3WTVA

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 20
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtvA00
3D08A 4IBVA 4GUQA 3WTSA 3Q01A 4AGMA 2ADYA 3TS8A 1LJMA 3IGKA 2J1WA 3ZMEA 1GZHA 3KZ8A 1HJCA 1EAQA 2X0WA 5AB9A 3WTVA 2IOIA 4IBWA 1GZHC 3WTUA 2BIOA 4IBUA 4L18A 1T4WA 3QYNA 2VUKA 3US0A 3D05A 5A7BA 2MEJB 2GEQA 1TUPA 2X0VA 2IOOA 4KVPA 4AGOA 2XWRA 5G4NA 1IO4C 2ATAA 2J21A 4AGPA 2XWCA 5LAPA 3WU1A 1E50A 2P52A 4AGLA 2AHIA 1UOLA 3D06A 4IBTA 2X0UA 3VD0A 3Q06A 3IGLA 1YCSA 5AOMA 1EAOA 3EXJA 5AOLA 4HJEA 1KZYA 4IBYA 4IBQA 5AOJA 2IOMA 4AGNA 4LO9A 1CMOA 3WTXA 2J20A 5BUAA 4XR8C 4IBSA 2J1YA 3EXLA 5ABAA 3Q05A 5KBDA 2J6WA 2OCJA 5G4MA 4MZRA 4GUOA 1H9DA 1CO1A 4LOEA 4L0YA 3VD2A 2H1LM 4L0ZA 3D07A 1HJBC 4A63A 4IBZA 2J1ZA 2AC0A 3US1A 5AOKA 3WTTA 5AOIA 3VD1A 2WGXA 4IJTA 3WTWA 4LOFA 2PCXA 4AGQA 3D09A 5ECGA 1TSRA 2BIMA 2RMNA 2BINA 3WTYA 2J1XA 5G4OA 3KMDA 2BIPA 1EANA 4MZIA 4QO1B 2FEJA 4G82A 1HU8A 4G83A 5LGYA 3QYMA 2BIQA 2YBGA 3D0AA
chains in the Genus database with same CATH superfamily
5I73B 4IBVA 1AGCA 4Y19A 3NRPA 4D8OA 2VZTA 3OKEA 4ELME 3FTSA 1ACYH 4GEJA 4OH2A 2NQCA 2V7NB 1IGFL 1XCTB 1KCKA 4KNSA 3RHWF 4DKFL 1WT5A 1XBDA 4G8IA 4LSTH 4HVBA 3DUSA 3MREA 5BUGA 2VW4A 4BQ8A 3GUTA 3S37H 3TVMC 4D7BA 5FOBA 4IK6A 2A2QT 1BFSA 1X7QA 4P05A 1A7OH 2DD8H 3U83A 2ZUTA 5HYSB 2NXZB 3E3QC 4NO5B 5E1AB 3BCFA 1RD6A 2H2SC 3EJCA 5E8DH 4DVRH 2XG4B 1ZT1B 3KXFB 4ZFOA 1NFDB 3NCYP 4N3UA 5GGQH 1UD8A 1DZBA 5DMIL 3FPXA 3EOAB 4A7UA 3NSXA 2E7DA 3I9AA 4WTZG 1Z9LA 3HG0A 4FZ8H 4P5KB 4NXKA 4YXKL 3ARDD 5CEZL 2D9QB 4WNSA 2QTEA 3K2KA 3GSXA 5I16A 2FO1A 2DM4A 3SDXB 1AMYA 1DBBL 2CBOA 1J86A 2W0FB 4KY2A 4RQQA 4XWGH 4PCYA 1NWPA 1XWVA 3QNXA 3V0JA 3LZFH 3WFHB 1JGDB 3MNWB 5GRVL 1MCHA 2UZYA 1A5FL 2YA2A 3DETD 3VRLE 5AG8A 1S9XA 4Y5VA 1IC4H 4JPVL 3PE9A 3H1ZA 5C71A 4P23B 1AHWC 1X9RA 2J20A 4GSUA 1CXLA 4RFOH 4P2QA 4QGYA 3ARGB 1FE8L 3BLPX 3N06B 3TF4A 4DUVA 3BKJH 1MDAA 3DVGB 4PLOB 1RZKL 1JWUB 4GP4B 3DK2A 4LHJB 2ARWA 3TH4T 1A9EA 1F86A 4EI6B 1YY8B 2V9UA 5SWZB 3MLRL 1O6VA 1S78C 4WW1A 2B4CL 1OM3H 3C5SA 3ZOAA 5K9KA 5FYLH 2GT9A 4LDEB 4PP2B 4X0NA 1ULVA 3LRSB 4MYWB 1A9BA 1JJUA 1WFMA 2JCCA 1PDKA 1XAUA 5FW6A 3WFZA 3M7OA 5IR1A 3PQYD 5ACMA 3TEZA 2X42A 3DTUB 4N0UB 1PX4A 4WEUD 4JJHA 5GS3A 1WAPA 1M42A 3WV0A 2P5WE 2O6DA 1XF5B 1U8OB 3WELA 1D2OA 3BN3B 3T08A 4PQXA 5F7HA 2XN9D 1JZ3A 3SN6N 2J1XA 1JXFA 3IVKB 2QR0A 5C9JA 1EAPB 1NANH 4JHBA 4P5TB 4G8GA 3CU7A 4EUPH 2BP0A 1DO5A 3PAVA 5I8CB 1PW3A 5AZ2L 3KLSA 3V55A 3NT0A 4IK7A 3FCTB 3RFRA 2NY4C 1XGYL 3H7BB 3UFIA 2NW3A 1N67A 4Y2DC 1G4RA 4UOQA 4ZDHA 2GUYA 1R5WA 1NCBL 1IMHC 3MODL 4MNHB 2ZTBA 3UG3A 4NO3B 4X5XB 1CURA 4DKEL 1K9TA 4PI0A 1FSKC 4HCIA 4PFEA 1BFVL 2WXKA 1LEKB 4GUQA 2TRHA 3PL6B 2AMGA 3GSVA 3E9UA 1R3JB 2YQ3A 3LEVH 2DQUL 3HJEA 2JKSA 4L29A 4LESA 2X0WA 3QP3A 2BIOA 3ECWA 1QBLL 4DO4A 4YGVB 3MCKB 2HG0A 5B39A 5GS2H 1KC5H 2IH8A 4OZHB 5IR1B 1U9KA 2VUKA 3FTYA 4HALA 4QOKE 3L4ZA 4ORZC 2XWRA 3MCLH 4ODUB 1BYNA 3HHMA 1S9YA 4BFJA 4ETYA 1E2ZA 3MO1A 3N50A 4Y9GA 1PKQB 3SZKC 2VLKA 3AM8C 4G9FA 4MAUL 4N2AA 4YSDA 4D0CA 1BZQK 1C12B 1Q9WA 1IM3D 2IH1A 4OW6A 4XC3L 3SQBA 4FI7A 3VI4A 4G7QB 1BZ7A 5T5FH 4PV8A 4GO6B 1JGVH 1ORQA 1X9QA 5SV4A 1BCIA 2Z91A 3ULVE 3CQQA 2R2HB 2DZEA 4XPTH 1EAOA 3DPBA 3PJSA 4X83A 2HX9A 3HI1A 3MMEB 2WWOA 1BD2B 1RZFL 4FADA 4FFYL 3GMMA 4GQPH 4R4FL 2DBLH 2H32H 3SB3A 4FULA 4Y4HB 5EHFA 4HJJL 3OPZH 3D25A 3EYOA 3CFMA 2EEDA 1PIFA 4W6YB 1KPVB 3ULVH 4N85A 1TITA 3SDCC 3APFA 4PRPE 1ETA1 3T65A 2DTSA 3ROLB 3ZZ1A 4PD4J 3OC8A 2ZT9C 5K1JA 4GG6E 3V2AR 1CO1A 2AZAA 1KN4H 1R75A 4UTBA 4EIZC 4XNYL 3WIHH 3KJ6H 4PJ5A 3RWIA 2BO0A 4KVNH 4GXVL 5SWSD 3DOSB 3NIGF 3QAZC 5C09A 3MRKA 3TWYA 2OSLB 3LRSA 1J9SA 1KUMA 1CF1A 4A6YH 4JPIA 1PDKB 2ZOLA 4JHUA 1I4FB 2YD5A 3OF6D 4R83A 1V5JA 1NGWA 1FNSL 2GSIA 2PR9A 1KJ2L 4OM1L 4ANWA 5I75B 4I4WA 1HYRC 5DRWB 2VDMB 4PJAF 1S7WB 5D7IE 4APXB 3CPLB 5CILH 4XMZA 5EU6D 5C0EA 1JZ4A 4BH8B 4AK2A 4TOYH 1FJ1A 3GS4A 3KYOB 4XNQA 3D69A 4J3WA 4LQ1A 4AVIA 3ATDA 3F6IA 1D5ZB 1EJOL 2QVTA 3WLBB 1MNUL 1OO2A 4CSSA 4K8RD 1HHHB 1TQCC 4IRSA 1KT2B 2J88L 3NJMA 2R0LH 4U1JA 2XT1B 3ULUL 3R18A 4ODVH 5EIIG 1T6BX 2H6UA 3G08B 4CVXA 4M7LH 4KAQH 4PR5A 1PG7L 2GHZA 4IJ3B 3G6JA 5C0GA 3WNLA 1GOHA 2OMUB 4NEHB 2WBJD 3TYGL 5AAPA 4HKJA 2KYIA 1CD1B 4DESA 1RZKC 1RZJL 3DTXA 2FSEB 3HN5A 4P23C 5HHQA 2VLJD 4L1SA 4FQJH 5EO9B 1XL6A 2P8LB 3RVUC 5CGMA 1L9RA 3VACA 1QI5A 1LK2A 2OX5B 1U8JB 4G6KH 3WDJA 4B9GA 5ABZA 1EDYA 3KPTA 2X88A 5ICXB 1G7JB 3O6KH 3VU2A 5TDNA 4V33A 4OLZL 3OXRB 4Z3JA 1AS8A 5HI5C 1YPZB 1G6RA 4QLWA 1R5VA 1NINA 2EIDA 2GSGB 3CHQA 3IE9A 3O6FC 3TBYB 3Q9PA 5JDSB 5IBUB 1GW0A 1TEFA 4PJGE 3PQYE 5FK9B 4XNBA 1N0LA 2EDFA 2Y69B 1FHNA 3B7YA 3CVBA 4JKNA 4TVPE 2JXMB 5CFHA 4I0KA 1K4DA 1MJ8H 4KTEL 4EIBA 3LN5A 1GCYA 2AV1B 2I5YL 3EO0B 4XCFH 2R2HA 1JD7A 4XP1L 3W57A 1WAAF 3IFPB 2VLLA 4OLVL 3RVXC 1XD1A 1A64A 3K46A 1LWRA 3LHAA 2NNAB 4PR5B 5HYJD 1XCWA 3QZNA 3LHPL 4L8CB 1BVNT 4TVPH 3AW5A 3UCRA 4AXWB 3BW9B 1UOVA 2D7QA 1KDIA 1F4WL 1E9QA 1CIUA 1FH5L 2B2XL 5HBBA 2VNCA 3FFDA 1QEXA 5T33L 3EFDH 4K2UH 3P1VA 4NUJB 1U2YA 1RVFH 4GG8A 1Y6NR 2EXTA 3QNYA 1AD0A 3VVWA 4KJQC 4TUOB 5F93C 3K72B 4NZDA 3AS2A 3U2SA 1MIMH 4EEEA 4B9CA 1OAXH 3SDCB 2R2BB 4KWUA 4OLWL 5F7DA 4XNZC 1BGXL 1XH0A 2H5UA 5E99L 5C0RL 4LFHD 3LOWA 1JNHA 5J6GB 3D87B 3MRMA 3K91A 3EGDB 3QDGD 2EYSA 3PYCA 4AQAB 1R3LA 2R69H 3W39B 3EHBB 1AGFB 2EDNA 3KM1A 5JW4M 2IXQB 1TSHA 4XCNA 3BN9C 3KPSA 2ESVD 5DHVH 2VN7A 3MV8D 2VSKB 3MPCA 4ZSOB 1F97A 2CHXA 2WKOA 3QEQA 2LAAA 3QSKB 1OD9A 5CGYC 2YBGA 3PWPB 4HUCA 3TNMA 1A7QL 2F0CA 3TA3D 1SN5A 3C6SA 4WHDA 1FFQA 4U7MA 1H6UA 2F6AA 1NJ9A 1QBML 3ASOB 3KLDA 3S36L 3SYCA 4E41A 1IX2A 3BP7A 4UM9B 1SOXA 4D3CL 4LASL 2EIZA 4LHUA 1FCGA 2NXZD 4W68A 3L2MA 3DUHA 1HXYA 4LL1A 3TF7C 3DROA 4HXBH 3L9BA 5JW4N 1R5IB 1T6VN 1HX0A 1PLGH 3BT2L 1CLVA 5JQHC 4URTB 2Z1KA 4EBQL 4NO2A 3HC4L 1ZEAL 4PY8I 1GHFL 2A6JB 1RIVH 5EIIB 3ZYOA 1U3NA 2J5LC 1O75A 4JHAH 5F1IB 3JWNC 2HRLA 4JRXB 4KKRA 5ACZB 3EZ8A 4JFFE 4G7RB 4P04A 3WBDA 2ZKXA 4DFIA 3SE8H 2DB8A 2MJWA 4EI0A 3IFLH 3Q5OA 1JMXA 3TXAA 1KGYE 4M9OA 5DRZA 1DO6A 1JGEB 3T1FB 1A0QL 3LKQA 3V6FB 2GCYA 1NCIA 1GH7A 2JK5B 4JHZA 7FABH 4MJ6A 2IDSA 3HZKA 1IQDB 2YR3A 4N22A 1ZGLB 2L8AA 2CLZB 4QOKD 1I82A 2NR6A 1F45A 2A83B 3D0VA 5DJCA 3TN0D 5T1KD 3R8BB 3SY0A 4DO6A 3HPLB 5ESAA 1XGQB 1SDDB 3APMA 3HMWH 4Y7OC 1AR1B 2L7QA 4WUKL 3OLDA 4Q9BA 3ML9A 4UNIA 4LOEA 1RSFA 3R06B 4HIQA 4AM0A 4H8HA 3DIDA 4RMRA 3TT1L 5F3HB 3H56A 3O45B 4Q6IA 5JHLA 1C5BL 3WIFA 2XV3A 3FQ1A 4HUXB 4F93B 4I3RH 1U8MB 1XH2A 4XXCA 1KWGA 2DBJA 4HK0B 2JKWA 4H0IA 1KTRL 1IGCL 4MQSB 4LEEA 3I6KA 4QT5B 3GI8H 1ZJBA 3VRLF 1K4DB 3LVTA 1IEAA 2WOYA 4G72B 4P5TD 2AV1A 5EZPA 5IIEA 5E8OA 2L7EA 4KV5E 3B83A 3VVVA 3WGUB 3DSFH 2B14A 3GEWB 2CRMA 4HIJA 3KCWA 4HFWB 2M8XA 5CP3A 2WYHA 4EQ2A 1IKFH 4MX7A 2CR6A 3D9AL 1WA0X 2PW2A 2WZPD 3RA7L 1ZGLA 1G7MB 1VGKA 2NTSP 5DGQA 3I2CH 3FO1A 1ZHLB 3V4LA 1QWUA 3PL6D 1E9QB 2BNRE 3BZEA 5AVTB 2KZ1B 3PHQB 4DFHA 1REIA 1CLOH 2XJLA 2G5UA 1S6NA 2M83A 2BVQB 5TE4H 4ETQB 3LVEA 3VSTA 3WMQA 4OJAA 4UV4H 3TL5A 3GMRB 5CP3H 3UABA 1ITCA 1G7QB 1UVQB 2YRLA 5F6HI 4JM2D 4P57A 5ID1A 4PP1C 4AIZB 3TWCL 4PGZA 1IT9L 1JF5A 1NGPH 1SQ2N 1DQMH 5FGSA 3I6KB 4F92B 1KGCD 5I0WA 1DCLA 3B2UD 2ZUSA 2ZKWA 2H6PA 3ABMB 2YEZB 1MWOA 3SE9L 3DJ9A 4QYAA 2FGZA 3QUYB 1BXUA 3SE3A 2HKFL 3DMMC 3KPSB 4FFVC 1JK8A 1BMGA 5D5ME 3CZUB 1WAEA 2XN2A 3DUUA 3RVWD 1KELH 3B43A 2BDNL 4ELMF 4IM8A 5D1QA 4H88H 3P4MB 4ZX4A 3TFBA 2YPKB 3HPJB 2Z93A 3JV0A 4NAJA 3BFOA 3L81A 4Q6IC 2XRAL 3U4AA 1GPOH 2EDDA 2WJ5A 3MRDB 3BSZA 4ZAKB 3HUJB 3BOVA 4LRIC 4N9GA 5C08A 4E9SA 1K72A 3DV4B 3TYFA 3ZK0A 2NY5H 4FERA 2WKOF 4MJID 2DQDH 3POHA 4KK6C 3Q05A 1FFPB 3PWPE 2DKSA 3RL1A 5DLML 5GRVK 3QG6A 3RTLA 2J72A 2BHUA 3SBWC 2R0ZH 3VWKB 2YN5A 5F6IC 3QAZB 1AQMA 3ILPB 4M7JL 4NUPA 2B9AA 1OGPA 2VRQA 2OL3H 4HZLB 4FOMA 5C6TL 4MJ4A 5MENB 2DV6A 4JO1L 5E2UL 4JM4L 2VL5B 3EBIA 2CJ3A 4LPVA 2DYPD 4XVTL 4XVUC 1M1XA 5D1ZA 4ZUVA 1SJEA 4B5ZA 4PGEA 5JA8B 1N5AA 3L6FB 5BPPA 4JM2F 3K71A 2WYTA 2YO3A 1TEGA 5GRJH 2X4RB 3T8XA 3P0GB 2UUDK 1JUFB 1QG3A 3WXWL 1I8MA 1YC7A 3RIFF 2E7BA 5EBLB 3CN1A 3SJVA 3FDWA 5LHDA 2OTUA 1DUZB 5IQ9A 1VFUA 4O02A 4OIBA 4X5RA 4PUBL 4N90E 3H3BC 3UJJH 4NRXA 1G7IB 3BZ4A 4L8SC 3F12A 4JY6A 5E7FA 1FORH 3D4GA 4DZ8B 1MHEB 1SYSA 3WNIA 3KBFA 3H9SD 1UCBL 5DJXB 3UYPB 5KS9E 1MCPH 4M1DH 5LCVH 5J5EA 1VA9A 5F7WC 4JKMA 2BVQA 2DTMH 4FP8H 3DJSA 2IWKA 2QADB 1U58A 4Z7QB 3QO0A 1MJUL 2E86A 3MJ7B 3FU3A 3RE0A 4DQOH 5IEHA 5E5LA 3KR3L 1AE6H 3D3VB 4Y5YC 5DJ0B 5J9PA 1EJ8A 4HJGB 5D72L 1MI5A 5KAQF 2HVJB 1A9VA 1KBBA 2VIRB 2BCMA 2BHZA 4OCYL 2ZKHH 4LP8A 3IMBA 2MNWA 2QJDA 4APQC 2KKQA 5MHSE 5KVDE 4NM4H 4HS3B 3LNHA 2H26A 2YC1A 2R39A 3QUYA 5GSVB 4Y2DA 3QR0A 1NL0L 3ELAT 1W16A 4MA8H 3ETSA 2A0LD 4PJ5D 3BKCH 4KK9D 3FCSB 4H1LH 4KXAA 5EZJA 4ONFH 2P44B 4DEWA 5ESQB 3NH7L 5TD4A 1T2QH 3L1OH 1I7TA 4GS7B 1I8AA 1IGYB 3P40A 1YYCA 3REVB 2DRUA 2EE0A 4CN6A 3QG7H 3T3MF 4J4PC 1A3LL 4PRAB 1CDGA 3FC8A 3S97C 1MFEH 5CZVH 1M3IA 3FOLA 3MLYL 4LDOB 3IJEA 5I1CH 2XG4A 3JUYA 4ZFOB 4ZW5A 4IGBC 2ZNWA 4ATWA 1BBDH 3BUYA 4JGMA 4LHQB 2NRDA 1AGDB 2Y6SC 3UAJD 1FO0L 5D6DA 3L4CA 4GOSA 1NH6A 5F7DB 2EZ0C 3LXCA 2HUHA 4DPRA 2E6QA 2QSTA 3IAPA 4HMEA 2DMHA 5FM5O 4K3HA 3DJRA 5TF1L 5CSBA 3V6OA 5FF6A 4JDTH 2KPWA 2H41A 5E9DA 3KJ4B 3GSWA 2PCXA 1RZJC 4JO8A 2UWEB 4F7MB 4KJWC 3BESR 5C07D 3EHBD 3IKKA 1DQDL 2F8VA 4I9WD 4L9LB 3KVDD 1A6WL 3QAQA 1I7UB 3QEQB 1JZDC 4S1DD 4B9ZA 1YMHA 2ODIA 4KJYB 4MRCA 2E8ZA 5A40E 4N86A 1AHMA 3G6JB 1J5DA 3UC0L 3QORD 2PP8A 2OZ4H 4WO4B 1MRCL 2H7WA 5JXEA 3JWNH 2LLLA 5IHUH 3TA3B 3VI3A 5ACLA 2P5PA 2R0WH 2YKKA 5AALA 2D0FA 5I66B 3W82A 4PJXA 2I9TA 4YSPA 3UTZA 3Q6GH 3F12B 3IAQA 2A3TA 2CUMA 3MRJA 1LHZA 1P7QA 2EDLA 3GJEB 3LXUX 4M6AA 5HPMB 4UM9D 3VFGL 2K7QA 2MPAL 2I69A 1IAIH 3ULUF 4IBUA 3AXLA 2F74B 3A5VA 1G6RB 3NUKA 4BHUA 4H8VA 1J1XL 4OT1L 4WY7H 4DVRL 5FA3B 3D52A 3FN3A 4OLXL 3RI5F 2YD4A 3V7AG 5F7MC 1AGEB 4LEXL 4XN4A 3K71B 5GGSY 2D31A 3BEVA 3BH9A 5DJ2A 3LKOA 5DJAA 2VLRB 2EDOA 1Y07A 2J4WL 4LLVA 1DEEA 2Y7OA 1X5YA 4XBEH 5FO9B 2F7PA 3HEIB 3GHEL 1FSKB 1KXTB 4Z7VB 1J5HA 1LGVA 1DYZA 4DGYL 1QLFA 5D5MB 3W0WE 5TQ2L 1DBJL 4KJYA 1OZUA 4BSVA 1E6OH 4WV1B 1L3WA 1D5MB 3E1ZA 3BVTA 3SY6A 4M93C 4K4KA 1P4LA 4OFQA 3WAKA 3KPRB 2IAMD 5JHDB 4NSKB 4OZIA 3TCLB 1IC4L 4R26L 4UTBL 3H6AA 2EC8A 2B5IC 3QRLA 1SGKA 4MJ2A 1X7QB 3AVEA 3S6CA 1HINL 3ES6A 1R3IL 1RUKL 4GT0A 5L7XL 3SBWA 1KB3A 3KWWB 3S35H 1XD0A 3RZWA 4BZ1L 1BPLB 4NJAL 3QUML 2IWFA 2Y3NA 3WI9A 3V4VB 3C08H 3GPEA 3OC5A 4Z7WE 3WUZA 5BVPH 2EKSA 2H8PB 5B8CB 3KBPA 1QR1A 5FYKH 4AQEA 1TVBA 1F3DH 1IVLA 3GXNA 4P4KD 3BRFA 4KX8A 1VEPA 4YDJB 1QEWA 2CNZA 3I3BA 4FX5A 4NN6B 3BPNB 4K23H 1T20B 3B2VH 3OHXC 4QF1B 3GWJA 4UQ2B 4QTFA 3QRGH 5IIEB 2MHAA 4JFSA 3SGDI 2DQCH 1F3DJ 3P3TA 3T3PF 3O41A 3W9EB 4PVBA 3HE7C 5TPWL 4AJYV 2YSSB 3X14B 1QFWL 3MZTA 4K9EH 2D7TL 2GKIA 4AMKL 4N2KA 1D5MA 5EZJB 4U3SA 2QVIA 3L7EB 1U42A 5MP6H 5JW3H 2V37A 4F9LC 3TO2A 1SJVA 4CILA 1KCUL 4PY7A 5AB1A 4WU5B 3RY6A 4K8RH 4KQ4H 1D7FA 3MJ9H 4JCMA 3N1MC 1XAKA 4JO2L 4AEFA 1FDLH 2OMYB 4K3JH 1XR9A 2APXA 1ZA3B 3ROOA 2HMID 3NJVA 3QR1A 2EP6A 3VFVA 4RZKA 4OIIH 2WSKA 2VDPB 3NN8A 1DVXA 2Z31B 4MA3B 4TSAH 1I9IL 5I19L 3IMWA 5HYJE 5KW9H 5ID1B 2CJUL 3RPBA 4ODXA 1NC2A 3D18A 3V79C 2YBRA 2LABA 1KC5L 1OF0A 4U6VL 5E0QA 3DX1A 3IVKA 4BSJA 1F6AA 1J9CT 2F5BL 4KO6A 3VXMD 4J12A 2WTPA 4HSAC 5DJ6B 1HTYA 5A7BA 2F18A 4F7MA 3GJFH 1FRGL 5ICZA 2E9BA 3OAWA 3GZQA 4RGMC 5AL8A 5CGTA 4U6YA 1FUNA 1DJXA 5JOFB 4X6DB 4CN1A 2B59A 2AEIT 5HYEA 2LR4A 1HI6B 3VFNA 1AD9B 4KZDH 4R6UA 3WLBA 1OP9A 3F62A 5I1AA 2WM0A 1MI5D 5IHWA 3KLHC 1XFPA 2J6EL 3QCVH 4LPWA 2G3NA 5BQDA 4KDWA 5J13B 3OHXB 2MQ3A 4M03A 1HEZB 3FOMB 4M7KL 4OFDA 4PJXB 4XC1H 5HGAA 1SMAA 3QIWA 1J5CA 3TIEB 1CMOA 3Q48A 4NSKA 1BXXA 1XIWB 3FT4B 5KAQG 5HDOA 3BO8B 1H19A 3ZDZB 4PJCB 3L3OB 5IJVA 3BAEH 1KLUA 2X89A 1JHTB 4A2FA 5LXGH 1AKJA 3K0WA 2H6OA 1BWMA 3PRZA 1SBSL 4MDJA 2JB5L 5AYQA 3VWKD 1PZDA 4K7FB 1D5XA 3C9NB 3G04B 4X8GA 5DJ6A 3LS5L 1E4KA 3MYJA 1N9PA 3F7LA 4UT9L 1SN0A 3UIYA 4X6DF 1MHCB 4L05A 3IJSB 5CCKL 3NCJH 3QQ4B 1TCRB 1MZYA 2D9CA 1DE4B 3B1UA 5GZOA 1SLXA 2FL5B 5JORB 4M8QA 4NHUB 3Q2CA 4Y4HA 4YFLF 2Z9TA 3L5XH 1RZIA 3D33A 2FQEA 2J3SA 1ET8A 3NP4A 1AFVL 4X80H 3VSUA 2VDLL 4HDIB 4NCC2 4OY9A 2X70B 4RISL 3WY4A 2R15A 3O0RL 4LSQL 4XX5A 2X4UB 3EGSB 1KXVC 3BPNC 3ULUE 2XWTA 4YLQT 4ZMYA 4WW2C 2X05A 1FA4A 2AQQA 2F53A 4JRWA 2DEYX 2V2WB 1AZCA 1BZ8A 2CUIA 2D73A 1G94A 2ZCLH 1I7RB 2GHWB 3MRBB 4Y2OA 5AL0A 1T5XA 4J1UB 2W0KA 4ZFFA 3H9SB 5JQ6L 4XPAL 3VXQA 4JDVA 1TVHA 4P57B 4JZOB 2Q2LA 5C0ND 1R34A 3FT3A 2EE2A 4ZRGA 1SYVA 3WJMA 3TYGH 1KLFB 4YEEA 3S4SA 1OB1A 3WJJA 1IILE 2PWGA 3QIUB 4MWFB 5DWPA 3B2DC 1FPTL 3ARGD 1WFIA 1YQVL 4UQ2A 4G6FB 5DD3H 2ITDA 2I25N 5H37G 5BZXA 4FQHA 2ICES 5DZJA 5K69A 1ADQL 4XGZB 1NC2B 1PIGA 3CG8A 3D18B 4YSEA 5J7CC 2ATPA 3PJLA 2EYSB 2VN6A 4G6KL 1TJHL 2J2ZA 1B4RA 1XH3B 4AYEC 4KKBC 5B3JE 3QJVB 1UZ8A 1MCIA 2ZX6A 1MCBA 5DHVA 3EOTH 4PREB 2IFGA 3QUHA 3O3AB 2CHZA 4W9KC 3C5JB 2CPUA 5CZXC 5C0AD 2DQ6A 5C0CB 4FFZA 1G7HA 2I27N 5ESVB 1W72H 4ZSOA 1RMFL 2CRYA 4O51A 5F72S 2YSTA 1VJSA 1OE1A 4W9CC 2F19H 1FV1A 4P3WA 4HWBH 5HVHC 1XGUB 3TZVD 4Z23A 2X4NA 3BWAB 3BD5A 4F57H 4PCKA 4GIPD 4X7FC 1AHKA 2FH6A 4QHNA 4ZUSB 2IOMA 3VWJD 3O11A 3O2DA 3OX8B 3EBGA 5DJZB 4U1MA 2O26U 2AGJL 4P4RB 2IBZX 3VXTA 3EF7A 1CDUA 2KLTA 5HHVH 4TVPL 4MMZA 1VESA 5C3LD 2AEPH 3N42F 4PJFB 4ODXB 3KLHD 3SDDA 2Q7YA 2Y36H 5CU9A 3NMEA 5E9AA 4J39A 1F4WH 1KLUB 1OTUD 4IGBB 3U1QA 1C8QA 4BH7B 2AJSL 3BFWA 4JB9H 4BK5C 3IDJA 1UM6H 4XBGB 2VAAA 3FCUB 3GHBH 1EEUA 4ORGA 5EF1A 2ATPB 1NPNA 4Z7UE 2CK0H 1MIML 1S8DA 4Y89A 4A63A 2J57A 1LO4L 4MNQD 2FWOB 2J5WA 4Q6KA 1E27A 5AOIA 2E9GA 4R90H 2BWQA 3X2QB 5JIIA 4E0RA 5AG9A 5C07B 4BSWA 3LPOA 5HI3C 1P5VB 2A6DB 1UQSB 2Z4QB 2WJ7A 3JYBA 5DURB 3WNNA 1CFVH 3TV3H 3FQNB 1WFUA 5JPMB 2CHWA 4P3DB 2UYLA 4DZ8A 2IVFC 3IJ9A 4GSDH 3FONA 1Z5HA 4DUWA 3BWZA 2VO5A 3HCVA 5EZLA 3VXPA 3PPEA 2EDXA 1P0SE 3BVDB 5EZOH 5I6PA 1TETH 2ZSVA 4N20A 3ZR5A 1LDPL 2RACA 2WLKA 3L3KB 4P9HH 4PJIF 3EYVB 5HPMA 1E4HA 4XVUD 1XZWA 2VXTH 3UGUA 5BV7H 3SODB 2XZZA 4F2MA 1N10A 1RURH 2BVOA 2FO4B 2WVVA 1T4KB 3PPSA 2KZKA 1AS7A 1DVYA 1PLCA 2RQ8A 1D3CA 4BQCA 4HOZA 5FC9A 4LIQH 3HN8A 1XL4A 1MHCA 1JZEA 1N3NA 2QGBA 4JFFA 2IH1B 5E8NA 1TQWA 1X44A 2WTRA 4O2FA 4WEBH 4KXZI 3U7YL 3GXDA 5IKCB 1B88A 1DBKL 2E7LC 5IQ7L 3QXDA 1S5IL 3NPZB 2WAHA 1UD5A 3SHSA 1YNKL 3UYRH 1N19A 2EVJA 1RUPL 3S3JA 2DJ4A 2PPCA 4QXTA 4GAJH 3IDMB 3VRJB 2VLRE 3L4TA 1VFMA 4AC2A 2BNQE 1MFBL 4IBTA 1AZVA 4OD1H 3ECBB 3U1SH 3HCVB 5EZLB 2WQ8A 1A1MA 5D70L 5IVZB 1CGVA 3F3HA 2IAMB 4OZHF 1WWBX 3E1F1 1ZV5A 4I7ZC 4CAGA 1TKWB 1DBBH 4U6XB 2EDRA 3CQPA 3LZFL 5JQIB 2E6JA 3BYYA 1SNRA 4Y9EA 4Q9RH 4JPWL 1Q9WB 4XPGH 1JRHI 1PKQE 3GTNA 4XR8C 2XV0A 4IS6B 1OTSC 2Q86A 2HFGH 3EDKA 4FMVA 3T6WA 1OGAE 1BBJA 4W9EC 2EYRB 1PJ9A 1FL3B 4LCIL 1BD2A 3MOBL 3A6BH 2ATKA 4QWWC 1AXTH 2K4WA 1RERA 5HI4D 1X7SA 3Q43A 2KQMA 5ACZA 5DK0B 3VI4E 1FNGA 2XLLA 1KYFA 3O41B 4HA1A 3W9EA 2QDVA 2YD3A 3BIKA 1QVOB 4APQA 4UF7C 1P9MA 4IHOB 5D1QC 4JUSA 3IJ8A 1J10A 5K9OA 2JB6A 3WTTA 1FGVH 4LSVH 1JF6A 4G1MA 4U3SB 1VLXA 1YMHB 1T2JA 1TPXC 4P07A 3MOAH 5HDBB 4PTUA 5E2TL 5I26A 4AGQA 1MW3A 1QTYT 2H3XC 2X1WL 3QH3B 1N7MH 3RVTD 4ZUSA 5DZNA 2R8SL 4JFXA 3MTRA 4ZS6C 2Z65C 4OFIA 1QFUL 5E1AA 4X7DC 4EQ3A 4NQUA 3I02A 3E8UH 4UQAA 1DUYB 3K81A 3WIAA 4AEEA 1BQSA 4NYLA 4PJ8D 1AZUA 3ZXAC 3NEOA 1WTLA 3AFLA 2W9DL 3VXOA 1HQ4A 3LTVA 2WNKA 3NOIA 3M45A 5DA0B 5F3HA 1GW6A 1KV3A 1Q0YL 2DEXX 4JHWL 4ZFGH 3TVMB 3UH8A 4XCEB 3CFKB 1IM9B 1P4UA 1URZA 2W0PA 5LBGA 2GBVA 1ZPUA 3RY5A 4F5CE 4Y1AE 5LGJA 3CHXA 5E2JA 4LLMB 4L3EA 5F7UA 1O9ZA 1X5KA 3CJJA 5F7FA 3QW9A 1PGRB 1CN4A 1DJWA 2F7RA 3JTBA 4HJ0D 4RA0C 3VXMB 4HWEH 1U8PB 2ZD0A 3MLXL 1MAMH 3RNQA 4U1JB 4PRNB 3V0DA 3FYEB 5LQBL 2BVUA 3PWUB 3FMGH 4X6EA 4XO4A 3EJUA 4P46C 32C2A 2HKHH 4GEIA 3BJ91 3W9DB 1I1CA 2JIXD 2BVPB 3HLAA 4OBSA 4XMTA 1OWWA 3DX8B 3SDCD 2DW5A 3FTZA 4YDVB 3G7TA 2UY7B 4TS6A 2R56L 2YJLA 2IV9A 1FZJB 4O4YH 4F37F 4EI5B 4IBYA 3VXRE 5KSBE 5F97E 1KGXA 3KWUA 4GAGH 3AU0A 5EOTB 2LQRA 4XB8A 2IO5A 2ESVB 5CBEA 3TP4A 4Z7QF 1S7SA 3I50L 1F00I 4GQ9H 5DEZA 2VXVH 4TN9A 5CMAA 5E2VH 5DLMH 3KXFE 5IUCA 2VLKD 4G9FD 4Q6YA 3L16A 4GKZB 2I7SA 1I31A 4B96A 3T09A 1KYOK 3WNMA 2NXZC 4G43A 3ZO0A 4L5FE 3NFPA 1BXAA 1CPUA 1N6VA 3MACH 3T3PE 1NFIA 4P0DA 2YC1B 2YPKA 4ADJA 4QO1A 2VDMH 4Q4IA 3LKPA 2LTQC 2LLNA 3FPYA 4HWNA 4H26A 3O3EB 5HYQB 3H4FA 4OM0H 1RV6X 5C09E 2A4ZA 1F56A 1IEBA 1FNSH 1FP5A 3HZVA 4TTDC 1KJ2H 4CJ1A 3M8OL 4HH8A 3G5VA 4M3HA 3ZRSA 2IG2L 4XPFH 1CGXA 4PGJA 4P5SA 1Y18A 4P4KC 5DZVA 2NNRA 1B6DA 4PUBH 5E1HB 3DURA 3RWJA 3HHRB 3FT3B 3WJMB 1EX0A 5J11B 3MN8A 1PKQA 4DP1X 5GGUB 3B5HA 3WIIL 3RPIA 5L4JA 4ONGH 3CSGA 4F8OA 2J73A 5I1KH 3U82B 4J3OG 2EH8H 4ZK8A 2EXWD 3ZY7A 1E43A 1BM3L 1OQXA 3QIUD 4YSUA 3MUJA 3RGVB 3V8CA 4ZQTA 4KAQL 2HH0L 3VE0B 4J6RH 4HUVA 4GRMB 4LGSB 2VR4A 3NAAL 3S5YA 4DQOL 3EFOB 3VYOA 3ZQWA 1H3WM 2VM9A 3C5JA 2R29H 3SYPA 3BUIA 1AE6L 3TC9A 4PW9A 4XAKE 1MJ7H 5L4IA 3MI6A 3L1GA 4EVNA 2WIMA 4YXLH 5C0AB 5C0CD 1NBZA 4R84A 3VGHA 5ANMA 2ALWA 3FU7B 5A2BA 1CXFA 3HR5A 3D2UB 1AI1H 1N12A 2BSTA 1IARB 3E6HB 4KMTH 3D39B 3LKNB 2BVPA 4POUB 4LGPB 1KB9J 2G0LA 4FTDA 4CC4A 5C7ZA 1QLRB 5CEXB 1EERB 3VXTB 1G9NL 1BJ1H 3V5DA 2XZCH 1XF5A 4O9HL 4UTAL 1AC0A 3MFFB 4OCMC 3G3LA 4KU1A 3CFDB 4JQXA 2EECA 2I5YH 5KTEL 1PQZB 3UADA 4I0PD 5F1IA 1CL7H 5CZVL 2C1PB 4PRBA 2VW7A 3CZGA 1CK0H 4XP6H 2D31B 3NJGA 1BZ9A 4RFNC 3F04A 3SCMB 3OR6B 4TRPL 3MLPA 3NA9H 4MXQC 3BWUC 3RPKA 1E4WL 3N85L 4M8QB 4NHUA 1KJ2B 2YLHA 5HHMD 4ZO7A 2DQEH 4YH6A 1HDMA 2XPGB 3MV7A 3UAEA 1EO7A 5IVNA 2ETWA 5DJCB 4H1LA 1N5YL 5JW4Q 3QFJA 4JM2B 4Y5YA 4JO5A 5MI0B 2AMUA 5AD0A 1CQYA 2XZAH 1DQDH 3OL2A 5GJTL 5KYUA 3FO2B 4Z7UA 2IALB 4OLWH 3HFML 5ISZE 3KPOB 3S3PA 1EHKB 4F7CB 2LFGA 1IKNA 3D30A 4F80A 3KYMB 1X7TA 4DF9A 3FOLB 3QXUA 4JKLA 4EOWH 4OB5L 4OZGF 1FL6A 5EUKB 5ANHA 4A68A 5E6YA 4JQIL 5GHWH 1T03L 2K6WA 1AKJD 4K5LA 1UB5A 4QHKJ 3JTTB 3H55A 4NZJA 1U8CA 3B5TA 3D85A 4IRJC 5CHNA 4CJ0A 1T5KA 4EE2A 4FFYH 3DRQB 1RULL 2GIYA 1D5RA 2YKLH 5CN3A 3PJSB 3QHZH 3VXRD 4R0LC 4HJJH 4OZIE 4JO3L 1XH3A 4R5TA 5IKCA 3GDCA 2IOIA 4RZCB 5HI4C 5ITFA 1JK8B 5GGTL 5C7XL 1T4WA 2VDQH 3RBSA 2ADIB 4OLXH 5AQ0A 3R7QA 4UAHA 2FT6A 1JAEA 2QPEB 4YBHA 4YXHH 3RWCA 2GTZA 1U3HC 1QI3A 5DVNA 1P2CB 2WYIA 1JVKA 1UD2A 4ACTA 5L8LB 5L4FA 3N3EA 4MZ2A 3U4EA 4XXDB 3IBOA 1V7MH 3OKLB 5F3BA 1E7VA 5HGDB 2ZE0A 2DLFH 3HG1B 1T1XB 1ASQA 1EMTL 2FO8A 1I3RA 1K8IA 2HZHA 3GMRA 4JFPB 3PP4H 3F7PC 3KCPB 4ZUWA 2DDQH 4H8WL 4JFQB 4UQ3B 3LPWA 2WVSA 3ZVVA 2Z0BA 2UWEF 3E7JA 4PJAE 2VR3A 3QG6B 4UQCA 1XB8A 3TN0A 2NNFA 4H0GA 4G9DB 4IKLA 4LO9A 4Y4FC 2YZ1A 5DQ9A 1WUNT 4PJXE 4DP2X 2I85A 2P80D 3MLVH 3QCUL 5FUCC 1DLHA 5C70A 4WJG3 1MIEH 2EE3A 3O3DA 5LWYH 3TBVA 4KJPD 2VR6A 3ARYA 3JTSB 3S35L 1BAFL 3ZHDA 4BZ1H 1EA9C 5CEZD 3MBWA 1PZ5A 4URKA 1HHGA 4TUJB 3Q0HA 2NLJA 2XICA 3RIAF 6PCYA 3EH5B 2R0LL 3IU3A 4HCRH 4PB9L 3MXWL 4GXUM 4HFUL 4GW5B 2X1OA 2RFXA 1M6OB 4LF3A 2VN5A 3ATEA 4GKNB 4NIKB 2B59B 3ZDXF 3ZMNA 3AROA 3VDBA 1KBGL 1BFTA 2WCGA 3TN0C 2YHGA 4TQPA 3VWJC 2PWFA 5D5MA 1RUQH 3EYSH 3MRRA 3CGTA 4YN3A 1EK3A 1TZHA 3OB8A 2OMUA 4TLKA 4ZPVB 4CW1B 4GAYB 2EYTB 3NQIA 4LCUB 4GIOA 3RUGA 4PJGB 5B4MD 1Q9KB 3X12B 3WDIA 2CKBB 3ARFB 4JW3A 4G8EB 2RMNA 4N2BA 4OCWL 2WTOA 2XJKA 3GI8L 4U33A 1I9RH 4JFHD 3UJIH 5A2LH 3VXOB 5BNXD 4YWGL 4CBPA 2VRKA 2WLLA 1E67A 1WFOA 1N59A 2H2PC 4XH2B 3OXRA 2WLNA 1WBXA 2P28B 3O2VL 5DS8A 5F0LB 3O3DB 2BNRA 1QATA 1E9OA 4NP4H 1LP9A 2P7TA 1XEDA 2B20A 5CJXC 2UWEE 2MCPL 1DQTA 2I32A 1N8OE 1T0NA 2X9WA 4H8PA 3QPXL 5IBLC 2WY3B 2UZXA 1TQBB 1MCOH 2YWYA 3QQ4A 2W88A 3ME0A 3CFEA 5INDA 3T0EC 4YHNB 2H3KA 5KZCD 5I82A 3QQNA 2JFCA 1XVSA 3OKEB 4G8FB 1ZTXH 2C4FU 2QGCA 1SHWA 4N0UE 4XAWH 3VRJA 5IFAH 2BY1A 2YOAA 4MD5A 4CVWA 3STZA 5FDWA 5CIPH 1MHEA 4F7PA 2J44A 4N28A 4GI9A 2VZ1A 1KTLA 4JE4B 3LNGA 2YWZA 3LH2H 4MNGB 5IG7A 1NKRA 1K6QH 4MCZB 5B38A 4KZDL 2EDHA 1NTDA 4PJBE 3LNDA 1CG9A 5D7IB 5T1MA 4QRBA 4GKLA 5E1QA 4G6MH 1BVOA 1E9PA 1XGRB 1EPFA 4HJTA 3SE9H 4NKOA 2PO6A 5FV1L 3O45A 4RBPH 1T5WB 1KEML 1XZ0A 2FHFA 4XC1L 3BZ5A 4FZEH 1NAMA 3PXJA 1HCYA 4EDWH 4HYTB 2JKTM 4JM2C 5KS9A 5L2KB 2UV3A 4HGWA 4NQDD 3ZJAA 2CO6A 3BUDA 3DX7B 3U9WA 5I1IH 2FQGA 1GPOL 4AQ8C 1J1OL 1DN2A 1W0YT 1Z9MA 2G3ZA 3A22A 4JMXA 3BRDA 1Q4NX 4WO4D 3UGEA 2C3VB 2GTWA 4YHKH 1QVOA 4XAKD 2YJQA 2GITB 3HG3A 2CDFA 3WEBA 1LE9B 4X8XA 1PFCA 1ZLUK 4WFFE 1YA5A 2QKSA 3UOAB 1TTFA 3STZB 5L88L 4RBPK 3UTQB 2A9BA 4Z7OF 3L45A 4M4RB 1RHFA 4WWKD 2J1ZA 4EKXA 2ZG2A 1VACB 2DPKA 1Z32X 3RUGE 4E41B 1CUOA 5I1DA 5K9KB 1GGBL 1NCDH 1ONQB 4XMPL 1A4JB 3QQ3A 3FUNA 4LOFA 4U1LB 1NGYA 4X80L 2BIMA 5A3IC 4KK6D 1T5WA 4KITB 2EIEA 4YFEA 4GRWH 4TLUA 5KYWB 5CEZE 4AKOA 1ZEAH 3N5AA 4LVHB 4N0YH 3EGXB 5I30L 2GG1A 1A5FH 2QPDB 4PW4A 3ZYJA 5KWYC 1ZLUH 1GGIH 5IBTH 1CBVL 2OMTA 3UZQB 3EJYC 3FFCD 3S3SA 1OAQH 2WLLB 4KY1H 3G04A 3L3DB 2ZOUA 5DUPH 1IBFA 1Z66A 5DJYA 4Y9FA 4ENZA 3MSPA 2MPVA 1T3FA 3BPLB 1LP9E 5CEZH 1MH5A 1RZKH 5F1SA 5DSCB 1AR1C 1M6OA 3QEQE 1IBZA 3L48A 1ICTA 4GJTB 2VT0A 1JGEA 3CK0H 4FTVB 3WTSA 3D0LA 4ELKB 3IGKA 3GSUB 3IFNH 1D6EB 1D5ZA 4IHBA 1F3JA 4OIAA 1YYLH 1MELA 2X1PA 2Y1ZA 3N41F 4U1KB 2YA1A 5DTFA 1VEOA 3GKWL 1AGBB 3DHMA 3CFJA 2Y24A 2AJYL 1AQDA 3PL6A 3FQYA 5C0AA 1JZ2A 1TJHH 5ISZD 4N9GB 1J0KA 5ANMB 3ABKB 2GEQA 3PWNB 4WI6A 2HJFB 4MSWA 4XOAA 1C1EH 1FVCA 3WFCL 3COOA 3KPRA 1SDDA 3PREA 5IESL 1MEXH 1ZHNB 1R6VA 3CAFA 3ARQA 3QIBD 1CD9B 3VH8B 4MHHI 2WXMA 2DI8A 1NLDL 4M1CC 5DK2B 5CJQL 3QQ9D 4PJIB 4WFGE 2NZIA 5C8JB 4OCYH 1CG9B 2BSBA 1IGCH 1YN6A 3QWOB 4UDUB 4Y16C 2VMEA 3RRQA 1RSYA 1PQZA 4JFVA 1S3KH 2XN9A 5IJBC 2JLPA 2AGJH 5I1JH 4ZUTB 2EKSB 2R9HD 3DSFL 5D1XB 3KNBB 4I0PB 5LGKA 4MCMA 3QCTH 3BAJA 4M43L 3NP3A 4DGWC 4Q52A 4KTDL 2DQUH 4ELKA 3VFRB 2H3NB 3LZPA 1QACA 2WWKT 1WIUA 3E38A 3ZL2A 3HFFA 1I8MB 3O3AA 4LFHG 4YDLB 3H9HB 2MOGA 3SCMD 2CDEB 1YHPA 5DFVC 1JWSB 1VZIA 2D2OA 2MTPA 4WWID 1DDHB 5HHMB 3QFJB 4RMVA 1FV1B 4I77L 3LKRB 3ES6B 1H8LA 3KW7A 1EFXD 4PSPA 4CKQA 3EKCA 4I18C 5HPOA 1BLNA 1F42A 3KWTA 3LEXB 3LEVL 1TQBC 2JV6A 1MAJA 5T5FL 4L4TD 4DEUA 4KVCH 4XNUH 3QNYB 2BY2A 3ISWA 3ESVF 3GMNB 1OE3A 6FABH 4KKPA 4LNRA 5CR8A 2OJZL 2ZOLB 1DVFC 5GGUA 5HJGA 5LG6A 1OANA 3P9MB 1E5ZA 3PWLB 4KO9A 3RAJH 3AUVA 3MLWL 1MI5B 1YMME 2Q5BA 2X4QB 1HAWA 3QS3A 3VXUE 3W39A 2BZCA 2F08A 2RBLA 4JMNA 1ZT7B 3G6JF 3FRPG 4TNEA 3V6ZB 3PXHA 4N5EC 3WXVL 3VXRB 5KSBB 2NUTA 3VB8A 3BRGC 3O6LH 4PYHA 1ZHKA 4JREB 2VQTA 3BKML 4UQIM 2V7HA 2H47C 3Q6GL 5DO2D 4XHJD 5EOCL 1VACA 2DBLL 3MJ8B 3ZKMD 4WEBL 4P3CL 3S48A 3BAIA 1AH1A 4ZI8A 4A6YL 4XBPA 2VQ1B 3N44B 4YR6B 4LDLB 3SPVB 1NCWL 3GRWL 3T0BA 2R0ZL 4LVNB 3RFZC 4WSJA 3H3KA 1A8ZA 2WLMA 1KIUB 1KB5A 1OW0A 2B0SL 3KM2A 4AGPA 1LEGA 2CR0A 3PF2A 3HG1D 5CNHA 1UWXH 2QQLH 4P4KA 1KULA 1U4FA 5KSAA 5H4YA 2XVBA 5PAZA 4EIUA 5EPMB 3WE6B 2D03H 1BZDA 5EOQL 2M26A 4E41E 5I76B 3T4YA 3CFKA 3QJTB 2E7HA 1RZGA 3IYLW 1YAIA 1SVBA 2HLFC 4MDJB 4PRPA 5EDXA 4BDVA 3Q5TA 5DR5L 1YDPB 5E8EA 1EJ6A 1ZT7A 5FK9A 4Z77B 3EYQC 4O2FB 1KPRB 3ARGA 4ZFOL 5BV7B 5EN2B 2P4AB 3TZVA 1FBIH 5HGBB 2FIRT 4FD0A 3AXIA 1P84J 1YG9A 3IJSA 5CCJA 2P8PA 3MOBH 2IBBA 3SJVE 1MVYA 4XCCL 4XVJL 1PD0A 3G5XA 5EF3A 3DA0A 5C0DA 1XV8A 3H9HA 3U9UB 2HJLA 4NFDA 4AXWA 1OP3H 3GMPB 4L0YA 3CHSA 4JFDE 2QT6A 4JFWA 1F11A 4ZOBA 1F4AA 2ICCA 4HPHA 3MV9B 3L08A 3QDMA 3ZUNC 1NC2D 4WTXA 1TDQA 5F89B 4M6NL 1NFDA 1FNHA 1ML0A 3APNA 1KJVB 3L3IB 5DJDB 3A4EA 2IH9A 5EOTA 1OAKH 4EIGB 3WD5L 1OCZB 1X5GA 2VDOB 4XCFL 2ZP8A 2BNRB 2W81C 4WFEE 5J6HB 3NPSC 5FA3A 4GS7C 5I2IA 4KZ0A 1AP2A 4FJ6A 2XHNA 12E8L 4Z77A 4KHXL 4MMYB 1OP3K 1AMXA 4QYOB 5EN2A 3TZVB 3BKCL 3T6VA 3RFZA 4A37A 2Z92B 3GTVA 1M2VB 5CD5C 2E0PA 4HLZG 4OV6F 4XO9A 3SE6A 4HHAB 2FX9H 2EXWC 2WNGA 3HZMB 2OTWB 5EN3A 4PGDA 1ACXA 2EZ0D 1D5BA 3NIDF 1OTTD 5KZCB 4Z1PA 1M7IB 2BC4B 3PQYA 4E9YA 4LARL 2HX7A 4QRSA 2G2NA 4GRWF 5BV7C 3FB7B 2FCBA 3LNIA 4XOBA 2DLHA 2G4EA 4JUTA 5GRWA 1N2RB 4UQ3A 2WSDA 1HL8A 4O00A 4YDLC 3CDFA 4O2EA 4BZ2L 3AY4A 3DROB 4E9VA 1TU2B 1A2YB 4MNQB 4AZ8A 2FATL 6TAAA 2NYKA 2WXRA 4DZBA 1A4CA 3SDDB 3GD1C 4XCEA 3WJLC 3ULSA 4EJ1C 4J28A 2BRRH 5I8EB 5DURD 4DP5X 1EAPA 4GAGL 4K73A 5C0EB 4NQQA 3QCVL 3OSKA 4HV8A 3ILQC 3GT6A 5I8OH 3O2WH 3DRTB 1H6EA 4E36A 3VD4A 1I1AC 1IL1B 1DSFL 2COVD 1A6AA 4OF6A 2BNUB 2DS4A 2QHRL 2QMJA 3BH8A 2Z7ZA 2O93L 5DZPA 1YYML 5LXGL 4QRTB 1FL5A 3TPUA 2ZG1A 1BEXA 3HRZC 4D2NA 4ZAKA 2C9XA 3V0VB 5HYSA 4MD4A 3AB0C 3ARED 1QZNA 3MRFB 1S7RA 1XGQA 5B39B 2GFBA 4JRXE 3PUCA 3K2UL 2PPDA 4E41D 5CAYB 1A65A 1IJ9A 2VLME 2W9EL 4M5SA 3BHBA 1W80A 1H8NA 5DT1L 1FFTB 3VA2C 4OUUB 5DYOA 2P5ED 3FQRA 4W9LC 2ZCHL 4GP8B 5I76A 4XN1A 4ORGB 3DX9A 3N91A 2AAVA 4Z7WF 5ERWA 4AYFA 2YD8A 1DFBL 3K1DA 1HHIA 1FI8C 5J1AA 4K07A 3ZRFC 2EADA 2EDBA 2ZUQC 3OF6A 4AK1A 4F2MB 5GS0L 3KMDA 2E4TA 4QRUB 4ZMLA 1BEYH 3ESMA 3FFCB 1GXEA 5F8QC 2XX0A 5E6IB 2QBWA 1RL1A 2IMNA 4G43B 4DSYA 3DVIA 4FTVA 2ZXDA 2FECI 4JHAL 1QWNA 1V05A 1XF4A 4MMXB 5EEVA 5E94B 2P47B 5ENWB 3BH8B 3G5XB 3LIUA 4HIHB 3OGOE 3W5NA 3ARSA 5E5MB 3BMVA 3EYUH 1ES0B 3UTSA 3QRBA 3IRPX 2BY3A 5DFVD 1OB0A 4H1LB 4IJ3C 3KDPB 4IBWA 4KROC 2IGFH 3DETC 4RGMB 4A67A 1A9BB 4H44C 1J11A 1OW0C 4S1QH 2OZNA 3QNZB 2AV7A 3I6LD 2MQGA 1MVUA 1JVLA 2LVEA 2I07A 3AT0A 2IGLA 3VD9A 3HMWL 4N8VB 2YZ8A 4KMTL 5J13C 3INUL 3AWGA 2ED7A 4HLEA 3Q1EA 4M8UA 1JG9A 2LOEA 5DS2A 5TPWH 3UBXB 3T6QC 3MA9L 3JBG7 5EWIH 3QXVA 4UINL 1IJNA 2WXIA 5H94A 1ANUA 1E4XH 2Y0SA 3LQAL 2BERA 4YHIB 5JHBA 5GSVA 4C56A 2H4EA 2APWA 3EH2A 2NZ9D 2ICEB 1BOGA 4JPKH 1KBVA 3D34A 1CK0L 1OAUH 3JWNG 2E5EA 4JLRA 4R7VA 5K9OB 1CXEA 3B7RL 4FN0A 1L0QA 4KKBD 3OQRA 5BUPA 4PLKD 4K3JL 1X3DA 3OKOA 4Z5RB 4LRNL 4ISVB 4MBOA 4BKLB 4GG8B 2N1KA 1ZS8A 1JWUA 1A4JA 1UUSA 3QQ3B 4KQ3L 2CLVB 2GJZB 4W1TA 1YEKL 1QUPA 1ID2A 2D3VA 5SWZA 1F4YL 3UAJA 4TNVK 3GLDA 3SKJL 5FYJU 3GHBL 1P9MC 1N68A 2P80A 4NWTL 2VSMB 2FSEA 3ZX1A 3PV6A 2YPVL 4KDTC 1KYUA 2PO6C 2FJFB 4X7EC 5KJ4A 2A6IB 5IHHA 4U0RB 5IEKB 1KELL 3NCCB 2ADFH 3QIUA 4JEGB 4MWFA 4G80A 4RQQB 3TFKD 5FYJL 4X7SH 4Z7VF 2WCSA 3NCBB 3O3BB 4GLRH 2VDNB 4PIRF 4CC1A 3V9CA 4EDXB 2X4QA 2WYZA 4RSVA 5DSCA 5EU4B 3FN0H 1K3IA 4QD2E 2G9KA 3UTSE 4PVNA 1SF5A 2BOCA 3D25B 4P2QE 5AUMA 1G7HB 5ESVA 3WN6A 4AW7A 3EO1A 4UUJB 2V7HB 4F58L 5BXFB 4NQEA 2CRZA 3V52L 2ZPKH 5IFJB 3FQUA 1ECZA 2AI0L 2BDNH 2NY1B 4ZXBB 4MNHA 5KVGL 3POCA 4JVUA 5ADPH 5A2FA 2WLYA 3SD2A 1OGAD 2DQIL 2L3BA 4H8UA 1YQ2A 4ZX5A 4WNQA 4AITA 5DZ9A 2GPZA 2OS7A 1NAKH 4UT9A 3BGFC 1UGNA 1DN0A 1QAWA 2G2PA 4BFEA 4LHUB 5EF2A 1PYWB 4R97C 3OMIB 1MXDA 3J27A 5E2UH 3MC0A 4MJIE 2OSLA 2VDLB 2Q3ZA 4DP8X 3WO4B 4W70A 1A6PA 4ESKA 5LVEA 4U2YA 1MDTA 3VW3L 1HILB 3OR7B 2CG9X 4UT9H 43C9A 1BIIA 1WZKA 3C12A 2K3TA 1UB5B 3V4PL 2OKMA 5ALBH 4ENEC 4HC1L 4N24A 3PP4L 4JRXA 2N4IA 4I9XA 2AXWA 3ARXA 1SRDA 1TLMA 3FFCA 4JX0A 4MJIA 4OGZA 1GS7A 4BFOA 3P3SA 5TE6L 4YFDB 4KKNA 1ID5I 1MFBH 1VFBA 2GSMB 2J6EA 4MNQE 1O5DT 2XXCB 1A6VL 3VRIB 3UBHA 2GBTA 5F7EL 4AUJA 3AREC 4JO4H 4RH4A 5J3HD 3QCUH 3O0RH 2FHBA 1KBPA 4KDTA 1YECH 2WIIA 4FQXB 4PWFA 1JZFA 3HE7D 1NIEA 4UOJA 5D7SH 2YAHA 4NQSA 4J3OH 4WTWA 1VKXA 4HEMA 5GRJL 3ZHLA 3QIUC 1IIKA 1U3YA 5FXCH 1H3TA 2QLVB 2DYPA 3IMSA 5DMGD 3WXWH 2DTML 3GLZA 5GJSH 3HMXA 1C08A 3PCYA 3A23A 5ETUA 4XPAH 1KTLB 4X9YA 2X40A 4KUCF 5AAWA 2HCZX 3AC0A 4DEPB 4ZFFB 1LK3H 1S9YB 1W15A 3MAWA 1FORL 3CVIL 4HX1A 3IDNB 3VG0L 4F1ZA 3IRZA 5FYLL 3MRPA 3WHE1 2MQ0A 1HIML 3B9AA 3QFGA 1ADQH 4BZ2A 2Y5TA 2QPUA 4XP4H 1U8KB 3HAEG 1AANA 4K3DH 2BP8B 3GSOA 3WTWA 2ZSWA 1T7XA 2H8PA 3VM7A 5B8CA 2CH8A 1TT6A 2BSRB 4NO2B 4HZAA 3CH8A 2A4EA 5HY9B 1R3HA 2ADJA 2BNRD 2Z3FA 3O4LD 4GW4A 4XMKH 1JPST 3SGKA 3VFTB 3MBWB 2QV2A 2B1AH 4NJ9L 1R0AH 3UO1H 3C2SA 1UWEL 4XPBL 1GCFA 4R2GD 2AQ2A 3C87A 3CC5A 4PJ8A 2UXVA 3D69B 5DZLA 5FO7B 1ND0A 2Y6TE 3IN0A 4F8LA 4NS0A 4O51B 3ZKNC 1CI3M 1GGYA 3GSNL 5F6IB 4AV5A 4KRPD 2F7QA 5DHYB 4HW6A 2XPYA 1AO7E 5I1CL 2K70A 3BW9A 4RMSA 2L04A 5CP7A 5KBMA 3S5LB 2F1AA 4LCUA 4F2FA 4UZSA 1ORSA 5I71C 4OAWB 1ZANH 3VGFA 1Q9KA 4FNTA 3X12A 2HN7B 5A1AA 2ZXAA 4KK8C 3NABL 3E6HA 3PHAA 4UOZA 5JPNB 2A9MH 1A7RL 2Z6FA 4HQQH 3B37A 4E5XB 1I85C 4NZTH 4YHMH 3DV6B 1RJYA 1TYRA 1RJLA 2YFOA 2OMZA 3B2PA 3J7HA 2IBZY 2PXYA 2VJ8A 4QCIA 1G9HA 3P02A 2PN5A 2EYRA 5TK2A 5J6GA 3ULSB 2OMTB 3WEMA 2IAMC 4I48A 3MJGX 2YMOA 1BBDL 3ZPDA 3CZEA 1MW2A 3L3DA 1KJMA 1DVSA 2HKHL 2FB4H 4LCVA 3SGJA 3WE1A 1QFWI 4YDKL 3EJZD 4XC3H 3VFUB 2BMKA 2C7UB 3CBJB 5GGSA 2MCMA 1LMIA 5CBAA 2V2TB 5BXFA 4BWTA 2E7MA 4RSYA 1T04B 3ZTNH 4KO7A 3VXNB 5I6NA 3GO1H 4WV1A 4JG1H 1SLUA 4FG6C 3MXVH 5EULV 1G7MA 4IYKA 1R4XA 1JXJA 3MV8A 2MPAH 4JRFA 3VH8G 2DICA 3I6LE 4WEMB 1LNUA 1ORSB 1SF3A 5ABAA 4AV4A 4MCZA 4GQ9L 3WCYA 2VXVL 1KZQA 3UTTB 5E2VL 2H0FA 4NBZB 4WY7L 1RURL 3FRPA 3QDAA 4CGUB 3TCTA 1BIIB 2D4FA 2LU3A 3GB7B 1F90L 4N68A 3FT1A 3WIHL 5C8JA 3NDYE 1WE5A 4JN2B 5C2UB 4BK8A 1FZKA 4HX1B 4W9FC 5JDSA 3TBYA 2I60H 5C0CE 2E9JA 2W1NA 5I2IB 3BXNA 3U2SB 4NO0A 3OV6A 1AOHA 4W93A 2XYBA 1BAWA 2WZAA 1HXMB 3VDCA 4W9GC 5DC0A 2CIKA 3D2TA 1RUPH 5FKPB 4F7EA 4JQIA 4YJZL 3FCGA 3ORJA 3QORA 3LRLA 3Q6FB 4Z7WA 3DUUB 3A67H 2AABL 5E6ID 1H6FA 1XR8A 4KY1L 1ECYA 3OLIA 1HINH 3FQXA 1U8NB 2YXWA 2GJ6A 3VQ1C 3SYOA 3TEXA 1A02N 1EJOH 5LNGA 1MG2C 3RVVC 2OP4L 2WQUA 5BRPA 1DBJH 2GEEA 5ALCL 5T5NF 3FB7A 3RY6C 4PTTA 1TO5A 5EFIA 2J1WA 4KRMB 1WWAX 4QAMB 4Q9RL 1RJCA 2IIJA 4JDZA 4RAUA 4UT6L 1BLNB 5HGDA 1PG7H 2E7CA 2ERJC 1BM3H 1PAMA 2HFGL 2OQJA 3F58H 3O9WC 3IF1A 4X99B 4YUEL 1G87A 4PYGA 3B2VL 3T0EA 4YQXL 1J05A 4DPBX 3RQ3A 4J6RL 2D7MA 1JI2A 3RX5A 1NBYA 4LAQH 4KMQA 5JOEA 4I3GA 2CDGA 3KYNA 4XP9H 3GBNL 1TYEB 5G4NA 3CLEH 5F1NA 4K9EL 3CXDL 1R47A 2G4GA 2VE6A 3ETTA 4OR1A 3FUFA 4Y8DC 4N8VG 5FYKD 1QSEE 4V2CB 4XN9A 4ANXA 1FGVL 3TM6A 2BIHA 1OD7A 4APQB 3ZTEA 4GXUN 3GJFA 4RGNC 5E2TH 5T3ZE 2O61A 1Q38A 3VD0A 3GXPA 4KV5F 4FFWD 5DD5L 1IL1A 3TO4C 3ARFD 3B9DA 2MCG1 4OKVA 4C56B 3MJ9L 1P2CA 3QRGL 1CE6A 2VSDA 4HKXB 3JZ7A 5D2NB 4CMMB 5I1HH 3TJEL 5HVHB 4KTEH 4PAZA 4FMFA 2XWDA 3KLAB 1F2XK 1AOZA 2QQNL 2D7TH 2O1AA 4B9IA 1S7XB 5EA0H 3T65B 1D5IH 1I9IH 5L2JA 5D2LB 3MRRB 1I3RB 4R7NB 1FO0B 3HNSL 4S10A 2FJUB 4L1BA 5L0QC 2E27L 4GMTH 1T7VA 2J1YA 4U6VH 3C6LB 3KPPB 2XN9E 3L9RA 2WXJA 4I18A 4JHWH 4ZFGL 1H8SA 2PWDA 4WHTA 4FLRA 1IAMA 1H6TA 2OMZB 4GSXA 1CGWA 4FQIL 1CJYA 1NBYB 1FRGH 2UXFA 5FHBH 1FNEA 3B7TA 4HWZB 4NO0D 4ZMXA 5DHMC 2X4PB 1JPTL 3AG1B 2EO9A 2V0AA 2YS4A 3CIAA 4YBLB 1E4WH 3N85H 1ET7A 3QO0B 3V9EA 2AK4A 3MRNB 1PZ5B 1RUML 2YEZA 2N3JA 1ZMYA 1QW9A 4MXQD 4OSUL 3ZKND 4FLSA 3LQMA 2ZIDA 3QDME 3REWB 1BVKA 2OK0H 3KNBA 2XQYG 4C55A 4ONHA 5E99H 1Q94A 3FAXA 1TCRA 5LCVA 1O9WA 5DUJA 1CU4L 1F02I 5GJTH 2H26B 2VJ0A 3B1TA 2BIPA 1MW1A 2OW7A 2QGEA 3TIDA 2N59A 1BFOB 4XRCA 1RI8A 4S0SD 5D7JD 4XXWA 3AAZB 3WGVB 4DHLA 4WW2F 2YEQA 1MCQA 4FFTA 4JANA 1ROCA 4X2UA 3SKUD 3RWGA 3D2UA 5I0VA 2NY1D 4ZXBD 1A1OA 1CGSH 1UD3A 3BVXA 4K0OA 3X3GH 1N6QH 5AEAA 2G2RA 4NQDB 2AK1H 1ETB1 2AV7B 2KZWA 3IJ7A 4UNVA 4PWGA 3WNJA 3LMJH 4X9IA 2NXYD 4ABVA 2X4TA 5D1ZI 1Z6JT 1UT1A 2P49B 4GNKB 1MN4A 4JDZB 5SX5H 4P2RB 3T4AA 2HJKB 5H35B 4OGXL 4PS4H 1E8YA 4X7TA 1BVLB 1ZLEA 5TDNB 1LO3H 4D3CH 1MFDH 4LDCA 2YD6A 4OLEA 4HXBL 3VQLA 3DGDA 4OQTL 3GPSA 4MA1C 1KTKE 1CTOA 2Q6WA 3EJRA 4P2AA 1V7ML 2W91A 3MBXH 3GGWB 1F4XL 4JAMB 1JNLL 4ZJ9A 1SXNA 2Z7UA 1RAMA 1HCVA 3WNKA 2F61A 1SJHA 4YPGA 5HDRA 3A6CH 3W0WD 4L3FA 2XIBA 4FQXD 2W60A 1A1OB 4LLUB 4NQVB 4FFVD 3H7LA 3QULB 1HFUA 4MXVF 4AQ8A 4FL4B 5JOPE 5I1LB 5FOBB 3MBEA 4FFWC 4DOHE 4JFEE 2YQGA 4UOW1 1FPTH 2IPKB 5GZOD 1THAA 1MIEL 4U1MB 5DGRA 1J8SA 2FK9A 5DC4B 3O6MH 2OMYA 3K4AA 2XQYA 3GTTA 5DCCA 4GUOA 3ZDWA 3DJZA 4FQ1L 2OMBA 1FFPA 3WY2A 5CD3A 5CWSA 4BBWA 4TPRH 2ZCLL 4LMQE 1C9SA 1XH1A 1A21A 2K0RA 3EOTL 1JV5A 2J56A 4WI4A 3VXUB 1WEJH 1FZMA 3CDZA 4YHOL 1KV7A 4KJQD 3US1A 3A4DA 4WCYH 3U25A 2F8XC 1C5BH 2JQAA 3ARBD 1MI5E 1RUQL 3QIWC 3EJTA 5ISZB 3C6LC 3VMPA 3X1NA 3SKMB 1QNZL 2PYED 4NNYB 1YQVH 4S0HA 5HGHA 3WD5H 3O4LB 4DK6A 4HV8B 3QIBB 1SJEB 5ELIA 5IVXF 3CDCA 4A7GA 2VMCA 3II3A 5ITBH 4LCCA 3QJZA 5B1JA 2P8PB 5LO7A 4HUUA 1YPZF 3ZKSD 5C08B 1CTMA 4QHKI 3IDGA 5DQJA 3QULA 4Y16B 1JPSH 5EBLA 4FNUA 5ADOH 3GXMA 3P3YA 4KRPB 2PO6D 4ZUUB 3UTOA 2ED6A 1SVCP 4JFXB 4WK0B 3SKOB 5C08E 4XN7A 1W0VB 2IPTL 4JPSA 5SWZD 1I9JH 2OMWA 5L6YH 3H2WA 5D1XD 2APSA 5AWNL 5TH2A 3CZJA 4MLIA 1CIDA 3FUMA 3CFDA 2XFGB 3QPXH 2EIMB 1LO4H 5K93A 5EH1A 5D2LE 4Y4FB 3CZNA 4B95C 4PRID 4YK4B 1L9NA 1AACA 3I3EA 4GRLA 1INDH 3RU8L 1ZTXL 5CZRA 4F33A 1BQHA 4P59L 4X6CB 5E56A 2XN9B 3QFJD 3TLRA 5E8NB 4LKCA 4X50A 3FUJA 3AABA 1RK0B 1J9RA 1IGIL 4YC2C 1EFXB 4CDHA 1XDTT 4GKOA 2C4FT 4TV3A 5DYFA 4LOVA 3T0EE 2WIIB 3H9SE 4FQXA 4LCWA 4N2DA 5G5DA 4A2HA 4L4TB 4ZO6A 1TTBA 3STLA 1H5BC 4F2EA 4NOBA 5E00A 3EXJA 2F58L 2ORBH 4N5UA 4YX2L 1X6LA 4HIXL 1NBVL 3CLFH 1FNAA 1PD6A 4ZZFA 2XRAH 4OD3L 4OB5H 4FKHA 3NIGB 1JHTA 2CM6A 3VMNA 4WI5A 3AWFA 3F7YB 2Q1EA 4RMTA 4U1HB 4AQ1B 1E5BA 1YPZE 3ARPA 4NQXB 4XZUA 5I18H 3REVA 4FDWA 3HKZA 4ES8A 1Z5LB 4UV7L 3R06A 1OHQA 4QHMA 3TTSA 5FUZH 1CE1H 3K80A 3WIFB 2I07B 1OLLA 3LIZL 4R4ND 1JOIA 4F7KA 2WV3A 1LDPH 4WO4C 3UYRL 4FXKC 1LP9B 5F9AC 2A77L 1WISA 1T66C 1H8OA 5C97A 5L88H 4UBDD 3SGDH 2DI7A 1NCOA 1AIFB 1LD9A 2J8OA 2DQJL 1XXDC 2P3YA 4NFCA 2X2IA 5FUOL 2APBA 5IVOA 4NX0A 4TQEH 3ZE2F 3ILDA 1O7VA 2X53A 4XVTH 3OKNB 2BW5A 2MOQA 2HPOA 1SJXA 3C8DA 3C6EA 4ILDA 3QUKA 1DQJB 4RNRA 5DD6B 1NA8A 4FHBD 1L7TH 5C09D 2V2WA 5F3BB 4YDIH 4JPWH 3QBTB 5I74B 1T1XA 5JMOC 4NGHL 4NQEE 3U46B 3VXQB 1OAQL 3EYUL 3GBEA 3ATFA 4LNRB 3U1SL 4WJKB 5F9WC 1UCTA 3QIBC 2NTFB 4LCYA 3SKOA 3W3BA 1QX1A 1AXTL 3QJRB 1O9VA 2ICWB 4DCQA 2V5MA 3CK0L 1JGIA 4RGNE 2SEBB 2WW8A 5C0JB 3CZKA 4FKEA 5CIPA 3TBVB 1BQUA 2YXFA 3Q8FA 4FYSA 3K3QA 3WKML 5I8KH 5JHLH 2CBTA 5J1AB 4XPGL 2RH0A 1UZ8B 1GJIA 1S7WA 4APXA 4WUUE 4ZTEA 2P5EE 2VAAB 3O4LA 3QUGA 5BS0A 5D71L 1DJGA 1U8QA 2XTSA 3QIBA 4K3EH 3JT2A 4OGAD 1N7ML 2YPVA 3T2PA 1EHNA 4A39A 3MV7E 2DQTL 4PWHA 1KBWA 3GXIA 3MV9D 3EFOA 1DFXA 3MUZ1 5EZIL 3U9PH 4A7VA 2PETA 1J0HA 1ZJAA 2ZKHL 4NUGH 5DVKA 1PS3A 2APFA 3UTQA 1OF2B 4C56D 5C0BE 5K9JH 1P5VA 5GS2D 3A21A 3VXME 1JMZA 3RDJA 3LZRA 5IB3B 5HJBA 1PCSA 1A6TA 1II4E 1S3KL 2TRYA 2CIIA 3HMXH 5B39G 4C56E 1WS7A 1EZVY 1RU9L 4IU2A 1IEHA 1GAFL 1I7ZA 2X7LB 3C6LD 3L17A 1I8IB 3MLTA 1ZT4A 4I5BA 2YA0A 4AG4H 3NIDB 5F71A 3FT2B 5I5MA 3GBLA 1ADQA 1KCBA 1L9TA 2W9DH 4HT1H 1G7JA 3SKJH 4NO0B 3WY3A 3MNZB 5IY5B 4NWTH 1OLZA 1BZ7B 3VD2A 3EAKA 1M1XB 1G5AA 2JTDA 1NCUA 3T0DA 2DJUA 1N3NB 3T1WA 4GW1A 1Z9NA 4R8WL 2ZX9A 3SGJC 3B9VA 3UPCA 1JIBA 4U1GC 4YHNA 4EN2A 2VXUL 2WPGA 4A38A 3AREA 4NUMA 1EH9A 5IJKC 2R56H 3KL0A 4JDTL 5A16B 4KXDA 4MB5A 2YGOA 3AG4B 3VD5A 1KPVA 5LG1A 2Y2YA 4L3ED 5LQBH 1SEQL 2ITCB 1WBYB 3Q2LA 2ROXA 1XIWA 2MCAA 4DTGH 5BO0D 5F7YC 3DX6B 3VM5A 5I17A 1NDTA 1MREL 5D9SB 3RAJL 3QQDB 3WO4C 4TLSA 3L9YA 3FFDB 2KDGA 4N8CL 3GIZL 4M00A 1U92B 4LSRL 3QIWD 2PTTA 2CDGB 3KYNB 2H1XA 1S7VB 1ZDSA 2FUTA 4LSPL 4N1CA 3WXVH 1KBKA 4GT7A 1UACL 4K94H 4GRLC 2ICWA 4DCQB 4I1PA 1XIWC 4MVBD 5IMLA 2LV4A 5CJ8A 1KN2H 4KKCD 3KEHA 3B8SA 4JJ5B 4ZTPH 4EO5A 4B9JA 5JXEC 2VC2L 3AREB 1NKGA 2H1PL 1MUJA 2Q3XA 3QNXB 5K1VA 2WLJA 1OCCB 2BOCB 4K5OA 4XTRD 3ZDYF 3HN3A 5I6XB 4OZFA 4OZGB 1HHHA 4KI5D 2IG2H 2TAAA 2VZUA 3DYMA 4UZUA 1CDBA 1GGBH 2WQAA 3GSNB 5CLWA 3CXFA 1G6RH 3NFSH 2P5EB 1OZTG 1VAHA 2XWTB 4NQVA 5F0MB 1R24A 3TBSA 4I0PC 5F6HJ 4F15B 1FVDA 1DQQA 1TENA 3G6JE 1A9EB 1ZT1A 3KXFA 1FFNB 3MRBA 4ONGL 4Y2OB 5EOQH 4M3JA 4QRPD 4I18B 5D96C 2P24A 5I30H 1JXGA 1EEYB 1MCLA 2ZOTA 3KH3A 1NCNA 3FXIC 5HYFA 1CBVH 4WRLA 1K8DB 4IKJA 2FLBT 4Q74A 5IB5A 1UOWA 2Z8WC 5DUBA 2SEBA 2E8YA 1CF8H 4ODHH 2NSQA 3RZCA 2J7LA 4PS8A 4Q0XH 3D12B 4G9DA 5L7XH 4XNZB 1OSPL 3L5WA 1JV5B 5K1NA 1QTSA 3BUTA 1U8OA 3HTLX 5FW8A 3T2LA 3U36B 2CGRH 2IDTA 3HI6H 5ICZB 1MJ7L 1T3FB 3QDJD 3LEYL 4K7FA 1HIMH 3DMMA 5FYJD 1LWHA 3D5OF 4WWKC 3GKWH 1O6TA 2NXYC 3KGTA 4KNTA 2AJYH 4Z3HA 2PYEB 2KLRA 2LU7A 4JKPL 5J1TC 3RKPA 1T04A 3AGWA 1HL4A 4BCXA 1IE5A 1RFDH 1P4IL 1GC1L 4FABH 4NKIH 3S9DB 2O6EA 3EYFA 1TJXA 1N26A 3FUEA 5SWZE 4JKWA 5HGAB 5KBPA 3SE4C 2BCKB 2VZVA 2HT4C 2B7DT 4ZOAA 2A5UA 1QO3A 3OKYA 1OQOA 4ZX6A 1ZWIA 2XTJE 4N2GA 4XCYB 4Y16D 5B7EA 3RNKA 1ZLWH 4JGNA 1USZA 1G4MA 4OUOA 4F5CA 2X7LA 1EXUA 1NDGB 1T89C 1KCUH 3EGSA 4RFEB 1ZRUA 2XCMC 5EUKA 2F1BA 3E8VA 4OQTA 3WL9B 2FYVA 5ID0B 5JNYA 2I24N 3RWHA 2CO2A 1I85A 2QR0B 5C9JB 3SQOH 1N4XL 1ZANL 4MD0B 3GYRA 1CFNA 1RXLA 1EXGA 2BHFA 4DERA 1RPUA 4QRQA 1ZV2A 2FX9L 4OIIL 4NENB 1Z9SA 3L13A 1RP8A 4I0PA 4TSAL 5I19H 5HVGB 1KLFA 4HQQL 1W9XA 1IGTB 3DIFB 5KTEH 2YAQA 2VN4A 4HU2A 1CXIA 4PRIB 3ZTJG 5DJ2B 1AGFA 2YRPA 4UBDC 4LARH 1U8LA 5GGRA 3CLWA 4MA7L 3ARZA 3RP1A 4QXGH 3HI1B 3MMEA 1EIBA 3GM8A 4I77H 1QBBA 3BIAX 4PSRA 5FO7A 3UG4A 1Q1PA 1VF5C 2BWDA 4PJIE 2K6YA 3CSBA 5A2IH 2VLJE 1MCWM 1XTLA 3WUWG 3TJHC 3KS0J 3F6JA 2BPBA 2GI0A 3P4OB 2XY2A 1VENA 1Y1DA 2E56A 4KVCL 3PABA 1NICA 1MXGA 4J2QA 3D4CA 4MNGA 2NCMA 1B0IA 1IEBB 1W91A 1ZK5A 4J3OF 4PTTB 5IQMA 1U93B 2DOCA 2QSVA 5AVYB 5IFHH 2LAGB 5KUKA 1OGAA 4TVSa 5D6CB 2Q87A 1F1GA 1SEBB 4JQVC 1Z5LA 2UY6A 1EDHA 2ENSA 4X99A 3HNTL 1XB3A 3FUDA 1G7LB 3BDYH 3HNVL 5IMMA 3SQBB 3EUUA 4I13B 5H4ZA 4JG0H 1CFNB 1MHPH 4FTVE 4LLDA 3RWJB 1ZIAA 3N40P 2ZWKA 5LN4A 4P5RA 4DP9X 5DUBB 3CDZB 3BJLA 2D2CC 2F54D 5H94B 3LX9A 3U30B 5JMRA 5I15L 3MJ6A 4IOSA 1RIUH 2OL3A 3SQRA 4TUJA 2EO7A 3F7VA 1KY6A 1I1AA 4BFFA 3P9LA 2DLIA 3ZU8A 1U21A 4U0QB 3KDMA 3PHOA 3AWEA 1R19A 5T3XL 3VO0A 5DEGB 1ADWA 1L9SA 5D4IA 1ZKAA 2EVFA 1EMTH 1AZNA 3TFKC 1CBJA 4N3TA 2MRYA 2DQFB 2XQBH 1IQDA 4F8QA 1IGML 4RGOL 5KUMA 4EXPX 5DT1H 4Z95L 1OAYL 5IFJA 5JO5B 4U4IA 5BOZG 3MJ9A 4HPYL 5FLVA 3QWRD 5JW5A 2OMVB 1HSAB 2X2JA 1HZKA 2GB2A 4YDVA 2EO1A 4AYDC 2QSCH 3DOSA 5C09B 3KBHE 1WFNA 5HYJA 1A6UH 1R3KA 1NGZB 5M7QA 3VQMA 2W59A 1GYCA 1G7LA 5FX3A 5IMMB 4K7PH 1MFAL 1AHWA 1UZGA 2QV4A 4C59B 2NW2A 3ULVD 4Z3FA 2FBJL 4GB9A 4HPOH 2DDQL 5J56B 4PB9H 5KBKA 2OM5A 1JTOA 4DOHB 3P3UA 2IQ9H 2CBPA 1ED3A 5J57B 3Q8BA 2H32A 4NDMB 4AI7A 3E2HC 3EYSL 4PM1A 1JRHH 2FWOA 2NY2B 1TFHA 5MEND 5HGBA 4V1DB 5JYLA 2N0KA 1RPQA 2VABB 1TUPA 1NAML 1AZBA 4RRPA 2G60H 1Y0LB 4JPQA 4PS7A 5AOZA 4ACPA 2V5YA 4YO0B 4G1EA 1L9MA 2C3HA 2O6FA 2PW2B 4YZFE 3UJIL 3NPSB 4DKAA 3IXAA 4AT6A 1OOAA 3UL4A 2C3XA 1KYAA 1F11B 4WF7A 5KVFL 2VKWA 2WZ0A 3BI9X 5IG7B 3INUH 4J3BA 4M8RA 4M6NH 1ZHBA 4B6ZA 1DJSA 4QXVA 1PL3A 1YEIH 1A1NA 4GFTB 4BRJA 3V0EA 1YNTA 5D7JA 1B9ZA 43C9B 2BXZA 3M7FB 4N2LA 4ELMA 4HHWA 3RWHB 1CQKA 4MAZA 2QADC 2QL1A 4FF9A 3C5ZA 2NSXA 3W1ZA 1ZS2A 4EN3A 4L5FH 2JH2A 12E8H 1I9RL 1A7OL 1BYPA 3IETB 3DX2A 2K1MA 1ZVSB 4PJCE 3GJFK 4YWGH 1JWMB 4JPKL 4N5ED 2VE6B 1OAUL 4KJWD 3KJ4C 3FRUA 4Q4EA 1GGUA 1YUKB 5FDYA 4Y5VC 3WMPA 2X9XA 2ALAA 2NW3B 2GIXA 1R3HB 3KW8A 1SDYA 5FFGA 3W0WA 2WVTA 1IIIA 2H3NA 2CDFB 4NNPH 1LE9A 2HMIC 2W94A 3NSCA 4S2SB 5D2NC 1F4YH 4X6CF 3BP5A 3U0PB 3SGEI 4C83A 3TONA 5H2BB 4FQ2H 4RNRB 4H25A 4TNFA 3H3PH 1NFKA 3PQYB 1MCOL 4G7SB 3SDDC 4JFYB 4M4RA 3PWVA 1IVTA 3ETBJ 3ZDXE 3KPOA 1TSRA 4CADA 2WKLA 5L0QB 5DHYA 1XMEB 4BZ2H 1G0XA 5ICYB 3U46A 4OZHA 4RFOL 4U1IB 1BECA 2F53B 3QUYC 4NWUL 4RRPG 3MRPB 3IMTA 5EG6C 4FEIA 3ZSTA 5J1SC 4LLDB 4PB0H 1S7SB 3EGXA 2B4CH 4KFZC 2O5YL 1BQLL 1MJJA 2VDNL 25C8H 5B4MC 3OMZA 3LD8C 4TVPD 5DZOA 3QDHA 5HY9A 4LLYB 4I85A 5I8EA 1ETJA 2PXYB 4P06A 5AYUH 1GYVA 1CDIA 4J3UA 3DDGA 4C47A 1DVQA 2BOBB 2ZPKL 3JWNE 2DI9A 4UILL 5F7LB 4F8TA 5ES4B 4IMKA 3VFMA 5D1ZB 1UT2A 3CC5B 2D3JA 1HWGB 3FB8B 4ZUVB 1WD8A 4ZMNA 4P23A 5TE7L 3ZDYB 1S78D 4KDVA 3BAXA 2W07B 4LBEB 4WVRA 2CKBL 4PBWD 5A7EA 5E9DE 1OF2A 3PWVB 5IQ7H 5DQDH 2G9HA 4ZT1A 5BW7C 1MVFA 5IQ9B 5DVOA 3B34A 1KFGA 2JKIS 4LPYA 5CJXA 3G9AB 4NRXB 4OFPA 1XBRA 2JJTC 5KSAD 1VIWA 3MODH 5JPNA 2UZIH 3L5JA 1GR7A 1TEYA 3VX1A 4AUYA 3A6CL 2B77A 1MY5A 4DJMA 2K3HA 4TM9A 5AOLA 1FGNL 4IBQA 3ETBF 4E9QA 5GS0H 3CWGA 4HJ0C 1RZ8A 2LGNA 5E2WH 4BGLA 4AYBA 1QBLH 1BEYL 2OTPA 2Y25A 4OGQC 4M61A 5HDQH 1U91B 4Y4HD 4JN2A 3GLAA 4HIIA 5GZND 1WBXB 1N64H 5D93C 1FYTE 2B39A 5CR1A 3CIQA 2ZCKH 4PGBB 4YC2B 3DC0A 5TDOB 3W56A 1TO4A 3CX2A 1IGJB 3B7UX 3DI2B 1FIEA 1XF4B 5AVXB 3L3JA 2IDCA 3PWUA 4FQLH 5F7NC 2E76C 2EVGA 5KBLA 2X6MA 3ME0B 1JTPA 2AQ1A 4U7SA 1CZ8L 4XPTL 4CVZB 3VD1A 5LBSA 4IDJL 1KG0A 4XXCC 2X4UA 5ILTL 3F2LA 4NC0B 2NSMA 1YYLL 1S5HA 1EZVX 4X6FA 1Q9LB 4FYTA 4UCFA 2N7AA 2OSWA 3WFDH 1UXLA 3KPRD 3ZHNA 3PV7A 5I23A 3QQDA 4R5XA 5HHQB 4WTQA 2EILB 2IPKA 2C9RA 3RDTC 4U1NA 5FIEA 1C1EL 4LBAA 4R4BA 1C7TA 4WDIB 5F88A 3VXSB 3FQ4A 5BQ7B 2OR7A 4JFQA 5ADOL 5CZXD 4M43H 5IWLC 3S4SG 3TO4B 3S8WA 3CH1A 1AR2A 3MA9H 2UXTA 2WVVB 2HRPH 1X5AA 1KN4L 2G3MA 3HZYB 1CD0A 1WZAA 4PRHA 4PPTA 4QTIL 3VSVA 3UTPD 5L4MA 1E4XL 4V11A 1OCWH 5DQ9B 1LO0L 3ZT7A 1IBYA 3K6IA 3P9WB 5AWNH 3VG9C 4NZRH 1TJIH 4KXBA 3Q9QA 4FFZH 4X0KB 3WY1A 2FEDC 2E46A 2XPZA 2QZ5A 3KPNB 4PJ9D 4PRIA 4W4OA 4HD5A 4KTGA 1URIA 2X2YA 3NJJA 2B15A 5K39A 5KYYB 4G8FA 3BP5B 3U0PA 2H9GB 4F8PA 1JZ5A