3WTVA

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtvA00
3D0AA 3ZMEA 3KMDA 2WGXA 4LOFA 2FEJA 4IBYA 3TS8A 5AB9A 1EAOA 2IOIA 5ECGA 1IO4C 4GUOA 2AHIA 4IBZA 3QYNA 4LOEA 1TSRA 1TUPA 1KZYA 4G83A 2H1LM 4AGNA 2X0WA 2J20A 5BUAA 3WTSA 4MZRA 3US1A 3IGLA 4MZIA 3WU1A 5A7BA 4IBQA 3VD2A 1LJMA 3EXJA 3D08A 4IBWA 3WTTA 2P52A 2BIPA 4QO1B 4AGQA 4XR8C 1T4WA 2J1WA 2MEJB 1E50A 3Q01A 3US0A 4L0YA 2X0VA 1CO1A 4AGMA 1GZHC 4IBVA 5AOJA 3WTWA 4IJTA 3D09A 3IGKA 2YBGA 1UOLA 2AC0A 3WTYA 2ATAA 5AOMA 5G4NA 3D06A 2J21A 1YCSA 2OCJA 2ADYA 4G82A 4L18A 4AGOA 3EXLA 1HJCA 3D05A 2BINA 5ABAA 2J1ZA 4IBSA 2J6WA 3Q05A 5KBDA 2GEQA 4IBUA 5AOLA 3Q06A 5G4MA 2PCXA 2J1XA 4AGLA 3WTUA 1H9DA 3KZ8A 2X0UA 5AOKA 2VUKA 2J1YA 5LAPA 5AOIA 4HJEA 1GZHA 2BIOA 4KVPA 2RMNA 4GUQA 2IOOA 3QYMA 2BIMA 3VD0A 3VD1A 3WTVA 4AGPA 4LO9A 1EAQA 4A63A 1HJBC 1CMOA 5G4OA 3WTXA 1EANA 2BIQA 5LGYA 4IBTA 2IOMA 4L0ZA 1HU8A 3D07A 2XWCA 2XWRA
chains in the Genus database with same CATH superfamily
3QEGL 2YOCA 2R2HA 2HN7A 3QXWA 4Y1AA 1I8MB 3BVNB 1ZHNA 1TEFA 4XPAL 3QEQE 4YNYB 1JOIA 4AEIH 5D1QE 4Y4KD 1MFBH 3L9EA 4AV0A 1W16A 2DQMA 3DJZA 3GO1H 4WI0B 5MEND 4LVEA 4L0PB 4ZX6A 2UZPA 3O6KH 3BPCB 4NO0B 1F86A 5C6PB 3FQRB 4FLSA 3HE6C 3KPPB 3BP6A 3MJ7B 4EN3C 2DBLL 3B4NA 2FECI 3TF7C 1XGUA 3QCUL 4ZYKA 1ID5I 3PJSA 4PN6A 5LVEA 1L9NA 1XBRA 1MFDH 5GZOA 4KMQA 4OKVB 3ULVL 4BZ1H 3ATFA 1WZAA 2F9BT 4KDTA 5HJDA 2ODHA 2FTAA 2XVBA 4DPCX 4Z76B 5IOPB 4ZAKD 1E65A 1HCZA 1ORSB 1IZJA 3B2UD 1NKGA 2D3JA 5IW6B 5C0GA 3VDAA 1VFUA 1PJ9A 1J0ZA 4RGNB 5CAYB 2YD6A 3B9VA 4R2GD 3D39A 1Y6KR 2VL5A 1BFOB 4YN3A 3D4GA 3KXFE 5CM1A 2BVTA 1MQKH 2OQJA 5FGBA 5I23A 1D5XA 3I9GH 2LW3A 3WELA 5DD0L 4LNVA 2XNAB 4S1QH 3QWOB 3ERXA 1E8WA 4O2CA 3EBAA 3CSTA 3KDPB 4LSUH 4FKKA 3IDIB 2YA2A 3NTCH 3QZBA 4NIKB 4BFIA 1W0YT 1L6ZA 2EDEA 4NNXB 1NUGA 3QRGL 2RA1A 3RDJA 5B1JC 3UTZA 2HRGA 1AAJA 2GSIA 3SPCA 1OWRM 5EZLA 4YHML 4F58L 2OL3L 5IHLB 1RZKL 4GBXB 3BGFB 4XCCH 2J1XA 1G9EA 2X3AA 3QFJA 4WTWA 5EO1B 5I6LA 1ZPLA 3SPVA 2EC8A 1ICTA 3P4OB 1NC4B 2PABA 4WKZB 3OAUL 5LXGH 3IDUA 4PD4J 4Y1SA 2VLMD 3WIFB 5J0BA 2X3BA 2H45A 4GO9A 3MXVL 4H20L 3ULVC 4Q74A 4C4KO 3MLVH 4E41D 5ISZD 1YO4A 1X3DA 1YY9D 2CLZB 1U8NA 1KN4H 3CDZA 4OLZH 4HEMA 4BFOA 3GIVA 3M1BB 5JOEA 1LMKA 3KPOA 4WHYG 1IGYB 4PJ7E 5G4OA 3D34A 3KW7A 3LB6C 2GJRA 4AW7A 3TONA 2F1BA 2WYZA 3VGHA 3I9IA 4CVZB 2A6DB 1U4EA 4NQVA 1TVBB 2VDRL 2IDCA 1TU2A 3RKDD 1NSNH 4AC4A 4OLWL 2ZKXA 4L9LA 4ALAH 3C8KB 3FB8A 3TN0C 1BIIB 1BOYA 1IARB 5C0BD 1BWWA 1NCDL 1EH9A 1WFMA 2W5PA 3D6GA 4WK4B 1HE7A 1ZE3C 1LE5B 5E56A 4KJWC 4X4XB 1XV8A 2OMXB 4J2XA 3WFCH 2ICEB 3EDDA 2RHEA 1SYVB 3C6EA 4LHJB 4NQEB 1O9VA 3LQAH 4X98B 4P4RB 5KBKA 5LN8A 2X4SA 3KYOB 4KNSA 4XMUA 3SQOH 3S8GB 1RZKC 3MR9A 1ZK5A 3HNTL 1GYVA 3U0TA 3UPCA 4PP1D 3P9LB 3ARED 2VAAA 3HZKA 4W9CC 1N0XL 4YSAA 4I8DA 5AW6B 2WWNA 4RFEB 1K2DB 2VLRA 3ARGB 4ZFOL 4NQCA 3QQ4B 4DFHA 3TEWA 2IFFH 3PGFL 1LNUB 4OQTA 3SYPA 3OSVA 5AW1B 4XBEL 3L1GA 1WT5C 3V0EA 3QZWG 1V55B 1NIEA 2Q1EA 2ZCHL 5AWNH 3RTQC 1MHEB 4U1IB 3ZTJG 1KFAH 2LGNA 3P02A 4QRBA 4JQVC 2NXZD 4W1TA 5AW0B 1CL7I 5MEOA 2YKLL 4QRSB 4B9KC 2BVYA 2XVKA 2LVCA 4FFZH 4KH9A 4HPHA 1NGYB 1Z0NA 1P5VB 5D9SB 4I0KA 4N0YL 4Z0BH 3EXLA 3DJTA 1V7ML 1K72A 1O6SA 3BT0A 5EOQH 2X6CA 2NY6D 3K6IA 3BT2H 4B3VA 3Q05A 3BP7B 1KJ2L 5BUGA 2Z4QA 1RIHH 2FHCA 4D9RE 4YHYB 1F4WL 3HLKA 1J87A 1NEZA 4QPEA 2VUKA 3BSZL 1KDJA 2FATH 5K59E 3BKJL 1XSJA 1RZ8A 2IALA 2ZG3A 4PUBL 3RBGA 1S7UA 2DS4A 4YGVA 5FHBL 3HE7B 5ICUA 3VG0L 4QXGH 4KVCH 1AQHA 4BM7A 1NANI 2YD7A 1QACA 1HDMB 1PZAA 5A6MA 3BUTA 1CFNA 3WOVA 2ADJB 1HYSD 2WAHA 4Q56A 1D5ZB 4NI3A 3PPSA 3EYFA 1VPOH 1N10A 3RIAK 3MMEB 4DETA 1ZTXL 4GG8B 1N18A 3L4CA 3GM8A 3MCG1 1NMCC 4JO2H 4QHLA 4HETA 4DEUA 2FEEL 1CQKA 4ICXA 1J1OL 1IBGH 5EULV 4ZDHA 4OW6A 1KLUA 2VZSA 1IGML 5C0DA 2NUTA 3GSWA 5L8KB 3HG1D 1F11A 1LWJA 1HXYB 2QQNH 1T22A 1MG2C 5JORB 1CBJA 1PG7H 1N5YH 1RK7A 5D1ZC 2C1OB 4PS4H 4QAWA 5E00A 4HT1L 2NNXA 5KVFL 1I1AD 1UFGA 4NHUA 5C0EB 4XPFH 4XPTL 2XJLA 3JTTA 3LN4B 1J0YA 5DURD 2CSPA 4F8QA 3F7LA 2HWZH 5JHDA 1AFVL 2H1LM 1ZVNA 2WWKT 3VGGA 1WFTA 3F64A 1UWEH 5FCUH 5L8LB 5I28A 1CYXA 4GUCA 5IVXA 2QVKA 1YQ2A 3TO4D 3WI9A 4G6MH 2EEFA 1QLEB 3KW8A 3MV7B 2V2WB 3C60C 5ESVB 3C87A 5IQ9A 2PR4L 3F2LA 4BSJA 4EZLA 4UOQA 1UWYA 3TF4A 2W07B 4OJEH 4G80B 3L9RA 3WO4C 4TNFA 3SDDA 5CMAA 3SKJH 4UT7H 3HI5H 3RWDA 1VACA 4U1HA 4E9SA 2G0LA 2KLRA 3GQFA 1AS6A 1V27A 2J7LA 1E7VA 3OKOB 4JHWL 1M05A 4NZRL 5FO9A 2EDOA 3C6SA 3VXPB 3NCFB 5TDOA 2CDFA 3NSJA 2FSEB 5FO7A 4QCIB 35C8L 4GLRH 5B1AB 2VMCA 4ZPTA 5I1IH 4JEGB 4N90E 3TH4T 1SOXA 2FJSA 3NCEB 1G6VK 1UXWA 5BRZE 3MRJA 2MPVA 5GS2D 4WFED 2BFVH 3EOTL 3PWPE 4ZS7H 4YLBA 5EU5B 5T1DH 2UZXB 4HK3J 4NUGL 5HHNA 4OV5B 1TJXA 2CUMA 5DZVA 1OP3K 4S1SL 1Z5HA 2A9MH 1WGVA 1M4KA 3PP4H 1AJ7H 4I5BA 4G2AA 4XBPB 1YMHB 3UMNA 1E5BA 3QPQC 2QJDA 1RLWA 3EOBB 3K6SA 1SGKA 1GKEA 1M9WA 1QKZL 3VRIA 4YL4A 2AJUL 3I3DA 4KY1H 4OCNC 2CHXA 5CILH 4F9PA 2GCYB 3GTVA 5FB8B 4KXBA 1NAMB 2F54E 1QLEH 2E4TA 3G6JE 4TLSA 4JPVL 5FYJD 1TF4A 3P2BA 4OUUA 3MTRA 3BPLB 1T4KA 1UQSB 5EG6C 3T0EA 4TKWA 4JR9L 3LS4H 4K4KA 1DLHA 4LP4A 2AK4E 3P11L 2F7OA 4HPYH 5DDHA 4Y2DC 5I6XB 2E9WA 1VF5C 2G75B 3O2VL 3JVGA 3GHBL 4AG4H 1ZY9A 2NNRA 2Y1AA 2GJ6B 2H3XC 2XZZA 4LMQI 1L3WA 5J6GA 3LVEA 2WVVA 3NIFB 4PRHE 1JMZA 2BRQA 1T1YA 4Z0XB 3FQWA 1UT2A 3NSCA 4UDUA 2V4LA 2XFXB 3PGCA 1IEBB 4G9FA 4O58L 4Y9EA 4A2EA 3QNFA 4FYRA 3FQXB 5FEBA 1BYNA 3FOLA 4X6DA 2CBMA 1AGEB 3LSOA 2IH9A 1DJSA 3O3AB 4B50A 2GUOA 3QH3B 4LHUD 5FCSH 1OCOB 4L3CA 3KPQB 2JKWA 4MCNA 3FCTA 1TOXA 5C0CA 1PQZB 2IPKA 3F84A 4NNYB 3HS0C 5AKTA 3IETA 5B3NA 4G83A 2NY4D 1PLCA 2Q76B 5JXED 3CFCL 4AQZA 5GGUA 4KKRA 5MEQB 2XIDA 4P4KD 3ZN6A 2NY5L 2IDQA 1JZDC 5IFJB 1NAMH 1A6UH 2OMZB 5FO2A 4HWEH 4MXWL 3QEQB 4WGVB 4ATTA 4WI2A 5IGXL 5D1QB 3OQRA 3GTTA 3BKYH 4QHNA 1XH0A 3WBDA 3WDJA 1LDSA 2TAAA 2GITB 1K8DB 1U8IB 4MQSB 1XIWC 3FO2B 4Q58C 5I71C 2X6AA 1FP5A 4D9LL 5KZCD 1CO1A 4PRPD 4YDLC 1QPKA 2VQTA 3STZA 1IM9B 4LIQE 4WUUA 5TQ2L 1JAEA 3VFPB 4UYQA 3B7SA 2R4SL 1VADA 4JBSA 1KIPA 3O41A 2CMRH 5LO7A 1FNHA 1SJHA 1ZLDA 3B6SB 3IGUA 3OJDB 4J3OF 1BZ7B 2WMPA 4U3SB 3U0WL 5KSAC 2BWDA 2FGZA 2YPVA 2W60A 1RZIA 4ZW6A 2X9WA 4JY5H 2O1AA 5C0IA 4S1DD 5LBSL 1HSBB 1IJ9A 2HH0L 2GW5A 3HG5A 3QNYA 2WXGA 3T1FB 4F7EA 4ICWA 3GZOA 1S3KH 3KXFB 5H4YA 4AVIA 5J3HC 5FYKH 1TZGL 1CU4H 2OW7A 3HG4A 3OKNB 4K2UH 5HDRA 5EMYA 4QYAA 4LQFH 4XO5A 1DBBL 4BWUA 5F3HA 4DQAA 1CS6A 2FX7H 4GMSL 2DAVA 4CDHA 1AZUA 1D9KC 2K6ZA 4HS6B 1X5ZA 2BIOA 3ABKB 4PS8A 2FJHB 5KVGE 4ERSH 1ITBB 2Y7SA 5IHUH 3KJ4B 3DV6A 4JFEA 4DQOL 2G3MA 2ERJB 1UB5B 3IE4A 4OCSL 4UDTA 4X6FB 3RIFK 2QFPA 1Q0YL 3L3DB 2WLKA 3WL9B 2P48B 3AAZA 1VIWA 5EUOE 3P9MA 4P5KA 3PNWB 3V6FA 2OXGB 2AMUA 3G04B 1VEOA 4JG0H 1P0SE 3DX9B 5DK0A 5J4MA 4LZKA 3S88L 1IE5A 2AV1B 3S5LA 1TJHH 1CICA 3RJQB 3GMMA 1KCRH 2YPKB 4JM2D 1BV8A 1JD7A 3CQQA 4TLKA 4Z7OF 4YIQB 4U6HA 4J3WA 1GGBH 4E5XG 5KVEE 2OMUA 4YHNA 4ZT1A 2UZIL 4M6AA 4FQQB 4AV4A 1R33A 3JQOB 2IJ0C 4WI9A 5DD6A 4L8CB 2ZXBA 1N3NB 3BYTA 1SM3H 3LRSA 5D6CB 4HOZA 3RDTA 4DUXA 1QZNA 3BQUC 4PJ7B 4XX5A 3BUYA 4GSDL 4NPYB 2VLKE 3U9WA 2EXYC 5CINL 3OB8A 1S7WB 2CAKA 2CDEA 3BXNB 1OGAA 2CBQA 1XCTB 4Y89A 3O2WL 5I2IA 1TQSA 3LH9A 1OCWL 2HCZX 2BNUA 3BVXA 4YK4C 5FF6B 4HJ0C 3IGLA 2WCSA 3AMKA 3ARUA 5FECA 2P5PA 5K59F 1P84K 4X42A 2LLGA 4IKIA 1HKFA 1KIUB 4PW3A 3HVDA 2XU9A 3F7VB 3MRIA 2P5ED 1U8CB 2GB2A 4BINA 1PKOA 5JXAH 4RNRB 2UZYA 4GSRA 1JZHA 2AW2A 4XAWH 5DEGA 5ALCH 3U25A 4Z3EA 3OB0K 3SY6A 4DOHE 4FABH 3K46A 4N26A 3FFOA 3TH3T 4NQSB 4ZFZA 3DVGB 1HQ4B 2CG9X 4OFYA 1FO0A 4QNPF 2E7DA 2C8NA 4PVNA 1Y0LA 4LKXB 2W65A 1YPZE 3VA2C 1L9TA 4KXAA 4Y1AD 4XNMA 2LFEA 1FLRH 3UTPE 1TKWA 3Q7JA 5F89A 4OGXL 4HG4K 4PV9A 3SCMA 5JR1L 1EMTL 2OTUB 4NCC1 1WCBB 4ZFGH 2WXPA 2YFOA 1ET5A 4ACPA 3H4FA 4L2YA 2KDYA 1F4XH 1QUPA 2W1NA 5DFTA 3OD3A 2ZWZA 4ZX3A 1CI5A 1DQQB 3FUKA 1Z9OA 4RAUA 5EWIH 5GZOD 5F6IB 5DJ2B 2V2TB 3UG4A 5J13C 2J71A 4Y8AA 1MFVA 3L5HA 4BK4A 2YRBA 4JFPA 1KEGL 3K2UH 1PPIA 4G8GE 4A04A 3G5ZA 3KLLA 4OZFG 5E9DE 3VCLA 4MBRA 5CO1A 3C09B 4O5LH 1UM5H 2WWOA 3TPKA 1CTNA 4W9EC 3T0AA 5MP6H 4AEIL 1OOAA 4AI7A 4ZOEA 2ZKHH 1W6LA 2FO8A 3MJ9L 3S37X 3TVMA 1DVYA 3D39D 3RVUC 2NY2C 4L8SC 3HG2A 2RH0A 1Z9SB 5CCKL 1MCOH 5CIPA 1MJUL 1PCXA 2ZOKB 4XZUA 4TQHA 1NCBL 4OM1H 4AV5A 3O8XB 5GRVK 5A6LA 2VSCA 5L9DH 1R0AH 2HT3C 2ICES 1CXHA 4YSTA 3SYAA 4BH7B 4IBYA 2V9TA 2YUWA 4ES8A 3DURA 2NQCA 4ONGL 4XTRD 3WLWC 4J8QA 5LBGA 5TDPA 3ULVF 2UY7B 3DLQR 3F58H 4ADIA 1NMAH 4F8OA 4WI5A 1Z9MA 4NKMB 3QUXB 3CVIH 2NUPB 5DQJA 2Z31B 4F8PA 3IDXH 1JYWA 5EEYA 4S2SB 2EXWC 4LAQH 3QFJD 5L4JA 1MQKL 1QI5A 3W11D 4GAYA 4MD0B 5HJGA 4QTHB 2FT8A 3QQ9D 3VJ6A 3IN2A 3L9BA 4QRAA 4BDVB 4Z77A 3KDMB 5B1KA 3RUGF 3AZUA 3MLWH 3HUJA 5CSBA 3AQXA 4HK3N 4G42A 4LSUL 4LPXA 4P46A 2OV0A 5IHBA 2CIKB 2NR6C 2ZAIA 1BQRA 4OBSA 2UWEE 4KVNL 1IU1A 1QPPA 1FVEB 3QUKB 2B15A 3WJMA 4EI5C 5AW7B 1L0YA 4RMVA 2IAAC 2C5DC 4XB7A 4XCCL 5CGMA 2PF6A 2R56H 3PDDA 4QLWA 4BZYA 4OZIA 3BPNC 1E9QA 5G4NA 3X11B 2DM3A 1YEGL 3FUIA 1CFTA 1AMXA 2CR3A 5E6SB 3S97C 4A7TA 3QO1A 2I9LA 2WYHA 2HG5A 2R59A 5EPMA 4BKLB 1L6PA 3MLVL 1KSRA 1N70A 5LNDA 4WFHE 5HVHC 3IJ9A 4NDMB 2EIEA 3H9SA 5HI5C 2Y72A 3KWWB 1KN4L 4OLZL 3UAJD 1PZ3A 1QSEA 3QJUB 4TSAH 4DZBB 1NBYA 1V3KA 1ZGLA 4ZFFA 5C0NC 2X10A 4A68A 4IRJA 4GAGH 3QRBA 2J1YA 2IWFA 1HL8A 1FH5L 2APWA 5LAPA 4R7DB 1VGKB 4UUJA 2B5IC 4KVPA 3T4YB 5LHDA 3P4MA 3WEXB 5BRZB 2ZUQB 5D1ZI 3NIDE 5C08A 3GI8H 4NZFA 5T5NF 2VLRD 3PWPB 2EKSA 5IJVA 4NQCD 1NCCL 2X4OA 2UUDK 4OLEA 1QA9B 4OD2A 3I6KA 4UTBL 2V33A 2WYTA 3TA3A 5EOCH 1XAUA 2JNZA 4ADGA 4U1NA 3ZYIA 4Q9CA 3WFCL 4PWIA 5FM8A 4NYLA 4R4NC 4UIMB 3EO0B 4M56A 4UQ2B 3U4KA 4C55A 1UACH 3LQAL 3RWIA 3K80A 3PYCA 4YFEA 1MCIA 4L1DA 4R97B 5FYLE 5DZ9A 2F54B 1XR8B 3G6JB 3SQOL 3RZCB 1A22B 3WJJA 3DOSA 3FCUB 3CFMA 2PETA 5KAQG 5IQMA 2GSMB 2CXGA 5ELIA 3RVTC 1U3JA 4A2MA 2AK4B 3CPLB 3P69A 4EVNA 1CFBA 3DX3A 3WJLA 4QF1A 3U0PA 3CWGA 4FG4A 4RGNC 5LLIC 1TMQA 3RWEB 2YXFA 3D18B 3MNZB 1E8XA 5AWNL 1Z7JA 4AL8L 1KFAL 1MIEH 1JHTB 4PRHB 4KKCD 3DROB 2FEEI 4FFZL 1UA3A 3WXWL 3AS2A 2VDMB 4U7SA 4K5OA 4XVSH 1HQRB 5DC4B 2ZOUA 3OZKA 2WJ7A 5C6WH 4G7SB 4NO3B 4OIIL 1CDBA 1IC5H 4Y4FA 3BT2L 5HP5A 3VXRD 1UZ6F 2QGDA 3GBLA 1RIHL 4JMXA 2YJLA 3BH8A 3DI3B 5E2UH 5F2FA 5K1VA 3MLSH 1AZRA 4JZOB 4RAVA 5AVXB 2X6VA 5GSRA 1WPCA 2D7QA 4RMUA 3HG3A 3KPRA 4GBXC 2FATL 3LQAC 4X5XA 4ZMNA 4YE0A 1T89A 5J12B 4AYEC 2ZX7A 2BVQA 2XN9D 3A6OA 4QXGL 4KVCL 4ANXA 1BXAA 2B1OA 5AOLA 5KSBF 2PWDA 4ZUUA 3PWVB 4FTVE 4PHZA 1C5DB 3VRJA 2A9BA 5JHDD 3JT0A 4LF3A 1VPOL 4Y9FA 2ATPA 2YRLA 1W9XA 3B2VH 3VYPA 3MX0B 3GSNL 4C56E 4JFDA 1IBGL 5AAMC 1JNHB 3L3HB 4FHKA 3WKMH 4L1LA 4F9LC 5F7UA 1TZOA 5FA4A 4AZUA 1UYWH 4AL8C 2PO6B 3NP4A 1XL6A 1CVSC 2QQNL 2VDMH 3FQNB 3BRFA 5DS8B 4QJ4B 3IGAA 1N5YL 4PS4L 4PMFA 1NDMB 3SDDD 3TV3H 4NI6A 4PG9B 2E7CA 2V7NA 1S6NA 4OQ1A 4XPFL 2WKLA 1FAIH 1NEPA 5IZ7A 5EEXA 5KBNC 2HLFC 1NFDE 3UFIA 1Z5LB 4Q89A 3ARBB 3GMOA 2HWZL 3ARDB 3K91A 3NA4A 2YGNA 4X8JB 3R7RA 1UWEL 2VR4A 3SBWC 4ZW8A 3H53A 5F9JA 3UGEA 4G6ML 3FJTA 4Z7UA 4FZ8H 3G5YA 3WUWB 4P2QA 2I7SA 2R1YA 1GY1A 3CLEL 2JLPA 2R1XB 5DLMH 5EUOB 2BVEA 5FOJA 3BIKA 4HKZA 5ILTL 3SKJL 2BHUA 4UT7L 3HI5L 5I19H 2J8UE 2DIJA 4IS6A 1ADQH 4LIQH 4WCYH 1C8QA 4R96B 5JLZB 3WTSA 1QI4A 3HC4H 5J6HB 4OIBA 4XP6H 3UC2A 1A6AA 1J8HA 4DPBX 2FH6A 4X6CE 2COQA 3CHXA 4U6YB 1CGVA 4FL4C 4L4VA 4MXVF 4BUGA 3T0ED 2ZCKH 1FUNA 4NP9A 3A47A 4ZMQA 1OVZA 2YGQA 3GYRA 4IBLT 5T1DL 5CF3A 3TA4D 1QFWL 2HFFB 4HKJB 1S8DA 2VLKB 2A9ML 3QNXA 3PP4L 1AJ7L 1NGZB 4K5MA 1EBPA 1UZ8A 4LCYB 5E94A 4WY7L 3LV3A 4NKDA 2EIZB 4KY1L 4L8BB 5CILL 3WMSA 2LABA 4YHYC 3R8BB 5KVGH 3T1WA 1ZT1A 1Q1JH 3VRLF 2WHVA 3N1PC 4AENB 43CAB 3S36X 1QLEL 4ZSOA 2BMKA 4PS3A 3T4AB 4G9FD 2BERA 2IQ9H 4PJ8A 4BA0A 1CE1H 2CJUL 1P1ZA 4XE0A 5KYUA 1HEHC 1BJ1H 5AVRB 4DOHB 1XB3A 3V4VA 3QHTC 3D9AH 5I66B 2HMID 3ISWA 5I0XA 5C0CD 3MUY1 3A67L 4FEIA 5DJZB 1T1XB 1H9DA 2B4CH 4BCZA 4NBXB 1RULL 3VNZA 3ME0A 3L48A 2KZBA 4I48B 3I50L 3H1ZA 3OR6A 4AG4L 2R0ZL 1KELH 5D1XA 1YPZB 2AJYH 1TITA 4OFVA 5KVEH 2IOOA 3ZDZF 1W72L 4P3DB 1R9FA 2YQ3A 3GDBA 5DJ0B 1HWWA 4PRIA 3BZ4B 1EEZB 5DWUH 1VFAB 3PDGA 1OSPH 1JZ7A 1FG2B 1Q9KA 3ML8A 4JJ5A 4OGAC 4PJDA 2XN0A 3MBEA 3VDBA 4DP7X 3PNRB 3U1SH 4W9DC 1TT6A 4C83B 4D8PA 4H5SA 4F8LA 2ARJQ 4WUUD 2Q9OA 3CTTA 3HMWH 3MJ6A 4P04A 3WN5A 1RPQA 1XCQA 3TBBA 2JSFA 2NW3A 3CFBB 1GZQA 2MQ3A 4KJQD 3SD2A 5LG6A 3KNBA 5EBLB 3VXQA 4G8GB 5E9DB 4HWEL 1U8PA 3JTBA 2NXYB 2K8MA 4DAGH 1ZCRA 1E27A 1JGDA 2C3HA 1E28A 3BKYL 2P45B 1NC2D 5IMLB 1U2HA 4P2RA 2ZSWA 4KQ4H 2CCLA 4JY6A 3V7AE 5FC9A 5L0QB 5TK4A 4PJFF 5SX4H 3V6ZA 4G8EA 3RL1A 5HYSG 4PJGF 4LB8A 2K7PA 4FYTA 5F7DB 4L1BA 1X4ZA 4RA3A 3UBXI 2XWBA 3FRUB 1U58B 4R0LB 1NGQH 1K5NB 3MROB 5T1LB 3UDWC 4BIKA 2BS9A 3KL0A 4PJXA 2P8MA 4IKLA 2XTJE 4TN9A 2CMRL 2BHYA 4JB9H 4JFED 4J7RA 3LXAA 3C5JA 4FFYH 3VFWB 1T3FA 1JNNL 5LN4A 3G08A 1UT1A 2B77A 3VD4A 2VQ1B 2Y3AA 2ZUYA 2ODIA 4P5TB 1UH4A 5EEWA 4DEWA 1OTSC 1LYQA 4AKOA 1AYOA 1ND0B 4F3FA 1WTGT 1RI8A 3GFUA 1CICD 1WBZB 3S2AA 2R83A 5FYKL 1CU4L 3TEUA 1AGDB 3WIHA 5J9PA 4K2UL 1KYFA 3G9AB 5ECJE 4LQFL 5FO8B 3U4BL 2ADYA 1MRCH 3IDYB 2AP2A 2BDNL 2OMWA 3IFOA 1MFAL 4R2GB 1KGUA 3MHZA 5IHUL 2W9LA 3MACH 2ZOWA 4AY0A 1J8RA 1FCGA 4J8RA 4X9FA 2JK5B 4H40A 1NFKA 3FTVA 1R6VA 2UWEB 2I9TA 3MJGX 2WTRA 2XY2A 4DT2A 4EDWL 1JPST 3ARXA 4XX1G 3HPJA 1IT9H 2IV8A 3BPLC 3ZDYF 3TOPA 4ZFQA 4JG0L 3QDMA 5D6DA 4M1CD 1YNTB 4AOFA 5SWZE 1OGAD 1VZIA 1GZHA 1FVCB 3IPBA 4LSRH 3MFGB 4K3HA 4DP2X 3QAQA 1EVUA 2DEYX 4ZG1A 1E90A 4KZCA 2P24A 1J9QA 3C5ZD 3NG5A 4UQ9A 1EEQA 2VO8A 4HCRH 5JZ7C 1EEYB 2WXNA 4Y4HB 2BOCB 2XYCA 4F33A 1FC1A 3QEHA 3FUEA 3O3EB 2HX8A 1BREA 3RJOA 1QPXA 4GRMB 4BQ8A 3H7BA 4E0RB 4WHYH 1BYOA 3UOAB 3A0OA 2F53E 3QZWB 2X9YA 3O9WB 1IM3A 2E6QA 3PGDB 3FULA 4NO5A 1WAAA 1DVFB 4OFYD 1QATA 3VH8B 3QIBD 1TTBA 4DN4L 1T5WB 4Z7NF 2VABB 1ZWIB 4QRTB 5FFGA 4UANA 3WDHA 1HHKA 1JXDA 3WUZA 3NIDB 3SCMD 1UCTA 3QI9A 4P9ML 2NTSP 4TVPL 5JXAL 2H32A 4JFYB 4OLXL 2EE0A 3CZFA 4F5CE 1AKJB 5ALCL 2JQMA 1EHLH 5D1QC 1GRWA 3Q48A 4JFWA 3NDZE 4FABL 1P84J 4XP1H 2CZNA 5DZPA 1T0NA 5ERWA 1KIRB 2K45A 4JG1H 1JUFB 4Y2OA 1X5JA 3PWNB 4BA8A 3NYKA 5KSUB 2DQIH 3BP5A 4WEMB 1EJOH 4DO4A 2H4EA 3GSVB 2P5EE 4W6WB 3PQYA 3U30B 1YEKH 4MSWA 4KKAD 2VKXA 3GNMH 2H2SD 5EC2A 1HYRC 1I8KA 2BLFA 3HZVB 5EU3A 4ZFGL 3SEPA 5IJDC 4XP9L 5AVSB 1AD9A 1UEMA 3L5XL 3FBKA 3KLSA 2GAZA 3NCXA 4PRBA 3EDJA 1F4XL 4LT7A 1Z9NA 1JFQH 2YEVB 4HG4J 5C0AA 4I4WA 4U1LA 2FLRT 1OV8A 3ZTJH 3LPGA 4PJEF 1DVTA 3P77A 1QTPA 2JKSA 2NYKA 5F1KC 3ZTNL 3QXAA 1OLLA 1F3JB 4DGIH 3UADA 3R0NA 3NDYE 3K2UL 4M6MH 5ACZA 5KTEH 5JIDA 2Y2WA 1BCIA 1LDPL 1SHMA 4RAHA 2VIRB 2F2HA 4BSWB 3CFTA 4DKAA 5JHAA 3IFPA 5C9JB 5F8QC 2XCMC 2VN3A 4UBDC 3E6FB 1G0DA 2LLNA 2J6EA 3MCYA 3EHBD 2X4TB 1BX2A 1SEQH 5FYLH 4M6OH 4OM1L 4XI5D 3KE0A 5L9DL 3KYKH 3TEYA 3U7AA 1FDLH 2MH4A 1IKNC 3QIUC 5ETUB 2YZ1A 2XHNA 3MRFA 3ZTCC 2ZUUA 4MMZC 4NX0A 1Q72H 2HJKA 5KYYB 1W6WA 2PPCA 3MLUH 1NMAL 4ODWB 2ADIA 3DI2B 4FTVB 2ENJA 1NPJA 2BVPB 3ETBF 3CVIL 1AZBA 2FLBT 4GSUA 3IDXL 3DXAE 3QUMA 2IQAA 1RSFA 4JFZL 3LX9A 4LAQL 5DJYA 4PMEA 4C56B 2O72A 3MXWL 3KR3H 1QVOB 2R69A 4OAWB 4WW2B 4XPBH 4YSRA 4S11A 2K3TA 3VUAA 1CGYA 5DJCB 1KPRA 3POCA 2WBXA 4OZFA 4C57C 5DK2A 1IZKA 3H9SD 3MO1A 4KJPC 1T21A 5DUBA 1KY7A 1VLXA 3ZZQA 5GRUL 1QSED 2NY0D 1RKRA 3FB7B 1OE2A 2UY6A 5ICZA 5IQNA 1O0VA 2OPCA 1WBXB 1G6RA 4FLRA 1NFDB 3D7PA 3KPSA 5HGHB 2HVKB 2PCPA 1Q9LB 2QKSA 3OLGA 2P4AB 5KJRH 3L45A 2G5UA 3CFUA 4HIIA 3MRBB 4U1MB 2BC4B 2AXFA 4M8QB 3PHOB 3LQZB 4U1KA 4NWUL 5J1AA 4L23A 5C08D 4H44C 4ETQA 3U36A 3KM2A 3VI4E 2ZJSH 1SLUA 1P5UA 3S3PA 1LVEA 1H6FA 3TA3D 4IIQC 4LEXH 4PU2A 4MQ7B 4IBVA 5FKPA 3LKOA 5ESQB 4GXUM 2A74B 4H26B 4EMZA 2J8UB 4L2LA 1BVLA 2FIKB 4TSAL 3TO2B 3LIZL 3D09A 2OSLA 1KNOA 2EVIA 2BCKB 1IVTA 2WGNB 1YUHB 1OP4A 4GAGL 1I1RA 3BFQG 5C2UB 4AGOA 4WU5A 4FI6A 4FNRA 4X6CB 3QE5A 3FT3A 2KPNA 2ZOTA 3IFNH 3VXSA 1I3GL 4WU7B 4YBQC 1F56A 4ZMZA 1QLFB 3O6LL 4P3WA 4LLQB 1F8TH 3RHWK 1IC0A 4XVJH 2OR7A 2B39A 3SDAA 4HD9A 4HA1A 3VX1A 3Q5YA 2Y6TE 1SEBA 3C09C 5EOCL 3RVWC 3DTXB 2B1AH 5C0FB 4UNUA 4X0KB 1QASA 4JHUA 2A9CA 1HCVA 1QSVA 4XN8A 5CJXA 3REWA 3EG9A 1ZS8A 2VJXA 1OE1A 15C8H 4U6VL 3O8XC 4PJIE 4HIEA 3GD1C 4PGZA 5EIIA 3SPHA 3D4YA 3MRRA 2G30A 3NFPA 5KW9H 1XWVA 2NRDA 4Y4FD 4AIZA 1KTLA 1OD9A 2BSDA 2H6PA 1DQDH 1ETB1 4WWKB 4UINL 3CH1A 4F15B 4U4BA 2VSMB 3L4ZA 4POZD 1WH0A 2FAUA 2OTPA 1PGRB 1UM6H 1UA7A 3R19A 2APXA 3SB3A 4ELKA 2X7LB 2Z31C 1MIEL 3U6RA 4UV4H 3RI5K 4FQIH 2C9XA 2MCAA 3E38A 3KPRD 3N0AA 1BGXH 2KQMA 4H8WH 4NP4H 1RU9L 5C7XL 3V0AC 1RURH 3DWTA 3IXTA 4X8GA 5GXBB 4KAQH 4IBZA 4KK6D 1KYOK 3C6LC 4Q2ZB 4BK5A 3KGRA 4N1HB 1DQTA 4XMLH 2BSEA 3K0WA 3L3OC 3O81A 5MHSE 1IC5L 1PG7W 2J20A 1HHIB 4NN5C 1FZMA 1I8LA 1NLBH 2K6YA 4F57H 5CCHE 1OB1A 4DESA 2GSGB 2DRUA 1URZA 1JE6A 2RACA 1RJCA 3LZPA 2I27N 1H3XA 4JFDD 3GUTA 1BW8A 1N4XH 3P3SA 3V52L 3ZY7A 3MLSL 5EHFA 4B95C 5IEKA 1ZOXA 2NPLX 3OAZK 1FORH 2B9BA 5CKGA 5GS2H 3S9DB 2EEXA 4ZMLA 3K6OA 5GJSL 5B3JF 1CUOA 2EDLA 1U21A 5A3IC 1JK9A 1NBZA 3RX9A 4PJ9A 2WLYA 2WINA 3CDGB 1I8AA 2YOAA 4FI8A 1OD7A 2HKAA 2L8AA 4LVHB 3PY9A 5AUMA 3VTAA 5M7QA 2OW6A 3SJVE 4EIGB 3OZ9L 1NICA 4WI4A 1XF3A 1EO5A 2IGTA 4FEMA 4OGZA 4QYOB 4XCNB 2XTJB 4LCWE 4WFGD 5GGTL 3RPKA 3VMOA 2YR3A 5H35B 4BCYA 2V5TA 1UYWL 3RVVD 4E5XB 3BD4A 3TZVB 4P2QD 2VDML 2WKOA 5G4MA 4N8PA 4GLRI 1J11A 3IDNB 5I75B 5C0RH 2B08A 3TV3L 3Q9PA 4PRDA 3E8UH 4YXKH 1XDTT 1FAIL 2PWGA 2C9PA 4JLRA 1R5WB 1QFWI 3O3DA 5IVXE 4PS7A 2HLAA 4APQC 5HYJD 4TSCH 4HUWA 1QWHA 1F6AA 1NCAL 1J8HD 2EE9A 3WAJA 4IOFC 4HF5H 2QADB 5DTFA 1O75A 4V33A 5AYTA 2D31A 1FL5A 5DVMA 3UX9B 4L4VD 4ZW7A 1IC4H 3GRWH 4R97C 5CXPA 4FZ8L 2YJQA 5CGYD 2XVLA 4DP6X 1Z66A 3ZK0A 2NCMA 1GAFH 1N64H 3C5XA 4EQ3A 5DLML 3FSZA 1IBYA 4P2OA 1HEJC 3Q2VA 2EAEA 3VMPA 2BOBB 5SWZB 5C3IA 4XO9A 4HV8B 3QVAA 4LIQL 4WCYL 4A7GA 3WV0A 4O2FA 3HC4L 1PAMA 2ILLA 2LQRA 4WFFE 5BVJB 5DMJB 5F9WC 5KYXB 2YPLE 5D2LA 3TNNA 1CZ8H 5CGBA 4PJ8D 2Q20A 3K1DA 3NJVA 3ZL4L 1OAXH 5FDWA 4N2IA 1KTDB 3WKQA 2ZCKL 3GXFA 5D71L 2PN5A 3H55A 1ETZA 2ARJA 5DSCB 3KYNB 1QSZA 2Q3AA 2JKIS 5H2BB 2F53B 1SRDA 5E1AB 1OZTG 1A1NA 3L7EA 2YXVA 2KS0A 4FQHA 4P99A 4Z7WE 3JWNG 5BRQA 4FTDA 4X7FC 1KIQA 3KLAA 3O4OB 4FHJA 5D1XD 5DRZA 1NIBA 2Z93B 2EUXA 2Y7MA 5E6UB 1AGBA 5IB1A 3VI3A 2D3LA 1WK0A 3RWHB 1BQHB 4Y88A 1EDQA 3FTSA 3PS6A 1T2JA 1Q1JL 4ZOBA 1LEGB 3SE8L 1A1OB 2G3ZA 2CIIA 2WXFA 4PRID 4YHZL 4UB0H 1GYCA 3AGVA 4A6YB 1CE1L 3FTWA 4JZJB 1NAKH 2O5YL 4O9HH 1QWUA 1A3RH 5TGBB 4CKQA 3MBED 2KERA 1SBBA 4GRLC 1LWRA 3D9AL 4P57B 5E8PA 5EIQA 1DE4B 3GXTA 1CLZH 1T20A 1WAPA 4XOAA 1JPFA 3QJFA 3MV8E 4LCIL 5EFIB 5GS0H 1CFMA 3OGCA 3PDOB 2CO3A 4DP5X 1F3DH 1KELL 3BMVA 2W9DH 5CLWA 5DF0A 4PWHA 1ETA1 3MRHA 1DO5A 2J6WA 1I1YA 5KVEL 4R7NA 4X6DE 1J5CA 3II3A 2WSKA 3ABZA 4N2CA 2E59A 4LRIA 5DJAA 1JRHH 2VC2L 1WC7B 2N7AA 4P2RD 3CLFL 4NENA 3T8MA 4UM8A 3II2A 2OAAA 2R2BB 3QEUB 3DGDA 5I1EH 4PCKA 3L3IA 2DQFA 2EIDA 2NDGA 1PZBA 4TMPA 3UTOA 4MKTA 2R2HB 2ICWA 4B9GA 3FS9A 3S2CA 5HGDA 4GO6B 1LD9A 5FAAA 4HS3A 2DQEL 5CN3A 3REVB 1YEDB 1M3JA 3EGSB 2HYMA 2F8XC 2R1WA 4A6YH 4DAGL 1KLFB 3AXIA 3OPZH 2FH8A 1A9BB 1OF2A 2IH1B 1S7QB 3WE6B 3RGBA 2BX5A 1I4FA 3CAFA 2CGZA 4F8NA 1DUYB 1EZVY 5DRWA 5CP7B 5DVNA 5BO1L 3DO3A 4YSPA 5D4QA 4MNQE 5DVOA 4LLMA 1ZHLA 3KYMB 1TJMA 4ODUA 1A3QA 1GGCL 3L4WA 1M6OB 5IW1A 1NGQL 3LKQB 1A7PH 2NNFA 4X6BA 1R24B 7FABL 1HSAB 4CA4A 5AKSA 2X70A 5F7WC 1ZV2A 1M7DA 3CVBA 1HHGA 3NRPA 4FFYL 5BJTB 3Q2WA 2IBZY 4FADA 1NBQA 4I0PC 2XOTA 3ARFA 2ESVA 3T04D 4RH4A 1UURA 4NQXA 2Z92B 2ICWJ 4S10A 3U79A 3KHQA 2KZKA 3DXAB 5ACLA 3QDMD 3NUKA 3M46A 3UZEC 4CADA 4NQDA 3ZHLA 2KL6A 4O2CB 1P2CA 1N6UA 3DGGA 5DD1H 1FFOA 4JFEE 4KK8D 2Z9TA 3VYNA 4C54A 1FZOB 5C8JA 1MRCL 3N40P 5EU4B 1DBMH 2HTLC 2CO1A 3BWUC 3VQ2C 3MACL 1KGCD 1NBCA 1D7FA 1TZHB 1E2VA 4ACTA 4XN5A 3FSVA 3T4AC 1ZHBA 3SPVB 4AJYV 2CLRA 1IT9L 1X5XA 4AVKA 3NAAH 1HWHB 1IM3D 4WO4C 4KXZH 4ZUWB 1I3VA 1SOQA 4OKDA 2SODB 3FH7A 3L95A 1ES0A 2PWEA 5GZNC 4ENZA 2NZ1A 5FA3B 4OCRH 3ISRA 1JPTL 3EYSH 4YHOH 1M7IB 2ENPA 2HTKD 3FL7A 4R6UA 3QI9D 3VI4B 3KG5A 4HCRL 1UD6A 3MRCB 1NDTA 2AANA 4AGLA 1JPGB 1S9KC 3TIDB 5IB2B 2DH3A 2H9GA 2JJVA 2V9UA 1ACXA 2YFNA 3PWLA 5H37G 4FQJH 5JDJA 1ZMYA 3WNLA 2OMYA 3MBWA 3MREA 1ANUA 2ENQA 3L7FB 4KMLB 4XXDB 1J86A 3NJNA 1PX8A 2MNUA 4LXFA 1U95A 5E5MA 1VKXA 3DX8B 3VD5A 3CHRA 3UIYA 3GJEA 3PQYD 3IU4H 2V8LA 1CLCA 3L5WB 2C9AA 1XF5A 3FNKA 3DPBB 5LGYA 2O61B 5E8EA 1HINL 2N59A 5CSZB 1EGJH 1RJYA 2C4FT 3IAGC 5DGRA 3CFIC 4HUVA 3DUSA 1JERA 1XBDA 5C0AD 3WEOA 2J56A 3GJFK 4XP1L 4G9DA 3CFDB 3EO9L 2F8VA 5IV2B 3QT2A 3VU1A 3ZOAA 2H26B 5F3BA 2YWZA 3CCHA 4OIAA 3HZKB 3ZQ9A 2DQIL 4ZMOA 4FI7A 1EJOL 2C4FU 2CXKA 4PJIB 4R0LC 1YZZA 4HHAA 4JFUA 2ZT9C 3AITA 4RFNC 1BWMA 1KEML 4XNZB 1YEKL 4DGYL 2VDNL 1YYMH 4BYHA 2OK0H 3OXRA 2IO5A 1CGSH 3BFOA 3M86A 4AJVA 1MW3A 4Q6IA 1JFQL 1S5HA 2LT9A 2G9HA 4GG6E 4MA1B 4BKSC 3DO7B 1JV5B 5SWQB 4QRUA 2AVGA 2RFXA 1CFSA 2VXVL 3GMNA 1G7HA 4TSBH 4TUOA 5JPNB 4G72B 4PJ7F 1ZLVK 2IDUA 2XV6B 3S7GA 4DGIL 1AXSB 1MWOA 5BXFB 4K8RH 5KTEL 1G4RA 1MXGA 2RD0A 1YEIL 4ZAKC 3D33A 1YC8A 2HJLB 4I3SL 3IDYC 1TIUA 2EDWA 4IHBA 5BW7A 2AQ2A 1U3HA 2WUBH 4R2GC 2A1WL 4L3EE 1ZLWH 2ZICA 1Y1UA 5C9KA 4FMVA 4LLVB 1H0DB 5DQ9A 3P0GB 1GOHA 5KUMA 4N8VA 4Q9BA 4HIJA 1F2QA 32C2A 1B6DA 3I74A 4HMDA 1RZ8B 1KXQA 1SEQL 1BBJA 3KAAA 1V54B 4M6OL 3BSGA 3V0VA 4M43H 1KT2B 2F5AH 3KYKL 5BZDA 3EJJX 1FDLL 1MUJA 3MRMA 2CA4A 1I3UA 1IAIL 2RBLA 3KHOA 4ODVL 2VZVA 3ZQWA 3EYFB 1A6TA 1Q72L 1A7QH 2R0LH 4ENED 3NEOA 1IKOP 1CXIA 5I9QC 4AUUA 4W9KC 1L0XA 3QJRB 2JCCE 3EOAA 4Y4HC 4YDIH 2XTSA 5E8DH 3KPSD 3T77A 4AKQA 4DHLA 3BJLA 3SJVB 1LWHA 4PV8A 3GSWB 5D7EA 1JDDA 1F11B 5GS1C 2LOEA 4MAYA 2B3IA 3PU7A 4LCWB 3ELQA 3SGKA 2PNDA 5E00B 1OSZB 1JNLH 4ZNCD 4P9HL 4XPBL 1P9MA 1C08A 1QP1A 1UKTA 4MCMA 5D2NA 5JHBA 2OYKA 1OQOA 1HU8A 1CTOA 1KBBA 1YY9C 3RFZB 3TWCL 3ZT5A 5FOBB 3PV7A 3ZGHA 1SFDA 4FA6A 2VLLA 4EIZC 4J3TA 2OMTB 3P2DA 1NGPH 4ZMYA 5IVXB 3W5MA 3VFMA 1RAMA 1C1EH 3ZE2E 1MHCA 2YEQA 3BLBA 2G0KA 2GJZB 1X4YA 2L7EA 4FQXA 1NGWB 3EJPA 2GTQA 3FW6A 3VXSD 2WVUA 3RKDC 4P23B 4IRSB 3HHSA 3DV4B 1PKQA 1VACB 1B6UA 4UQ3A 1RK0B 1GA2A 3SDAD 2D2OA 1XB8A 2ZJSL 3WE1A 1L7TL 2FE0A 3VAEA 3EJQA 3V9FA 2B16A 4UTAH 4LEXL 4MDJB 4R4FH 3U30C 1MCWW 3CC1A 4GW4B 2VUYA 3KL5A 5FO7B 1OWWA 3U46A 3RAJH 3UC0H 2R7EA 2JE8A 4IBWA 5T1KA 3WTTA 3HZYB 3BPOC 5JIPA 3TBSB 1DLFH 2BP8A 2YPLB 2PR9A 1RQ5A 3IFNL 3LN5A 3HMXA 3O6FA 3X13A 1JWSA 4G8IA 3Q9QA 1X5GA 2WBWB 4PP1C 5SV4A 5H94A 3AREC 1F8TL 4I5BB 1LO3H 4P9HC 4XVJL 2YAOA 1JCKA 1TXKA 3BIBX 4KKNA 2CGYA 3KLKA 5D5MA 5DEFA 2VXQA 3LH8A 4UU9A 1ZA6B 3FO9B 4UQBA 4EKXA 1A2YB 4Y7OC 3D52A 3OMNB 3PAYA 3INOA 1AXIB 1DZ0A 4AYSA 4EF3A 4Z7WB 5AD0A 2B1AL 5D7LE 1FFRA 1XSOA 1ROCA 3F05A 4OZHF 1ASOA 3D0LA 2NXZC 4OY9A 4OM0H 1TQUA 1T4KB 4CRPA 4U6XB 4YZWA 5CEZD 1DLHB 3DHPA 2VKWA 3DMMB 4WJ5A 4QD2E 4ZXBB 5INCA 3ZYZA 1O7DC 2BSED 4XNQA 5K9KA 5J06A 4X5WA 1E5CA 5KW9L 2ADGA 3O2DA 2NY6C 3JBG7 4DW2L 2QT6A 4YX2H 2WVVB 3WNKA 4QRQB 5EH1A 3MV8B 1YNKL 1NUDA 4D9QD 1G7LB 3LKSA 5DEZA 4ISVB 5ADOL 4LGRB 4UV4L 4FQIL 4WEUD 3PABA 4Z5RA 2HFEB 4X6DB 2GIMA 1BGXL 4H8WL 4NP4L 5ITFA 4JDZA 4RMRA 1I8UA 3ILQD 2BIIA 2X2JA 3C75A 4PJ9D 2C3VB 3T8XA 3V2AR 1K6QL 3ROLA 4DFIA 1XEUA 4WW2C 1MJJA 4B0MB 5HDOA 4TRPL 3LRLA 4XMLL 2AJVL 2HFTA 3BCDA 4MX7A 4PJCF 2ZKYA 1D2PA 5AZEH 1K4CA 1QNZL 1HYSC 1MELA 1I8IA 4F7TB 5GGQH 1KYOJ 1RLBA 1U4FA 2J55A 3S35H 2X12A 2AS5M 2X6MA 1JXFA 3BUQA 2PWHA 4IJ3C 1HOCB 1N4XL 5ID1A 4FXLA 1C5BL 2A77H 2V37A 3TBWA 3GSXA 1FORL 1KJ3H 4YJZL 2R29H 4WHTB 3WIIH 5FFLA 3WXVH 2MSPA 5PCYA 4JDVB 5HYQB 3R1GL 3US1A 3STZB 2Y0SA 3TFKD 5IEHA 3G6JF 2GY7B 3U4AA 2HG0A 4MNGA 5F3FA 5I8CB 4MNQB 4G1MA 3O41B 4M9OA 4NKIH 4A1RA 4FQLH 2DLIA 1NFIA 3QA3A 3S3CB 4YHLH 2VYRE 3OM3B 4FZEH 2HLEB 4LOVA 2QQKH 2GK0B 3FO0H 1QFUH 1Q0EA 1HXMA 4DPAX 2YUXA 4FHBD 4M03A 3TO4C 4I89A 4ONHA 1S9YA 4GW1B 2ITDB 4HIXH 1ZSDB 3BC9A 5DWPA 4FXGA 1IVLA 4LEEA 2WUCL 3AXLA 2F68X 4H8WC 4XP5L 1BF5A 3CBJB 5C0RL 4P2OD 1R46A 3HAEA 5AOMA 2DQDL 2QV4A 1CD0A 4PGBA 1NMBH 3RVXD 4WV1C 4YXKL 1CFQB 3T0BA 2WJ5A 1UASA 4GKSB 5KBMA 1V7NL 1AZVA 2X4QA 4IOIA 3VGEA 4DN3H 3DSNA 4I18A 4HF5L 4UDTB 3LNGA 3B83A 4TL5A 3RB7A 4DVBA 1T0MA 4HGWA 4YSSA 5IMMA 3AAZB 3C2AH 4XVTH 2G3XA 4PRAB 1B4RA 1PZ5B 1IC4L 2R2EB 3GRWL 4XB8A 4N0UE 4LSDA 5CEXA 1AQDA 1FHNA 4OCWL 3H7LA 3TM6A 1A6PA 1TYEB 4M61A 1MHHA 1GAFL 1N64L 4JE4B 4B5ZA 3GMMB 1MI5D 1XGQB 3IRZA 4NC1C 4MMXB 1MF2L 1I1FB 4XWGH 2HT4D 4D7BA 4F2FA 2ZAHA 2XZCH 1MPAH 3QBTB 2K6WA 5LAXA 4B5EA 2OMBA 4IKJA 4GW5A 4KROD 1U2YA 3SGJC 3HHMA 3IDJA 4UT9L 1RVFL 3HI1A 2OJEB 5KSVB 1JN6B 3J7HA 4OLVL 1N19A 3RDTB 4HQQL 2Z1PA 3BKCH 4HCIA 1ACYL 3VFUA 4JVUA 3RG1C 3DRQB 2IAMB 1BVNT 3BUYB 3RU8H 1OAXL 1RK1A 2J88L 2VH5L 4OSUL 3E0GA 5DI8A 5KS9F 2AQRA 1GOFA 1C16B 3B56A 1Q9WA 4H25A 3RWFB 1JNJA 1SY6A 2DIEA 2G2RB 1CD1B 3JXAA 5KG9B 4K7FA 3IJEA 1NL0L 2H0FA 3VWJB 4BE5A 1XGTA 5TH2A 3PV6A 2EEAA 3AQDA 3FH5A 3MVSA 5TF0A 1ZVYA 2G3NA 5DHVB 4ZSOE 4XO3A 3NJMA 1WP6A 1FJ1A 1G7IA 3MRIB 4FXKC 2G60L 2UZYB 4X80H 4FNUA 2FR4A 4RMWA 5HGAA 3T6ZA 1PF3A 2F74A 2VZ1A 4IOSA 5IK3A 1QAWA 4O9HL 3GMPB 2FQDA 4ZFZB 1AOHA 2BJML 3GGWB 4HYTB 1NCIA 1IGIH 2YIHA 4JPIB 1FO0B 1KPUA 1YN6A 4XXCA 5HBBA 5DYOA 4ODSL 5K9QG 5CEYA 4CSZA 3K5RA 1DJHA 3LS5H 5SX4I 5GS0L 1NGXB 2Y9RT 4K3EL 4O00A 4PV9B 4KPHL 2DMBA 5JNYA 1TENA 2W9DL 4P4KC 2V5SA 3MRKA 1NCJA 4XXWC 3BVVA 2WQ8A 3B5GA 4HEPG 1BVKA 5EN2A 5FYJU 1LK2B 3LCYA 4K94H 4PJDE 4DTGH 4QOKE 3PWJA 3RY6A 1MWAL 2XTJC 2FX8H 1JRHL 1R3JB 2A7BA 1Z2KA 4RAUB 4MXQD 4BWTA 3IPEA 4ZRGA 3FB5A 4Z7VF 4JO5A 1RUKH 1TZ8A 3MOAH 2WZ0A 3F83A 1N6QH 3NFNA 3F6LA 3VXOA 4GG6B 1MXDA 2VCOA 1R3LA 4QY8B 5DHVH 1LM8V 4OB5H 5JQHC 1UOVA 4JQXC 5J11B 4GT7A 5F7EH 4ZQKA 1RZQA 1VFBA 3VFNA 1WE5A 3TVMB 2WBKA 3WTUA 2EVJA 3TFBA 2HSIA 4OF8A 2X0UA 2QADC 5ANMA 3VXNB 3OPZL 4F7CA 5BNXD 3BWUF 3UBXG 3ARFD 2ESVD 4L3EB 1FF5A 4KK9D 4X83A 4S1DC 3DRTB 1LP9F 1WIOA 1FO0H 3DDGA 4MWFB 1PZDA 1BVZA 4TUKL 4NQDD 3L6FA 3SODB 4CC4A 1JGLH 5IHZA 1KB5L 3DURB 5EO9B 1PAZA 4X99A 2YD3A 4JFHE 3ZSSA 3UTSE 1FWXA 1A7PL 5MERA 3FT2A 4U6TA 1S7VB 1VHPA 2YD2A 3L5IA 3IJHB 2Q86A 5GS0C 1AD0B 1WBYB 4AQAB 1SDDA 3FOMA 4MRCA 2GYSA 4J6IA 4DKFH 4NFBA 4BZ2A 5D7IA 2JCCB 2JB6A 5C09A 4J3VA 4P5SA 1TEYA 1PJWA 5GGSB 1HH6B 1BD2E 4N85A 1IAOB 3WEAA 3ML9A 2K0RA 1OK8A 4EUPA 1NOFA 2PW1A 5DUML 5DMIH 4UM9B 3OLIA 5DD1L 3I6GA 4P46B 3U7YH 2Z1KA 2EH8L 4BEIA 4JM2C 4MCYB 3UXFA 5GS3A 3CDFA 3MZGB 3FRPB 3H4HA 4E9XA 3RX8A 1XMEB 3T71A 1G7PA 2VDPB 3VFGH 3L3JB 3H3PH 1DBML 2P8LB 2A4CA 3JYBA 5BUAA 4Q0XH 1MNUL 1ULVA 1I9RH 2Y69B 3QJHA 3C8DA 1EIBA 4DP9X 4HLZG 4HUNB 3WU1A 2VISA 2H8PA 2DY2A 4TYUA 3ZE2B 3B9KA 3D08A 4HCGA 1P4LB 4GAJL 1XCXA 3NAAL 1P7KA 4X9IA 1CFTB 5I1GH 3P1VA 3QO1B 3MU3A 4N5UA 3D50A 5DJ8A 4H13C 1I85A 1M7XA 4YHPA 4OCRL 4F27A 1T03L 1DVXA 3NOIA 1KCBA 2KKQA 3EYSL 5JQ6H 1LE9B 4H7VA 4XO4A 4NZTH 4N2BA 2H2PC 3E80A 2WBJA 2WN3A 3GJFA 3ZL2A 3WTYA 4IRJB 2W9EH 5T3ZD 3UROR 1B2WH 3G7TA 3PIQA 1QEWA 3DIDA 5AW8B 4B9YA 2AGJH 5GGRY 3E2HB 3I02A 5E4EC 4ZUTA 1E5YA 4Y5XA 5IJVB 1AQMA 3B2MA 3CSBA 1AO7A 2CBPA 5I82A 3SBQA 1R47A 3OWEA 2VDPH 4F2MA 3NEXA 2IDSA 3SQBA 5ESAB 2DPKA 4U1NB 3MNDA 2FZ3B 3EYOB 5HHOA 3TT3H 1Q9OB 3FPYA 5D7JB 3SDYL 4P05A 3INUL 2C7FA 3QORB 1N8ZB 1XX9C 4N28A 5D7LB 2VLJE 3R4RA 3QG6A 4PY7A 1B4JL 1T7WA 2FD6H 3DOSB 4QRFA 5GZOC 1D5BA 3HRZB 4J3BA 3DX4A 3PJNA 1DUZB 4NN6B 2UWEF 3VSTA 2F15A 1IUZA 2Y07L 1ZLEA 1CE6A 4F1ZA 1GJUA 4RZKA 1KUMA 1PFCA 3IT8D 4EVNB 2CA3A 3LKRA 1UXSA 1QFWM 1YNTF 3OLDA 3ZT7A 3QNZB 3AGWA 1U3HD 2EICA 3LKNA 5AYQA 5JW5A 1O7SA 1V5JA 1YYML 4YDKL 5E2TH 1M56B 2OK0L 1QBLH 2WTPA 2PW2A 1ZHKB 3H2QA 2JKJA 4LL1A 4PJAF 2DD8H 5L7XH 3VFSB 1Q90A 5IBTL 5H37A 4I1NB 5AAPA 1KJVA 2ZAGA 4ZUVB 2DWDB 5I0WA 4NHCH 1H6EA 5FGBC 4GKLA 4P3CL 5I1AA 1N7MH 4CW1A 3ZUCA 1LO0L 1XGPA 5I0VA 3WHXA 3P3TA 1K5WA 1P4IH 4PJBF 4HAGA 4IU2A 5DZAA 4G8FB 4LLUA 1KTJA 3TNMA 3X12A 1OM3H 4QHUA 4K7PX 3P0VH 2EZ0D 2DEXX 3CQFA 4KKBD 4Y9GA 4R26H 5A2FA 4LNRB 3S5ZA 1TETH 4L37A 3BO8A 5EZIH 4D0DB 3BH8B 3GBMH 3NIGF 4KITB 4DKEH 4RAVB 1U3YA 3ZL1A 1FCCA 2LTQB 4IKKA 5I1HH 4MAYD 1D6VH 4X5XB 3K81A 3D3VD 3UG3A 3W11C 4BWWA 2AJZA 2F7RA 2Y36L 3IB4A 4NN7C 3RGVA 4M43L 3QXDA 3QQ9C 4YO0A 2F5AL 1KGIA 4NM8L 2BP0B 3V0HA 4M4RA 3TCTA 4OQTL 4MTMA 1M1XA 4M8VA 4R7LA 2YBGA 4LF3B 1IGFH 1A7QL 1JWMA 4XH2B 1WISA 4PM1A 5I17A 3RUGA 4YDIL 5E8DL 2YRPA 3FU9A 2YA0A 3O45A 3KPTA 1AHWA 2BINA 3PXLA 4PGDB 4XMXA 6PAZA 4OFPA 1SF5A 2B8OT 3BWAB 5I1CH 2KI6A 4FQXD 4G7RB 1HZHL 1DVUA 5HVGB 1C12A 3SKNA 1XF4B 2LE9A 4HOWA 1ET8A 1JNLL 1HILA 5IBUB 1UZ6E 2HRLA 4L9LC 1E4KA 4JM4H 1CI3M 3DOHA 3J2PA 2HJFB 4Z1PA 1MLCB 3GMOB 3TIEB 5GRZA 5FM5O 1H5BA 3NACH 3ZKXB 2ZXQA 4NWTH 5C1MB 4XAKD 1C1EL 1JP5A 5T1KD 1RUQH 3UJJL 3KPNB 3BUIA 3G5YB 4X4ME 2WANA 5KSBE 1W91A 3O6FD 1J8SA 2R1YB 1J9SA 1H3UA 4GP4B 3OX8B 4GFXA 4XMPH 3U2JA 5AYUH 3BIKB 3BAEH 6PCYA 4N0UB 3CVHB 3KCPA 2FX9H 1FLTX 3FYEB 5KVDL 1EK3A 4FQ1L 4R4BA 3LEXA 1B0IA 3QQ3B 2FJGA 1NIFA 3HKFA 3QIWD 4G6AD 4XNZC 1QR1A 2K1MA 2I07A 1S9XB 3RAJL 3L08A 5KOVC 1OIOA 2KDGA 2QR0A 3P30H 4MLSA 4NRXB 3THMH 3AW5A 3AXHA 4EI6B 2X4RA 1BFVH 3GSUB 1BG1A 2VR7A 4LDOB 3QUYB 1DLFL 1WHOA 5FUZH 3X14A 2LU5A 1A5FH 4YQXH 3V5HB 1TTUA 5KVFE 2XBZA 3BHBA 3GMQB 1WEJH 5I8KH 1E43A 1LO3L 4GI8A 3CVDA 2QZQA 2EXSA 3FU7B 4X4YA 3GINA 4WW2F 5E94B 3RPIA 2PYEA 1A1MA 4WEBH 3AG3B 1UD2A 2BS8A 2IGLA 5IB5B 4L8DA 1ZT1B 2EP6A 4PB9H 2EDHA 2Y7LA 1NWPA 4ZSOB 1TCMA 4PJ8B 3G5VB 3QCTH 4AEHH 4OM0L 1H8OA 4DP0X 1FHGA 2XDHA 3EF4A 4MJ6B 3GZQA 1NFDF 4E9VA 5B38G 3V4VB 2MHAB 3CMOH 4J12A 4RZCA 4ZFOA 3CVHH 2PXYA 3B5HA 1F58H 4X7TB 1HX0A 1BZDA 4J3OH 4KH2A 1E5ZA 1R3KB 4YX2L 4MXVE 4QGTA 3T65B 3WGVB 1MDTA 5AVQB 4N2MA 1ILUA 3AS3A 3LD8C 5D1ZA 2RB8A 3S36L 3D85A 4IU3B 3LH2L 2J8UF 1QZ1A 3UTTA 3ZQXA 4N6RB 4JJ5B 4PJDB 3AB0B 4QOKB 1WAEA 3MBEB 3VGAC 1QR4A 4BELD 3P4NB 3VQLA 2CLVA 4MA3A 4JO3H 5AQ0A 3T3MF 4OGYH 2P7TB 3MLYL 1GW6A 1GYWA 1N67A 4X6CF 1KJ2A 3N1FC 3WN5B 1FVDB 4U1GB 4N0FB 5AZEL 2NW3B 2PUQT 1JGUL 2VRKA 1NLDH 2A83A 2XFGB 4CMMA 3E9UA 1P4BH 1YDPA 3IYLW 5E03A 1E28B 4O02A 3JWDH 2JXMA 2YEZA 5I15H 2A77L 1XZ0B 3HNVL 1GPOH 2UX6A 3V4VH 5ID0A 1KJ3L 5F1IB 3HE6B 4EN3B 1QQDA 4ORGA 3V6ZB 3WIIL 1UGNA 7PCYA 5D8JH 2YKKA 1UCBH 2D9QB 4R5TA 3SDDC 2NY7L 3QDGA 1N6VA 4ANVA 4YR6B 3Q6FA 4JFOA 3ZX1A 1HNYA 2BNRD 1KGYE 5JW4M 4NKIL 2J1KA 4FQLL 3G5XA 4NT6A 1G7JA 4YHLL 2ZOLA 4JGMA 4FZEL 4KJYB 1COBA 1MCCA 1YMME 3GS4A 4H4NA 3UTSB 2Z91A 3FO0L 2DM4A 1WTLA 4K71C 1EUUA 2ZXAA 1LK3H 4BQCA 3W5NA 5A16B 4PJHA 2NT1A 2Z7WA 5LB1A 3EOYG 4HIXL 1IQDA 3NN8A 2IWGA 5DFAA 5GGVL 1X5IA 3O11B 1BFSA 2DIBA 5AVWB 4ATWA 3WFHB 2WLLA 3HZMB 2QLYA 3QUZA 4Y9BA 1BD2B 1QFPA 1NMBL 1T6BX 3OMAB 4QLRA 5JOPE 1J0HA 1KWGA 2OMWB 3MLXL 2WWMD 4DZ8A 2OULB 4IGBA 4JY4A 4F9PC 4WO0A 1G9HA 4L0YA 2X53A 2XQYK 2AJSH 4G6KH 4PJFE 5EUKB 4PJGE 1ZT4A 5DR5L 1HH9A 2I9TB 3KPMA 2WTRB 4TTDD 1YYLH 4LRNL 4ZBJA 2X5PA 5HHVH 4A7UA 2NY3D 2N0MA 3N5AA 3T0EC 3PLYA 5HHME 1T83A 4WNQB 3QG7H 4J4PA 5HYFA 1KLGA 1GS7A 1OAKH 3JV0A 5I18L 2DL9A 2MQ0A 3JV6A 3TX4A 4OJFL 2OXHB 5T5FH 3JVGC 1BEXA 2AJ3A 4BXSV 1MCJA 3RWGA 3QZMA 4ELMF 5CUSH 3VE0A 4EDXB 2DQJH 5B1CA 4ZMPA 1CK0H 1IRAY 2Q2EB 2CO6B 3GXIA 5ICXB 2P5WA 4NRZB 4AZ8A 3VG9C 4IOSD 4G70B 3L8QA 4JKLA 1T04A 1WFOA 4OZGF 3RU8L 5EBGA 3TXAA 4PIBA 4AJWA 4HH9A 1U8MA 5C97A 5HPOA 1T2QL 1JRHI 3OKEB 5GGVY 3OKKA 3UTQA 3A6BH 2HMIC 5A2JH 3W57A 5IG7A 3GEWB 2C4XA 3O4LE 5HHPA 1CLYH 5FPIA 1SXCA 2AKRA 3UAEA 1XIWA 2NNAA 5I1JH 5HY9A 5IBLC 3LJ3A 3ZDYE 4X80L 5IMOB 4QHKI 3N44B 2APBA 2OI9C 4XN2A 4I2XE 2C3XA 2JJWA 4E9YA 4F37K 3BFWA 4W9FC 3RE0A 3IF1A 3ZU8A 1ORQA 2SEBB 5IB3B 3QCUH 4GAAA 2HB0A 2VLJB 4OT1L 1S4IA 3BH9A 5C92A 3MNWB 2QHLA 4Y2OB 8CGTA 1O6VA 3KGSA 3BP5B 2G5BB 4MS8D 4PI2A 4QTFA 3CFKB 2DTMH 3IDMB 3I75B 3JUYA 3LS5L 3NZHL 5IVOA 4MSWB 4JCWA 2GFBA 3FHQA 4KJQC 2VTFA 4HVBA 2CJTA 3GHEL 4IMKA 4Y4KA 3DBXB 3W38A 3CBRA 2QFRA 3RTQB 4X6EA 1EO8L 3FQUA 4Z7NE 3SQRA 4LPYA 4WTZG 1G1KA 3DK0A 5ACMA 3W81A 1OQXA 2J2ZA 3TEXA 4HWZB 5HGBA 1FNSH 5EA0L 3P77B 3R06A 3BQVA 4LGPB 5EZOH 3MOAL 1N6QL 1HWGB 3RRQA 1U93A 1JV2B 4WEEA 1TQCC 1T1ZA 1EZSA 3BD3A 4OB5L 2UXTA 3GSRB 3GZPA 1MCWM 3CU7A 5F7EL 1VJSA 4JM2F 2OFQA 2NYYC 2F7QA 3WS3A 2JCWA 4LDLB 5CWSA 1UOLA 4W9JC 4PP2A 1YCSA 1UVQA 1TVHA 3KEDA 4HMCA 4WRLA 1RPKA 4Z3IA 4TNEA 1WO2A 5C09D 2X1PA 4OCXH 4F58H 3D25A 2BSTA 2X6UA 3FQ1A 2M2DA 4HJJH 1FO0L 4R7XA 4UAOC 1H8SA 2YBRB 4AUJA 1XTMA 2HX7A 3OAUH 4HZLA 1A4KA 1B0GA 3IKCB 4UCFA 4KXZI 3MXVH 3P2TA 1S7RB 4BH8B 4U7MA 1HTYA 1OAJA 4URTB 3TBYA 4NB7A 4MDIB 5DFVD 1KMGA 1AR1D 3H6AA 4PJEE 5E4IA 1F41A 5KYWA 3RDTC 4DKFL 5T1JA 2UXVA 3BKMH 1FFPA 4UNVA 3GIZL 3B9KD 4HWBA 4U1JA 2IH8A 3RL2A 3MLTB 3PWUA 4M1CC 3QPKA 2X4NB 3DX1A 1O9WA 4YHKH 1A9VA 4M8UA 1KPRB 1H19A 3MRGA 4OLWH 3U7YL 1JHLL 5BZWB 3VWJC 4TUUA 2C9QA 1IEAA 3N9GH 2X2IA 4MD4A 4NOFA 1U92B 2AZAA 5I5MA 1NM4A 4B6ZA 5I76A 5ICYB 2UY6B 1A8JH 3MV9E 4NKOB 4EZJA 3NJFA 2WBJD 4KKZA 3AM8A 1PIFA 4Q0XL 2C1PB 2J6EH 2PCPB 1I9RL 1NM9A 4DVRH 1EAOA 3QQDA 4H2AA 3UBXA 3MNVA 5I1KL 5G5DB 2DMHA 3L16A 4HD5A 4KNUA 5AVVB 4V1DA 4HUUB 3VQMA 2OTWB 3C60B 1PD0A 1G9NH 2ZZUT 4U1KB 3A4EA 4JHBA 2R27A 5J1AB 5KSBB 3T3PF 4ETQB 1AO7D 2R23B 3HNTH 2DV6A 3CFJA 3PHQA 3HPLA 2OCCB 5IROA 2H5UA 2B3RA 2ED8A 3FHEA 1N0XH 2AF2A 1Z0MA 2PCFB 3DYMA 4JRXE 1NUNB 3SCMC 5HHOD 2IDTA 5EB9A 4HDIA 2HPTA 1KNOB 3B3BA 4JAMB 1YN7A 4XBEH 5IUCA 4GQ9H 1X5LA 2DM2A 1FFNB 2EE3A 1B2WL 4WU5B 2R69H 3FT3B 3MI6A 5B39G 4NKQB 2AGJL 3TBTB 2EDQA 5DS1A 2YKLH 2GK2A 5F0JB 3FCBA 1BOGA 4LPVA 3RNQA 1FA4A 2CCWA 4Q6YA 4BE6A 1MCPH 1TJIL 1GZPB 4X5QA 4N0YH 4WW1B 1JZ5A 1BJ8A 4KRPD 1SEBB 3UABA 4EXPX 3N3EA 3Q3GA 1G6RH 5IM7B 1RHHA 1RZFH 3MUGA 4KKAC 4KY2A 4G82A 1ILSA 3GLZA 3K7UA 3RBSA 2H2SC 3TT3L 3TVMC 2EDTA 4QXWA 5JDSB 1IGTB 4YXLH 2EUZA 2J8OA 4JFXB 4UV7L 1PDKB 2EDXA 3PUUA 4A7SA 5L2JB 3K6NA 3TYFA 5AB2A 5CD3B 4NO2A 4TVSa 4HALA 2YO3A 3GF8A 4GY4A 1X7SA 4LE8A 3OJMB 1A9EA 4HIEB 3BOVA 3MGOB 5EF2A 2D7TL 4G1EA 2GEEA 3NFPB 1UB6A 2NOYA 1KZQA 3LXCA 3GMRB 2BW4A 1KCUH 4Y2DB 1J9RA 5L4IA 2OX5B 5AFAA 2O5XL 4U1SA 2ZUSA 2DJ4A 2YSTA 1G5AA 3DIVA 1Z3RA 2NCEA 3V9CA 5K9OB 4ELKB 5E2TL 4FA8A 5I8EA 4FQ2L 2DD8L 5L7XL 3IBEA 3OBAA 3QQXA 1ZA3A 1SLXA 1NDGB 1UC6A 3EHBC 1BYPA 4PPTA 1N7ML 3CUPB 4GEIA 1KBPA 4YC2C 5KUKA 2X05A 3H2WA 3RGVD 4ZJ9A 1FPTH 1F90H 4XI5C 2NX5A 2BO0A 2AXWA 4EO5A 4HT1H 5KVFH 4W9LC 1OM3L 4JX0A 4P46C 4F7PA 3WMQA 3HS0B 1AHMA 1XMWA 4LARL 1TETL 3MUHL 4ZX5A 3V0WL 4CSSA 2C3GA 3WYRA 3DSFH 5EZIL 1GSKA 3GBML 1A6WH 2H3KA 1AFVH 4DKEL 2P26A 2VR8A 2Y5TA 3N55A 4HBCH 3TN0D 1EDYA 3VWKB 5I1HL 5DRXA 4BZ1A 1D6VL 2UYLA 1ADWA 3BX7C 4RQQB 3BZFA 4XPGH 1KOAA 5PAZA 1E8ZA 3S4SA 2FNBA 4NFCA 4ZX4A 2BVOB 2PR4H 2P80A 3M7FB 4QRRD 4BUQA 4X0NA 3V5KB 4YDLB 3SDCA 1I1AA 4XBMA 1IGFL 3HI6H 2VR5A 2YAPA 2ZF8A 3DUUA 2VITA 4NZRH 4ZOAA 3IGFA 2VUOA 4FS0A 4NQUA 2HVJB 4IRJC 3BZEB 4WNSA 2AQ1A 4XCFH 1YMMB 4Y16A 4YFDB 3V7MA 5I1CL 2DN7A 1JTOA 5D2NE 1MVUB 4PG2A 3E2HC 1I8MA 3BVNA 3IAQA 3QZPA 4YNYA 1XF2B 1DCLA 4ZI8A 3EOTH 1ROWA 4BV1A 5AVUB 3G6AB 4NUGH 4L18A 3NPSC 3O3DB 2PWFA 3W0WE 4CNIA 3FQRA 2W94A 3TA3C 3KPPA 1PY4A 1BXXA 4HUWB 3VQ1C 5A2BA 1QKZH 5INDB 3NACL 2GEQA 5DTFB 2LU3A 2XZAL 2WLJA 4NWTL 4OKVA 4MYWB 1X5MA 2VDKB 3HCVA 2VZTA 1I7UA 2ZG1A 4Z76A 4PJFB 2ITEA 1OSEA 4PJGB 4FQPA 3WJJC 1AZNA 2VAJA 5DA4A 5E8OB 1OLZA 5BS0E 3BAEL 3OL2A 1ID2A 4KQ3H 5HHMB 1RY7B 1D7DA 2FX9L 2C26A 1INQB 1UKSA 3BZ5A 3SBPA 1L3NA 1BFOA 4JL1A 3ETSA 3ZZSA 4KFMA 4X4ZA 3WJLC 3O2VH 3ESVF 2E7LA 2CD0A 3PUCA 3B7YA 2L4OA 2M8XA 4LEOB 4B9JA 1MRFL 4OLUH 3HLAB 3P30L 3THML 2XNAA 3TPUB 5BQ7B 5FDWB 1BFVL 1N2RB 3QWOA 1VGEL 2VR9A 4O58H 1A5FL 3BQUB 4YQXL 4NUQA 1N59B 3ULUD 2PXYD 2VMEA 1SYSB 4XHQA 1HS6A 4I9WD 1A1NB 3H9ZA 3Q0HA 4NNXA 3RWJB 1WEJL 4MKMA 5ECGA 1BIHA 4PTUB 3P54A 4Y4FC 5CGTA 4I0CC 4D94A 1WUZA 4HH8A 3EGXB 3PF2A 2X41A 3NZSA 5AZUA 5EIVA 3T2PA 5IB1B 3K71B 3CFCH 3O4LB 3H9HB 1B9ZA 1KCKA 3S34L 4POZC 5IFAL 2X89A 2WLNA 2VDKH 5D1ZD 2B14A 1NC4A 3D85D 4WKZA 5JO5A 2PP8A 1OANA 2LTQC 3QCTL 3UTTD 1I31A 5IGXH 3ZDYB 1ITCA 1U8QB 4AEHL 1I7RB 5IVXF 2PYFA 1O9ZA 2DQUH 1T89C 3MYJB 1M3IA 1KB3A 2HFGL 3ILDA 5E8PB 4I2XB 3W3BA 1Z32X 1T20B 1QMUA 4KK6C 3O6ML 4Z9KB 1JF1B 2WNGA 3M1BA 3VFTB 3VXUE 2FUTA 3CHQA 3QJFB 3LYRA 1IGYA 4D9LH 2YQBA 4PBDA 2XVGA 3NK3A 4PLKD 2Y7NA 3BGMB 5TQ2H 4CVZA 2A6DA 3I85A 4R7NB 5JXEA 4AGMA 1TVBA 1MOEA 5DJAB 2ROYA 3MA7B 3U0WH 3I2CH 2QBWA 3C8KA 3TJEH 3FH8A 3I9AA 1BIIA 3SE6A 1AS8A 2DJMA 1LE5A 3L3IB 1FYTE 4Z7NB 1X7QB 4X4XA 1BXVA 2OMXA 1A7NH 1VB9A 3QDGD 5DC9B 1WWAX 2ICEA 3SBWA 1TZGH 4RLDA 1T5XB 3FN9A 4X98A 4NSKB 2E76C 4P4RA 3WO3B 3FN0L 4GMSH 1B0RB 3KYOA 3MN8A 5I24A 4H8PA 3ZKXC 5DT1L 4DP4X 3JWDL 2OJZH 4DQOH 3P9LA 1I4FB 1IL1A 1GPOL 1SVCP 3HJEA 4OCSH 3V4VL 2NY2B 3NMEA 4MJHA 4RFEA 1K2DA 3ARGA 2ADFH 3MJWA 1Q0YH 1WS8A 4IK6A 3QQ4A 1BHGA 1BXUA 4HAFA 3FMGH 1LNUA 4QIRA 3QUZD 3AG2B 9CGTA 3S88H 1X6LA 3X1FA 2XQYA 1MHEA 3E6HB 4U1IA 4XVUD 2X70B 1Q94B 1F45A 5F7MC 2VR6A 2E27H 5JPMB 4QRSA 3T0XA 3C2SA 2UZIH 3IJ8A 4G8AC 1NGYA 1BLNB 5E08H 5D9SA 1B2YA 2WXMA 4NQXB 4PJEB 3FTGB 1OGSA 5CGYC 4N25A 4CADB 2AHIA 4GSDH 3BP7A 3EBIA 4X6DF 3DGGB 5A6IA 1FFOB 4NZDA 1JK8B 3MKGA 3MRLB 4ECNA 3GKWH 3O2WH 1OCWH 2X3CA 2O30A 3GT6A 4GQRA 4MJIE 4HPOH 4A2LA 4NZJA 1E67A 2P5WD 1ACCA 2AJSL 3DHMA 3WUWG 4GT0A 3HE7A 3MV9B 1ZHBB 4A67A 2G5RA 4PJ8C 3HJ0A 4EI5B 1J9CT 1HDMA 3JWDC 4K07A 3EXJA 2GY5A 2GIXA 4KDWA 3V0GA 2ADJA 4BBWA 4ZMVA 3BPNB 4HLZH 3L95B 1ES0B 3QG7L 2DQCH 1OAKL 3MMEA 4GG8A 4BQBA 1CB4A 1WQVT 5I6KA 3EYVB 5AOJA 5SWSE 2DMKA 5HVHB 4AJ0A 1XIWD 3GBEA 2J44A 1CK0L 1GMEA 1HXYA 2CO7A 5CSGA 5DVLA 5JORA 2KBGA 4JRXB 4U7KA 4XCEB 5D7KD 4E9QA 1TO4A 2IIJA 5KOMC 2C1OA 3FTZA 3P3UA 4DWHA 3PWLB 1KYUA 3LIUA 2OMYB 3MBWB 2R0WL 3MREB 3ZJAA 5C0EA 3B3IB 3T6XA 1UZGA 5J1SC 3AB0C 3MBEC 4PVLA 1OW0A 3UYPB 3WIHL 4IBUA 4OI8A 3LN4A 4LSPL 2IPUK 3A6BL 4KI5D 5KSAD 4MA7H 4A2DA 1EAPA 3GJEB 1CLYL 3WN5C 1J1XH 4H2CA 2R4RH 3HG0A 5JTWA 1KEGH 1JL8A 1N5AB 4HK0A 4HLJA 3BUBA 1RFDL 5E8EB 5HDQL 3MV7A 1WV7T 2EIMB 5ESVA 5I1JL 3H0TA 5J3HD 5C71A 3NCCB 1HL5A 1TPXC 2OKMA 3MJ9H 2GHZA 3QARA 4G80A 5FV1L 3ABLB 5GJTL 4CMHB 4AK2A 2Z7UA 4GIAA 1D9KD 3NCMA 2H0PA 3QULB 5CCKH 3CCHB 3D4CA 4ZK8A 1GR7A 3OKOA 1MJUH 2FO1A 4XBGB 1BP3B 1NCBH 3VXPA 1INDL 3VD9A 1W15A 3QS3A 2FSEA 2PTVA 4QCIA 2DTML 3D30A 3FFCE 2FQGA 3VGFA 3TWYA 4ONGH 4HOMA 4HMEA 4M1GH 1UD4A 1E40A 1FBIL 2AI0H 4L4TE 4ZMAT 4JPSA 4GP5B 5EU5A 4ODHH 2UZXA 4OV5A 2WTOA 4LFHG 1LLAA 4P2YA 4XBPA 4FYSA 1LEKB 1YMHA 1FNSL 1CFSB 4TUOB 5EZOL 3APMA 1DQIA 4JPQA 1EHAA 2GTZB 1JZFA 4MDRA 5DCCA 2GCYA 1Y6NR 5FB8A 1NAMA 1JI2A 2FYYB 1U3HB 4G6FD 5I0DA 1S7XB 3TL5A 4AIEA 1UQSA 4TVPE 3B8SA 2NYZA 2QL1A 3DIFB 3OVUB 4KVNH 1R17A 32C2B 2YUZA 2XN1A 1R3HB 4M1DH 1PYWB 4OCXL 4ZNEA 2QVTA 1CF8L 1PEZA 4HJJL 2J3SA 3FT4A 5D6DC 3WFEL 1GZHC 2GJ6A 5BZDB 1MUJB 3MRMB 5AALA 1YEGH 3GRBA 1U8LA 1LO2H 4POYA 3VU2A 1WIPA 4KRLB 4KK8C 5G55A 5I5JA 1DQKA 1QFOA 2MCPL 5EBWB 3BAXA 1RUPL 5D7IE 3EOAB 3FQXA 3I6SA 3EYQD 3OKMA 1AGCA 3PREA 1AGEA 1KJMB 2DYPB 5GRVL 1LQBC 2HT2C 3QH3A 2Y4SA 5IY5B 2XRAL 3KPQA 4WTZA 3BKML 1PQZA 1PTZA 4RISL 4JN1L 4NNYA 2DEWX 4V1DD 3ATEA 2Q76A 1XH3B 2WOBA 1FH5H 5K39B 5HPMB 4I87A 3KBHE 2ZF9A 3GSQB 5MEQA 2EJ1A 4ZTEA 5D2NB 1E9PA 4E9WA 5IFJA 3GZKA 5IROD 4YHKL 1WRFA 4H8QA 4IMLB 3BN9D 2OMZA 4RFOH 4BHUA 1FN4A 3EH2A 3T2NH 1CGWA 1H3TA 3N9GL 4XHJD 1A25A 1NCCH 4FCAA 1FZKA 2HTKC 2GITA 3QI9C 4I3GA 4GG6F 1JZ2A 1K8DA 4UTBH 1U8IA 4FG0A 4HJGA 1ZVSB 2D7MA 3FO2A 4HC1A 3W0WB 4LEBA 2W95A 1U8HA 1DBJH 2FEDD 3C5SB 2ATKB 1BQUA 2J6EL 3P0YL 3QGVA 4JKMA 3UAJA 4DVRL 3BUPA 5EEZA 3JV4B 3NRFA 5BV7L 1JZEA 5IR1B 3ECVA 1IM9A 3FAWA 2D0FA 2EDDA 3DVIA 4JG9A 1G9NL 1QRNA 3SZ6A 3VM5A 1IIIA 3K5SA 5E1IA 1TO5A 2WC7A 1MEXL 4CVXB 3B6SA 3OJDA 3R0MA 1BZ7A 2X2HA 4U3SA 4U2ZA 3CK0L 2YQ2A 5B38B 3C8HA 2UVEA 5BS0B 1R34A 3Q1SH 4OD1H 2COVD 5IQOA 2DTSA 2Z65C 2G2NA 4KZEL 2BRRL 1JF5A 1HSBA 3GLAA 4WTXA 2AXJA 3T1FA 3QDJE 3FFDB 5IIEB 2HT3D 3KXFA 5T1KB 5IMKB 4GQ9L 3HA0A 1UT9A 3H6JA 3UP1A 2FL5A 3VH8G 2R69L 3QB7C 1YRKA 2AEIT 3OKNA 4AL8H 3GSNB 4FL4B 4GXFA 3WLWD 5MI0C 1JWSB 3W2DH 2XC8A 3QR1A 1ZJBA 1DQLL 2A0LD 3HBGA 4I9XA 4HS6A 1NA8A 3D69B 4HS8L 2FJHA 2JCCF 1XR9B 2BNQD 4QR7A 3U9PL 4JN2A 3VXME 2CBOA 4KC3B 3WXWH 1MCPL 5JA8B 3CN0A 3C9NA 3SOBH 3CFEB 4IDLA 1UB5A 4LPTA 2EXWD 4OIIH 4X6FA 5BVPH 1UH2A 1G6RL 3CHSA 3HUJF 3L3DA 3BAIA 4FMKA 3WL9A 1RZFL 4KKLD 1CYWA 4Q7DA 3GXNA 3PNWA 4YPJA 1TZIB 4NGHL 4HBQA 3AVEA 3IVKB 3G04A 4ZO9A 2F18A 4YXLL 3DX9A 2OYMA 1WVZA 2VM9A 1FFTB 4YLQT 3WHE1 4HUMB 1MSPA 2OBGA 1WFJA 3LAFA 2YPKA 5EU6A 2HUHA 2PMZA 1ZT7B 4YIQA 2NR6D 5BV7C 1E4JA 4WJ5B 4ZMWA 2NX5D 3ZTDC 2AITA 4MVBD 4OZIF 1G9NC 2LU7A 2YAMA 4FQQA 4X5WB 3ZE2F 4ZTOL 1YNLH 2IH3A 4F20A 5LDSA 4P59H 1TG8A 2IANE 1KCUL 3ZYJA 3VXUB 4UAHA 1JDCA 3BUDA 1NPNA 3FBQA 2XPZA 4XWOD 4RETB 1F13A <