3WTVA

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtvA00
3KZ8A 4AGOA 3D09A 2MEJB 2J6WA 4IBQA 5LAPA 2X0VA 2X0WA 3WTTA 3US0A 1HU8A 3Q01A 5A7BA 5KBDA 2VUKA 2J1XA 4IBVA 2BIMA 2H1LM 1KZYA 4LOFA 3D07A 2J20A 2YBGA 5AOMA 4IBUA 1EANA 2BINA 2ADYA 3QYNA 4G83A 2OCJA 1CO1A 1LJMA 5LGYA 1UOLA 3IGKA 3VD0A 1GZHC 1TUPA 2IOIA 4GUOA 4A63A 4IBSA 2WGXA 4IJTA 1TSRA 3ZMEA 2ATAA 1IO4C 3TS8A 2J1YA 4L0YA 1H9DA 5AB9A 2P52A 4GUQA 5AOKA 2PCXA 2XWCA 4MZRA 5BUAA 3D05A 3VD1A 3WTSA 4KVPA 3Q06A 3QYMA 5AOIA 3WTUA 5ECGA 1E50A 1HJBC 4HJEA 4IBWA 5ABAA 3EXLA 1HJCA 4IBZA 4AGLA 3EXJA 2RMNA 5AOJA 3WTWA 2IOMA 1EAQA 5G4NA 1EAOA 4L0ZA 4LOEA 1CMOA 2J21A 1T4WA 4XR8C 2AHIA 5G4MA 4AGNA 4IBTA 4MZIA 2BIPA 4LO9A 4AGMA 3WTVA 3Q05A 2GEQA 2AC0A 2J1ZA 3D0AA 2BIQA 3WTXA 4AGQA 2IOOA 4QO1B 4L18A 3IGLA 5AOLA 3US1A 3D08A 2J1WA 2XWRA 1GZHA 2BIOA 5G4OA 2X0UA 2FEJA 1YCSA 4IBYA 3VD2A 3KMDA 4G82A 3WU1A 4AGPA 3D06A 3WTYA
chains in the Genus database with same CATH superfamily
4AE1A 4E41D 2WUBL 3UCQA 2CNZA 3MOBH 4M6ML 2DIBA 2ALWA 5C86A 4WFFD 3B2UC 4YHYB 2WCPA 2CJTA 2GIYA 4FJYA 2DMHA 3HMXL 4P9HH 4BEIA 5SWZA 5IFHH 2XN0A 4Q9QL 3BVVA 5ESAB 4IU2A 2WUBH 4M6MH 3FF7A 3FT3A 2JKWA 2K3TA 4G80B 4G7QB 4L3EE 4IK7A 2VRKA 4A7SA 3OKLA 4HOXA 2WKGA 3ZE1E 3DPBA 4RAVA 3HMXH 4H8UA 3D50A 1SXAA 3LDBB 4OLEA 3F7VB 2VMDA 4YSDA 1UXWA 3LVTA 4D7BA 5ESVA 4Q74A 4NKDA 2VXQA 4XPHL 2EDXA 12E8L 3IJEA 5SWSA 4JCWA 2LE9A 1R3LB 2GW5A 3VXNB 3G5VB 5I76B 5KYXB 3E7JA 4LVOC 3UBXI 2DQUL 3U46B 1PZBA 3K0WA 3S8FB 1PQZB 4GFXA 2NY4D 5IFJB 1GZHC 4XPHH 12E8H 5F7FA 1HXMB 2GT9A 3MV01 3KPSA 3RVXC 4KMQA 1ZS8B 2DQUH 2XV0A 3DV6A 3BQVA 4F24A 1EXHA 2EDDA 4AXWB 5B1JA 2EDQA 4TXVB 2Z4TA 4JL2A 1NICA 3VRJB 2BNRB 1OF2A 1E5ZA 1FNLA 4JL1A 5FKAB 3QDME 3Q2VA 2IJ0C 3DX3A 2LTQC 3PNWA 1NC2B 1H3UA 1TLMA 3OLEA 3U0PA 5DURB 1J48A 1Z2KA 1UH4A 5DC9B 4HU8A 4PWJA 4MDRA 1JHTB 4W81A 3S4SB 4G1MB 3GS0A 2AV1B 2W9DL 4TNWK 4KKAD 3MLWH 4IMKA 4PJEE 3NJNA 2X6CA 1AXSA 1XO8A 4PTTB 2QPDB 2VZOA 3X3GL 1YPZA 2FBRA 3V5KB 3Q3GA 2W9DH 5EOQL 4N20A 4PJ8B 4KOCA 3P4MA 2NY5L 1TQCB 2LLLA 5C09D 5AKSA 4WWKD 3ZE2B 3X3GH 4Q9RL 2C4FU 3VI3E 3PV6B 4JM2A 5EOQH 1R5IB 2NY5H 5F9JB 2O4EA 3LZQA 4YE4L 3RA7L 3VFOB 3BQUA 1AHWB 5BOPA 4ZUVA 3ZYZA 1R5VA 4Q9RH 1NKRA 3FQTA 25C8L 3D0LB 2CLZA 4KKNA 5MI0C 4CSTA 2XYBA 4Z3TA 3JV6B 2Q86A 4N9GA 1ETZA 5CP3A 5E6UB 3RA7H 4CC0A 5BS0E 4RGNB 2ENQA 2KZWA 1TO5A 4DERA 3HE7D 1IAOB 25C8H 5L6YL 4F2EA 1HEZA 3L9RB 4GAYB 4PRNA 3EYSL 2VKXA 2XVBA 4RESB 1J0ZA 4ONFL 1JN6B 2F5AL 1X4XA 3KYOB 2NTSP 4HKXB 3R19A 3EGDA 3FO9A 1JUFB 5HYEA 4GXUN 5FK9A 2A4CA 1S5HA 2ED7A 3DRTA 3P2BA 4TLKA 5FYKD 5L6YH 4C4KT 3KBHE 2KERA 3EYSH 5HHQA 2F5AH 3WN6A 3OMIB 5A7BA 5BNXD 4H40A 1MIML 2AQTA 5FV1L 1HH6B 3L17A 5ISZE 1QBAA 3QWNA 2B14A 1HCVA 2XDHA 4PJCE 3UPAA 3GJEB 2WBJC 2J20A 1JYNA 1MIMH 4KHTH 3AU1B 3FN9A 3AREA 4XMVA 5IV2A 5J13C 3O3EA 3BXNA 1BF5A 3CDGB 2DLTA 4B27A 4YX2L 4KKPA 4YBHA 1ZT7A 3UC2A 1I7ZA 4GUOA 2LABA 2G9KA 4JO8A 2R51A 2XWEA 4BZ1L 3FCTA 4ZAKC 4YX2H 2CXGA 3HG0A 4E9TA 1FJ1A 5EA0L 1BJ1H 4PP1C 1ID5I 1BLIA 2HFGL 4UQIM 1CUOA 1NPNA 1XGZA 2V9TA 2CPCA 4Y4FC 2WNWA 4X50A 4BZ1H 4MQTB 2MWCA 4AMWA 3CXDL 3VXRD 5EA0H 5IOKA 2HFGH 4HMEA 2XZZA 4ZS7L 4M61A 3REVB 4FYSA 2F7OA 3CXDH 1B6UA 3CZSA 3MN8A 3SDAC 3NZHL 3GB7B 4ZS7H 3TURA 5IBUB 4P04A 2WQWA 2DM2A 1Y7VA 2JLPA 2P28B 5D1XB 4UQ2A 3TO4C 4N2IA 5J5EA 2PP7A 1NCUA 2KDYA 2F7PA 3NZHH 1QI4A 1MHHA 3ZE0E 4G7YH 5FYLL 2CHZA 3BZFA 4QJ5B 3VRIA 4OLUL 5I66A 3MAWA 2ZXEB 4YDVA 5GRYA 5GS2D 1T0NA 1MLCA 5IVZA 4MASA 3ZSSA 3WBDA 1QNIA 5HHVL 1P4BL 2WWMC 2XZAL 2E74C 4WU7A 5FYLH 5F0LB 4BKTC 4C59B 1JZ7A 1IC0A 4OLUH 5DJXA 2Q76A 2R1XA 5C9JB 4DEPC 1RZFL 1FPTL 3EBIA 3FHEA 3JWNE 2UXVA 3FH8A 5C0EB 3MBEC 3BAKA 2XXFA 2XQYK 5HHVH 1P4BH 4I5BA 2XZAH 1D9KB 1L0PA 3OAUL 4MQXD 4X7TA 5JUEL 4JFDB 1RZFH 4N2MA 5ERWA 1FPTH 2ZT9C 4NERA 4QO1A 1MJ7L 2HUEA 3VD2A 1QR1B 4JHAL 3UG5A 4YFDB 3ZVVA 3E8VA 3U4BL 3MUGB 5F1NA 5I0DA 4GI8A 4MNQD 4N22A 5JUEH 1AKJB 3KDPB 1MJ7H 2ARWA 4JHAH 3PL6C 1YAIA 3SBWC 3H3PL 3L3DB 5I0WA 3AS3A 3U4BH 4EN3B 4QXTB 3L9EA 5A43C 2BVOB 2FSEB 1IJNA 3BD5A 4JAMB 5AUMB 1WICA 1MWOA 2ZSWA 3T0EA 1UWGL 4ONHB 1I9EA 3ULUC 1QSEB 3H3PH 2LU5A 3AITA 4I48B 5FFOA 3JTSB 2QHRL 3SDCB 1MJUL 4P07A 4LHUD 5D1QD 4HBQA 1A6PA 4JK0D 1AOHA 5CD3A 3ME0B 1FZKA 1UWGH 3QIWD 4XB3A 1TVDA 5D7LA 5LGYA 4ZZFA 4K9EC 4PJHE 1AGCA 4GQZA 2QHRH 1MJUH 3MJGX 4Z7VA 1CTNA 2HXAA 1BIIA 5ICUA 1OXYA 2RTTA 2VXQL 4PEEA 1HINL 2FCBA 1X7SA 1R5WB 1M53A 3GLZA 4ZODA 1A02N 1RK0B 1IB5A 2VXQH 1VA9A 1ZHNB 2P45B 3BP7A 3KEDA 1HINH 4BFGA 4V1DE 4F7TB 1F97A 2VZ3A 1T1YA 1KTRL 3AS1A 1UJTA 3CV5A 1KY6A 3TZVC 4NZJA 4NFCA 4JCLA 5DHVB 1DDHB 1MRDL 1G1CA 3U7WL 3ATEA 1S9KC 1IVTA 5DHMC 4QRRA 2UXFA 4ZZKA 3CDYA 2VLJB 2YD0A 4UDUA 1A25A 5AZUA 3WTUA 3GC3A 5KYYB 1MHEA 4IM8A 1MRDH 1AY1L 3D18A 3U7WH 4B7IA 5I17A 2OXHA 3FO0L 3MRMA 3EXJA 4NBXB 2HN7B 3QXDB 1TF4A 2WLZA 3I02B 1GGCL 3N1PC 2XN9D 3RZCB 4JY4B 4K4KA 1AY1H 3NCCB 3OVUB 4C83A 3FO0H 3BAJA 1HDMA 1X5KA 4DP1X 2C9RA 5D7KE 4G6JL 1GGCH 1IE4A 1OT4A 2GBUA 3L3OA 5JNYA 2JCCA 4FDWA 4FYQA 2Y7NA 2Y69B 5ICYB 5K9OB 1KTCA 1E27B 1LM8V 4UTAL 5HYQA 5IQLA 4M1DL 4GSRA 4G6JH 4PGEB 2KLRA 2BERA 3NUKA 1TQBB 3FUIA 1JD9A 4OUUA 5I30L 3MRBB 3QZLA 3UTSB 3NZSA 1E7VA 4FJZA 4UTAH 4JFPB 2CLVA 3QR1A 1CCZA 4M1DH 2BSRA 5TPWL 2BIHA 4PRHA 3CDZA 3WFHA 1JXDA 2J7LA 5M95B 2YRLA 5I30H 3UG4A 1PZDA 3ARFC 3LHAA 1JSYA 5IBLD 2OMNA 2EDLA 1E3ZA 3HS0B 2D2OA 5TPWH 1CE6B 3KXFA 3QQNA 4RDBA 2APFA 4RAUA 4HKBB 2F7QA 5IJBC 4Q6KA 2TSBA 1JNJA 5AD0A 4LCYA 1JZ4A 4ES8A 5IOPA 1D6VL 1BQSA 3BRDA 2P43B 5LDUA 3UZVA 5FGCB 5DEGA 2FL5B 3SKNB 2DWDA 2X9YA 2OQJB 2AGJL 2YA1A 3EBHA 3N43F 4Y16A 5IHZB 1FIEA 5EZJB 3VJ6B 1BZEA 1JVOA 2OR8A 2P24A 2YAHA 1NAKL 3C5ZD 3MRHB 4JFUA 2FEDC 4NPYA 1ZLSL 1KJMB 1RUQL 3C6LC 3VGFA 2AGJH 4PGCA 3DVGA 5AFAA 2CBQA 1TYEB 2OMWB 4CDHA 4N2OA 2UYLA 2KHAA 2YEZA 3TA3D 4AM0Q 1NAKH 4GAGL 4AQOA 1NGXA 1ZLSH 1RUQH 2Y23A 5I23A 1EBPA 2F54B 2YZ8A 4K3DL 1QZNA 1W72L 1OB1B 4J3VA 4WFHE 4U1MB 3W39B 2EDOA 1I1FA 2NY6B 3APDA 1IKNA 4NQEB 7TAAA 4QXVA 4DP4X 2APBA 5B38G 3DJSA 4OCYL 1FZMB 1CDCA 4K3DH 3P73B 1W72H 4N1EA 4IBWA 5D5MB 3O8XB 1LWRA 2LAGB 1HKFA 1XVSA 2M83A 4OCYH 1R33A 3LH2L 3O45B 3QIUD 4EN2A 4URKA 1I1AA 4RIRA 1W0VB 2CBOA 3GXUB 2VQUA 4FMKA 5I26A 4B9YA 3IDGB 3K81A 3LQAC 2XTJE 2ZKWA 1Z9SB 5DJDB 2Z92A 3VWKC 4F15C 4R3SB 3LEXA 2BVQA 4F7MB 1U2YA 1Z3GL 2F6AA 5C0FA 3D7PA 2JQZA 1IGFL 2BFVL 4JRYA 4A7TA 1RULL 4HGMA 2P8MA 3ES6B 2A4EA 3DX1A 2ICWJ 2Q1EA 1O6SB 3E3QE 2E9IA 1Z3GH 3GINA 3GUFA 3SCMC 5DU7A 1IGFH 2BFVH 4Y19B 4KOBA 3V0HA 2JQAA 4W68A 1RULH 5EFIA 1CBJA 4NIKB 3LB6D 1DJHA 2H3XC 4PRPB 1AXIB 4NYLA 1CI5A 2VGLM 5HGDA 1KG0A 1QBML 5LBSA 3BN9D 4J39A 3UTPE 2WB7A 5DHDA 3V8OA 1UGNA 1X4ZA 3CC5B 3I6GB 2AQSA 3IFOB 4AEHL 3LPFA 3K8LA 3K6OA 5K93A 3SPIA 1QBMH 1J8HB 1J5HA 3HUJF 2ITDB 2F0CA 3VYOA 1KPVA 1BFSA 4MNGA 1IUZA 1CLCA 4AQAB 3ZHDA 1FL3B 3C2AL 1MNNA 1R4XA 4Q6IA 1ODAA 3WE6B 1CS6A 4TN9A 5IG7B 5ENWA 1CICA 4AM0A 5C0AD 2D3LA 4UQ3A 3IRCA 2YPKA 4PJ5B 3QP3A 3LN4B 2A6JA 2VERA 4P2OB 3L54A 3C2AH 5C8JB 2BIIA 1RFDL 1H5BB 3INOA 2EIKB 3G9VA 4KI5D 4E9WA 2CIIA 1R75A 1MCLA 2XYCA 1RH8A 3HZVB 4I9XA 2WXLA 1F13A 3X17A 3KVPA 2UXTA 4H2CA 6CGTA 3IM1A 1T22A 5FYKL 2Y7MA 4LNRB 3DVNB 3LNFA 4NCDA 4AH2B 2E6PA 4LSSH 1UGKA 2GITB 1G7HB 1JV2B 2HUHA 1XTLA 4DQOH 1GVIA 1C9SA 1J5DA 3OKDB 2A5UA 2OMVB 5FYKH 2ZAIA 2BJML 3FTYA 3BVUA 3I3BA 1BFOA 1CT8B 2GVYA 3K71B 2JJSA 2YGQA 3ZRCC 2VR5A 4JFVA 2JKNA 1DCEA 1K4DB 2AXWA 2QVIA 1DQML 2GYSA 5ESQB 4N8VA 4Z6AT 4CMMB 1O6TA 4MHHI 2PTTB 3P3YA 4L5FE 2BJMH 2NDGA 3JV4B 4KUZL 5B3SB 1F4AA 5HHNB 1AIZA 4KJYB 5FKPB 5HI5D 1DQMH 2PXYC 1EJFA 3G04B 5DHYB 3U7YL 5K39A 3CFIC 5I1GL 4MXVF 3WTWA 4XT1C 4QRPD 2DWEB 3F6JA 4GXFA 4KUZH 3BSHA 5CHNA 3FB7A 3WIHL 3O6LL 1SXBA 5CZVL 4YDMA 3U7YH 3C12A 1NTDA 2ADGA 3PAYA 1FLTX 4LO9A 3RDTC 3DTXB 1ET7A 5CXPA 1HIML 3CSGA 2CG9X 1A7QL 5GGSY 4KRPD 4B6ZA 4YBQD 3WIHH 1XIWA 3O6LH 4J1UB 5CZVH 2A6IB 1WHOA 2B5IB 2ZUTA 3NIGE 4JREC 3O3BA 4YE0A 2IH9A 3TH3T 2J72A 2IAMA 2P8PA 1HIMH 3QUYD 1J7VR 1A7QH 1SFDA 3ABMB 4L4VD 4PS3A 2N0KA 5CLXA 4WIQA 2X4PB 5DDHB 3QIBC 4NKOA 4PVBA 2BSEA 4XNXL 4K5PA 3QXAB 32C2B 5E1GA 4GUPB 1HILB 4UZGA 3AG3B 4P3DA 3FAWA 3NJMA 4XH2B 5G55A 1U8PB 1CFTA 2A6DA 3B9KA 4XP4L 4ZSOE 4XNXH 5KOVC 2XXGA 1MHPL 3NCYS 5BOJA 4K8RD 2K3HA 2YAFA 3RIFK 2NY2B 1MFAL 3KHOA 5E9DD 4XP4H 5ESAA 4E9QA 1OPGL 2OMYB 1MHPH 2YBGA 4G6FB 5E23A 3T3ME 5D9SB 3U48A 2I7SA 1CXKA 2Z0UA 4G80A 4N25A 4C58B 1U3JA 2X2HA 1MFAH 2YA2A 3D0VB 3F7VA 2MCMA 3RFZB 4ICXA 1OPGH 4HIJB 1U42A 3FB6B 3F7KA 4R26L 3IWVA 4ODXB 4NAJA 1J88A 1R3LA 1QSFE 3G5VA 3M7OA 1NH6A 3ML9A 4YO0B 3VXNA 5I76A 5KAQF 3U46A 5HY9B 1QHPA 1PQZA 2WQXA 2YN5A 3QUZC 5T1LB 5IFJA 2VMEA 4R26H 1LO0L 3D4YA 1HXMA 1AGDB 2Y25A 3ECWA 2AZUA 1L0XA 1ZS8A 3UAAA 1TZGL 4AXWA 5C0BD 4PY8I 4BZ2A 2YPLE 4LE8A 4NUGL 3VRJA 1LO0H 2BNRA 2CBMA 3DHMA 2X2YA 4YHPB 5FKAA 2YXFA 1TZGH 2I60H 1NC2A 3KBFA 1Z1WA 1BQ5A 2V9RA 2NRDA 1AQDB 3O6KL 4NUGH 1JHTA 1BVNT 1SN5A 5D6DC 1IGCL 4NC0B 3S4SA 4G1MA 4JO3H 3VXUB 3ZY7A 5KSBB 4PRIB 1EHXA 2Q87A 4TQIA 1CURA 2AV1A 1WFIA 2FLMA 4RX4A 3O6KH 3QQ9C 4PTTA 3W3BA 5M94B 2C3HA 1JPGB 1IGCH 1U58B 2FAUA 3V5KA 3P40A 4U7MA 4BSWB 1TEFA 4PJ8A 5F3FA 1UXLA 4H20L 1JZ2A 2X44D 4AGNA 3TPUB 1BEXA 1FLRL 5BRZD 2DQ6A 4RMVA 3HRZC 2VT0A 3PV6A 4KXCA 4LARL 1A3RL 4Q0XL 5C0CE 1R5IA 4H20H 5F9JA 3SE8L 3VFOA 1AHWA 1AACA 1WFMA 3ULVL 3QK0A 4UU9B 4YN3A 1KMGA 1HNFA 3D0LA 2LGNA 3I84A 4LARH 2EXYD 1A3RH 4Q0XH 3P30L 4QYOB 3JV6A 4Y8AA 4PV1C 1MFEL 3HLKA 1E4HA 3RL1B 1JAEA 3ULVH 4YXKL 1E9PB 1IAOA 2PW1B 3D2UB 3L9RA 2A38A 4GAYA 2BX5A 3V6OA 4TQPA 1JN6A 3P30H 3KYOA 4HKXA 1MFEH 1U0QA 1JUFA 4YXKH 2EDEA 2NSMA 5LBSL 5GZOC 3G7TA 3O4LD 4OFVA 3SD2A 4E9XA 1HH6A 4EOWH 4KNQA 2Z4QB 3QZOA 3R0MA 4KAQL 5LBSH 3WG7B 4AG4L 2NX5D 3GJEA 4KKRA 4F80A 1MXGA 1QOKA 5BO1L 2BS71 2OZ4A 1QFWI 2AQRA 3AU1A 1V27A 1RZKL 2CGRL 4D9QD 1TKWB 4KAQH 4BUHA 2F53E 5EOTB 4AG4H 3BKML 4GY4A 3ISRA 4OIIL 4L1SA 3RX7A 3CDGA 3ZKXB 5BO1H 5EUOE 2WXRA 3RWIB 3ZMEA 3DC0A 1RZKH 3L9BA 2CGRH 4P4KC 3BKMH 4H8WL 1FF5A 4L0YA 4OIIH 2RB8A 2I9LB 2I27N 2LT9A 3JWNC 3N04A 1ORSB 4HMCA 3VXQB 3L1OL 3U1QA 5AYQA 3OKMB 1OY3B 1A1NB 1CFVL 3JWDC 3R8QA 4DGVH 4H8WH 3MLTB 5ADOL 1OSYA 3W0WB 1DHKA 1D5ZB 3E2HB 1T04B 3GWJA 1NCTA 2KUTA 3L1OH 1E30A 4BK5C 5DQJB 4GKLA 1CFVH 4FULA 4GQ9L 4P5MB 5ECGA 4AV5A 3HN5A 2Z31C 1Z32X 3E9TA 3REVA 1AHKA 4HS8L 4QAWA 1ZIAA 3DO3A 4K3GA 5CO1A 3BUYB 3GB7A 3VYPA 3ILEA 4AENB 1OK0A 3L3HB 2NY0D 4GQ9H 5IHUL 3ORJA 1JGUL 4FEIA 2WW8A 4HS8H 5D1XA 5F6IC 3ZO0A 2OX5B 3FUEA 3QSKB 4WZ9A 3LS4L 5ICXB 1P6FA 3FBQA 3MRDB 2FJHB 1UFUA 1JWUB 4H1LH 1UD8A 3ZHKA 5HHMD 4C4BA 3LY6A 3MNZB 5IHUH 1JGUH 1H3TA 5IQOA 5F72S 1ID2A 3FTXA 2YD4A 4G6KL 3LS4H 3PJSB 4WTZG 3ZL4L 4G9FB 1QO3B 4EIBA 3ZE1F 3DXAE 1WGOA 3IDYB 3VSTA 2E75C 5C9JA 2XJLA 1CF1A 2F08A 1FZJB 1CE1L 1U6AL 4G6KH 5C0EA 2I9TB 2X1PA 3ZL4H 1HXYB 1PZ5B 1D9KA 3VTTA 2ZSVB 3QORC 5IROC 3JWOL 4AKQA 5BMFL 5MEQB 3RX8A 2AQNA 4OM0L 4JFDA 1OAXL 1CE1H 1U6AH 1TJHL 4XNDA 1QR1A 2UY6B 4FQJL 1EZUA 2HKAA 4LPUA 1EERB 1N0LB 2XHNA 3GDBA 3JWOH 3MUGA 5BMFH 3ARVA 4W6WB 1W8EA 5DZLA 1PAZA 3TTYA 1AKJA 4OM0H 1BPVA 2BP0B 1OAXH 3WKNA 3ARGB 1CD0A 1TJHH 4W4NA 3WFZA 2HT4C 3L3DA 5LG6A 1NSNL 1VEPA 1MZYA 1WYJA 4EN3A 4QXTA 2BVOA 2FSEA 3WS3B 4JAMA 5AUMA 5JXEC 4RZCB 2OK0L 1S46A 4ONHA 4CMHB 2FH6A 4JKWA 1QSEA 1T1XB 2WXHA 1M9SA 1NSNH 4GQRA 2YRZA 2VRAA 4I48A 3JTSA 3SDCA 4AYFB 4N5EC 1XF1A 5D7JC 2OK0H 1UM4H 5DT1L 2E6QA 3ME0A 1ET8A 2O6CA 4PJEF 4Y9EA 3IK2A 4HKZB 1UCTA 3F85A 4KH2A 5E8PB 1LQBC 4PWGA 4LKXB 5BV7L 2WJ5A 1I7RB 3LNDA 3P2DA 2GUOB 5DT1H 3ARDB 3EHBC 2BVPB 4HWZB 1R5WA 1PCSA 4TL4A 4FCHA 5E5RB 4A7GF 1RK0A 5BV7H 4XZ4A 4NJ9L 3SGJA 4UOW1 3T8XB 3VI3F 4J2XA 4FC3E 1ZHNA 2AQ2A 2WLJA 3UJJL 4EQ2A 2BM3A 4F7TA 1RSYA 3MBWB 5T3XE 3PHOB 1DFBL 3QDGE 1T5XB 1OP3K 4AMKL 4G8IB 4NJ9H 3QULB 3B7RL 5DUBB 2P8LB 5SWQB 2W88A 4WJKB 4BZ2L 4JE0A 2BK8A 3GBNL 1DDHA 4MJ4A 3HG5A 5DHVA 1YUKB 2FWUA 3UJJH 1I8MB 1ZJBA 1B0GB 2ZONA 1UD6A 1DFBH 1CC3A 1WQVT 4AMKH 2VLJA 5ANME 3S34L 4BZ2H 5KYYA 3GBNH 2IDCA 3L2NA 5FOJA 3QRGL 3ZRSA 4M48L 4ABWA 1JNNL 4TOYL 2HN7A 1QWHA 3QXDA 3SB3A 4MAYC 4Z7WE 5DHEA 3D39B 3I02A 4WK0B 3S34H 2Y6SC 3RZCA 4JY4A 3D30A 1NGZB 2OJEB 4CN4A 7PAZA 3QRGH 1QMUA 4AEFA 2VMFA 4M48H 1JNNH 4RRPG 4BIKA 4TOYH 5LGJB 3VO0A 4DK3A 4PJIE 5D1ZD 1CDJA 4H13C 3B2VL 1T7WA 4PJCF 4OJEH 3QAZC 4GSDH 4JLRB 3V5DB 4K5NA 3OSVA 4P5TD 1BZ9B 1DUZB 5ICYA 1CXIA 2V2WB 5K9OA 1E27A 3JVGA 3CDFA 4OGAD 4PG2C 4AGOA 3D25B 3QJRB 4PGEA 2GBVA 3B2VH 2C5DC 5HYJB 1J0YA 2JTYA 2YK1L 1A5FL 2R0ZL 3B1UA 1WWBX 3MRBA 3UTSA 3RVUC 3GZPA 4G6AD 2WSKA 4JFPA 3RGVB 5AENA 2JLLA 2DICA 3KDMB 1MW0A 2F58L 3EADA 3ZX1A 2QMKA 2YK1H 1CG9B 2R0ZH 1NPJA 5TGBB 5LUMA 2ZYRA 3CLFL 3MJ8B 3G9AB 4RISL 1SYSB 4G11A 4YSRA 1AR2A 1X5JA 3HS0A 1CE6A 2F58H 4HKBA 1YN7B 5FGBC 2OMBA 3B9AA 3NJHA 1LEKB 3CLFH 3PQYB 3CZFB 4TQ8A 3AWEA 1IKOP 1OQOA 3THML 3NOIA 3TV3L 4RISH 3T5WA 4J3OD 5GHWL 1UT2A 2FL5A 3ZXAC 3SKNA 3ZQ9A 2OQJA 2WNXA 1DVYA 1KBBA 2XTJC 3TV3H 3THMH 5IHZA 5EZJA 3VJ6A 3RIAF 2OR7A 2DEWX 4N28A 3MV7D 5GHWH 4AK1A 2OZ4L 3AADB 3MRHA 3FSAA 1S3KL 2Y2TA 1KJMA 4B3EA 1T66C 2OMWA 4CADB 3ZE0F 4EXPX 4X6CE 4K8RL 4XHJD 4NZDA 1KULA 3WS6C 3QUKB 3E3QC 5LNGA 2OZ4H 3DLQR 4NZ8A 1ZANL 4A1RA 1S3KH 1SMDA 3Q9PA 4G8GD 3FFDB 2F54A 2ZWZA 4K8RH 4YZFE 5FFGA 1OB1A 1G9EA 4Z3JA 1CL7H 3WAJA 4U1MA 3W39A 3PDDA 4F8PA 1L4IA 1ZANH 3KVQA 4NQEA 5T3XL 1HL9A 4Y5YC 5F6HI 3NP4A 4KTDL 4P48A 2VN4A 1FZMA 3L48A 3P73A 4OZFG 4QLRA 3HFML 3WIIL 4KXAA 5DVNA 4H5SB 2AFNA 5D5MA 3O8XA 4X0NA 3DX6B 1T5WB 1H19A 3ZGHA 4KTDH 4GPVA 1FFTB 1OTUC 5DQ9B 3O45A 1NCDL 1KWKA 2AHIA 1N18A 3HFMH 3WLBB 3WIIH 1E7UA 1Q0XL 1W0VA 1F3JB 3II3A 4Y9GA 1AO7D 3IDGA 1Z9SA 5DJDA 1NCDH 4F7MA 1Q0XH 2P1YA 2EEDA 2OKMA 1A6ZB 5T1KD 5B8CC 1XCQB 3L7EB 2G4EA 3DMMB 5LGHH 1KXQA 1OAQL 3ECQA 3L3GA 3ES6A 3KMDA 2CM6A 1S7UB 4Q14A 1O6SA 4BE6A 3L4XA 2EH7L 3VX1A 1JZ6A 1GS6X 1BWWA 5D96C 4AV4A 4OKVB 4Y19A 5DMIL 4ZMXA 3K4AA 5IJKA 4M3JA 2EKJA 1OAQH 1L0QA 1OTTD 3NDZE 4PJHF 4PRPA 5GS3A 3CMOH 2EH7H 2EP6A 3TIEB 4W6XB 5DMIH 2UX7A 1J12A 1LMIA 2GIMA 3QWRD 4LLYB 1EFQA 4WFEE 4YNYB 3CC5A 3I6GA 5DZOA 2JJWA 1Q9LB 5T1JA 3IFOA 5DJ8B 1J8HA 4N85A 2ITDA 2ORBL 2R59A 4G2AA 1P1VA 2D3NA 2LOEA 2OSXA 4AQAA 2VN7A 1FL3A 4CN6A 1NCAL 4QTIL 5DZAA 4GH7B 3WE6A 2ORBH 1TUPA 5IG7A 2X4NB 3ZTEA 5I75C 1X6LA 4K71B 1GSMA 4PJ5A 5D2NB 1ZGLB 3LN4A 4P2OA 3QCUH 5MI0B 1MN4A 5C8JA 1NCAH 1IAMA 2H0JA 4F2MB 5KYNA 4XOAA 1Z3RA 1H5BA 3SJVB 4AQEB 1PD1A 5DRWB 3HZVA 4NFDA 1MWAB 1PIGA 5KAQG 1ZVHA 2O5NA 1ZSHA 4TNVF 4TQEL 4LNRA 4ZO9A 3OTTA 3DVNA 4NQUA 5GPRA 3TCLB 1H8SA 3VXSD 4AH2A 4B9JA 4ZMLA 1ET5A 4KKQA 4UV4H 2AI0L 2GITA 4I3GA 1G7HA 1JV2A 1NUGA 1NWPA 3WGVB 3BAYA 1L9SA 3OKDA 2O93L 2OMVA 4HSCX 3N43B 3H42L 5EEXA 2F8OA 3HA0A 5CSZB 3K71A 1IT9L 1CT8A 2HB0A 2AI0H 1K4DA 5ESQA 3IPEA 2V5MA 2WBJB 1YVLA 2YRBA 2CRZA 3O0RL 1BX2B 4CMMA 2DQJL 2PTTA 4N2BA 3H42H 4D9LL 3F05A 3JV4A 4N0UB 4L0ZA 4PRDB 1IT9H 1DCLA 2OSLB 5HHNA 4APQC 4IDLA 5J12B 4KJYA 4WFFE 5FKPA 4P8QA 1KTLB 3G04A 5DHYA 5KYUB 5GZND 5CJBA 1V10A 4O9HL 4PJGF 3O0RH 4PIRF 3GBEA 2DWEA 5IJCC 2DQJH 3HI1B 4D9LH 5BCAA 5IJVB 2X09A 4WUKL 1XWVA 5DHVH 4O9HH 2DIEA 5EZLB 1MY5A 1YN6B 3DRQB 1J9TA 4ZXBC 3DTXA 3MUJA 4LZKA 4WUKH 1VKXB 1NLBL 3V0WL 2IWFA 4J1UA 5KW9L 2A6IA 1Q0YL 4DP6X 2X1WL 1JCVA 4R2GC 1NLBH 5E4IA 2X4PA 5DDHA 2H6OA 2OMUB 5JQIB 5KW9H 1P4IL 3QXAA 5AKVA 32C2A 3MJ7B 3CN1A 3KBPA 3HW7A 3SDAB 1S78C 3UTZB 4YSAA 1Q0YH 1HILA 3AY4C 3OKEB 4GUPA 4XH2A 3WENA 2PCYA 3PPSA 4AE0A 1U8PA 2E4FA 4BKSC 4AITA 1XF2B 1P4IH 3I6SA 2YQGA 1AQMA 2V0AA 3P9MB 4UTCA 2WGNB 2MOGA 3NAAL 2DL9A 2H8PB 3ML8A 4XCYB 2EH8L 5CJOL 3RVTC 4KKZA 5HD8C 1BJMA 3KAAA 2VC2B 3ZTJG 3N1MC 1QPKA 2OMYA 3NAAH 1HN1A 1W8OA 5D9SA 1F45A 5CJOH 5BO0D 1E67A 3D0VA 4U1SB 4EI5D 1TITA 4DEPB 2KLTA 1KGWA 5KVDE 5I6XB 3UTTE 3RFZA 4HIJA 3FB6A 1UYWL 3TYFB 1A4BA 4DOHE 3BZ5A 4ODXA 4FNSA 2ICWB 4IGBC 4LP4A 4LRIA 5DD1L 4YO0A 1XDTT 5HY9A 2DPKA 4PBDA 5D6CB 5C09E 5F7WC 3HUJB 5T1LA 1UYWH 4D94A 3QJVB 2GJJA 3I2CL 4C4KO 2PTVA 4G72B 4DUWA 4MZRA 1AGDA 2DI8A 1CJYA 1C7TA 4XZUB 5DD1H 2JKRM 3BEVB 4GRWE 5IF0B 1U8JB 2J5LB 3SO5A 3WKML 3PL6B 4OU3A 2DWTA 3I2CH 4X7DC 2RIKA 1N67A 2XLLA 4WTQA 4M7JL 4YHPA 2GJ6B 2QR0B 2MNJB 2VLKB 2NW3B 2F8VA 2XT1B 3WKMH 5HDBE 4WHTB 3QC5X 5E95B 4BUGA 1AQDA 3TH4T 2MQCA 3E8UL 2XZCL 4M7JH 3VXUA 5KSBA 4PRIA 3CVDA 1Y07A 3CSBA 4KJWD 2NXZB 3IJHB 2PPCA 2AMGA 1JDCA 1MREL 4MZIA 4LSQL 2YD5A 1JPGA 3E8UH 5EG6C 4NBZB 1U58A 4XO8A 2R2EB 3KWTA 3CU1A 4BSWA 1SEQL 5E6RB 1I1RA 4OZFB 3TPUA 5E5LA 1MREH 4KDVA 1KBKA 1XXFC 1MCPL 4LSQH 1YEHL 1UJ3B 3RNQB 1UEMA 3EJJX 4IU3B 3M07A 4NQSB 4Z7OE 1SEQH 4HALA 1DSWA 4MZ2A 4DFIA 1SUJA 4JVUA 1MCPH 1OHQA 4H4NA 1UWXK 1YEHH 4Z77B 4UU9A 3QC6X 3NPSC 5KSAD 1F1AA 2OMTB 1XCTB 1XEDA 4WDIB 4QYOA 2X4TB 1MSPA 1T1WB 3RL1A 3OAWA 4CU6A 1E9PA 1DO5A 2PW1A 3D2UA 1PKQE 4OJFL 4LOFA 3FFCD 1AQKL 3IXAB 4NO5B 4AUUA 5JIDA 3NIFE 1YEJL 1AZVA 4FZ8L 4XBGB 4POZD 3ZOAA 3ZIMA 1JRHI 2PO6D 3VXRE 3A3YB 1ZLWH 1AQKH 2ARJB 4IKJA 5BRPA 3ZHFA 4DO5A 3COOA 4XB7A 2Z4QA 3OZKA 4FZ8H 3H7LA 1WHPA 2V9QA 3SZ6A 4XODA 5CSGA 1KY7A 1O9VA 1BFVL 2O6PA 2Q3XA 1GOGA 1JERA 1WIPA 5I0VA 1TKWA 3QUGA 5EOTA 3U4EB 1FUNA 3ZTDC 5KANI 2QQKL 1BFVH 4WGKA 4X7CC 3RWIA 3BZEB 1P6WA 5GGTA 1PKOA 1FG2B 4GSQA 2EC9T 2QQKH 1VIWA 3D05A 5EV7A 2I9LA 3VXQA 1JK9B 1ORSA 3QEQD 1UEYA 3MRPB 5LDSA 3OKMA 1A1NA 2C7FA 4LCWD 1BAFL 2GFBB 2YD6A 3NZ8B 1NDGB 2G60L 3MLTA 4KHXL 1IAIL 2FEEI 3W0WA 3W5NA 1D5ZA 1KSRA 4IKNA 3K2IA 3ZDWA 3WY3A 1T04A 3KLAB 2RMNA 2B2XL 1KTJA 4B96A 1PX3A 3DA0A 5DQJA 4AZUA 1BAFH 4P5MA 3MNMA 5LXGL 2G60H 2B4CL 2DLEA 1IAIH 4KHXH 3HC4L 2OMZB 5K59F 4MNQE 2B2XH 3BUYA 4AENA 3F7RA 3L3HA 4WJ5B 3EJUA 1WVZA 4LRNL 1JYWA 1N6QL 5LXGH 2F8XC 3O4OB 2B4CH 2H5UA 5JYMA 4PV9B 4L18A 1PEWA 3HC4H 1FC1A 2OX5A 5GSVB 9PCYA 2HMID 5ICXA 1GYCA 3MRDA 1YA5A 3T09A 2FJHA 4U49A 1JWUA 5AL8A 3RKDD 4X83A 1SN2A 1NOFA 2VW4A 4R4ND 1OAJA 4LRNH 1X5ZA 3MNZA 1N6QH 1A3ZA 5GIRB 3Q8BA 2YMXL 1EFXD 2ZX5A 4HT1H 3PJSA 3E80A 5D1QE 3Q2LA 3T3MF 3U2IA 2K0RA 1OK8A 1QO3A 4G9FA 1O9WA 4FG0A 3U4AA 1OGSA 2X0VA 2YMXH 1J87A 1FZJA 1XCXA 1UG9A 4JQVC 2I9TA 1MCOL 1OSZB 2P5EB 4M1CD 1HXYA 1PZ5A 5MEQA 2ZSVA 4FXGC 1ZLUK 1GXEA 2Z8WC 3SOBL 2R2HB 3BUBA 2HJLB 5ITFB 2XICA 1D5RA 1MCOH 2UY6A 4WGVB 1JGVL 4W93A 5L4IA 3BLKA 1N0LA 4OKDA 1BVLB 3ULSB 3SOBH 4CSPA 2YSTA 3VAEA 4Z7UF 4ZMZA 4O00A 5FCUL 1CYGA 4KKBC 1I75A 2BP0A 1OB0A 2WLLB 3ARGA 3NCXA 5CZRA 2C3GA 3GSQB 3OB0K 4F15B 4OZGE 1JGVH 1RLWA 2IV9A 3H9HB 5KSVB 4E2OA 4XBPB 4FERA 4YC2C 4HOZA 6FABL 3WS3A 2YLKA 5FCUH 5HGHB 1KLUB 4RZCA 2IAAC 3EYQD 1XSKA 2WY3B 1FDLL 1T1XA 1A7NL 2EE9A 1GMEA 1NZRA 3TN0C 4AYFA 6FABH 1JFHA 4OFDA 2DJMA 3SCMB 4RBPK 2V2XB 1K8IB 1QR4A 4KKLC 4LSVL 4A67A 4LVNC 1FDLH 4HKZA 4ELKB 5C2UB 1A7NH 3MDJA 3BZ4B 5E8PA 4LKXA 4ZW5A 4NO0B 2XN9E 3MYJB 2BNUB 1I7RA 2GUOA 2P26A 3QXVA 3ARDA 1A9BB 2BVPA 4HWZA 5E24E 3LKOB 2IXQB 2B39A 2IO5A 3ZT6A 2CKNA 3T8XA 5IWLC 5DK3A 5JMRA 5I1KL 4JDZB 5HVFB 1QI5A 1V3JA 2FQGA 3MBWA 3PHOA 2XWTB 1T5XA 3R8BB 3WHE0 5EOCJ 4KV5E 4G8IA 3B2XA 3QULA 3RVXD 3ZYOA 4F91B 5DUBA 2IOMA 2P8LA 5SWQA 3C75A 1EO5A 2O5YL 3KE0A 5I1KH 1IX2A 5TE6L 1CXHA 1I8MA 3N85L 1B0GA 5HVHC 4N3UA 4TYUA 3JWNG 4YDZA 1P9MA 5HDQL 1IC1A 2WAQA 4KDTA 5B22A 1PJ9A 2O5YH 4MD4B 2ZXGA 1B9ZA 5TE6H 2ID5A 3GF8A 4E5XG 3AJ7A 3TEWA 3N85H 1GIGL 4HSAC 4KVCH 4YIQB 1KIQB 5B39G 5HDQH 1U3HD 2DZEA 3P1VA 2VLRB 3D39A 3MJWA 4PCSA 2AANA 2B59B 1NGZA 2OJEA 2IEPA 1N19A 3WU1A 5F7NC 1DVFC 4I18B 3T2PA 5LGJA 1WP6A 1BG9A 4JLRA 2CA4A 3V5DA 1BZ9A 5DJZB 4ANKA 1DUZA 2AZAA 4DGUA 2G0KA 2V2WA 2V7NB 5D2LE 4S0SD 2E27L 2F1AA 4M6NL 1W8NA 5JIHA 3D25A 5HYJA 2QTVA 4GFTB 5CILL 1RIHL 3RPKA 2E9BA 1KB9J 1EO8L 3N44F 3RGVA 4XWGL 2E27H 4BXSV 2PXYB 2CMRL 1CDHA 1MJ8L 1LWJA 3KDMA 4LDLB 4M6NH 3KGSA 4A7UA 4P4RB 1ZLVK 2NNCA 2QELA 1O5DT 5CILH 3QI9C 1CG9A 1RIHH 5TGBA 4LDCA 4LSUL 1WWAX 2NQ3A 4TSBL 1G4MA 1EO8H 3MJ8A 3ZE1B 4XWGH 4BFFA 1Q8MA 4F20A 1SYSA 2CMRH 1MJ8H 2YJQA 5HSFA 1QLEB 1IIIA 3D8MA 1PF3A 3AXIA 4MGXA 1YN7A 4OJCA 2FIKB 1ZS2A 4QHPA 4HCRL 4LSUH 4WW2F 2ZAGA 3PQYA 4HISA 3CZFA 4TSBH 4FQLL 1VGKB 4EMZA 5AW9B 5B7EA 4DP0X 1PD0A 1OT2A 5AZEL 1ILUA 1KOAA 4NC1C 2GSMB 4IRZA 5I2IB 2AK4D 3OAYK 5D7EA 4HCRH 1NBQA 4FQLH 3VM7A 5LHDA 3H54A 3VUAA 4MHHG 5AZEH 1MVFA 3O6FC 3Q6FB 4PGBB 1I4FB 3VGEA 2ZXCA 2BC4B 2KZBA 3WFEL 4CADA 2ZF8A 3L4CA 2HVKB 3QDMB 3LHPL 1FAKT 2NR6D 3N55A 3QUKA 3WFBL 3WNIA 4MCNA 2YS4A 4OT1L 2X4SB 4YS4A 2XVKA 1WIUA 3DKHA 3FFDA 5GGTL 4DQAA 3WFEH 1JZHA 4UQ9A 3LHPH 3T8VA 2JXMB 5GGQL 5EU3B 3WFBH 4OT1H 4PJEB 4ZAKD 3H4HA 4NNPL 5GGTH 5EO1B 1X9QA 5T33L 3D85B 3KS0H 4NQCE 3WY4A 2RH0A 4KU1A 4Y4FD 4WTWA 5GGQH 2F2HA 4H5SA 1QA9B 1YJDL 1OQXA 3DX6A 1T5WA 3B7YA 4NNPH 4QIRA 3BIKB 5DQ9A 4OI7A 3MZTA 5T33H 1BM7A 3VI3B 4ZUSB 3WLBA 2XPZA 4P5KB 2OAAA 1F3JA 1YJDH 2MNUA 2CPUA 1GZHA 3MR9B 5GGRB 3WXVL 1LXMA 5F9AC 4KTGA 3CFMA 4O2FB 3PP3K 2JKXA 1BHGA 3D06A 3KWVA 1ZDSA 4XAKD 1A6ZA 5C0AE 4GI6A 3TO4D 1KZQA 2MPVA 3Q1EA 1XCQA 3L7EA 4GIOA 4XPBL 4U1IB 3DMMA 1NGQL 3Q43A 1GOFA 1X5LA 4PR5B 2ZYHA 1S7UA 1JHKL 3AC0A 3DJZA 2NQCA 4OKVA 2UXGA 3TVMD 3C87A 1NGQH 3PHSA 4H44C 2UV3A 4MB4A 4RMRA 4WTZA 2OTWB 2K45A 2VITB 4FFVC 4ETQB 1JHKH 3TIEA 2W80C 3MBED 1WA1X 5E03A 4CVZB 3LKNB 3CH8A 4LLYA 3NIDF 4YNYA 4KK6C 4WEBL 1Q9LA 1LGVA 3KYMB 2J44A 4PJCB 4Y2DC 5KBKA 5DJ8A 1UHVA 4UANA 3I9GL 4AYID 1L6XA 5CGYC 1KJ2L 4LLDB 4X8JB 4P05A 2WWNA 4WEBH 4LEXH 1QYGL 4NLAA 3IAGC 3A4DA 4YHNB 5F1SA 4MJ6B 1MCHA 5DFAA 3GJFB 1J5IA 2X4NA 1LE9B 1KJ2H 4WRLA 4WWID 4NKMB 5D2NA 4PCTA 3X12B 4DIXA 1ZGLA 5A2FA 4N0FB 4F2MA 4HEME 2H1PL 2UUDK 3ULUD 3SJVA 4WNQB 4AQEA 3LNHA 2Q2LA 3N41F 2EUWA 5DRWA 5JPNB 1CXFA 5DR5L 1MWAA 3GJFK 4BE5A 3EGXB 4Z7WF 4PJDE 1EZLA 4NQDE 4U1GC 2H1PH 4AVHA 2BSBA 4WUUD 3TCLA 5FGSA 3SE9L 5CJ5A 4AY0A 4JY6B 1ZDQA 1R3HB 4L4VE 3VFWB 3ARZA 3QUXC 4JHZA 1WBYB 1IEAB 2Y3NA 1OP3H 3SGDH 3MUZ1 3EBAA 4N8UA 5CSZA 2MJWA 1GHFL 3SE9H 4CA4A 2YHGA 2W60B 2EVIA 3EFDL 3AROA 4D2NA 3FTWA 3O11B 1WEJL 2WBJA 1VZGA 5E6ZA 3S3SA 2XQ0A 3EJYD 1BX2A 4AC4A 1G9MC 1XHHA 2H7WA 3KW8A 2BXYA 3BVXA 4N0UA 1V54B 4PRDA 3ZE0B 1DJWA 1GHFH 1GGIL 2OSLA 1J0JA 3EFDH 3VGHA 1KTLA 4R9HA 5KYUA 1WEJH 3RGBA 3TZVD 2DEXX 2VJ8A 4FN0A 5E9DE 4QOKB 2XWRA 4E9RA 2BY3A 1ACXA 3HI1A 1CFMA 3RIAK 2CE6A 4JFSA 5IJVA 1P5UC 1GGIH 4G8FB 4JFED 2QDVA 3PE9A 5T1DL 4X4MA 5T1MB 4AQ8C 2ADJB 3MGOB 5EZLA 1YN6A 3DRQA 2FHBA 3OKOB 1VKXA 4PJ9C 2AXFB 2HH0L 5T1DH 4E5XB 1X7TA 1MH5B 4EO5A 5EUKB 5B39B 4JG0L 1CFBA 2WBKA 3LS5L 1XL6A 4JDVB 2Z31B 5IB1B 2HH0H 2OMUA 2G30A 4U0RC 1JJUA 2YOAA 1S7SB 3MJ7A 2OTUB 3KGUA 4JG0H 3RTQC 3SDAA 3UTZA 2ZKYA 5DYFA 5ID1B 1EHKB 1RQ5A 1X9RA 1YSOA 3OKEA 3VH8G 3LS5H 3VFMB 1S9YB 4PWHA 2NW2B 2A0LC 4HV8B 4P23C 2XBZA 5JQHC 1XF2A 3W9DB 3P9MA 2OSYA 5LAXB 5BUPA 2H8PA 1UOLA 3AFLA 4CKQA 2V5TA 4XCYA 4JDTL 4EKXA 2EDKA 1SM3L 3AG4B 4JEGB 4JANB 4QDGA 3CIAA 4L2LA 4YZFF 3A0OA 3AU0A 1MF2L 1QWUA 2OSWA 1WTGT 2VR8A 3ARFD 4JDTH 3TWCL 4EAEA 4PJHB 2R27A 4U1SA 3CFJB 1MI5D 1SM3H 1NEPA 2VW6A 2YRPA 3EDDA 5DC4B 3UL4A 2BDNL 4JE4B 3QJOA 1MF2H 2ZYSA 4LEEA 4FG6D 3TYFA 2XKNB 3TWCH 2X2UA 1CGTA 1RZJL 3M1CA 4FS0A 4DETA 2ICWA 3L4TA 4AJVA 3K46A 1ZIBA 4N87A 4RVBA 1NKGA 1XQ4A 1ZPUA 5JHAA 1V7ML 1BVZA 1O9ZA 5D6CA 5BRZE 3HUJA 4OZ4B 2XI9A 2YARA 3S3CB 2VNCA 4YWGL 4V1DB 1RZJH 1Y18B 1F4YL 4XZUA 4FKHA 1YAZA 2JJTA 1RUAL 3BEVA 1M7UA 1V7MH 5IF0A 1U9KA 1U8JA 3HC0B 4P3WA 3PL6A 3TBSB 2FEDD 4YWGH 2F7IA 3C6LD 5AEAA 1F4YH 1TVBB 1O5PA 1M1XB 5D93C 1ESOA 1LNUB 1RUAH 2GJ6A 2QR0A 4ZNEA 1MAML 2VLKA 2HLEB 3FQNB 2NW3A 3MMEB 4WHTA 2YEQA 2Z8RA 3HKFA 5D7JB 2CO7B 4JRXB 4P2QD 1JF5A 1URLA 1E3FA 5FLUA 5TE7H 2ZOTA 3IJHA 5A6IA 4LESA 4TULL 1MZZA 1AQ8A 4WI6A 1D7FA 4PWKA 2DL2A 1P4LB 1N8ZB 2R2EA 1GYUA 3H53A 4O2EB 3TJEL 5BVJB 4OZFA 1U3YA 2PUQT 2VDPL 1ADQA 4TULH 5GS0C 5D1XD 1UJ3A 1T0OA 4JM2F 4IU3A 4YHIB 5HGAB 4NQSA 4TNVK 3KLSA 3RNQA 5T3ZD 3TJEH 3KLHD 1UUSA 1CK0L 2K8QA 3NMEA 1JZIA 5E1HB 4D9QE 3VFVB 2VDPH 4OY9A 1MCEA 2LW3A 4Z77A 2QLVB 4UOQA 2OMTA 4MJID 1RUKH 5T5NG 3HZMB 1XCTA 4WDIA 5F7YC 1CK0H 2X4TA 1HWHB 3BP5B 4I4WB 1T1WA 3VA2C 3QG6B 2RBLA 1OD9A 3C8KB 2ZXAA 4ZO7A 4A2LA 1KEGL 2OCJA 1CO1A 3DO7B 5BQ7B 3IXAA 4NO5A 5KVFE 1EAPB 4MQXC 3IGKA 3BGFC 1TYRA 1T89A 3HN8A 1IAIM 1PZAA 2BNQD 2FX8L 4XBGA 1NFDE 2AJSL 4L1TA 4FYTA 1OCZB 2ARJA 2QPEB 4LP8A 2FX8H 2XIBA 3E1F1 3FSWA 4ZW7A 3EDJA 4X6BB 2AJSH 3QAZB 2NYKA 5FO8B 4UI2A 5GGSB 2PPDA 4PYGA 3PWPD 3NGBC 3GRGA 5FO2A 3MA7B 4ZX4A 5DTFB 3UBGA 4RMQA 1BDYA 2NY1B 3S3JA 3U4EA 5CFHA 1DEDA 4MXQC 3OSKA 3KPLB 5HHME 1XFPA 1URZA 3WJJC 2CA3A 4ADGA 5D1QC 3BZEA 1MCWW 3D6GA 3BI9X 4KXDA 1RY7B 4GBXD 1FG2A 3SE6A 2ZX8A 2EDFA 3QIWC 1IGYB 1JK9A 3NQIA 4UNTA 3QRBA 3MRPA 5K1JA 2ZUWA 4CN1A 1PAMA 4HIEB 2GFBA 3FT2B 3NZ8A 1NDGA 3GBLA 5EN2B 5F88B 3PDGA 1VDGA 3KLAA 4GSXA 3ENEA 2DKSA 1SDYA 3ILDA 4PS4L 5E5UB 1B4RA 2E5EA 3ZUNC 2V7HB 3NACL 2EO9A 2K6WA 3LIZA 2OMZA 4OAWB 2XTJB 1VSCA 1REIA 4NNXB 3HMWL 4CILA 4WJ5A 4PS4H 3V79C 2Z35B 2BRRL 1NCIA 3NACH 3S3BB 3P9WB 3HZ3A 4PV9A 1SQ2N 3N40P 5GSVA 4OCLC 4Y5VB 4AGPA 2A4ZA 3HMWH 1TNMA 1Z66A 5EBMB 4CKVX 3S36L 2BRRH 3AXLB 2EADA 2HKFL 5GIRA 3UCRA 5FUZL 3WTTA 2WQVA 2JJVA 3N5AA 4IRJD 3ZL2A 4AK2A 3NFPB 4K94C 4L3ED 5K9QG 4Y4KD 1NUFA 3KJ4C 5AG8A 3S36H 2HKFH 2QADB 4QCIB 5B1KA 3TM6A 5FUZH 3BUTA 1OSZA 2P5EA 1JCKA 3RDTD 1VFBB 3ZMNA 5HDOA 3KWXA 2R2HA 3VGBA 2XWBB 2HJLA 1ZD6A 3QFJE 1Z9LA 5ITFA 2WZPD 4NQQA 1S8DB 2Y2WA 4BFNA 4Y1SA 1BVLA 3ULSA 2EEFA 3QIBD 4RFOL 1DJYA 2PP9A 5MENB 2WLLA 3GSQA 2JIXD 4GYBA 3IDIB 3H9HA 5KSVA 1TMQA 4HMDA 4XBPA 5I5MA 2R9HC 3NN8B 4RFOH 3HS9A 3VH8B 2NZ1A 5HGHA 5B8CB 1KLUA 1HL4A 4YGAB 5FB8B 2VAJA 5HDBF 4J28A 4IBLT 5AB9A 2P52A 5IBLC 1FV1B 1I9JL 5HP5A 1BXVA 3SCMA 1WISA 2V2XA 4EI6B 1K8IA 2K7QA 4S0HA 5CP7B 3O9WC 4LCCC 4DK5A 4LFHG 4ELKA 5DJ6B 5JOEA 3BZ4A 3S8WA 1A6UL 1I82A 2IIJA 2NY3C 1I9JH 4NO0A 3HNTL 5DD0L 3MYJA 4LLMB 2BNUA 5FM5O 4AC2A 5IVNA 1JV5B 3EZ8A 1SJVA 4GMSL 1F4HA 1A9BA 5AZ2L 3IXTB 2ZQKA 2FJSA 3LKOA 1I85A 2IXQA 2F9BT 3MLZL 2TAAA 1A6UH 1NCHA 1NKOA 1XL4A 3HNTH 5DD0H 1FC2D 2ZPKL 4KRNA 2XFXB 3QUZD 4MS8C 5G4NA 2IV8A 1TR7A 3C60D 4JDZA 2W0FB 4GMSH 5AZ2H 2JK5B 4Z7OF 4L9DA 4KXBA 3MLZH 3H8NA 2XWTA 3UJIL 3VWJB 2JCWA 2LU3A 3MRCB 4MB5A 3TA3C 1EZVX 2ZPKH 1E5UI 2RJMA 3ZMRA 2LU7A 1XB8A 5I75B 2XV6B 1F4WL 1JWSB 1XD0A 1WITA 4FQXC 4PN6A 5BS0D 4GRLD 5D70L 3DOHA 3ULUL 4U1JB 5LN8A 2WTOA 4MD4A 1KIRB 4K7PL 1FYTD 1F4WH 4IBYA 2NOYA 4YIQA 1KIQA 1FG9C 5D70H 5INDB 1OE3A 4FLHA 1RZPA 2VLRA 4M7ZC 2Z7WA 1KCVL 4K9EL 4AIZB 2B59A 3NIGB 1S7RB 2HVJB 3BC9A 1TZHB 3UO8B 4M5SA 3ZHNA 1RUML 4ODSL 4HH8A 1J0KA 2APVA 3QQ9D 4WWPA 3EF7A 1HU8A 4ZNCD 4I18A 2PPEA 4HCGA 4QLWA 5D7IE 3MGTB 2N3JA 3WDJA 1KCVH 2PNDA 5E9AA 4K9EH 4XP6L 3G6JE 4AVKA 1BQUA 1W6WA 4HIIB 1RUMH 4ODSH 5DJZA 2V7NA 1UWXH 3MV7E 4IJ3C 3IETB 4LL4A 1E8ZA 3CPLB 4LPXA 4OFKA 5A2IH 1CXEA 4L1DA 3U6XA 2VZ1A 4OZFH 5L2KE 5IB2B 2EZ0C 2C9PA 3INUL 3W11D 2HJKB 2X89D 4BBWA 1LP9E 2XKUA 2PXYA 2Q9OA 5F7BA 4G8GE 4P4RA 4UQEA 4RWYL 2Y36L 3FU8A 3INUH 3MOAL 3LB6C 3T3MB 3J7HA 3MHZA 4P2YA 1DQKA 2J3SA 2KBGA 2VL4A 3BN9C 2BY2A 4J4PC 3F7PC 4M56A 4RWYH 4BV1A 1UB5A 4F9PC 3A6CL 4ESKA 2Y36H 3MOAH 3Q8AA 2FIKA 2E7MA 1VGKA 1BXUA 4UOJA 2EYRB 4C47A 5DMYA 5GZOD 4IKIA 5EPMB 5I2IA 3A6CH 4RA0C 3KLKA 1BIHA 1P7HL 4R2GB 3VB8A 2K9UA 1AO7E 1H15B 3IKCB 3VDAA 2Y7SA 4PGZA 3I6LD 5LLIC 3Q6FA 4PGBA 1I4FA 2GEEA 4FXKB 4NB7A 1IM9B 1YO4A 2H47C 4Y9BA 2YPLB 1V55B 1DBKL 2BC4A 2CO4A 3QDMA 1JMXA 2HVKA 4U33A 1IBBA 2YBRB 1QRND 1QX1A 1IE5A 2X4SA 1CTMA 1GW0A 5GS1C 2WVSA 5IVXE 4P4KD 4CGUB 4NBYB 1KCBA 3II1A 3O0LA 2JXMA 3DETC 1YG9A 2X10A 1H6UA 4NZFA 5EU3A 5TF1L 3VD5A 4F33B 4PJEA 5FR3A 5MEPB 5EO1A 4ALAC 5JIIA 5KTEL 3D85A 4I0PB 2PCPB 5FYJD 1N8OE 1ITBB 5TF1H 1PFCA 1QA9A 4O58L 4I2XE 3MRKB 4IGBB 2IPTL 2DQGL 5E8DH 3BIKA 4A7GA 5KTEH 3H6JA 4HAGA 5HHOB 3VI3A 4ZUSA 4RLDA 4H26B 5DMJB 1OF0A 5C0CB 4GG6E 4W70A 3D09A 2A74B 3MR9A 3QR2A 4O58H 1MFNA 4NPJA 4OH2A 5GGRA 4TTGA 2RQEA 2IPTH 2DQGH 4LP5A 5F7KC 4OZGF 4O2FA 2R1WB 1WPCA 4Q7DA 4CAGA 5HI5C 4FLSA 1CN4A 5FF6B 2K8MA 5IHLB 2YIHA 3LIZH 3KD4A 4RMUA 1PU0A 1AIFB 1E28B 1QNZL 3BPOC 4U1IA 4B5ZA 1PZCA 3T0DA 3HG4A 2DY2A 4PR5A 4N2NA 5H94B 1K2DB 3BYYA 2IWGA 3AQZA 5E6YA 2FYVA 1QNZH 5EHFA 4KRPC 2Q10A 3AWGA 4JNXA 5HI4C 1ZLUH 2J4WL 2XG4B 3C8DA 3HPJB 4KROC 5DZNA 5BJTB 4OZIF 5F3BB 2VDRB 1DUYB 2OTWA 2PYED 2VITA 4ETQA 3IU3B 3CVIL 1ZSDB 4AV0A 2C34A 3VXSE 1GOHA 4HWEH 4CVZA 1A4KB 3LKNA 3QORD 3KG5A 2J4WH 4Q2ZB 1NEZG 3KPSE 2CJSA 2ZUVA 1CFQB 3KYMA 4OF6A 4PJCA 5L4JA 3CVIH 2WVVB 2ZXBA 3DK0A 1JWMB 5EIIG 1RU9L 2DLGA 4XXWC 1D5IL 1DJSA 4LLDA 4X8JA 4M8UA 3VQ1C 4A2FA 3BUDA 3LQAL 2F53B 3H2WA 4KV5F 1ZAGA 4YHNA 3I9AA 1ZLEA 4MJ6A 4BFOA 1OGAB 3GJFA 2IQAB 3L1FA 4UMSA 1RU9H 2HT4D 1LE9A 1D5IH 1JZGA 1FAIL 3N44B 3QQ4B 4JB9L 4NKMA 2J2ZB 4U6XB 3X12A 2D0FA 3DX9B 3LQAH 5HYSG 5I71C 5JXED 4N0FA 4YHML 5JW4R 3FUHA 5C70A 1ZWIB 3BLPX 2HTKC 5L8JB 4WNQA 4BFJA 2OYKA 5DWUL 2XOTA 4ZPTB 4JB9H 1J8KA 4GS7C 5JPNA 4S2SB 1YPZE 3EGXA 3HPLB 4YHMH 1M9WA 1VHPA 4OCXL 3FUDA 2QKIC 4WW2B 4TVPD 5TDNB 4ADIA 5DWUH 5EZIL 3NQKA 4NXSA 1LILA 5T1LD 4JY6A 4ZFGL 3RL2B 4U31A 2B77A 3MRNB 1VADB 4RDQG 4OCXH 5E2TL 1MCQA 1R3HA 3ZTJH 3EHBD 3S97C 3VFWA 3SOTA 3O3UN 5DQDL 1WBYA 1IEAA 5EZIH 4LIQL 2IOOA 2W60A 2PWDA 3N0PB 4YR6B 4ZFGH 4DUVA 3O11A 5E2TH 3BLBA 2ITCB 3A23A 4NN6C 3E6FB 1JZJA 4LIQH 4WY7L 5AALA 3TONA 5FUCC 1OE1A 4AIEA 4G82A 3IWUA 4WO4B 5F93C 5GRVK 2DYSB 2FATL 4QOKA 2C1OB 4WY7H 3BOVA 1UWFA 4G8FA 5GGUB 1JFQL 4OLWL 1T6WA 5T1MA 2ADJA 3GMOB 2FATH 3MGOA 1ZVYA 4NOBA 3IAPA 1OSEA 3OKOA 2BIMA 2AXFA 1NBZB 4E5XA 4MAYD 4NZRL 4Z3EA 1JFQH 1G0YR 1MH5A 5FYJU 4WI3A 2Y6SD 5EUKA 5B39A 5IHWA 4CNIB 2H6UA 4BK5A 4LVEA 1OL0A 5DJ0B 3VFTB 4JDVA 3GSVB 2Z31A 5IB1A 4WGWB 1T2QL 4NZRH 3NSDA 1S7SA 1DE4B 1I8LC 2OTUA 3ARTA 4XMZA 1U3NA 4ZI8A 3SE3A 5ID1A 3I6KB 1T7ZA 2IOIA 3LSOB 3X2QB 3VFMA 1S9YA 2NW2A 1MPAL 3GIZL 3N1GC 4HV8A 1T2QH 2VDQB 3VMPA 5C92A 1YEKH 5EU7E 3W9DA 4OGYL 4UOW0 5LAXA 3HG3A 1HKLL 1MCKA 3X13A 2H6PB 1CYWA 1JP5A 3DGDA 3OX8B 1MPAH 3GIZH 3BAIA 3K4DA 4JANA 2P80A 5FM8A 1H9DA 3OHMB 3BJ91 4OGYH 5HHPB 2JMRA 3RAJH 1O7SA 5CMAB 1HKLH 4WK2B 3TEUA 3MBXL 3CVCA 1HL5A 1PY9A 1CFSB 3SDDD 2WM0A 4PJHA 1CD9B 4Z7QE 1QLEL 1KENL 3CFJA 1TU2B 3MKGA 3Q7JA 4NJAL 4XTRC 1TNNA 1NC4B 3B34A 3MREB 1E8WA 4KZCA 4YZWA 4QJ3B 1MLBB 7FABL 2ROXA 2XKNA 3MBXH 2A6KB 3OAYH 2DJUA 4KMLB 4M62H 5IROA 5CKAA 3NIDB 3GMLB 4AJYV 4POYA 1QLEH 1KENH 1VFMA 3JV5A 4NJAH 3CSYB 4OZ4A 3UP6A 1NMCB 7FABH 4LGSB 2W38A 4V1DA 1EJ6A 1Y18A 1AS8A 1M3IA 2CKBB 3LQMA 3QDGB 4PUBL 3BCDA 3OHXC 1IZJA 2VZUA 3DPDA 4FQ2L 3HC0A 3DNKA 5D4JA 3TBSA 1NGPL 1E4XL 1T66D 1BVNP 1TVBA 4PUBH 1DBBL 1G9HA 1B0RB 1M1XA 1G7PB 1LNUA 5FC9A 2ALAA 3K6DA 4FQ2H 4DEWA 5ANMB 1KLGB 1S2EA 2GQHA 1H3PL 2QBWA 3FQNA 3MMEA 1TQUA 4NP4L 1NGPH 1ANUA 3HG1D 1TCMA 1E4XH 1ZXKA 4KI5F 4PMEA 3TN0B 2UVEA 1DBBH 3N41B 4P46B 5ADPL 3NA9L 1P7BA 4OV6F 2Z91B 5D7JA 4DK6A 2CO7A 4JRXA 4LQ1A 3WNKA 1H3PH 4Z7WB 1QKZL 2Z1KA 4NP4H 1AZCA 4U3XA 4B9ZA 5B7FA 5IMOB 2MFNA 5KSUB 5E99L 1DQTA 1AOZA 1AQHA 4FTVD 5I19L 3LJ3A 4XX1G 1F8TL 5ADPH 1A2YB 3NA9H 2X0WA 3ASOB 2X88A 1P4LA 1N8ZA 4O2EA 5BPPA 1COBA 4GT7A 1QKZH 5BVJA 2BOBB 2C9XA 1N9PA 1OTUD 3BVDB 3ZE2F 5I19H 3QRFM 1F8TH 1AANA 4E9VA 4YHIA 5HGAA 1LO2L 2Y5EA 4KJQD 1BQKA 2KL6A 5KJ4A 2Y72A 4X9GA 3VFVA 1G6RL 3QYNA 3EOYG 4N2EA 2WNGA 3VX0A 1ZHBB 3DYOA 4R7LA 4AL8C 3IBEA 3TBTB 1LO2H 1CDUA 3HZMA 5PCYA 3VDBA 1WT5A 4G9FD 4IOIB 5C3LD 1E4KA 4OV5B 3U30C 3BP5A 2O5ZH 4I4WA 3PXJA 3QG6A 1G6RH 1W0YT 3WN5C 3C8KA 3QEGL 2EDWA 4LSTL 5KS9E 1I3RB 2DI7A 5C08B 3DVIA 4OD1H 4Q6YA 5F1KC 3DO7A 1T83C 5BQ7A 1EAPA 2X4RB 4IK6A 2ZAHA 1OW0A 3QEGH 4H8HA 2I24N 4LSTH 3CLEL 5EB9A 3WJLC 4YDNA 4ILDA 3GHPA 1DVFB 1G1OA 2ZYIA 1K3IA 4FQHB 2Q7YB 3CLEH 3N2JA 1SOSA 3ALPA 4X6BA 2PWHA 5FXCH 4ANXA 5FO8A 3ARRA 1E40A 1SMAA 3ESMA 5GGSA 4KVPA 1YQ2A 3CX5J 4QRRE 5EIIB 5KJRL 3MA7A 4X6CB 5DTFA 3T3PF 3KPLA 3LH9A 1CLYL 2A9NL 2AV7B 3SE4C 3IMBA 1G7QB 1ZY9A 4ZRGA 3RUGE 5KJRH 1KCSL 3S37L 1AS6A 3HBZA 3TX4A 1UM5L 2RD0A 4N2AA 1IGYA 4N0YL 2P5PA 1CLYH 2A9NH 4PPTA 4R6UA 3RY6A 5JQ6L 1KCSH 3QWOB 3O3AB 4HIEA 4MB3A 3S37H 3FT2A 4JHUA 5E2UH 3ROLB 3SODB 1UM5H 1YMMD 4QHKI 5FGBA 5HJGA 4WI4A 4LPVA 3T4AB 4N0YH 3H9SD 5EN2A 4KH9A 5F88A 4HUMB 5JQ6H 4ZOEA 3IMSA 3N50A 4GW1B 2V7HA 4LCVA 3GSUB 1Z7JA 2X40A 3QHZL 2SEBB 1KGYE 4OAWA 1V7NL 3DJ9A 5J9PB 4NNXA 2XWXA 4JFQB 4RRPM 2Z35A 5F8RC 3O6FB 4DO4A 1LK3L 1NCBL 3GTVA 4PRHE 3S2CA 4ATTA 2AERT 2KLSA 4Y5VA 4E9LA 2EVJA 1V7NH 1IM3D 4YK4C 4FNPA 2P49B 5EBMA 4APQD 3ZDXE 4POUB 3AXLA 1ZA3B 3ABZA 1LK3H 1NCBH 3KXFE 3ELQA 3NFPA 2BPBA 2QVTA 3W56A 3REWB 3QDJD 5ILTL 3NEEA 1A7OL 1L7IL 1PLAA 3MCKB 5EU6B 3DUHA 4QCIA 2H32B 3RX5A 3WXWL 2CR3A 4HC1A 1CGWA 3JWDL 2DB8A 4H8QA 4ZXBD 1MDTA 5F3HB 2ATKB 5L8KB 4FQIL 4DESA 1VFBA 3K8KA 4L37B 5ILTH 1A7OH 1L7IH 4HIXL 3T6WA 1U8IB 3JWNH 2D7QA 2XWBA 3WXWH 1S8DA 2G5UA 1ZPLA 3JWDH 5TDPB 2C3WA 2J8HA 2YKLL 4PM1A 2YR3A 1IBZA 3BMVA 1THCA 4JM2B 4HIXH 4TUKL 2QJDA 4ENED 4LLAA 2VWEC 1MCDA 4JG1L 5MENA 3S8GB 2CHWA 1S78D 1IZKA 4JQXA 3IDIA 2YKLH 2P5WB 4M43L 3QE5A 3APMA 2DQHL 2ZX6A 1N2RB 3NN8A 4TUKH 4DAGL 5JHDD 2YD7A 3TEYA 4Z18A 2E7BA 3VH8A 5L4MA 5B8CA 2P48B 4NN7C 1XR9B 4JG1H 4NM4L 5DA0B 5DD5H 4JPVL 5GRXG 5HJDA 5FB8A 5EF1A 4IMLB 3OF6D 4FQCH 1ZV2A 4JZNB 4M43H 4Y7MA 2DQHH 1FV1A 2PMZA 4D0CB 4DAGH 4XRCB 1UXMA 4EI6A 4HAFA 4NM4H 4JPVH 5CP7A 2AS5M 1D7BA 5DJ6A 4LLMA 4PU2A 2YA0A 2WQAA 4UT9A 4J3OC 1JV5A 3LKRB 1OD7A 1A3LL 3IXTA 3K2MC 4XMUA 1Q1PA 4RGOL 5E1QA 2XFXA 4UZSA 2NUPB 3PWNB 2NUTB 4HHAB 2W0FA 1A3LH 2JK5A 2Y7OA 3D69B 3P4NB 4RMSA 5J89A 1XBDA 4AVJA 2CUAA 4E41B 4RGOH 1E9QB 3VWJA 3MRCA 1KWGA 4DKEL 3CSTA 4LHUG 4JGMA 4ZMAT 4JRFA 5DVMA 4K9JA 1JWSA 2R15A 4OZIB 3QQXA 5F97E 4KBPA 1RJCA 1W72B 4HVBA 4U1JA 1UWEL 1TQTA 3AAZB 3B56A 3I75B 3GK8L 4DVBB 1KIRA 4JO1L 3SYAA 5E1IA 1J9SA 4UMGA 1FNGB 4NN5B 4V11A 3VRLF 4TPRH 4KQ4H 5INDA 4Y1AD 1YEIL 4XNUL 1UWEH 3QA3B 1JXJA 3GK8H 4AIZA 1NFDF 4JO1H 1S7RA 2HVJA 3UO1L 1TZHA 4Q9CA 2CJUL 3IS0X 3V7AE 1S9XB 4BSVB 1R9FA 4R7VA 4I7ZC 1MCSA 1Y6KR 4CSSA 2AK4E 2NY4B 1YEIH 3MGTA 1SZNA 4XNUH 1YNKL 3VFNB 1XAUA 2I85A 3UO1H 3QISA 4WHYG 4HIIA 4JM0A 1U36A 2CJUH 3P2TA 4D8PB 4APXB 4M7KL 3IETA 3CPLA 1MFMA 3U9UB 1F41A 1I7TB 5B21A 1YNKH 1Q9OB 4OVUA 5LCVA 1QFUL 5F1OB 5IB2A 3EJTA 1P7QD 1UKQA 2HJKA 5DJCB 4NQTA 2K78A 4M7KH 2WGXA 3GXIA 2WKLA 4KZEL 3B3BA 4DGWC 1AXTL 1QFUH 1WO2A 1N0XH 5SX4I 1OTTC 1KEML 3NYKA 1SY6A 4F8NA 4Y4HD 4DJMA 3DX0A 1R47A 4X9FA 1KT2B 1WAPA 2PW2B 4PHXA 1CWVA 1RHHB 3S7GA 4KZEH 2EACA 5IM7B 3VD7A 1AXTH 3V4VL 2WQSA 4KXZH 4M3HA 4AZ8B 2BVUA 4HU2A 3WGUB 1KEMH 2VR6A 4JKPL 5BUAA 5K5YA 1V3MA 4HPYL 3EH1A 2EYRA 4UM9D 5C09B 5EPMA 4JJHA 3LPOA 4NWTL 4WWKB 5F7UA 3UGEA 4HJEA 1T7VA 4K5MA 2JV6A 4PBWD 4X9YA 3ZYJA 2DM4A 3IGLA 4JKPH 4KNTA 4OLYL 5FDYA 4DPBX 1BSIA 1H15A 3IKCA 4HPYH 5FO7B 3IGFA 3MXVL 3VQMA 4X4YB 3P0GB 4U3HA 1S6NA 2E7LA 4NWTH 4JQIL 4FXKA 2EXTA 1IM9A 4BFKA 1JHLL 1MCBA 2YPLA 4HK0B 5IMKB 4OLYH 4XMTA 2EVGA 1X5MA 1QFHA 1ZEAL 3MXVH 3PF2A 5G4MA 1MW1A 2YBRA 4JQIH 5HDBB 4C56D 3D51A 1JHLH 1SHSA 3HE7B 3C2SA 4IIQB 4XO4A 1LEIB 1XX9C 3DBXB 3BESR 1ZEAH 3CJJA 3DXAD 4JFYB 4M29A 3L5WB 4F33A 2FO8A 4X2UA 5ES4B 5MEPA 2FWLB 1HHGB 4I0PA 2ENSA 2PCPA 3SO3B 4MJ5B 1MCJA 3T8MA 4Z7NE 5D5MF 4H1LG 3WLWC 3MRKA 4IGBA 5B1JC 1HQ4B 1WTLA 2APTA 4CW1B 3KL0A 1CZ8L 5HHOA 5IQ7L 1RUPL 4H26A 1U8OB 5C0CA 1OGPA 2ITEA 4Z7OB 4JY5L 2A74A 4FA6A 4MDJB 1BXXA 2CRYA 3F01A 4QR7A 3UZQB 1T03L 2R1WA 4YVNA 1CZ8H 3WEBA 5EDSA 5IQ7H 1RUPH 5FF6A 4PB0L 1Y1DA 4YHLL 5GZNC 5C0RL 2OJZL 1C5DB 4JY5H 1ND0B 5C07D 1AIFA 1E28A 3A22A 1TZAA 3L8QA 4IMKC 2I32A 1T03H 4QNPE 5GRWA 2VSMB 5H94A 3UEQA 1K2DA 4PB0H 4YHLH 3ULUE 1PKQB 4OIFA 5C0RH 1HSBB 3NCBB 1ZTMA 5E6ID 5TH2B 2XG4A 3HPJA 5BJTA 1EGJA 5F3BA 2H0EA 1DUYA 4YOKA 3IU3A 4P2RD 3VXRB 1ZSDA 4WUUE 5E9NA 3QO1B 4ICWA 4RFNC 2EC9U 3MRQB 1A4KA 1GKEA 3N42F 3RYMA 1FBIL 4Q2ZA 3EH2A 3BQUC 3WY2A 1PBYA 3B1TA 2ZD0A 1EHAA 1CFQA 1E0OB 4Z23A 4Z5RB 2WVVA 4MTMA 2YN3A 1JWMA 3MLSL 3WEMA 1XGRB 2K1MA 5DF0A 2VDKL 3BWAB 5IY5B 3RPBA 5ACMA 3RFRA 2ZX7A 1N26A 2F53A 1BQLL 3AG1B 1ML0A 2VDOL 2NXYD 4HXAL 4YFEA 1OGAA 4LOVA 2IQAA 3MLSH 1KJ3L 4M7LT 2VDKH 3QQ4A 4LCIL 2R7EB 4GUCA 3HMXA 2J2ZA 3K6FA 4LU5L 4U6XA 3DX9A 4DSYA 1BQLH 3VU1A 1E6JL 4YDLB 2VDOH 4HXAH 1ZWIA 5B4MD 2F15A 1KJ3H 4UYPA 4EI5C 3TBWB 5IB3B 3WO4C 3BVTA 4LCIH 1XR8B 3FO1B 4ZPTA 3TIDB 2J21A 4LU5H 5F1IB 4S2SA 1XAKA 1E6JH 3RVWC 3J27A 3HPLA 1MFDL 3GQFA 4XOCA 2EQDA 4L4TD 3I9PA 4WW2A 3ATDA 4ORGB 3Q05A 4U05A 4PFEA 5TDNA 1F0LA 2Y1ZA 2BSTB 4UT9L 1X5AA 3HC2A 4ORZC 3B9DA 5D7IF 3RL2A 1MFDH 1VADA 3MRNA 4TNFA 4RFEB 4MNQB 5DZJA 2K4WA 1T0MB 4LCUB 4JFFD 4UT9H 4W9DC 4WSJA 3OJMB 4YR6A 1I8UA 1KFGA 1SGKA 2EXSA 3CSPA 5EU7C 1KYUA 2ITCA 3GRBA 4L5FL 1SOQA 3E6FA 4YAQB 4ATWA 3NGBB 3FU5A 3JTBA 4RGNE 3IBOA 1PJWA 3L3IB 4NRYB 4WO4A 3PPEA 4L5FH 3K6NA 3IMUA 5D1QB 2C1OA 1E2VA 1MIEH 2C4FT 4KK5C 3HB3C 1XXDC 4FNRA 2FTAA 5GGUA 4X99B 4J12A 3QIWB 4OJAA 1SN0A 3KPPB 3GT6A 3GMOA 1MI5E 3MODL 4RZKA 1RLBA 2JI1A 4N2KA 3O2WL 3AY2A 1L6ZA 1L3WA 1NBZA 2B20A 1GJUA 3SYCA 4CNIA 3MODH 4MMYB 2M2DA 1DVUA 3O2WH 1UCBL 5DJ0A 3VFTA 3GSVA 5E2JA 1U2CA 1IC4L 3D1MC 1DE4A 1FFRA 2QDWA 4OZGB 3I6KA 3LSOA 5KSAC 1UCBH 3ESVF 1Z5YD 2VABB 3LRSB 4PS8A 4DKAA 1IC4H 3T2OA 3GFUA 2H6PA 3BWZA 3B83A 3OX8A 4L8SC 1KBWA 2FYYB 2Y9RT 5LCVH 4RQQB 4WQOA 5HHPA 4WEEA 5CMAA 1XBRA 3QI9D 5J11C 2ZP0T 3K6SB 1CFSA 2YD2A 4WVRA 4P2QE 2WANA 4B9CA 3KJ4B 2R4RL 1O75A 2X2IA 4POZC 2XN9B 1TU2A 4G59C 1KUMA 2PO6C 1NC4A 1HNYA 4JQVA 3MREA 1MLBA 2CXKA 1SY6H 5LGKA 5AOJA 4CC1A 2A6KA 2WXKA 4IOSA 2CALA 4AJ0A 1ZTXL 3GMLA 2R4RH 4B9GA 2Z7UA 3QQDB 5HGGS 3CSYA 3BPLC 4O02L 4F9LA 3FL7A 1UQSB 3FQ2A 3FUNA 4XP1L 3T65B 4GG6F 3KPMB 5D1XE 2YQ3A 2G9HB 4K7PY 1I3GL 3T0EC 2CKBA 2E9JA 3QDGA 5T3ZE 3P69A 2EICA 1WCBB 1EUUA 4O02H 2DLIA 5D72L 2ICEC 4LAJH 3OPUA 4GP4B 2EXWD 3IE9A 1FWXA 1VJSA 1I3GH 1K5NB 4MJIE 3POHA 2CUMA 3FBKA 1B0RA 1D5BB 1G7PA 1JPFB 2R1YB 5ETUB 2XZQL 5ANMA 1KLGA 1RP8A 4ZQTA 3FRUB 1JGDB 3SZKC 4KC3B 4Y1TA 3UFIA 3TN0A 3O41B 2WMPB 4P46A 3CHQA 4BQ8A 3EG9B 2R29A 2Z91A 2XZQH 2QSVA 4L9LC 4Z7WA 5IJDC 3PUCA 5IMOA 1M6OB 4ZW8A 4IEFB 1NAML 3AT8A 4ZYKB 2QPFA 4Y2OB 5KSUA 2BNQE 2KT6A 1O6VA 4XVOA 4F7KA 3ZDZE 1SJMA 1G5AA 1I9IL 1A2YA 4WFED 4QY8B 4F7PB 3ARBD 5B3JE 3KCWA 4X9BA 3A21A 4X6EB 3ESNA 3UAJA 1NAMH 2BOBA 3LD8C 5D2LB 4H1LB 4KKCD 4NFBA 3C5ZB 3CPUA 5IWLA 2PP8A 3Q0HA 5HDLA 2CK2A 4YBLC 3PWPE 4N24A 3RKDC 2PWEA 3NCEB 4R4NC 1E5YA 4MKTA 4YDKL 4OFYD 1RK7A 1Z5LB 1ZHBA 2XSKA 3TBTA 4IOIA 2E6JA 4ZMYA 2MTAA 3PXLA 4OV5A 4ZX3A 4IJTA 1BEYL 3KEHA 5CBAB 4YDKH 3OPZL 2ATPB 1M7DB 4MYWB 2N7BA 3FUKA 3QB7C 3LPGA 1I3RA 4IKKA 4DGIL 5C08A 2MHAB 4PREB 2GBTA 3L3OC 3MV11 3CTTA 1BEYH 4YLQT 2X4RA 3OPZH 1N3NB 2CJ3A 1SMOA 1OEZW 2FE0A 4DGIH 4BHUA 2HP4A 1G0XA 5JW5B 2VISB 3TNMB 3WJJA 3QIUB 1DVFA 4RSYA 4WJG3 4Y9CA 4FQHA 3WKQA 3MRGB 2Q7YA 4KK6D 5HTSA 3BWUC 4Y2DD 3OZ9L 4MLSA 2VYRE 4KRMB 5FGRA 1JPEA 1Q0EA 4I9WD 5C3TA 3MTRA 2KYIA 2H9GB 3EUDA 4FTDA 4IJ3B 1N12A 5EIIA 2NT0A 4X6CA 2CBPA 2XXMB 4MMZC 4M93C 3EYQC 3GLAA 3OZ9H 3VTMA 4C55A 2DAVA 4Y2LA 5IZ7A 2AV7A 1G7QA 1VFOA 1XD1A 4HF5L 4WI5A 4FI7A 2Q7NA 3CZEA 2GEQA 1ETA1 3UZEA 3L7FB 5INCB 4MCMA 3CFTA 4HK3N 4XCNB 2OULB 4NO0D 1F18A 1HEJC 4HETA 4Q9QH 5BV7B 5IIEB 3BH4A 3O3AA 3QWOA 4HF5H 3VNZA 5IKCB 1NLDL 2L8AA 3ROLA 4Y16C 4EZKA 3GLDA 4AW7A 3T4AA 5FWRA 5K69A 3KGRA 4ZMPA 1E6OL 3VI4F 4XVTL 1NLDH 4GW1A 3GSUA 5GRVL 2SEBA 3K72B 3OL2A 4GAFB 3QUXD 3QDHA 5J9PA 1E6OH 3V5HB 4JFQA 4TSCL 2JF1A 4XVTH 4HUWB 2AQ3A 3O6FA 3PAUA 5JPMB 2H1XA 5GXBB 3QUMB 4BDVB 4OZHF 5C0AB 3SDXE 2ODHA 4BFBD 5B7MA 1IKNC 4QKTA 5DRZB 4QRFA 5A3IC 1QBLL 3HHRB 1F4XL 2J8OA 5HPOA 4IHOB 1YQVL 3MX0B 4EDWL 4Y5XC 1ZA3A 3AM8C 3T0BA 1U3HC 4FFYA 4TTDD 1QBLH 3REWA 4OR1A 1YQVH 3MCKA 5EU6A 4EDWH 1ZGLP 2VXSL 2H32A 2V9UA 5AKRA 1LE5B 1I1AC 3FT4B 3UTTD 3TFBA 2X6UA 3ISWA 3GDCA 3CE1A 5F3HA 1Z9MA 2ATKA 2VO5A 3BUIA 3W57A 4PJ9D 4L37A 2OM5A 1U8IA 4KMTL 1LEGB 2RALA 2VXSH 4UQDA 5FHBL 3NTCL 1IO4C 4ETYA 3ULVC 3GMRB 4J6IA 5TDPA 1CL7I 5CJ8A 1F42A 4FFZL 2J71A 4F8LA 4GUQA 4UTAA 4KWUA 1HOEA 1MAKA 4KMTH 4WWOA 1U8LB 5FHBH 3NTCH 5JO5B 3RU8L 3RTQD 1RJZB 4W9IC 2Y7QB 4FFZH 3GMNB 1UD3A 2VDQL 2P5WA 4FZEL 4NO2B 2APSA 2F54E 3CH1B 4BK8A 2A0LD 2OCCB 1N2RA 4ZUWB 4P23D 4QRPB 3CD4A 4L2YA 1XR9A 3WNNA 4YE4H 5JZ7C 3RU8H 3FUMA 3IF1B 3PNRB 2E7CA 4IMLA 1HI6B 3DYMA 2VDQH 4FZEH 4JZNA 1RZQA 4K3EL 3V10A 4D0CA 2HT2D 4UWQB 4FFTA 3U0WL 1FYTE 2YXMA 4XRCA 5F8QC 2IDFA 4Z3GA 4PJDB 3QXTA 4UQBA 4KRPB 3FW6A 1E42A 4X7FC 2C26A 4IOFC 3SYOA 4ACPA 4ODHL 1KCLA 2ILLA 4K3EH 2CRIA 5FM5M 1QSZA 4IBTA 3U0WH 1SLUA 3LKRA 4ONFH 3T1WA 3KPNB 2Z1PA 1H3GA 3QUYB 4L4VB 5E2WL 1RZKC 5TQ2L 3IJ7A 2FT8A 2LQRA 4ODHH 5AVVB 4FLRA 1CICC 1N68A 1BZ7B 4XNZC 4GAJL 4HEPG 4UNUA 4BSJA 2NUPA 5E2WH 3PWNA 4HHAA 4HK3J 4N9OB 4NQXB 1T7XA 2CKBL 3P4NA 3D69A 3QH3B 4IS6B 5TQ2H 4OF0A 3RTLA 4E41A