4QWWD

Crystal structure of the fab410-bfache complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMHWVRQAPGKGLEWVARIRSKSNKYATHYADSVKDRFTISRDDSQTMLYLQMNNLKTEDTAMYYCVREGSYYDSSYGAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Snake Venom Acetylcholinesterase in Complex with Inhibitory Antibody Fragment Fab410 Bound at the Peripheral Site: EVIDENCE FOR OPEN AND CLOSED STATES OF A BACK DOOR CHANNEL.
pubmed doi rcsb
molecule tags Hydrolase/immune system
molecule keywords Acetylcholinesterase
total genus 50
structure length 225
sequence length 225
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwD01
3WFBL 4HK0B 3MV7A 3O2VH 3TNNA 2F54B 2IAMC 1CF8L 5I2IA 2A9MH 4IRJD 1INEH 2UVFA 4U6VL 3K74B 2WP3T 1A1NB 3LKPB 5JTWA 1MOEA 2G2RA 4L1HA 1VADA 1HHGB 2NY0C 1HKFA 3K2MC 3KLAB 3U9PL 1WC7A 4HJJL 1G6RH 1T3FB 3NFPB 4XP4L 3IAGC 1BEYL 2CPCA 1PJ9A 4L3EB 1JPFA 2W0FA 1NGZB 3QWRA 4FQPA 2GK2A 3CFJA 5BRZB 2ATPB 3MMEB 3ISWA 3LD8B 3TEUA 3HNSH 1D5MB 3WSQH 1KCSL 4HXBH 4NWUH 4XCNA 5ILTL 1J87A 4P0DA 5JW3L 5DYOB 2KZ1B 3QUKA 1TVHA 2UY7A 5BV7H 3SKUD 5I0ZA 5GISL 5ETUA 1ZLUH 1D5IH 1G9NC 3BIBX 4R26L 1T03H 3Q6FB 2YXMA 1NGWA 5AEAA 2I9LA 4IIQA 4OZGB 1CFVH 2AXJA 1OTSD 3DXAB 5IQ9A 5DEGB 3VJ6B 3M07A 4K9EH 5JIIA 1L7IH 4X6DE 3T77A 3MRLA 4XBEH 1N5AB 1NQBA 2WBJB 5IFJA 1XR9B 3RY4A 1MWAL 5F1KC 5CEYA 2R4SL 3IDGA 4B7LA 1CU4H 4ZTOL 2VXVH 1P4BL 2Z35B 5J1SC 1XIWC 4PG2A 2PR4L 2UV3A 4GG6A 3R8BB 3WO4B 1TCRA 1U8MB 3KR3L 3C60D 1CL7H 4PV9B 4WENB 3SJVB 4G8IA 4I4WA 3RPIA 4ETQB 1XMWA 3ALPA 1KNOA 5CFHA 4L4JA 4LEOA 2CKBH 3JTSB 3NA4A 5C0RH 4M43H 4Z0XB 1NGWB 1UGNA 4G9FB 3HAEA 5F8QC 3IFLL 5TDNA 1LO4H 5HGDA 3UPRB 1AHWB 3WDHA 2IAMB 4HUKB 4TRPH 3SY0B 4M03A 4YHOL 1R24B 4PTUB 1AY1H 3C8DA 3RDTB 3GSNH 3RVXC 4FQQA 1QFHA 1A21A 3SBWC 4GAYA 3BQUA 1G6RA 4KJYA 5H37G 4IIQC 1TITA 3EJJX 4CU7A 3DI2B 1RMFH 5ANME 4PRID 3PABB 3E6HB 3S98A 4QXGH 5IB4B 1NEZB 1LILA 2XRAH 4MAYC 4OUUA 4YEFA 2VQ1A 3CFBB 2FJGB 2VLKE 5A2FA 2B2XH 1LDSA 1MFDH 3O4LB 1CE1H 1QSFB 3V79C 3HAEB 3MJ9H 2PXYA 1C16A 1OAYL 1U8JB 1JRHL 1IBGL 1AQKL 4E9LA 3CVHH 4NDMB 2VITB 3B5TA 4LSQL 4PY8J 4ZQKB 1U8LB 4FTVB 2VZVA 5IIEA 4EUPH 3UJIL 3QNZB 5CGMA 1KPUA 4YDLC 3T0XA 4NQEE 3W5NA 1FNEA 5EBLB 3UCRA 1TVDA 1BHGA 3E1F1 5IJVB 4QRTB 5C0AA 3U36B 4S2SB 3ARQA 5CD5C 2CKBB 4R2GB 3HE7B 4K7PL 3EO0B 4N1HB 1SQ2N 1U93A 5I1LB 2ADJB 1IGFL 2AERT 1W2KT 3EFDH 3BE1L 5ISZD 4YDIH 4H20H 1UJ3C 1JYXA 4K3JH 4M6NL 2D0HA 5EUKB 3SDDD 4X98B 4OI8A 4N0FB 1HHGA 1DVFA 2V5SA 2IPTL 1UG9A 1OARL 1XR8B 4K3EL 1QR4A 1D9KA 3RJDA 3MFFA 3KWWB 1GAFL 2Q20A 1WZKA 1N26A 5JHDA 5K9JL 5D1ZC 3RTQC 4JFYB 2AK1L 1UEYA 4G8GE 4CADB 4QRTA 4PRDA 4NRXB 5C0CA 4H1LH 4PJEE 3PHOA 3PWVB 2DQEL 4Y2DC 1OSPH 3HCVB 5DJDB 3JWOC 3TVMD 1AHWC 1GGCL 4OM1L 5BXFB 3GSNA 5KSUA 3FB5B 1D6EB 2VMFA 3W39B 1V3MA 1JHLH 2WUCH 2DJ4A 5E5MB 3MRHB 5LJYH 1ZWIB 2W65A 4FZEL 3FAWA 3L3DB 3LS4H 1SYSB 3RL2A 4HH9A 1NFDB 3NFSH 4Q9CA 5DFVC 4XCCH 3TZVA 2UWEE 1DE4A 3A6BL 4EQ2A 2GKIA 4OD1H 5IFJB 2V6HA 1KJ2L 1IEBA 5E2UL 3SGDI 2W9DH 3ZTNH 1I8MB 2H45A 1UM4L 4G3YH 5KTEH 4LCCA 3WHXA 4HGMA 2VDQH 3C87A 3GMMB 3CVHL 4Y1AB 3SQBA 3W2DL 2DQTH 2R56H 2Z31B 2CRIA 3O2DH 1NGXA 3BDYL 5C09B 3SE9L 1CFSA 4P5KB 3KS0J 1JF1A 2WIMA 1A4JA 5DFVD 4LSSL 5DZNA 3QCUL 5F1NA 1P1ZA 4TUKL 2ZSVB 4G9FA 4HK3N 1F4WL 1IGJB 2JELL 4HIXL 1CE6A 1ZVHA 4ELKB 2X5PA 4LPVA 1YPZF 4KK5D 3IKCB 3NOIA 1WEJL 4H26A 4MXVE 3VXPB 2Z91A 2ZNXA 5HXMA 2YUVA 4RQQA 2X10A 4UQ3A 3DV6A 4W6YB 2PW1A 2VB5A 5IHZB 2QADC 4G42A 3BRGC 1YUHA 4TSCH 1X5XA 1VB9A 3DVGA 1I1YB 2SEBA 4OLYH 4P2YA 5GS1A 4PJGF 4LCIL 3U0PA 1G7MA 2VOTA 3AC0A 3SDCD 2IANE 1BQLH 4F7PA 1PY9A 3V7AE 2DQCH 1FNGA 2X89A 3TA3A 3UP1A 3EOTL 2OJZH 4QTHA 1WWWX 1KXTB 5HHOE 1P9MA 1QSEB 3A6CL 3UZVB 1YYLL 2XTJE 2FZ3A 3VD4A 3LKRB 4PRBB 3GMOB 4JFDE 4LLDB 3JWDC 5IHBA 3CIQA 1IM9B 5DD1L 2WINB 1U58B 4JEGB 2P5EA 1ZEAL 3L3HB 3QFJD 3REVB 3T3MF 2A6JB 4ORGA 2DLTA 3GJFK 4HWZA 4BH7B 2D7TH 4TVPH 4WI7A 3I50L 1F6AA 3SHSA 3OHXA 4JZJB 4QRQB 4ZUTB 3CXHK 5LWYL 4GRWF 2XTJD 4IDJL 3MGTB 3GMNA 3SDDB 5C7XH 3BRDA 4YDJA 1OSZA 1XGUB 3RZCA 5E8EB 2GTZB 5JMRA 2W9EH 4UT7H 2ILLA 1JFQL 4KVNH 4O5LL 1KEMH 1IAKA 1XT5A 3BSZH 4JR9L 3MYZA 1RUML 1ADQH 5D2LF 1HH9B 2HJLA 4O58L 3FONB 1A6VH 4HF5L 4LLDA 4L4VE 1CXEA 1AO7E 4PJAA 5E9DD 3KR3H 4LNVA 5EU4A 3PE9A 2HJFB 2VXSH 4NT6A 2P8LB 3D39A 4IRSB 4Y2OA 5E2JA 3RGVC 2YMXH 3DIFA 1K3ZA 4TOYL 3CJJA 3CC5A 3T0EB 5BS0B 5ENWA 3MNZB 3MJ8B 3DX6B 1QBBA 4OZFB 5T1MB 3TIEB 5DRWA 3HB3D 5EU3B 1EEQA 4NM8L 4JPWL 3L7FA 4OTXL 5TE4H 1A2YB 5E9DE 1XF5A 4K71B 5T1DH 4PP2A 3MLRH 2UZYB 4LRIC 1JV5B 5EC1B 4PGDA 1F4YH 5BCAA 2EDTA 2AXGA 4PP1D 3AREA 5HY9B 1ZLSL 3CDYA 5EU4B 5FYKD 1M4KA 3R4DA 5I1KL 1XIWA 4PG2C 3ZKXB 5LXGH 1FO0A 3GBNH 4HBCL 1A6WL 3TO4B 4KROD 1CG9A 3DUUA 1DBKL 4HG4J 4ODTH 3S36L 5I74C 3HE6D 3LEYL 4G80A 1ZGLB 4HJGB 3BIKB 3P11L 5F93C 1MJ7L 1TIUA 1IMHC 3P30L 4MNHB 3EYUH 3PDDA 4LVOC 5F88A 1P1ZB 1OPGH 1GH7A 5C0ND 3V95A 2APXA 2CXGA 3BQUD 4OTXH 4Y5VB 2C3VB 4DUVA 5A40E 2X05A 1FL6A 3K8LA 2EKSB 4IS6A 1QEWA 4NRYB 3VI4F 2Z91B 2OL3A 4Y5VC 5DT1L 1BGXL 1T83A 3T0VA 2KH2B 5JW4Q 3KYNA 4K7PY 2H1PL 5IFHL 1P7HL 3ARSA 1T03L 5SWSA 3U4EA 25C8H 2JLLA 1GGIH 2FRGP 3BIKA 5GGVL 3U0PB 1VFOA 4AMKL 5HYFA 4MHHI 1O7VA 3OMZA 1GC1L 1RK1B 2HLFC 1OTUD 3TPUB 4ZFGL 4JVWA 4RZCB 4EI6B 4CBPA 3I50H 4JFQA 4N0YH 1YNKL 4JFYA 4WI5A 1N5YL 2JJSC 4LQFH 4Z7UE 1EJ6A 1VPOH 2DYPB 2W60B 3DRTB 4N5EC 5DD1H 4OIAA 3LH2H 4D94A 3KXFD 4HUMB 1Z5LA 5EUOB 4KVNL 1U8NB 5CUSL 3M1BB 3BN9C 3X12B 3VXME 2YD2A 4HS3B 4F2MB 5ICYB 1C1EH 3LN9A 4JKMA 3DJ9A 1FC1A 3DHMA 3QZWB 4ZOEA 2X4PB 4OI7A 5DT1H 4GG6E 3PDGA 4HH9B 5LBSH 3BZ4B 2DB8A 4KKAC 1CLOL 3QEQA 3WIIL 2EEAA 5HVWA 3LKQA 1GPOH 3VFNB 4TOYH 4XCYB 4YHNA 3OXSA 1DQTA 2Y36L 4QHMA 2Y06L 1JL8A 3EYQC 4BH8B 1T66D 4HBQA 1N4XH 4NJ9H 5EZLA 4PJ8A 2D2OA 4EDWH 2HFEB 3FOLB 2DTML 3KGRA 1GGBL 4MD4A 4HJ0C 4WW1A 4P5MA 4XCNB 1FG2B 3EBAA 3QUXD 1UB6B 4KDVA 3WIHL 5F96H 4NQTA 3IU3A 4JANA 1B6DA 1EK3A 1JTPA 1I85C 5A2JH 1G7IA 3O4LA 2C1OB 4MXQD 5CGYD 3MJ8A 5I1KH 3RL1B 4JN2B 1T66C 2H26A 4XCEA 4FFWC 5J89A 1P5VA 3ARGA 1BOGB 2A6KB 5E6IB 5E6ZA 3QO1A 3FO0H 2A6DA 3FB8B 4GXUM 4M02A 4R0LC 5D6DC 4HKXB 3NZHL 3TN0A 4CDHA 1L0QA 2RQ8A 1QSEE 5DD5L 3ARDA 2M1KA 4LFHD 4WI2A 2EDJA 3P0GB 5HY9A 2UWEB 2VLRB 4ZOAA 3E3QE 3DX7A 4O4YL 2X9YA 2VAAA 4JFFA 5MEPA 3ZYIA 4L8SB 4Y4HB 4M5ZL 1NSNH 3L95A 4LK4A 3L1OH 4X98A 4G9DA 3G9AB 3HUJE 4QGTA 4JN2A 2PYEA 1KJ2H 4E5XB 4KZEL 1JZ5A 5HHOB 4ZXBA 4M5YH 5DRZB 2A9NL 2EICA 5T5NG 4UQ2B 3ZHKA 1IM9A 1VEPA 3C5JB 1JZ7A 5DMIH 4JM4H 3PV6B 4YFEA 3FZUC 2NY3D 4FOMA 4LPWA 4ELME 2J88H 3DMMD 3LKNB 2VL5A 4UIMB 3S6CA 1A02N 3N85H 2J4WL 1GZQB 1P4BH 4FQXA 1QLEH 3ARBC 3HC0B 1OAXH 1GRWA 2V9TA 5CCKH 1RZJC 4X6CF 2APVA 4QTIH 4WHCA 3QCUH 4YIQB 3MTRA 3GI8L 1A7PH 4W4OA 4P57A 5T3XE 3TO2B 3DTXB 5JNYB 3BT2L 4W4NA 1VFAA 1RIUH 3Q0HA 2NY3C 4XBGB 4X8JA 1AP2B 2P8PB 3O11A 4ZPTA 2QQNL 1FP5A 1FIGH 2C7UA 2LFGA 4XT1C 4XNQA 4LLAA 4W70A 1A0QL 1KGCD 4PJAF 2FX8L 2XQYG 4OZ4A 3ZTNL 1NFKA 1MJ8H 2I9TA 1ACYL 4I0PD 4F57L 4OGXH 3WHXB 2HTKD 4PRHA 1SY6A 4OFDA 2YC1A 3K8MA 4H0IA 4YHPA 4QRRA 5IV2B 2X9XA 4JQIL 4LCWD 4WDIB 1ED3A 4XVUC 4JHAH 2H2PC 3X3FL 1JWSA 5MP6L 5CSZB 2E8YA 3QUYC 3SKNB 3HNTH 4MS8C 1KJVA 5CP3H 5KSAD 5ITBH 4QEGA 2FB4H 5MENB 4KFZC 1ORQB 3IJSA 2JK5B 4OQ1A 3GO1H 2QR0A 4Y4HC 4OV6F 2Q3AA 3QQ9C 4CVXB 4I0PC 4FQXC 4IMLB 3VRJB 1JYVA 2YD9A 1MIEL 2YPLB 3HAEG 4YE4H 4LBEA 4XC1L 1RIUL 3LMJH 1KJMA 3NIGF 5E1AA 2AEIT 3DROA 1NSNL 4MXWL 4N8VG 1BPVA 1EO8L 4GAFB 4WW2C 4DEPB 1P7QA 4P5TB 5A3ID 3CFJB 1R5VB 5CD3B 1OD9A 4GW1B 3T8XB 1MEXL 4ZSOE 3NCYP 2FJFB 3OKNB 4X9FA 3BN9D 2CK0H 1ETZA 1SMAA 1DANT 1JPTL 3VDAA 1H3XA 1ROWA 3Q3GA 4NBZB 2BNQE 4GW5A 4BKLA 4U1HA 3ZTJH 4UTAH 5JO5B 3RKPA 3VD7A 1HHJB 3ARRA 5GSRB 4LOUC 4NHUA 4HGWB 3UC0L 4M62H 4NCDA 5B39A 3MV7B 4DUWA 4LRNH 1KJ2B 3EOTH 4EEEA 1WZLA 3VFSA 2RR3A 5FOJA 1X5IA 1DQJA 4XH2B 4PJBA 5MERA 2FLRT 1MWAB 4RIRA 4M61B 5DHYA 3MGOB 4PTTA 3M8OH 2DQEH 4CN4A 5I1HH 4WHYH 3MR9B 3UTPE 1XGUA 2D03L 3BKYL 4XNXL 3RZCB 1MFDL 5JHLL 2B4CC 4TTDD 4HCRH 5EN2B 3V6OE 1HKLL 2DF3A 4H88L 5EOQH 4NRZB 4ERSL 2F5BH 2J8OA 2G75B 3JVGA 3P30H 2D3VA 4K07A 5BV7C 5CJQH 2FX7H 5C6TH 2ZUSA 2IFGA 2YS4A 1W0VB 3ZE2F 3VFSB 1CFNB 3N85L 3VXUA 4GG8A 1KTLA 4KQ3H 4K7PH 3TM6A 2VDMH 4Y4KD 1JHKH 4DGYH 2QQNH 1WK0A 4ODVL 1MCJA 5MENE 4HWBH 4XVSH 5HYJD 4AG4H 2W9DL 5EWIH 4I3RH 3I75A 5HD8C 5I1AB 3CU1A 4FQIH 3T3PE 5D5ME 5J6GA 2W1NA 4HIEA 1ZTXL 1OTTC 3HNSL 4MJIA 2PYEE 2I24N 5EUKA 1JK8A 4QNPE 1T22B 5KSBF 4OUUB 3ZE1E 3VFMA 1E6JH 4RRPG 5H94A 4MD0B 2VC2L 2B0SL 3TO2A 1VDGA 5DWUL 3IGAB 1IGFH 1ZT7B 1ERNA 3GHBH 5KS9F 5F7KC 4I4WB 4OFKA 1XIWB 3HI5H 1NJ9A 1HHIB 1BM3L 5FGRA 5CMAB 3VH8A 2HKFL 4KMTL 3F12A 4QRPA 2BVOB 2K7PA 4XCEB 5E8PB 3MOQA 4U1LA 3C6SB 4M6AA 4MDIA 2IALA 3ARPA 5FYKL 4J12A 1X5KA 4MJ2A 1BJ8A 4WEBH 3UTSD 4G5ZL 3JWDH 4QNPF 4PY7B 1FC2D 5C0JB 3MSPA 1A7NL 3ZDXE 4L8BA 5C0RL 1KIRB 2Y07L 4P99A 3VFVA 1FFOB 3WFEL 3WXWH 3KYAA 4NNPL 2R8SH 4LF3A 1DLFL 4QLRA 1I8MA 4D9LH 1AGBA 3BJLA 3HE6A 3AU1A 1R3JA 4UU9B 4KI5C 3NFNB 1GGBH 2Q7YA 3OKEB 5DD0H 5HYEA 4JO3L 3UTSE 5IT2L 3I3DA 1JF1B 4KK8D 1A4KA 3GZKA 4LKXA 3TFKD 4DGVH 4XGZB 4PJ7F 1MVFA 2OTWB 5CS7A 1MWAH 1P5UA 1DBAH 3WJJA 5EOTB 1GZPA 4TN9A 2AV1A 2R0LH 5FB8A 2X1WL 3BPLB 3VXRB 1UXWB 3RFZC 5INCB 4GRMA 2DICA 4WU7A 1GGUA 1ZLUK 4K3GA 4UB0L 3O41A 3HFMH 1IEAB 5BJTB 3DUUB 4JHWH 3DV6B 3MRQA 5ICYA 5DJ8B 4JFFD 2Q7YB 1MCPH 1FHGA 5T5NF 1DVFB 3NPSB 2WNGA 1ZVYA 1XR8A 3VXOB 5J06A 2EDBA 2IPKA 5TE6H 3ZL4H 5JXED 2FGZA 2AJYL 2ARWA 3KPMA 4JO1L 1Z9OA 3IDNA 4L3CB 1XH3A 4LLUB 3L6FA 3UJJH 4JB9L 1H5BB 1NUNB 2E9JA 2I27N 3SE4A 3HRZB 3S97C 2GI7A 4PRDB 3T0AA 5BV7L 1DUZA 2NTSP 5C6WH 1XGQA 4OGZA 2W38A 3QYCA 1ZHLA 1MFBH 3V6ZA 1EEYA 4CVZB 3CSYA 3OX8B 4Y5YC 3UAJC 3VRIA 1Y18B 4KZEH 3I2CH 3U30B 5IB5B 3IXTA 2XA8L 4L4TD 3SBWA 1AXIB 3RKDC 5JW4R 2XTLA 2P8MB 5FECB 4YPJA 2AQ1A 4XXDB 4XP1H 1S7RB 5F9JB 7FABH 2H26B 4NQDD 4AM0B 1OT1A 4RX4A 3VRJA 2R1XB 4NZRH 4Z7WE 5KSVA 2QQKL 1UENA 3B9KA 3UZEA 1H3UA 2NW2B 1Q38A 3MRKB 6FABL 1R6VA 1W72H 2VL4A 3UAJD 5GRXG 2V7HA 4DVBB 5J1AA 4G43A 4HXAH 4UMGA 1MRFL 3I6LE 4OF5A 4XNYH 4DCQB 1A6VL 3RUGF 2VJXA 3UBXG 1WVZA 4KKCC 3QUMH 2QKIB 3VXNB 5F97E 5IP4A 1S9XB 3MJ7A 2GSGA 4O5LH 4WEUD 3B5GA 5I9QC 4LNRB 4LLQA 1RUKH 3PQYB 1Q9OB 4MAYA 2FR4B 4P4KC 5GS0C 1FCGA 1C16B 1WBYB 1E4XI 3UYRH 2Q6WA 1S7SA 3HC3L 1Q0XL 5IVXE 2VN7A 4MZ2A 3RVTD 3Q48A 3X13B 2GY5A 2BNQB 4XMKH 1UT9A 5A2IH 2PXYD 3U1SH 5L88L 1N0LA 1I4FB 2PCPA 2X4QB 2IALB 4NO3B 1JYWA 1CGSH 4PRAA 5GGVH 5GS1C 12E8L 4ZODA 4KU1A 2L7JA 2VABA 1J86A 1K5NB 2MCPH 3FFDB 1MCKA 5EUOE 4ZUUA 5BMFH 5CEXA 4MA1C 4ONFL 2YRPA 2DLEA 4XPGH 3DVGB 3E8UH 3KPRE 4HZLB 4EOWH 3KYOA 4KQ4L 1HH6B 5BVJB 2NY5C 2QHRL 1EEZB 1UCBH 4GFTB 1E4XH 4ENEC 5HGHB 1D6VL 1P4IH 5I9QB 1QSZA 2F53B 1DFBL 3HE6B 3TJEL 1TTFA 1N6QL 4KRLB 3LEVL 5GJSL 4HQQL 5EZOL 5HGDB 3UPRA 1EFQA 3ARZA 3IU4L 4MSWB 1YECL 4NN5C 5HHME 4HWEH 1OP5H 4DK6A 5FUZH 2JJVA 1CFTB 3P11H 5IEHB 4FFZL 5AWNL 5LAXA 2YD5A 3HUJF 2XKUA 2EC8A 3RVVD 3PGFL 5E2VH 2NX5A 1LO0L 3PV7A 4HUUB 4QWWD 3T0EC 1RZFH 1DCLA 4V1DE 3DYPA 5I0DA 4MQXD 3W82A 3DHJA 1F6AB 4LHUD 3BGAA 4PRHB 4KVCL 1R3KA 1LEIB 2VR4A 1RJLB 4OCSL 4JFFB 1A7OH 1J05B 3TVMA 1JPSH 3RBGA 5ITFA 3JZ7A 4JRYB 4PIRF 2KKQA 1A64A 3GSXB 1BMGA 5D70H 4APQB 1CICB 4D0BA 1JJUA 4MD0A 2X4OA 3V7MA 4NP4L 3T08A 4DKDC 4W4OC 4FABH 5E2UH 2XICA 4HIIA 4C56D 4X4XA 2VXUL 4RZCA 3GSVA 4Q6IC 1YY9C 5BO1H 3B2VL 2EDFA 3OKMB 4FXKB 1C5DB 5IGXL 2VLMD 3TV3L 5GS3A 1H15B 3DUHA 4OZHB 1E4WH 4DKAA 3KXFB 3VD9A 4X4YA 4ZO6A 5EU6D 1FV1A 5F7LB 4YEEA 1U3JA 4Q9QL 4WV1B 5D7KD 1OF2A 5FIEA 4WCYH 4PRPD 4NJAL 3QXAB 4PPTA 4XC1H 4NM4H 1IQWH 2FDBP 1FYTA 3OZ9L 1VKXB 1LEGB 5F1NB 1BBJA 3MLZH 3KYMA 4PJ5E 5E8DL 5H2BA 3BZ4A 1UKTA 3JWOL 4NQEB 3WLWC 4JO2L 3ARVA 5C3LD 4AM0A 2ATKA 3RWIA 1J1OL 1O7SA 4XPBH 3DVFA 1GVIA 2VLJB 1KB5A 1CXKA 5JXEC 3ZE1F 5EIQA 4N90E 3SDYH 5EBGA 4HWBL 3DLQR 4ZTPL 3VU2A 1LD9A 2HAZA 5C0CB 1I8IB 3VXTA 1TMCB 1QBAA 2XY2A 2BRRH 3ZDZF 1NGQL 5K93A 1SMOA 1C5BL 5E5RB 3QI9A 3HI6H 3GBLA 3DARA 1UWEL 3FB6A 3PQYD 4BFGA 3QAZC 4WFFD 5E8NA 1FFPB 4HX1B 4HIJA 2CR3A 1T4KB 4R7NB 3VGFA 4PJGA 1ZT4A 3KPOA 3O3DA 2ATKB 3QRGH 4K8RD 5CZXC 2VLJA 4J8RB 3BPNC 2V5MA 1HHKA 2YPKA 2B4CL 1H8OA 1K4DA 4JO2H 2P1YA 5BZWA 4OLYL 1UA6H 4NPYA 2VNCA 1M6OA 4OB5L 4YHIA 1JNJA 1BBDH 3C8KA 4GW4B 5IHUL 4G8GA 4OJFL 1YPZA 1IL1B 4JY5L 4MQ7A 1YEJL 3NH7L 4YHKH 3THML 4A6YB 1EBAA 3STLA 3L3GB 2C1PB 4HS8H 1ZT1B 2DQIH 4J23A 1MVUA 2OTUA 3UTQB 1GAFH 2BNRE 5HHNA 3W11D 1U6AL 2XWBA 1XEDA 2FSEA 2BCKB 2O5YL 3IS1X 4PJ7E 3T1FB 2DBLH 1M7XA 5IGXH 4N8CH 1EERB 4U1HB 3JVGC 4O02H 5GSRA 1FBIH 3S34L 3FN0H 2QV2A 2DIBA 3MUY1 1EUUA 5CP7B 3OAUH 3MLVH 1K6QH 3OBAA 4ODWA 3CXDL 1B9ZA 4MXWH 4PB0H 3RVUD 2KBGA 3ES6A 4KXZI 4QHKI 3QCVH 4ALAL 2BNRD 3W11C 2WIIB 1MIEH 3WV0A 4KMLB 4JJ5B 1KB5H 1S5IH 3HLAB 1JGDA 5DDHB 3VGGA 1MCOH 1G6RB 1ONQA 2GJ6B 4KJYB 5HHVL 5DZLA 3QNYA 3DGCR 3IDIB 4JRYD 3VRLE 2ADFH 2RCSL 5DMGC 2X4SA 3B9KB 2UY6A 5GHWL 5A2KH 3GJEA 1UWXK 1JGLL 3RWJA 4NJAH 1JV5A 5EC1A 4U1SB 3SCMA 1JGVH 2G5BB 4S0TD 1URLA 2H41A 2Z8SA 4XBGA 3A67L 1MAMH 4XNYL 3ARWA 3BPOC 4M7LL 3JXAA 4BA8A 3RPIB 1S7XA 2Z92A 3VFGH 1GGCH 2AGJL 2FX8H 9CGTA 2CO6B 5CINL 1MJ8L 5E8OA 3SO3B 3T1WA 3DX8A 4CMHC 1JNLH 1ONQB 2GJ6A 4X9BA 1X5ZA 3IDXH 3H9YA 2KQMA 2WBJC 1HI6A 2X4TB 1D3CA 4Y2DA 2ZUWA 2VL5B 4M1GL 4UIMA 2XN9E 3TT3L 3P40A 3ZHDA 4P2QA 4CL7A 2ESVE 2W65B 1F5WA 5D72L 3SDCA 4PJHF 4FHBD 1KJVB 4XNUL 1REIA 3CU7A 1DN0B 4HMDA 4G6KL 4ZFOA 1L6XA 4ZS7H 1DBBL 1MIMH 4OV5A 3EOBB 3HG1A 5F71A 3QJFB 3HUJA 1OP5K 1HIML 1YY9D 3G5XA 2EYSB 1UZ6E 1L9NA 5E4EB 3FKUS 1JPGA 4Y1AE 1OWRM 1C7TA 5F9AC 3QWRD 3D2UD 3BGFC 1OT2A 3GMMA 4I18C 4PRIE 3LH2L 3ZO0A 5INDB 1A6TB 4L1DA 3BYTA 2LAAA 4PJ9C 1MELA 3D85D 2MJWA 3K8KA 1CXFA 5TQ0L 1P6FA 4HJJH 1N5YH 3A67H 2VLKD 5IWLC 1QLFA 4RFEB 5IB1A 4JO1H 1H3GA 2B1HL 3EDKA 4GKNA 4EJ1C 4YBLC 2QQKH 3W0WB 1R5IB 4QHLB 1VACB 2GAZB 1EO7A 1TVBA 5B22A 4GKZA 3DVNB 1C7SA 5E99L 1GPOL 3O8XC 3JV4B 3PNWB 3D0VA 1CGSL 5FYJU 1GZQA 1U0QA 5CEZL 3CCHB 4HHAB 2YA2A 2LVCA 4OIBA 4UU9A 3LQMA 4XMKL 3ALXA 3OR6A 1LK3L 1ZA6B 5CP3A 5CD5D 1A6TA 4A6YA 1MCLA 3NIDE 1SVZA 3WKML 3CXDH 3FT4A 3KDMA 1RQ5A 1CFQB 3B5HA 5HYQA 1D9KB 5D1QB 2P5WD 2QQLH 2X4NB 1H9VA 2MQCA 3DSFH 4Y16C 1MRCH 3KPTA 4O02L 4R26H 3SE4C 2NY5H 1T7YA 1JNHA 4YZFF 5C09A 4BUHA 5FFLA 5SV4A 1NC2A 1S7WA 1W0YT 2J7LA 5FHBL 3VGAC 2FX9L 1Q72H 2VRAA 5C92A 1J11A 4Z7QE 1CK0H 2VSCA 3FT2A 5JW4N 3EW3B 4RFNB 4YK4C 1AFVL 1IAIM 4X5WB 3KPSA 2WINA 4OGYH 2XPGB 2NLJA 4JPWH 4YGVA 3VXSE 3IU3B 4EZMA 3IJYB 1U58A 3RHWK 1T04A 4GRLD 5IMOA 4LSRH 4XVJH 3QQ3B 2HVKA 4YR6A 1FLTX 1MUJB 2A0LD 4RQQB 3QDJA 3S3JA 3P4OB 5D2NE 5SX5K 2E7LA 3B9KD 5KJRH 3NCCB 3K2UH 4DKEL 4NSKB 4NN6B 1U8HB 4K3DL 1GL4B 1YNLH 3NA9H 2AXHA 3WBDA 2AEQL 4F7PB 1PKQB 2XWJB 4M9PA 4QCIA 4QF1B 1FORL 3RTQA 5DGQA 3MLPA 5DK3A 3GHBL 3QDMD 4PJIA 43C9B 3TN0C 2G60H 2HN7A 3G5ZA 4HS3A 4XAWH 4LSUH 4F2MA 3HI5L 2APTA 2NY4D 3OKNA 4LQ1A 1DBJH 3GSOB 1Z9LA 2YBRB 4BFIB 3MUHL 1DBBH 3SGDH 2AJXH 4GS7B 1QFWL 3FO0L 3QIBA 2H2SD 3P4NB 1GHFL 3QDJB 4O2EA 4R7DB 4G6JH 5D72H 1OGAB 3A0OA 4U1JB 2F5AL 1RIVH 1G1YA 3G04A 4NWTH 3PDOA 3FJTA 1BQHG 4BELD 1DDHB 3BYYA 3PP3H 4JVUA 5DMGD 1RZJL 1EIBA 1IEHA 3RAJL 2NY4C 1IVLA 1J7VR 4ODHH 4QF1A 3ROLB 2ZCHH 4JN1L 2B1AL 4FQJH 1I1YA 1G0DA 2OZ4L 2Q8BH 1T5WA 1T7VA 5J13C 3DVIA 4P2RB 2XZCH 5IBTH 3ARTA 1G7MB 1LP9F 4JZOA 1MVUB 4LASL 3JWOH 2A73A 2R0KL 1G7IB 4A2MA 1EFXA 3K4ZA 1R3JB 4LHUG 5J3HC 2QHLA 3BH9A 3H7BA 4M8QB 2FR4A 2AKRB 4F15B 3MRRB 2DN7A 3RU8L 5KVEL 1KPRA 4LEXL 3R0NA 2E7BA 2VXQH 2DKMA 2XXCB 4CGTA 5D71L 5E00B 1JNNH 4HIIB 2KL6A 3U46A 3AAZB 1G7PA 3U0TA 5HJ3B 5L2JA 5GRVK 5MEQA 4KV5E 4GKNB 4LCCC 3LS5H 1GZPB 5D7LD 3DXAE 1BQHA 2FGWL 3C6SA 2VDNL 4Z7WA 4YUEH 4BSVA 4K23H 4X7TB 1MRCL 1UWXH 1SJHA 1SJVA 2NY5L 4PJHA 5B8CB 1H8SA 4P2OD 1QEWB 1J12A 2D7PA 2ORBH 4YQXH 1TENA 1U8OA 4I48B 1JGEB 2P48B 3AY4C 4FFVD 5FHAH 2E7HA 4K55A 3WKMH 3C2AH 1FYTB 4ZO7A 3JTTA 1QYGL 5D7JA 1PG7W 4H8WH 1QSFD 4NHCH 3NN8B 1J0IA 1F3DH 1GC1H 2FATL 4P9MH 1F45A 4EI5B 1YEEH 3CZFA 1NFDA 5ADOL 5D1QD 2P5WB 3E6FA 4F9LA 4HIHB 2F8OA 2XWTA 4UIKH 1P6AB 1JPFB 1UWGH 3BKMH 2FHBA 5T5FH 1VA9A 3C5JA 2UUDK 4POZD 3QEHB 5E4IA 1X5GA 2ICCA 3EKCA 2GT9B 2OSLA 3TCXA 4Z7WB 4Z77B 4NQCA 5FO9B 2FO4B 2AJUL 3RVXD 4MD5B 1V8HA 3HE7D 5I1LA 1YN7A 1NANI 1D6VH 4RA0C 3JV0A 1ZHNB 3EJZC 4ZD3H 4P23C 1OD7A 5F6IC 3MV9E 4NFDA 5D2NA 3P3YA 5ITBL 1Y6KR 5EZOH 5JW4M 2P24A 3I85A 2WQRA 1KXVC 2BY2A 4QRSA 2ZUQB 4NQDB 5CJBA 2DM4A 4WHDA 5EULV 1OGTB 4LLMB 3SDXA 2EE6A 1NBVH 4L8BB 1EZVY 3MFFB 3TZVC 3V4UL 1I9JH 2ZP0T 2RCSH 2DL9A 4NHUB 5CIPA 5MHSD 1BZ9A 2VDRL 4UOW0 1I9IH 3SCMC 3S35L 5JXAH 3RGVB 4RGNB 1HDMB 4GRWE 4P23D 1R3HA 4LLUA 4H88H 4G42B 3DI3B 3IVKB 2BY1A 2MCG1 4PREA 3GMLB 4WY7L 5F3BB 4KKNA 1I7UA 3IDMA 3LQZB 3Q5YA 4I3SH 1S78D 4YHPB 5IVNA 2AK4A 1FDLH 4GMSH 5D2NB 2DQIL 3BDXA 5T1LB 4JCLA 1ZANH 5ISZE 3OV6A 1JNLL 1AXSB 3M1BA 1BIIB 3HZYA 3MV7E 2BXZA 2CKNA 2DBLL 3SDDC 3PHQB 2IAMA 2NYYC 2IMMA 4NO0B 5IVXA 3P73A 5EOCL 3QFDA 3VXRE 2J4WH 3BPCA 5I76A 3WCYA 4PLJD 3VJ6A 3P9MB 4PGCA 4K2UL 7CGTA 5HTSA 2QSVA 1K85A 4GXUN 4Z18A 5I71C 4X0KB 2PTTB 2PYFB 2IH1A 3S5LA 1P7KB 2CUIA 1BJMA 3S36X 3L3KB 4FQ2L 3BH9B 3D3VD 3H7BB 1K4CA 4N0UA 1IGML 4GUPA 1NH6A 4OD3H 1FRGL 2HLAA 1YPZE 1NAMB 2OS7A 1AQKH 3DMMA 2GUOA 2NXZC 3HI1B 4IMKA 3IB4A 3QXWA 1KFAH 5DQJB 2R1WB 2QADD 5HJ3A 5MEQB 2IANA 4LKCA 4MA8L 4FMKA 3CDGB 3U6RA 1EMTH 4NNYA 1NGQH 3IXAA 4G6FB 1LO4L 4NCC2 5CINH 3R06B 1JWMA 4N5ED 4QHUA 5CCKL 5C1MB 1MWAA 1RJZA 3I9GH 4OF3A 5DEZA 3LDBB 2BRRL 2Q7NA 4Y88A 1CN4A 4URTB 5DD3H 1Q94A 4NZTL 4AJ0A 5GGSA 5BW7A 1VEMA 1DBML 4DVBA 1VFAB 3ZKND 3BMWA 5CKGA 5FCUH 3SDXF 1B4JL 3RTQB 1A0QH 4XP6L 2VYRE 5HBBA 3EOBA 1ACYH 2CIKB 5K33A 4F57H 4JREC 2AJUH 5HHMB 1VENA 3FO9B 4U0QB 3QIWB 1F8TH 3KJ4B 1VFBB 2Z8VC 5KVGH 1KFAL 1I9RH 4NP4H 4MAYB 1BZ7B 4ISVB 4JQIH 3W9EB 1E4WL 1EVTC 3P4NA 4OFYD 3FHQA 3PWPA 4X6CA 1QVOB 2D7OA 4RFOH 1FVCA 2D7MA 2DMBA 4ELMB 2ZOLB 4ZAKC 4NWTL 1SHMA 1T2XA 4YHZL 2O5ZL 3SDCC 4CKVX 4Q0XH 1PX4A 2F9BT 3EO1A 5J6HA 1FGVL 4P23A 3ZYZA 2XZZA 5C6PB 2GAZA 2ARJA 1R3LA 1RUKL 1I1FA 2N7BA 1HXYB 1V3JA 2R0WL 3F7PC 4PBWD 4KI1A 4P2RA 3UBXI 2VZTA 3PNWA 1DUYB 4M1DH 1CT8B 3GRWH 2DLHA 2BJML 3DTXA 2YD6A 2N1KA 4JG0L 1LHZA 5JNYA 2BMKA 1QRKA 4M1CD 1PY4A 2E6PA 3SQOH 5E8DH 2XXMB 5GRZA 4X4XB 3U4BL 4XHQA 5D1ZB 1A7RH 4JO4H 1D7FA 5F7MC 4XPTH 1YMME 3DX6A 3QFJE 5F96L 5B4MD 3S9DB 1FVCB 2CLRB 4L8CA 3MZTA 1A3RL 4F7EA 1LGVA 5D96B 3TCLB 4OF0A 4LP4A 4HAGA 4OZIE 2ZPKL 3QR2A 1NGZA 3WIFA 4PS4L 1CTNA 4HH8A 1RUPH 3MYJB 3MREA 3HRZA 4YBHA 5I8CA 3ARYA 2WQ8A 5BZDA 4UOJA 1GGIL 1I3GL 4LSVH 3PL6C 3LEVH 5GJSH 2HFTA 4PJFF 3RL2B 3ILQC 5H2BB 1S7UB 4RWYL 3HR5B 1ORQA 3IJSB 1I9EA 2EDLA 2IQAA 2J12B 2R4RH 3O4LE 3OG4B 3RGHA 1Z6JT 1D5BB 3KYKL 1MHEB 3MRBA 5EFIB 1C1EL 1D9KC 4H1LG 2OZ4H 4A6YL 4CJ1A 4NHCL 1FVDA 5GIRA 4XRCA 4LMQI 4RNRB 4F7MA 5C0GB 2P5WA 1OP3H 1IRAY 2GJJA 3OAYK 4H5SB 1EJOL 5DUBA 1IT9L 4HS6B 3PL6D 4FFYH 1RIVL 3HB3C 1MRFH 12E8H 1J8HE 3MRKA 2O5YH 5FO9A 3QEQE 1B0GB 3U1SL 3QUMB 4X6EB 4TUJB 5HVFB 4XMPH 1VGEL 1FGNH 4JGUA 5AZ2L 3CGTA 4EN3D 3UYRL 4PLJC 2OJEB 3DBXB 3T65A 4WHTB 4NQXA 5FYKE 3D39E 1KGCE 4M6ML 2OJZL 3HA0A 2A6JA 3NCMA 2AS5M 2EDEA 4YHML 1ZXQA 3QIBB 2Q3ZA 3B6SA 4R2GC 2PW1B 3O0RL 4LPTA 1F02I 1E4XL 2BSRB 1DQML 5IROA 4MQ7B 5FA3B 2FNBA 3QEUA 4JFQB 4Z0BH 4CN1A 5TQ0H 4B7IA 3EYOA 1A7PL 2AJSH 1HCFX 4S11A 2VABB 3QIUB 5C0BE 3IGAA 3DOSA 3M45A 4PREB 1MCEA 3WNOA 4DFIA 4J4PD 2E9BA 3BQUC 1I8LA 4TQEH 2OR7A 4QYOB 4OCSH 3U7YL 2XFXA 1VPOL 4R2GD 1WT5A 4Y4FC 1G1CA 2ADIA 1UXSB 1C8PA 5FHAL 1W8OA 1XAUA 4MVBD 4MYWB 3NTCL 5BS0A 3T0EA 1ZT4B 3O3DB 4XHJC 3HZYB 4ETYA 5A3IC 2BJMH 1S7RA 2ENSA 5F9JA 1V7ML 4XP4H 4IRJA 2F8VA 5C0BD 4CNIB 3EYQD 1G7HB 4M1GH 4D0DA 4ZUVB 2HT2D 2E9IA 4LDLB 4KC3B 3LSOB 1F00I 1XF5B 4UDUA 4E41D 2VDKH 2WUBH 3QUXC 4KKLC 3DSNA 2AV7A 1JK8B 1XGRB 2YPVH 5C09E 5CSGA 5EORL 1RZ7H 5DJAA 5F1IA 3HR6A 4EDWL 4BZYA 5E2TL 1WAAF 2X44D 3OKEA 4Y0GA 4RISL 3K4DA 4Q9RH 3GJFA 1WFNA 5B3JE 4E41E 1AR1C 5TDOA 3MNVB 4I0PA 4F58L 1UJ3A 3K46A 4CU8A 2MOVA 2R2EA 2CLRA 4L8CB 1HILB 4HBCH 5IW6A 3OJ2C 4JR9H 2PNDA 4Q7DA 3S88H 1JBJA 3W0WD 2YN5A 1OCWH 5AYQA 1HSAA 1C5DA 4FS0A 5CHNA 2YD1A 1T1XA 2X7LA 4J3TA 2YKLL 2EYTB 2L7UA 3KXFA 2Z4QA 1SJXA 4Z77A 1TZIA 2VSDA 4K7FA 1JTTA 1X5YA 3UDWA 4OLVL 2AEQH 2ED8A 2G9HB 5EU7E 5T1KA 5C0FB 1IAOB 4YNYA 1LE5B 2IPTH 1Y0LA 3PL6A 4LHJB 2X42A 4JM2D 4AH2B 4LCYA 3G6JA 4BZ2H 2ICWI 2X2YA 3W0WE 4PJDE 3F7QA 3VI3E 1IGYA 4ZQKA 4DUXA 4OZGF 3VFUB 2NX5D 3CDFA 3K0WA 5DRZA 3E3QC 3JV6B 4JFOB 5C0AD 1FNEB 3AB0C 4HUXB 4GAGL 3RIAF 5EBLA 3DMMC 1MI5B 3MCLL 3IYLW 3QJHA 5CBEB 1M7IA 2NY1C 4KUCF 1G7JA 1F3JB 4Z6AT 5FYJL 3MA7B 1R5IA 1NGXB 1MQKH 4CVUA 1QLRB 3ZHLA 3RWDA 1CLZL 3TBYA 3QRGL 3MUGA 2OCFD 3QIBD 1CICA 1CR9H 3A6BH 4YR6B 3SDCB 4HK0A 4ODVH 4NZDA 1QBMH 4JRXE 1H3VA 3L3OB 3UJJL 1I7TA 4MA3B 5JDSA 2XZAL 4KHXL 3LS4L 2DJSA 3V9FA 3ZYOA 5ACMA 4F7TA 4QRRE 3ZE2E 3MROB 1MCRA 2M26A 4OZFH 1RK1A 4Z7OF 2JJTC 3QDMB 3RY6C 3BDYH 3MRIA 1U8MA 1MCWM 2LABA 4KV5F 4OLXL 4XVTL 1K6QL 1QHOA 1S9XA 2KZWA 2V5RA 1IAIL 4LEOB 4X6BA 5I1DA 3BOVA 1FE8H 1B4JH 4KI5D 5KG9A 2EIZA 3MLSH 4PJEA 3D25B 3PGDA 35C8H 1OGAD 4WWKC 5FDWB 1JMZA 4MA3A 1WBZA 4JHZA 4ZMAT 3ZDYE 1EUTA 3GGWA 2G75A 4DW2H 4JPVL 4ERSH 2DAVA 3E2HB 4LPXA 1MRDH 4CRPA 4RBPH 3T2PA 3QPQC 1RV6X 1XFPA 3MV11 2GTWA 3VXTB 4QKXB 3VA6A 2RB8A 4I2XE 2AAVA 3VE0B 3RX8A 4BYHA 1U8HA 2I60H 4MB3A 5EO9A 5JW5B 3T8XA 3FQXB 3LEXA 4HIEB 2VLLA 4JFZL 2EO1A 5D8JH 1LO3H 5HSFA 1KJ3L 2VDML 4DGYL 3RY6A 3QPQD 5T1DL 5DVKA 4M1DL 4ZPVA 3CVIH 3UO1H 4GQPH 4PB0L 1Q9OA 4BFBD 1NCDH 1E0OB 1NPUA 3NPZB 4H26B 1KPUB 2ITDA 3IJHA 4IDLA 4QRPD 4TVPL 5GS2D 3CSYB 3OX8A 4X5WA 1U8IB 1F97A 2HWZL 3QPXL 4WHTA 5F21B 4OKVA 2X4QA 4NO3A 2R2BB 1MSPA 1TZHA 1ZLVH 1E28B 2ICEA 5IUSA 2DWDB 4K7FB 1J1XH 1FNSH 5ESQB 4GH7B 2J1KA 3VH8G 2O26U 5GGRA 4OZFA 5T3ZH 2ZCKH 5CJXA 2ZG2A 1IARB 1EH9A 2EH8L 3JTTB 1NC4A 1RUMH 4APQA 3ULVE 4L4TE 2AI0H 1DQLL 4P9HL 2HLAB 1I7ZA 3WO3B 4M7LH 3HMXH 3GJFH 1PSKH 4HQQH 4U33A 4NKDA 3P77B 4NQDE 4JFDB 1TXKA 2HG5B 2ERJC 3CSGA 4LSQH 4ODWB 2R0WH 1ORSA 5C07B 3G5ZB 1TQBC 3CDGA 3U6RB 3DURA 4L9LA 1IM3A 1FGVH 2FX7L 1E28A 5CAYB 4B41A 1S7SB 3CMGA 4U2ZA 2VZUA 3EYSL 4UIKL 1UVQB 3AM8A 5KSUB 1YC8A 1CU4L 4ZTOH 4AL8L 3VDCA 1SVCP 1JVKA 3O9WA 3MRMB 3BE1H 5CSZA 2X4SB 4F9PA 1Q94B 2P24B 2Y4SA 4M48L 4FABL 1FLRL 1RJLA 5IQ7L 1W0WA 5A2LH 4P4KD 2J88L 1Z9SA 2ZUTA 4QY8A 2XQYK 4AEEA 4F37F 3QT2A 4TNVK 3UTPD 4POUB 3RJQB 3BZEA 3DVNA 1T2QH 4P9HH 1BF2A 1SYVB 4YH6A 4YGAB 4U6TA 1YMMB 5I16A 4PRNB 5HI4C 1EV2E 4KXZH 4QTIL 2BOBB 4APQC 3CCHA 3SPVA 1H3WM 3OPZL 1U6AH 3S35H 5JXAL 5DR5L 4HXAL 1YMHA 4TNVF 3GM8A 2AI0L 3OKMA 4FXKA 3LB6C 3MRDB 1R5VA 1YDPA 5DK0B 3BISA 4H5SA 4JKKA 5E8NB 1EFXD 4QXUH 2CDFA 5ALCL 2H8PB 4RWHA 3IF1A 1FL3B 2CJUL 4N0CD 5KG9B 3QI9C 4Q9BA 1VFMA 5D4QA 2Y06H 3NA9L 5BRZA 3WJJC 3MV9B 4QOKB 1YY8B 4WV1C 1DUZB 3AREB 4TVPD 2H3NB 3F62A 1UZ6F 2I5YL 1R3KB 1BF8A 1QQDB 4DGIH 5LGJA 1JRHH 5C0FA 2JK5A 1MCFA 5LG1A 3W2DH 3HMXA 3T65B 3ZDXF 4LLYB 2FECL 1UC6A 3E8UL 3V6FA 5CIPB 4D9QD 1YEFL 5FEBA 4NBYB 5HYJA 5TH2B 4MQXC 4GOSA 4HKZB 5HHQB 5IESH 5JPMA 2EDDA 1EHLH 4NWUL 3AUVA 5ILTH 2BSRA 1QLFB 4RFEA 2H32A 2XWBB 4LQFL 3UO1L 5TDPB 1Q0YH 2IMNA 5KOVC 2D31B 3QH3B 4MJ5B 1SBBA 3FB6B 4QTHB 1YY8A 5JHLH 4MCZB 2Z35A 3OQ3B 5TPWL 4X4YB 1UH4A 3JV4A 2I9LB 3P0YL 1GOFA 4OLZH 4K9EC 2DQJH 2WV3A 4PJIB 4EIGB 1JTOA 3N06B 3Q1SL 4L9DA 3UYPA 3TF7C 3C60C 4J8RA 5HVGB 5ACZB 3VA2C 3OKYA 1JUFA 1MCWW 2VLRD 4Z0XA 1HHHA 3NACL 4PLKC 1TZHB 3U4EB 3VMNA 4M3JA 5KJRL 2Q6WB 2EH8H 3PP3K 4KPHH 4GG6F 4AEHL 4ONGL 1C08B 4PJ9A 2J5LC 1AI1L 4XAKD 3MJ6A 3BXNA 4G6ML 1LO2H 2NR6C 4X5XB 1EAPA 2B20A 4RIRB 3TBWB 4TYUA 3RIFF 1XGQB 4GRWB 1YEDB 2WUBL 1F2XK 3SE3A 3FMGL 3KYOB 2B5IB 3MBXH 3MRIB 3VGHA 4PLKD 3LQZA 1I7UB 3EUUA 3IDMB 2IBZX 4KMQA 3TJHC 1L6ZA 2VN4A 5FKAB 2P43B 1MY7A 4NRZA 4L8SC 4OLVH 4MAYD 2YN3A 5HI3D 1DLHA 3I84A 4XAKE 5K9OB 2CXKA 4IRZL 4NKQB 5FOBA 2DBJA 5F7EH 2DM2A 3ILPB 4JFFE 4OCWH 3KYKH 3REVA 4Q6IA 1QO3B 5IB4A 3HG1D 4K3HA 1FNAA 4G6KH 4P3DB 1RJZB 4LU5L 4UT9H 1DFBH 5HVHB 5CJ8A 4NPYB 3KVQA 4L29B 4Q9RL 5IJVA 4Q0XL 4E41A 2R9HC 2K7QA 3FOLA 2XYCA 3P4MB 3BP6B 2GTZA 1UACH 3C6LA 1CL7L 1CLZH 4X7TA 4RMVA 1DUYA 3HC4L 3VGDA 4ONGH 4PYGA 4ETQA 1OQOA 1YNTA 4JRXA 4UV7L 2OQJA 1K2DA 2NY4B 1TJGH 2FHCA 4JFXA 1T7XA 3QDAA 4DKFL 5FHBH 1J1PH 3LPWA 2BVPB 3SKOA 2UUDH 4M6MH 5JXEA 4Z7VE 2PO6A 4IRZH 5IT2H 2JB6B 4GXVH 5T3XH 4WRLA 4ZUWB 2G5RA 4UV4H 5FUOH 5LQBL 4UT6L 3BGMA 2FYYA 3UPCA 4GQ9L 3H0TB 5I1CH 4CADA 4MDJA 3DETC 2HKHL 4MJIE 3MLRL 3VG9C 3LZFH 4MD5A 4JFPB 3N9GL 1CGYA 1AE6H 5GGRB 4O2FA 1MIML 4NKIH 2IQAB 1YJDL 4YDKL 5FYLE 3RVUC 3G6JE 4PJ7B 4YK4B 2JJWA 4R8WL 5IG7A 3V6FB 4DW2L 4KKCD 4OF8A 3SKNA 2X89D 3TA3D 4JPIB 1LDPH 2EH7L 5F7UA 1JZ6A 3GJEB 4XNMB 5D7IB 1AGBB 3NFNA 1MJUH 3UTZB 5DJDA 3VFWA 1MQKL 2JB6A 2OK0H 4MJID 4U31A 4NQVA 3WS3B 2LVEA 2W0FB 5CEZE 3MOAL 3KPSD 4BQ9A 4N8CL 3T04D 3WFZA 2NQCA 3PWPE 3S3SA 2AJ3A 3HMWL 4I5BA 1ZMYA 1EVUA 4U6XA 1ZLWK 4F37K 3QQ4B 1AC6A 3GMLA 4Y8DC 2W9EL 3MCKA 1TZGH 4LLVB 5CBAB 5CZVL 1E27B 2UZIL 2E6QA 4IOIA 5KSBE 3U7WL 4NQSA 5DUMH 3TH2T 4WO4D 1KC5L 4PJ7A 2V17H 3MLWH 3EDDA 3I2CL 5DJXB 4YBQC 5AD0B 4TSAH 4P57B 3SDAC 4OIIL 3T09A 2F54A 2NY7L 3GEWB 5C08A 4X4ZA 5KANG 3P4OA 3PWPD 3S4SG 3PHQA 3QPXH 2HWZH 1MHPH 3QUZC 4K94H 2P7TA 3WEXB 5IW1B 4KI5F 5JHDB 4PJBE 5CZKA 2UYLA 4NO2B 4O9HL 2EC9T 2H32H 1FORH 3C9NA 3LCYA 1RUQL 5EO1A 4L4VA 4ELMF 2CDEA 2OSLB 2NPLX 3I6GB 2JE8A 5HDLA 4G43B 1IM9D 5EU6B 2VLJE 2CQVA 3LMJL 5DVMA 3FB5A 2DLGA 3QFJB 4G8IB 1JHTB 3JV5A 4KRNA 3VFGL 3S7GA 2CLVA 2R69H 3FRPG 1ZWIA 1SEBB 1QFUL 2AXFB 1LEGA 3C08L 1KLUA 4MNGB 2BRQA 2JKXA 5C0BB 2JJSA 1HYRC 4UUJA 2AEPL 4QOKE 3IXTB 5BV7B 2Y6SD 4ODTL 4KDTC 2VLJD 4EIZC 2VDOL 4U1GB 4FQQB 3EZJB 3AREC 4UTBL 1JYNA 3I9GL 1T21B 4V2CB 1CFVL 3ZSTA 5J56B 3B8SA 4XWGH 2GIYA 4UILH 3B9DA 2AK4D 2VDKL 4Z7UB 4JFHD 4PB9H 1U3HD 5IK3A 5BVJA 2VLME 4KUCD 3MBED 2NW2A 4M7JH 3CK0H 3W9DB 4ZUTA 3MLVL 4QGYA 1WZ1H 1YEHH 1A6UL 4HFWA 2Z31C 3QXVA 5HI3C 4PRPE 1J5OH 3MRRA 4OLWH 4ZNEE 3QH3A 4MJ5A 3P9LA 3V0VA 1UWEH 2V2TA 3C2SA 4MCZA 3TGXA 4ZUSB 2DWEB 2YD8A 3MUJA 3MLYH 5EA0L 4L8DB 2Q86A 1WBYA 3TIDB 4X7CC 3NIGE 2VDLL 3FQTA 4OQTA 4V1DB 3N1FC 2F5BL 2FWOA 4YHIB 3MA9L 3FO9A 1IC7H 4PR5A 2DQUL 1AIFA 1ULVA 4X0KA 4QHNB 5I1IL 3VWJA 1B0WA 2IPUK 3MO1B 3NAAL 2OM5A 4O58H 1HYSC 1I7RB 1IILE 1NBVL 1BQLL 5D1XA 3U48A 3OJVC 3VXSD 3OL2A 3IFLH 2FD6L 1Q9KA 1Q9LA 4JRYA 4N0UB 4C59B 4P2QB 2X41A 4XP5L 4Z7VA 3MOBH 3I02A 3WKNA 3D2UA 2CLZA 4YPGA 4XB7A 1LP9B 4LVHB 3DIFB 3F8UB 3V8OA 3AVEA 1MRDL 2PW2B 3CFDB 1FAKT 5KVDH 3GBML 3WN5B 4KK6C 3V4VL 3NGBC 5K9QI 1LE9B 4X99B 4IHOB 4ODBD 4RAVB 1FZOB 2IQ9L 2VKXA 2DQDL 3MLYL 5EA0H 2HMID 5DXWA 4OZHA 1U92A 4M3KB 3DETD 1AGFB 5SWZE 1F4XH 1BVLA 1T0NA 5CBAA 5DGRA 5E1HB 5J6GB 2AABH 5HGGS 2KUTA 4S1RL 1L7IL 2MFNA 2OI9C 4YDJB 1T6WA 2FATH 3LRSB 4KHTL 5DJCB 1B0RB 3EOAB 5JUEH 1D5ZB 4KK6D 1FZMA 3TH3T 1KYOJ 5KS9B 5TF1H 3TO4A 3L3JB 3S3PA 1UM6H 2HMIC 4O9HH 3P77A 2ARJQ 5JOFB 3CFCH 1U3ZA 5JZ7C 1EGJA 4WWKB 1UXWA 5DJ2A 4J6RH 4AYFA 2JIXA 4XI5D 2XZAH 1IQWL 3VI4E 4NO2A 2X4UA 4EKXA 1M1SA 3LKOA 1T89C 5L8KB 4KRMB 1Z3GL 3QIWA 4MNHA 4GAJL 1C12B 2ESVA 3ULUD 3FCTA 1P2CB 5DMIL 5EFIA 1AD9A 5I15H 3UYOD 1Z2KA 2C7UB 3Q5OA 5TH2A 3ARBB 5F3BA 1ZA3B 3PXHA 2VIRA 5CILH 4I2XB 4OLUL 2W92A 3JUYA 5BO1L 5CBEA 5EO0B 5C0DB 5ISZB 3FAXA 1ETZB 2EDKA 3HS0B 3KPMB 4L3CA 5F3HA 2B39A 1T4KA 4MA8H 3ARFB 3HMXL 1FPTH 4R7NA 3EO1B 4HPOH 2HLFD 4JQXC 3PGDB 5CHNB 2D31A 4Z95H 2ZCKL 3L7EB 1PZ5B 1T1YA 3WFBH 3MRFA 2AK1H 1NCAL 3NAAH 4HUVA 3IDJB 3PWNB 2V2WB 4F33B 3QG7H 4U1NB 5F44A 1M6OB 2BSSB 1T83C 4ODUA 1A47A 3VMPA 1U3HB 3G6JB 3HHRB 4OZGA 4RGNC 5EO9B 4EI5C 2XRAL 2VDPH 4OD1L 1I3UA 2ITCA 1FZKA 4ZXBD 3V4VH 3IRPX 3ZE0E 3TCLA 4FZEH 2LTQB 3C5ZD 1A7QH 4D9RE 3QUKB 3BN3B 4R97B 2AJZA 1OW0A 4JHAL 1I3RA 5DS8B 3NFSL 2B8OT 4HKJA 1T1WB 4LHQB 3T1FA 4ZYKA 2BHZA 1PZ5A 2H1PH 3PWJA 1MNUL 5DJ6A 4XTRC 2HFEA 3H2WA 2E5EA 3MRFB 3NZ8B 3KPPB 3MRPB 4GXVL 3BKCH 4YXLL 1CICC 5C71A 1BGXH 1W0VA 3J7HA 1JGUL 5SWSE 1KCRH 4ZFZA 3ET9F 4K3DH 1CIUA 4O2CB 1TJGL 3MO1A 4NZRL 4Y1AD 5JPMB 3VXOA 3I75B 1J0JA 1RZ7L 5HDQL 1RZGA 1QFOA 4YDKH 4X7EC 1NCBH 2DQGL 4U1JA 4P2QD 1T5XA 4QRUA 4RDQG 2YXFA 2UYLB 1WAAA 5D6CB 2YPVL 2CDEB 3FRUA 5E08H 1DSFL 3QXDB 4NZUH 5FF6B 5IJKC 2ZCLL 2MHAA 4IJ3B 2NY2D 1V7NH 3IDYC 5JUEL 1I1AC 1NAMH 5BOZG 1F8TL 5C70A 3AB0B 5I19L 1AH1A 2EH7H 2FX9H 1B3JA 1FAIL 3O8XD 1T04B 1MHHA 3RAJH 2A0LC 2FL5A 3FQNA 2IFFL 2AVGA 2Y5EA 2ZUXA 1FG9C 3FFCD 3B3IB 1ITCA 1BVLB 4LIQL 2YRLA 1ODAA 3G5VA 3WNNA 2BVOA 1V5JA 3LKQB 3L5XH 4XP9H 5LGHL 3E6HA 5I6XB 2CGRL 3BP5B 3QFDB 2JIXD 2NY2C 1JNNL 1J88A 3NABL 4XNZC 3DPBA 3O4OC 1NAKH 2K1MA 4X7SH 3NIFF 3IS0X 4E0RB 4GBXD 5EZIH 4NKOB 4Y16D 3DRQB 3ARDC 2YD7A 4JDVA 2HFGL 3VFVB 2NYYD 2J8UB 3UTTB 5D2NC 3S5LB 4LAQH 2VUOA 3CNKA 3ALWA 2A6IB 1WCBB 1IAOA 1N2RA 1IJ9A 3QNZA 4MA1B 1WFTA 3VWKD 3PGCB 3ARBD 5HYSA 2YWZA 3HNVL 3GM0A 4N0RA 2DIJA 1ZGLA 3WNPA 2IFFH 1IM3B 4GBXC 4UT7L 4HIHA 4GMSL 3EYVA 4L4TA 1QACA 1FGNL 5AZ2H 4QT5B 2VERN 2O93L 1CYGA 4LP5A 2QBWA 1WBXA 3ARDB 1SEQH 2ZOLA 3BP6A 4HZLA 3MBXL 1BWMA 3GK8H 2I9TB 3B43A 4IRJC 3VWKC 4GRMB 1MLCB 4WU7B 3HPLA 3N50A 2NXYB 4PGDB 4XI5C 5GGUA 3TT3H 1NMBL 1K2DB 3W39A 1OHQA 1AP2A 3C5ZA 4Y4FA 4B50A 4IRSD 4XVUD 3RA7H 3DV4B 3H3PL 1MY5A 3UBXA 5I16B 5DK2A 2PYEB 4W68A 1DSFH 4ZXBB 4FQHA 4MS8D 5E00A 1FFNA 1KACB 3BH8A 5IBUB 4PRPA 4M93C 5D1QA 4ZD3L 4DZBB 5IW6B 3MXVL 3ECBA 5CEZH 1XH3B 1PQZA 4LAQL 2R15A 3GUTA 3GMQB 5ICXB 4S1SL 1IEBB 2EXYC 1G7QB 2QEJA 5CJOH 3MMEA 4XVTH 3QA3A 3HE7A 3OF6A 3T2NL 3WHE0 2OXHA 5T1KD 5HI5D 3P0YH 3W9EA 4FNLL 1P53A 3HC4H 3NZ8A 4X7FC 4RMSA 5GPRA 3V6ZB 5EOTA 3QRFM 1RZ8B 4RFNC 2B0SH 1Q0YL 3LRSA 4GKZB 5DJCA 1N59A 5DWUH 4PJFB 2XZQH 2IG2H 4KHXH 3UBXB 4R97C 2B7DT 5F1SA 3VFOA 5CKAA 5I2IB 1C5CL 1ZHKB 4OLZL 4LCCB 4EI5D 1HCVA 1NDMB 5IFAL 1HXYA 2M2DA 3OF6D 5BW7C 1EAPB 4U7SA 4D8PB 3BAEL 1WWBX 4LSPH 1T21A 4GW4A 1BLNB 4XTRD 1FG2A 3WL9B 4YXKH 5HGAB 2DYPA 1F6FB 4UNTA 3IKCA 4P46D 4UINH 3D18B 3NPSC 4JZNA 2WBKA 4Y19A 4U49A 1MFNA 1NEZG 1KEGL 2MMXA 4YLQT 4FFVC 3PP4H 4MNQB 2ENYA 4QOKA 1NAKL 1YUHB 4X7SL 5J12B 2SEBB 1FO0L 3QCTH 4JY5H 4P3DA 1QQDA 4OZHF 4ONOA 4RGMC 4J3UA 2C26A 3WD5H 5IFAH 2AGJH 3I6KA 3RGVD 1MPAL 4KTEL 4XMLH 3H3PH 1P7QB 1BECA 1M71B 1U95A 4QXUL 5ALCH 1JN6A 1G84A 2WIIA 5GIRB 4Y5YB 1DEDA 1NGPH 3HTLX 4JG0H 1ND0B 3QWQB 1JZ4A 2V7HB 5JW3H 1V05A 3D18A 1ZGLP 3SGEI 1WITA 2GCYA 1BQSA 3VW3L 5I30H 4JANB 5AG8A 1X5AA 3RU8H 1KBGH 4PP1C 1Z0MA 3BPCB 4XAWL 4H25B 4AG4L 5I76B 1ACZA 5DMKA 4M7KH 3QP3A 3HZVB 3A6OA 3QCVL 3BGMB 3TZVD 4NKMB 3U9PH 1FZOA 3T0WA 4G3YL 4Y19E 5EORH 1YPZB 3P0VL 3WS6A 3O2WL 3UTSA 6FABH 3SCMD 3EOYG 3Q6GH 4TNWF 5FCUL 3BP4B 4HUNB 1QD0A 3WD5L 1DBMH 3OKKB 3C60B 5E9DA 3KPLA 2Z93B 1AQDB 2RAMA 1NMCC 3GO1L 3LEXB 1BZQK 5FV2A 5FO7A 3TA3B 3RWGB 3D39D 3DYOA 2D9CA 4D0BB 1MJJA 2AEWA 2VAAB 2GEEA 3F7VA 4IBLT 4R3SA 1NAMA 4RAUA 1HOCA 4I1NB 3BJ91 2FEEL 3TT1L 5CMAA 4B0MM 4S1DD 3ZT6A 3GSRA 3Q2CA 1T2JA 4OGAD 4Y5XB 2X1XR 5F72S 3GUTB 3LKOB 4YHZH 3VXRD 1HXMA 4XPFH 5ADOH 4PJDF 3OGCB 1UH3A 4X5LA 5K59F 3O6LH 4U3CA 3H8NA 1KIUA 2X1QA 4WV1A 3U2SB 4NQCE 3REWB 4ZO9A 5DURB 1PLGL 2GQHA 2GYSA 1D6EA 4JRWA 2QHRH 1OTUC 2ZG1A 3G5YB 1DN2A 2HFFB 1T22A 4RX4D 5EBWB 4F3FB 1TETL 1SYSA 2YUZA 2XG4A 3D87B 2NY7H 2VLKA 5A43C 5IB3B 1EGJL 4TSAL 1CZ8H 4XZUA 4PGEB 3EJYD 4WW2F 4FTVD 1RULH 3WEXA 4Y5XA 4BQBA 1ORSB 1LK2B 1UB5B 1IEAA 2I26N 2NXZD 4OGYL 4NT6B 4TSBL 5EO1B 5C07D 1NCCH 3SO5A 2Z0BA 5D8JL 2EXYD 4Z95L 3OR6B 5DVLA 2NTFA 1XGPB 2JJUA 1BVKA 4PG9A 3GJFB 4ZDHB 4LVEA 2IJ0C 8FABB 3BP7B 4WUKH 5DTFA 1A5FL 2R4SH 3RDTC 4Y5VA 3WIHH 4Q2ZA 2GK0B 4L4TB 4NQCB 3RP1A 2R69L 3T2OA 4TSCL 4WCYL 3TBSA 3O45A 4L9LC 1X5LA 1JI2A 3L6FB 5L2KA 2OXGA 4Y19B 3Q3GB 1BIIA 1CI5A 4QXTA 4P4KB 5C07E 1JZ8A 1K9TA 1I1FB 3LDBC 1NUDA 1U8QB 1DLFH 2AEPH 4M1CC 5JIPA 4EDXB 3GNMH 1Z5LB 5EUOA 3NVQA 1UB5A 3H9HB 1KTDA 2R23A 5EB9A 3BWAA 4PRHE 1A7NH 5D7LA 1M05A 3N1GC 1J8HA 5D93B 1EPFA 1CQYA 5IMMA 2DRUA 5IW1A 2V5TA 1JUFB 3O3BB 1A7BA 4C58B 2AJXL 5JIHA 3HZMB 3QBTB 3DWTA 1QFPA 4LCWB 5L0QB 3HS0A 4P46C 1KCRL 3WE6A 5TQ2L 1J0YA 1PEWA 3V5DB 3MFGB 4JM2C 1JHLL 3MREB 4Q6YA 1GC1C 3MJ9A 2FB4L 1H0DB 5IB5A 5DRNA 3ILQD 4I5BB 4OAWB 3QZWA 1UA6L 4FP8L 1QR1A 4PV8B 5BOPA 4GG6B 4PJEB 5IHLB 4L3AA 5C0AE 1BFVL 3RIFK 1WBZB 3MA9H 4X9IA 4CW1A 1J1XL 4DAGH 1WLHA 3MJ7B 2NY6B 1RI8A 1K4DB 1HQRB 3PWUB 5T33L 4BH8A 1OL0A 1KJ2A 3GKWH 5HPOA 3EHBC 3B2VH 2LU4A 1ZHKA 3G5VB 4LCWA 2BFVL 2P49B 4EI6A 3RVTC 2FEDC 3MC0A 1VGKB 1ES0A 1FVEB 1F11A 3C5SA 1JNHB 2BY0A 1QA9A 4WGVB 5E2WH 4IOFD 5KSAA 3H6JA 5CJXC 4LLQB 3WNMA 2QSCH 3RY5A 2YZ8A 3DRQA 3AS2A 2FSEB 1PVHA 4P2RE 3ORJA 4HPOL 3CUPA 2HVJA 3O8XA 1UM5L 3MLZL 1QSEA 1CL7I 4J4PA 5I8EB 2DWEA 4WFHD 1NJ9B 2IF7A 5ICZB 2EC9U 4G6JL 1KPVB 1HKLH 4PTUA 4N0YL 5EZJA 5E94A 4P2OB 4AIZB 4JFED 3HNTL 4OZHE 5FGSA 1NBZB 5T3XD 3S96B 5C0BA 1DBJL 15C8L 3GBNL 3LVEA 2ZOKB 4MNQE 4IOFC 2PUQT 2LAGB 5DVOA 3EYVB 2R2BA 2YR3A 4NO5B 4MDIB 2ICWA 5IKCB 5IEHA 3VFPB 1MFEL 4F3FA 3CFBA 4U1GC 5D1XB 4DVRL 5CLTA 4JHWL 4QY8B 4G6AD 4HSQA 3H0TA 3HNVH 4WFHE 1JF5A 4WWKD 4OCNC 3RUGA 5BVPL 4MD4B 5CJOL 2EYTA 3MV8B 4NC1C 4U6VH 1R3LB 2HTKC 1J10A 3U4AA 1MCNA 1CDJA 2GY7B 2VE6A 1FO0B 4PJ5A 3KPQB 1JPGB 2YHGA 3BKCL 2YD3A 4EN3C 1QG3A 3OKLA 2MCPL 5BMFL 1V3KA 1FFRA 3ARBA 3B9VA 2WBWB 1TCMA 1SM3H 4G6AC 3EGSA 3BP5A 4FQXD 4J3OC 2PETA 2E7LC 4YC2B 4N9GA 3ROOB 5J0BA 3MLTB 3PJSB 2HTLC 3KPNA 5D7JD 5T1MA 3TIEA 5C2UB 3FL7A 5CGTA 3CPLA 4OIIH 4E41B 1AKJB 5K59E 3ZZ1A 4YFLI 1G9EA 3MRGA 4ODXB 4MJ6A 1X6NA 1KC5H 4N1CA 5L2KE 3L3JA 2FO4A 1BX2B 2RFXA 2VE6B 3IDJA 2WZPD 3TWCL 1ZHNA 5BJTA 3K1DA 2F19H 4G6MH 2E7MA 2BSED 2ZUUA 4FQ1L 1NFIA 5DJ2B 2LV4A 2HKFH 2XN9A 1ZA6A 1AGEB 4X9GA 1NC4B 4LF3B 1CT8A 4R3SB 2IBZY 2BVPA 1H15A 4M5ZH 3NFPA 3SKOB 4KGJA 3BWUC 3CVHA 1B2WL 3O3AA 2IPKB 4L3EE 4K8RH 4XHJD 3AGVA 5FUCE 4G80B 5EPMA 4UZGA 1G7PB 3U0TB 5L2JB 3SDAA 3GIZL 1H5BA 1GIGL 5GGTL 2BP3A 2GFBB 2X09A 5E99H 1SY6L 1LMKA 4HCRL 4OGXL 3ULVD 5FM8A 3UTTE 1P69B 5D2LA 2DQCL 1KN4L 3ULVF 1RJYB 15C8H 1QOKA 1A3RH 1U2HA 2VQTA 3BO8A 3HC3H 1U8NA 3VW3H 4MQTB 4WUUE 1N8ZA 4KROB 1A6UH 5DSCB 1DBAL 4YO0B 5IG7B 2EKSA 4P3CL 2HVKB 1P9MC 3FQWB 1HHHB 5KS9A 4S10A 1KLUB 1MNUH 2X1OA 4MB4A 5GZOC 2F19L 4FA8A 4JREB 4EVNA 4RBPK 3QISA 4J2XA 1CLYL 3RZCC 1JPSL 3GMPB 3W81A 1A8JH 3D3VB 5IEKA 4CAGA 1G9MC 3CSBA 3D9AH 3H9SB 3O3EA 2R4RL 5DHXB 5EU7C 3VGBA 1X44A 5J9PA 4G7YH 2IAMD 4PUBH 1FL5A 1G9ML 3MX0A 3KJ6H 4M6OL 4UQ3B 4WTXA 2BK8A 4NC0B 4HS6A 2D4DA 2NY0D 2JJTA 1M71A 5TDPA 4YXHH 3B83A 3PIQB 4H1LA 1JZ2A 3STLB 5HD8D 4Z78B 2B5IC 3O8XB 1CE6B 3TV3H 4Z0BL 1L4IA 2X6MA 3FFCB 3TBYB 1FL3A 5DMJB 4AEHH 2DQHH 5C0IB 5FYKH 4KK9C 4NN6C 1BM3H 4JDZB 4Q58C 2L0DA 4OJFH 3LB6D 5DO2D 3TBTA 4O2CA 4DVRH 3G04B 4WFEE 3INUL 4TULL 4XP6H 4F7TB 1BVZA 5FECA 1BZ9B 1F6LL 2HJKB 3MRCB 3RGVA 4Y16B 2EDWA 4L4VB 2NX5E 4GAYB 3ZDYF 2FWOB 4EBQH 2WWKO 1IFHH 3UPAA 4MX7A 2WM0A 2CRMA 1HQ4B 3O3BA 1G9MH 3QI9B 3L5XL 4XP9L 3MNWA 4C83B 4LL9A 5I73C 4M4RA 2FZ3B 2R8SL 1PGRB 1XF3B 4PJBF 3QXDA 5FF6A 1A6ZB 4RMRA 2XZQL 3B9AA 3DX9A 5IVOA 4OZIB 5DO2C 4GJTB 4DCQA 4LARL 5GRJH 3V5DA 3B4NA 5D1XC 4ZYKB 1UQSB 5JIKA 4OT1H 2VITA 1YEKL 2Y72A 1MCDA 2OR9H 3IFPA 4Q97A 4MZ3A 2EDRA 5FUOL 1E6OL 4HWZB 4K94C 4BH7A 1A14L 5C08E 1BFTA 1OAUL 2I25N 3V5KB 4FRWA 1IGTB 5GGQL 1N3NA 5LAXB 3QUZA 1WJ3A 1BD2D 1KIQB 1UM4H 3QNYB 1TQCC 4KTYA 1A5FH 4MDJB 4ZUVA 1PSKL 4ODXA 5GRYA 1HQRA 3PWUA 2BDNH 1KB9K 1TDQA 4ODHL 3U30C 3FQRA 5I6XC 2R2HA 4HCRA 3WLBA 1XF3A 1G7LB 2Q1EA 4I48A 3TFKC 1LE5A 2VWEC 4HFWB 4JKWA 1T5WB 1DQQA 4RA3A 4YHLL 4PJCE 5AYUL 4DK3A 3G6DH 2ZPKH 1AGDA 1N6UA 5I18H 2IADB 5CWSB 1EHLL 2VLKB 4XPAH 2VUYA 3G6AA 4KJWD 1EGJH 4JZJC 1KG0B 4GQ9H 5I1CL 5ENWB 3IDYB 3QHFL 5TQ2H 5KOMC 5GRVL 3F12B 4QRPB 2CDGB 2XQBH 2D0GA 5FKAA 5C7XL 3EDJA 1F4AA 2A77H 4KDTA 3ULSB 4GG8B 1A1OB 1OAUH 1TJIL 1NCDL 3VRLF 3LRHA 2VZ1A 2H2PD 4U6XB 3QHTC 2FJHB 1YN7B 3FB7B 3T0BA 5IM7B 1EHAA 4W6WB 2YUXA 3X11A 5F9OH 2ICWB 4HFUH 4Y4HD 4XNZB 3L5JA 1N0XL 3ARFA 1QBML 1H3PL 1BP3B 4DAGL 3G6DL 3FN9A 4YHKL 1ADQA 4R4NC 5DK2B 3HG1E 4IHOA 3GFUA 1WCBA 4M5YL 1FYHB 2OL3B 2V2WA 5EC2A 3DURB 4L9LB 4MWFA 1F13A 5HDBF 3RZWA 3TNNB 3VXQA 3MRQB 4XPTL 4XBPA 3ULVC 2ZUYA 5L7XH 5B3JF 4N8VB 2F58L 2CKBL 1LO5B 2R9HD 2WBJA 5B38A 4I13B 1F58L 3RNKA 4H1LB 2H9GB 1X7QA 5IVZB 2DQHL 3BEWA 3LN5B 5BQ7B 2ZUQC 4HPYH 5MI0B 2R1YA 5TJWK 1CD9B 2DTMH 4LOUD 3WE6B 4JO3H 3VWKA 2VZSA 4JZNB 3TYFA 5EDXA 4UDTB 3OAUL 5SV3A 5CLWA 4AL8H 5IB3A 5D7SL 2B2XL 3N1MC 4PJFA 1X6LA 5IVXB 1BBJB 3RWEB 4R4BB 4W6XB 3X14A 5JOPE 3SEPA 1O5DT 2FH6A 2J2ZA 3SDXB 5EOQL 3OTTA 3B9EA 1S7QB 4UB0H 3QWOB 5DEFB 1W72B 5HDQH 3CK0L 2BHYA 1FN4B 5INDA 3GI8H 4DTGH 5IVZA 4DZ8B 3L3GA 4WEMB 2EECA 3ZDZE 5E1AB 4LARH 4WI4A 2XA3A 5GRJL 3DRTA 5EO0A 5I66A 4PRPB 2WK2A 1ZHLB 1YEKH 3O45B 4JM2A 1T1ZB 2BY3A 4YUEL 3MCG1 3BUYA 3C5SB 2XPGA 2IGFH 5JOPD 5T33H 5L7XL 4H8WC 1PKQA 1RZFL 3KPRD 3VG9B 2FLBT 5E95B 2GUOB 5IB2B 1WV7T 2VXTL 4D3CH 4C56A 1WIPA 3KLSA 1OP3K 4LLVA 4AMKH 2VR9A 5DJ0B 2APFA 4FZ8L 3P73B 4HFUL 3DGGB 3GSUA 3T2QA 1RULL 1DQDH 1QSVA 5ADPH 3F6IA 5C9JB 1YNLL 1MFCL 4RGMB 2A9NH 3O2VL 4TPRH 3QDGE 1HN1A 3B8YA 3C8KB 1CQKA 1NDMA 4GLRH 1OSPL 1EO5A 1OSZB 3H9SE 4V2BA 1FDLL 2BERA 1FL5B 2N4IA 5GS0H 4YDLB 1NC2B 1S7WB 2QSTA 4YBQD 4LSRL 3CX5J 3QO0A 1IGMH 1WTLA 2YKLH 3MR9A 2C1OA 1XGRA 4YX2L 1RZIA 4OLEA 3D6GA 3UTTA 2BNQA 5C07A 3WSQL 5TE6L 1YEGH 5A1AA 4XCCL 1HXMB 3QDHA 4L8SA 4BZ1L 2Q86B 3V5HB 1IE5A 3TO4D 4PJXE 2PN5A 4OI9A 1CLCA 1VERA 1CVSC 4MNQA 4JFZH 2I07A 3QG6B 2YK1H 1YEIL 1EZVX 1SY6H 3MODH 4U3XA 4JDTH 3L7FB 3OKOB 2HFFA 4RGOL 3WNLA 2HRPH 4K8RL 3U46B 1FZMB 4WNQA 4UNVA 4LASH 4U1MB 1AQDA 4KPHL 4RCAA 2NX5B 1T1XB 2R2CA 1QSFA 4QCIB 3S37H 3D69A 2CKBA 4DKEH 4P49A 5MP6H 3BZEB 3VFMB 4OCXH 3MNWB 2X4RB 1P4IL 4Z76A 2NXZB 3F5WB 3TO4C 2HRLA 4U3HA 2X4UB 4NKDB 1QBLH 5ICZA 3AU1B 3TBVB 4PJAB 4KK8C 2Z9TA 3QHZL 5B39G 4YXHL 1GHFH 2AK4E 4Y4KB 1X5HA 4JCMA 3AMKA 3GHEH 4IRJB 4JAMA 2VLRE 3QDGA 4NC2B 5ISZA 4NKIL 1UEMA 1CK0L 3N9GH 3TBSB 2GW5A 3QUZB 4O51A 3P9WB 5E7FA 2DI9A 2C3XA 3T4AA 4UDTA 5ID0B 4AQ1B 4OCWL 1QNZH 3FQUB 2V2XB 3BZDA 3VD5A 5I75C 2DJUA 1HEZB 4GBXB 3KLHD 1Q9WB 3WFCH 5IVXF 4P2CG 2A9ML 3FQRB 3JBG7 3CZFB 3MCKB 3KPLB 4P23B 2RHEA 1RFDL 2DDQH 5KW9H 3PQYE 4JKPH 3HE7C 2A73B 1RZ8A 3QIUC 5DJ8A 3TJHD 2FECI 5TE7H 3EDFA 3MRJB 1HK6A 4MJ4A 3GKZA 5I18L 2ED7A 3BVNB 3KLAA 4K7PX 3PP4L 5K9KA 5CZVH 4S1SH 3GNML 1FV1B 1FZKB 4MMZC 4OSUH 4I3GA 3KLHC 1MFEH 4L3EA 2UZIH 1H5BC 3MRDA 1CD8A 2R39A 3IAPA 2VXTH 4D3CL 3KPRB 2NMSA 3HE6C 1U92B 3KS0H 2AP2A 4KJQC 2YUWA 1LWRA 4EXKA 4F9PC 1VFUA 4Y1AA 3RKDD 2IPUG 2FJHA 3FB7A 1DEEA 3WIHA 5ABDE 4Z9KB 5DYOA 5I8CB 1ADQL 1NEUA 5BVPH 3LKRA 1NCTA 1NFIB 5ITFB 3QUXB 3DGGA 1C5CH 3GSUB 4K23L 5IMOB 3CFEB 5T1LA 3X17A 3SJVD 4DN3H 2EE2A 4XNMA 5D7IA 5SWZD 3PHSA 3K7UA 1EAJA 1TQCB 3K4AA 5E0QA 4HWBA 4ELKA 5L6YL 3ECBB 2Y5TA 4Y2DD 1FVDB 5KANI 2G2RB 3U9UB 2W59A 4HD9A 4NSKA 3VXUE 5HHQA 1WC7B 2YPKB 4PGBA 3X3GH 1T0PB 4P5KA 5FAAA 2GTWB 1YJDC 2N7AA 3K1KC 3GMNB 1YYLH 3GKWL 5IHZA 2V7NB 1M7IB 4XWOC 4EBQL 2CH8A 2QADB 3D0LB 3RNQB 1NKRA 4M00A 2FBJL 4PD4J 1B4RA 1VCAA 1EA9C 3GSQB 4JRYE 4X83A 5IJKA 4NIKB 3DX9B 4JFEB 3DO3A 3O0RH 4CVZA 1AGCA 1PG7L 3FT2B 4UBDD 3ULUE 2ZKHL 3VXUD 1X5FA 2ZSWB 3IJYA 4QXTB 5FDYA 4CMHB 3EAKA 3BKJL 1OAKL 3SQOL 1L0YA 3Q1SH 3SGJC 3V5KA 1DANU 4PGBB 1DDHA 3RPKA 2R1WA 5EH1A 1HIMH 1U8IA 2DOCA 1R3HB 1AR2A 1U3HA 2W07A 2NZIA 3CDCA 5H37H 4LIQE 4YC2C 5I74B 2EDYA 1AFVH 3PABA 4LPUA 4ZS7L 1INQA 4UBDC 3WL9A 5ID1B 4FQCH 1I1CA 1N0XH 1CTOA 1T7ZA 1MAKA 3JWDL 3KPQA 2F53A 4LIQH 3GMOA 3BSZL 2XN9D 3IDIA 5E5UB 4OCYL 43C9A 5KBNC 4JB9H 3D25A 1T1WA 1AI1H 1IAKB 4Z7VB 2WANA 3KNBA 2Y6SC 4W81A 1INDH 1TNNA 4JG1L 1QP1A 4HC1A 1G0YR 2JCCE 1XCQB 2ED9A 1LO3L 5K9OA 2ZKHH 3K2UL 1S7TB 4JY4B 2RIKA 5L8JB 1NBZA 3S96A 3CZJA 3P9MA 4PGCB 2J5LB 4NNXA 3V8CA 4D9RD 1WIOA 5ID0A 2HFGH 5D96C 2P45B 2IAND 1DR9A 1ZVSB 3DNKA 4Z7NE 3GI9L 3EO0A 2NY6C 3OGCA 4Y7MA 2D4FA 3M8OL 4E0RA 5TE7L 3FONA 5JQ6L 4Z8FH 2VKWA 3IFNL 2VH5L 4X6CB 4AENB 4OZIA 4Y5XC 3TVMB 4BQ6A 4FG6C 3BPOB 2X4TA 5FK9B 1R5WB 4FQ1H 6CGTA 3QNXB 1FNLA 1MREL 3VI3F 4PJXB 1KULA 3IFOB 1V3LA 3P2TA 4DWHA 3QDJD 4NM4L 4BUGA 4P4RA 2AQ3A 4PGEA 2PXYB 5HYSB 3KHQA 1PKOA 3EYUL 1RZIB 1A7QL 4LRNL 4OV5B 5DUPL 3BD4A 5GGTA 1WFOA 4LKCB 2DTSA 4ZNCD 4QOKD 2H6PA 1NCWH 4PFEA 1HI6B 2BMKB 3S34H 1CG9B 2AJ3B 4FG6D 3AXLB 2ESVB 1CFBA 3QULB 3HLAA 4AEIL 3QQ4A 1HNGA 3BO8B 4J6RL 2ATPA 4NJ9L 5IESL 3CFCL 4HW6A 4S0SD 4JFHE 2GHWB 5FK9A 3CX5K 2ZG3A 5B4MC 3EYSH 2EZ0C 1BX2A 2E7CA 1KV3A 4MGXA 2R56L 1OLZA 3G5XB 3I02B 3VFOB 1OOAA 5KVGL 4XMLL 1Y0LB 3PL6B 1VACA 2QR0B 4S1QH 5IW3A 3FN0L 4LCYB 3CFIC 3DV4A 1CDIA 3U9UA 4JPIA 1MHPL 3MLXL 4HJGA 5IQ9B 4AT6B 4HF5H 1VHPA 1FPTL 4HAFA 3QIWC 5D7LB 5MI0C 3EO9L 3PGFH 4HUXA 5IBUG 1W72A 4PS4H 1CCZA 3O9WD 5DD6B 4EN3B 1MFAH 3MCLH 2W91A 2CJUH 5IR1A 5GQBA 1BFVH 1NANH 2ADFL 4HT1H 5GGRY 4P5MB 3BW9B 1JIBA 5FGCE 3TPUA 1OWWA 3L3IA 3HMWH 4LCUA 3MLTA 3MA7A 3PJSA 2WLYA 1RURH 5L9DH 2K3TA 4FN0A 3UJTH 4WFGE 1BFOA 4JQXA 3U4BH 1IZJA 2IGFL 5EUOF 4K71C 3GDBA 2VTFA 5DD5H 5E5MA 1KNOB 4BZ2L 4X9HA 3TBTB 2O5ZH 4YAQB 4AEIH 3QDME 1WWAX 1TPXB 2IC2A 1BD2A 1TJIH 4NUGL 4U6HB 1T0MB 4YHYC 2IBGA 1P2CA 3MRJA 2XT1B 3MXWL 4YHOH 4KTDL 1EDQA