3WTVA

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
b'GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtvA00
2BIOA 2X0WA 3WTXA 4LOFA 2ADYA 1H9DA 2IOMA 2BIQA 5G4MA 2H1LM 1EAOA 5AOLA 2FEJA 2P52A 3US1A 3ZMEA 4IBTA 3VD0A 4G83A 4IBUA 3IGKA 4IBYA 4XR8C 3US0A 4AGQA 5AOJA 1TSRA 1E50A 4AGLA 1TUPA 3WTYA 5AB9A 1KZYA 2X0VA 2AC0A 4MZIA 2XWCA 1HJCA 1UOLA 2IOIA 5BUAA 4L0YA 4MZRA 2BIMA 1CO1A 2J1ZA 3D06A 3WU1A 3VD2A 4L0ZA 2J20A 2PCXA 2BINA 1EANA 3KZ8A 3Q01A 3Q05A 3IGLA 4IBVA 4L18A 1GZHC 3D0AA 4HJEA 5LAPA 2GEQA 2J6WA 4G82A 1HJBC 4AGOA 2XWRA 3D07A 2J21A 3TS8A 4AGNA 1T4WA 4IJTA 3D08A 3WTUA 5G4NA 4LOEA 3WTWA 2J1YA 4IBQA 2WGXA 3QYNA 3EXJA 3EXLA 1HU8A 1LJMA 5AOMA 5AOIA 3Q06A 3WTVA 1CMOA 2X0UA 5G4OA 2MEJB 1YCSA 5LGYA 2IOOA 4A63A 3D05A 4IBSA 4GUQA 3KMDA 1EAQA 2VUKA 4AGPA 4AGMA 2J1XA 5ECGA 4QO1B 4IBWA 2AHIA 3QYMA 4GUOA 3VD1A 5KBDA 2ATAA 3WTSA 2OCJA 5AOKA 5A7BA 4IBZA 3WTTA 1GZHA 1IO4C 2BIPA 2YBGA 3D09A 5ABAA 2J1WA 4KVPA 4LO9A 2RMNA
chains in the Genus database with same CATH superfamily
4PRBB 1FZKB 1Q9LA 2WZ0A 2BIOA 2VISB 3V6FB 4MXQC 7FABH 3FN9A 1AZUA 2MKWA 1NC2B 3A67L 3QEUA 4NCC2 2WIIB 4PJCF 4F24A 3QNXA 1XSOA 4GB9A 2BY2A 5TJWK 1HZLA 5LJYH 3O3DB 2VISA 4PLJC 3TBCA 1NC2A 1NFKA 1A4CA 2WIIA 3TN0D 5AVYB 1Q1JL 2YPLE 3O4OC 4JM4L 3MBWB 1NPUA 4AVHA 3WKMH 3FFOA 3TJPA 2NY4B 3CMOL 1I9RH 1CICB 2PW1B 4W9CC 2M26A 3ALWA 3BUQA 3GTTA 1SOSA 4CMMA 3S88L 5HPMA 1ASPA 4XVSH 3ZHDA 2CO6B 2R69H 2CO7B 1MVUB 2LW3A 3MV11 5D6DC 2PW1A 3O11B 3PWLB 2HRLA 3BSZA 4MYPA 2NQDA 1RVFL 5FB8B 3M1OA 1FHNA 2CBQA 3QJUB 2CO7A 3NIFE 1T2XA 1WBYA 3BH4A 4D9QE 1BFVL 3L3DA 3RTQD 3KPOB 1H3PL 2E6PA 2HXAA 1GY1A 1Z5YD 4JAMB 4KTYA 2NYYC 4BE5A 3T04D 3EYSH 3CHRA 4MMXC 2IALB 2AJYL 1LO5B 1TQTA 2RTTA 5CU5A 4I3SH 1G7LB 1ZTXH 2ZKYA 2BOBB 5KUKA 3KPOA 2ZCKL 3UADA 2FLRT 3QBTB 4N6RB 1JTPA 2V7NB 4NKOB 4PRPE 1IMHC 1LO5A 3GHBL 1G7LA 3AU1B 4NI6A 2AQTA 2K4WA 2WOBA 1QHQA 1AQMA 2BOBA 3C5JA 1PZ2A 4HCRL 3V0HA 1N0LB 2DM4A 3CHSA 3DMMB 2ZG1A 3UC0H 3TNMB 1U8KA 1NGXB 2V7NA 4NKOA 4X8JA 1L9QA 3GLDA 1A9EB 3MYJB 3IDXL 4ZW8A 4GG6E 5CGYD 2YPLD 1YMMA 1I3GL 4HMCA 4WCYL 2HUEA 1N0LA 5GRVK 4FA8A 3HC4L 4B53A 1PSKH 1NGXA 5L0QB 4R5VA 3GSXB 2BVYA 2DJMA 4CDHA 4XCYA 5IHBA 1U3ZA 4KJQD 4DGYH 3PLYA 3R7QA 5K33A 5AOKA 1JWSB 1WZAA 2G3XA 2DQJL 1GSKA 3GSXA 3UXFA 1QWUA 3ARYA 3ETBJ 3N41F 4HSAC 2XC8A 2X6CA 4PJEE 5HYJE 4QMEA 2C9RA 3IAQA 2ESVE 2OP4L 4D9QD 3HW7A 3MV9B 3BIKB 2I85A 1BLIA 2XKNA 1PLBA 4U1JB 3B7UX 1JGUH 3MA7B 4JX0A 1KT2B 2R0ZH 2XIDA 4BSJA 1JZ5A 2ITFA 3D33A 1NLBL 2WHVA 2J8UB 3L4XA 5F0MB 2CWRA 1ZLDA 2WXFA 5C07E 1AXSA 4IEFA 5DFAA 4J4PC 2BXZA 4PRPD 4U1JA 3BP4B 4CSPA 3LH8A 1NDMA 5TPWL 5T5NG 1WA1X 4M4RA 5F7UA 1MXGA 2B5IC 3UYOD 3QI9A 1HHKA 1P4IL 3GMQB 4JM0A 1UD6A 3ES6B 1AD9A 1ERNA 3BP4A 1U2YA 2BIMA 2WZPD 1RU9H 3B2UD 3BGAA 1MJ7L 1TNNA 5GGVY 4BH7B 5KZCB 3QIBB 3VWKA 3TC9A 4L1TA 4U3SA 1HKFA 2PR4H 3ES6A 3GBDA 3NBNA 2HT4C 4MJIB 1BZDA 2XX0A 1PX8A 4OZGA 5JA8B 4BH7A 3F65A 3D7PA 3IVKB 2N7SA 3NP4A 2FH6A 2H6OA 2GTQA 2BNQE 2MNWA 1M7IA 5AEAA 4B95C 3MCKA 4CJ1A 4Y5VC 1M7XA 1SQ2N 2A6DB 2WXPA 4YSTA 4CN6A 4JPVH 1NBZA 4OZIF 2NLJB 4ODWB 4TLSA 3IVKA 1ZDQA 4RMWA 4I3RL 1QSZA 1CD0A 5DFVD 1FYTA 4AGNA 2R4RL 4P2QA 2GI7A 2ESVD 1XGRB 3BZEB 2A6DA 1CFQA 3OL2A 2RJMA 4YDLC 1N6QH 1MCOH 1DQML 1QW8A 5CLWA 4ODWA 4GFTB 3QEGL 4M9OA 4BH8A 3KWTA 1FO0A 4PBDA 5EDXA 4DVBA 5E7BA 2JKXA 3O6KH 1XD0A 2FX8L 2P26A 1XGRA 2WXOA 3V8CA 4GAJL 1GHFH 3T0EE 3TEYA 3BZEA 5L6YL 3DETC 2AAVA 5C07D 4QXTB 1IB5A 3D1MC 2H8PB 5CJOL 5BW7A 4YDZA 3T09A 1EAPB 3GZKA 3SE4C 1UZ6E 4QRQB 1ZJAA 3DSFH 4QRRA 3GF8A 3KPQB 4YVNA 5IOKA 5IV2A 2YQBA 1HSAB 2L4OA 2ENYA 5LG1A 2NSMA 2ALAA 1XF2A 1EAPA 2YC1B 4M7LT 1YC7A 4JFUA 4QRQA 1FE8L 4X4KA 4Z3HA 2ZCZA 1PKQE 5DA4A 1SEQL 4PMEA 4E9LA 3G5YB 4HUWB 1H0DA 1WBXB 2WXLA 1DQLL 4LSDA 2YPVH 1XF1A 2YC1A 3TJHD 1TETL 4PAZA 2X2JA 1WBZB 3FONA 3J7HA 5I26A 4KK8D 5GHWH 3W9DA 4I88A 1P69B 1X6NA 2BNQD 2J8OA 3G5YA 4KRPB 5AOLA 4A6YH 4ZQKB 4YK4B 4XBGB 5AVQB 4XCFH 3B2XA 4ZFZB 3MRLB 1C8QA 3ZMEA 1WBZA 3H1ZA 1OF0A 4PLNC 5CGBA 1XEUA 5IVOA 3DO7A 3NZHH 2LABA 2OX5B 3MA9H 5D1XE 3APCA 3I02B 4XBGA 4ZQKA 1IEHA 3QIWD 1MREL 2R27A 3IJ9A 3OPZL 3S7GA 4GW4A 4BWWA 2D03L 2XWCA 1CGWA 2Z7ZA 3SGKC 3OKDB 2OX5A 1PZDA 4MQ7B 5TTRA 2VR5A 2GSGB 2VLRB 4G8EB 4TLUA 5KOMC 2KS0A 1RFDL 5AYUL 4OR1A 3NACL 4Z0XB 3LD8B 1GOHA 4LPCA 5AVXB 1QFWM 5BOJA 4MQ7A 5BV7C 2Y6SC 3T2LA 2FECI 2GSGA 2VLRA 2X3AA 2Y4SA 1MUJA 2RQEA 3QWNA 4RLDA 1KIRB 1CYWA 3C5ZD 4Z0XA 5IROA 3ZE2F 4ELKA 3T4AB 2NW2A 5F1NB 1V7NL 1TQWA 2FSDA 3V52L 2BVQA 1D6VH 1FDLL 2BNRB 1XB3A 4QTIL 2YAEA 4GLRH 2XWRA 4Q9CA 3DX1A 3Q5TA 1HWHB 5F1NA 1MQKL 2BVPB 4WKXA 2JLLA 2XDHA 2VZ1A 1INDH 3KHQA 2BNRA 3UBGA 5CLYA 1HZHL 4YWGL 4FZ8L 3AG1B 4GQ9L 1BVNT 1IAKA 4G7YL 1YEGH 3NEEA 4Z8FH 4QRTB 2VDQH 2AANA 3H55A 3L1OH 1VKXB 1J9TA 4IOSD 3IKKA 4N0UA 4UDTB 2MCMA 5I1CL 1MNNA 2BH0A 5E00A 1BQSA 4MDJB 4OD2A 4ODHH 1TCRA 5D1XD 3LYRA 4OLEA 4QRTA 2R2HA 1P6FA 3E1ZA 4DQOH 5KTEL 4F3FB 3MGTA 1LILA 1VKXA 2K9FB 4UDTA 3X12B 4ZTPH 5F88B 1TZHB 2Y06L 3U1SH 1PIFA 1FL5B 4MDJA 2VZOA 3QYMA 2VXSH 2VL5B 3NCYS 2Q0ZX 5C0RL 1JFQH 2QV2A 5CF3A 3JWNH 3AFLA 4XWGH 1NEZB 4K5NA 4PUBH 5DO2D 3PWPB 4YSRA 1EWHA 2VERA 3KWWB 5F88A 3S4SG 3LH9A 1Z66A 2APSA 3X12A 4CDGC 3HVDA 1FL5A 1B4JH 1QBLL 2HFGL 2XWEA 3BE1H 5T3XE 3PL6B 5AYQA 4YHOH 5TF1H 4EN3D 5A2KH 4K15A 4Q2ZB 4PSRA 1OLLA 1WUNT 2YGPA 4L1SA 3BGFC 4EUPG 4NAJA 1QFWH 4YXLL 2BRRH 2W0PA 2Q76A 4H8UA 1BM7A 2DIEA 2FEJA 2YGNA 1WF5A 4FFZA 5DWUL 3PL6A 2VLLA 4WI2A 1AQDA 3GNML 1HQ4B 4XBMA 4H20L 4OV6F 2G75B 3QUYB 1SVZA 1YJDL 2DN7A 2AP2A 2V2TA 4G9DB 1OCZB 3SDDD 4G70B 4J28A 4DP2X 1ZEAL 4F7PB 3FZUD 3RZWA 1T7ZA 1BQLH 2GQHA 2VDRH 4HIJB 2YD5A 4WI8A 4NHCL 2G75A 3QUYA 4PRAA 1U3HA 3T65B 4DKFH 3ISRA 4F7PA 1CL7I 3HZKB 4WWKD 1OK8A 1F0LA 5GSVB 4XAKE 2DH2A 4O58H 3T65A 5F9OH 4XPHH 3LKPB 3RVXD 2DMHA 1G0DA 1KGYE 3WSQL 1GKEA 1BAGA 1J8RA 4QXGH 3V7MA 3VH8B 4LB8A 5AW1B 3JTBA 1M4KA 5DEGB 4N8VB 1FHGA 3BAYA 3BYTA 3K4AA 4FD0A 3T3PB 4UT6H 3BLKA 4DKDC 1FBIL 5D7LA 5KN5B 4E5XB 3CJJA 3ZO0A 1HK6A 1G43A 1JYNA 4N8VA 4P2OC 1GGYA 2IG2L 5T3XD 1Z5LB 3LNHA 5CEXA 3LX9A 4K8RL 1I82A 3OWRA 5KN5A 3O2VH 4E5XA 4AV0A 3QWQB 2Z92B 1INEH 1YHPA 1RD6A 2N1TE 3NFSH 4IJ3C 1Z5LA 3LVTA 3BYYA 3V5HB 1QSFE 3W11D 2AJUL 4R0LC 5MP6H 4CNIB 4PRDB 1QMUA 2Z92A 4JFFB 5I1LB 2C9AA 3MACH 2Y1AA 4JVUA 2QDWA 3ZW3A 3GXNA 3RWJB 2G60H 4P57B 1PPIA 4QHNA 1M2OA 2K6YA 4YGAB 3HE7C 4MHHI 4QO1B 4XOCA 4XPTH 1ED3B 2Q9OA 4MASA 4UM9B 5CILH 2ODIA 3BO8B 2XN0A 5J3HD 3RWGB 4UQIM 3RWJA 2LFEA 4XAKD 1J1XL 1CK0L 2O6CA 4QO1A 1ED3A 3N44B 3VG0H 4UM9A 1U6AL 1Z7JA 5FAAA 1NGPL 2R69A 3TGXA 3ZR5A 3EFDL 5GRJH 25C8L 3ARDA 3RWCB 2UY7A 3O2DL 4MXWH 1XBRA 4BFJA 3WKNA 3CX5J 2R29H 3I9GH 4O02A 2QJDA 2RD0A 1F3JB 3CD4A 4HAGA 4N26A 4I1RA 5DZOA 2UYLB 4Q58C 5CMAB 3DX3A 4B7IA 1T1WB 3HB3C 1N5YL 3MC0A 3RWCA 2P8MB 2ICWI 2QSVA 5IMOB 1ACXA 4H1LG 1F3JA 4HBQA 4TPRH 3FUDA 2UYLA 5HHNB 2NNAA 4K2UL 4UZUA 1TYRA 1D6EB 2Q3AA 5LGHL 1T1WA 1QSFD 3EOTL 2C5DC 2P8MA 3CCHA 3G6JB 4XCEB 5I30H 5DQ9B 5IMOA 3F83A 5FLUA 1AFVH 1MDAA 4MNGB 3SPCA 3IRPX 1D6EA 3K72B 3TYGH 2X87A 5IFAL 4HWEH 2QGDA 1E2ZA 4XCEA 3U2SB 4Z77B 1VIWA 2H3NA 1J5OH 4PN6A 5C0AB 4QHKJ 2NR6D 3IDNB 1ADQL 2NCMA 4MNGA 5JW3L 3NFNB 3K72A 2WZAA 5ELIA 1PLAA 1IRAY 5I18H 1JHKL 4GRLB 4MMZC 1XSIA 1JMZA 3HG4A 1MH5B 2IWFA 4ZO8A 3ABMB 2X70B 5CSGA 1IGMH 3P77B 1HYRC 1X44A 2NUTB 2IAMB 3H0TB 4QNPE 4QAWA 3BGMA 2CNYA 1WWBX 3AY2A 4N8UA 4GRLA 4XNBA 4YHKH 4WFFE 1KEML 1E6JL 4KKQA 3I9IA 1B3IA 2B0SL 2V3DA 3VGAC 3ZZLA 3P77A 5KSBA 3ZL4L 2DYRB 4MRBA 4FFVD 2V5RA 2AQRA 5IP4A 3WUWG 1JGLL 1TTFA 2X9ZA 1JYWA 1HHHB 2EH7H 2A83B 2TRHA 1OVZA 3IDYB 3IYLW 1MCWM 1PVHA 2AV1B 2PW2B 5DURD 1IAIM 4LKCB 4AJ0A 1AKJD 3D8MA 4ENEC 1IFRA 2AFNA 2IDFA 2KDGA 5FYKU 1JRHL 1DEEB 1HHHA 3FUMA 1XIWD 1R3HA 4PGCB 3MRHA 1JTOA 5BUGA 2AV1A 4LPTA 3CPLA 3QDME 3V5KA 4R7VA 3APMA 4F1SA 1GZHA 5EEZA 2EDWA 3V6ZB 4HEPA 4PG9B 1R5WB 3SJVB 1ASOA 2CO1A 4KVPA 1DEEA 4L5FE 1O5PA 5ESAB 1JZDC 4GXUN 4PS7A 3WJJC 1BVZA 4J39A 1JL8A 4YSPA 5DSCB 3HN3A 1PD6A 2CRZA 5G5DA 4F1ZA 4AC2A 2ZWKA 4NQQA 1RULH 5I75B 1OT2A 5ESAA 3CBKB 5KSAC 3L3OB 4G83A 1SRDA 2NY3B 2FO8A 4Y1AB 5C0DB 5JHDA 4Q74A 1HX0A 5AVUB 3KWXA 3SKNA 5FWQA 1UM6H 4GQRA 2DWSA 4WFFD 2X4OB 5K39B 2OLDA 1P5UB 1UB5B 4C8XA 1LO0L 4KKCC 2BWQA 4YN3A 5C0DA 3F5WB 3PJLA 1WEJL 5E9DE 3HR6A 2HT2C 2EC8A 5DXWA 3IRCA 5K39A 2R2BA 3LKSB 5LLIC 1P5UA 1UB5A 3IMSA 1U0QA 1U8PA 3JV6B 1CTMA 4NQEB 4E9XA 3VQ1C 3FQ1A 4WI3A 1LDSA 4R83A 4AY0A 4JO3H 2W8CA 4R7LA 5JHAA 3E80A 5TH2B 1S6NA 2XQBL 1AXIB 3EH5B 3JV6A 4I85A 4M1DL 1X5GA 1I7UA 4X5RA 2ED9A 1IAIH 5BXFA 3MNDA 1O6VA 2DJSA 5LXGH 5TH2A 4KMTL 3L9BA 4LCWB 1QSED 4F7CB 1KDIA 2A9DA 2XSKA 4L4VE 1UXMA 3NRFA 3HBPA 3TS8A 3NN8B 4CW1B 3TWCL 3PYCA 1N12A 3FQXA 1VFBA 4E9WA 1WH0A 1IGFL 5A2BA 4G8IA 5IHZB 1G1YA 1WFOA 3UABA 4AEEA 4LGPB 2YPVA 4A6YB 5FO7B 2VDPL 3VX1A 2DMCA 1HINH 2EE0A 5A1AA 5D2LE 1MWAL 2XHNA 2V33A 4JNXA 3TBSA 5AUMA 4A37A 3QHZH 2WQRA 5CLTA 4YXHH 3CDZB 4FQ1L 5FO7A 4EZKA 4GPVA 4YHLH 2WKLA 4U1HB 1U33A 2XZCH 1V55B 2BC4A 2ZCHL 3FCGA 3RDTB 1A7OH 4I2XB 1X5ZA 4NBYB 5DS2A 1NGYA 1BIHA 4JEGB 1DBML 2OSLB 3CDZA 4AK1A 1FSKC 4OIIL 3GINA 1HI6A 3PIQB 4MB5A 4U1HA 2VZVA 2ZP9A 4I18B 2QHLA 3WXVL 2VDLH 4TYUA 5T3XH 2V5YA 3ZE0F 4J7RA 2H1PH 4NKIH 2J3SA 3CVHH 3H56A 4FQXC 1BJMA 5FYLE 5CBEB 3WEXB 4U6HA 3VDAA 5LHDA 4RFOL 3JSSA 1JN6B 4ZO9A 3TV3L 3MLRH 4M6NL 4LOVA 1ZHKB 4LMQI 1KCWA 4JFZH 2DI7A 5CBEA 1NDTA 2KLSA 3WEXA 2M83A 3T0DA 4NZUH 4AW4A 1JN6A 1RJLA 4TTDD 4X7TB 1TT6A 3B6SB 4AGQA 3MDJA 4IRJA 3SPIA 4FYTA 4JM2A 5JQ6H 4HFUL 2AMUA 5E1AB 3MCG1 3MLUL 3TN0A 2VDQB 1JGVH 2ZAIA 4JO1H 4X7TA 3AREC 3B6SA 3PXHA 1C5CH 1DVZA 1M1XA 4MS8D 4X50A 4QRBA 4N0FB 5E1AA 2F15A 1UXSA 3MLXL 1NCAH 2E9GA 3VRLF 1EQWA 1FUNA 3VD2A 1HC1A 2QGBA 1EIBA 1EZUA 4PJGE 4XNZB 4Y1SA 4FQJL 1J8HA 5DEJA 2R1YB 3RTQB 3IGLA 4H8WC 4K3GA 3JZ7A 1PGRB 5MERA 2HYMA 4BA0A 4L3EE 1CBVH 1BEYH 1RUAL 3IFNH 3J07A 4JPWH 4Z7WE 2OL3H 4ZMLA 3R7RA 2QSCL 1NCBL 3NAAL 1XEDA 1CG9B 1E5ZA 1FNEA 1YY8A 2R1YA 3RTQA 2WO2B 3IETB 3OJDB 1UZGA 5KS9A 4PRID 3ATDA 4YDIH 4RGMB 5DD3L 5FYKL 5E0FA 5FYLD 2GT9A 4HISA 3M86A 4XP5H 3F7YB 3TCLB 3M88A 1PG7X 4HF5H 5TDNB 1IC4H 4PJ5D 5CN2A 1YYCA 3KBPA 5K93A 1VCAA 5FYJU 4TKWA 2E7BA 5I1KL 3VXME 4M5YL 1HYSC 1NBVH 2YPLB 2QGEA 4JUTA 3LEYH 4P23B 1FP5A 2VDRB 3MJ9H 1KCRL 4HHAA 4AQ8A 3LQAH 1I8MB 1EEQA 4ODXB 3F7PC 2NZIA 2WAQA 4ERSH 2F2HA 4IBWA 2VDNL 4QHMB 4BCXA 5KBKA 2YPLA 1MW2A 4JRLA 3ULUD 1ZLUK 3QJTB 1NPJA 2EEAA 3GM8A 3OKNB 2QDVA 2GABA 3ILQC 1I8MA 2ORBL 2CU9A 4ODXA 4ZQTA 2CXKA 4D0BA 1Z9OA 2HLFC 2JK5B 2W81C 4PTTB 4QHMA 5D5ME 2DBLH 3Q2CA 2CLVB 4W9ZA 4CC0A 3OKNA 1TPXC 1YYLH 5FA4B 1MFMA 5GGSB 4RMQA 1VADB 1EVUA 4U1LB 4Q9RL 5FFOA 4Q4EA 5DA0B 1U8OA 5BJTB 2JK5A 2HVKB 4KNTA 4L3ED 2PMZA 2R0KH 3TA3D 2CLVA 5F7LB 3HI6L 5HGDB 2DLIA 4J3XA 5FA4A 4ZW6A 1BQHG 4K9EH 1VADA 4U1LA 2E0PA 2WW8A 4QHPA 4YE0A 5EN2B 1Q9OB 1BD2A 2HVKA 3V6OE 4I7ZC 2R9HC 4PRPB 1O9VA 4P4RB 5HGDA 1FGNH 4YL9A 4OT1L 3PABB 4JDTH 3VXRE 1Y07A 2VQTA 4XE0A 1RAMA 2D3LA 3FTXA 4J3SA 4YQXH 5GGRB 4KJWD 1HNFA 4PRPA 2YD2A 4P4RA 3VXMD 5GIRA 5I5JA 4GG6B 1A6ZA 1BJ1J 1UOKA 3IXAB 3SE8L 2G9KA 2CRMA 1MFEH 2FDBP 3LKNB 3FH8A 3KVQA 4UAHA 5GGRA 1IFHL 4JFDD 4GBXC 5E1GA 2WZPA 4JRXE 4Y4HD 1IBGH 2IV8A 1P9MC 5EOTB 5K1VA 5D72L 3IF1A 2VAJA 3LKNA 3NIDE 1DJGA 4WW1B 5FFGA 4DGIH 1Y6KR 3FB5B 1EFQA 4M56A 2QTVA 2Q86B 1QQDB 4B9GA 3LSOA 5INCA 4AX3A 1KCSH 4HGWA 2PWFA 4PJEB 3D07A 5HYJB 4FTDA 3LPWA 4WFHE 4WW1A 2J21A 3SYAA 5E5UB 5IQ7H 3S5LA 2ESVB 4D8PB 4EZJA 1I1CA 1U42A 2Q86A 3OZ9H 2NXZD 4UIKL 4L1LA 3I6GB 3UJTH 4GSDL 2WLZA 4PJEA 1T7XA 2B08A 2NY0D 3IJEB 3S8WA 5E6SB 4D8PA 2R0LL 4DEUA 3BVNB 4GG8A 2WLNA 5C07B 4X7FC 3JBG7 4AVKA 1S9XB 3FSOA 1ZWIB 1LWRA 1LNUB 3HKZA 3D05A 3VFUA 2R29A 4M43L 2JXMB 4UMGA 2ZTBA 3EJTA 5I76A 3BVNA 2J8UF 5IFHL 3VXRD 3MU3A 5C07A 3UYRH 5BPPA 1HKLH 1ZWIA 2NY4C 5KG9B 1LNUA 3DIFB 2FB4H 5I0ZA 2HVBA 2JXMA 3SYPA 5SWSE 4UQ9A 2OCJA 3FQYA 4NQVB 5F6IB 3EJPA 1J0YA 4YR6B 5EULV 3D12B 3MV01 4L5FH 3LRSB 4JRXD 3C09B 5HVHC 2NY2B 5DUMH 1JXJA 4NQVA 4JDEB 1U8CB 4OFDA 4HBCL 4GAAA 4YR6A 2BNQB 5FM5O 2R23A 1MFCH 5D1QE 2Q10A 3LRSA 1BQRA 3IU4L 4ORZC 1Z9PA 1IAMA 5JLZB 1BQKA 2CK2A 3MOBL 5DMGD 4JDEA 4AQZA 1U8CA 1IILE 5JDSB 1IIIA 4NNPH 2BNQA 3NA9H 4WFHD 1HOEA 2NRDA 4JFWA 2AJZA 4AYBA 1DCEA 1NCCH 4QY8B 4PM1A 3P2TA 5JLZA 2X3BA 1VENA 1WC7A 3QIWB 1TYJA 1TQCB 3B5TA 3CFTA 3LZPA 5D4QA 3SDYH 1N6VA 4L3CB 4AMWA 2WAHA 3T0EB 1ZLSL 4K3DL 3PAYA 5AWNH 3RIAK 3BKMH 3CU7A 4PCYA 3QIWA 3MLVL 4KGLA 3P9WB 1QP1A 4YSUA 3CFIC 5GXBB 4L3CA 2PCPB 1FAIL 5F6HJ 3ARWA 2L7EA 2FEEL 2QZ5A 3FU7B 4RDQG 4KXCA 3ARFD 3K6FA 3KGTA 4F9PC 4FNLL 2YGVA 3GSRB 4AENA 4M4PA 3C5ZB 3U36B 1BQ5A 1AANA 1IGIH 1KN4H 2YMXL 1PCXA 3UO1L 1EJ8A 3ARUA 1GW6A 4YMPA 1NINA 1ET8A 3GS0A 3I50L 1TTRA 1PKQB 3RU8L 4P04A 4BQ9A 3VG9B 3TJEL 2FAUA 3GSRA 3C5ZA 4WTQA 4ZFGH 2ITDB 2YA0A 2OYLA 4NC1E 1UWYA 3DX0A 4ANWA 1M2VA 4E9RA 4HJUA 1PKQA 4UOW1 2FZ3B 4JJHA 3KLKA 4U0RB 4YC2B 3AXHA 4KXDA 2FX7L 5AQ0A 2HH0L 5EO1B 3RNKB 3CIQA 5DVNA 4IGBD 4L8SB 2FZ3A 1K3IA 2EACA 3QWOB 3OB8A 3GO1L 4X5WA 5C3IA 3FQ4A 5D1XB 3UTZB 3BUPA 3ZDZF 3D4GA 3RNKA 3QI9C 4XNXL 1JF5A 2WINB 5CINL 5IBUG 4KTDH 1PKOA 4L8SA 2XQYK 4FZEL 4GMTH 4RBPK 4UF7C 5FO9A 5D1XA 5DDHA 3GSNA 3VWKC 5FCSH 4JB9L 3UTZA 5BV7L 4LU5H 2IDSA 5BCAA 2YGOA 1O7VA 4GLRI 4X6DE 4OLYL 4KX9A 1WG3A 5K1NA 4HS6B 3RGVD 4KROD 2O61B 1SDDB 2M8XA 5F7WC 4EN3B 5LVEA 2K70A 3G9AB 3HPLB 3MODL 5FYLH 1Q72L 5FA3A 3H3PL 5D7EA 1P0SE 4DKEL 4HS6A 5T1MB 2ITCA 4NM8L 3Q44A 2N1KA 1SDDA 2VDML 5ICYB 4EN3A 5JHLL 5FW6A 3CN1A 2BW4A 2AV7A 2CK0H 2HRPH 3MV7E 3HPLA 2ZWSA 1URIA 3NJGA 3KPNB 4OLVL 3SDDB 4JZNB 3D3VE 4PWHA 1SXCA 3ATAA 4KXAA 1X5LA 1TMCB 3I6SA 1CFVH 35C8L 3MRIA 5ICYA 1KGJA 4PRNB 4IMKA 4QPEA 3SY0B 3P4NA 2AC0A 4X0NA 1HJCA 5K59E 3SDDA 1E4XL 4JZNA 1IVTA 2R4SL 1QW9A 3RNQA 5J4MA 1J5DA 3VI4F 1HT6A 4WWKB 4PRNA 5BW7C 1S9VA 1X5HA 5EU7C 2HFEA 5CLXA 3GMMB 5I1JH 2UWEE 1UCBL 2HJLB 2ATKA 5EEWA 1SXSA 1NMCB 1L3WA 2P8PA 2ZKWA 4TQEH 4MYWB 4WWKA 5C08E 1LO2L 4I0PD 3OAZH 4K7PX 4JPIB 3UP6A 3GMMA 2KHAA 2HJLA 1AGDA 4UCFA 5J6SA 1KGXA 1P53A 4IIQB 4ZS7H 1ZVSA 4ZPVA 4YHZH 3LIZL 1A9BA 3MBED 3QJFB 3RVUD 4JPIA 1I31A 3O6FA 1LP9E 2VDLB 4NX0A 1JNHB 4Z0BL 5C6TL 2BXYA 2CJUL 3CVHB 5HHQB 3MRDB 3QJFA 3UJJH 1I3VA 5CUSH 5B3JE 1F4WL 1KBBA 1N9PA 2FATL 4J3UA 4ZD3L 4O2CB 2R7EB 1JZEA 4C4KT 5EORL 3FT4B 1JERA 4GAYB 4NUGH 4EF3A 2N56A 3IE9A 3K5SA 3JT0A 3Q6FA 1XCQB 3GMLA 5HHQA 3FQRA 3MRDA 3MV7D 4FA6A 1OWRM 5JDJA 3UBXG 1I7RB 3OHXB 1EZVX 2WP3O 2R7EA 3D3VD 3BP7A 2BSBA 3KWVA 4O2CA 4M61B 2JIXD 3R18A 4JK0D 4FXGB 3GBNL 4HVBA 1XCQA 4YDKL 4POUB 1KJ2L 1LQSR 5EO9B 4G9FE 1Y1UA 4OJFL 4XO4A 1J12A 2G2RB 3B9VA 3OHXA 2MIZA 4Q6YA 3ARPA 4XOEA 3MUY1 3MRKA 3P9LB 1MFNA 1FGVH 1WIPA 3ZY7A 2NTSP 1KSRA 1ZD6A 4WK2B 2G2RA 4KKPA 5KSUB 3MX0A 4Z7NF 4IHOB 3SQOL 5C08D 5GS0C 3P9LA 4Y9FA 3VU2A 4NRYA 4PRHD 5IROC 3V79C 3O2WH 2OJZH 5EIQA 3RQ3A 4F80A 5C0IA 5DU7A 5LUMA 1PZBA 3DPBB 2D3NA 3FAWA 4A2MA 3BPLC 3QXDB 3OTTA 1AO7B 1NAML 3HUJF 2H1LM 4YAQA 2OXGB 1DLHB 1EVTC 2Y5QA 2OL3B 1L9PA 3W37A 2X9XA 5HHVL 3T4YA 4IBUA 3T3PF 4BGLA 3FTUA 2GTZA 2VO8A 3L4CA 5I0YA 4EI6A 1KENH 3UFIA 5BUPA 4B9FA 1RURL 2JKWA 3QQ3B 5ERWB 4JN1H 1YY9C 2B39A 4NFDA 5DGRA 4QHLB 4RFEB 1QSFB 1PMYA 1MRFH 4OCYH 1XGQA 2AABH 2AZUA 2AI0L 2JCCF 5ADPH 4KKBC 2OR9L 4M5ZL 2DKSA 5FUOL 5LN4A 3AGWA 1KTJA 3AW5A 1FVEB 4RFEA 4AT6B 1N8ZB 5BRZE 2WB1A 4G9FD 4Y5YA 4XPAL 2V6HA 1E4HA 3OJVC 4NERA 4AV4A 3RKDD 1DQJB 4DH2A 1AHWA 4EXPX 2G3NA 5JIMA 3I85A 3Q6GH 2Q8AL 3VXPB 4KKLC 4P3WA 5C2BH 4XNYH 4KJYB 3WELA 4CSZA 4UIMB 4AT6A 3EO0B 4XMVA 4NQUA 1OSPL 1JDAA 4J8RB 1M6OA 2NR6A 1DQJA 2I07B 4GW5B 4HDIB 3BI9X 1UKTA 2IDTA 5AB1A 3HBQA 4KJYA 4UIMA 1SVBA 1A2YB 3TA4D 1G7JB 4LOEA 2DYSB 1YLBB 2OMYB 3N44F 3PL6C 5E6ID 4QXUL 2I07A 3WXWL 3CFCH 4HDIA 5C9JB 3GMPB 1KFAL 3QULB 2GJ6A 4XNUH 1KTKE 2A9BA 3MLYH 1A2YA 2YD3A 4IRSB 4JPQA 4MTMA 4UYPA 1G7JA 5DHXB 5JXAH 3GD1C 2ZOUA 3FU3A 5GJSH 5E0QA 4KK6D 4N1EA 1YEHL 5ISZE 2VLMD 5J9PB 3DTXB 3QUYC 1U3HC 1HOCA 2FO4A 5DURB 1XF5B 1H3VA 1S9YB 1KPVB 4QD2E 5DD1L 5IBLD 3MQIA 1AKJB 3WLWD 2HB0A 2AZAA 1UA6L 4YS4A 5A16B 2XI9A 4G1MA 4F7TA 2IQ9L 3GHEH 1XF5A 1S9YA 1KPVA 3MRQB 4WV1A 4MA7H 3OXSB 4WFGE 2D31B 4POYA 1U8LA 3G6JF 4U4IA 5BRZD 5A16A 2A5UA 3HLAA 1XIWA 2FJGA 4AZ8B 3KLQA 1A21A 3MRQA 4WF7A 5BNXD 2Q7YA 3PDDA 1FF5A 3SQBA 1MDTA 3B9EA 3ULVE 2X9WA 2D31A 4X4XB 2EEBA 2FQGA 3MKGA 5FV2A 4PJBF 1DJIA 2OYMA 2B59B 5GRUH 2AJVL 1KLUA 2ERJC 3DRTB 4QGTA 4D94A 4OIAA 1MNUL 1DVTA 2F5BH 1D2PA 1ZS8B 3TT1L 4PCTA 2WM0A 1HTYA 3BD5A 2YXMA 3DRTA 1RERA 4QCIB 3TBWB 5E95B 3NZ8B 4WWOA 5BUAA 4I0KA 4KDVA 2GAZB 1QSVA 1CXHA 2GJRA 1THCA 3P3RA 4NZFA 1URLA 4YDJA 3VXTA 1XZWA 5ISZD 3O6LL 3V4PL 2XWZA 3TBWA 2XX1A 2K1MA 1FFNB 1RUQL 5L9DH 2VXTH 3FKUS 5ESVB 4LSTH 2CQVA 2YD4A 4DESA 2ZXGA 4JFEE 5ANME 4TTGA 1OAJA 1VF5C 2CR6A 4ABQA 5CEYB 3OQ3B 2IC2A 3QDMB 4GEJA 4ODVH 3VYNA 4F8QA 5ESVA 5LCVL 4A67A 4M48H 3M7FB 1TENA 2L04A 4WFGD 2ADGA 3N91A 4NC2B 2YUVA 4FFWC 4KAQL 3K8KA 4UT7H 3O45B 3BH9B 3FUEA 3AACA 3NYKA 1KYFA 2P9RA 2JQZA 2XFGB 3T0BA 1TJHH 3ARDC 4ES9A 3ULVD 3L9EA 3FU0A 4N9GA 4HHWA 1JE6A 5JW4M 1QSEA 3W39A 5FKAB 1F6AB 1MCPH 2GG1A 2F7RA 3O45A 5TE7L 3EXJA 5IW6B 4ABWA 2BHZA 2EE6A 4XVUC 4M7JL 1JZ4A 1RJZB 3B9AA 1UD5A 3DTDA 2YXWA 1GJWA 5I8KH 3ZZQA 1XZ0B 4YZFF 4HU8A 2VC2H 3MKKA 4HJ0C 1VA9A 3NJHA 3FN3A 4DVRH 5IW6A 3P2DA 4DW2L 1AR1D 2YAPA 3AT8A 2FR4B 1LXMA 3F05A 5E9DB 5L8LB 2DMBA 4YSOA 1XZ0A 4UT9L 2MOVA 2C9XA 4HQQL 5I15H 1JI2A 3MOAL 2IPKB 3D9AH 1CU4H 5KVFE 1QKZH 5HJ3B 2FR4A 1MELA 2PF6A 2EVFA 5I1EH 3IDUA 3MRFB 3CK0H 4OU3A 4CVUA 1A7NL 2ID5A 3K6SB 3EBGA 2W07A 2IPKA 4OCMC 5AB2A 3E9UA 1BEXA 2Y23A 4I3GA 5HJ3A 1A1OB 3CLEL 2I25N 3MRFA 1ZT1B 5DHDA 3K0WA 5FW7A 3K6SA 4HS8L 3OAZK 1AQKH 2R1WB 4XP6H 3S97C 4KV5F 3HC3H 3D50A 4BWTA 4L4VB 1A1OA 4GRLC 4L2LA 5D6CB 3B9KD 1J05B 1ZT1A 4XXDB 3A22A 1IQWH 1BYNA 2O5ZL 5AKVA 2R1WA 1X4ZA 2ROXA 3OSKA 1GAFH 4R26H 1IBZA 1HIML 5AENA 3QAQA 1OP3K 3O3AB 3FB8A 2ZP0T 2W5PA 4XMLL 5L88H 2A0LD 5D2LB 1PD0A 2FD6H 3QHTC 1S3RA 4NXSA 4BRJA 3TH2T 3GXIA 3QH3A 1T2QH 2JQAA 3ZT7A 4NWTH 4H8VA 4NBZB 3O3AA 4PGDA 4JY5H 1HQRB 3BJ91 4R4NC 1B2WH 3EFFA 1JMXA 2F74B 2R83A 5D2LA 5ALBL 3I6KA 3RFZB 4PB0L 4A38A 3IDYC 3CAFA 5DD0L 4HYTB 1CC3A 1THAA 3H9SD 3PWJB 3QPQD 4WEEA 1GZHC 1NUGA 2H26B 1GS6X 1I1AC 3UBHA 2PO6D 2QPDB 2PTTB 4JBSA 3RFZA 4X7EC 3D51A 2Z0BA 1D7FA 3EDKA 4J6RH 4NO5B 2E6JA 2JV6A 3IPBA 2MTAA 2H26A 4B41A 4G3YH 5F9DC 4OCRL 1CE1H 3SPGA 3ZZ1A 3C8KB 2IANE 2HMID 2FWLB 1IU1A 1EGJL 3WIFB 4IM8A 2ZSWB 5HDWA 4YUEL 1QFUL 1A3LL 4PRIA 4NKMA 1T03H 3APNA 5HYQB 1L5GB 5I75C 3C8KA 1E28A 2AXFA 1NLDL 3G6DL 1XGPA 3QRGL 4AKPA 3WKPA 4NO2A 2MPVA 2D4FA 1X9RA 4PJ5A 3S4SA 5E2JA 5EH1A 5JA9A 3BPOC 1ZSHA 3ELQA 5L7XH 2EXSA 1CI5A 3MUZ1 4JLRA 3MRPA 3EO1A 2N4IA 4KO5A 6CGTA 1L7TH 3OAYK 4EUPA 4NKDB 3QAZC 2ATAA 1S7WB 1G1KA 1XV8A 3IFLH 2DM2A 2HTLD 2WLIB 3TO4B 3GI8L 4H8WL 3OM3B 2QPEB 5B39B 1PZSA 1TZ8A 2OJEB 4BZ2H 2VUYA 4NKDA 4PJGB 3NABL 1DBAL 5ITBH 1A6PA 1S7WA 1TQSA 5B7FA 4UQCA 4LEXH 1C8PA 2HZHA 3MREA 1DQDH 5DRZB 4BINA 1D7BA 4L3EB 2WLIA 4NIYE 1WAPA 3TA3B 2OCFD 5EIIB 4Z7WB 5B39A 4PVMA 2OJEA 3EGDB 4NQSB 1MRCL 2LLGA 5DZLA 2HT3D 3QUML 4UTBH 3VD0A 1KCLA 4HGKC 4PJHE 2BSCA 5E8DH 4L3EA 4HZ1A 3TA3A 3IAGC 5JPNB 4Z7WA 5EIIA 3LY6A 2IAND 4JJ5B 2IJ0C 4BRVA 4NQSA 3GEFA 2IFGA 1ZHLB 1O6SA 5M94B 1RUKH 1H8OA 4W4NA 3VXMB 2KLTA 3SPHA 4JJ5A 2VR8A 1G6VK 3HR5B 5I5MA 3INUH 2Q3ZA 4DZBA 1ZHLA 1Q94A 3PGCB 1T6VN 1IBDA 3WV0A 4BQ6A 4Y4HB 3VXMA 3IPEA 1OPGH 4UILL 4HJIA 5H37H 3CLFH 2QQNH 3RILA 4P4KD 3NSJA 2W38A 2IBZX 1FZJB 4HAFA 4W9LC 3QZMA 3C12A 1OY3B 4JFDA 2VWEE 1W2KT 2Z8SA 2BSRB 4Y4HA 4TSBH 3WNMA 2OZ4L 1B0GA 2OSYA 2VO5A 4XB7A 5D5MB 3F00A 1UT9A 3UZVB 2QGCA 4KU1A 5F2FA 1OQOA 2HJKB 2WUBH 3U7WH 1FZJA 4ZFFB 2V37A 3PV7A 4LVOB 3CQFA 1DBKL 1CDGA 4XI5C 3L81A 2J2ZB 3W81A 3ZSSA 4KZDL 4J3TA 1U8IA 3UZVA 3DDGA 4M6ML 2YRPA 1KB5L 1HXYB 2HJKA 3KJ6H 3W5MA 4OZ4B 4ZFFA 4M7ZC 2NY0B 5HDLA 4DK5A 1ACZA 3JT2A 3S3BB 4XB3A 2FJHB 4D9RD 4XMKH 2BHYA 2DQHL 3EO9L 2A73B 4U0QB 4BHUI 1A7PH 5MEOB 4IRJC 1C1EH 2FL5A 1VEOA 4JM2C 4ODSH 1EXUA 4OZ4A 4HS3A 4IK7A 3WDIA 1KEGH 4Y2DD 3HA0A 5AAWA 1OAUH 2CMRL 3TN0C 4E0RB 3RVVD 5JHMA 4G2AA 3VXRB 2A73A 3CBJB 5C0EA 5MEOA 3LXAA 1FL3B 3V6OA 1SQMA 5GGTL 4ZODA 1HXMB 3V95A 4D2NA 1QAWA 1DFBH 4JO2H 3V10A 5IG7A 3NQKA 4E0RA 4JY6B 2H0PA 3MLTB 4KH9A 1NCWH 2H45A 4GIAA 5D96C 1M7DA 2J1WA 4GG6F 1T6BX 5LQBH 3WD5H 1KN2L 3KBHE 3QPKA 2HX7A 4JY6A 3ULVH 3PP3H 3NIDB 4XBPB 3C87A 4D9LH 5IB3B 1IC7H 4H1LA 5AZEH 3WE1A 2B1HH 4JRXA 2X38A 3DJ9A 4H88L 3ARZA 3T2NL 4ZMNA 3FRUA 1YEFL 1DN2A 1YEWA 2QQKL 4X42A 1E8XA 4K5OA 4XO8A 2BNUA 3O0RL 5IB3A 4WI9A 3EYOB 5CKGA 3AADB 3FU9A 1ORSA 4KZEL 3ETSA 4XCCH 4KPHH 1N67A 5C7XL 3RB7A 4TNFA 4RGMC 1N4XH 3I9PA 3UTOA 4AL8L 3EYOA 2XQ0A 1L9MA 2GK0B 1JPFA 4OZHA 3VSUA 5KANG 1OARH 1UH3A 4AQ8C 1F86A 5HD8C 2HJFA 2ARWA 4NQXB 5CGYC 3ARFB 5E2VH 4UOW0 5D55A 3BSZL 2WSPA 3HTLX 4HIXL 2EVIA 3KHOA 4BCZA 5JPMB 4Z95H 5CM1A 8CGTA 5SWSB 1A6TA 3S2AA 1VAHA 4HK3N 4NQXA 3GLAA 4B0MM 4YHIB 2HLAB 3ARFA 1C12B 3QNZB 4RH4A 4XMPL 4LAQH 3K6OA 4RMVA 4L0PB 3N1QC 4G59C 2AS5M 4OM1L 5G2NA 2XZQH 4HG4J 1I8LA 3EF7A 5E5LA 4ZJ9A 4JFVA 1G1OA 1E4KA 4YHIA 2HLAA 5F1SA 1C12A 3WUWA 4EXKA 1J1PL 2KZWA 3QNYB 5BZXA 5D1QB 4OF5A 2YUZA 4D0DB 5EOCL 3MLZH 2B15A 4OLZL 1TVDA 4ZX6A 5LGJA 1PW3A 3QNYA 4E41E 1AZRA 4F58L 2BERA 3UIZA 1JK9B 5HHXH 3IAPA 5DHVH 1PFCA 2D7TL 4YHPB 4L1DA 5DJ2B 5L2JB 1E42A 1Z6JT 1ILSA 4IGBA 2B9AA 4OGQC 4QWWC 4W1TA 3TVMD 5H4ZA 1OAXL 1IC0A 5AFAA 5KVFH 2NT0A 4YHPA 5L2JA 5DJ2A 3ZDXF 4YXKL 3FQWB 5MEPB 4UQBA 1E7VA 1RJYB 4NGHH 4BXVA 4ONFH 3O8XB 4KROB 1FRGH 2BZ7A 2F9BT 3ARXA 3ZQ9A 3CVIL 4L3FA 3K8MA 4NAMA 4K3EL 4OZIE 1XR9B 3KL5A 3OMNB 1FN4B 3LNFA 2B2XH 5CP3A 3CC5B 5E23A 4FQ2H 3RGVA 3GRWA 3H6AA 2NY7H 3CZNA 4DF9A 2V17H 2X4TB 1J5CA 4YX2H 5JOEA 3NSXA 1XR9A 3DX8B 2BFVH 2JJUA 1FN4A 1HHGB 3CC5A 3K71B 4WU7B 2DS4A 2YAMA 5DVKA 5J06A 5KVEE 1UJ3B 5DFVC 4LLMB 3SD5A 5LO7A 2X4TA 3HNTH 2MPAH 5IK3B 3DX8A 3BRFA 1MCDA 1GTNA 1HHGA 3U9PH 3H9YA 1KLGB 3C5SB 2ADIA 4WGVB 4ZK8A 4E41D 4PJDF 1ZK9A 2XPGB 1P84K 4LCIL 3QORD 5F89B 3QNFA 4M62H 3K2IA 3NH7H 3QQDB 5SX4I 3HS8A 3CQQA 2G0LA 3KM1A 4WUUE 1QNZL 1KLGA 3C5SA 3RY5A 1TZIB 2CHDA 2XPGA 5DUJA 3MJ8B 2VZTA 5F89A 4F7EB 1H6FA 2EYRB 4GH7B 3QQDA 4FQLH 5BVJB 3JTSB 4PV9B 2ZYSA 3MBEB 5KVGE 4I0PA 3RX7A 4X6DB 1TZIA 2C9UA 4K23L 5HY9B 1JZ7A 2N3JA 3MJ8A 5DHEA 4U31A 3OKKB 3SKJH 2CZNA 3WYRA 5F6IC 5FUZH 2ICEA 3JTSA 3ARRA 3VDBA 3MBEA 4NFCA 1MPAL 1WHOA 5HY9A 2WUCH 3NFPB 3TJHC 3OKKA 3C09C 1U2HA 1BXVA 4FEMA 1SLXA 1UC6A 4KK8C 4LHUG 5GS1B 2NY6D 1IQDB 3MV7B 3S8FB 1FO0L 4FG6C 4BQ8A 1U92A 3NFPA 2BIIA 3D3VB 4TV3A 5L4MA 2JIXB 3POHA 3NA4A 4G6AD 4H0HB 5D1ZD 3SBWA 3UEZA 2FRGP 3VE0B 2C3WA 3MV7A 4TVSa 1FNGB 5F7BA 2QT6A 1F90L 3D3VA 4O4YH 2JIXA 3QIWC 4DP6X 1BF8A 1CDBA 3VCLA 3RIAF 3FU8A 4OVVA 4TVUA 4OCXH 1NAKL 3TIDA 3VE0A 2UWEB 5TK4A 3ECQA 4EIUA 3ECBA 1UB6B 3COOA 4F15B 4WUUD 4NM4H 2DLGA 3ZE2E 4JKPH 5C08B 3KPSE 1WA2X 3IKCA 5KVDE 1S7TB 4N2HA 2Y22A 4OCLC 2CRYA 3F6IA 5FHAL 4DPBX 1OCWL 1N2RB 2MH4A 4JRYD 4XRCB 1UASA 4XMTA 3C5ZC 2FJFB 5AVVB 5C08A 2E4FA 5DD6B 4G6FB 2E9IA 4OSUL 4PRHA 1S7TA 2UZIL 1LP9B 3US1A 1T4KB 5AD0B 5TDPB 1N2RA 4YOKA 5IESL 4JFYA 4G6MH 3CVBA 1A25A 2FJFA 1OT4A 2VAAB 2Z34A 4QJ3B 5IBTL 4G80B 5DD6A 4R8WH 1WGOA 3VFGL 2FBJL 2GSIB 1OCRB 3DJSA 4YH6A 1QBML 1T4KA 2A2QT 2BVUA 4DGWC 1V8HA 2IV9A 1PG7H 2Z9TA 2J5WA 5HDQL 1I9EA 1PTZA 1EH9A 2OM5A 4KH2A 1QTSA 3EZJB 3OD3A 2F8XC 2B77A 3NIGF 4G80A 4XNAA 1KXTB 1YN7B 5DJYB 3PQYE 3U0WL 4OF0A 1ZKAA 2J1ZA 1KACB 4QF1B 1TZGH 1EHAA 1BVKA 4L8SC 3SB3A 3UIYA 4G9FB 1XHHA 3F84A 5D1XC 2C1PB 5FUCC 3PWVB 4K07A 3SGEI 1QUPA 3I2CL 4LHQB 1L9NA 1T5KA 2GKIA 2WTOA 5DJYA 3MTXA 1CF8H 5GS0L 3GBMH 3C60A 4QF1A 4BBWA 1SY6H 1S3KL 4G9FA 1OAZL 4Q6KA 1NIFA 4QOKA 2K7PA 3PWVA 3TBYB 3CXDH 2A1WL 5DZNA 1E5BA 3KPSD 3VMPA 2IMNA 1U91A 1DLFL 2WP3T 3HFMH 3QDGE 1N70A 5E6IB 4C47A 4EN3C 3TBYA 1PYWB 1MSPA 2BP3A 5I0DA 3Q5YA 1I75A 2CHZA 4CRPA 3KS0H 4FI7A 2APXA 2C3XA 3L3KB 3PGFH 4K5PA 3EDFA 1S7VA 1AAJA 1U58B 1JP5A 1TQBB 5BVPL 3CXHK 4KY2A 4P0DA 4UQEA 3PP3K 4ADJA 3IGAB 2WBWB 5E6IA 4IMKC 2W9DL 2AK1L 2YD7A 3G5VB 1EEYB 2JI1A 3GJEB 4NQDE 4OD3H 1YMHB 3L3KA 3SDDC 1U58A 7CGTA 1KPRA 1K6QH 4AGMA 4UTBA 1ZCRA 1RZGB 4MXVE 1I9JH 2FHFA 2X42A 3IGAA 4R90L 3CMGA 5I1GL 5J5EA 2YAQA 4OCWL 5DI8B 3P4MB 4RAUB 4H2CA 5KW9H 3GJEA 1QFOA 4JFSA 2VW4A 1XF3B 1YMHA 3LNGA 4TUJA 1A8JH 5GS3A 2DQFA 4TVPL 1T89A 3PQYD 4WWKC 1UUNA 5DI8A 3AG3B 4RAUA 5BRZB 2BVTA 3CN0A 3AXIA 2I5YL 3UTTE 1KTDB 3J27A 1XF3A 3RVXC 5FC9A 5I9QC 3VD7A 1W0WB 2EYSB 2BSED 3F12B 3WIIL 1YEDB 4HULB 4XGZB 1RUPH 3ZRSA 1F11B 1K4DA 3LS4H 5CEZL 3GKWL 1S7RB 4ACTA 5BRZA 1YEKH 1OLZA 5F3BB 3B7RL 2Q7NA 3O6FC 1A5FL 1KTDA 1MLBA 1Z3GL 2FX9H 2XA8L 3K8LA 2A4CA 2EYSA 2YD9A 3F12A 5H37A 1YEDA 2QFPA 2VMEA 3V0AC 4RGOH 1F11A 1FG2B 3JZYA 4U1NB 2QR0B 3SDXF 1ICTA 2YKLH 3TEWA 4H8QA 1F00I 3QDGD 2QADB 2WPGA 1D9KD 3B8SA 5TE4L 3BDYH 2DI8A 1CQYA 1GYVA 3DX6B 4NZRH 4U1IB 5IHUH 1I4FA 3N9GL 4HPHA 3RY6A 1A7QL 2G4GA 3TPUB 4LPUA 4O00A 3TWYA 4OY9A 1XXFC 1BVOA 5ISZB 3SGJA 2R1XB 3ASNB 4NQDD 3HI5H 5EZJA 2CLZA 1MCKA 4M1GL 3EAKA 4LCYB 4QJ5B 5DFTA 1SJMA 3DHMA 4JANA 4NYLB 2HKHH 5DUPH 5EOQL 5D71L 3VWJD 2E7LA 3DURA 4UB0L 5DTFB 5FS5A 3AT0A 3BN9D 4HWNA 4X0KA 3LN4B 3EW3B 3D69B 4LCYA 1I7ZB 4QGYA 1GGIH 1SXBA 4DAGL 1I8KB 1W91A 4YVUA 5J3HC 5HGAA 1L9SA 2EEDA 3QXWA 5BZWB 1CCZA 1TTCA 3UTTD 3ZYIA 3FQTB 3QRBA 1PX3A 3D69A 3SDAB 1I7ZA 1I8KA 3RX5A 4ANXA 1MEXL 2PXYA 3FTGA 3UGUA 1PEWA 1FZOB 2EIEA 3OKLB 2CH8A 3T6QC 3KM2A 3HAEH 3K2KA 3FQTA 4N3UA 2H6PA 1F41A 1NMAL 1OE2A 1BZ8A 1RZ8B 1XXDC 4D0CA 2I69A 4AJVA 1E8ZA 3VX0A 4QHUB 1MQ8A 7FABL 3OKLA 4N0YH 2XWJA 1GC1H 4MAYB 3RVWD 4PW9A 1R1CA 1AR1B 2WKOA 4QNPF 1RZ8A 1Z0NA 3S9DB 1TVHA 2YKKA 3NEXA 4YZWA 4PJ6A 4OLWH 1RP9A 4A7QA 4XC1H 4PQXA 1NICA 1XQ4A 2F8IA 5HGHB 1OSEA 7PCYA 1XCXA 3WKML 3ZX1A 2LGNA 4G6JH 4Y5YC 2BP5M 3SE9H 1G9HA 4FLRA 1I9RL 5KSVB 1AHWC 4LO9A 3HE6D 4JFEB 3OR6A 2NZ9C 4LDOB 5HGHA 5ANMB 3F58H 3WHXB 4FYSA 5EN3A 3KR3H 4FL4C 4XVSL 4HV8B 1OM9A 2R69L 2NOYA 3SOBH 2RCSH 3NDYE 5JR1H 2NR6C 2LV4A 3BQUD 1FC2D 5EU4A 3NJMA 3MNWA 4LLUB 4NBXB 2WXHA 3WHXA 1HH6B 1ZY9A 2WK2A 1L0QA 3RL1B 1F56A 3B9KB 4ZX4A 1A3QA 5KVEH 1HZKA 5FM5M 4B3EA 2DICA 3T77A 1DJWA 4LLUA 2M1KA 4UAOB 4ANVA 3MUGA 4UUJB 3GFUA 1D5XA 3DPDA 3T3ME 3RL1A 3EYSL 2YZ1A 4GEIA 4RISL 5DJXB 5DS1A 5I6NA 2ZZUT 1ZTXL 1Z9NA 5IQMA 4PIRF 1OB1B 3IXTB 5ECJE 1YEIL 4FFVC 1XD1A 4UUJA 2PTVA 4LNRB 3IMTA 4R7XA 4E9TA 1ANUA 3KWUA 5DHVB 4MRCA 3MCLH 2VMJA 2E5EA 3SPJA 1OB1A 1U8JB 2ITEA 4FTVE 4X8GA 3UC0L 3NPZB 4HJGB 4LNRA 4WV1C 5DHVA 4KUZH 4LEOB 5KVGH 1TF4A 3FH7A 1A4AA 2UXVA 1HL5A 4EKXA 4M8VA 1B4RA 1G5GA 1XIWC 4ODTH 4OZGF 1OCOB 2IQAB 1PSKL 2ZT9C 3H9SA 1EAJA 2VSMB 3QEHB 4F5CE 1MCNA 4ZFOB 5TGBB 1AI1H 2PO6A 4DGYL 2DQUH 1ZSDA 3A4FA 4W6WB 4BKLB 3WO4B 3QEHA 1DVFD 4ZFOA 4FKHA 1JXFA 2C7UA 2XTJB 2ZOKB 3CDFA 1F1GA 2J43A 5EA0H 5LGYA 4AKQA 3BCDA 4P5RA 3KCWA 3L5WB 1B0RB 4CVZB 1KXVA 2R0ZL 3Q7JA 1RZJC 3THMH 5EZIL 3TNNA 3VRJB 2D9QB 2OMVB 5DJZB 3MGOB 4Z3TA 2F18A 2WQSA 4JG1L 3TV8A 1YG9A 2DMGA 3L5WA 2ZOOA 4IBZA 2Q8BH 1C7SA 5K9KB 4DQAA 2XV0A 2Q5BA 4CN4A 1TG8A 1LTXA 1UVQB 3QQ4A 4XZ4A 4RVBA 3VRJA 5KVDH 5HI4D 5DJZA 4K7PH 5B8CA 5CAYB 2X4QA 5F1OB 3LN9A 3K1DA 1A6WH 4LPYA 1RU9L 2E9WA 4MJ6B 1IGYA 3S37L 4RSVA 3R0MA 1UVQA 2PR4L 1WJ3A 1YDPB 2Y1YA 3WIAA 1BYOA 5AKRA 2Z1KA 4L8BA 4QI3A 1FPTH 1MFDH 5A2LH 4OM0H 3HBZA 2QQQA 1M53A 2VITB 2IANB 3NP3A 1VEPA 5AW7B 1ML0A 2VLJE 4HKXB 5I1HL 4JPVL 1VB9A 2AEQH 3C75A 3DJRA 4NAQA 2VITA 3AG2B 4U1MB 4XPBL 4HZLB 3DO4A 3WS3B 3P30L 5B21A 1CO1A 1FL6B 4NZTH 4IOFC 1N6QL 5KYUB 2YRLA 3PGDB 3A6CL 3KVDD 2BP8A 1W16A 4WTWA 5FF6B 4JFXB 2EE9A 1NMBH 3KYOB 1XFPA 4N6QA 4KTGA 4HOXA 4MNHA 4U1MA 2H2PC 2WCSA 5D9SB 2OYKA 4FQPA 4HZLA 3O6KL 5CHNB 4HD9A 1FL6A 3FC8A 1GHFL 1SUHA 4P4KB 3ZK0A 5KYUA 3L2NA 3PGDA 4Y4KD 1OQXA 3DARA 3LNDA 1I3RB 5BQDA 5L2KA 3UBXB 3KYOA 3ZE0E 1SLVA 1T0MB 3UG5A 3A23A 1A6UL 3JVGA 3TCTA 4X4ZA 1T04A 4P4KA 3DSFL 3BEVB 5D7IA 1WAAA 3L48A 3X1NA 1I3RA 2Z91B 1IKFH 3UBXA 1F8TH 3G5ZA 4BFOA 1NWPA 3T1FB 2X89D 3ZT5A 1OZTG 3RAJH 4RAHA 3RJDA 5KYNA 2YAFA 1ESOA 2Y2YA 3LZLA 2PPFA 2VSDA 4LBEA 4OVUA 4WI6A 2ZYHA 4PJGF 4G72B 4NRXB 4RNRB 3DUUB 2YPVL 2CGRH 4LLYB 3T1FA 1PX4A 4EDXB 4GRMA 3VGBA 5GHWL 3K4ZA 2DQDH 4Z7QF 3CMOH 2G5UA 4NRXA 1E2VA 4RNRA 4XBEH 3OMAB 4JKNA 4PWKA 1G84A 2EDFA 3DUUA 3BCFA 4TTDC 1YN6B 4PJHA 5CBAB 4F8PA 4EDXA 4M1CD 1ZHBA 4QRPE 3LRKA 1XGTA 5F9JA 1NEZG 3GK8L 4Y2DA 3V4VA 3NZHL 3VRLE 4AIOA 4ZG1A 4L9DA 2HVJA 4Z7IA 1G9EA 4J5VA 1QD0A 4Q6IB 4X5LA 4K4KA 4MS8C 1TMQA 2Z8VC 3TF7C 2E3VA 4RWHA 4AYDC 1NGQH 3L45A 5EUKB 1CR9H 1G9MC 1HH9A 3A21A 5H94B 2I60H 4HA1A 4Q6IA 1H3PH 3LZQA 4Y0GA 4I13B 2ZOTA 4DNLA 3RFZC 5AW0B 2XWTB 5K1JA 2IF7A 2ZAHA 4HIIB 4Z3JA 1IM9D 4TF4A 2ICWJ 5EUKA 3T6WA 1T21B 3OF6A 1AZVA 5E6UB 3EOBB 4BJLA 4FYQA 3ZL1A 1BOYA 2A7BA 2WQVA 1LK3H 1SY6A 3B2MA 3FBKA 3NGBB 1IL1A 3GHBH 5D5MF 3V0GA 1T21A 4RA0C 3AAZA 4PJCA 3EOBA 3Q48A 1D6VL 4C59B 1GKOA 4XVOA 1VESA 4K7FA 4Z6AT 4LBAA 1JRHI 4BIKA 4TSCH 4X5QA 2WBJD 3P1VA 3CUPA 4FFTA 2VQ4A 4GOSA 3SE3A 1INDL 3L5IA 1DFXA 1JOIA 4JJOA 2H2SD 3EFOB 5GS2D 2HG0A 3V5DB 3VH8G 1YEGL 2ZCLH 4RGNC 3DRQB 1G7MA 2VDQL 1GXEA 2P1YA 2R56H 4DP4X 4UTAH 3MNMA 4QRPD 4F8NA 2COVD 4NLAA 3NPSB 3EFOA 1EX0A 5CJBA 3V5DA 1JZ8A 4ODHL 4E5XG 4GP4B 3ULUC 1UYWL 2Q87A 3H6JA 5SX5H 4DQOL 4ZW3A 4L8CB 1UA7A 2BDNH 2DLEA 3V0JA 5KUMA 4AYEC 3U1SL 4RDBA 3TP4A 5LNDA 2VXSL 3OZKA 4PS3A 1SXNA 1JFQL 2X4UB 4XWGL 3DUSB 4PUBL 4UNUA 5ILTH 5E5MB 4YL4A 5HXMA 3TCXA 4ALAC 3GSQB 1B4JL 3RX9A 1FFPB 4P5TD 3TA3C 3BE1L 3ROOB 2X4UA 4XVTH 1AGEB 5TF1L 4YHOL 4DIXA 3H4HA 2CIIB 5E5MA 1OGPA 5KYWB 4FXKB 5TPWH 4JMXA 3GSQA 4QYOA 3V4UH 3WNLA 3G5XB 5A2JH 2VN4A 3TIEA 1H3TA 3DJTA 4TQIA 1AIFB 2CGYA 3VNYA 2CIIA 4KKAD 4BUQA 3TVMB 1R5IA 1XX9C 1J0HA 5KYWA 2V2XB 3AQZA 4FXKA 3ZRFC 4PGEA 4JKWA 4PJ8D 2W88A 4KJWC 1BQLL 2VDRL 3GB7B 2HFFB 2JB5H 4KX7A 4P59H 3TVMA 2V2XA 4DKFL 2VMFA 3JUYA 1NWOA 4L3AA 1ZE3H 2RMNA 3FSWA 1WISA 2VXQH 3NTCH 4GO6B 5C09E 4Y4HC 3WFCL 3IMWA 2HPTA 1XMEB 2Y72A 1MOEA 4O58L 4R2GD 4BDVB 2ZX6A 1YUKB 2LAAA 3PNWB 4NT6B 3CNKA 3IPFA 4XPHL 5F9OL 5CZXD 4C83B 4MD0A 5MENE 4X83A 5IWLA 3MUHL 2UX6A 4QXGL 1G6RH 5DVLA 2R4RH 4DJMA 1DVUA 4TULH 4JFHE 4BDVA 3OGOE 4NT6A 3PNWA 1CGTA 2F8OA 2N7BA 2PWEA 3EDEA 3QEGH 5AOJA 1PS3A 4C83A 3N5AA 1CXEA 1IEAA 1IZKA 3GUFA 4IOIB 4N8PA 5CJ8A 5JMRA 3HAEB 4L8DB 2NXZC 3HC2A 5L6YH 3FSZA 1D7CA 4E41B 3TBBA 3PHOB 1ADWA 3HMXH 1Q4NX 1AJ7H 1JUFB 2N01B 2NY0C 1J9QA 2JKIS 2OI9B 3MRNA 2W65B 4GQZA 4H0IA 5IIEB 3O2VL 4HWBA 2WQXA 5AAWC 2OMWB 4AYMC 1INEL 2ZWZA 2AGJL 3V6OC 3NFSL 3M17B 4E41A 2XU9A 3PHOA 3QORA 1JUFA 1DJZA 3LKQB 2W65A 5IIEA 5MP6L 1RMFL 4WO4B 4JG9A 3VFMB 2OMWA 1FE8H 1IIKA 3MACL 5TDOB 5J56B 1T22B 1SEQH 2A74B 4R4FH 4WW2F 1WDAA 3KEDA 4PIBA 2G60L 3LKQA 1PJWA 3ZJAA 1HJBC 1G5AA 3VFMA 4XPTL 1Z0MA 3BVTA 5TDOA 4H5SB 1EPFA 1T4WA 5CILL 4OZIB 3ZZSA 3POCA 5I6PA 1A0QH 1WT5A 2I7SA 3EYUH 4HJJH 5C09D 2IWEA 3UPCA 4D3CH 2ADJA 4G7QB 3WNPA 4LIQE 4N85A 2OQJA 2NY6B 5MEND 3FFCE 3MRBB 5E51A 4OZIA 4BCYA 1UTDA 4NO0D 3FO2A 2FGWH 4TNGA 1ZXKA 5DMYA 4JFHD 5DMGC 3CX5K 5D1ZB 1NM9A 5B4MC 4KNQA 1TQUA 3MRBA 3CV5A 4MXWL 4EAEA 3EJUA 1WV7T 2R29L 3FUKA 2AKRB 5J1AB 2WMPA 3PP4H 4IQHA 4X4ME 3CLWA 3GLZA 1SN5A 3AITA 5CIPH 4DP9X 2JB6B 1XR8B 3IDGB 1GYAA 3X17A 1ROCA 4HU2A 4TPRL 1FCCA 3L3GB 4XX1G 4XC3L 4NJAL 2JB6A 3IDGA 1FFTB 3QR2A 1KXHA 1TQVA 3GRBA 4X99B 1SHSA 4XNMB 3CFDA 5KJ4A 3ARFC 5I30L 1OGTA 1CXFA 3IU3A 4WUUA 1AFVL 3L3GA 2BHUA 2LTQB 4QTIH 1DYZA 1MIEH 4WUKL 3TYGL 1QI4A 5G55A 1I8LC 3QR0A 4HWEL 2J1KA 4X99A 1E4KC 3OKOB 1N10A 4JRYA 4NP9A 1WIOA 3BKJH 1C5DB 1J5OL 2EO7A 1MY7A 4L9LB 5ESQB 1CLZH 1HZHH 2FYYA 5DWPA 2NNRA 3HZVB 5I6XB 4YWGH 3LS5H 3ZTJG 4AG4L 2ZP8A 5I18L 3BWAB 3G08B 4B60A 4EOWH 3VD4A 3I74A 4QXWA 4Y7MA 2X0VA 1C5DA 4OF7A 1IGML 3UBXI 5IVZB 3HZVA 4ORGB 3ZDZE 1JF1B 2C4XA 4QTFA 1BJ1H 3G08A 5F9AC 5TD4A 4YHKL 1TVBB 3SCMA 3PUCA 4JY4B 4OQTA 4ZUVA 4IGBC 1EJ6A 2CLRB 4MJ5B 4ORGA 1JF1A 4PMFA 1T1ZB 2J7LA 4YE4H 2E27L 3TX4A 4HPYH 3ARGD 3QO1A 2IPUK 3FHEA 1PZ5A 2O26U 2A6KB 3ZR6A 4JY4A 4IBLT 1M56B 1OE1A 2CLRA 4MJ5A 4POZD 4AUYA 5K59F 3AMKA 4PV8A 3NSDA 5FM8A 1QBLH 1T1ZA 5BS0A 3ZE2B 3BWZA 3GXMA 4WK0B 3KPSB 4MVBD 3CZSA 1XB8A 4HK3J 2V9UA 4AEFA 3IT8D 3RGVC 3QYCA 4N2LA 4KROC 2R0WH 3AS3A 2GIMA 2X7LA 3KPSA 1EZSA 4ZMAT 2DEYX 4H20H 1SJXA 1O7DE 5CCGE 4EZMA 1NCNA 1ZEAH 4S1RL 2GY7B 1UZ8B 4YSAA 1KJVA 3GSOA 4J3OF 4A63A 5GS2H 3DVNB 3VI4E 2L7JA 1EZLA 3QJXA 4NHCH 1HHIB 1N5AB 4UNIA 1AQHA 1Q0YH 3PNRB 2NXYD 1MJUH 4F7MB 5I8OH 5LB1A 3LDBC 2DMKA 1S5IH 1X5IA 3DVNA 4Y1TA 4EIZC 1QPKA 1A1MA 3AXLB 1HHIA 1N5AA 3IFPA 5D7JD 1WUZA 3S3SA 3ZQXA 2C4FT 1UM6L 2TSBA 3GSNL 3PQYB 2ZXWB 3DXAE 3FT3B 3WSQH 1DBBH 3N2JA 1I85A 1F4AA 3MMEB 2AJ3B 4KQ4H 2DWEB 3NJNA 3PF2A 5CJ5A 2FUQA 2C7FA 2CR0A 2GCYB 1K4CA 1L3NA 3PQYA 2WXNA 4I0PC 3VFVA 3GUTB 2DWEA 1OWWA 1I1YA 2ZONA 1EHKB 2OCCB 4N20A 4L05A 2BS8A 1D2OA 3TONA 1SF3A 3US9A 2P52A 3VFNA 2BSEA 2ICEC 2IG2H 2WANA 3QEQE 4BSVB 3P0VL 4JO3L 4JCWA 5EZOH 4BKSC 4X4YB 5ID1B 3FULA 1E5AA 3GUTA 2O1AA 2GBUA 4Y2NA 5FYKE 1ZVYA 2ZKXA 5SWQB 4X9GA 5I1AB 1KBPA 3QDGB 3HS0B 5EHFA 5SX5K 4AYID 3ZMRA 4IMLA 1RPQA 5LXGL 1RCYA 1XGZA 2ZX5A 3FSAA 2V9QA 3QDGA 1RZIB 2P47B 5I1AA 1D9KA 3WIHH 4F33B 1FC1A 3SBWC 4JM2F 3MOQA 3U6XS 4PI2A 4A2LA 3KDMB 4PEEA 2CGZA 4NQDB 3SHSA 4HFWB 3TOPA 3FHAA 2A4EA 3BAJA 3LIUA 2YRBA 3QFJA 4A7SA 1YJDC 2VKWA 1CFBA 3K3QA 3MHZA 4JCLA 4PV1C 2I26N 3UOAB 1COBA 2N59A 4AE0A 4F33A 3VWJB 3FQNB 4NQDA 2W60B 1L6PA 1VACB 3SSGA 4Z7NE 3JWNG 3QXTA 2OMBA 1CK0H 3Q1EA 1FAKT 1U8QA 3QHZL 4KO9A 3HCVB 4JHWH 4Z1PA 3DXAD 2FBOJ 4FFYA 5EO0B 1W6LA 4YHLL 5FLVA 3VWJA 4S0SD 4YPJA 2W60A 2XZCL 3CFJB 3UTTB 4H2AA 5FGRA 4F8TA 5FHBL 4CU7A 3HUJE 4KJPD 2J6EH 5HHME 4F15C 5DZPA 3HCVA 2K4AA 5EO0A 4WWPA 1J9SA 3O2DH 2APTA 4U7MA 3CFJA 5C86A 4MXQD 1KIUA 3H2WA 3QEQD 2VDKL 5T3XL 2JKSA 1EDQA 3N3EA 5BMFH 2H1PL 4NKIL 2Y7LA 1Q38A 3QFDB 2ENJA 4WKZB 1Y1DA 2WLLB 5DF0A 4FF9A 2JCCE 1RIUH 2FEEI 1AZCA 2B16A 2GJZB 2AEPL 3CGTA 2DD8L 2X12A 3BEWB 3PAVA 2WIMA 3EOTH 2EXTA 4K8RC 2WO4A 4OFYD 1MFAH 3MLRL 4XB8A 3H3KA 3QZWG 3BMWA 3BSHA 4YSQA 4KRMB 1MHPH 2DDQL 4H13C 4MS6A 4U7KA 2YD0A 4OAWA 2QTEA 3FO1B 4OKVB 2GJZA 5DJAA 4NZUL 3F6JA 3VRIA 4A39A 5IQ9B 1ZIAA 3GMRA 1SOQA 3BP5B 2NPLX 2BIPA 4PJ9B 2LT9A 4ZAKC 3REWB 5AOZA 3HE6B 1ONQB 3FO1A 4PS4L 5JW3H 4JO1L 5IQ9A 1NBQA 3C60C 1C5CL 5IB5B 4W9EC 1JBJA 1A6VH 3TFKD 5SV3A 4JFQB 3REWA 3RKDC 1AHMA 1NOFA 3S36L 3QQ9C 1MIMH 5F96H 1NCAL 5GRYA 4DTGH 4GYBA 4UTAA 2W9EH 3WKQA 3OKYA 3P02A 1UT1A 5LNGA 2WBXA 3ZKSD 5I2IB 5IB5A 1KYAA 4WGWB 5F93C 5HHMD 4JFQA 1R3KB 2WCGA 3Q2NA 3BQUA 2EDHA 3AQXA 1TKWA 4YDVB 2B0SH 4JMNA 3REVB 1FJ1B 2OSWA 2C3VB 5F1IA 1CBVL 3PU7A 5HP5A 3O0LA 1T5XA 1BEYL 3IFNL 3QCVL 1XB6A 4JPWL 5EC1A 4N4YB 4AQAA 5I2IA 3VFRA 2XBZA 1IC5H 2RA1A 1KGCE 5E6IC 4KMLB 1SYSB 2BS9A 4YDVA 1K9TA 5A2IH 3REVA 2ZJSL 2Q20A 1OAYL 2OTWB 4MWFB 1XO8A 2B8OT 3EHBC 4JVWA 4KK6C 1SYSA 4HF5L 5B7MA 4WI4A 2ALWA 1OSZA 2PCXA 1CS6A 1ND0A 3LZFH 4NB7A 5SV4A 3RUGF 3Q1SH 3R0NA 4HPOH 3Q01A 5F1KC 3G6JE 1NBVL 1T89C 2VJ0A 1U9KA 2OS7A 3LEYL 4X6CF 5GGSY 2APWA 3GXDA 2H3XC 3UP1A 4PY7B 3LQAL 1R5VB 1U41A 4G82A 1EMTL 4ERSL 1NC4A 1NJ9A 4PJBE 4NHUB 1DL7L 4M3HA 2HPOA 4LIQH 1QBAA 2YPKA 1R5VA 4GKNB 1XMWA 3O41A 1X4YA 2P4AB 3TO2B 1E4XI 1MFBH 1DVFB 4NHUA 4JO8A 2VXQA 1G6RB 1JVLA 3UAAA 1YYLL 5DLMH 2JE8A 5GGRY 3TO2A 5AVWB 5B1BB 3LHPH 1WWAX 4WHTA 4PJXA 1DVFA 2R0KL 4G42B 3T3MB 1M42A 1G6RA 3RY6C 4YHYC 1E4JA 5T33L 4JKMA 4K9EL 1KGCD 1ECYA 3QJVB 3SGJC 3CXFA 3MXWH 1OIOA 4TQPA 1JD9A 1PY4A 3KGUA 2C9SA 5EBMB 3DUHA 1FGNL 1YEEL 3S2CA 4FTVB 5CZKA 4JDTL 2E7LC 3HG0A 3HMXA 2OMUB 4BWUA 4YQXL 3FUHA 5FYJE 2LU3A 2XTSA 1EERB 4ISVB 5EBMA 2VN3A 2EE3A 2BIQA 1QPXA 3ISWA 4RSYA 1EAOA 2WO3B 2Z35B 4HKZB 4KMTH 3FOLB 1J0IA 2XJLA 4E42B 3BVVA 4BZ1A 3BVWA 3TWCH 1IBGL 2XA3A 1AXTH 4ISVA 4XX1E 4UI2A 3TFBA 2PXYC 1RPKA 2RBLA 2OW7A 2H0FA 2VIRB 1G4RA 3N42F 4UM8B 4K3HA 2YLHA 3GMOA 4E42A 4GO8A 4I4WB 5C0JA 2ZSVB 2I9TB 4U6TA 3KW8A 1CWVA 1NFDE 4YZFE 4F5CA 1KCSL 3ABZA 3ULVC 4YEFA 4CAGA 1IJNA 1TJIH 1P1ZB 3NJVA 1NBYB 2VIRA 2IAMD 2LQRA 2IWGA 4UM8A 2I9LB 1SF5A 2QZQA 4I4WA 4WEUD 2I9TA 3BJLA 5I74C 3QG6A 1EGJA 1RZJL 4DO5A 4X7DC 1WWWX 3UJTL 1RH8A 3KVPA 3T71A 1NBYA 3DX7A 1IE4A 1S46A 2V5MA 3U4EB 5KJRH 5A2FA 2I9LA 2P5EE 1PZUB 2BOCB 5I8EB 1AR1C 3FFDB 4Y4KB 5CIPB 1G7IB 1QACA 4ZNEA 4HX1A 5E8PB 3WXVH 1P7KA 4YJZL 4O2EA 1IGJB 2H0EA 4Y4FD 4Q9QL 4ZNCD 4B9IA 4Y4KA 3UYRL 2Y7QB 4ZMQA 4HZAA 4OF6A 5FYJD 3R19A 2FB4L 1YPZF 3CX2A 3NQIA 4KV5E 1WITA 4RFOH 1F02I 5J13B 4NUQA 4IBQA 4APQA 1W72H 1K5NA 1RHFA 2Y7QA 4LLWA 4BFKA 3FOMB 3P40A 4UWQB 1ZT4B 4L5FL 1ZHNB 3UGXA 1UENA 1A1NB 1IZJA 3CFUA 3QC6X 4NNYB 3H2PA 4PJFA 4ONOA 5DUML 3H7BB 2YK1H 2YR3A 5MI0B 1R0AH 1CDJA 1QVOB 4Z7UF 3IDJB 2VLJB 1LO4H 2V8LA 1MFCL 4AGPA 1T7VA 2JI2A 5F71A 3BOVA 4G43B 4NNYA 3KGSA 4UAOC 4ZZFA 5F7DB 1J9CT 3M8OH 2VXVL 4NNPL 4EDWH 3NA9L 3IDJA 1KLFB 1MJJA 4CBPA 1SJVA 4LARL 1JPSH 2X4RB 3MLXH 4XCNB 3U48A 3U82B 1RIVH 2A0LC 3WN5B 4G43A 1DR9A 5AVTB 3CZUB 3QCTL 5F7KC 4Z78B 4F37K 1A9VA 5F7DA 3U2JA 3SDYL 1AE6H 4I1NB 2EILB 1E4WL 2P5ED 1PNCA 3BFQG 2HTKD 2DTSA 5AWNL 3ZE0B 1EJOH 4P06A 2NQCA 1IM9B 1IBFA 3UG4A 3F01A 1TFHA 1H9VA 1AC6A 2DWXA 3QPQC 4M93C 4Y9BA 3UCRA 2WLMA 1JV5B 3ZRCC 3DECA 1HEHC 4WWID 4ILDA 2PO6C 2Z1PA 2OXHB 1ZGLA 5FYKH 4G7RB 1IGIL 1KN4L 1JD7A 1U95B 3NSFA 3WJMA 1JK8A 2FVNA 2WGNB 2VR3A 1JF6A 3ETBF 2A9AA 3OKMA 4P2YA 2OZ4A 1JV5A 4ZMTA 1FLTX 1USQA 2YHGA 2YARA 2FWUA 4KC3B 4ZFGL 1DDTA 2HMIC 3S3DB 4N1CA 1U95A 1OP9A 2D3VA 4JDZB 4N5EC 5I6OA 2AXJA 5AW8B 3U30C 1RLWA 2WBJB 3WO4C 3GDCA 3VAEA 2EE2A 2PP8A 4G11A 1N18A 4AQEA 4PW3A 4YNYA 1EHLH 4HXAL 1KXVC 2DWDA 2Q3XA 3D06A 4S0TD 4WI0A 5CNHA 4B27A 2C1OB 4W9IC 3L08A 5DGQA 2CD0A 3FQ2A 5IM7A 4PVNA 4QRPB 4PP2B 2O5YL 5AZ2L 3U7YH 1NL0L 2VXUH 4FQCH 1GW0A 2WTPA 4ONGL 4UOZA 1HSBA 2C1OA 3VXOB 4P3DB 2XN2A 1M7UA 5I16B 5B8CC 3D0LA 3WS6A 5GGTA 5C0BE 4DZ8B 2J57A 3DIDA 3RDTD 2HTLC 2ZKHH 3D52A 3GSVB 2XICA 5D70H 9PCYA 1SGKA 4KY1H 1DVXA 5D93C 4YO0A 3MRCB 3QYNA 1UD3A 2O5XL 4L48A 3EXLA 3HN5A 1JZ3A 4P5TB 3GSVA 3TEUA 5MEQB 1KBWA 3S34H 1ETZB 2XQYG 5FYLL 2HT3C 3MRCA 1DSYA 4XZUA 4ZXBA 1VLXA 4RZKA 3D5OF 4P5TA 4AMXA 5MEQA 1I9IL 2MRYA 2VTFA 1ETZA 4HOWA 4PRBA 1FZKA 5KANI 5F0LB 3V6FA 3Q9QA 1TEYA 2A9MH 4MJJA 1C9SA 2AXHA 4PJ8B 1CFVL 5JIDA 3ESOA 1MFVA 1GZPB 1IFHH 5B1JA 3U9UB 2EH8H 2CDEB 5IJVB 1R3JB 3UMNA 3O3DA 1F4HA 1QA9B 3KLSA 1KBGL 3WIHA 2ARJB 3ULUL 1KTLB 4BD4A 4PJ8A 1BX2B 3MBWA 5K9JL 3L4VA 2X0WA 2CDEA 5I1JL 3JVGC 3H8NA 4R2GB 4P4KC 3LHAA 1CICA 4BFEA 1KTLA 3N40P 4TQEL 2MCG1 4LEEA 2VABB 1BX2A 1UD8A 2L0DA 5C0BD 1CFSB 2CO6A 2EDKA 4Y9EA 2D7MA 4KVNH 1MVUA 4ALAL 1EUUA 4UIKH 3T8VA 3O11A 3PWLA 4RRPM 4ZS7L 1SLWA 5EU3B 2C3GA 1RK1B 2CM6A 1J48A 2EDTA 2VABA 3ZIMA 2Y69B 4EN2A 5FB8A 2R0LH 1DJXA 3GM0A 5DQJB 3WMPA 1KG0B 1P7QB 3QISA 3S5ZA 3EG9B 3U4BH 3CHXA 1RZ7L 4ELMF 3EH4B 3O81A 1F4YH 1BJ8A 1B3JA 2EDDA 1RK1A 4OTXH 3UJJL 5CUSL 2V3EA 4EI5D 4JAMA 1S78D 1KG0A 5JQHC 3EG9A 2IALA 2PPDA 5EEVA 4DOHE 3RZCD 4URKA 1J11A 2HP4A 4GXUM 3MLSL 4L0ZA 1BGXH 5A3ID 4Y2DC 1EANA 1NKOA 2CRIA 3UH8A 1D5IH 1TJGL 1TJXA 4KK9D 4N6RA 1X7QB 3RVVC 3VTTA 2KMWA 4UV7H 1WS7A 3DWTA 4QKXB 2IGFH 3QIUB 1RI8A 3AU1A 3FS9A 7TAAA 4BGDA 5KYXB 1E5CA 2N0KA 4P23D 3ZTNL 5IR1B 2JFCA 3DMMA 3RRQA 1X7QA 3TNMA 4Q6IC 4X9YA 1A9EA 1E9OB 3MYJA 4HBCH 3UO8B 5C09B 5KYXA 1FGVL 1B88A 3WFDH 1F3DH 3IU4H 1GMEA 1ZXQA 3MOBH 5ACZB 5MENB 1NCIA 1E9OA 1U3NA 4HC1H 2VWEC 1BP3B 4NO0B 4H0GA 4NN6C 5C09A 3MPCA 2XZAL 1KGIA 2PETA 2X0UA 2X40A 3SPVB 3O2WL 2OJZL 5KYYB 1JWSA 3NJIA 4Z76B 5MENA 1Q1PA 2GYSA 5IVXF 3QZOA 3ESPA 4NO0A 3SGDI 2J1XA 4WJ5B 3HG1E 3RL2B 1SFHA 4WZ9A 1ZLSH 3SO5A 4K3DH 3SPVA 2C9VA 2DQTH 2WNWA 2J5LB 3AB0B 3MLVH 4M3JA 3SE3C 5I1IH 4OBSA 3MV9A 3BIKA 3GS7A 4GUOA 3FMGH 1BMZA 1KENL 4MQXC 4XODA 4XPFL 4WJ5A 3RJQB 1P2CB 4JN1L 2Q6WB 3MA7A 4IIZA 3WNOA 1KT2A 4IS6B 1ZANH 4R3SB 1UH4A 3G3LA 3KLAB 1EK3A 3LPOA 5KVMC 5FOJA 1CYXA 1DQKA 2J8UA 4HLJA 4OCYL 2AABL 5E4AA 5FYJH 5ADPL 1OAKH 2W95A 3I50H 1BFOB 1P2CA 3T0XA 2PWGA 2Q6WA 4BEIA 1JS4A 2Z6FA 4PCSA 4IS6A 1EO5A 4WSGA 3D0VB 4LEBA 1WP6A 1M9WA 3QT2A 2GITB 1CBJA 3NPSC 3NESA 5T1JA 3CTTA 1QUNB 3GMQA 5DJ0B 4GS7C 2O6PA 5F9WB 3DROB 3Q6GL 1EEUA 3D0VA 3QIBA 1AS8A 2GITA 5C2BL 1AKPA 4XNYL 4HOZA 3Q8EA 5EV7A 1V3KA 4PVBA 3MBXH 2YN3A 1QUNA 3TYFB 4ADIA 5DJ0A 2YUWA 2HH0H 4MJIA 3FFCB 3ECUA 3VXQB 4M8RA 3GO1H 4MD5B 2XG5B 5FIEA 5HYJD 4Q52A 1BZ7B 3KLDA 4N2CA 1P4LB 4GNKB 3AUWB 2NLJA 5CINH 4XN8A 3ZTJH 3CFCL 4OF3A 2YOCA 4FZEH 5EF0A 3HG1D 3WNNA 2DIBA 2XG5A 4BK5C 1KGWA 3ARGB 3LV3B 4FXKC 3ZDXE 4OIBA 3SY6A 1P4LA 1U4FA 3DVGB 4N28A 4LOUD 5GJSL 4OCNC 2OPCA 4N2EA 4G8GE 4OLYH 5C71A 1JWUB 5DZ9A 3TVMC 4O2FB 4X4MA 2GEQA 3ARGA 3JWDH 4GT7A 3KW7A 3O3BB