3IS0X 3MPCA 4O58L 5F1KC 5DJXB 4Y5XC 2XZAL 2CO6B 4X6CF 1CXHA 3OHXA 3GNMH 4TPRH 2LVEA 1YY9D 1BFVH 3GBNH 4LVNB 4UQ3B 5E8OB 1KJVB 1Q94A 4BSVA 5MENA 3QEGH 4ZPTB 1ZLWK 1XH3A 1BVKA 4UOW1 2EYRA 5D93C 3D6GA 1JGLL 4FFVD 1IZJA 5FKPA 3UBXG 2PW2B 5CP3A 1BOGB 4XCEA 1UXWA 4U1NB 4UQ2B 3GSQB 3BH8B 1A3RH 1MPAL 2JJUA 2RGSA 5JHDE 4Z7VE 4LCWE 1CD1A 4QLRA 4XRCB 1KN2H 4ZD3L 1MFBL 4JFXA 2P8MA 3RI5K 1NCDH 3P30L 4QRPE 2FJGB 4RMRA 3M1BB 4U1IB 1NFDB 5K9QG 3NFPB 3IJSB 4PRPB 5FV1L 4I77H 5I8EA 1N2RB 5D1XB 5IMLB 1I1FA 2VXSL 3L6FA 1MREH 3U9PL 4WI3A 3SPVB 5F7WC 5HHNA 5AG8A 5KSBF 1JGEB 4LRIC 3WNPA 1SJXA 4HIIA 1A14H 4XWOD 3S35X 4GMSL 1T7YA 3P2TA 3N9GL 1WTGT 2P49B 4LVEA 3TBSB 1ZA6A 1J0YA 1R3HA 4NN5B 3T1FA 1SJEA 2Y4SA 2CIKA 4ZUVB 5CJ8A 3S98A 4N68A 1H0DB 2NW2A 1GC1C 1CLOL 1UFUA 5IFJB 3MFFB 3D25A 5DSCB 1F00I 3RTQD 5I1IL 3IDXH 5DS8A 2I9TB 4NT6B 2DJ4A 3LKPA 3PWLA 2DQJL 4FS0A 4YBLB 1T7VA 1O0VA 2Y6SD 1BD2B 1DLHB 2CH8A 5FDYA 1QKZL 2VABA 4LARH 4M6OL 3VXMD 2LAAA 4NBXB 5CUSH 5SX5H 2W59A 2VLRE 3GSWA 3SE8L 2JJTA 3DGGA 3QFDB 2VLME 3V5KA 4LLVB 1NUNB 2J88H 3EOTL 4XH2A 3SY0B 1YZZA 4MJ2A 4Q9BA 1MRFL 4LCCB 4PJIB 4RAHA 2ZUUA 1NLBH 2BJMH 4A6YA 1DTUA 5EPMA 2NCMA 3DMMB 2A74B 3WFHA 1BJ8A 3MO1B 5GRVL 5BMFH 1C08B 4R3SB 1RHFA 4FQHA 4X99B 1BZ7A 3IJYB 2VZ1A 2YD5A 1VEOA 1Y18A 2Z8SA 1BZ9B 5IW6A 4OCYH 1RI8A 5SWSD 2V7HB 4YFLI 4EIZC 3KPSA 4HK3J 1S9VB 1SEBA 1KYOK 3VMNA 1HIML 1Z9OA 3LKSA 5FYJU 3JV6A 1F90L 1A7NH 4K94C 1RU9L 5IW3A 2VR9A 3T0EC 4Z7UB 2NY6C 3MXVL 3VXUB 4NC0B 4BQ6A 3PDGA 4AL8H 3GSUB 3U2SB 5IHZB 4K71B 3EYFB 1HINL 4XP6L 3HZVB 4KUCF 3WJJA 3D9AH 4P3DA 3V7AE 3PDOB 2GYSA 2ORBH 3ARGA 2D2OA 1JRHL 3ZYJA 5DJDA 1PG7H 1K6QH 4Y4FD 3ARZA 1ZT1A 4LKXB 3WNKA 4P2RA 2CR6A 4KVNH 5EFIB 4LVOC 1ZTXH 1UH3A 2OR9H 1LO0H 2NY4C 3EO9H 2BOBB 1YN6B 2Q20A 1M71A 5B8CA 7FABH 3OJVC 1XR8A 4Y89A 4OUUA 4WUUB 4K8RD 2EYTB 1DSFH 5DJ0A 3X17A 4P5TB 5IVZB 3HAEH 4AQ1B 5JHDA 4F58L 5BV7C 1RV6X 4OLWL 2X4QB 1DEDA 2VR4A 1FC2D 5GGVL 5GRUH 5D7IA 3MLYH 1IC1A 3ARFB 5FB8A 1FH5L 4JFPB 3K8KA 4HWZB 2F5BL 4Z95H 3GGWA 4OAWB 1K8IA 2OTWA 2D0GA 3TJHD 3WYRA 1B4JL 3T77B 2BOCB 1RZGA 4H8WC 4TNVK 3Q5OA 5D71L 2DJSA 1KJ2L 4X6DF 3O41B 5LCVL 3C60D 1D5BB 2IC2A 3FT3B 1K6QL 3MSPA 1W0VA 3G5YA 1MCJA 2EYTA 4ONFH 2AABH 3KPQB 2WV3A 1LO3H 4OF8A 3EOAA 1U8KB 5EBMB 5B8CB 3S5LA 3GMLB 3UPRB 4JFZL 4GT7A 2VAAA 4NQXA 1VFAB 4AMKL 1RZFH 4F2MA 5ILTL 1UJTA 5J1AB 4X4MA 3TBVB 1K8DA 1BFOB 3QUKA 1VESA 3PV6A 5TQ2H 5E2VL 1ZWIA 1MCSA 3QUML 3L3KB 1B2WL 5BZWA 4U1HB 3MACH 5F7DA 1LP9A 4PJAF 1JWSB 3Q0HA 3NPZB 5D96C 5ALCH 3PWPA 3LEYH 3V4PH 1LGVA 3LZFH 3ELAT 4R26L 5JO5A 1EHLH 1UEYA 4KROB 4ORGA 2DOCA 4L9LA 3QJFA 3KJ4B 4RGNC 1F6LL 4XBPA 1P7HL 2BVPA 1OAXH 3WE6B 1P4IL 5FOJA 1J5OL 2X44D 3B3IB 1A6ZB 4KI5D 5FFLA 3O8XA 1QRND 3BW9A 3N06B 5FCSH 4F15C 4WU5B 1CGVA 1EJOH 2X41A 3EOTH 4UIKH 3ZE1E 1T7XA 2NY3D 1ERNA 3D85A 3CLEL 4FQ2H 3O6ML 3NABL 5LG1A 3RIAK 1RIVL 5ID1B 4N9GA 1GC1L 3T8XB 5DJYA 2AJ3B 3DSFH 3SCMA 1U36A 4LLDA 5D1QC 4GSDL 4Y4HC 1ZSDA 4Z7WE 4XPAH 4Q6IB 3NFNB 1UWGL 3FO9A 4KWUA 3OKMB 1FG2A 1KTDA 3QQNA 3HC0A 2HMIC 4MDIB 4I77L 3GKZA 2GJZB 3S5LG 3ARBD 1OP5K 2DTML 2FSEB 4GW5A 1HHIB 1QSEB 3CFBA 4JJ5B 5HHPB 4NJAH 5C08B 3FB6A 1GGYA 1UEMA 3RPIA 4DWHA 4PJ7A 2EC9U 3RUGE 4PJGE 2IALB 3U1SH 3KPNA 4NBZB 5SX5K 1IAIH 4BH8A 5F7MC 4U0RB 4WV1C 3E8UH 5F97E 2V2WA 5F6HI 2HT2C 4OLXL 3ROOA 4NKQB 4HIJB 4NWUL 3WXVL 1CT8B 4XP1H 5KSAC 4NRZB 1JF1B 2X09A 5D2NE 1S78C 1C5BH 2N7BA 1DE4B 3WCYA 3HMWL 3HE7B 4YX2L 2C3WA 1KXVC 1WWWX 5MEND 1BIIB 2W9EH 4Q6YA 4DGIH 1JVKA 4Z18A 5CEZE 4MAYB 5SWSA 1U0QA 5CKGA 4J4PD 5K9JL 5D2LF 4IRJD 4P5KA 1HOCA 5ABDE 3N85H 4Y5YB 3CUPA 1GVIA 4WHTA 2PNDA 1HXMA 3NZ8A 1G7PA 1MCQA 5J89A 3BP6B 4YNYB 5CBEB 5EO9B 3SCMD 3DUUA 5D5MF 5GXBB 1MHHB 3WEXB 1ITBB 3VWKD 5I1GL 2GAZB 3NH7H 3HPJB 1JNHB 2HYMA 4PGEA 4QNPF 5HI4D 5DK2B 1HQ4A 5E2WL 3REVB 3CSGA 1U8IB 3RWDB 4A2MA 4OTXL 2PXYC 2WUCH 1UVQB 1WBYB 4JM2C 4KKLC 3IAQA 2DDQL 2AEPH 1ORSB 2X9XA 2X70A 4G42B 5AUMB 4DGIL 2AEQH 1FYTA 4NQCB 5TH2B 1MFEL 4QRRD 1J88A 3FT4B 4XC1H 1DZBA 5E4IA 1A4JB 3GHBL 3AUVA 4FG6C 1FYTE 5EOQH 5FGBC 2UWEF 2B8OT 3OPZH 3D9AL 4GRWE 4UAOC 5F3BA 1F2QA 1GC1H 2PTTA 5GSRB 1IC4L 3PL6B 3R06B 2ZPKH 1RUPH 3PWVB 4X6EB 4OCMC 5GZOD 3D39B 1IL1B 2R0KL 4J8RA 4AYFA 3RVVD 5IESH 4DVRH 1F6AA 5I6XC 3U46A 3QDMB 3IF1B 2C4FU 5E9DE 1OB1A 2DWEA 1II4E 4XNYH 3QXUA 1YJDL 3N1QC 4U49A 5I71C 1Z5LB 2E6PA 1NC2B 1OF2A 1AQKL 5EC2B 1HDMB 3QQ9D 5I73C 4PLKD 2NY1D 3P0VL 3VFVB 5DJ0B 3BOVA 1UCBH 3DVFA 3I2CL 4RDQG 2DQJH 3EFDH 4F37F 4L5FH 2AI0H 3PWUA 3DV6A 2BNQE 3PWPD 1CXKA 5F21B 3MOAH 3T4AA 5CHNB 2HVKA 4TNWF 4NYLA 3WIFA 1XF2B 4HQQH 4YDKH 3UROR 3SKJH 3L3IA 1YMMB 4E0RA 4X7SH 4UB0L 3VXRB 3QIWB 2F54B 1S7SA 1F4AA 1UWXH 2XZQL 4WFGE 3AREB 2YA0A 4MAYC 2VDPH 5I8OH 4UNTA 1JP5A 5DHXB 3DETD 4XCCL 4YZFE 3OGCA 4L8CA 1UKTA 3HUJA 3K46A 1UM5H 1PZ5A 3H2WA 3PNWB 5H2BA 3U2SA 3GZKA 4GXUN 4U1SA 5DQ9B 2OM5A 3LEVL 3WHXA 1KC5L 5IQ9B 4LHUB 4JGJA 2R23A 4D0BA 4OZIF 3L3OB 4ZAKA 2XWJB 2IQAB 4IMKA 4RNRA 5DQDH 1LO5A 4GAYA 2G60H 4MXQD 1P7QB 5C0AA 2Z31B 2NYYD 2WNGA 4X4YA 1A6TA 3EGSB 4OZIB 4HPYH 5T1DL 4OLZH 4DKFH 3T8XA 2NY2C 3ZDZF 1GOGA 3SDDA 3UTPD 3DGGB 2P5WB 1J87A 4IEFB 3FFDA 4NJ9L 3SO3B 1TFHA 5DJCB 2GSGB 1W72H 1MCDA 2UY7A 4ZXBB 1URLA 1FSKB 4ZOCA 5FYKD 3OR7A 3BYTA 1X5JA 3F7YA 4HLZH 4AIOA 1N0XL 2Z31A 3ZDZE 5DRNA 4OD3L 3ILQC 3WNLA 1JV5A 4YO0A 2J8HA 4L9LB 3H9HB 4J4PA 3DXAD 3MGTB 4RSVA 1YQVH 5DZOA 5I19H 3QAZB 1I7UB 1K5NB 4Q9QL 4GG6B 4PTUB 3WSQL 3D2UD 4KZDH 3INUL 4ZTOL 5JIKA 3BZEA 3VFPA 1ZOXA 1SJVA 3RWGA 3DIFB 3DRTA 2A73A 3AREA 5IBUG 1J1XL 3FQUA 4OB5H 4G9FB 3TLRA 1RJYA 3O9WD 4PLNC 1CGUA 5DJ2B 1AP2A 2NTSP 3OR6A 5SV4A 5EC1A 1L6XA 5FECA 3QUZC 4TNWK 1BGXH 3UTSA 1VFMA 1QPXA 2IFGA 5BRZB 2VITB 1G6RH 5A3IC 1NFDF 2J6EA 4IIQB 4NYLB 1XF2A 1IGMH 4KXZI 4PR5B 2V2TA 2B1HL 5DJZB 3SO5A 1ZA3A 1TQCB 3A6CH 5LJYH 1I4FA 3K81A 3LHPL 5FYJH 2Y72A 1C12A 2VUOA 4OV5B 3QWOB 1QVOA 2C4FT 5F7EL 1IEBA 1QFWM 4P99A 3U48A 3TESA 3MYJB 3TBTA 2HVJA 3SKNB 3JV5A 4LCWB 3F7PC 5JXEC 4QXWA 1YQVL 3BZDA 1UB5B 3WLWD 1QUNA 5J3HD 4PRAB 4MCYB 5C0EB 1B0GB 2DICA 1KIRA 2IQ9H 3A0OA 1HEZB 2GSIB 3BRGC 2IJ0C 3KYMA 1UADC 3FQWB 1K8IB 1M7IA 4U4BA 3CFEB 3WUZA 4X7CC 3WNMA 4JY5L 4LLQB 3U46B 1MQ8A 1MWAB 1UCBL 1KLGB 4RRPG 2L7JA 4OFPA 2XA3A 5KSBB 1KYOJ 5IBTL 4K3GA 1V7ML 3GKWL 3IXTB 1IL1A 4R97B 2F53A 1FJ1B 1AO7A 4K8RL 3WS3B 4EXKA 3QDHA 3VRJB 5DHVB 3PWVA 3FN3A 4ZS6D 3SE3A 4AK1A 3TBYB 5HHMD 4PJGF 3JWOH 2C3GA 4LAQH 4Y16D 5CD5D 2ZOLB 4PJFE 4LGSB 1YYLL 4ZDHA 4PJ5A 1DQJA 4HFWB 3WIHA 3D0VB 3ARGB 5ECJE 4F9LC 1FFQA 3GUTA 2NLJB 1JZ4A 1DVFC 1UB6A 2FD6L 1XAUA 4XXDB 4NQCD 3MNZB 1AGEA 4JHWL 3BHBA 4KJQC 1BREA 2VWEC 3AFLA 4J3WA 4OI7A 1E4WH 1YN7B 4B0MM 2Q76A 5D2NC 3MV8D 1UVQA 1WBYA 4NSKB 4KMTH 3VXSA 5EB9A 2FEEI 3JV4A 3REVA 5DK2A 5TE6H 4EI5C 3C2SA 5CBAA 1VSCA 4WI5A 3IFOB 5E1HB 2Q8AL 1ZS8A 3L3GA 5DZLA 3VG9C 3GKWH 3U0TA 4CVUA 1DLFH 2AEQL 5IB1A 3MNWA 3EDDA 1NAMH 2CKBB 3MV9E 2GTZB 4C56E 3GIVA 1NLDL 5K9OB 1U41A 4HFUL 5ICYB 4YBHA 4H5SA 4WUKH 5KVDL 2XIDA 1HI6B 2FATH 4JB9H 5E94B 1UENA 5HD8D 3TEUA 2JB6B 4H20H 4D0DA 4MD0A 5I71B 2XG5A 4LCYB 1TDQA 2AXFA 4HXBL 1CS6A 4DKEH 5FUCC 2ZUYA 4U1LA 4XNYL 2HWZH 4EI5B 1T5WB 4Y4FB 3BRDA 3OAUH 4E5XB 2Y06L 1BBJB 1X6LA 4P23C 2Z92A 2H1PH 1IBGH 3CSYA 5IOPB 3VG9B 4FZ8L 1T22B 2A38A 1WFNA 3IDGB 4IDJH 3U9PH 5C70A 2IH1B 4ZUVA 1AQDA 1IARB 5J9PB 1CU4L 3GBMH 1BLNA 3V2AR 1YMHB 5LGHH 3CK0H 3QQ3A 4JR9H 3ZDXE 1T2QL 4L29A 5I8KL 3TT1L 3SJVD 3EYQC 3GSOB 1KTKE 1TETL 1LEIA 5JOPD 2R4RL 3K2MC 4X9IA 4R7DB 4QT5B 1IM9A 4ODVH 1CN4A 3IU3A 1A21A 1G1CA 3IRZA 4NUGH 3DV4A 4PJXA 4YHPB 2X42A 3K1KC 3SDDD 2A6DA 4ODSH 5JOEA 1CCZA 4NQDA 4O2EA 3TH3T 3TA3C 2QBWA 3SGKC 4P48A 2FCBA 4YAQB 3U0PB 2YMXH 1CLZL 3FO9B 5LGJA 1MRCH 2DQIH 4LCWD 4R2GB 3UTZA 3WDJA 43CAA 2B39A 4OFVA 5HDBF 3IKKA 5CJXA 4O4YH 4JN1H 4N0RA 3F58L 4JY4B 4JFDE 4NJ9H 4YPGB 4JFDD 5JOFA 4MNQE 5DJZA 5L6YL 5ITFA 4P2YA 5A16B 4LNRA 2D7OA 4M7JH 2MFNA 1IAIM 3TCLB 5C0NC 1XF5A 1DBKH 2XRAL 3EKCA 1M6OB 4RFNC 1KT2A 4Y5YC 1DVFB 4J12A 5I8CB 3FFCD 1RZJL 4P4KD 1OAQH 1KTLA 1AGFA 3VXTB 4JPVH 3U36B 4GLRI 1IC5H 1N7ML 1M7XA 2YA1A 3JWOL 4F3FB 4JZJB 5F9JB 4WHYH 3VXSE 3BH9B 1INDL 4PJCA 3SDXE 3LN5A 5DD3L 1F5WA 5IWLC 2WWMC 3R1GL 1EA9C 4AJ0A 1IGJB 4HKXB 1U42A 1XZ0A 2MCPH 2XWBB 2XXMB 4RIRB 3BPNC 4CN1A 3KPOA 5HHVL 3FT2B 3O8XD 1A7OH 2NY0B 1S7VB 1J8HD 3L7FB 3QUYA 3QFJE 1U8LB 4R4NC 3VFWA 4YK4C 5C0BB 4F7MB 4DFHA 1UC6A 4LGPB 5FDWB 2EDKA 3KLDA 5J1AA 4HS8L 4BQ9A 5HYJE 1WIPA 4KTEL 3JBG7 1MIEH 3C9NB 5TDNA 2E8ZA 1WK0A 1AKJD 1JZ3A 4F58H 2VLLB 4GW4B 4PG2C 1G6VK 5TDOA 1YNLH 5DD1H 2VQ1B 5IB5A 1RVFH 4JHAH 5DMIH 5I1KH 1UXSA 2W07A 2ERJC 4OI8A 3CPLB 1JNLL 1RZ7H 3BT2L 4MA7L 4NQDE 4PUBH 4L8SC 3CFEA 1S7RB 2XN9B 4MQTB 3C5ZA 3C6LA 3CGTA 1RJLB 4K3EL 4NRYA 4OGYH 4C56D 2HG5A 2GFBB 4DZ8A 1AD0B 5TFSH 3O4LB 2VLKD 4OAWA 1YJDH 1UH2A 4XPAL 3C5ZB 1XGRA 2D03L 1E4KC 3CFIC 4Y16A 3TN0D 3OAUL 3OTTA 2F5BH 3H9SB 2JIXB 2SEBB 5FM5O 3QUMB 6FABL 2UY6A 3G08A 2N1KA 5C0IA 1IKNC 3PJSB 2VQ1A 3SE9L 3FONB 4MYWB 3PIQB 1XR8B 4RFOL 3B9KB 4GW4A 1X5AA 5BOPA 1ZHNB 1RUPL 3AAZA 2R2HA 1QBML 3FO1A 3VXPA 4YFDB 5L2KB 2A6IB 4JVUA 5D70H 3T4AB 1ZHNA 5T3XD 2O5YL 5T1LA 4MJ4A 2JCCB 4GW1A 2NW3B 4QOKB 3PG2A 2OL3A 5EZOH 3DSNA 3MRBB 5CP7B 3QPQC 3VXMB 4PJIF 3HHRB 4OCSL 1RZIB 3KWWA 2YN3A 3FOMB 5MEPA 1AGBA 5EBLB 5IGXH 5C3LD 4NZTH 4HH9A 4RGOL 1OTUC 3IU4H 5F8QC 4PJ8D 4Y1AE 1OF2B 4K9EH 4JO2H 4QY8B 4EXPX 4WDIB 4KRNA 4W4NA 5FYLH 1F4YL 3RVXC 3SBWA 1SEBB 1MUJA 2WIIB 4L4TD 3LKQA 1CYGA 1PYWA 2NXYB 4NKDA 1QEWA 4U3HA 3QZWG 4W6YB 4MJ6B 4AEEA 1A7RH 3MGOA 4LIQH 3C08H 1CLCA 4MD5B 1NAKH 5L0QB 3WFHB 2DKSA 4Z0XB 2PO6C 2FHBA 2H2PC 3SY0A 1WWCA 4BZ2L 3VE0A 3MV8E 1N6QL 4O4YL 3O3DB 5ICZB 1GGBH 3ARRA 1T1WA 3DUSB 2B1HH 3RWFA 4KKBD 5GIRB 5GS3A 1BD2A 4RX4D 2D7TH 1PYWB 2LVCA 4OTXH 4LPTA 3O3AA 2ESVE 2C3XA 1I9IL 2F5AL 2BVYA 3QEUA 5GGVH 3MFFA 4JG1H 1R6VA 2BRRL 5C7XL 4R4BB 5FO7A 2I9LA 4BZYA 5CEYB 4G9FE 1UM6L 1RUQL 1HXYA 5EIVA 1EXUA 4XNXH 3KAAA 3N1PC 1HQ4B 5IB4A 3K4DA 3AB0B 3LKRB 1T89C 3BGFC 1TJIL 2R9HC 5L2KE 2XKSA 2K7PA 1R3HB 2DQFA 5L88L 4MB4A 2VL4A 4ZFZB 3WS6C 5ACZA 3TCXA 1RZIA 5F8RC 4HIIB 1IJ9A 3BN9C 1MI5E 5DVOA 1CK0H 2F54A 3AROA 1Y0LA 2DM3A 1F97A 4WI9A 1MQKL 4F80A 4TSAL 2YZ8A 3MLZL 4QOKA 2NW3A 3D69B 2APBA 3HE6D 1NMBL 4ZNEE 2A6IA 3OX8A 5HJ3B 1VEMA 3NCMA 4Z7QE 7FABL 4PRHB 4BQCA 2BSSB 1WZLA 4JFXB 3B8SA 1JPSH 1BHGA 2FYYA 3HTLX 1JYXA 1KOAA 1FO0H 3BZFB 1YEIH 3VXUE 3V8CA 2OTPA 4GRLD 1WICA 1GIGH 5FIEA 4HUWA 5T3ZL 4KZEL 2JB5H 3TWCH 5GGSB 4HZAA 2H2SC 1ZT4A 1XGYL 4U1NA 2Q7YA 4KRPB 5MENE 1EGJA 2J5LB 4M62H 1J05B 3QP3A 3PXJA 3VJ6B 3GB7A 3SDAB 1WZMA 4UT6H 2XACC 4UTAL 5KBNC 1QSED 1QRNB 2UYLA 2WAHA 1FCCA 5I75B 1LO2H 2HN7B 2YPVL 2IPTL 2VXQH 4UQ3A 5GJSH 3ZDYE 1ZANH 3ALPA 4P46B 4J3TA 5EU4A 3QDGE 4RX4A 3FKUS 2CGRH 3MJ8B 1F11B 4M5YL 5D2LB 4X6EA 2PW1B 3ZHLA 4X7TB 3RGVC 5EN2A 1HHIA 1PEWA 1OPGL 3GSRB 3D48R 2A0LC 1KJ2B 3JUZA 1ED3B 1QA9B 3CH1B 4WO4D 4IOFD 5IP4A 2OR7A 5C86A 2HFFB 5JW4N 4HDIA 2IPKB 3VFWB 3ZSSA 3LVEA 1ZV5A 1AR1D 2AQ3A 2NLJA 5DI8A 2UVFA 3EZJB 2KQNA 4XNMB 4BSJA 3F5WA 4JPVL 2EIEA 1F4WL 3HFMH 3TZVC 3JXAA 4YXKL 4AG4L 1ULVA 4E42B 1I1YB 3FQRB 5CINH 1FDLL 4MSWB 3F7QA 2PF6A 2DKMA 2F53B 5CFHA 2FH8A 3MJ8A 3DXAE 1P84J 5JHLH 1FHGA 3KR3H 3VW3H 1OW0A 2DQTL 4X4ME 4OCRL 1KPUB 1LO3L 4ZUTA 4GMTL 4ZPVB 1E6JL 1OT2A 1CLYL 3QCVH 1JZ6A 2BVOA 3WO3B 1I1AB 1NFIB 5IESL 2A2QT 5HYJD 4ZOBA 1JNNH 4ZUWA 3EJZD 1KCRL 4MCZB 5HVHB 3V7AG 3IGAA 4OF3A 4Z7OF 3I2CH 5CD3B 3FAXA 1UZ8B 5F7DB 1KCLA 4JRYB 2HWZL 3MYJA 3OJDA 3TBTB 3LY6A 4XWGL 1CF8H 4ZODA 5IBUB 5ACMA 1CICA 3D3VB 3LB6D 1FLRL 3UTSD 4OV5A 4PTTB 3RL1A 4JDVA 1X7QA 1G6RL 2PYEB 3KG5A 3CH1A 2EDOA 4HD9A 3GSVB 2DTMH 3RZCC 5FYJD 5TE6L 4HS6A 3GSRA 3TPKA 3EYVB 1VFAA 1T7ZA 1CU4H 1S78D 3HI5H 5FYJL 4FQIL 3O6KL 3KR3L 4L4TA 3VW3L 3N9GH 1IM9B 4N9OB 1U8KA 4JG0L 5BV7B 5FCUL 3P9MA 3THML 4P3CL 4W4OA 3MV7A 1MQKH 2EIBA 1RZKH 3BPCB 1NGWA 3R0NA 5IR1A 4R96A 4KZDL 5EDXA 5JNYB 5ACZB 2WINA 1D6EB 1CFSB 3CVIH 2EIZA 1MAKA 1JK8A 4X5WB 1XCTA 1J0HA 1YDPA 3NH7L 3IT8D 3MA7B 5BS0A 4PFEA 4JJ5A 5FA3B 2D7MA 2RCSH 1EXUB 4NPYB 1T5XA 4Y4KB 4WWID 3WN5C 1OAKH 5D7JA 1OSPL 4C83B 1FZOB 1HEZA 4ZFGH 4HKJA 1AJ7L 2L4OA 5IOPA 3MLUH 4LQ1A 5D7IB 2EDBA 1H8NA 3KPRA 3TFKD 2FH6A 3X11B 1OGAE 1FZMB 3CMOH 3RX8A 5H37H 1U8QA 1I1AC 1MFEH 4IS6A 2QADB 4OGAD 2CLZB 5ID0B 3BKYH 4M4PA 1FNEA 5BJTB 1EERB 1R24A 1T66D 1PSKH 2CLVB 3SDCD 1Z6JT 2VDQL 5D7IE 2AJ3A 3HG1A 1PKQE 2PYFB 1X5KA 3O3DA 4OGXH 4K9EL 1SY6L 5DD5L 4PJAA 4OLZL 1NCBL 1UACL 4IIQA 3S34H 2GW5A 1ZANL 1LE5B 3C8DA 2CUMA 3S96B 3SQBA 4JEGB 4OCWH 1EAJA 3D5OF 4V2BA 5D1ZB 3RY4A 4ELKA 2IAND 3KPPA 3UP1A 1PFCA 5E99L 5C0BD 5DLML 2OXHA 4K7FA 2DI9A 2QSQA 3I6KB 4GRLA 1MJUL 2R0ZL 2A73B 2GCYA 4Y19B 1NANH 3WE6A 3EJYD 2AV7A 3RWGB 2KBGA 1A8JH 3NN8B 3WNOA 1LO5B 3MV8A 1CICD 4Y1AA 3RZCB 5ILTH 3DJ9A 1XF4A 4K7PX 4Q9RH 3DVNA 2JK5A 3LEXA 1F13A 4DN4H 4ZAKB 4JDZA 1TQCC 2HJLA 4U1KA 1A9BB 4LHUD 5GZOC 5GRYA 4P49A 3K1DA 4JFZH 5J13B 3S4SB 1PZ5B 1WAAE 4G8GA 4NHCH 3P9WB 1NLBL 4PJ9B 3QRGH 4MMZC 5IFHL 4CNIB 2OL3H 4FABL 4P4RB 4JN1L 4TSCH 3RX5A 2DAVA 5DMKA 4K7FB 4HUVB 2OK0L 5I16B 2ZCHH 5DJ6A 4HT1H 2GSGA 5E6IC 4MXWL 1SJHA 1UQSA 3DX6B 1YJDC 2QQKL 3MX0A 3I9GH 4LIQE 5K33A 5L2KA 2YKLL 1ZLSL 5GS0D 5IHUH 2RFXB 3DV6B 2KL6A 3ZDXF 4QYOB 4Z5RB 4XNXL 4Z0XA 1KBGL 1FNEB 1LP9F 3QUXC 3VFVA 1W0VB 2IQ9L 2XQYG 4L4VE 4U3CA 4NJAL 3QG7L 1P7QA 5C0AB 4S0SD 1BAFH 4WI6A 4X83A 1H3VA 3RVTD 3ET9F 3T0EA 5DFTA 3T77A 3O81A 2J8UF 3GJEB 5TF1H 4D0BB 4JQVC 1HZHH 4QRQA 1QRKA 1LP9E 1U95A 3I50L 4RAVB 4XPFH 1GXEA 3IDNB 1UWGH 4NQEA 3B8YA 5C0EA 1T83A 5HHVH 1JK8B 4NDMA 5BVPL 2N56A 4GBXA 4JANA 3GJFB 1GYAA 1QG3A 3FOMA 3K8LA 5EUOE 3F12A 1GSMA 3U4BH 3RBGA 5IROC 1S7SB 1S5IH 4WEMB 5CCKL 5JLZA 4KVCL 5GRJL 4JHZA 5HI3C 3B5TA 3V6OE 2O93L 4NQDD 1A6UH 3MMEA 3RDTB 1V3LA 3K7UA 4D0CB 3V0WH 3B9KA 4MXQC 2CIIA 1I3RB 3OKDB 4NM4L 1U8LA 1VACA 2O5ZH 4XNZB 1Q9KA 2FHCA 3GJFA 1VDGA 4FXGA 1RAMA 4OUOA 2X70B 5IHZA 3BDYH 2OJZL 4NQEB 5B38B 1NC4A 1XT5A 1U8MA 4I8DA 4PB0L 1MCWW 1X6NA 1C5BL 1CDCA 4AEIH 4PJFA 4Z0BL 5FK9A 5DJAB 5AZEH 1CLZH 1WF5A 2HT3C 3BD4A 4NHUA 5FYKH 1JTTA 4G8EB 3C5SA 4OLXH 4P2OD 2QSCH 2GIYA 4M1CD 4ODSL 2PTUA 2GCYB 4KQ4L 4D94A 1ROWA 5E2VH 2GQHA 4I48B 3CXDH 3FQTB 4L3EA 3O2WH 1JGDB 3UBXB 1G7PB 4QYOA 4Z5RA 1INEL 3FFDB 2P8LA 1G7IA 1IGTB 1MLBA 5DR5H 4MVBD 3T0ED 3V5KB 3SDYL 3NTCH 3E6FA 2RQ8A 3HLAA 1MHPL 1R3LA 1YC7A 3QDGA 3ULVL 4BH7B 5IFAL 1QFWH 3UJTL 3RY6A 1GGCL 1W8NA 5I76A 2ATPB 3OJMB 5L2JB 1D5IH 4NQCE 1VB9A 5KVEL 5FHBL 4GRMA 4F9PC 1U3HC 2EC9T 1QHPA 1KN4L 3ARGD 4S1QL 3VFGL 3GM0A 5FUOL 4MXWH 1PY4A 3PWJB 1DE4A 4NT6A 4G8GB 4OZGF 4TVPH 2R0KH 2G2RA 3HI5L 4QTHB 1XZ0B 5GRXG 5LBSL 4C83A 4Y5VA 2NY4D 4DKAA 2EDJA 4YHPA 3BH9A 4F33A 4G8IA 1AI1L 4NO5A 3L3DA 5E95B 4L8CB 5KSVB 3U36A 1EK3A 5EOQL 1CFSA 1KIQB 4HXBH 3CXDL 5SWQB 5GHWL 1BQHG 4MGXA 5JXED 2R2CA 4I13B 3ZE0F 4QXGL 3MLVH 4H0HB 4OT1H 3T0DA 4Y0GA 3MV11 4I0PB 5CBEA 1H15B 2QR0B 3CK0L 4JR9L 2DLGA 2EZ0C 3MYZA 4XWOC 2ZCLL 2VLKB 2OR9L 4J1UB 4WW1A 1DBML 2MHAB 3VJ6A 3U30C 1MRDL 3IDGA 4FNLL 1J05A 4HV8A 3WHE0 5CEXB 5CAYB 3U7YL 1AIFA 5E2JA 5I1EH 1UKQA 4RBPK 1DQLH 2Y7QA 2WANA 4PTTA 4QXUH 4S1RH 2P44B 1FO0A 1OSPH 1LILA 1NCAL 4WY7L 5KJRL 1D5MA 4RMUA 3F6LA 5F72S 4ZS7H 1RHHA 4G6FD 3W5MA 1CDGA 1WT5A 3G6JE 1RIUH 4HMDA 2AXFB 4JY6B 4PGBB 1KB5B 4OZGE 3P0YL 4OF0A 5FKPB 4B41A 4YWGL 3S37L 3S6CA 5T1LD 3P73B 4ETQB 2KDGA 3DV4B 4YXKH 8CGTA 5CD5C 3E3QE 5BW7C 3AS1A 3REWB 3AS3A 5K9JH 1R3JA 4PRIE 4QWWD 1D6VH 3ZKXB 5TE7H 5CCKH 4WV1A 1H8OA 5E70A 4UUJA 3K8MA 2VXUL 2Y9RT 2WK2A 4LASH 4I0KA 4XB7A 3C5JA 3FN0L 3ZHDA 5I0DA 4GKSB 3VGAB 1NMBH 2C1OB 5C2UB 5K59E 4G8IB 2EXYC 3LEVH 4YDVB 3T2QA 2YXFA 1QYGL 5HHPA 2Y5TA 1BF2A 1OPGH 4PRDA 5F88B 3QXWA 1HXYB 1XIWA 2VDQH 1FLTX 1BWWA 3OG6B 2ZUQB 4S10A 2XY1A 4J3UA 3PGCB 3RBSA 5E9DA 1CG9B 5KS9A 5A2KH 4F7EA 4OZIE 5IEKA 2ERJB 3GRWA 4PJ5B 2F53E 2HFFA 1BBDL 3STLB 3P9LA 3V4UL 3TBVA 4POZD 2EE2A 3G6JF 2XA8L 4X6CA 4RQQA 4D8PB 4Y2OA 1NGQL 1WWBX 3TH4T 4LSUH 4PRPD 3BXNA 3CX5J 1I3GH 4GXVL 4J3SA 4NZUL 3MRLB 3U4AA 4H5SB 5D1QD 4OLUL 1QPPA 3I9GL 4FFWC 1GL4B 4S1QH 3KXFE 1DUZA 1M05B 3G04B 1ONQB 1CFVH 3QDJD 3DROB 4CRPA 1S9WB 3QZWA 5DJ8A 1NMCB 3J8F7 4NKDB 3O41A 3ULUD 5SWSE 4JFED 2HN7A 3C5SB 2BCKA 3U0WH 2HRPH 3HNSH 5DD1L 1QFPA 2YWZA 1UM4L 3B2UC 2XTJB 4G8FB 3EDKA 4H0GA 4OM1L 1P84K 4AL8L 2FX9L 3MJ7B 1RZ8B 1UWXK 1FZJA 2X89A 5FB8B 5B38A 3C87A 4MCYA 2KPNA 1A7QH 4NNPL 2Z4QB 2VISA 1A7PL 2Z35B 3K3QA 1G7LB 4HUWB 4L5FL 3RKPA 1AC0A 1VERA 3KWWB 3FAWA 1ETZB 4LSQL 4UIMA 1K2DB 3BIBX 4I3RL 2FYYB 3HPLA 4I3SL 4YH6A 5EWIH 3C60C 1T2XA 2ATKA 4YQXL 3CFDB 3S88H 2J12B 4X6FB 4FHBD 3HC3L 1PAMA 4D0CA 4MNGE 4PLOB 5HDBE 3RDTA 4ZFFA 1FFNB 3O0RH 4N0UB 4PB9H 1DQLL 1IGYB 4HK0B 4MJIE 2Q8AH 2Q6WB 3GMLA 5DHVH 1VENA 4MNGA 3VRLF 5EC1B 1J1OH 4LCIL 5HHQA 1A64A 5DMGD 2HJKA 1UA6L 4BJLA 5I66B 2AJXH 1OGTB 1I8KA 1XF1A 4GUPB 2QQLH 5C08D 4Z7WB 4LLQA 3C6SA 3IYLW 5CSZB 1JTPA 5IB4B 4YE4L 5T1KD 3MRMB 3SDAD 1QSEA 3OGOE 1OAKL 4XPBL 4AT6B 4EDXB 1VGKA 3LS4H 1LO2L 1Q8MA 1ZLWH 1LDSA 3HC0B 1ZVSA 2G2RB 3ZSTA 1TVDA 4DJMA 1UKSA 1EGJH 3OR7B 1IAOA 3DX8A 5ITBL 3PGFL 3BGMB 4OCSH 5TDOB 4FQXA 4GLRH 3MZGB 3PP3H 3DUSA 1MJ8H 3TBWA 1EPFA 1I9EA 1F3DH 2BSSA 3DHJA 5SWZB 2V2TB 2UWEB 4UOJA 2EKSA 5DC9B 1S7UB 2A1WH 1NEZA 5BMFL 2Z91A 3UYRH 3CZJA 4P9HH 1J18A 1IMHC 4NQTA 1DQQA 2AABL 4QF1A 1MJJA 3V6FB 3TO4C 4WNQB 2W65A 3FJTA 4UZGA 4CNIA 4EUPA 3RQ3A 3LKQB 5J1SC 2XWJA 1A1MB 3CCHB 1MEXH 3FRUA 4E41D 1U58B 3T2PA 4QHNB 5IG7B 2LV4A 3DXAB 2HMID 3U6RA 3HRPA 4HXAH 4LHQB 1RUQH 1J11A 3W2DH 5ENWA 3RAJH 4OBSA 3VFSB 4M00A 3T0AA 4BYHA 2UZIL 4P5TD 4GXVH 1I3GL 2I07A 4FRWA 3DMMA 4PJHE 5T33L 3QISA 4LQFH 5IK3A 2BDNH 1GAFL 1RIVH 3DBXB 1FNFA 3WJLA 1YPZA 4HC1A 3WUWG 5DFVD 5T1KA 3TN0C 5ITFB 4PJHA 3DECA 1M1SA 3X14B 2I24N 5CEZD 3X13B 3ALWA 5D7LB 3WSQH 5E9DD 1K4DB 4GJTB 4NOFA 3CVHH 4IS6B 1NLDH 2Y06H 3BPOB 4PREB 2EDFA 3C2AL 4X0KA 4M3JA 1IAOB 1AFVL 3N1FC 4Z76A 4TNVF 1D5BA 4PG9B 3B5GA 4KQ3H 3QUMA 1OM3H 4LSPL 1SMAA 4KKCC 4U6YA 3RDTD 2EO9A 3ARUA 5DVLA 5D6CA 1U92B 3L95A 2VXTL 3RVUD 3M17B 1RULH 1SBSL 1PD6A 1WVZA 4AT6A 1ZGLM 1IC7H 4M6NL 4D9LH 4G6KL 1KXQE 1G7MA 3MBEC 4QXTA 1V7MH 4M5ZL 2AQ2A 2OS7A 3CFJA 2NTFB 4MAYD 1ODAA 3TBSA 1KJVA 1Q94B 4EDWH 4LEXH 1I8MA 3GI9H 3NCFB 3F7RA 4M5YH 3WO4B 4D3CL 2Z8VC 2X2YA 3V95A 5JHDD 2A9NH 3ALXA 2YPVH 4Z78B 4M3KB 5LWYH 1JE6A 4WFGD 4L8BA 2C9AA 1LDPH 4I0CC 2JCCA 4L4TB 5EO1A 1FC1A 3RVXD 2PKDA 5GSRA 4R4FH 2NXZD 4D9RD 2ICWI 4YQXH 3H3PH 3DO7B 2Y25A 3CFDA 1DBJH 3PL6C 4PV9B 4DVBA 3S3PA 3C2AH 4JDVB 3FONA 4RMQA 5JXEA 1C1EH 5DMKB 1C5CH 3VXNB 1CBVL 1T5WA 4Y4FA 1REIA 1S7VA 1UH4A 4P59H 5ELIA 3DTXB 4XC3L 3LOWA 4MA1B 3KPLB 4MA3A 4EN3B 4LRIA 1A3LL 4GRWH 3EYFA 4P2RD 4JGMA 1T4KB 3A67L 4UT7L 4M9OA 3ARDD 4XCEB 3OXRA 1F4YH 2DQDL 5E0QA 3E2HC 1A9BA 1JI2A 1OB1B 3FB8B 4NCC1 3FB5B 2XKNA 5C08E 3RNQB 1WISA 4JRXE 4X5XA 4R0LC 3B6SB 3MJ9L 2W9EL 3IXAA 4P57B 3DVNB 3TC9A 4JO1H 1BEYL 4OFIA 4JFFA 1V7NH 3ROLA 1T1YB 1A22B 2YPLE 3CPLA 3UJIH 7CGTA 4Y19D 1AI1H 4Y19E 2X4OA 4JZJC 1L7IH 3LMJL 4WFEE 1JHKL 5MHSE 1KB9J 3GI8H 5B22A 2G5RA 4MDJB 4Y4HB 5DGQA 4HCRA 1T03L 1R0AH 5MEOB 4WHTB 4H88L 5I1HL 3EUUA 4M7ZB 4NN6B 4NNYB 3RWEB 3U7AA 3MODH 3AGVA 3R4DA 3O3EB 1V3KA 2PYFA 4RQQB 5DC0A 1IGML 2BMKB 5CJOL 3I6GB 4ALAL 3WLBA 4OM1H 3RJDA 4JDTL 4FFVC 1A6WL 4GQ9L 5KS9E 3ARED 2C7UA 2B2XL 1FZMA 1H8SA 2AGJL 3S8WA 3HE7A 1FBIH 1TPXC 3FCTB 3DARA 1FQ9C 3VWJC 4RIRA 3PHSA 2CKBL 4M4RA 1GZQB 5DXWA 3MLSH 1RU9H 4DVRL 1DQTA 3VD7A 2VN4A 4HEPG 4WRLA 1AO7E 4Q9RL 5EU7C 3HUJE 4KGJA 3PE9A 1J8HE 3RWHB 3LIZL 1YDPB 1E6OH 2NY1B 2WBJD 1KGCD 2AJXL 2RAMA 1U3YA 1BQHA 5IEHA 3Q6FB 1OT1A 1T21B 4U1GC 4G6MH 5IR1B 2W0LA 3MRPB 3B9EA 1KIUA 4PJCF 3MRNB 1YMHA 5JZ7C 5D9SA 1ZHBA 4QRSA 4RFEA 4PRPA 1YEFH 4H26B 2ZSVA 1VGEL 5ESQA 5IB3A 1MRCL 2DQIL 4EEEA 5HGAB 3HZYA 4Y2DC 1P69B 4LEXL 1ORQA 3VFNB 1TZHA 2I5YH 3BKYL 1WFTA 2YEZA 2Z92B 1ZLUH 4P23A 2AGJH 1BBJA 4K3JH 2MKLC 3ISWA 4NWTH 2R39A 1FGVL 1IM3A 1J1OL 1BIIA 5EOCL 4X0KB 4ACPA 4BSWA 3VFMB 2ZG2A 4P46C 3A6OA 3BH8A 4F7CA 1IGCL 1EO8H 1Q0YH 5MEQB 3M8OH 1ACYL 5I18L 3FO2B 2NZ9D 5DURD 4KDTA 1BD2E 3OKEA 5GJTH 5I30L 3BP4B 1PW3A 3QXVA 1U3JA 4MCZA 3L5IA 4LPXA 5B39A 1G0YR 2UVEA 1R5VB 3BEWB 1U91B 1AC6A 4H26A 3DI3B 3TIEA 4XCYB 5GGUA 3LS4L 3WL9B 4LNVA 2GTZA 4PJ5D 5LWYL 1NJ9A 3ARFD 3MLVL 3MBXL 5FO9B 2AJVL 1KFAL 3FQUB 4U6XB 3OKOA 5F93C 3U0TB 2YUVA 4Z7UF 5DUBB 4X98B 2V2XB 2XY2A 3BZEB 3TVMA 1KIPA 3FQNA 4WGVB 4N0CC 4LRNL 4TUKL 5D1QB 4ORGB 5EIQA 5JO5B 3FQRA 1BFTA 4YLQT 4GW5B 5KS9F 5HXMA 4ZUUB 4IRJA 1A1MA 3RP1A 4CADB 1X5XA 4XI5C 4KK5C 2VLRB 4NO0B 2ZJSH 4YC2B 3NAAH 2EICA 3RHWF 1ES0B 5FHAL 1F6FB 4EUPB 2BVQB 1S7QB 2ZKHL 3U4EA 5M7QA 1NAMB 4M6OH 4N1EA 1LEGB 1TMCB 4WNQA 1LK3H 3RWFB 4LCYA 2ZOLA 3MRQB 5I17A 4YXHH 4HCRL 2DMKA 5D6DC 3GHBH 3Q48A 2QLVB 4JQXC 1FE8L 1HYRC 2P7TA 1X5HA 4MNHB 5E08L 4N8VB 2VUYA 2DQTH 3TZVB 3CFCH 4KUCD 1J5OH 2ZUVA 1OTSD 1RUMH 2NR6D 1OAYH 4JO3H 4H1LH 2BVPB 5MERA 5TFSL 4XAKD 4OIIL 3EIFA 5IWLA 2FO4A 4JFFB 5MP6L 4BK4A 1RZGB 1ZVSB 4BELD 32C2A 3F7VB 1F3DJ 5MHSD 5L9DH 3ARBA 2QKIA 2IMNA 5DUML 2D7NA 3PWPB 5IBLD 2FJHB 4XP6H 1IC4H 1ZT7A 2L7UA 2A77H 2GTWB 1ZT4B 4WWKC 4X8JA 4LPUA 2JF1A 1OGTA 1Q9LB 4FXGB 3UTTB 2VDOL 1J1XH 3KPLA 4EN3A 4LEOA 4X9FA 5EBLA 1VACB 4ELMF 1G9MC 5ISZD 1PQZA 4IM8A 3VXMA 4ZDHB 4BM7A 1C12B 1G7HA 3PWPE 2XWTA 3VGDA 5DUPL 3GMOB 2ADJA 3RWIA 4LSSL 3OX8B 5HJ3A 3TNNA 3BDBA 4G9DB 3O6KH 4FQIH 4HF5H 4KVCH 2AVGA 2VDPL 1MY5A 4ELMA 5I8OL 3WS3A 4LKXA 1AHWB 1T1XA 4RGOH 4U05A 1U8HA 1NCAH 3IFLH 5I1CL 1UJ3B 3PDOA 4QRUB 4L8SA 2HP4A 2Z31D 3OKLA 4M61A 1TENA 2NTFA 3CZFA 2YRPA 4YBQD 1WBXB 4Y16B 3VMPA 2O5ZL 1YPZF 4LSTH 2BSED 2Q86A 3MRRA 1OCWH 5F7EH 4Z7WF 3CDYA 4NNPH 3NVQA 3V52L 3QDMA 3ARFA 1A7PH 1G9NH 4Z7NE 4ONOA 5HYEA 4UINH 1D9KC 1I8LA 5DO2D 2EDQA 2P8PB 4A6YH 3TVMD 5IB5B 1QBLL 4POYA 3QWOA 5T3XE 4RGNE 2P45B 4YXLH 3CDGB 4RGND 4OUUB 4WUUA 3IETB 3X13A 2CSPA 3IDIA 1DQML 4H8WH 4ALAH 5J57B 5AWNL 3GSWB 4KHXL 4P3CH 5KN5B 3CX2A 2WBJA 3BI9X 3VFRB 4NQVB 3K4ZA 1EHNA 1FIGH 1RURL 4X4YB 3U4EB 3AY4C 2GJ6E 2ITCB 1RVFL 4JHAL 2GY5A 1CG9A 3LMJH 1YQ2A 3QIUC 2CPCA 2JIXD 4PGDA 5DSCA 1MCPL 1YECH 1FVCA 3T3MF 1TZGL 1INEH 3FZUC 2OP4H 2VDMH 4XPTL 3ULVD 1B3JA 4UILH 1ZLVH 2Y5TB 3BKCH 3X12B 4I2XA 5F1IA 4NFDA 3H7BB 1P4IH 4JM2A 3NN8A 1CFTB 4Q9QH 4CUCA 2NX5B 3MUJA 1AGFB 2NXYD 5C07D 2HT4C 1NAML 5T1MA 1K3IA 4XTRC 3NAAL 5EO9A 5KTEH 1AD9A 3QIWA 3RVTC 2ICWA 1N3NB 1IQWL 4PJDF 4E0RB 1VADA 1N0XH 3DI2B 1N2RA 3MA9L 5C0CA 3KLHC 3QPXL 3VH8G 1QLRA 2YC1B 4YHMH 4RRPA 3HB3C 2E7LC 3BP7A 3P73A 3AAZB 3FO1B 4P5KB 3RRQA 5F7UA 2JTDA 4PGBA 2R2BA 3RA7H 2R15A 5F9WB 2ADGA 1EO8L 1Q0YL 5ISZA 3BGMA 2ICCA 1BVLA 1BQUA 3CFKA 1U93B 4AIZA 5JMOC 2PYEE 1PEZA 3IJHA 4S2SA 4HJGB 1N59A 2E3VA 1YEIL 3DRQA 5AD0B 4ONHA 4PY7A 2VDOH 1H0DA 3VCLB 2MHAA 4Y4KA 4MJIB 4ZO7A 3MRMA 4L4VA 4ZNCD 5L7XL 4ONGL 3NGBC 2UV3A 3MA7A 4KRLB 5DC4B 1G84A 1XCTB 1BQLL 1HYSC 3OB8A 5DRXB 5DUMH 3X3GL 4JKPH 5KTEL 1U3HB 4BH8B 3MCKB 3VD4A 4ZG1A 5LXGL 1GH7A 4YHOL 1I1FB 3EDJA 3D39A 1CFQA 4YPJA 1QBMH 2DN7A 2OQJA 4L4VB 4OFDA 2FSEA 1FL5B 4OZHF 2J2ZA 4M1CC 4Z7OE 2P8MB 2BXYA 5FA4B 1LD9B 2R4RH 3X3FL 5FEBA 4OIBA 3TPUB 2HLFD 2JLLA 3CVHA 2PR4L 4X7EC 1CICB 3D3VA 5FO8B 3BAEH 2DLHA 5EC2A 1UZ8A 3FTGB 2OJEA 5A43C 4NC1E 3GSQA 2Q8BL 3DOSA 2DQDH 4N90E 1BJMA 3G5ZB 4HKXA 2VDKH 4TVPL 5BS0E 3IB4A 3C8KB 4NQSB 1RZFL 1HI6A 1S7XA 1WIOA 1CFVL 1MLBB 4GKZB 3ZKND 3ARQA 3VG0H 1BVKB 3TH2T 5E8PB 3VXQA 3QCVL 2VIRA 2CKBA 3TF7C 5DD3H 4UTBH 4NRXB 5B4MC 1MHHA 1S9YB 4NRXA 3O6MH 4S11A 4XMKH 3MRDB 2B0SL 2ED9A 4AH2B 2YSSA 3MOBL 1U8NB 1YNKH 3AS2A 2BVTA 1D5ZB 4JFEE 2GK0A 4OZFH 3BXNB 1RFDL 4LVHC 1FGNH 5TDPA 5JOFB 1FIGL 4FZEL 1XGTB 4WEBL 3P9LB 4MS8D 1A7OL 1KB9K 1T7WA 3L9RB 4K07A 4OFYA 1CE1L 2XFXB 5EZJA 5LGJB 3U0PA 4LSVL 4HX1B 5C0FA 4PRNB 4G42A 3FHQA 1F42A 3VFRA 4I0PC 3QIBA 1FAIL 3QQ9C 2E6JA 4JFDA 4OQTL 5J8OA 2NNAB 3HE6A 4H25B 2RIKA 1FVDB 5JDJA 1BX2A 3TV3H 2F19L 5CEZH 1QR1A 5EWIL 4X7TA 1FFRA 4KJYB 1F11A 3KYNB 4R7DA 4HC1H 1WGOA 5JA9A 3DO3A 4QTIH 2EXWD 4M8QA 1U3ZA 2V9RA 2GAZA 3NFSL 3BE1L 1JRHH 1EEZB 3VWKA 3QEHB 5F7LB 3HI1A 2H2SD 4HKZA 4GRWF 4LOUD 4WUUD 5IJKC 15C8H 1PLGH 4ODUB 2FBOJ 2DJUA 2EH7L 4DAGH 3LDBB 1AGDB 3QUZA 2G75B 2JJVA 3W0WD 5E56A 3A6BH 3S36X 4YX2H 2ZNXA 5DQJB 1DBBL 3FO0H 4JRXB 4ODHH 1BF8A 1FGVH 5HHOB 5FUOH 5F89B 4BFIB 1JRHI 5JORA 1J8HA 1JN6A 4RGMC 1MCRA 4MXVE 5JHDB 5LQBH 1V05A 2EXYD 1NMCC 1AY1H 2F53D 2CLRA 2NYYC 1Z3GH 2DKUA 2CKNA 3BUYB 2ZUWA 3V5HA 5T3XL 4HWEH 4PJDB 1H5BA 1TITA 3D39E 1S9XB 4J1UA 4PS4L 1I8IB 1N5AB 2VITA 1DFBL 5ICYA 4NKOA 5I1GH 3EHBD 4K2UH 3OR6B 2F74B 1MI5A 4WW2C 4V1DA 4LU5L 4F7PB 3SE4C 5IHLB 5JXAH 2ADIB 2AKRA 4CVZB 3HNTL 5DTFB 1JTOA 4G3YH 2R8SH 5INDA 3WN5A 4KK8C 1NMAH 5D7JC 1B0WA 3FB6B 4N8CH 2R69H 2VZVA 4G6JL 1ZT7B 2NY0C 4Z77B 5AZEL 4C56A 5ICXB 5J12B 3IDYC 4Y4KD 1FVCB 3SGEH 5HHXL 1EFXB 3QEUB 2FB4H 4CN6A 3UDWC 4OF6A 4OKDA 2ADFH 4KKAD 5E5RB 1VFOA 2R1WB 4HFWA 2PCPA 4QGTA 3E6HA 2AEWA 3MRJB 5CZXC 3P3YA 4XAWL 1A7NL 2J1KA 3QUKB 3V6FA 3LDBC 5GGRY 2ATPA 1HKLL 4FQLL 3QDGB 1IFHH 2GI7A 4JZOB 3QDMD 3D85B 4PJAB 1B88A 3ARVA 3HR5A 5J7CC 4PJDA 3RTQC 3V6ZB 4L8DB 5EBMA 3MRKA 1NAKL 4ZUSB 3V6OA 2FBJH 5F1SA 2CLZA 5ID0A 1F3JA 3E6HB 5IT2L 2Y6SC 2Z93A 1QEWB 2OL3L 4FABH 4MNQA 5GGQL 3KLAB 5AYUL 1WWAX 3EO9L 4MAUH 1OM3L 3UZEA 5DT1H 4ZAKD 3ZTNH 3FOLA 1EO5A 5HHMB 1T5XB 4E41B 3GGWB 1U8MB 4XNQB 5DRZB 3W9DB 5L2KD 1JWSA 4PJ9C 1I7TB 2AERT 2BVEA 3MUGB 4P4KA 4GKNA 4Z7QF 3OGCB 3OZ9L 3NIFE 4TTDC 4YHLL 3OKOB 4QRUA 1A6AB 5GRJH 4NCDA 3GNML 5IMKA 3H9SD 3G5XB 5E6IB 4KJWD 4YR6B 1BZQK 2CMRL 5ESAA 1EZVY 1Z9SA 2A6KB 3MXVH 5IMLA 2O5YH 4QXUL 4PJCE 3AM8C 1C7SA 2CDFB 3SDXA 4A2LA 5GGVY 4ZOEA 2QSTA 1R5VA 1WLHA 3BEWA 4PGZA 5ESVA 4PB9L 3ME0A 2E9WA 3TNNB 1K9TA 2IPUK 3NFSH 1EVTC 4JM4L 1JCKA 3T3PF 4RFOH 4XVUD 5DD6A 5HGHB 3KNBB 1INQB 4JLRB 1G6RA 3BSZH 3PJSA 2JCCF 2LFGA 1GGIL 2VZ3A 4HJJL 1GHFL 2DD8L 5AYUH 5C92A 5JMRA 4P23B 5CD3A 4Z95L 1JYNA 3QCUL 4UQ2A 5K59F 1JGVL 4OZFA 4NOBA 4RAVA 4LMQE 1LO4H 4PLJC 2BERA 3G5VB 1QP1A 1DFBH 1I7ZA 2APVA 3UEZA 4YK4B 3LN4B 3IVKA 3NZHH 3BX7C 5KVFL 3MRNA 3FFCA 3MOQA 3KYKL 2YBRA 2EECA 2Z93B 4EI5D 3G04A 2P24B 3TNMB 1QZ1A 1QLFB 1UYWH 3KYNA 4QNPE 3IDYB 4C54A 1S5HA 5CJXC 5GISH 4YHYC 3NMEA 1NCBH 2ZOKB 4JZOA 2PTTB 4LVHB 4CJ0A 1RQ5A 1K3ZA 4LSRH 1NSNH 2OZ4A 4Q2ZB 2FLBT 2BP3A 3H3KA 4XVTH 5M95B 4PJEA 4P2OA 5EZJB 4P3WA 4RWHA 4MX7B 2YPKA 4FP8L 4KJPC 4DUXA 5BO1H 5JPNA 2VSCA 4RAUA 4YE4H 5FUZH 3MBXH 4WTZA 1WZ1L 2I27N 4TRPL 3DSFL 4I2XE 1FORL 2JJSC 3RWDA 5EN2B 3QXDA 4PJCB 2NY7L 5F96L 2VN7A 5FKAA 3KPSB 4OJFH 1SJEB 3I84A 5E8EA 3D3VD 1MI5D 1V5JA 5E6ZA 3RWJB 5DUBA 4EOWL 1CLYH 2GJ6A 2WIMA 3LV3B 4R8WL 4Y5XB 1L0YA 5MP6H 4BQ8A 1P7QD 2RB8A 3OKNA 2D7TL 3O3UN 5EPMB 4OV6F 2EO1A 3VH8A 3NOIA 5LXGH 4DKDC 3BISA 5C9KA 4LKCB 3CUPB 2A6JA 1EHAA 3DHMA 3CFCL 1J86A 4ONHB 4PY7B 5DWUL 3VMOA 2GJJA 1EV2E 3RVWD 4HUUB 4DTGL 4YDKL 3L7EA 2XN9D 4HCRH 3ZTJH 1OWWA 1RIUL 5EUKA 1J0IA 2H6PB 1DANU 1TNNA 4G7VH 3WXWH 1RK1A 2CMRH 4LMQI 3IFNL 1IM3B 4M62L 4U0QB 1SEQL 2H6PA 3NIGF 4NM4H 3P4NA 4D9QD 3NABH 4ZTPL 4DW2H 1AKJB 2E27L 1ORQB 3VFNA 3TFKC 1D5XA 4AIXA 2NY3C 5HVFB 2NY5C 1BOGA 2M26A 5D8JL 3RI5F 1CT8A 1OY3B 1TZIB 4F37K 4TN9A 5FM4A 2HKHL 4OIAA 3SGJC 3W5NA 1QHOA 3C6LC 2IAMA 5J6HA 4YIQA 25C8H 2FIKB 3TJEH 5ERWA 1UA6H 4MQXD 4ZPTA 1BOYA 4BSVB 3ZLQC 1D6EA 3JVGC 2GUOB 3MRHB 4LAJH 5SWQA 1NGWB 4NKIL 1CGSL 3SPVA 2B5IB 1SQ2N 4M8QB 3TT3H 1MF2H 3VXRD 2IPTH 3L3JA 4YHKH 2JJTC 4FQPA 1CF8L 1G7MB 3MOAL 5FKAB 4KPHL 4DFIA 3GMNA 1R0AL 5EU5A 3GSVA 1LNUA 5TE4L 5BRZD 3NZHL 1TVBA 4KV5F 3BIKB 1NCNA 4QHKI 1LK2B 2FEDD 4O2CB 4JHBA 2BZDA 1LK3L 5C0GB 2AS5M 1N4XL 2E7CA 1GCFA 3IFNH 3FT4A 1HHGB 3C60B 3RWCB 1O7VA 3KJ4C 4RGNB 1LO4L 3FQXB 1CE6A 2J8UA 1Y6NR 5I1AA 4PB0H 1XGTA 4ZNEA 1KCUH 4I4WA 3CLFL 2JB6A 2F5AH 4Y7MA 4ONGH 3O4OC 3RHWK 5KVGL 5LBSH 1FAKT 5HYJB 3DBXA 4D2NA 1CD8A 1FRGH 4JE4B 4OGZA 2OX5A 5AAMA 5IB2B 3JWDH 4P2QD 4PJEE 5IK3B 5I2IA 1ACZA 3AXLB 2DB8A 2FRGP 1FDLH 5GS0C 2GJ6B 4H8WL 3MLUL 4OLUH 4JZNB 2ORBL 4NHCL 3GMPB 5HGDA 3DYMA 3U6RB 1HXMB 4RZCA 1X5IA 1FL6B 3O6LH 4M1GL 4Q58C 4XAKE 5EU6A 4E42A 4DKEL 3OXSA 5JW4M 3VGHA 1WITA 4AY0A 1T04A 4X6BA 2DS4A 3U83A 3KJ6L 4QRPB 2H26B 4LK4A 3VXOB 4U6VL 1CE1H 4MX7A 1JPGA 4NWTL 1NGPH 1AO7D 4NQVA 1QACA 1BFOA 5FM5M 2Y36H 5IM7B 2A9MH 4PYHA 3DO7A 3PGDA 1FFOB 2F19H 2FHFA 2D31B 5T3ZE 1G7QA 1MFCH 1CDIA 4M1DL 2Q7NA 3ROOB 4EJ1C 5TPWH 2DQEH 4Y2DD 2HLAA 2X4UB 5DD0H 3MV01 2BNQA 3DVGA 3QA3A 2X89D 5C09E 3S36H 1AFVH 2P24A 2MKWA 2NY7H 3G5YB 3DWTA 1QSFE 4OLVL 2P8PA 5TGBB 4K23L 2YKLH 1PDKA 1ITCA 3O6FD 2QL1A 1HH6A 4Z6AT 4IRSA 1NCCH 4P2CG 3O45A 1KELL 5CWSA 4EQ2A 2ZCHL 1P9MA 1AD0A 2AAVA 4GRWB 4PJBF 3F65A 3VRIA 4JFHE 4PV8A 1JGVH 3DRQB 4MQSB 4KRPD 1RSFA 5J1TC 5D4QA 4ERSL 4LCUB 4ZSOA 3FHAA 3HUJF 1OVZA 2CR3A 2D7PA 5GISL 1MLCA 2J4WL 2XNAB 4K3EH 4FMFA 4PRID 2HFGL 1RZKC 3KNBA 4N0CD 1CQKA 1U8HB 1QLEL 1QO3A 4L8DA 1U8PB 1M71B 4D9QE 3DX9A 2Q6WA 5D7SL 4X4XA 2DI7A 2BOBA 1CBVH 2JE8A 4N9GB 4DEPB 3X14A 3ZE0E 4XI5D 4M02A 4ZMAT 1FFNA 3CSBA 3LRGA 4JFEB 2H2PD 1T2JA 3LS5H 2VLKE 2YXMA 4AM0A 5AG9A 4LU5H 5ESAB 1IGFH 2BX5A 2DLEA 4OZGB 5A1AA 3BWUC 2L0DA 3H6JA 4OCWL 4UDTA 1KB5H 4JO1L 3GO1H 3BKMH 4BFBD 2CJUH 1R3KA 4HIEA 3LKRA 3C5ZD 4JCLA 5J4MA 2BHZA 4DK6A 3OXSB 3VG0L 4JRWA 3K2UL 1JNNL 2ICWJ 2H8PB 4AEHH 5HY9B 5D1QA 1VFUA 2BY0A 3MV7E 3O3BA 4XC3H 4R8WH 5HYQA 3SJVA 3MV8B 1A3LH 1CL7L 1JFQH 5T5NG 1N6QH 5F3HB 3WFCL 4TUJA 5T1DH 5E8NB 1Q9OB 1RZJC 4GRLB 4LBEA 3UXFA 4R3SA 1H3PL 2AXHA 4OZGA 3QT2A 2NY5L 4FQJL 4TPRL 3B2UD 3QH3B 4PJIA 2GT9A 1IC5L 1N6VA 3SDYH 4UT9H 3JWOC 4XCYA 2ILLA 5GGUB 4LLVA 5I6XB 5CINL 3FN9A 1Q9WB 4WWKD 2ESVB 3DNKA 4CBPA 1G9ML 1WAAF 2CLRB 4LSDA 4XGZB 4TVSa 3GJFH 3VGGA 2AJSH 4K7PY 4DW2L 4JG0H 1I1CA 5IEKB 1DN0B 4V2CB 1C5DA 2AEIT 1S7QA 1NBVH 3SDCA 4N0YH 5F3HA 2ZZUT 5F89A 5E9DB 1H3TA 2UZXB 3SKOB 4D9LL 1A6VH 1JBJA 1IKFL 3C09C 2DQEL 1LNUB 2OTWB 1NEUA 1E4XI 5IQ9A 3WHXB 2ZSVB 3QNZB 4FQ1H 4PGCB 1MCOL 2FO1A 2HTKC 3O6LL 4M1GH 4QRSB 4RFEB 4UMGA 4JN2B 5IJVA 2M2DA 2ZCLH 4NC1C 2EIZB 1T20B 2WINB 2VZOA 3MRPA 4X80H 4FZEH 3UC0L 4V1DB 2FNBA 4BUGA 1JZ8A 1BLNB 1YMMA 3ZO0A 3P4MB 2ZUSA 4ELMB 3HMXL 2GKIA 5IVXE 5L8JB 1FPTL 3N1GC 2YRZA 4NUJB 4H25A 3FO2A 4S1RL 1T2QH 1QTYT 4TUOB 1G7HB 4Q6IC 4HX1A 3TJEL 1WCQA 4KZEH 3H0TB 2D0HA 3OJDB 2Z4QA 1YC8A 4LCUA 4CL7A 4N5ED 1NFKA 1U8JA 1WCBB 3IGAB 2XOTA 4WFHD 4YHIB 2FJHA 5FF6A 2MNUA 4MLSA 1INDH 2QKIB 1WFUA 1MWAL 1S7RA 2MPAL 2XN9A 5MEOA 1IEAA 5D1ZC 2X40A 5K9OA 4ODBD 1OTTD 1ND0B 3R8QA 1FFPA 3RL2B 2EH8H 2BHYA 5F9WC 4PRIB 3X3FH 2ZWLT 3L3GB 3HAEG 2A74A 4Y1AD 4HUNB 4CJ1A 2BNRE 3VFUB 3T0XA 3JV4B 3PL6A 1MVUB 2X7LA 1EFXD 3BO8A 4NSKA 2NY4B 4WVRA 4X6CB 4O5LL 4HPOL 4CMMA 3FN0H 2VABB 3TO2A 4JFFD 4XXCC 2C1PB 2Z9TA 2LTQB 1GGCH 1N0LA 2ZCKL 1L7TH 2CO7B 3EYSL 1D6VL 3GMMB 4MWFB 4EUPG 4O02H 4HDIB 2E7HA 4I9WD 4P9MH 2VKXA 3LIZH 1A47A 1FL5A 3OL2A 5F88A 1NGXB 3BE1H 5JQHC 3ZYOA 3B2VH 2I60H 2OQJB 4JZJA 3RZCD 1RUAL 4KKNA 4UV7L 1JNHA 3ARXA 2AJZA 4LDEB 2EEAA 1S9YA 1NANI 4WCYH 2X4OB 2HRPL 4PRIA 4UIKL 4KC3B 4FXKB 1JFQL 3MA9H 1KT2B 2GITA 5E8PA 5D1XA 4NZRL 3U7YH 2R1YA 5DMGC 5IB2A 3MJ6A 5KSAD 4TQEL 1GZPB 3IXAB 4P57A 1FV1B 1S7XB 2V9QA 4F7TA 4FMKA 4XX1G 3RPKA 3MLSL 4XHJC 1GOHA 5I1JL 1LQSR 2DL2A 3HZMA 1HYSD 1D5XB 3OSKA 1B0GA 5HVHC 4JY6A 5I1AB 3HE7C 4DK3A 4MAYA 2J8UB 2ARWA 4LSQH 1HHHA 1YEDA 4RBPH 4UB0H 4Z76B 2FECI 1IEBB 5E08H 5IHBA 3BZFA 1G6RB 4NUGL 3PP4L 4JVWA 2HH0L 2YEZB 1ZGLB 1FO0L 2XZCL 2H32B 5HGAA 1X4YA 2F58H 3NA9L 1HQRA 4F8TA 2R1XA 2D03H 1AY1L 3WJJC 4YGVB 1FV1A 3B9KD 5DURB 5IVXA 5LGHL 2BC4A 3UTSB 3VH8B 1XH3B 3OV6A 3BSZL 4N0FA 4Y4HD 3G6AB 5FECB 5EA0L 5ISZE 1AD9B 2F8OA 1QYGH 2R0LL 3NCCB 5A2FA 4IDJL 3DX7B 1NUFA 5F7FA 5C09A 5DGRA 4KKLD 1TJHL 5J9PA 4Y2DA 4YZFF 1MJ7H 4A6YL 4PTUA 3MRFB 3BKML 3V79C 3BRFA 3WV0A 3NTCL 3V0AC 1FL3A 3EYUL 4G6JH 1OAQL 4XT1C 1E4XL 3NCBB 1JNJA 3EYQD 3KLAA 4OSUH 5E8DH 1SM3L 3BMVA 3MCLL 3EAKA 5HVWA 1BVLB 4LSTL 3ARTA 2DIAA 2WLZA 5A2LH 3RU8L 4BZ1H 4ZXBA 3WUWB 3BQUC 2VE6A 2WBJB 3I6GA 4ZUSA 3G9VA 4OD3H 2FX7L 3QNXB 5IQ7L 4OQTH 1LE9A 4HWNA 3PXHA 1DLFL 1RMFH 1MFCL 3VGEA 2WWKT 3BZ4A 3X3GH 2QADD 5JW3L 4EBQL 3QDME 2LTQC 3AREC 3O8XB 3RKDD 4R7NB 2I07B 3JUYA 3EO1A 3O4LE 3T2OA 4UOW0 5F9OL 2AEPL 1UCTA 4TRPH 1YYML 3H7BA 4ODXA 3BMWA 4I2XB 5F1IB 2KKQA 1AXIB 5F1NA 3C09B 3PGFH 1IRAY 4X5XB 4MHHG 1KACB 3BVNA 2HJLB 5BXFA 2XKNB 3V4PL 4JDZB 3STZA 3G5VA 1YEHL 4PLKC 3IFPA 1L7TL 1I9JH 1U8JB 4OQTA 2V5SA 3MRIA 4O02L 1LP9B 1H3XA 4FQ2L 4YHML 3IDJB 3MNZA 1VPOH 3DUHA 4U1MB 4N1HB 4MJ5B 5BOZG 5JZ7D 3MBED 4L3CB 1WEJH 4ZFOB 2VLJB 5C8JB 2UWEE 2JB5L 2ZSWB 3TWCL 3W0WB 4JQXA 3SN6N 4JFEA 1NL0H 4W70A 1LE5A 3CMGA 3THMH 5CEZL 3L1OH 1CXLA 1QFWI 1QSVA 4NQXB 5SWZA 5DHVA 2FX8H 3W9EA 5CGTA 3ECBB 3EOAB 1DR9A 2DQHH 3E8UL 3Q5YA 4OCLC 2OP4L 1MFBH 5KVMC 5BQ7B 1MLCB 4JQIH 2B0SH 3QHTC 3FT3A 1MCEA 4BFIA 1X44A 1OP9A 2ICES 4XP1L 3LN4A 3UC0H 4I3SH 5J11C 1FGNL 4WWKA 2DQUH 4E41A 2DWEB 5B3NA 4HULB 2IAMD 2EDYA 4QRQB 2VSDA 4U31A 5EUOF 3ARBB 3M17A 1G9EA 4ODUA 3IDXL 3VDAA 4P0DA 3DYPA 4GUPA 3QNYB 2VXVL 4Q0XL 1OLLA 4HKZB 3CZFB 1JYVA 1HWHB 1T80A 1HHJA 1WEJL 3AU1B 1MF2L 5DK0B 1YUHB 1AXTL 3BPCA 4JRYD 1TJHH 5IW1A 4K94L 1T0NA 4Z8FH 1NQBA 1A1NB 2XG4A 3UO1H 1ZA3B 4CAGA 4GMSH 2AXGB 3W82A 3SKJL 4JREB 2HH0H 4PS4H 3EO0A 1Q9WA 4L3EE 4NGHH 5C0DA 2CK2A 3UYPA 4YXHL 1MREL 3IRPX 4X6FA 1UQSB 1MIML 1IT9H 1OLZA 1QSZA 2YHGA 4NP4H 3PP3K 4UV4L 1BECA 4MVBC 4ZFOA 3EFDL 4PRNA 5C8JA 3OAZK 4YFEA 1EJ6A 1DBAH 5IMKB 2NY1C 2R1WA 1JPGB 4NO2B 1Q9OA 5DZNA 3QUYB 3DRTB 1TXKA 5ENWB 3PHQB 1FYTB 4NQCA 5TH2A 1CFBA 1ZVYA 2QSCL 3D0LB 3G6DL 3SJVB 3C8HA 1JPTH 2GTWA 3TYGL 2VLRA 2EKJA 2BSTA 3IFPB 1MCNA 3QB7C 5KSAA 3RY5A 3ARGC 1FZJB 1MRFH 3MNVB 3KXFD 1XR9A 3MLPA 4IRJB 1ZGLP 2P43B 4OGXL 1KNOB 1BEYH 3RIFF 1SVCP 3LEXB 4C4KT 4Z77A 1XIWC 3B9AA 1QFUL 4HIEB 5AAWA 2BSRA 4CDHA 1G7JA 4PJ8B 2YPLD 2DIJA 4CVXB 2VMFA 5INDB 4JREC 4G6AC 1WUNT 5FYLL 2E7MA 2DDQH 1OTUD 2I60L 3KS0H 4U6XA 4ZUTB 4DGYL 3OKKA 1AGCA 1RY7B 1XFPA 2HJFA 1F3JB 4LFHD 4XPHH 2BJML 3VA2C 5BS0D 5JIPA 5CILH 4AM0B 1M6OA 1C5CL 4MNHA 1QSFB 4U6HA 4RMWA 5JW4Q 2P47B 1HSBA 5BZDB 3D2UB 1EBAA 3SGEI 4XCNA 3OKEB 2DM4A 3TIDA 4LIQL 4K3DL 4TTDD 1MH5B 1F90H 1DLHA 3MRJA 3V4VL 4EN3D 1A6TB 5GRZA 43CAB 4FN0A 4FQXD 1NAMA 3ARSA 4QRRB 1AQKH 4F7EB 1J8HB 1Q72H 1XCQB 2OK0H 1KSRA 2VL5A 2BXZA 3MLXL 1TVBB 2APTA 1EFXA 4LPCA 3PABA 1IGIH 5FHBH 4PBWD 2MOVA 2A6DB 5C0CD 2BDNL 2R23B 3R0MA 1SYSA 4J3OC 2CIKB 3S7GA 4PRDB 3IU3B 3TA3A 2OCFD 1YNKL 3NA9H 3I3DA 2QEJA 4LSVH 4XBGB 2IEPA 4RMTA 2OXGA 1ZE3C 1MRDH 4FNLH 1KBGH 2CUHA 4X9HA 4PJGA 5FGBA 3T4YA 1BQSA 1FLRH 3K0WA 2APFA 3L3DB 2C3VA 3P9MB 5ERWB 4Q74A 4MB5A 1TIUA 3S3JA 5I8EB 3RIAF 4ZO8A 1TJIH 3LRSA 3L3IB 3TIEB 1YY9C 1ZHKB 4LLUB 1QR1B 3T65B 3T2NL 4ZO9A 2XPGA 3DGCR 3MLTB 5GRUL 3N85L 1DN2A 3PABB 4YHKL 1ACYH 1KENH 1L0QA 5AWNH 4KPHH 2P5ED 2PYEA 1CLOH 1CD1B 2R29L 4S2SB 2VWEE 5EOCJ 3GSNB 1OD7A 1T1ZB 4HWBH 3LKOA 4KK5D 4QEGA 3ZL4H 2JKXA 3SQOH 3L7EB 2BMKA 2X4RB 1Z5LA 3RIFK 4CVWA 4MD0B 3FRPG 3WIHH 3CIQA 3QAZC 35C8L 4XNUH 4DKFL 3FMGL 3NGBB 2FLRT 2X10A 2NMSA 3D69A 1U8NA 4KQ4H 4POZC 4KI5C 4HBCH 2XQBL 3QUYC 3TP4A 4KJPD 4U2ZA 3HI1B 4I48A 4ZPVA 2X4SB 3LV3A 3I3BA 4LAQL 5KG9B 5DQDL 3GMQA 3Q6FA 3SO3C 3QWQB 3KXFA 4PRPE 3HC4L 1VA9A 5DD5H 3U7WH 2NR6C 4MLIA 1FVEB 1ZEAH 3QXDB 3RNQA 3SEPA 4GS7C 5DF0A 4PG2A 1D3CA 1YYMH 2XRAH 2NNAA 4NO3A 3W81A 3S97C 1U2HA 4KVNL 2OJEB 1JUFB 5EIIA 3PWJA 1E28B 1FYTD 1RFDH 4XTRD 2C1PA 4IHOB 1AE6L 2OZ4L 5IV2B 3CX5K 5DRWB 4GG6E 5GIRA 1NGZB 2N4IA 1LK2A 5HYSG 1YECL 1VPOL 4U1GB 1HINH 5EU5B 1HK6A 5DHYB 2ESVD 2FGWL 4Y16C 3NCYS 4NNYA 5LGKA 2AK1L 2ZOKA 2DBLH 4HBCL 2N7AA 1S3KH 4ENED 4WO4C 5I15L 1G7IB 1IGTA 4KY1H 4LVNC 5EO1B 4YDVA 4O9HL 3TO4B 1U8OB 5CILL 2COQA 3BPOC 1YUHA 1IAIL 4FQQB 5EBWB 4ZXBD 4WHCA 3QBTB 3GRWL 2KUTA 2YBRB 1S8DA 2DI8A 2ZJSL 3ZT7A 4EVNB 4YNYA 3SDDC 3V9FA 4J7RA 4NKIH 2FWOB 4PJ7E 4PGJA 5SV3A 1H3PH 3CNKA 5EO0B 1FNSL 3ILQD 4ONFL 1WBZB 1SMOA 3VU2A 2G9HA 4MA1C 5FF6B 3UJJL 4O2FA 3OXRB 3T0EB 2J6EL 2YPLA 2Q7YB 3WDHA 3SDAC 2FJFA 5DDHB 3HZKB 1U93A 4JJHA 2VNCA 3GSNA 4KQ3L 1Q9KB 5I74B 1JNLH 3CC5B 4JB9L 4PJ7F 4OI9A 3CD4A 4OLVH 3B9VA 3KPRE 4EI6B 1D9KD 2FL5B 4HUUA 4AENB 4KAQH 3H9YA 1QFOA 2BFVH 1MIMH 1QD0A 4PJXE 3CJJA 2DWDA 3O2DH 2YK1H 3MV9B 4L3AA 1R5WA 3BP7B 2DYPB 4ZSOE 4HKBA 5KSBE 3QUZD 1JL8A 5I1CH 5I1DB 2A6KA 3KLSA 1AP2B 3MGAA 1SVZA 3P4OB 1B6DA 1QBBA 3ZE2F 3MBEA 2K7QA 3P0VH 3MCKA 4U3XA 1KULA 4P23D 4X8XA 4I18A 3DIFA 2IALA 4O00A 1KIQA 2CK0H 2WWMD 5TE7L 4K8RC 4XBGA 4UINL 1R5IB 1NUGA 5JUEH 1KFAH 3ABZA 5IIEB 4PGCA 1CXFA 1NKOA 3BEVB 2OYPA 3CDFA 2HG5B 1SHMA 2GJZA 2AJUH 2XICA 3I02A 5J3HC 3TYGH 1S9VA 3ARDB 4JFOA 1QFWL 1EGJL 3GM8A 2XI9A 3MACL 2YUXA 4M6AA 1KLUB 1Y18B 1Y6KR 2VR5A 1SEQH 1XCQA 3ULVC 2IH3A 1F8TH 4B7IA 1UG9A 3VDCA 3BP5B 4KMLB 4HJ0C 5CKAA 2OMBA 3ARYA 5D7LA 4KTEH 4GS7B 2FD6H 4Z7VF 5TQ0H 4XH2B 2RFXA 4EIGB 4K3HA 4QO1A 1NEZB 1WFOA 1YPZB 5M94B 1S7UA 1LE9B 2ZP0T 4WW2A 3MCG1 3TV3L 5E99H 5GGTA 1YEEL 2GT9B 2XQYK 3HRZA 1XGQB 3VD3A 2J7LA 5DD0L 1TCRB 1QFUH 4UILL 1JZ7A 1SY6H 5E8NA 5E00B 1G0XA 1YEKL 2IH3B 1T66C 1CTNA 3JV0A 2EH8L 4HXAL 1CFTA 2LU7A 4G6ML 1MCPH 4G8EA 3QIBD 4HIXH 4PIRF 3DXAA 4X6DB 3GK8H 1UZ6F 1MUJB 2WIIA 3UDWA 5B21A 2NXZB 1YEHH 1JGUH 3CCHA 2X4TB 3FRUB 2NY3B 4H0IA 5F9AC 3BEVA 1IFHL 2JK5B 5CSZA 5I1LB 3SKMB 3D0LA 5FUZL 1BM3L 1A9EB 4XVSL 3IKCA 3L3KA 3SE9H 1HCVA 5JNYA 4YHZH 4LOUC 1NSNL 5ANMB 1KJMB 1JGEA 5T33H 1RUML 3MTRA 4KK9C 1FNGA 1INQA 2X5PA 3GSNL 2AK4D 3MC0A 4GW1B 1UJ3C 5EU6E 5HI5D 4ELKB 4Z8FL 1JWMA 1IGYA 1P5UA 4HK0A 3HNSL 2X4PB 2CDGB 3MMEB 3VWJA 3MLXH 5E5MB 4BFEA 2J8OA 4KRMB 5ANME 4PUBL 1YNTA 3GRWH 3SDXB 3S5LB 2FECL 3HC3H 1I85C 5CGYD 5GRWA 4NBYB 5BJTA 2NXZC 5DMIL 1HZHL 5T3ZD 4HGWB 1K2DA 5KSUA 1HNGA 2AV1A 2QQNH 1HHJB 5ACLA 2Z35A 5ALBL 2VISB 2HLFC 2ICEB 1PY9A 2JIXA 3H9SA 1UXWB 4NQDB 2J6EH 2BY3A 3OMZA 4WHDA 3MRRB 3QRFM 3TT3L 4LPWA 3H9SE 1CDBA 2Y1VA 4G8FA 2PXYD 4IRZL 3K4AA 5ADOH 1W0WB 5B38G 5B8CC 1PZUB 1DUYB 4YHOH 4P5TA 2HJKB 3MLWL 5IEHB 4GFTB 2O5XH 2IBZX 3TZVA 1NL0L 4G6KH 3PHOB 2JJWA 3QEQB 3RWHA 5C1MB 1B90A 4FG6D 5C0AE 4KKBC 1EMTL 3VFOB 4G9DA 3RUGB 4GAGH 5FYKE 4KMTL 8FABB 4Z7VA 4G8GE 1S7TB 3PQYD 2DQGL 3QHZL 4KK6C 4APQB 4PJEF 4HHAA 1MY7A 4EZMA 1J9CT 3QFJA 4ISVA 5EBGA 1CGTA 1WZ1H 4P2QE 5FYLD 4P4RA 3B9DA 2DF3A 3BJ91 4U1LB 2DTSA 5GGTH 3UTTA 4Q9CA 4KROC 5E6YA 5I15H 2WQRA 2R0ZH 2R9HD 2EDRA 1WTLA 2D3VA 2D0FA 4HMEA 1FVEA 3WD5L 5C0RH 4QHKJ 4IRJC 4XP9L 1NBYA 5MERB 4M7LH 5DTFA 4X99A 2RJMA 4PJ8C 4XVJL 1A6PA 5FO9A 4TVPE 4XWGH 3MRGA 1FRGL 4KU1A 3E1F1 2A83A 3BJLA 4NZUH 5DVMA 5HYJA 4Y5YA 1YNLL 3S35L 4NQEE 3BYYA 1C16A 1TZGH 3OB0H 4G7YH 5A2IH 3BPLB 5D6DA 1YN7A 4WI2A 3Q3GB 3NBNA 4XNMA 4L9LC 3WUWA 4LGRB 4MA3B 1AGEB 2YS4A 4L9DA 4KAQL 3J7HA 3LQAC 6FABH 4UTBL 1UM4H 1LO0L 3DETC 4LF3B 2EDWA 2R0WL 2VDNL 1LD9A 3O8XC 4NNXA 5L9DL 5CJOH 3VI4F 5IFJA 1KCRH 1T6VN 4L1HA 4R4ND 4YDIH 5D7JB 3LHPH 4LLMB 3RUGA 3T65A 2JCCE 3HNVL 5LVEA 3VFGH 5F6IC 5D8JH 1MSPA 5C09B 3VRLE 2V2XA 3GSNH 4DZBB 4BA8A 3P30H 3T4YB 3HKFA 3MR9B 4DZBA 3BPLC 5FYKU 4UUJB 4U33A 3WXWL 4B7LA 3MV7B 1HE7A 3HMXH 4CW1A 5A40E 5JW5A 5IF0A 2IAMB 4NZJA 2DQHL 1QQDB 4YHNA 1KXTB 5F9DC 1V3JA 1A5FL 1CVRA 3L95B 4YUEH 5D2NA 1CVSC 1DDHA 1M7DB 1FH5H 1X3DA 2A1WL 1PG7W 3PUCA 1T6WA 4L4VD 4BKLA 2ZNWA 3RL1B 4U6YB 3OKMA 3MFGB 3S9DB 4LCWA 5LQBL 5GRVK 4E5XA 4BSWB 3U9UA 4EI5A